3BAAA

Structural basis for the inhibition of bacterial nad+ dependent dna ligase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
312
structure length
312
Chain Sequence
LTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Inhibition of Bacterial NAD+ Dependent DNA Ligase
rcsb
source organism Enterococcus faecalis
molecule tags Ligase
molecule keywords DNA ligase
total genus 103
structure length 312
sequence length 312
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3baaA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3baaA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3baaA02
4DV1B 4PZ8A 4UFZA 1V9PA 4GKJB 4GLXA 1S68A 4X64B 1IBMB 2UXDB 4JI4B 2ZM6B 1J5EB 1IBLB 4JV5B 2HHHB 4B3MB 4JI2B 4JI5B 4E6NA 4TOIA 2UUBB 5LMNB 4DR3B 3W1GA 3RTXA 4CC6A 1CKNB 5FPOA 4LFCB 4DR6B 3PN1A 4X62B 4DUYB 4B3RB 4DV0B 4JI1B 4LF4B 5D1OB 4AQYB 1FVIA 4YHHB 4OX9B 1HR0B 5BR8B 1VS0A 4JI7B 4CC5A 4JI0B 1HNXB 4JI8B 3SGIA 1X9NA 4UCTA 4DR4B 2HIXA 3GJXB 1N34B 4K0KB 4DV7B 2VUGA 2HVSA 3QWUA 1N32B 4UCVA 1XNQB 4PZ7A 4B3TB 5D1OA 2UXBB 1XMOB 1XK5A 2HVQA 4EFBA 1CKNA 1HNZB 3VNNA 3BABA 5D1PA 1N36B 4LF8B 2VQFB 4UCRA 2Q2TA 1N33B 1XMQB 3TY9A 3NBZB 2UUAB 2HIVA 3KYHC 1XNRB 3TY8A 3S24A 4DR7B 2CFMA 4LFBB 2HVRA 4GKKB 4DR2B 2VQEB 4DV2B 3NC0B 5IWAB 4KHPB 1A0IA 3TY5A 4NXMB 4UCSA 3BA9A 1B04A 4LF7B 3W5OA 4UCUA 3OTOB 1TA8A 4EEQA 4B3SB 2F4VB 3T1HB 1IBKB 4JI6B 3RR5A 1FJGB 5DISC 5FPRA 4DUZB 1CKOA 3GB8B 4PZ6A 4DV4B 2OWOA 3W1BA 4YY3B 4UCOA 4NXNB 4X66B 4JI3B 2E5LB 4EQ5A 4EFEA 1I94B 3BA8A 4DR1B 4LH6A 4LH7A 1DGSA 3GDEA 1TAEA 1ZAUA 2UXCB 4LFAB 3BAAA 4DV5B 4DV3B 5LMUB 3UQ8A 4DV6B 4JYAB 4DR5B 4X65B 4LF5B 1P8LA 3T1YB 1XDNA 3JSNA 2Q2UA 3JSLA 1P16A 4LF6B 1CKMA 3NBYB 4LF9B 4DRFA 1HNWB 2UU9B 3L2PA 2UUCB
chains in the Genus database with same CATH superfamily
2VUMG 3DTGA 2CK3G 3E86A 1K5SA 4TV9B 3CCVV 2W70A 4QE9A 4ME6A 5K2MA 4JYCA 4TT3G 5L3CA 3WNZA 1VQ4V 1I94H 2P22C 2HHHB 2YW2A 5IYCO 1FXKC 1FXKB 1X4TA 4U7CA 3E8FA 1NTMH 5C8YB 4FLUA 2EIMC 2EIMB 3JALB 3JATB 4P30A 3MR6A 1S10A 4CKEA 3KXYT 5KFZA 3K79A 4DR3O 3Q8RB 2BOBC 4B3RB 2Y0IA 2J6UA 1P7GA 3SJAC 1W0KG 3ETQA 2W0FC 2E3CA 1S97A 3VOTA 1VBGA 1NBMG 3K0DA 2BTOA 1XNQO 4CS4A 3HKCA 1Y1WA 4JI8B 4DV7B 5LMUO 1QLEB 1QLEC 1U96A 1FKAO 4GKKO 2R7MA 1RPRA 2B5UA 3LWBA 4JI7H 1Q8IA 3GIPA 5FLMG 3G6VA 2UXBB 2P4KA 4PA7A 5CB4A 5KG0A 4ZOLF 2CAZC 1FPOA 4I9QA 1SESA 1N0NA 2LGQA 3CCJV 4QE7A 5D1PA 3UFXB 1CPYA 3RIZA 4FFLA 1SA0A 2H8PC 1I2KA 4GYCB 1M7JA 4DV2H 1XREA 4FFBA 4ZOLA 3U9TA 5JQWA 4MV3A 4JI5O 3SYCA 4DR7B 1E79G 5KG5A 2L35A 2W9CB 4AQYH 3TW7A 2WLMA 2FMLA 2QE7G 5HFLA 1JIHA 1AROP 2CH7B 2EZOA 1ZL8A 1WA8B 4M7EA 4HZ3A 4O84A 4LF7B 1BJTA 1BGYH 3K3PA 2DJVA 1US6A 5KAIZ 4Y8VB 2UUCH 2P90A 3RAXA 3AK2A 2EIJC 2EIJB 4DUZB 3HKDA 1MG1A 1COWG 4GX5A 3ETGA 2R72A 1XI1A 5I5VA 5L3FA 1NS1A 5IE9A 1P84F 2ITDC 3BQ0A 2VQFH 4ABMA 4X62H 4U6PA 2W9BB 1AP6A 2KB1A 1E4EA 2Y48A 1GH6A 5IYBO 1TAEA 1GRJA 3UZBA 5FNVB 3W7WA 3FFQA 5C93A 3UQ8A 4JV2A 2H94A 4K8ZA 5DLGA 2KSDA 4JTAB 2IM9A 5CM0A 4A3EG 2WLIB 5C8YF 2VA2A 1T36A 3TW6A 4GX2A 4CS2A 2Z0AA 5KS8A 4Z1MG 4TVIA 2E76B 1SETA 4DRFA 5KT2A 4B3TO 4DV3H 2UXDH 4CMFA 1URFA 3HKEA 3M9MB 5KUKA 4MVMA 4IZOA 5L1KA 1Z2NX 4GZRB 2W8KA 2V5AA 1H2SB 3MWMA 3CMEV 3H1IH 4RB0A 1XMQH 5DMXA 1SQVH 1MA1A 1M93A 2D2CB 5BPHA 4RB2C 5IWAO 1K34A 2EJ3A 1V4YA 3E5NA 3FYEB 1RK5A 1BZKA 4MV1A 2PVPA 4O4LF 4TV8F 5JCOA 4JTDB 3HKZA 2LFSA 4BIZA 3RN4A 2A7WA 4JI2O 2DQ3A 2WLIA 3JD1A 4HNVA 4AQYB 3VPCA 4IT5A 2R7ZA 2ZCEA 1KP2A 2V4DA 4Q8EA 4PA6A 3M7MX 1BHBA 3VOUA 4R7RA 3JYCA 4M9UA 4H0LB 5H80A 2ILMA 2ZIMA 1AR5A 4O7RA 3TXQA 5B5EZ 4O7VA 2Y4RA 4I0XA 2LJ2A 4JGSA 5AG2A 3RVYA 3L74H 1Y67A 3BVOA 4ED7A 2LO1A 5FD5A 5FJ8G 1I7LA 3DAAA 4BBRG 3PR4A 1AI4A 1JR9A 2BE3A 1EM1A 4K3AA 1XMQO 2HR3A 4MVOA 1UC8A 2E2IA 1GN4A 4LFBB 5FR9A 4YJ3F 3LP8A 4NZNA 1A0IA 2CTRA 5CA0B 1TUBB 4O3PA 2JA7G 4FS2A 4EYIB 4I55F 5JVDB 2CTQA 1FYJA 1S3JA 5DISC 1BQ0A 3TQTA 2NR5A 3VQXA 4RQEA 2A3QA 2CW8A 3R66A 1HNXH 2O03A 1PM9A 4RWUA 3F5TA 3W7SA 2R85A 4OX9O 4I55A 2FL4A 3C3SA 1VQ8V 1CEZA 5KHHA 2EIKB 2EIKC 2Z5UA 4X1IB 4DV3O 1JDEA 4PBCA 4B3RH 2BTQA 1ZHQA 4LF7H 3QF7A 4ASUG 4Q45A 3OR6C 4LFAB 4YQWA 1Z5VA 3OSNA 3W7UA 2R82A 4JI8H 3G4SV 5CAEB 1M9NA 3ZIAG 1Q6HA 3RB4A 5KFNA 1PNKA 5EZYF 2UXCH 5I5SA 4HBNA 3V4ZA 3JAKA 4MTXA 4LF6B 3L2PA 2HJWA 3K9SA 3OTOO 4GCZA 3OD4A 1TWCA 4WCEV 4MVRA 4O4IA 5KG6A 1M6VA 3ZN1A 5BYBA 3VPBA 3B4SA 3G8DA 1ENVA 1V51A 4EB6B 1NVPD 4FLTA 5EIBD 4JI5B 4IHJB 1KC7A 4DW0A 4F4ZA 3N6XA 2UUBB 2Q5ZA 2R6FA 3CRCA 3SYPA 3JRXA 4ZI7A 1CQIB 4DV5H 5KFJA 1OBGA 1B6QA 2PYJA 2WLLA 1JFFB 3AEIA 3L70H 3PN1A 4DUYB 4DV6O 4RUAA 1L2ZA 2QWRB 2ZR2A 3TIGA 2DIKA 3Q8QB 2HHHH 4I9WA 1N32O 3SGIA 2XC9A 3BQ1A 2YIDA 3P30A 2WYOA 4O7NA 4JI8O 1OJHA 1S0MA 1Y4MA 1X59A 3BFRA 5D1OA 5EWEA 3RBEA 3RT3C 1VQ6V 2IA6A 1A48A 3STLC 2R9RB 2Q7EA 2C28A 4ZI7B 4MVQA 4YAKB 4G28B 2YEVB 1AI6A 2VPQA 3RGZA 5DGHA 4KFMA 4PDLA 3TY8A 4J9PA 1EN4A 3AK3A 4WD3A 3ZRWA 1S5LZ 5KFBA 2IJJA 3U55A 5IWAB 4MAMA 2M05A 3L71H 3MD0A 1AP5A 1IYDA 4UCUA 2XAJA 3T1HB 2VUMA 3H40A 4PA9A 3BQ2A 5FPRA 4LF4O 1G8MA 1Z2GA 4KL1A 1W93A 2DMXA 1KT8A 2C22A 2YIBD 4IRKA 3T1HO 1K4CC 2HHFA 3PVXA 3ZHQA 2YI9A 2FJZA 3JASA 4DR1B 2OTLV 4EYHB 3IGAC 5BWWA 5JH7F 4XDLA 3FYIB 3OTOH 1KJJA 4U7NA 2IJHA 1XUQA 4FFPA 4EKWA 1XMOO 4OXSA 1FD9A 4FE2A 3JCZA 2V1DA 5KG4A 5LBQA 2EX3A 1RFYA 3A0BZ 3JAWB 4LF8O 2ASLA 4O4JA 4ICGA 4A3BG 4ZHQF 4LF5H 1EZJA 2UVRA 4WFEA 1NR7A 3OR7C 1ET0A 1Y14B 2HVJC 1QCEA 4X8AA 3CP1A 5CBGA 3RYHB 2I8CA 4O3NA 4X62O 2W6NA 2PTMA 4YJ3B 1FFXB 4JV5B 5LA6F 5FLXW 4J9ZB 2P67A 1IOVA 3OW2U 2R8GA 2Q0OC 4TUYB 4AYBA 3L73H 1G6UA 4RCNA 3BHPA 4FMTA 2WE6A 3DF7A 5BMVA 1CKNB 1BT8A 5FPOA 5GONB 4E4EA 5HFMA 3LDCA 3U0ZA 4JI1B 2ASJA 4R6ZA 2J6TA 1DIKA 1AVMA 3JCUZ 2DW4A 2XT9A 1VS0A 4NXMH 2QM8A 1NR1A 4DUZO 1AI7A 4JASA 3IFXA 4X1YB 1N56A 5IJ0B 4UCVA 4NZOA 4PD4F 1XBLA 4R8CA 4PDMA 1YHQV 4IIJB 3DSQA 4JAAA 4PA3A 1J5EH 3VQVA 2LGWA 4FBUA 4DR4H 3KCXA 2Q69A 4GX0A 2CTPA 4FJCC 4YB8B 4N21A 3RF2A 3RB3A 5L3BA 3RW0A 2RDIA 3BABA 4DR7O 1N33B 4W4KA 4F6EA 1OCZB 1OCZC 2XCAA 5ITZA 3CEIA 4LWSB 4PV1B 4LF7O 4O7SA 5DQHA 5KFMA 4DR5H 5I60A 2R8JA 3HBLA 4DR2B 1A32A 2IH3C 1K5QA 3LDDA 3KZIZ 5EWGA 4AI8A 3B40A 1SQBH 1SZXA 1Y74A 2W6MA 5L1LA 1P7BA 5E25A 3HKEB 4ECVA 3HOZG 3FB5C 3ZMUA 3W1BA 3CQZA 4JI5H 5KFTA 2W9AA 1C3OA 4A3MG 3CXCU 5JH7B 4IIJA 1I94B 5C44G 1MZFA 4LH6A 3GTKA 1R3JC 2WA4A 3ZHSA 2NU8B 1EZVH 2HVKC 1E4EB 5BR8O 3B09A 1JJ2U 4QWAA 4HNUA 1XDCA 3BAAA 4C5BA 1FJGH 1FXVA 3APQA 4CH3A 4O2BB 5EIBC 5LMUB 2R86A 4AILC 4A3JG 2LQTA 4YP3A 3I56V 1FKAH 4LFCH 1LNQA 3QQMA 2O57A 4J9QA 3D36C 1E1RG 1P4RA 2Q8VA 1OWTA 2OCHA 3JSLA 1IDSA 4DXWA 5C1OA 4PHZA 4X88A 1K8AW 2QTSA 1CKMA 1B6RA 4RAIA 4IGGA 2UUCB 2ADPA 2W0XA 2YUAA 1NU1H 2DZDA 3A8TA 5CR5A 2AXTZ 4MS2A 1IYEA 1RYSA 2YI8A 2UXDB 4EEYA 3SPHA 4Q0YA 3T5LA 2IU3A 1K92A 2QF7A 1F23A 4K0KH 3SJBC 4PI0A 5LMNB 5KLVH 2VOBA 3LSSA 5KT6A 3A2FA 1S0VA 3PFFA 2Y4UA 4DL6A 2ZE6A 4U7OA 4MVSA 1UFIA 3OMAB 1AJNA 3VA7A 2BQRA 1Q6IA 1FVIA 3ETDA 1RSOB 2R9AA 2HIXA 4DV0O 1N34B 2JRIA 5E1AC 2XHBA 3STZC 1DF5A 1N32B 3N40P 2JS5A 3PZPA 2JEJA 3GTMA 4HYKA 1Q90D 3LULA 4FFMA 4NB5A 2YIAA 1O9GA 1XILA 4TM5A 5DG9A 4JI2H 3RB6A 1AUVA 2JGDB 1OV9A 4CH4A 3BPZA 5BZBA 2VQFB 1WN7A 1K7DA 3HOWG 1TVKA 2EILC 2EILB 4JTCB 2M7WA 4LC1A 5I5YA 3JAMW 2EJ0A 5BYAA 1FXKA 5KFAA 1I1KA 3ABMC 1VF7A 2IBZH 3ABMB 1MSWD 3AYHB 5IYZA 4FU0A 5B1BC 5B1BB 2PI5A 4JAVA 2EBOA 2R7ZG 3W7TA 5EYPA 3OTOB 1QVGU 3F7YC 3H1JH 1FFXA 4YJ3A 1ZX3A 3RYHA 4KXRA 2Q6AA 3THOA 4X1YA 2GPSA 4RAZA 4UCOA 4TQRA 1RM1B 3AG1B 3AG1C 1RM1C 2PI4A 1NI8A 4MW8A 2RMKB 5LP6C 5LP6B 3LQSA 2WTFA 3BA8A 2W7OA 2HEPA 4X1KB 4DV7O 2XCLA 3E22B 3UKMA 4O83A 3R9RA 2ZE8A 5L1IA 4O2BF 2QYZA 3A0HZ 4Q43A 3GDEA 1JVMA 1XHXA 2X6CA 5KFSA 3AW8A 3QVNA 4B08A 4DK0A 4NR1A 3BEHA 2QEXV 2B9ZA 4BY1G 4LFBH 4RAYA 4ZBMA 3DTFA 1KKCA 5DECA 2WAQA 4BIOA 4PDBA 2VR1A 3CC2V 3QO5A 2YRXA 2QK4A 2QWQB 1KBHA 4LF9B 5IYZB 2QKAA 3K0GA 1YF2A 4B3SO 1GLVA 