3BAAA

Structural basis for the inhibition of bacterial nad+ dependent dna ligase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
312
structure length
312
Chain Sequence
LTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Inhibition of Bacterial NAD+ Dependent DNA Ligase
rcsb
source organism Enterococcus faecalis
molecule tags Ligase
molecule keywords DNA ligase
total genus 103
structure length 312
sequence length 312
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3baaA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3baaA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3baaA02
4LFAB 4B3MB 4UCUA 1HR0B 4LH6A 1XNRB 1P8LA 1IBLB 2CFMA 1CKOA 1HNWB 1N32B 1TAEA 5DISC 5FPRA 4AQYB 4JV5B 4PZ7A 3OTOB 2UUCB 5FPOA 1XMQB 3W1GA 4LF7B 1XDNA 4DV3B 3NBYB 3S24A 3BA8A 4DR6B 3UQ8A 4DV1B 4YY3B 4DV7B 4DR5B 4JI1B 4DV4B 4JI0B 1FJGB 1A0IA 3GDEA 5D1OB 4E6NA 3W5OA 2UXDB 4DRFA 3NC0B 4JYAB 4EFEA 5LMNB 3PN1A 2E5LB 4DR2B 4UCSA 4JI4B 2UXCB 1CKNB 4DR4B 1CKNA 3GJXB 5IWAB 1CKMA 1XK5A 1ZAUA 4DV0B 4X65B 4KHPB 4NXMB 1N33B 4JI6B 2UXBB 3GB8B 4UCTA 2VQEB 5LMUB 4LF8B 4EQ5A 2OWOA 4JI7B 4EEQA 4GKKB 2VQFB 4UFZA 1XMOB 1XNQB 3TY9A 4YHHB 2HIVA 3NBZB 4UCVA 4LFBB 1VS0A 4X66B 4B3SB 2HVRA 1I94B 2HVQA 4DR1B 4LF5B 2VUGA 4EFBA 4TOIA 3L2PA 2HIXA 3T1YB 4NXNB 1B04A 4JI8B 1J5EB 3KYHC 4PZ6A 4B3TB 4JI2B 4PZ8A 3W1BA 1P16A 1X9NA 4DR3B 4LF4B 4CC6A 3BABA 4GKJB 3TY5A 4DUYB 4DV5B 4DV2B 4DUZB 3JSLA 1S68A 4UCOA 1FVIA 4DV6B 3SGIA 2Q2UA 3BA9A 3T1HB 3RR5A 3RTXA 2Q2TA 4JI3B 1DGSA 2UUAB 4LF9B 1HNZB 5D1PA 4LF6B 1N34B 4X64B 2ZM6B 4K0KB 3VNNA 4OX9B 4GLXA 3QWUA 1V9PA 4UCRA 4JI5B 4DR7B 2HVSA 1IBKB 2UUBB 2UU9B 4B3RB 1IBMB 3TY8A 3BAAA 1HNXB 4LFCB 1TA8A 1N36B 2HHHB 5D1OA 4X62B 4CC5A 5BR8B 3JSNA 2F4VB 4LH7A