2BOCC 2ZDQA 4NVPA 3ZRXA 3TJTA 4W4LA 4U3JA 4O4JB 2HG5C 4CH5A 2F1MA 4JI2B 2ATLA 4UVBA 3UT5A 4HNAB 3MFIA 2YWVA 2R92G 4WFFA 5DQIA 3KTMA 1DF4A 3LNMB 1L0LH 1HW7A 5BWVA 4LCUC 2YIBA 2HLDG 1PP9H 2R8IA 3WB2A 4DIMA 3ICXA 1EUCB 3WO1A 4ZI7F 2EJ2A 1NTZH 4QJFA 4QW8A 3GIJA 5KG7A 3LUTB 1BHAA 2DABA 2R7NA 1TWHA 4I50A 2PF4E 1H2KA 1BQZA 3D8CA 1F7YA 4X1IA 1R3LC 2CNQA 1BMFG 3CCSV 5L3GA 2HDKA 4A5UB 3MR5A 2LW1A 3T5HA 4RZQA 3HKBB 3SYAA 1T5EA 2R7LA 2ZJTA 1HNWO 5EZYB 1O9HA 2NN4A 5BMVB 1CKNA 5BWUA 1MNGA 2X0LA 1I7FA 2CE4A 5L3DA 3ZBHA 1I2LA 4Q44A 3FX7A 4HQ6A 4TUYA 3TY9A 3K06A 1M56B 1M56C 1QR8A 2OIGA 4NTXA 2Q7HA 3KYHC 1VF6A 1WNSA 4NXNH 1MOFA 1Q86W 2C35B 1N36H 3N41B 1FJGO 3K59A 2FMAA 2R9IA 1ZHSA 2EJ7A 1HNZH 1XOUA 2JIZG 1FJGB 2HJFC 1M0WA 2FK2A 5LP6F 4LWSA 3HOYG 1Y1VA 3JARB 2AQ4A 4GX1A 4O3SA 4QGPA 4ED2A 4DL5A 4QPKA 4DV4H 4I4TF 2PYLA 3FAVB 1I0HA 2LP7A 4GKJH 3T54A 4B3SH 4PJ0Z 4JI4O 1KUTA 3SPCA 4DV5B 3L4JA 4DR1H 3J81N 1HNWH 2GUZA 2A9HA 3L9DA 2Y69B 2Y69C 4E2LA 4IR9A 3V4SA 1P8LA 1YEWA 4EB6A 4MA0A 1PNLA 3LSQA 2AGAA 5GONF 4GC7A 3P32A 2K1EA 3R65A 3E2EA 2UUCO 1K83A 2F93B 4O4JF 5GONA 4DR4O 1L8DA 2FK3A 1GN6A 3FKIG 5KFXA 2QWPB 4YIPA 2KSWA 5LYJA 4JI0H 1EYZA 4N23A 1NH2B 3QFFA 4ZIBA 5I5TA 4DR3B 3Q2OA 1BXRA 3HB3B 1GSAA 4J9SA 5EBLC 5KX5F 1M5IA 5IT9N 5KFOA 3LSUA 4NTYA 3ML0A 4BBSG 1OCCC 1OCCB 2W6ZA 1MZBA 4RUEA 3VMMA 3H0GG 2YS7A 4CC5A 1VQPV 2K9PA 4UCTA 2PGGA 3GJXB 2HVSA 5B3SC 5B3SB 4K0KB 3K5HA 5J2TF 3D3QA 3TGUH 2XASA 3PO3G 2COGA 3PW2A 4BXXG 3U9SA 2VQDA 2XAHA 3ZHTA 2WAQE 1A3GA 5LGNA 4H44B 3K3WA 3GV5B 4Z2WA 4YR3A 3ZCCA 1M0TA 1KECA 5F2VO 2HGWA 2Q4PA 3NBZB 2ZE5A 2JVDA 1IX9A 1VF5B 4G3IA 5CBFA 4IAJA 3ZHRA 1YSCA 2KKWA 4XX0B 2CTWA 2QDOA 5JQGF 2C00A 2LFRA 1G1XB 1FAFA 3LNNA 5J2TB 1B04A 3M8AA 1S03G 2F4VB 3Q8PB 3K5IA 1THZA 4DV1H 4O86A 1CKOA 2CGNA 4BAYA 4LF6O 2FPGB 3JAKB 2FPIB 2B1IA 4BW9A 1WR2A 5KA5A 4NZMA 3WO0A 5JVLA 5KT4A 1I94O 4FBTA 1IBKO 5KG2A 3RGXA 2COJA 4EFEA 2JEFA 3I4NG 3JASB 3E89A 3G6XA 5KFUA 5L1JA 2W6IG 2HHFB 1Y76B 3QO8A 4JYYA 1ZAUA 3HKCB 3T99A 2P6JA 2ZQMA 3PW5A 2HKOA 2WLHA 4DV3B 3ETJA 2AGOA 1I08A 4DR5B 1FFTB 4I55B 1B3QA 2ZE7A 4QW9A 5E79Z 1G2WA 1K3EA 5C4XG 2ZR3A 2Z02A 3E22A 4YAJB 3OM3B 3U11A 4DYLA 2Y0SA 2UXNA 4Z1VA 4DV1B 1VAJA 1WPBA 4GKKH 4XZ3B 5IJ9B 3KHHA 1JX4A 3GQCA 2WA3A 3WFVA 1IBMB 1GSOA 4NTWA 2YEVA 4O3OA 1J5EB 2QA4V 1RYRA 1SQXH 5EC2C 3D3IA 4B3MB 5LMNO 4E6NA 4X65O 1GGOA 5CB4F 4NYKA 4LF6H 3E8BA 3EPIA 1MZEA 5KFLA 5EBWC 2W9CA 1WRVA 1RJQA 4CC6A 2ZT9B 3B2EE 4LFCB 4UVCA 2FPPB 2FLLA 3T9EA 2Q67A 4L8JA 4FM2A 2GPWA 4CMDA 2W6PA 1TVKB 4WFHA 1Y1WG 3OT7A 2YDEA 2QWOB 1XMOH 1OCOC 1OCOB 1SQQH 4H37A 2B63G 1XHZA 2RJZA 1HNZO 1EN5A 2BR0A 5BR8H 2N04A 2YRWA 3ZMZA 1SZTA 4B3TB 1D2DA 2NU6B 5LHHA 2CQYA 5KFYA 2QB5A 4AHCA 1B6SA 2UUAO 1RJPA 3CRRA 4LFAH 4J9RA 1HNZB 1V55B 1V55C 2JA5A 2KQXA 4LMYA 3Q8SB 3GIKA 2F95B 2UUAB 1SYXB 3ETEA 3MDSA 2HGSA 3VQWA 4O7WA 4PWQA 4FM0A 5LL6Y 3G6EV 4LP8A 3PW4A 5K1XA 3S24A 5C3EG 3RYCA 2RNBA 1IBKH 2ITCC 2Z3YA 2AHZA 5EWFA 1LUVA 5C8YA 2AW9A 4F4YA 2YZMA 3BA9A 2XTAA 4B3SB 3OUUA 1JLLB 1GSHA 3V6JA 2DWDC 4R8UB 4J9KA 4PZ6A 2OWOA 5I5UA 4MVUA 3K5LA 1VF6C 1KD1W 3T1YH 4DR3H 1CP9A 4JI3B 1QBZA 1IBLH 2GQSA 2R7KA 1KMIZ 2V58A 5LGTA 1S76D 1G4YB 4I0XB 3M4IA 2W9BA 3HKZE 4DL7A 4CH6A 2C2RA 2FLPA 2WB1E 5KFWA 4O2BA 3H9VA 4O4LA 4TWKA 2GV9A 4TV8A 1Q82W 4YY3H 4JZGA 4PELA 4ZKIA 2YXHA 4DL2A 2MW2B 3AG7A 5I5XA 1JDBB 1KKDA 3V6HA 5JJEB 3HPLC 2OTJV 4QJFB 4GKJB 4MV9A 3BRCA 4X64B 2M6YA 5KFRA 4P2ZA 5DGAA 2XAGA 4YR0A 4DV4O 3HR0A 4LF9H 2JJ2G 1I7NA 2W57A 1PPJH 5F9NA 1VQ7V 1GO3E 2YS8A 1VQNV 3E83A 2RGRA 1KJQA 3GIIA 3DC6A 4FFBB 4ZOLB 3K03A 4LSXA 4TSFG 4J0MA 5LXTB 2ZM6H 1SCUB 2EZPA 4DR2H 3T1YO 2GDSA 4ECWA 5KMGA 4LR3A 3RWRD 1J5EO 3WWHA 2JA7A 5LOVA 1QQCA 3CE2A 3PW7A 1C30A 3SYOA 4FVMA 1TWAA 5EK0A 1RJRA 4YHHB 4OX9B 1JOYA 3WWJA 4MTGA 4A3FG 1X9NA 4RNMA 4Q8FA 3A0RA 2VUGA 2YXLA 3ETHA 5H6QA 5CN0A 4FZ1A 3B8NA 1ZWIC 2WB1A 1XNQB 2PUSA 2W71A 3KHLA 4I50F 4D7SA 4NKGB 1Y74B 4DV1O 1ZQ7A 3KALA 2HVQA 4FZ0A 4JI1H 2N74A 1EBOA 5LOVB 3ABKB 3ABKC 3MAQA 3N6RA 1EFRG 1ZUQA 4F4LA 5KA6A 1M90W 4EBEA 4JYAO 4U3JB 5DN6G 4R7CA 1IZ3A 5DEDA 2QR4A 4P9PA 2GTAA 4NLGA 1A9XA 3HT5A 4X89A 2VQEO 4O3RA 3CS5A 3BCCH 3RB0A 3U0GA 4UUJC 1EKPA 4A93G 2HVRA 3FB7C 1MABG 4GKKB 2VQEB 1YJWV 3N8DA 1HWYA 1ZETA 3M99B 3KCYA 2QWNB 1UPGA 2I87A 2XNDG 4A3LG 4QPJA 2COIA 2XOKG 4JI6B 3UZOA 3K9AA 1Q3EA 2DWCA 2ETNA 2V9WA 5DAAA 4RQFA 2AZ2A 1L1FA 5IJ0A 4CE5A 5C1PA 1XQ8A 4ECSA 4X66B 2UVWA 1HP8A 2XD4A 4CHIA 4O4IF 3RV4A 3HKBA 4MV4A 1S0NA 4DAAA 4X1KA 1NT2B 1VQLV 1JKJB 2SCUB 4HR7A 2IH1C 1Q6UA 3EFFK 5BWTA 5CB4B 1GAXA 5B1NA 2ADQB 2IU0A 5DM6V 5FL7G 4FLWA 2PMZE 4ECQA 2A79B 4I4TA 1W0JG 4GUNA 4L87A 4L1KA 4LF5B 5D8DA 2VA3A 3OEHG 4YBZB 1H38A 1EHIA 4DRXA 2W6QA 1R3IC 2DWEC 4K0KO 4RB1A 4WHXA 2WLKA 2YYAA 4NXMO 3B77A 3UO3A 3UT5B 3K57A 1BE3H 2JDIG 4DUYO 2R70A 1GK9A 4O7LA 3CCEV 1DV2A 4TOIA 4MSWC 5KT7A 4DV0H 4PA4A 4MV6A 1WSCA 4YJ2B 2V4RA 5A9GA 2P5OA 1K1QA 1SKVA 3EVKA 1KJIA 4X64H 4DRXB 3G67A 3GB7C 2W8LA 3OE7G 2HGXA 3GIDA 3FDSA 3T5KA 3CRMA 4AYBE 4B3MH 5IDJA 4I4TB 3JD4A 5LL6b 3D36A 3SDLA 1RPOA 3JZFA 5JQGB 2DE0X 1HR0H 1XNRO 3KG2A 2CGOA 1PKXA 3K04A 5LP6A 3H4BA 2OCCB 2OCCC 2QM7A 4X20A 4NYEA 2QGNA 1N33O 1XL6A 5EDWA 3PO2G 3NXSA 4UCRA 3TCUA 4IRCA 4A3GG 3HXLA 4IL6Z 5JH7A 1N34H 2GQRA 3H3VH 5L3EA 3H20A 1KEEA 1E4GT 1T3NA 3SJCC 1IURA 4J7JA 3CWBH 3S3WA 1H2MA 1I3QA 4UVAA 2FB9A 4XBFA 1OHHG 2Q9LA 4DUZH 4G2KA 5FNVF 2MK3A 3GIQA 3JD3A 3B8MA 3WWIA 3N43B 4QIWE 1TGOA 3TINA 1TA8A 4EEQA 5IJ9A 5JWPA 3MHSC 3RR5A 5HNEA 4F50A 1BSMA 2RDJA 3KHGA 1NH2D 2YZNA 1GTOA 4EGJA 2UUAH 3RYIB 4FLZA 5KFCA 2YS6A 3OTFA 3TIIA 4YY3B 4DQNA 1BL8A 2YU9A 4B7EA 2QKSA 4EQ5A 1PX2A 3ABTA 5BXZA 4BR6A 4F6RB 5LYJF 1N8RW 3CRQA 3JZIA 3T7AA 4WFAV 5CE8A 3GTPA 4ZQIA 2X6AA 2OIEA 1WP8A 5CA3A 1QVFU 3H1KH 3OHAA 3KAJA 3SPGA 4JYAB 5KFIA 1H8EG 5KX5A 3CD6V 2E74B 3ZHUA 4WFBV 5KUMA 2Q73A 3I12A 5KHJA 2UU9O 2QKCA 1K73W 1YZBA 2IMWP 5KMGB 3IC9A 2JEUA 2Y4TA 1VQMV 3MR3A 3J7AK 2B63A 1A0GA 3I4MG 5K1PA 5J2TA 5IP9G 2E75B 5KAFZ 4J9LA 2R84A 2NNUA 2E5LH 2QM4A 1Y6XA 3FB8C 4JZ2A 2ZKOA 2X7RB 2CDYA 4DW1A 5KHKA 4Q6GA 1PNMA 2NVXA 1JJOA 1GO3F 3V6KA 4PDRA 1ZLZA 2AGQA 1R73A 5B1AB 5B1AC 3GIMA 4JYAH 2UUBO 3MFHA 3H1LH 3ZMTA 4JI6H 4O4LB 4TV8B 5JUMA 1UJWB 4B3RO 2VPSA 1T94A 4ED0A 1Z5WA 1SERA 1HNXB 3SI8A 2YICA 1PL0A 4LF9O 4MV8A 1DTOA 1AI5A 2AHYA 4RB3C 5KKNB 4RNOA 1IBMH 1QNMA 4NXNO 4HAMA 4ECUA 3AG4B 3AG4C 5GW7A 2H3OA 5CA0A 1EKVA 1KTAA 1I5YA 5BWRA 4EFBA 3MWEA 4DR2O 3U54A 2WLLB 2YSUB 2JEIA 1VP7A 1JA8A 1XL4A 4R8UA 2ARHA 3HOXG 4IWYA 3M9NB 1XNRB 2ZXWB 2ZXWC 5IYDG 5LYJB 5GTHZ 4O2AB 4ECTA 2VWKA 2A06H 3JD2A 3NC0B 4DV2B 3FD9A 3N2GB 4DV5O 3UM7A 3T4DA 1I1LA 4GKJO 4DR7H 3RYFB 2C2EA 1AR4A 2BQ3A 1CQJB 4QWCA 2XGQA 1D5AA 4B3TH 5DQGA 4NXNB 1GN2A 3ORQA 4QWBA 3H4DA 4CZZA 1KC8W 5IT9W 1S9FA 2FK1A 5DGIA 1JXLA 4XDJA 5CBHA 3GTLA 4DUYH 2XGPA 3ZMVA 4HNTA 4KUMA 5LHGA 1DGSA 1Q81W 3IN5A 4I7HA 2R8KA 1B33N 2E2HA 3O9OA 4YJ2F 2FYUH 2JA8G 4DR6H 1GM9A 3IJ4A 5LXTF 4RU9A 1XDNA 1BS3A 4X64O 3JARA 4APMA 4GLWA 4FLXA 4BIUA 3SJQC 5LXTA 4UFZA 1BCCH 1V9PA 4RNNA 3GVMA 1YI2V 1YTFD 1JFFA 4MTFA 1NZ6A 4LNUA 1IBLB 5H2FZ 1EN6A 1EKFA 3ABUA 3Q4HA 4LBEC 3J81W 4J41A 1NVPB 2RGVA 2ATKC 4J11A 3AG2B 3AG2C 3C90A 1YIJV 2IW5A 1J95A 4OGQB 3SPIA 1FS0G 3N44B 1SS3A 4DLKA 5EZYA 3I5DA 1KJ9A 1VQ9V 3JAWA 1Q5OA 3ORRA 3NGDA 3C0FB 2XUMA 3TEKA 3ZX6A 2ZDHA 3OMNB 5IYZF 2ZNIA 4JI0B 2F66C 4A3IG 4B7KA 2DPIA 4O4HF 3LMLA 2RCVA 3WG7C 3WG7B 5I5WA 2XIGA 3F5WC 2YZGA 3GLKA 2P4VA 1WLEA 3UO2A 4LF8H 4MT8A 4O4HA 4OPHA 1UC9A 1YJNV 2ODTX 1JCHA 2BTQB 2GHYA 1EUDB 4O3QA 3VNNA 1WH2A 1MMMA 5JCOC 2RF4A 2X0SA 4I7ZB 4FFNA 4UXNA 4O4IB 4UUGA 3MHHC 3K5NA 2WWWA 4O7TA 1SRYA 1YDXA 3QZ7A 4J9OA 4HNAA 4JYBA 1DAAA 4J10A 5LMNH 5JJNB 3T9FA 3RYCB 3T1HH 2NUAB 4ECYA 1WJZA 1CE8A 1F4MA 4JF3A 2GTSA 4F4XA 2UXXA 4FFOA 2W6OA 2F4VO 5EOYA 4TQDA 2A0LA 3AG3C 3AG3B 1QHTA 4QIWF 2YL2A 3QZ8A 4ZHQB 3GTGA 2ALZA 4ETSA 3R5FA 2Q7GA 2DYSB 2DYSC 1R6NA 3CMAV 3T9DA 4MA5A 3E8GA 1R9TA 2UXCB 1QLNA 2JK5C 4EBCA 4LFAO 5DLFA 3OSPA 2HJDA 4QSHA 1SQFA 1SF9A 3RGBA 3T9CA 4ECRA 1IXMA 2DOSA 5DGBA 1R1BA 4MW3A 1HNWB 2UU9B 3K08A 2PY5A 1HR0O 5BWXA 2EINC 2EINB 1ZL8B 1GMGA 2ZD9A 3Q4HB 1I50A 2YC0A 3CJHA 4DV2O 3G6YA 2YZLA 4C2MA 1CXZB 3R5XA 4UV9A 4YIOA 2PN1A 3OFNG 4CKCA 3T5JA 1WB8A 2UXDO 1VQOV 2AZ0A 4JUZA 3CC4V 4O7ZA 1UNNC 3RTXA 1JQ0A 3EXAA 2UXCO 4TUYF 1GM8A 1TWGA 1N4CA 2JGDA 1S0OA 4X62B 4BWSC 3HOUG 1VBHA 3G80A 4WFGA 2GSMB 1H2GA 2UXBO 1YCIA 4LF4B 3CB2A 5C5JA 2GUZB 5EC1C 3SYQA 4FK5C 4ZHQA 1Y1VG 4FS1A 3DGEA 4DR4B 1SQPH 3F8NA 3JZ6A 4JI3H 2EIYA 2NU7B 4DL3A 3FAVA 1NTKH 1WP7A 4O4HB 2RDCA 3CX5F 5CMUA 2HG8A 3MJFA 1HDJA 1Z2PX 1AN7A 2XAQA 1ROPA 5A2QW 1WPXA 5H9CA 5JVDF 1R3KC 3RJ0A 2VWJA 1YVWA 4B3MO 4E4TA 3DXRA 1AUXA 3L72H 2RN9A 3K3VA 2Z04A 3HOVG 2WLJA 1V54C 1V54B 2ABJA 3ZS8C 5JVDA 1XMQB 5BMVF 4DR1O 1E1QG 2FB5A 1DK1A 3PJSK 2CFMA 3R5HA 5B66Z 4A3CG 3GWOA 1PK8A 3KKYA 3CJHB 3Q1KA 3ABLB 3ABLC 2DPJA 5IYDO 4K35A 2OLSA 1WA8A 3RBZA 2CH7A 4ED6A 4TV9A 3AX6A 3W5OA 3LDEA 4MTOA 3GILA 3J80N 2J9GA 3GB8B 5IWAH 2BSKB 2V59A 4PI2A 2WAMA 5HBRB 4J9NA 2R87A 4JI0O 5KFQA 3JAMN 4H33A 2MCTA 4I5SA 2ZGIA 5KFHA 3JRWA 4JXUA 5LMUH 1GYFA 1GM7A 2VS0A 5BY1A 2W6JG 3OMIB 1BGWA 4FLYA 1K4DC 5GTIZ 3CCMV 3CVZA 2CKZB 3P3NA 3HKDB 4A2BA 4BY7G 1YITV 4DV6B 3UCSC 1S5HC 3BG5A 4D6TH 3T1YB 2DN9A 2IBKA 3FB6C 1Z2OX 4LF4H 3KREA 1RK6A 3J7AU 3OGIB 4PZ8A 4Q4DA 3APOA 3C3TA 3QO7A 1IBMO 2JEXA 1S68A 4FM9A 1K1SA 3CYOA 5JJJB 1PD3A 5KFDA 5KT3A 1Q7YW 1F4NA 2KG7A 2ZIOA 4IIJF 3H01A 2UXBH 5CA1A 2EULA 3MR2A 2WDTA 5F9LA 1E4FT 2Q7DA 3PW0A 1M57B 1M57C 5H5NA 5ITZB 4FLVA 2DYRC 2DYRB 2AU0A 2JEGA 2XAFA 5CA1F 3HO8A 2JGUA 4QNHB 1M1KW 3U10A 4JV5H 1H2LA 2JJ1G 3JD0A 4F4WA 1K9MW 4JI7O 2OT5A 3RFCA 3J80W 2F23A 2QJ1A 3DTUB 4J7KA 3H0GA 5KX5B 1HNXO 2JA5G 2ZDIC 4FFKA 3CCRV 5BR8B 4JI7B 3K5MA 5FD6A 3TETA 4KP4A 5FNVA 3FKSG 4DR5O 4HN2A 2DQ0A 3ZMSA 3QWUA 2IJKA 1S72V 3KAKA 2X5RA 4JI4H 3CSXA 4ECXA 1LUWA 1XK5A 4IRDA 4PDVA 3NR7A 3SE7A 2A1HA 3QTCA 2HHHO 4X66O 3L75H 2NLJC 4JAUA 3O65A 4MVZA 2XCPA 4UV8A 5EYPB 2UVUA 3M9OB 5K3WA 1AB3A 1EZ1A 2ZINA 2P0AA 5KG1A 2WLNA 4A3KG 3G6BA 4J80A 3ZHVA 2R8HA 4KHPB 3T4ZA 2BQUA 4UCSA 4YHHO 3CSWA 4M0JA 2YXYA 1H8HG 3OEEG 1SA0B 4C5CA 4A2AA 3GV7B 2JA6A 3CC7V 1VKZA 2OH2A 1TWFA 4OPAA 4GT1A 1BNCA 1K33A 3WB0A 4ED3A 3R23A 2G38A 2E5LB 2DLNA 3TQ1A 1SQGA 5EBMC 4LH7A 5LGUA 1ULZA 1R6KA 1RP3B 3DC5A 4XYLB 1Y76A 2ZDGA 4FM1A 4IYIA 2ASDA 3IAYA 3CEBA 1RSOA 1NJIW 5LA6B 4EGQA 1ZSPA 2JA6G 4ECZA 2OYQA 4BW5A 1N0JA 2DAAA 5FLXN 3N2KA 4J42A 4TQSA 5HV6A 1N33H 1K97A 2Q68A 1VIBA 3N27A 4X66H 1SFOA 3VBBA 3AK1A 5DG7A 1L0NH 1FXHA 3RV3A 1KP3A 2RQ6A 4RUFA 1IOWA 1JPXA 1VARA 1I5XA 1U97A 4K6NA 4MTEA 4GC6A 4MTDA 3JALA 3JATA 1D5NA 1VEWA 4JV5O 2B1GA 5LHIA 3FMAA 3WU2Z 2JS3A 4IR1A 2I80A 2FP4B 1R6TA 1KJ8A 1AR1B 3E8HA 4D7TA 4O81A 1DLBA 5IYCG 4JI4B 2ZM6B 2V7QG 3HB9A 3ZJZA 2Y0SE 2IJIA 3ZRWB 3N42B 5CA0F 1W59A 5KFKA 4WBNF 4DV7H 3OUFA 3TXSA 2R92A 4JI1O 5KFVA 4XYMB 4OX9H 1O75A 4FGRA 4DR6B 4WBNA 2Y0PA 4O82A 3CXHF 5J9PC 2AGPA 2CNVA 2QTOA 5D1OB 5KT5A 2PZSA 4KHPH 2EJRA 3BACA 1M4UA 3K5OA 1ZTEA 3CCQV 5H6RA 4CKBA 4G27B 1KUQA 1KBLA 2P06A 4PZ7A 4YXWG 2X6BA 5B1OA 1KYOF 1XMOB 4HYOA 4JPRA 2W7PA 3H1HH 2ZM6O 1S5JA 3BJYA 4DR6O 1Y66A 2FTKA 4WBNB 2NVYA 1WCMG 3RUPA 3T1CA 3GV8B 4LNUB 4LF8B 1GN3A 4K8XA 1SC5B 1TUEB 2F43G 3NUAA 2Q2TA 2PMZA 2J6SA 2C2DA 3RBDA 1WB7A 1QU7A 1DV1A 4IHJA 2D3OW 3CPWU 4IWXA 4RO2A 1F51A 2N05A 1KB9F 3TK1A 1W2BU 2CW7A 4YJ2A 3OHBA 3OAAG 1YTFB 5KFFA 3RYFA 4JI3O 4X20B 5BPFA 2FKXA 4IHJF 4J9YB 3N2GA 1OCRB 1OCRC 4XDKA 1B06A 1W96A 3OGCC 3SPJA 4DL4A 1IBKB 5J2UB 5CA1B 3ZRVA 4O7YA 1OZ0A 2KG7B 3G8CA 5KHGA 4EBDA 4RUCA 4QWDA 3SNOA 3RAQA 1N32H 4MV7A 3N2KB 3RVZA 4QIWA 5IYBG 1GKFA 3EYYA 1AJPA 2WSSG 1YJ9V 1VQKV 1OBDA 2R93A 1ORQC 4LSAA 3KHRA 3GTJA 4X65B 2E5LO 4H13B 4IYHA 3CCUV 5KHIA 4Q4CA 2GLTA 3IG0A 5LOVF 4Q20A 1IBLO 3ZRSA 3CHXA 4O2AA 3VQYA 4WF9V 4C7UA 1VMGA 4X9QA 3SR2C 5A2QN 2ZNJA 4GLXA 5KG3A 2HFEC 1TUBA 4JV0A 2R93G 4CS3A 2BSKA 4O2AF 2CNUA 3P3PA 4JI6O 4YY3O 2VRZA 3E35A 3FKIA 1P49A 3QG5A 1XNRH 2HP8A 5KFPA 1SEIA 1CS0A 4DO2A 3EPGA 5IP7G 1N48A 3OUSA 3W1GA 3ZN0A 4J7ZA 3T9AA 3RFRA 1AILA 3UYYA 5D5QA 1KU9A 5T14A 4BWAA 3G71V 3IC7A 4AQYO 2WPDG 2YCHA 3L4KA 4DV0B 1N34O 2F4VH 1PV0A 1IXBA 3S3XA 1HR0B 3EHBB 4UB8Z 3DXRB 2NU9B 1NQTA 2UU9H 2UVVA 3F7VC 4I50B 1KQSU 4CBCA 3ASOC 3ASOB 1YXBA 3T9BA 4UB6Z 4DK1A 4YHHH 5IY5B 5IY5C 2GBOA 4RZRA 2ZDIA 5LA6A 5KFGA 3CCLV 2C2AA 3WB1A 1S77D 2PBZA 4ED8A 4C5AA 5J2UF 1WCMA 2VQFO 1NKDA 4LFCO 3I55V 4LF5O 1XNQH 1N36B 1H2NA 3BY6A 4JV1A 3W7XA 5J2UA 3ASNC 3ASNB 2HIVA 1MSDA 2IP4A 4LFBO 1PL4A 1JX9A 1AJQA 3RYIA 3OUZA 1I1MA 4P9OA 2CUGA 4X65H 2LW7A 1XEQA 3TY5A 4NXMB 4J9MA 3ZEDA 2ODMA 3MWDA 1QR9A 4KHPO 4FPPA 2FE3A 4QWEA 4YR2A 2VQEH 3T2MA 3GTOA 4DV4B 1JMKC 3VPDA 4TV9F 5D5PA 3QNEA 3GTQA 1I6UA 5TISZ 4TQFA 5KFEA 1Q43A 4F6RA 2P7TC 4U3FH 5I47A 2L6LA 1VQ5V 5DG8A 2BCCH 1N36O 3X2QC 3X2QB 3K58A 4R50A 2CZGA 1WAZA 3PR5B 1LR1A 2FLNA 1IVSA 3CRAA 4EG0A 3GWKC 5JQGA 2V4QA 2QSAA 3JSNA 4FFRA 2FKLA 4ED1A 4A3DG 2Q2UA 5L9XA 2UUBH 1P16A 3NBYB 4DV6H 2Q0AA 4FIPC
chains in the Genus database with same CATH topology
5JJEB 4MV9A 4GKJB 2PY5A 3BRCA 4X64B 4TV9B 2YI8A 2UXDB 4LF9H 2W57A 1I94H 2P22C 2HHHB 4Q0YA 2RGRA 1X4TA 4FFBB 4ZOLB 4K0KH 3SJBC 4LSXA 4PI0A 5C8YB 5LMNB 5LXTB 4J0MA 2ZM6H 4FLUA 3JALB 3JATB 2VOBA 4DR2H 3KXYT 3A2FA 3RTXA 5KMGA 4LR3A 3RWRD 4X62B 4BWSC 4B3RB 5LOVA 1QQCA 3SJAC 3ETQA 2E3CA 4FVMA 4LF4B 3CB2A 4YHHB 1FVIA 2BTOA 4OX9B 4ZHQA 4CS4A 3HKCA 4JI8B 1X9NA 4DR4B 2R9AA 2HIXA 3F8NA 1N34B 2VUGA 4DV7B 2YXLA 2XHBA 4JI3H 1N32B 3N40P 2JS5A 4O4HB 1XNQB 1AN7A 2PUSA 4JI7H 1Z2PX 1Q8IA 4D7SA 2UXBB 2YIAA 1O9GA 5A2QW 3KALA 2HVQA 4JI2H 4JI1H 5CB4A 3MAQA 5LOVB 3RJ0A 2CAZC 2VWJA 4I9QA 5D1PA 4U3JB 4CH4A 3BPZA 2VQFB 3K3VA 1WN7A 3RIZA 1TVKA 1SA0A 3ZS8C 5JVDA 4GYCB 1XMQB 4DV2H 4FFBA 4ZOLA 3JAMW 1VF7A 4DR7B 2CFMA 5IYZA 2HVRA 4AQYH 4GKKB 2VQEB 4M7EA 1BJTA 4LF7B 4TV9A 5EYPA 3OTOB 3W5OA 1FFXA 4YJ3A 4JI6B 1Q3EA 2UUCH 4DUZB 3RYHA 3HKDA 3GB8B 5IWAH 5IJ0A 3THOA 4X1YA 1XQ8A 4RAZA 4PI2A 4UCOA 2R72A 4X66B 1XI1A 3HKBA 5LP6C 5LP6B 3BA8A 4X1KA 2HEPA 4X1KB 1NT2B 2MCTA 5LMUH 1GYFA 2VQFH 3E22B 4X62H 1BGWA 4FLYA 5CB4B 3GDEA 1TAEA 1XHXA 3CVZA 5FNVB 4FLWA 3FFQA 3HKDB 4A2BA 4I4TA 4B08A 4DK0A 3UQ8A 4DV6B 4K8ZA 2IM9A 4RAYA 4LFBH 4LF5B 4PDBA 3T1YB 4CS2A 1Z2OX 4LF4H 4DRXA 4DV3H 4DRFA 4LF9B 2UXDH 5IYZB 3HKEA 4RB1A 4PZ8A 1S68A 4FM9A 1Z2NX 5JJJB 4NVPA 3UT5B 3K57A 2ZIOA 4U3JA 1H2SB 2UXBH 2R70A 3MWMA 5CA1A 4O4JB 4RB0A 1XMQH 4CH5A 2F1MA 4JI2B 2WDTA 3UT5A 4HNAB 1E4FT 1M93A 4FLVA 4TOIA 5ITZB 4RB2C 4DV0H 1HW7A 2YIBA 2JGUA 4YJ2B 3U10A 2P5OA 4JV5H 1SKVA 4X64H 4DRXB 5JCOA 3WB2A 3J80W 2QJ1A 3ICXA 5KX5B 4AQYB 5BR8B 4B3MH 4JI7B 3K5MA 2ZCEA 4I4TB 5FD6A 2V4DA 5FNVA 4I50A 3M7MX 5LL6b 3QWUA 4R7RA 5JQGB 4X1IA 1HR0H 3KAKA 4JI4H 3CSXA 2ZIMA 4RZQA 3HKBB 5LP6A 1XK5A 1T5EA 2ZJTA 1O9HA 5EZYB 4X20A 5BMVB 1CKNA 3QTCA 1I7FA 5FD5A 4UCRA 3HXLA 4TUYA 3TY9A 5JH7A 1N34H 2Q7HA 5EYPB 3KYHC 3H20A 1E4GT 3SJCC 1WNSA 4NXNH 2ZINA 1N36H 4LFBB 3N41B 4DUZH 3K59A 1ZHSA 4KHPB 1A0IA 4UCSA 5CA0B 3N43B 1HNZH 1TUBB 1TGOA 1TA8A 4EEQA 5IJ9A 3RR5A 1SA0B 5JVDB 4A2AA 1FJGB 1M0WA 5DISC 3VQXA 2UUAH 2CW8A 3RYIB 2O03A 4FLZA 1HNXH 3OTFA 3JARB 4YY3B 4I55A 3WB0A 2E5LB 4EQ5A 5KHHA 1SQGA 4X1IB 4DV4H 4LH7A 2PYLA 4F6RB 4B3RH 2BTQA 4GKJH 1ZHQA 4LF7H 4FM1A 4B3SH 3QF7A 3IAYA 4LFAB 1RSOA 5LA6B 4DV5B 1Z5VA 3L4JA 4DR1H 2OYQA 1HNWH 3KAJA 4JYAB 5KX5A 3N2KA 4JI8H 1N33H 1P8LA 4X66H 1YEWA 5KHJA 2UXCH 4HBNA 4EB6A 3JAKA 2RQ6A 4LF6B 3L2PA 5KMGB 4MTEA 4MTDA 3J7AK 3JALA 3JATA 5K1PA 3FMAA 5J2TA 2F93B 5GONA 4O4IA 1L8DA 4D7TA 4JI4B 2ZM6B 2E5LH 2QM4A 2KSWA 5KHKA 5LYJA 3N42B 4EB6B 4JI0H 4FLTA 4Q6GA 5EIBD 4JI5B 4IHJB 3N6XA 2UUBB 4DV7H 1JJOA 4ZIBA 4DR3B 4ZI7A 4DV5H 4OX9H 1O75A 1M5IA 2PYJA 4JYAH 4DR6B 1JFFB 3PN1A 4WBNA 4DUYB 1L2ZA 4JI6H 4O4LB 4TV8B 5D1OB 1MZBA 2VPSA 2HHHH 2PZSA 4CC5A 1Z5WA 4KHPH 