chains in the Genus database with same CATH superfamily
1EN6A 1N4CA 3M4IA 3PW5A 5KG0A 2HVJC 4CKCA 4ED3A 4DYLA 4YJ2F 1Q5OA 1V55B 3TGUH 3ASOB 2JRIA 4O7VA 1GKFA 2A7WA 1N32O 3B77A 3HKZE 3KTMA 2WWWA 4J9ZB 3U11A 4YHHO 4QGPA 4DR6B 1P4RA 3OHAA 4OPHA 1KC7A 1NTZH 4DV7B 4DR5B 3T1HO 3CXCU 5FL7G 1UC8A 1M57B 2GPWA 1FAFA 4LF8H 1CXZB 3ZHVA 1IBKO 2NNUA 1I08A 1MOFA 3JCZA 4LMYA 5LGNA 2HHHO 1O75A 5DAAA 2KSDA 3G80A 2LQTA 3K5HA 3K5NA 2ASLA 4N21A 4QJFB 5IWAB 1S0NA 2EILB 3OTFA 3QQMA 1EKPA 5DN6G 5EWFA 4RUAA 2VQDA 2FLPA 4TV8F 3PW4A 4KHPH 1WCMG 1IXMA 3F7VC 2ADPA 1GO3F 2CDYA 2H8PC 2Q7GA 5C8YA 4Q45A 3H3VH 5L3FA 1VMGA 2GTSA 1GN6A 5LGTA 4J0MA 3FYEB 3BJYA 1PP9H 1X4TA 2NN4A 1PV0A 4DK0A 1J5EH 5B5EZ 1Q3EA 3T5JA 5DQIA 3MFHA 4NXNO 2DWCA 2CTRA 2VRZA 4YAJB 2XT9A 1RM1B 4BR6A 4JI8B 3SPHA 1BHBA 5ITZA 1V51A 2YIBD 3VBBA 3W7WA 3RYFB 4DR3B 1VQ7V 4LP8A 2KB1A 4FLYA 3MR5A 3H9VA 3OEHG 1FKAO 5C3EG 4A3JG 3E89A 1RYSA 4DUYB 1PPJH 2JGUA 5JQGA 4QPKA 2QM4A 1Q6HA 5KFTA 5HBRB 1KJIA 3J80W 2QWQB 4LWSB 4C7UA 3QO7A 5KFZA 4DL4A 2R87A 2Q67A 2XOKG 2QE7G 5CA1F 4TUYA 5F9NA 4PA4A 4APMA 3JD3A 2R9AA 2EILC 3ZHUA 3H1KH 3ETEA 3QWUA 5DM6V 3JAKA 4LFBO 3BFRA 2XHBA 1Y76B 5LXTB 4B3SO 2RQ6A 3BAAA 4MV8A 4CBCA 2CTQA 1YDXA 4FMTA 2HGWA 2XD4A 3AEIA 3MHSC 1KUTA 1NR7A 3TXQA 4JXUA 5DQGA 2NVYA 1PL4A 5CA0A 2ZE8A 5I5XA 5FNVA 2X6BA 1FXHA 3VQWA 4TUYF 5FD5A 4JZ2A 4O2AA 3OW2U 4FFMA 4I7HA 4FJCC 3THOA 2O57A 5FPRA 4IAJA 4ZIBA 2JGDB 1N34O 3ASOC 4PA3A 5EK0A 3HT5A 4O84A 2JEFA 1VQ5V 3CRCA 3ABKC 3FFQA 3ZHTA 3T1YO 4DV3B 4X88A 4A3LG 1OWTA 2NLJC 3APQA 2UXDO 2WLHA 3PZPA 2ZE5A 3TXSA 1FJGB 3GDEA 4ECYA 4IIJA 4KP4A 4PDMA 4J9LA 4FLVA 3CHXA 4MSWC 4XDLA 4DRFA 