1HNXB 3SGIA 4UCTA 2PGGA 1M4UA 3GJXB 2HVSA 4K0KB 3K5OA 4RB3C 2WYOA 1IBMH 4PZ7A 5D1OA 1XMOB 5CA0A 1S5JA 4EFBA 4WBNB 4LNUB 2Q7EA 4LF8B 4K8XA 4ZI7B 1M0TA 2Q2TA 3NBZB 3RGZA 2JVDA 1XNRB 3TY8A 4IHJA 4IAJA 5LYJB 2KKWA 4O2AB 2CW7A 2VWKA 4YJ2A 3NC0B 4DV2B 3RYFA 5IWAB 4X20B 3N2GA 3N2GB 3LNNA 5J2TB 1B04A 1S03G 4UCUA 4DR7H 3RYFB 3T1HB 1IBKB 2F4VB 5J2UB 5CA1B 4DV1H 5FPRA 1CKOA 1D5AA 3JAKB 4KL1A 4B3TH 4BW9A 5KHGA 2YIBD 4NXNB 3RGXA 1N32H 2YI9A 3N2KB 4EFEA 4MV7A 3JASA 3JASB 4DR1B 5IT9W 4DUYH 3EYYA 1DGSA 3OTOH 4I7HA 1ZAUA 3HKCB 4LSAA 4DV3B 4DR5B 4X65B 4DR6H 4I55B 5KHIA 2EX3A 3IG0A 1XDNA 3JAWB 4APMA 3JARA 4FLXA 4O4JA 3E22A 3U11A 3CHXA 4O2AA 5LXTA 3VQYA 4DV1B 1WPBA 4UFZA 4LF5H 1V9PA 3SR2C 4GKKH 5IJ9B 4GLXA 2ZNJA 1TUBA 4CS3A 1JFFA 1IBMB 3RYHB 1J5EB 4LNUA 1IBLB 2PTMA 1FFXB 4YJ3B 4JV5B 5FLXW 4B3MB 3J81W 1P49A 3QG5A 1XNRH 4E6NA 2RGVA 1SEIA 4TUYB 4LF6H 1G6UA 3W1GA 3BHPA 2WE6A 3RFRA 3DF7A 4CC6A 5D5QA 5BMVA 1KU9A 1CKNB 4BWAA 3B2EE 5FPOA 5GONB 4LFCB 3N44B 2YCHA 5EZYA 3U0ZA 3L4KA 3JAWA 1Q5OA 4JI1B 4DV0B 2F4VH 4L8JA 4FM2A 1TVKB 3C0FB 1HR0B 2ZNIA 1VS0A 2UU9H 4JI0B 4NXMH 2F66C 1XMOH 3LMLA 4I50B 2XIGA 4X1YB 1XHZA 5IJ0B 4UCVA 4DK1A 2RJZA 4YHHH 5BR8H 4IIJB 4LF8H 3DSQA 4O4HA 4B3TB 1J5EH 5LA6A 3VQVA 4DR4H 3WB1A 4AHCA 3RF2A 2BTQB 4LFAH 1HNZB 3VNNA 1WH2A 5JCOC 3BABA 1XNQH 1N36B 1N33B 5J2UA 4O4IB 4LMYA 2F95B 3K5NA 2UUAB 2HIVA 1SYXB 5ITZA 2HGSA 3VQWA 3RYIA 4FM0A 4HNAA 5K1XA 3S24A 5LMNH 5JJNB 3RYCA 3RYCB 4X65H 4DR5H 3T1HH 1IBKH 4DR2B 5C8YA 3TY5A 4NXMB 3BA9A 3ZEDA 4B3SB 3HKEB 2FE3A 2VQEH 4PZ6A 4DV4B 1JMKC 2OWOA 3W1BA 5EOYA 4TQDA 4JI5H 3K5LA 1QHTA 5D5PA 1I6UA 4TQFA 3T1YH 1Q43A 4F6RA 4DR3H 4JI3B 4ZHQB 5JH7B 1IBLH 4IIJA 1I94B 4LH6A 4ETSA 2Q7GA 1KMIZ 3M4IA 3K58A 2UXCB 4CH6A 3BAAA 1FJGH 4CH3A 4O2BB 5EIBC 5LMUB 4AILC 4O2BA 4LFCH 1FKAH 5JQGA 4O4LA 4TV8A 1SQFA 2GV9A 4YY3H 3RGBA 3JSNA 2Q2UA 3JSLA 4PHZA 1P16A 2UUBH 1CKMA 3NBYB 4DV6H 2Q0AA 1HNWB 2UU9B 2UUCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV1 B;  4PZ8 A;  4UFZ A;  1V9P A;  4GKJ B;  4GLX A;  1S68 A;  4X64 B;  1IBM B;  2UXD B;  4JI4 B;  2ZM6 B;  1J5E B;  1IBL B;  4JV5 B;  2HHH B;  4B3M B;  4JI2 B;  4JI5 B;  4E6N A;  4TOI A;  2UUB B;  5LMN B;  4DR3 B;  3W1G A;  3RTX A;  4CC6 A;  1CKN B;  5FPO A;  4LFC B;  4DR6 B;  3PN1 A;  4X62 B;  4DUY B;  4B3R B;  4DV0 B;  4JI1 B;  4LF4 B;  5D1O B;  4AQY B;  1FVI A;  4YHH B;  4OX9 B;  1HR0 B;  5BR8 B;  1VS0 A;  4JI7 B;  4CC5 A;  4JI0 B;  1HNX B;  4JI8 B;  3SGI A;  1X9N A;  4UCT A;  4DR4 B;  2HIX A;  3GJX B;  1N34 B;  4K0K B;  4DV7 B;  2VUG A;  2HVS A;  3QWU A;  1N32 B;  4UCV A;  1XNQ B;  4PZ7 A;  4B3T B;  5D1O A;  2UXB B;  1XMO B;  1XK5 A;  2HVQ A;  4EFB A;  1CKN A;  1HNZ B;  3VNN A;  3BAB A;  5D1P A;  1N36 B;  4LF8 B;  2VQF B;  4UCR A;  2Q2T A;  1N33 B;  1XMQ B;  3TY9 A;  3NBZ B;  2UUA B;  2HIV A;  3KYH C;  1XNR B;  3TY8 A;  3S24 A;  4DR7 B;  2CFM A;  4LFB B;  2HVR A;  4GKK B;  4DR2 B;  2VQE B;  4DV2 B;  3NC0 B;  5IWA B;  4KHP B;  1A0I A;  3TY5 A;  4NXM B;  4UCS A;  3BA9 A;  1B04 A;  4LF7 B;  3W5O A;  4UCU A;  3OTO B;  1TA8 A;  4EEQ A;  4B3S B;  2F4V B;  3T1H B;  1IBK B;  4JI6 B;  3RR5 A;  1FJG B;  5DIS C;  5FPR A;  4DUZ B;  1CKO A;  3GB8 B;  4PZ6 A;  4DV4 B;  2OWO A;  3W1B A;  4YY3 B;  4UCO A;  4NXN B;  4X66 B;  4JI3 B;  2E5L B;  4EQ5 A;  4EFE A;  1I94 B;  3BA8 A;  4DR1 B;  4LH6 A;  4LH7 A;  1DGS A;  3GDE A;  1TAE A;  1ZAU A;  2UXC B;  4LFA B;  3BAA A;  4DV5 B;  4DV3 B;  5LMU B;  3UQ8 A;  4DV6 B;  4JYA B;  4DR5 B;  4X65 B;  4LF5 B;  1P8L A;  3T1Y B;  1XDN A;  3JSN A;  2Q2U A;  3JSL A;  1P16 A;  4LF6 B;  1CKM A;  3NBY B;  4LF9 B;  4DRF A;  1HNW B;  2UU9 B;  3L2P A;  2UUC B; 
#chains in the Genus database with same CATH topology
 2VUM G;  3DTG A;  2CK3 G;  3E86 A;  1K5S A;  4TV9 B;  3CCV V;  2W70 A;  4QE9 A;  4ME6 A;  5K2M A;  4JYC A;  4TT3 G;  5L3C A;  3WNZ A;  1VQ4 V;  1I94 H;  2P22 C;  2HHH B;  2YW2 A;  5IYC O;  1FXK C;  1FXK B;  1X4T A;  4U7C A;  3E8F A;  1NTM H;  5C8Y B;  4FLU A;  2EIM C;  2EIM B;  3JAL B;  3JAT B;  4P30 A;  3MR6 A;  1S10 A;  4CKE A;  3KXY T;  5KFZ A;  3K79 A;  4DR3 O;  3Q8R B;  2BOB C;  4B3R B;  2Y0I A;  2J6U A;  1P7G A;  3SJA C;  1W0K G;  3ETQ A;  2W0F C;  2E3C A;  1S97 A;  3VOT A;  1VBG A;  1NBM G;  3K0D A;  2BTO A;  1XNQ O;  4CS4 A;  3HKC A;  1Y1W A;  4JI8 B;  4DV7 B;  5LMU O;  1QLE B;  1QLE C;  1U96 A;  1FKA O;  4GKK O;  2R7M A;  1RPR A;  2B5U A;  3LWB A;  4JI7 H;  1Q8I A;  3GIP A;  5FLM G;  3G6V A;  2UXB B;  2P4K A;  4PA7 A;  5CB4 A;  5KG0 A;  4ZOL F;  2CAZ C;  1FPO A;  4I9Q A;  1SES A;  1N0N A;  2LGQ A;  3CCJ V;  4QE7 A;  5D1P A;  3UFX B;  1CPY A;  3RIZ A;  4FFL A;  1SA0 A;  2H8P C;  1I2K A;  4GYC B;  1M7J A;  4DV2 H;  1XRE A;  4FFB A;  4ZOL A;  3U9T A;  5JQW A;  4MV3 A;  4JI5 O;  3SYC A;  4DR7 B;  1E79 G;  5KG5 A;  2L35 A;  2W9C B;  4AQY H;  3TW7 A;  2WLM A;  2FML A;  2QE7 G;  5HFL A;  1JIH A;  1ARO P;  2CH7 B;  2EZO A;  1ZL8 A;  1WA8 B;  4M7E A;  4HZ3 A;  4O84 A;  4LF7 B;  1BJT A;  1BGY H;  3K3P A;  2DJV A;  1US6 A;  5KAI Z;  4Y8V B;  2UUC H;  2P90 A;  3RAX A;  3AK2 A;  2EIJ C;  2EIJ B;  4DUZ B;  3HKD A;  1MG1 A;  1COW G;  4GX5 A;  3ETG A;  2R72 A;  1XI1 A;  5I5V A;  5L3F A;  1NS1 A;  5IE9 A;  1P84 F;  2ITD C;  3BQ0 A;  2VQF H;  4ABM A;  4X62 H;  4U6P A;  2W9B B;  1AP6 A;  2KB1 A;  1E4E A;  2Y48 A;  1GH6 A;  5IYB O;  1TAE A;  1GRJ A;  3UZB A;  5FNV B;  3W7W A;  3FFQ A;  5C93 A;  3UQ8 A;  4JV2 A;  2H94 A;  4K8Z A;  5DLG A;  2KSD A;  4JTA B;  2IM9 A;  5CM0 A;  4A3E G;  2WLI B;  5C8Y F;  2VA2 A;  1T36 A;  3TW6 A;  4GX2 A;  4CS2 A;  2Z0A A;  5KS8 A;  4Z1M G;  4TVI A;  2E76 B;  1SET A;  4DRF A;  5KT2 A;  4B3T O;  4DV3 H;  2UXD H;  4CMF A;  1URF A;  3HKE A;  3M9M B;  5KUK A;  4MVM A;  4IZO A;  5L1K A;  1Z2N X;  4GZR B;  2W8K A;  2V5A A;  1H2S B;  3MWM A;  3CME V;  3H1I H;  4RB0 A;  1XMQ H;  5DMX A;  1SQV H;  1MA1 A;  1M93 A;  2D2C B;  5BPH A;  4RB2 C;  5IWA O;  1K34 A;  2EJ3 A;  1V4Y A;  3E5N A;  3FYE B;  1RK5 A;  1BZK A;  4MV1 A;  2PVP A;  4O4L F;  4TV8 F;  5JCO A;  4JTD B;  3HKZ A;  2LFS A;  4BIZ A;  3RN4 A;  2A7W A;  4JI2 O;  2DQ3 A;  2WLI A;  3JD1 A;  4HNV A;  4AQY B;  3VPC A;  4IT5 A;  2R7Z A;  2ZCE A;  1KP2 A;  2V4D A;  4Q8E A;  4PA6 A;  3M7M X;  1BHB A;  3VOU A;  4R7R A;  3JYC A;  4M9U A;  4H0L B;  5H80 A;  2ILM A;  2ZIM A;  1AR5 A;  4O7R A;  3TXQ A;  5B5E Z;  4O7V A;  2Y4R A;  4I0X A;  2LJ2 A;  4JGS A;  5AG2 A;  3RVY A;  3L74 H;  1Y67 A;  3BVO A;  4ED7 A;  2LO1 A;  5FD5 A;  5FJ8 G;  1I7L A;  3DAA A;  4BBR G;  3PR4 A;  1AI4 A;  1JR9 A;  2BE3 A;  1EM1 A;  4K3A A;  1XMQ O;  2HR3 A;  4MVO A;  1UC8 A;  2E2I A;  1GN4 A;  4LFB B;  5FR9 A;  4YJ3 F;  3LP8 A;  4NZN A;  1A0I A;  2CTR A;  5CA0 B;  1TUB B;  4O3P A;  2JA7 G;  4FS2 A;  4EYI B;  4I55 F;  5JVD B;  2CTQ A;  1FYJ A;  1S3J A;  5DIS C;  1BQ0 A;  3TQT A;  2NR5 A;  3VQX A;  4RQE A;  2A3Q A;  2CW8 A;  3R66 A;  1HNX H;  2O03 A;  1PM9 A;  4RWU A;  3F5T A;  3W7S A;  2R85 A;  4OX9 O;  4I55 A;  2FL4 A;  3C3S A;  1VQ8 V;  1CEZ A;  5KHH A;  2EIK B;  2EIK C;  2Z5U A;  4X1I B;  4DV3 O;  1JDE A;  4PBC A;  4B3R H;  2BTQ A;  1ZHQ A;  4LF7 H;  3QF7 A;  4ASU G;  4Q45 A;  3OR6 C;  4LFA B;  4YQW A;  1Z5V A;  3OSN A;  3W7U A;  2R82 A;  4JI8 H;  3G4S V;  5CAE B;  1M9N A;  3ZIA G;  1Q6H A;  3RB4 A;  5KFN A;  1PNK A;  5EZY F;  2UXC H;  5I5S A;  4HBN A;  3V4Z A;  3JAK A;  4MTX A;  4LF6 B;  3L2P A;  2HJW A;  3K9S A;  3OTO O;  4GCZ A;  3OD4 A;  1TWC A;  4WCE V;  4MVR A;  4O4I A;  5KG6 A;  1M6V A;  3ZN1 A;  5BYB A;  3VPB A;  3B4S A;  3G8D A;  1ENV A;  1V51 A;  4EB6 B;  1NVP D;  4FLT A;  5EIB D;  4JI5 B;  4IHJ B;  1KC7 A;  4DW0 A;  4F4Z A;  3N6X A;  2UUB B;  2Q5Z A;  2R6F A;  3CRC A;  3SYP A;  3JRX A;  4ZI7 A;  1CQI B;  4DV5 H;  5KFJ A;  1OBG A;  1B6Q A;  2PYJ A;  2WLL A;  1JFF B;  3AEI A;  3L70 H;  3PN1 A;  4DUY B;  4DV6 O;  4RUA A;  1L2Z A;  2QWR B;  2ZR2 A;  3TIG A;  2DIK A;  3Q8Q B;  2HHH H;  4I9W A;  1N32 O;  3SGI A;  2XC9 A;  3BQ1 A;  2YID A;  3P30 A;  2WYO A;  4O7N A;  4JI8 O;  1OJH A;  1S0M A;  1Y4M A;  1X59 A;  3BFR A;  5D1O A;  5EWE A;  3RBE A;  3RT3 C;  1VQ6 V;  2IA6 A;  1A48 A;  3STL C;  2R9R B;  2Q7E A;  2C28 A;  4ZI7 B;  4MVQ A;  4YAK B;  4G28 B;  2YEV B;  1AI6 A;  2VPQ A;  3RGZ A;  5DGH A;  4KFM A;  4PDL A;  3TY8 A;  4J9P A;  1EN4 A;  3AK3 A;  4WD3 A;  3ZRW A;  1S5L Z;  5KFB A;  2IJJ A;  3U55 A;  5IWA B;  4MAM A;  2M05 A;  3L71 H;  3MD0 A;  1AP5 A;  1IYD A;  4UCU A;  2XAJ A;  3T1H B;  2VUM A;  3H40 A;  4PA9 A;  3BQ2 A;  5FPR A;  4LF4 O;  1G8M A;  1Z2G A;  4KL1 A;  1W93 A;  2DMX A;  1KT8 A;  2C22 A;  2YIB D;  4IRK A;  3T1H O;  1K4C C;  2HHF A;  3PVX A;  3ZHQ A;  2YI9 A;  2FJZ A;  3JAS A;  4DR1 B;  2OTL V;  4EYH B;  3IGA C;  5BWW A;  5JH7 F;  4XDL A;  3FYI B;  3OTO H;  1KJJ A;  4U7N A;  2IJH A;  1XUQ A;  4FFP A;  4EKW A;  1XMO O;  4OXS A;  1FD9 A;  4FE2 A;  3JCZ A;  2V1D A;  5KG4 A;  5LBQ A;  2EX3 A;  1RFY A;  3A0B Z;  3JAW B;  4LF8 O;  2ASL A;  4O4J A;  4ICG A;  4A3B G;  4ZHQ F;  4LF5 H;  1EZJ A;  2UVR A;  4WFE A;  1NR7 A;  3OR7 C;  1ET0 A;  1Y14 B;  2HVJ C;  1QCE A;  4X8A A;  3CP1 A;  5CBG A;  3RYH B;  2I8C A;  4O3N A;  4X62 O;  2W6N A;  2PTM A;  4YJ3 B;  1FFX B;  4JV5 B;  5LA6 F;  5FLX W;  4J9Z B;  2P67 A;  1IOV A;  3OW2 U;  2R8G A;  2Q0O C;  4TUY B;  4AYB A;  3L73 H;  1G6U A;  4RCN A;  3BHP A;  4FMT A;  2WE6 A;  3DF7 A;  5BMV A;  1CKN B;  1BT8 A;  5FPO A;  5GON B;  4E4E A;  5HFM A;  3LDC A;  3U0Z A;  4JI1 B;  2ASJ A;  4R6Z A;  2J6T A;  1DIK A;  1AVM A;  3JCU Z;  2DW4 A;  2XT9 A;  1VS0 A;  4NXM H;  2QM8 A;  1NR1 A;  4DUZ O;  1AI7 A;  4JAS A;  3IFX A;  4X1Y B;  1N56 A;  5IJ0 B;  4UCV A;  4NZO A;  4PD4 F;  1XBL A;  4R8C A;  4PDM A;  1YHQ V;  4IIJ B;  3DSQ A;  4JAA A;  4PA3 A;  1J5E H;  3VQV A;  2LGW A;  4FBU A;  4DR4 H;  3KCX A;  2Q69 A;  4GX0 A;  2CTP A;  4FJC C;  4YB8 B;  4N21 A;  3RF2 A;  3RB3 A;  5L3B A;  3RW0 A;  2RDI A;  3BAB A;  4DR7 O;  1N33 B;  4W4K A;  4F6E A;  1OCZ B;  1OCZ C;  2XCA A;  5ITZ A;  3CEI A;  4LWS B;  4PV1 B;  4LF7 O;  4O7S A;  5DQH A;  5KFM A;  4DR5 H;  5I60 A;  2R8J A;  3HBL A;  4DR2 B;  1A32 A;  2IH3 C;  1K5Q A;  3LDD A;  3KZI Z;  5EWG A;  4AI8 A;  3B40 A;  1SQB H;  1SZX A;  1Y74 A;  2W6M A;  5L1L A;  1P7B A;  5E25 A;  3HKE B;  4ECV A;  3HOZ G;  3FB5 C;  3ZMU A;  3W1B A;  3CQZ A;  4JI5 H;  5KFT A;  2W9A A;  1C3O A;  4A3M G;  3CXC U;  5JH7 B;  4IIJ A;  1I94 B;  5C44 G;  1MZF A;  4LH6 A;  3GTK A;  1R3J C;  2WA4 A;  3ZHS A;  2NU8 B;  1EZV H;  2HVK C;  1E4E B;  5BR8 O;  3B09 A;  1JJ2 U;  4QWA A;  4HNU A;  1XDC A;  3BAA A;  4C5B A;  1FJG H;  1FXV A;  3APQ A;  4CH3 A;  4O2B B;  5EIB C;  5LMU B;  2R86 A;  4AIL C;  4A3J G;  2LQT A;  4YP3 A;  3I56 V;  1FKA H;  4LFC H;  1LNQ A;  3QQM A;  2O57 A;  4J9Q A;  3D36 C;  1E1R G;  1P4R A;  2Q8V A;  1OWT A;  2OCH A;  3JSL A;  1IDS A;  4DXW A;  5C1O A;  4PHZ A;  4X88 A;  1K8A W;  2QTS A;  1CKM A;  1B6R A;  4RAI A;  4IGG A;  2UUC B;  2ADP A;  2W0X A;  2YUA A;  1NU1 H;  2DZD A;  3A8T A;  5CR5 A;  2AXT Z;  4MS2 A;  1IYE A;  1RYS A;  2YI8 A;  2UXD B;  4EEY A;  3SPH A;  4Q0Y A;  3T5L A;  2IU3 A;  1K92 A;  2QF7 A;  1F23 A;  4K0K H;  3SJB C;  4PI0 A;  5LMN B;  5KLV H;  2VOB A;  3LSS A;  5KT6 A;  3A2F A;  1S0V A;  3PFF A;  2Y4U A;  4DL6 A;  2ZE6 A;  4U7O A;  4MVS A;  1UFI A;  3OMA B;  1AJN A;  3VA7 A;  2BQR A;  1Q6I A;  1FVI A;  3ETD A;  1RSO B;  2R9A A;  2HIX A;  4DV0 O;  1N34 B;  2JRI A;  5E1A C;  2XHB A;  3STZ C;  1DF5 A;  1N32 B;  3N40 P;  2JS5 A;  3PZP A;  2JEJ A;  3GTM A;  4HYK A;  1Q90 D;  3LUL A;  4FFM A;  4NB5 A;  2YIA A;  1O9G A;  1XIL A;  4TM5 A;  5DG9 A;  4JI2 H;  3RB6 A;  1AUV A;  2JGD B;  1OV9 A;  4CH4 A;  3BPZ A;  5BZB A;  2VQF B;  1WN7 A;  1K7D A;  3HOW G;  1TVK A;  2EIL C;  2EIL B;  4JTC B;  2M7W A;  4LC1 A;  5I5Y A;  3JAM W;  2EJ0 A;  5BYA A;  1FXK A;  5KFA A;  1I1K A;  3ABM C;  1VF7 A;  2IBZ H;  3ABM B;  1MSW D;  3AYH B;  5IYZ A;  4FU0 A;  5B1B C;  5B1B B;  2PI5 A;  4JAV A;  2EBO A;  2R7Z G;  3W7T A;  5EYP A;  3OTO B;  1QVG U;  3F7Y C;  3H1J H;  1FFX A;  4YJ3 A;  1ZX3 A;  3RYH A;  4KXR A;  2Q6A A;  3THO A;  4X1Y A;  2GPS A;  4RAZ A;  4UCO A;  4TQR A;  1RM1 B;  3AG1 B;  3AG1 C;  1RM1 C;  2PI4 A;  1NI8 A;  4MW8 A;  2RMK B;  5LP6 C;  5LP6 B;  3LQS A;  2WTF A;  3BA8 A;  2W7O A;  2HEP A;  4X1K B;  4DV7 O;  2XCL A;  3E22 B;  3UKM A;  4O83 A;  3R9R A;  2ZE8 A;  5L1I A;  4O2B F;  2QYZ A;  3A0H Z;  4Q43 A;  3GDE A;  1JVM A;  1XHX A;  2X6C A;  5KFS A;  3AW8 A;  3QVN A;  4B08 A;  4DK0 A;  4NR1 A;  3BEH A;  2QEX V;  2B9Z A;  4BY1 G;  4LFB H;  4RAY A;  4ZBM A;  3DTF A;  1KKC A;  5DEC A;  2WAQ A;  4BIO A;  4PDB A;  2VR1 A;  3CC2 V;  3QO5 A;  2YRX A;  2QK4 A;  2QWQ B;  1KBH A;  4LF9 B;  5IYZ B;  2QKA A;  3K0G A;  1YF2 A;  4B3S O;  1GLV A;  2BOC C;  2ZDQ A;  4NVP A;  3ZRX A;  3TJT A;  4W4L A;  4U3J A;  4O4J B;  2HG5 C;  4CH5 A;  2F1M A;  4JI2 B;  2ATL A;  4UVB A;  3UT5 A;  4HNA B;  3MFI A;  2YWV A;  2R92 G;  4WFF A;  5DQI A;  3KTM A;  1DF4 A;  3LNM B;  1L0L H;  1HW7 A;  5BWV A;  4LCU C;  2YIB A;  2HLD G;  1PP9 H;  2R8I A;  3WB2 A;  4DIM A;  3ICX A;  1EUC B;  3WO1 A;  4ZI7 F;  2EJ2 A;  1NTZ H;  4QJF A;  4QW8 A;  3GIJ A;  5KG7 A;  3LUT B;  1BHA A;  2DAB A;  2R7N A;  1TWH A;  4I50 A;  2PF4 E;  1H2K A;  1BQZ A;  3D8C A;  1F7Y A;  4X1I A;  1R3L C;  2CNQ A;  1BMF G;  3CCS V;  5L3G A;  2HDK A;  4A5U B;  3MR5 A;  2LW1 A;  3T5H A;  4RZQ A;  3HKB B;  3SYA A;  1T5E A;  2R7L A;  2ZJT A;  1HNW O;  5EZY B;  1O9H A;  2NN4 A;  5BMV B;  1CKN A;  5BWU A;  1MNG A;  2X0L A;  1I7F A;  2CE4 A;  5L3D A;  3ZBH A;  1I2L A;  4Q44 A;  3FX7 A;  4HQ6 A;  4TUY A;  3TY9 A;  3K06 A;  1M56 B;  1M56 C;  1QR8 A;  2OIG A;  4NTX A;  2Q7H A;  3KYH C;  1VF6 A;  1WNS A;  4NXN H;  1MOF A;  1Q86 W;  2C35 B;  1N36 H;  3N41 B;  1FJG O;  3K59 A;  2FMA A;  2R9I A;  1ZHS A;  2EJ7 A;  1HNZ H;  1XOU A;  2JIZ G;  1FJG B;  2HJF C;  1M0W A;  2FK2 A;  5LP6 F;  4LWS A;  3HOY G;  1Y1V A;  3JAR B;  2AQ4 A;  4GX1 A;  4O3S A;  4QGP A;  4ED2 A;  4DL5 A;  4QPK A;  4DV4 H;  4I4T F;  2PYL A;  3FAV B;  1I0H A;  2LP7 A;  4GKJ H;  3T54 A;  4B3S H;  4PJ0 Z;  4JI4 O;  1KUT A;  3SPC A;  4DV5 B;  3L4J A;  4DR1 H;  3J81 N;  1HNW H;  2GUZ A;  2A9H A;  3L9D A;  2Y69 B;  2Y69 C;  4E2L A;  4IR9 A;  3V4S A;  1P8L A;  1YEW A;  4EB6 A;  4MA0 A;  1PNL A;  3LSQ A;  2AGA A;  5GON F;  4GC7 A;  3P32 A;  2K1E A;  3R65 A;  3E2E A;  2UUC O;  1K83 A;  2F93 B;  4O4J F;  5GON A;  4DR4 O;  1L8D A;  2FK3 A;  1GN6 A;  3FKI G;  5KFX A;  2QWP B;  4YIP A;  2KSW A;  5LYJ A;  4JI0 H;  1EYZ A;  4N23 A;  1NH2 B;  3QFF A;  4ZIB A;  5I5T A;  4DR3 B;  3Q2O A;  1BXR A;  3HB3 B;  1GSA A;  4J9S A;  5EBL C;  5KX5 F;  1M5I A;  5IT9 N;  5KFO A;  3LSU A;  4NTY A;  3ML0 A;  4BBS G;  1OCC C;  1OCC B;  2W6Z A;  1MZB A;  4RUE A;  3VMM A;  3H0G G;  2YS7 A;  4CC5 A;  1VQP V;  2K9P A;  4UCT A;  2PGG A;  3GJX B;  2HVS A;  5B3S C;  5B3S B;  4K0K B;  3K5H A;  5J2T F;  3D3Q A;  3TGU H;  2XAS A;  3PO3 G;  2COG A;  3PW2 A;  4BXX G;  3U9S A;  2VQD A;  2XAH A;  3ZHT A;  2WAQ E;  1A3G A;  5LGN A;  4H44 B;  3K3W A;  3GV5 B;  4Z2W A;  4YR3 A;  3ZCC A;  1M0T A;  1KEC A;  5F2V O;  2HGW A;  2Q4P A;  3NBZ B;  2ZE5 A;  2JVD A;  1IX9 A;  1VF5 B;  4G3I A;  5CBF A;  4IAJ A;  3ZHR A;  1YSC A;  2KKW A;  4XX0 B;  2CTW A;  2QDO A;  5JQG F;  2C00 A;  2LFR A;  1G1X B;  1FAF A;  3LNN A;  5J2T B;  1B04 A;  3M8A A;  1S03 G;  2F4V B;  3Q8P B;  3K5I A;  1THZ A;  4DV1 H;  4O86 A;  1CKO A;  2CGN A;  4BAY A;  4LF6 O;  2FPG B;  3JAK B;  2FPI B;  2B1I A;  4BW9 A;  1WR2 A;  5KA5 A;  4NZM A;  3WO0 A;  5JVL A;  5KT4 A;  1I94 O;  4FBT A;  1IBK O;  5KG2 A;  3RGX A;  2COJ A;  4EFE A;  2JEF A;  3I4N G;  3JAS B;  3E89 A;  3G6X A;  