4I55B 2CKZB 1YJNV 3H0GG 1ZUQA 4WBNB 2HG5C 1US6A 3GIMA 3WWIA 4LR3A 1CKNB 2E5LH 1ORQC 5LYJF 5KFDA 4TVIA 5C44G 1IBLH 3CJHB 3LDCA 2PI4A 3N40P 3K58A 5KT5A 5KX5A 3JATA 1QU7A 4IIJF 1QCEA 1VF7A 2WLKA 3GB8B 1LUWA 2IP4A 3N41B 4BIZA 1QR8A 4R8UB 2JEJA 2HG8A 3ASNC 3CCUV 2LW1A 1MSWD 3RGXA 5JVDA 4ZI7F 2B5UA 3ABMB 4ME6A 3KALA 5E25A 3TY9A 3NBZB 1B33N 4LFBB 4D7TA 3R66A 3W7XA 2K1EA 4NXMO 2K9PA 1BGYH 3N42B 3ABKB 2VUGA 1S77D 3FKIG 2YYAA 5HFMA 2NR5A 2PGGA 1QQCA 1M4UA 4RB0A 4JI2B 1AP5A 5KFQA 3R5HA 2BTQA 1OCRC 3Q4HB 4LWSA 1YTFD 3T4DA 4EG0A 4ETSA 4RB1A 3B2EE 5IYZA 1I7LA 4TQDA 4BY1G 4X66O 2PBZA 4DV2B 4GX5A 4PJ0Z 4XBFA 2ZE6A 1S10A 3DGEA 3JASA 4DR1H 4LF5H 2QGNA 5L3GA 3DTUB 3RBEA 3A2FA 3KHHA 1XMOH 3HO8A 2R7LA 1D2DA 1AR1B 1AJPA 2OTLV 1E4GT 1VQ9V 2DMXA 2UXCO 4I50F 2V4DA 4K0KB 5BWXA 3CD6V 3CCQV 1AJNA 4JI5B 2LGWA 3KZIZ 1AI4A 4WBNA 1AB3A 3N2GA 4O4JA 3WWJA 4HQ6A 1YXBA 2N05A 3G6EV 1TA8A 5FNVB 4IL6Z 1N36B 1EBOA 4X62B 5H2FZ 2HHHB 2HDKA 4CS2A 2UXDH 4WFAV 2F4VB 1FYJA 2DJVA 5IT9N 1DV1A 5BXZA 2EIKB 3ZMUA 1XNRH 2OT5A 2LFRA 3GVMA 5EZYF 4Q4CA 4DL3A 2YRWA 1H38A 1HR0B 4DAAA 2QYZA 2HHFA 1W96A 3OTOH 4MTDA 1WB7A 3VQVA 1SQBH 5GTHZ 1BT8A 1PM9A 3RB4A 4ECZA 4JTDB 4FM9A 2YXHA 3CSXA 2A9HA 2CZGA 1KJQA 2AGOA 3RWRD 1WLEA 2I87A 2AU0A 2QR4A 1DV2A 1R9TA 2GLTA 3N2GB 4O4JB 1R3IC 3H4DA 5KFYA 1PNLA 4O3QA 1NTKH 3C3TA 2W8LA 4R6ZA 2BTQB 2G38A 3L4JA 3FB5C 4DR6H 2BOCC 4YBZB 1E4EA 4QPJA 1ZAUA 2VWKA 1V55C 3ZRWA 1QBZA 1Y74B 2AQ4A 5JH7F 2RDJA 2Y0IA 4JI6H 2F95B 1THZA 3UT5A 4EQ5A 4BBRG 2X6CA 3MWMA 1NTMH 1UFIA 4TV9B 1VQLV 1I2LA 1A9XA 1S9FA 1AN7A 4MV9A 4GKKO 4HNUA 1FS0G 5I5VA 5CBHA 5LP6F 1K8AW 4M9UA 4B3SB 1RPRA 3Q4HA 1I94B 1ZLZA 2COIA 4ZOLB 1W93A 3X2QB 2ILMA 1BGWA 4ED6A 2D2CB 2W8KA 4L8JA 4BWAA 2GPSA 3OUFA 4HNTA 4FU0A 3RB6A 4FM0A 5FD6A 1JIHA 4A2BA 3Q1KA 4NZOA 4CH4A 5I5SA 2HHFB 2HJWA 1H2LA 2CGNA 4B3TH 3P3NA 1R6NA 1KJ9A 1Q86W 2CQYA 1IBMH 5CAEB 4HAMA 2DYSC 4JGSA 2ZDGA 4KUMA 5AG2A 1YHQV 3OUZA 5LGUA 4U7CA 3CC4V 2R92G 4LF9B 2L35A 4O4LA 2FK1A 4DV3H 2W9AA 4UCRA 3HOVG 3ETJA 4J9NA 1HNXH 1QVGU 5LL6b 2CNVA 4CH3A 4K0KH 3KHRA 2LP7A 2YXYA 1EHIA 4ASUG 4JYBA 4EGQA 2GHYA 4CC5A 5BR8B 4QIWA 2GDSA 2DN9A 3MR3A 3C0FB 1VEWA 2EULA 2LGQA 4HNAA 4UB6Z 4TT3G 4YR3A 1OBGA 4PI2A 1D5NA 2OLSA 5JUMA 3TJTA 2WLMA 3G8DA 2C2AA 3ZRWB 2HLDG 1Y76A 5C8YF 3B09A 4OXSA 4O82A 3BQ1A 1BSMA 2ODMA 4DRXB 3G4SV 3FDSA 4YB8B 2J6SA 1XMQB 3BG5A 5IYDO 2AHZA 4LF7B 1K5QA 4G28B 4UVAA 2RDIA 2P6JA 4AQYH 3HKEB 3WB1A 3MWDA 3IFXA 4ZOLA 5KG5A 4DV6O 2W6OA 1OCZB 4O3PA 4GYCB 3B8NA 4C2MA 5D1OB 3SE7A 4C5AA 3OGCC 2UXDB 4LFBH 4EYHB 4FZ1A 1EUDB 4Q44A 1GLVA 4MVUA 3GTPA 3MFIA 1B6QA 2WAMA 4QWCA 2EIMB 3BRCA 1Q6UA 4DR2B 4JI4B 4X65H 5KT7A 4PHZA 5LP6A 4FFLA 4BBSG 1XK5A 1JPXA 4DR3H 4LSXA 3OFNG 3H1JH 2IH1C 1BQZA 1F23A 4H0LB 4LF6O 4ECQA 3CCRV 2UVRA 4XYLB 4J9KA 4DV2H 1N33H 5BWTA 3ZHSA 2FP4B 5LHGA 2FMAA 3K3VA 2X5RA 5LXTF 3HKDB 4G27B 5A2QW 4X66H 3ASNB 4CMFA 2EINB 2IJHA 4GX0A 2DLNA 2XIGA 5IP9G 2AGAA 2Q8VA 1SQFA 5B1OA 2Z02A 4TV8B 3UO2A 3T1HH 3JATB 3OGIB 3E8GA 4YHHH 1S5LZ 1BL8A 1H2GA 1ZX3A 3OAAG 4ZHQF 4O3NA 1JMKC 3ORRA 1Y4MA 3CC7V 1ZQ7A 4JI3O 1VQ8V 1X9NA 2YW2A 4JUZA 2BR0A 5F9LA 1JLLB 2PUSA 2RCVA 1ENVA 1DTOA 1K7DA 5B66Z 3GV5B 1VF5B 1G4YB 3AG7A 3JYCA 3HKCB 4WFHA 1M57C 5KFMA 5KMGA 2PYJA 4FLUA 3G6BA 4GKKH 2EIMC 4F50A 4IYIA 1AROP 3DSQA 2Q2TA 2UXXA 5KT2A 2R92A 5KLVH 4ECSA 2R8KA 3KAJA 4NZMA 2Q7EA 2B63G 2UUBH 3VNNA 4OX9B 2OCHA 3JALB 3GILA 3PW2A 1IVSA 1OCZC 4DV5H 