5KFU A;  5L1J A;  2W6I G;  2HHF B;  1Y76 B;  3QO8 A;  4JYY A;  1ZAU A;  3HKC B;  3T99 A;  2P6J A;  2ZQM A;  3PW5 A;  2HKO A;  2WLH A;  4DV3 B;  3ETJ A;  2AGO A;  1I08 A;  4DR5 B;  1FFT B;  4I55 B;  1B3Q A;  2ZE7 A;  4QW9 A;  5E79 Z;  1G2W A;  1K3E A;  5C4X G;  2ZR3 A;  2Z02 A;  3E22 A;  4YAJ B;  3OM3 B;  3U11 A;  4DYL A;  2Y0S A;  2UXN A;  4Z1V A;  4DV1 B;  1VAJ A;  1WPB A;  4GKK H;  4XZ3 B;  5IJ9 B;  3KHH A;  1JX4 A;  3GQC A;  2WA3 A;  3WFV A;  1IBM B;  1GSO A;  4NTW A;  2YEV A;  4O3O A;  1J5E B;  2QA4 V;  1RYR A;  1SQX H;  5EC2 C;  3D3I A;  4B3M B;  5LMN O;  4E6N A;  4X65 O;  1GGO A;  5CB4 F;  4NYK A;  4LF6 H;  3E8B A;  3EPI A;  1MZE A;  5KFL A;  5EBW C;  2W9C A;  1WRV A;  1RJQ A;  4CC6 A;  2ZT9 B;  3B2E E;  4LFC B;  4UVC A;  2FPP B;  2FLL A;  3T9E A;  2Q67 A;  4L8J A;  4FM2 A;  2GPW A;  4CMD A;  2W6P A;  1TVK B;  4WFH A;  1Y1W G;  3OT7 A;  2YDE A;  2QWO B;  1XMO H;  1OCO C;  1OCO B;  1SQQ H;  4H37 A;  2B63 G;  1XHZ A;  2RJZ A;  1HNZ O;  1EN5 A;  2BR0 A;  5BR8 H;  2N04 A;  2YRW A;  3ZMZ A;  1SZT A;  4B3T B;  1D2D A;  2NU6 B;  5LHH A;  2CQY A;  5KFY A;  2QB5 A;  4AHC A;  1B6S A;  2UUA O;  1RJP A;  3CRR A;  4LFA H;  4J9R A;  1HNZ B;  1V55 B;  1V55 C;  2JA5 A;  2KQX A;  4LMY A;  3Q8S B;  3GIK A;  2F95 B;  2UUA B;  1SYX B;  3ETE A;  3MDS A;  2HGS A;  3VQW A;  4O7W A;  4PWQ A;  4FM0 A;  5LL6 Y;  3G6E V;  4LP8 A;  3PW4 A;  5K1X A;  3S24 A;  5C3E G;  3RYC A;  2RNB A;  1IBK H;  2ITC C;  2Z3Y A;  2AHZ A;  5EWF A;  1LUV A;  5C8Y A;  2AW9 A;  4F4Y A;  2YZM A;  3BA9 A;  2XTA A;  4B3S B;  3OUU A;  1JLL B;  1GSH A;  3V6J A;  2DWD C;  4R8U B;  4J9K A;  4PZ6 A;  2OWO A;  5I5U A;  4MVU A;  3K5L A;  1VF6 C;  1KD1 W;  3T1Y H;  4DR3 H;  1CP9 A;  4JI3 B;  1QBZ A;  1IBL H;  2GQS A;  2R7K A;  1KMI Z;  2V58 A;  5LGT A;  1S76 D;  1G4Y B;  4I0X B;  3M4I A;  2W9B A;  3HKZ E;  4DL7 A;  4CH6 A;  2C2R A;  2FLP A;  2WB1 E;  5KFW A;  4O2B A;  3H9V A;  4O4L A;  4TWK A;  2GV9 A;  4TV8 A;  1Q82 W;  4YY3 H;  4JZG A;  4PEL A;  4ZKI A;  2YXH A;  4DL2 A;  2MW2 B;  3AG7 A;  5I5X A;  1JDB B;  1KKD A;  3V6H A;  5JJE B;  3HPL C;  2OTJ V;  4QJF B;  4GKJ B;  4MV9 A;  3BRC A;  4X64 B;  2M6Y A;  5KFR A;  4P2Z A;  5DGA A;  2XAG A;  4YR0 A;  4DV4 O;  3HR0 A;  4LF9 H;  2JJ2 G;  1I7N A;  2W57 A;  1PPJ H;  5F9N A;  1VQ7 V;  1GO3 E;  2YS8 A;  1VQN V;  3E83 A;  2RGR A;  1KJQ A;  3GII A;  3DC6 A;  4FFB B;  4ZOL B;  3K03 A;  4LSX A;  4TSF G;  4J0M A;  5LXT B;  2ZM6 H;  1SCU B;  2EZP A;  4DR2 H;  3T1Y O;  2GDS A;  4ECW A;  5KMG A;  4LR3 A;  3RWR D;  1J5E O;  3WWH A;  2JA7 A;  5LOV A;  1QQC A;  3CE2 A;  3PW7 A;  1C30 A;  3SYO A;  4FVM A;  1TWA A;  5EK0 A;  1RJR A;  4YHH B;  4OX9 B;  1JOY A;  3WWJ A;  4MTG A;  4A3F G;  1X9N A;  4RNM A;  4Q8F A;  3A0R A;  2VUG A;  2YXL A;  3ETH A;  5H6Q A;  5CN0 A;  4FZ1 A;  3B8N A;  1ZWI C;  2WB1 A;  1XNQ B;  2PUS A;  2W71 A;  3KHL A;  4I50 F;  4D7S A;  4NKG B;  1Y74 B;  4DV1 O;  1ZQ7 A;  3KAL A;  2HVQ A;  4FZ0 A;  4JI1 H;  2N74 A;  1EBO A;  5LOV B;  3ABK B;  3ABK C;  3MAQ A;  3N6R A;  1EFR G;  1ZUQ A;  4F4L A;  5KA6 A;  1M90 W;  4EBE A;  4JYA O;  4U3J B;  5DN6 G;  4R7C A;  1IZ3 A;  5DED A;  2QR4 A;  4P9P A;  2GTA A;  4NLG A;  1A9X A;  3HT5 A;  4X89 A;  2VQE O;  4O3R A;  3CS5 A;  3BCC H;  3RB0 A;  3U0G A;  4UUJ C;  1EKP A;  4A93 G;  2HVR A;  3FB7 C;  1MAB G;  4GKK B;  2VQE B;  1YJW V;  3N8D A;  1HWY A;  1ZET A;  3M99 B;  3KCY A;  2QWN B;  1UPG A;  2I87 A;  2XND G;  4A3L G;  4QPJ A;  2COI A;  2XOK G;  4JI6 B;  3UZO A;  3K9A A;  1Q3E A;  2DWC A;  2ETN A;  2V9W A;  5DAA A;  4RQF A;  2AZ2 A;  1L1F A;  5IJ0 A;  4CE5 A;  5C1P A;  1XQ8 A;  4ECS A;  4X66 B;  2UVW A;  1HP8 A;  2XD4 A;  4CHI A;  4O4I F;  3RV4 A;  3HKB A;  4MV4 A;  1S0N A;  4DAA A;  4X1K A;  1NT2 B;  1VQL V;  1JKJ B;  2SCU B;  4HR7 A;  2IH1 C;  1Q6U A;  3EFF K;  5BWT A;  5CB4 B;  1GAX A;  5B1N A;  2ADQ B;  2IU0 A;  5DM6 V;  5FL7 G;  4FLW A;  2PMZ E;  4ECQ A;  2A79 B;  4I4T A;  1W0J G;  4GUN A;  4L87 A;  4L1K A;  4LF5 B;  5D8D A;  2VA3 A;  3OEH G;  4YBZ B;  1H38 A;  1EHI A;  4DRX A;  2W6Q A;  1R3I C;  2DWE C;  4K0K O;  4RB1 A;  4WHX A;  2WLK A;  2YYA A;  4NXM O;  3B77 A;  3UO3 A;  3UT5 B;  3K57 A;  1BE3 H;  2JDI G;  4DUY O;  2R70 A;  1GK9 A;  4O7L A;  3CCE V;  1DV2 A;  4TOI A;  4MSW C;  5KT7 A;  4DV0 H;  4PA4 A;  4MV6 A;  1WSC A;  4YJ2 B;  2V4R A;  5A9G A;  2P5O A;  1K1Q A;  1SKV A;  3EVK A;  1KJI A;  4X64 H;  4DRX B;  3G67 A;  3GB7 C;  2W8L A;  3OE7 G;  2HGX A;  3GID A;  3FDS A;  3T5K A;  3CRM A;  4AYB E;  4B3M H;  5IDJ A;  4I4T B;  3JD4 A;  5LL6 b;  3D36 A;  3SDL A;  1RPO A;  3JZF A;  5JQG B;  2DE0 X;  1HR0 H;  1XNR O;  3KG2 A;  2CGO A;  1PKX A;  3K04 A;  5LP6 A;  3H4B A;  2OCC B;  2OCC C;  2QM7 A;  4X20 A;  4NYE A;  2QGN A;  1N33 O;  1XL6 A;  5EDW A;  3PO2 G;  3NXS A;  4UCR A;  3TCU A;  4IRC A;  4A3G G;  3HXL A;  4IL6 Z;  5JH7 A;  1N34 H;  2GQR A;  3H3V H;  5L3E A;  3H20 A;  1KEE A;  1E4G T;  1T3N A;  3SJC C;  1IUR A;  4J7J A;  3CWB H;  3S3W A;  1H2M A;  1I3Q A;  4UVA A;  2FB9 A;  4XBF A;  1OHH G;  2Q9L A;  4DUZ H;  4G2K A;  5FNV F;  2MK3 A;  3GIQ A;  3JD3 A;  3B8M A;  3WWI A;  3N43 B;  4QIW E;  1TGO A;  3TIN A;  1TA8 A;  4EEQ A;  5IJ9 A;  5JWP A;  3MHS C;  3RR5 A;  5HNE A;  4F50 A;  1BSM A;  2RDJ A;  3KHG A;  1NH2 D;  2YZN A;  1GTO A;  4EGJ A;  2UUA H;  3RYI B;  4FLZ A;  5KFC A;  2YS6 A;  3OTF A;  3TII A;  4YY3 B;  4DQN A;  1BL8 A;  2YU9 A;  4B7E A;  2QKS A;  4EQ5 A;  1PX2 A;  3ABT A;  5BXZ A;  4BR6 A;  4F6R B;  5LYJ F;  1N8R W;  3CRQ A;  3JZI A;  3T7A A;  4WFA V;  5CE8 A;  3GTP A;  4ZQI A;  2X6A A;  2OIE A;  1WP8 A;  5CA3 A;  1QVF U;  3H1K H;  3OHA A;  3KAJ A;  3SPG A;  4JYA B;  5KFI A;  1H8E G;  5KX5 A;  3CD6 V;  2E74 B;  3ZHU A;  4WFB V;  5KUM A;  2Q73 A;  3I12 A;  5KHJ A;  2UU9 O;  2QKC A;  1K73 W;  1YZB A;  2IMW P;  5KMG B;  3IC9 A;  2JEU A;  2Y4T A;  1VQM V;  3MR3 A;  3J7A K;  2B63 A;  1A0G A;  3I4M G;  5K1P A;  5J2T A;  5IP9 G;  2E75 B;  5KAF Z;  4J9L A;  2R84 A;  2NNU A;  2E5L H;  2QM4 A;  1Y6X A;  3FB8 C;  4JZ2 A;  2ZKO A;  2X7R B;  2CDY A;  4DW1 A;  5KHK A;  4Q6G A;  1PNM A;  2NVX A;  1JJO A;  1GO3 F;  3V6K A;  4PDR A;  1ZLZ A;  2AGQ A;  1R73 A;  5B1A B;  5B1A C;  3GIM A;  4JYA H;  2UUB O;  3MFH A;  3H1L H;  3ZMT A;  4JI6 H;  4O4L B;  4TV8 B;  5JUM A;  1UJW B;  4B3R O;  2VPS A;  1T94 A;  4ED0 A;  1Z5W A;  1SER A;  1HNX B;  3SI8 A;  2YIC A;  1PL0 A;  4LF9 O;  4MV8 A;  1DTO A;  1AI5 A;  2AHY A;  4RB3 C;  5KKN B;  4RNO A;  1IBM H;  1QNM A;  4NXN O;  4HAM A;  4ECU A;  3AG4 B;  3AG4 C;  5GW7 A;  2H3O A;  5CA0 A;  1EKV A;  1KTA A;  1I5Y A;  5BWR A;  4EFB A;  3MWE A;  4DR2 O;  3U54 A;  2WLL B;  2YSU B;  2JEI A;  1VP7 A;  1JA8 A;  1XL4 A;  4R8U A;  2ARH A;  3HOX G;  4IWY A;  3M9N B;  1XNR B;  2ZXW B;  2ZXW C;  5IYD G;  5LYJ B;  5GTH Z;  4O2A B;  4ECT A;  2VWK A;  2A06 H;  3JD2 A;  3NC0 B;  4DV2 B;  3FD9 A;  3N2G B;  4DV5 O;  3UM7 A;  3T4D A;  1I1L A;  4GKJ O;  4DR7 H;  3RYF B;  2C2E A;  1AR4 A;  2BQ3 A;  1CQJ B;  4QWC A;  2XGQ A;  1D5A A;  4B3T H;  5DQG A;  4NXN B;  1GN2 A;  3ORQ A;  4QWB A;  3H4D A;  4CZZ A;  1KC8 W;  5IT9 W;  1S9F A;  2FK1 A;  5DGI A;  1JXL A;  4XDJ A;  5CBH A;  3GTL A;  4DUY H;  2XGP A;  3ZMV A;  4HNT A;  4KUM A;  5LHG A;  1DGS A;  1Q81 W;  3IN5 A;  4I7H A;  2R8K A;  1B33 N;  2E2H A;  3O9O A;  4YJ2 F;  2FYU H;  2JA8 G;  4DR6 H;  1GM9 A;  3IJ4 A;  5LXT F;  4RU9 A;  1XDN A;  1BS3 A;  4X64 O;  3JAR A;  4APM A;  4GLW A;  4FLX A;  4BIU A;  3SJQ C;  5LXT A;  4UFZ A;  1BCC H;  1V9P A;  4RNN A;  3GVM A;  1YI2 V;  1YTF D;  1JFF A;  4MTF A;  1NZ6 A;  4LNU A;  1IBL B;  5H2F Z;  1EN6 A;  1EKF A;  3ABU A;  3Q4H A;  4LBE C;  3J81 W;  4J41 A;  1NVP B;  2RGV A;  2ATK C;  4J11 A;  3AG2 B;  3AG2 C;  3C90 A;  1YIJ V;  2IW5 A;  1J95 A;  4OGQ B;  3SPI A;  1FS0 G;  3N44 B;  1SS3 A;  