5DGAA 2EX3A 3MDSA 3FKSG 3DTFA 2ZXWC 2WB1E 4ED7A 3RBZA 1Z5VA 2KKWA 3VQYA 4ZHQA 1HW7A 2VUMA 4IIJB 4Q4DA 3UCSC 1GO3E 3HOYG 3RYHA 2ZKOA 2CW7A 5E79Z 1OCCB 3U10A 1SS3A 1S0MA 2WYOA 1M56B 2ZR3A 3U54A 2HP8A 2AZ0A 4DW1A 1N32B 5IYBG 1I94O 1FFXB 2Q7HA 3CRMA 1I5YA 1KP2A 4NKGB 1SRYA 5GTIZ 4DV4H 3VPCA 1M0TA 3RIZA 5KFCA 4FIPC 4O4IA 4Q6GA 5H6QA 1NZ6A 2M6YA 3H1HH 5J2TB 1DK1A 2P4VA 4HNVA 3SI8A 2H3OA 4DR4H 4NB5A 3BACA 3B40A 3RUPA 5CB4F 3U9SA 5IWAO 4ED8A 2R84A 4ZOLF 1AUXA 1JVMA 2XGPA 2DPJA 3K0DA 2MW2B 4BIUA 4GKJH 1J95A 4UCTA 2Z0AA 3SDLA 5LP6C 3U0GA 2WDTA 2WLIA 2HFEC 4JTCB 5K2MA 1Z2NX 4LF4H 2DABA 4HZ3A 3E5NA 3MHHC 1XMOB 2VQEH 1FKAH 2DW4A 2GUZA 3TEKA 1ZWIC 4UCVA 4X1YB 1ZL8A 3ZEDA 4FM2A 4IYHA 1PD3A 2PVPA 1Y74A 2XAJA 5EZYA 3RGBA 5JWPA 3K5OA 4O4HA 3K5LA 1V54C 4IHJB 2R8IA 5KHIA 4J42A 1SYXB 1P16A 1WN7A 2W9BA 1EZJA 3WG7B 4CC6A 2P0AA 3RB3A 5H9CA 2QTOA 3E8HA 2PTMA 4DV5B 3WWHA 3DC6A 3AG4C 1BMFG 3HKZA 5JQGB 4ECVA 3LDEA 4F6EA 2FL4A 4FM1A 4B3SH 1NI8A 1R3KC 2HGSA 4J9RA 3P30A 1WPXA 4UUGA 1LNQA 4FFNA 3GIJA 3RR5A 4A3FG 2R8GA 1HNWH 4UB8Z 2UUCH 5IJ9A 2IBKA 4X64B 2ZM6B 4JI5O 1FXKC 1OJHA 2XNDG 3AG1C 4O4JF 3SYAA 2UUAO 2B9ZA 4FLZA 1IBKB 2UUBB 3DF7A 3UO3A 1IBMB 2IH3C 4O7RA 1S97A 2BSKA 2AW9A 2C35B 2YXLA 5KFUA 3CB2A 1BQ0A 4J7ZA 1ET0A 3JRXA 5BYAA 1R3JC 1TUEB 2FK2A 2W0FC 1XHZA 3PVXA 2QKSA 1DF4A 1Z5WA 4AYBE 2PN1A 1WB8A 3HKEA 1F4MA 1H2NA 3HKBB 4FK5C 3RYCB 1P8LA 3KCXA 1XI1A 1EFRG 5BZBA 5IYZF 4JV5B 5IT9W 1S5JA 4OX9O 2IBZH 5JH7A 4X1YA 2P06A 2Q73A 2YSUB 4A2AA 2ZDHA 3JAMN 1VAJA 5LA6B 4FGRA 3T9DA 4RO2A 3CS5A 2QWPB 2ETNA 1TUBB 3OR7C 4FLTA 3TETA 4DL2A 1QLNA 4QE9A 5H6RA 1H2MA 3Q8RB 3ZX6A 5BMVF 1FJGH 3FAVA 2UXCH 1TWCA 1LR1A 3RGZA 2CNQA 4UVCA 2OIEA 2VUMG 5LHIA 2E2HA 1CKNA 4CS4A 4RQFA 5KFIA 1B6SA 4J7JA 3CJHA 1JFFA 4O81A 1NH2D 5KG7A 2Y0PA 3CRRA 4TV8A 3L75H 2IA6A 3CE2A 1FJGO 1Q90D 4YIPA 5L1KA 5CA3A 5JVDB 1VQ4V 1I7NA 2C2EA 1R1BA 3GLKA 3HOXG 4DV6H 2XAFA 4DL6A 3ABUA 3M9OB 3OMAB 2W9BB 2W6NA 4G3IA 3KHGA 3CRQA 3L2PA 4X20A 4MAMA 1SA0B 3TW7A 2YEVB 1K4CC 2E3CA 1SQPH 3QVNA 4ED1A 4I50A 4GKJB 4MA5A 4ED0A 5A2QN 1XREA 3K57A 3B8MA 3GIDA 3HB3B 4PELA 4CE5A 5D5PA 1AR5A 3SJAC 3ZN1A 5I60A 5BWVA 3N44B 2VS0A 1GYFA 1OHHG 3BVOA 2VPQA 4U7NA 4XDKA 2UUAB 2QWOB 2C2RA 1IX9A 2ZNIA 3OMIB 4Z2WA 4QJFA 1K1SA 4LF9H 2UU9H 3PO2G 2PMZA 2WLLB 1Y1WG 3LSSA 3JAWB 4DW0A 1H8EG 2JA6G 4U3FH 1GRJA 2DWEC 1MZEA 4MVQA 3FAVB 4UXNA 1CE8A 4P9OA 4DV4O 4JASA 1SERA 4AYBA 4DUZH 5DGBA 3T54A 4MV4A 1N48A 5K3WA 3J7AK 3HXLA 2FK3A 1K73W 1Y14B 1WR2A 1PKXA 4I50B 3W7SA 1Q43A 4F6RB 1HNWB 3J81N 1YCIA 4DV0O 2UUCB 3UZBA 5FPOA 3W1GA 3T9FA 5L3CA 4JAAA 3CCSV 3SR2C 4RUCA 3D36C 1PK8A 1RK5A 5LYJA 1T3NA 3PR5B 4JI0B 4E6NA 3MD0A 3W5OA 3UM7A 4DV2O 4B3RO 3JZFA 3KCYA 3NC0B 3OD4A 1K1QA 2VQEO 4PWQA 1W59A 1M90W 4MVSA 5JVLA 2QM7A 1FFXA 4FFRA 1KQSU 4TQSA 2Q6AA 4I0XB 3CRAA 2KG7A 1GH6A 3JRWA 2YIBA 5KFEA 5LA6F 2VWJA 5LMUH 4J41A 1K83A 2PMZE 4GZRB 1TWGA 4LF8B 2ZJTA 2EIKC 2FMLA 4PV1B 1Y1VA 1NR1A 2ATKC 4MS2A 4GKKB 3G6XA 1YVWA 4O7SA 2VPSA 2ASJA 4DL5A 1IBMO 3OEEG 2WLLA 1CEZA 4NXNH 3KXYT 2L6LA 2PF4E 5CN0A 2NU7B 2ADQB 2X0SA 1R6TA 1E4EB 2OIGA 4EYIB 4TUYB 5KKNB 4RCNA 5KT6A 2QKCA 4I4TF 4FBUA 1OCRB 2CGOA 3O65A 3N43B 1I2KA 5HV6A 5EBMC 2VR1A 4X1KB 3UT5B 2V4RA 2GSMB 4MTEA 1BCCH 4DUZO 2ZXWB 4H37A 2UVUA 4O7LA 3I4NG 4KHPO 2IW5A 3K3PA 5EWEA 2QF7A 4JI6O 3A0BZ 4GLWA 1N33O 4J9QA 2VA2A 1HNZH 2Z04A 5CBGA 4DUYH 2Y4RA 2HEPA 4N23A 1Q81W 4MT8A 4B3RB 4DK1A 4TSFG 3GTQA 