4DLK A;  5EZY A;  3I5D A;  1KJ9 A;  1VQ9 V;  3JAW A;  1Q5O A;  3ORR A;  3NGD A;  3C0F B;  2XUM A;  3TEK A;  3ZX6 A;  2ZDH A;  3OMN B;  5IYZ F;  2ZNI A;  4JI0 B;  2F66 C;  4A3I G;  4B7K A;  2DPI A;  4O4H F;  3LML A;  2RCV A;  3WG7 C;  3WG7 B;  5I5W A;  2XIG A;  3F5W C;  2YZG A;  3GLK A;  2P4V A;  1WLE A;  3UO2 A;  4LF8 H;  4MT8 A;  4O4H A;  4OPH A;  1UC9 A;  1YJN V;  2ODT X;  1JCH A;  2BTQ B;  2GHY A;  1EUD B;  4O3Q A;  3VNN A;  1WH2 A;  1MMM A;  5JCO C;  2RF4 A;  2X0S A;  4I7Z B;  4FFN A;  4UXN A;  4O4I B;  4UUG A;  3MHH C;  3K5N A;  2WWW A;  4O7T A;  1SRY A;  1YDX A;  3QZ7 A;  4J9O A;  4HNA A;  4JYB A;  1DAA A;  4J10 A;  5LMN H;  5JJN B;  3T9F A;  3RYC B;  3T1H H;  2NUA B;  4ECY A;  1WJZ A;  1CE8 A;  1F4M A;  4JF3 A;  2GTS A;  4F4X A;  2UXX A;  4FFO A;  2W6O A;  2F4V O;  5EOY A;  4TQD A;  2A0L A;  3AG3 C;  3AG3 B;  1QHT A;  4QIW F;  2YL2 A;  3QZ8 A;  4ZHQ B;  3GTG A;  2ALZ A;  4ETS A;  3R5F A;  2Q7G A;  2DYS B;  2DYS C;  1R6N A;  3CMA V;  3T9D A;  4MA5 A;  3E8G A;  1R9T A;  2UXC B;  1QLN A;  2JK5 C;  4EBC A;  4LFA O;  5DLF A;  3OSP A;  2HJD A;  4QSH A;  1SQF A;  1SF9 A;  3RGB A;  3T9C A;  4ECR A;  1IXM A;  2DOS A;  5DGB A;  1R1B A;  4MW3 A;  1HNW B;  2UU9 B;  3K08 A;  2PY5 A;  1HR0 O;  5BWX A;  2EIN C;  2EIN B;  1ZL8 B;  1GMG A;  2ZD9 A;  3Q4H B;  1I50 A;  2YC0 A;  3CJH A;  4DV2 O;  3G6Y A;  2YZL A;  4C2M A;  1CXZ B;  3R5X A;  4UV9 A;  4YIO A;  2PN1 A;  3OFN G;  4CKC A;  3T5J A;  1WB8 A;  2UXD O;  1VQO V;  2AZ0 A;  4JUZ A;  3CC4 V;  4O7Z A;  1UNN C;  3RTX A;  1JQ0 A;  3EXA A;  2UXC O;  4TUY F;  1GM8 A;  1TWG A;  1N4C A;  2JGD A;  1S0O A;  4X62 B;  4BWS C;  3HOU G;  1VBH A;  3G80 A;  4WFG A;  2GSM B;  1H2G A;  2UXB O;  1YCI A;  4LF4 B;  3CB2 A;  5C5J A;  2GUZ B;  5EC1 C;  3SYQ A;  4FK5 C;  4ZHQ A;  1Y1V G;  4FS1 A;  3DGE A;  4DR4 B;  1SQP H;  3F8N A;  3JZ6 A;  4JI3 H;  2EIY A;  2NU7 B;  4DL3 A;  3FAV A;  1NTK H;  1WP7 A;  4O4H B;  2RDC A;  3CX5 F;  5CMU A;  2HG8 A;  3MJF A;  1HDJ A;  1Z2P X;  1AN7 A;  2XAQ A;  1ROP A;  5A2Q W;  1WPX A;  5H9C A;  5JVD F;  1R3K C;  3RJ0 A;  2VWJ A;  1YVW A;  4B3M O;  4E4T A;  3DXR A;  1AUX A;  3L72 H;  2RN9 A;  3K3V A;  2Z04 A;  3HOV G;  2WLJ A;  1V54 C;  1V54 B;  2ABJ A;  3ZS8 C;  5JVD A;  1XMQ B;  5BMV F;  4DR1 O;  1E1Q G;  2FB5 A;  1DK1 A;  3PJS K;  2CFM A;  3R5H A;  5B66 Z;  4A3C G;  3GWO A;  1PK8 A;  3KKY A;  3CJH B;  3Q1K A;  3ABL B;  3ABL C;  2DPJ A;  5IYD O;  4K35 A;  2OLS A;  1WA8 A;  3RBZ A;  2CH7 A;  4ED6 A;  4TV9 A;  3AX6 A;  3W5O A;  3LDE A;  4MTO A;  3GIL A;  3J80 N;  2J9G A;  3GB8 B;  5IWA H;  2BSK B;  2V59 A;  4PI2 A;  2WAM A;  5HBR B;  4J9N A;  2R87 A;  4JI0 O;  5KFQ A;  3JAM N;  4H33 A;  2MCT A;  4I5S A;  2ZGI A;  5KFH A;  3JRW A;  4JXU A;  5LMU H;  1GYF A;  1GM7 A;  2VS0 A;  5BY1 A;  2W6J G;  3OMI B;  1BGW A;  4FLY A;  1K4D C;  5GTI Z;  3CCM V;  3CVZ A;  2CKZ B;  3P3N A;  3HKD B;  4A2B A;  4BY7 G;  1YIT V;  4DV6 B;  3UCS C;  1S5H C;  3BG5 A;  4D6T H;  3T1Y B;  2DN9 A;  2IBK A;  3FB6 C;  1Z2O X;  4LF4 H;  3KRE A;  1RK6 A;  3J7A U;  3OGI B;  4PZ8 A;  4Q4D A;  3APO A;  3C3T A;  3QO7 A;  1IBM O;  2JEX A;  1S68 A;  4FM9 A;  1K1S A;  3CYO A;  5JJJ B;  1PD3 A;  5KFD A;  5KT3 A;  1Q7Y W;  1F4N A;  2KG7 A;  2ZIO A;  4IIJ F;  3H01 A;  2UXB H;  5CA1 A;  2EUL A;  3MR2 A;  2WDT A;  5F9L A;  1E4F T;  2Q7D A;  3PW0 A;  1M57 B;  1M57 C;  5H5N A;  5ITZ B;  4FLV A;  2DYR C;  2DYR B;  2AU0 A;  2JEG A;  2XAF A;  5CA1 F;  3HO8 A;  2JGU A;  4QNH B;  1M1K W;  3U10 A;  4JV5 H;  1H2L A;  2JJ1 G;  3JD0 A;  4F4W A;  1K9M W;  4JI7 O;  2OT5 A;  3RFC A;  3J80 W;  2F23 A;  2QJ1 A;  3DTU B;  4J7K A;  3H0G A;  5KX5 B;  1HNX O;  2JA5 G;  2ZDI C;  4FFK A;  3CCR V;  5BR8 B;  4JI7 B;  3K5M A;  5FD6 A;  3TET A;  4KP4 A;  5FNV A;  3FKS G;  4DR5 O;  4HN2 A;  2DQ0 A;  3ZMS A;  3QWU A;  2IJK A;  1S72 V;  3KAK A;  2X5R A;  4JI4 H;  3CSX A;  4ECX A;  1LUW A;  1XK5 A;  4IRD A;  4PDV A;  3NR7 A;  3SE7 A;  2A1H A;  3QTC A;  2HHH O;  4X66 O;  3L75 H;  2NLJ C;  4JAU A;  3O65 A;  4MVZ A;  2XCP A;  4UV8 A;  5EYP B;  2UVU A;  3M9O B;  5K3W A;  1AB3 A;  1EZ1 A;  2ZIN A;  2P0A A;  5KG1 A;  2WLN A;  4A3K G;  3G6B A;  4J80 A;  3ZHV A;  2R8H A;  4KHP B;  3T4Z A;  2BQU A;  4UCS A;  4YHH O;  3CSW A;  4M0J A;  2YXY A;  1H8H G;  3OEE G;  1SA0 B;  4C5C A;  4A2A A;  3GV7 B;  2JA6 A;  3CC7 V;  1VKZ A;  2OH2 A;  1TWF A;  4OPA A;  4GT1 A;  1BNC A;  1K33 A;  3WB0 A;  4ED3 A;  3R23 A;  2G38 A;  2E5L B;  2DLN A;  3TQ1 A;  1SQG A;  5EBM C;  4LH7 A;  5LGU A;  1ULZ A;  1R6K A;  1RP3 B;  3DC5 A;  4XYL B;  1Y76 A;  2ZDG A;  4FM1 A;  4IYI A;  2ASD A;  3IAY A;  3CEB A;  1RSO A;  1NJI W;  5LA6 B;  4EGQ A;  1ZSP A;  2JA6 G;  4ECZ A;  2OYQ A;  4BW5 A;  1N0J A;  2DAA A;  5FLX N;  3N2K A;  4J42 A;  4TQS A;  5HV6 A;  1N33 H;  1K97 A;  2Q68 A;  1VIB A;  3N27 A;  4X66 H;  1SFO A;  3VBB A;  3AK1 A;  5DG7 A;  1L0N H;  1FXH A;  3RV3 A;  1KP3 A;  2RQ6 A;  4RUF A;  1IOW A;  1JPX A;  1VAR A;  1I5X A;  1U97 A;  4K6N A;  4MTE A;  4GC6 A;  4MTD A;  3JAL A;  3JAT A;  1D5N A;  1VEW A;  4JV5 O;  2B1G A;  5LHI A;  3FMA A;  3WU2 Z;  2JS3 A;  4IR1 A;  2I80 A;  2FP4 B;  1R6T A;  1KJ8 A;  1AR1 B;  3E8H A;  4D7T A;  4O81 A;  1DLB A;  5IYC G;  4JI4 B;  2ZM6 B;  2V7Q G;  3HB9 A;  3ZJZ A;  2Y0S E;  2IJI A;  3ZRW B;  3N42 B;  5CA0 F;  1W59 A;  5KFK A;  4WBN F;  4DV7 H;  3OUF A;  3TXS A;  2R92 A;  4JI1 O;  5KFV A;  4XYM B;  4OX9 H;  1O75 A;  4FGR A;  4DR6 B;  4WBN A;  2Y0P A;  4O82 A;  3CXH F;  5J9P C;  2AGP A;  2CNV A;  2QTO A;  5D1O B;  5KT5 A;  2PZS A;  4KHP H;  2EJR A;  3BAC A;  1M4U A;  3K5O A;  1ZTE A;  3CCQ V;  5H6R A;  4CKB A;  4G27 B;  1KUQ A;  1KBL A;  2P06 A;  4PZ7 A;  4YXW G;  2X6B A;  5B1O A;  1KYO F;  1XMO B;  4HYO A;  4JPR A;  2W7P A;  3H1H H;  2ZM6 O;  1S5J A;  3BJY A;  4DR6 O;  1Y66 A;  2FTK A;  4WBN B;  2NVY A;  1WCM G;  3RUP A;  3T1C A;  3GV8 B;  4LNU B;  4LF8 B;  1GN3 A;  4K8X A;  1SC5 B;  1TUE B;  2F43 G;  3NUA A;  2Q2T A;  2PMZ A;  2J6S A;  2C2D A;  3RBD A;  1WB7 A;  1QU7 A;  1DV1 A;  4IHJ A;  2D3O W;  3CPW U;  4IWX A;  4RO2 A;  1F51 A;  2N05 A;  1KB9 F;  3TK1 A;  1W2B U;  2CW7 A;  4YJ2 A;  3OHB A;  3OAA G;  1YTF B;  5KFF A;  3RYF A;  4JI3 O;  4X20 B;  5BPF A;  2FKX A;  4IHJ F;  4J9Y B;  3N2G A;  1OCR B;  1OCR C;  4XDK A;  1B06 A;  1W96 A;  3OGC C;  3SPJ A;  4DL4 A;  1IBK B;  5J2U B;  5CA1 B;  3ZRV A;  4O7Y A;  1OZ0 A;  2KG7 B;  3G8C A;  5KHG A;  4EBD A;  4RUC A;  4QWD A;  3SNO A;  3RAQ A;  1N32 H;  4MV7 A;  3N2K B;  3RVZ A;  4QIW A;  5IYB G;  1GKF A;  3EYY A;  1AJP A;  2WSS G;  1YJ9 V;  1VQK V;  1OBD A;  2R93 A;  1ORQ C;  4LSA A;  3KHR A;  3GTJ A;  4X65 B;  2E5L O;  4H13 B;  4IYH A;  3CCU V;  5KHI A;  4Q4C A;  2GLT A;  3IG0 A;  5LOV F;  4Q20 A;  1IBL O;  3ZRS A;  3CHX A;  4O2A A;  3VQY A;  4WF9 V;  4C7U A;  1VMG A;  4X9Q A;  3SR2 C;  5A2Q N;  2ZNJ A;  4GLX A;  5KG3 A;  2HFE C;  1TUB A;  4JV0 A;  2R93 G;  4CS3 A;  2BSK A;  4O2A F;  2CNU A;  3P3P A;  4JI6 O;  4YY3 O;  2VRZ A;  3E35 A;  3FKI A;  1P49 A;  3QG5 A;  1XNR H;  2HP8 A;  5KFP A;  1SEI A;  1CS0 A;  4DO2 A;  3EPG A;  5IP7 G;  1N48 A;  3OUS A;  3W1G A;  3ZN0 A;  4J7Z A;  3T9A A;  3RFR A;  1AIL A;  3UYY A;  5D5Q A;  1KU9 A;  5T14 A;  4BWA A;  3G71 V;  3IC7 A;  4AQY O;  2WPD G;  2YCH A;  3L4K A;  4DV0 B;  1N34 O;  2F4V H;  1PV0 A;  1IXB A;  3S3X A;  1HR0 B;  3EHB B;  4UB8 Z;  3DXR B;  2NU9 B;  1NQT A;  2UU9 H;  2UVV A;  3F7V C;  4I50 B;  1KQS U;  4CBC A;  3ASO C;  3ASO B;  1YXB A;  3T9B A;  4UB6 Z;  4DK1 A;  4YHH H;  5IY5 B;  5IY5 C;  2GBO A;  4RZR A;  2ZDI A;  5LA6 A;  5KFG A;  3CCL V;  2C2A A;  3WB1 A;  1S77 D;  2PBZ A;  4ED8 A;  4C5A A;  5J2U F;  1WCM A;  2VQF O;  1NKD A;  4LFC O;  3I55 V;  4LF5 O;  1XNQ H;  1N36 B;  1H2N A;  3BY6 A;  4JV1 A;  3W7X A;  5J2U A;  3ASN C;  3ASN B;  2HIV A;  1MSD A;  2IP4 A;  4LFB O;  1PL4 A;  1JX9 A;  1AJQ A;  3RYI A;  3OUZ A;  1I1M A;  4P9O A;  2CUG A;  4X65 H;  2LW7 A;  1XEQ A;  3TY5 A;  4NXM B;  4J9M A;  3ZED A;  2ODM A;  3MWD A;  1QR9 A;  4KHP O;  4FPP A;  2FE3 A;  4QWE A;  4YR2 A;  2VQE H;  3T2M A;  3GTO A;  4DV4 B;  1JMK C;  3VPD A;  4TV9 F;  5D5P A;  3QNE A;  3GTQ A;  1I6U A;  5TIS Z;  4TQF A;  5KFE A;  1Q43 A;  4F6R A;  2P7T C;  4U3F H;  5I47 A;  2L6L A;  1VQ5 V;  5DG8 A;  2BCC H;  1N36 O;  3X2Q C;  3X2Q B;  3K58 A;  4R50 A;  2CZG A;  1WAZ A;  3PR5 B;  1LR1 A;  2FLN A;  1IVS A;  3CRA A;  4EG0 A;  3GWK C;  5JQG A;  2V4Q A;  2QSA A;  3JSN A;  4FFR A;  2FKL A;  4ED1 A;  4A3D G;  2Q2U A;  5L9X A;  2UUB H;  1P16 A;  3NBY B;  4DV6 H;  2Q0A A;  4FIP C; 