1P49A 3ZRVA 4QWAA 2YDEA 2XGQA 3T1CA 4JYYA 3RYIA 3ZHQA 4ED2A 4X62H 3A0HZ 2P22C 4U3JB 5EYPB 4O4LF 1Z2OX 2Q5ZA 1K33A 1JOYA 2QK4A 2MK3A 4U6PA 1XNRB 3LUTB 1IBLB 2E76B 1TAEA 4LCUC 1U97A 1XMQO 4WHXA 1AR4A 3WO0A 1RK6A 2QWRB 4DLKA 4MW8A 4O4LB 3WB0A 2NU6B 3RT3C 4U7OA 3TK1A 4ECTA 1JR9A 5CB4A 4DV4B 4RZRA 1H2SB 1I1KA 4DV5O 2V7QG 4DV1H 1VARA 2E5LB 3T9BA 5BWUA 4LF4O 1BXRA 4P30A 1JQ0A 3OUUA 1CKMA 2UXBH 2YCHA 2COJA 2GBOA 5IYDG 4QWDA 4BW5A 1BHAA 3KAKA 1K5SA 3NXSA 3SJBC 3CCEV 5LMUB 1WAZA 2FB9A 4YJ2A 2OWOA 4JI7B 4DV1O 3RV3A 1GN4A 2YIDA 2VQFB 1DIKA 3K5IA 2X7RB 4WFBV 3GV7B 3T1YH 4PDBA 3ABTA 1GM8A 3ZRSA 2BOBC 5H5NA 5LOVB 3CCLV 3EFFK 3LSUA 5IJ9B 2DYRB 4TOIA 4A3MG 4Q8FA 1KJ8A 3X2QC 5EBWC 4RQEA 3EVKA 2YI8A 4PDRA 3ETDA 4PZ6A 2JA7A 4TQRA 1A0GA 1N36H 3V4ZA 2C22A 3PW7A 5LOVF 1DAAA 1IURA 5K1XA 2W70A 3CWBH 2FE3A 4QWEA 3CVZA 3L73H 2BE3A 4G2KA 2RJZA 1T94A 1K3EA 3DC5A 4Q43A 4JZGA 1L2ZA 2JVDA 2YEVA 3MWEA 4DR7H 4X64O 2ZM6O 5I5YA 5D1PA 1XHXA 3IC9A 5KAFZ 1RM1C 4DR2O 1AJQA 3TW6A 3LP8A 1V9PA 4I4TB 2YS7A 2W7PA 2HVSA 1WNSA 3FB6C 3J7AU 3TY8A 3OR6C 4O2BB 3T5KA 1SQXH 5KUMA 5KFOA 4ECXA 4TV9A 2CH7A 4AHCA 3GTLA 3WO1A 4GUNA 3RFRA 2DYRC 5BR8H 1FFTB 1K34A 2P67A 2Q0OC 2YZMA 4O86A 4B3MB 4UCUA 4RU9A 2E74B 2QJ1A 3JAWA 1Z2PX 3N8DA 4B3TO 1V54B 1ZTEA 2OCCB 2AXTZ 3CCVV 2R70A 3CEBA 3GIIA 4IGGA 4O2AB 3S24A 1N32H 3BA8A 3CCMV 2J6TA 4WFFA 3H20A 2YIAA 1I1LA 4RAZA 1O9HA 1MA1A 2WLJA 3HR0A 3ZN0A 2FPPB 3G67A 3HPLC 3E35A 4IRDA 5BR8O 1KBLA 4O83A 4GKJO 3N2KA 4FFBB 3N6XA 4CKBA 1R73A 1GSOA 4MVMA 3RVZA 4O3OA 1Y66A 4EFEA 1E1QG 2YI9A 4NVPA 3F5TA 1HNXO 4F4LA 5KFHA 4PA9A 4O7WA 2VOBA 1JX9A 5L9XA 1SKVA 2JA8G 3AX6A 4NXMB 3N27A 4GX1A 5KFBA 5EWGA 1JA8A 5KFXA 4B08A 3HOWG 5I5TA 1YTFB 