#chains in the Genus database with same CATH homology
 5JJE B;  4MV9 A;  4GKJ B;  2PY5 A;  3BRC A;  4X64 B;  4TV9 B;  2YI8 A;  2UXD B;  4LF9 H;  2W57 A;  1I94 H;  2P22 C;  2HHH B;  4Q0Y A;  2RGR A;  1X4T A;  4FFB B;  4ZOL B;  4K0K H;  3SJB C;  4LSX A;  4PI0 A;  5C8Y B;  5LMN B;  5LXT B;  4J0M A;  2ZM6 H;  4FLU A;  3JAL B;  3JAT B;  2VOB A;  4DR2 H;  3KXY T;  3A2F A;  3RTX A;  5KMG A;  4LR3 A;  3RWR D;  4X62 B;  4BWS C;  4B3R B;  5LOV A;  1QQC A;  3SJA C;  3ETQ A;  2E3C A;  4FVM A;  4LF4 B;  3CB2 A;  4YHH B;  1FVI A;  2BTO A;  4OX9 B;  4ZHQ A;  4CS4 A;  3HKC A;  4JI8 B;  1X9N A;  4DR4 B;  2R9A A;  2HIX A;  3F8N A;  1N34 B;  2VUG A;  4DV7 B;  2YXL A;  2XHB A;  4JI3 H;  1N32 B;  3N40 P;  2JS5 A;  4O4H B;  1XNQ B;  1AN7 A;  2PUS A;  4JI7 H;  1Z2P X;  1Q8I A;  4D7S A;  2UXB B;  2YIA A;  1O9G A;  5A2Q W;  3KAL A;  2HVQ A;  4JI2 H;  4JI1 H;  5CB4 A;  3MAQ A;  5LOV B;  3RJ0 A;  2CAZ C;  2VWJ A;  4I9Q A;  5D1P A;  4U3J B;  4CH4 A;  3BPZ A;  2VQF B;  3K3V A;  1WN7 A;  3RIZ A;  1TVK A;  1SA0 A;  3ZS8 C;  5JVD A;  4GYC B;  1XMQ B;  4DV2 H;  4FFB A;  4ZOL A;  3JAM W;  1VF7 A;  4DR7 B;  2CFM A;  5IYZ A;  2HVR A;  4AQY H;  4GKK B;  2VQE B;  4M7E A;  1BJT A;  4LF7 B;  4TV9 A;  5EYP A;  3OTO B;  3W5O A;  1FFX A;  4YJ3 A;  4JI6 B;  1Q3E A;  2UUC H;  4DUZ B;  3RYH A;  3HKD A;  3GB8 B;  5IWA H;  5IJ0 A;  3THO A;  4X1Y A;  1XQ8 A;  4RAZ A;  4PI2 A;  4UCO A;  2R72 A;  4X66 B;  1XI1 A;  3HKB A;  5LP6 C;  5LP6 B;  3BA8 A;  4X1K A;  2HEP A;  4X1K B;  1NT2 B;  2MCT A;  5LMU H;  1GYF A;  2VQF H;  3E22 B;  4X62 H;  1BGW A;  4FLY A;  5CB4 B;  3GDE A;  1TAE A;  1XHX A;  3CVZ A;  5FNV B;  4FLW A;  3FFQ A;  3HKD B;  4A2B A;  4I4T A;  4B08 A;  4DK0 A;  3UQ8 A;  4DV6 B;  4K8Z A;  2IM9 A;  4RAY A;  4LFB H;  4LF5 B;  4PDB A;  3T1Y B;  4CS2 A;  1Z2O X;  4LF4 H;  4DRX A;  4DV3 H;  4DRF A;  4LF9 B;  2UXD H;  5IYZ B;  3HKE A;  4RB1 A;  4PZ8 A;  1S68 A;  4FM9 A;  1Z2N X;  5JJJ B;  4NVP A;  3UT5 B;  3K57 A;  2ZIO A;  4U3J A;  1H2S B;  2UXB H;  2R70 A;  3MWM A;  5CA1 A;  4O4J B;  4RB0 A;  1XMQ H;  4CH5 A;  2F1M A;  4JI2 B;  2WDT A;  3UT5 A;  4HNA B;  1E4F T;  1M93 A;  4FLV A;  4TOI A;  5ITZ B;  4RB2 C;  4DV0 H;  1HW7 A;  2YIB A;  2JGU A;  4YJ2 B;  3U10 A;  2P5O A;  4JV5 H;  1SKV A;  4X64 H;  4DRX B;  5JCO A;  3WB2 A;  3J80 W;  2QJ1 A;  3ICX A;  5KX5 B;  4AQY B;  5BR8 B;  4B3M H;  4JI7 B;  3K5M A;  2ZCE A;  4I4T B;  5FD6 A;  2V4D A;  5FNV A;  4I50 A;  3M7M X;  5LL6 b;  3QWU A;  4R7R A;  5JQG B;  4X1I A;  1HR0 H;  3KAK A;  4JI4 H;  3CSX A;  2ZIM A;  4RZQ A;  3HKB B;  5LP6 A;  1XK5 A;  1T5E A;  2ZJT A;  1O9H A;  5EZY B;  4X20 A;  5BMV B;  1CKN A;  3QTC A;  1I7F A;  5FD5 A;  4UCR A;  3HXL A;  4TUY A;  3TY9 A;  5JH7 A;  1N34 H;  2Q7H A;  5EYP B;  3KYH C;  3H20 A;  1E4G T;  3SJC C;  1WNS A;  4NXN H;  2ZIN A;  1N36 H;  4LFB B;  3N41 B;  4DUZ H;  3K59 A;  1ZHS A;  4KHP B;  1A0I A;  4UCS A;  5CA0 B;  3N43 B;  1HNZ H;  1TUB B;  1TGO A;  1TA8 A;  4EEQ A;  5IJ9 A;  3RR5 A;  1SA0 B;  5JVD B;  4A2A A;  1FJG B;  1M0W A;  5DIS C;  3VQX A;  2UUA H;  2CW8 A;  3RYI B;  2O03 A;  4FLZ A;  1HNX H;  3OTF A;  3JAR B;  4YY3 B;  4I55 A;  3WB0 A;  2E5L B;  4EQ5 A;  5KHH A;  1SQG A;  4X1I B;  4DV4 H;  4LH7 A;  2PYL A;  4F6R B;  4B3R H;  2BTQ A;  4GKJ H;  1ZHQ A;  4LF7 H;  4FM1 A;  4B3S H;  3QF7 A;  3IAY A;  4LFA B;  1RSO A;  5LA6 B;  4DV5 B;  1Z5V A;  3L4J A;  4DR1 H;  2OYQ A;  1HNW H;  3KAJ A;  4JYA B;  5KX5 A;  3N2K A;  4JI8 H;  1N33 H;  1P8L A;  4X66 H;  1YEW A;  5KHJ A;  2UXC H;  4HBN A;  4EB6 A;  3JAK A;  2RQ6 A;  4LF6 B;  3L2P A;  5KMG B;  4MTE A;  4MTD A;  3J7A K;  3JAL A;  3JAT A;  5K1P A;  3FMA A;  5J2T A;  2F93 B;  5GON A;  4O4I A;  1L8D A;  4D7T A;  4JI4 B;  2ZM6 B;  2E5L H;  2QM4 A;  2KSW A;  5KHK A;  5LYJ A;  3N42 B;  4EB6 B;  4JI0 H;  4FLT A;  4Q6G A;  5EIB D;  4JI5 B;  4IHJ B;  3N6X A;  2UUB B;  4DV7 H;  1JJO A;  4ZIB A;  4DR3 B;  4ZI7 A;  4DV5 H;  4OX9 H;  1O75 A;  1M5I A;  2PYJ A;  4JYA H;  4DR6 B;  1JFF B;  3PN1 A;  4WBN A;  4DUY B;  1L2Z A;  4JI6 H;  4O4L B;  4TV8 B;  5D1O B;  1MZB A;  2VPS A;  2HHH H;  2PZS A;  4CC5 A;  1Z5W A;  4KHP H;  1HNX B;  3SGI A;  4UCT A;  2PGG A;  1M4U A;  3GJX B;  2HVS A;  4K0K B;  3K5O A;  4RB3 C;  2WYO A;  1IBM H;  4PZ7 A;  5D1O A;  1XMO B;  5CA0 A;  1S5J A;  4EFB A;  4WBN B;  4LNU B;  2Q7E A;  4LF8 B;  4K8X A;  4ZI7 B;  1M0T A;  2Q2T A;  3NBZ B;  3RGZ A;  2JVD A;  1XNR B;  3TY8 A;  4IHJ A;  4IAJ A;  5LYJ B;  2KKW A;  4O2A B;  2CW7 A;  2VWK A;  4YJ2 A;  3NC0 B;  4DV2 B;  3RYF A;  5IWA B;  4X20 B;  3N2G A;  3N2G B;  3LNN A;  5J2T B;  1B04 A;  1S03 G;  4UCU A;  4DR7 H;  3RYF B;  3T1H B;  1IBK B;  2F4V B;  5J2U B;  5CA1 B;  4DV1 H;  5FPR A;  1CKO A;  1D5A A;  3JAK B;  4KL1 A;  4B3T H;  4BW9 A;  5KHG A;  2YIB D;  4NXN B;  3RGX A;  1N32 H;  2YI9 A;  3N2K B;  4EFE A;  4MV7 A;  3JAS A;  3JAS B;  4DR1 B;  5IT9 W;  4DUY H;  3EYY A;  1DGS A;  3OTO H;  4I7H A;  1ZAU A;  3HKC B;  4LSA A;  4DV3 B;  4DR5 B;  4X65 B;  4DR6 H;  4I55 B;  5KHI A;  2EX3 A;  3IG0 A;  1XDN A;  3JAW B;  4APM A;  3JAR A;  4FLX A;  4O4J A;  3E22 A;  3U11 A;  3CHX A;  4O2A A;  5LXT A;  3VQY A;  4DV1 B;  1WPB A;  4UFZ A;  4LF5 H;  1V9P A;  3SR2 C;  4GKK H;  5IJ9 B;  4GLX A;  2ZNJ A;  1TUB A;  4CS3 A;  1JFF A;  1IBM B;  3RYH B;  1J5E B;  4LNU A;  1IBL B;  2PTM A;  1FFX B;  4YJ3 B;  4JV5 B;  5FLX W;  4B3M B;  3J81 W;  1P49 A;  3QG5 A;  1XNR H;  4E6N A;  2RGV A;  1SEI A;  4TUY B;  4LF6 H;  1G6U A;  3W1G A;  3BHP A;  2WE6 A;  3RFR A;  3DF7 A;  4CC6 A;  5D5Q A;  5BMV A;  1KU9 A;  1CKN B;  4BWA A;  3B2E E;  5FPO A;  5GON B;  4LFC B;  3N44 B;  2YCH A;  5EZY A;  3U0Z A;  3L4K A;  3JAW A;  1Q5O A;  4JI1 B;  4DV0 B;  2F4V H;  4L8J A;  4FM2 A;  1TVK B;  3C0F B;  1HR0 B;  2ZNI A;  1VS0 A;  2UU9 H;  4JI0 B;  4NXM H;  2F66 C;  1XMO H;  3LML A;  4I50 B;  2XIG A;  4X1Y B;  1XHZ A;  5IJ0 B;  4UCV A;  4DK1 A;  2RJZ A;  4YHH H;  5BR8 H;  4IIJ B;  4LF8 H;  3DSQ A;  4O4H A;  4B3T B;  1J5E H;  5LA6 A;  3VQV A;  4DR4 H;  3WB1 A;  4AHC A;  3RF2 A;  2BTQ B;  4LFA H;  1HNZ B;  3VNN A;  1WH2 A;  5JCO C;  3BAB A;  1XNQ H;  1N36 B;  1N33 B;  5J2U A;  4O4I B;  4LMY A;  2F95 B;  3K5N A;  2UUA B;  2HIV A;  1SYX B;  5ITZ A;  2HGS A;  3VQW A;  3RYI A;  4FM0 A;  4HNA A;  5K1X A;  3S24 A;  5LMN H;  5JJN B;  3RYC A;  3RYC B;  4X65 H;  4DR5 H;  3T1H H;  1IBK H;  4DR2 B;  5C8Y A;  3TY5 A;  4NXM B;  3BA9 A;  3ZED A;  4B3S B;  3HKE B;  2FE3 A;  2VQE H;  4PZ6 A;  4DV4 B;  1JMK C;  2OWO A;  3W1B A;  5EOY A;  4TQD A;  4JI5 H;  3K5L A;  1QHT A;  5D5P A;  1I6U A;  4TQF A;  3T1Y H;  1Q43 A;  4F6R A;  4DR3 H;  4JI3 B;  4ZHQ B;  5JH7 B;  1IBL H;  4IIJ A;  1I94 B;  4LH6 A;  4ETS A;  2Q7G A;  1KMI Z;  3M4I A;  3K58 A;  2UXC B;  4CH6 A;  3BAA A;  1FJG H;  4CH3 A;  4O2B B;  5EIB C;  5LMU B;  4AIL C;  4O2B A;  4LFC H;  1FKA H;  5JQG A;  4O4L A;  4TV8 A;  1SQF A;  2GV9 A;  4YY3 H;  3RGB A;  3JSN A;  2Q2U A;  3JSL A;  4PHZ A;  1P16 A;  2UUB H;  1CKM A;  3NBY B;  4DV6 H;  2Q0A A;  1HNW B;  2UU9 B;  2UUC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...