2BQRA 1A48A 2IJIA 3STZC 1XOUA 2YZNA 2OH2A 2EBOA 3U0ZA 2HVKC 3LDDA 2R72A 4LSAA 2YZGA 2QKAA 1I94H 4AILC 4X66B 2FB5A 4TM5A 3OSPA 2ALZA 4NTXA 2HVQA 2ITCC 4AQYO 4BY7G 2YL2A 1J5EO 4XZ3B 1J5EB 3KYHC 5L3BA 1ZHSA 3FD9A 1KBHA 3GTJA 1JJ2U 5LP6B 3ML0A 1Q6IA 4MTGA 4JI8H 1E1RG 3WNZA 4DUZB 2ZDIC 4JF3A 3EPIA 4ICGA 4DV6B 3RFCA 1YIJV 1GGOA 2VQFO 1GTOA 5IYZB 5E1AC 2W9CB 4X62O 2MCTA 5KFSA 4LF6H 4J9PA 3TQ1A 1I7FA 4DXWA 1S72V 3BQ2A 2ASDA 1COWG 5IDJA 1N34B 1BNCA 3K04A 3CYOA 3E8BA 1XILA 2WAQE 3JD1A 3H40A 1PX2A 2UU9B 4FFPA 2FYUH 3E22A 5BMVB 4JI0H 3BQ0A 4RAYA 2NUAB 1RSOA 3ABMC 2FLNA 4BAYA 2UXNA 5DLGA 1Y1VG 2IM9A 3JARB 1R3LC 4HR7A 1GSAA 3SYOA 4HN2A 3UYYA 1RYRA 4W4LA 3RVYA 2QA4V 3K08A 1JDEA 1KT8A 2R7ZG 1BE3H 2YUAA 1M56C 5T14A 3SPCA 5CE8A 2P7TC 2QB5A 2KG7B 1CKOA 5EBLC 4B7KA 4PZ7A 3GWOA 3OTOB 4ZQIA 3RJ0A 4R50A 3K9AA 4NYKA 3UZOA 3K9SA 4KFMA 4YQWA 1S03G 4J10A 4JI7H 3L70H 1XBLA 2JK5C 3SYPA 1R6KA 4FLXA 1EKFA 5L1LA 2QSAA 4LFCH 2R7KA 1JKJB 2XAQA 4DUYO 2B63A 1W0KG 4WF9V 3HKDA 4EB6A 2WA3A 1VP7A 4JV0A 3QG5A 1BJTA 4K0KO 4X65O 4A3IG 4DR6O 4IRKA 5KFFA 5BPHA 3HKBA 1YSCA 2BCCH 1QVFU 1N33B 4LFAO 1M9NA 1UC9A 5KX5F 5KFAA 5GW7A 1SFOA 4JV2A 3OUSA 3T7AA 4IT5A 3WG7C 3FB7C 2JEXA 2JS5A 2R9IA 2ZIMA 5KT4A 3OHBA 5H80A 3K5MA 3OT7A 5BYBA 4KXRA 2B1IA 2J9GA 1IYEA 1GSHA 4GT1A 2HIVA 5BMVA 2R7NA 2HJDA 2JEUA 2WSSG 2F23A 2JA6A 3S3WA 1EZVH 4EFBA 4JI2H 3F5WC 2QEXV 5GONB 5J2UF 1UJWB 3L9DA 3GTMA 1SCUB 4JYAO 4JAVA 3KG2A 4QSHA 3GIPA 1N34H 2W9CA 3C90A 2V58A 3A8TA 3ETHA 1KYOF 1F51A 3Q8PB 1V4YA 5C4XG 2DIKA 3DAAA 1KECA 5JJEB 1NS1A 1VF6A 3T1HB 2EIYA 3VPDA 2COGA 5FLMG 2F43G 4JI3B 5CA1A 3HB9A 2ZCEA 5KFPA 3P3PA 1L1FA 2UUBO 3CC2V 1KMIZ 4XDJA 4JI4O 4NR1A 2Q7DA 2OTJV 3L4KA 4ABMA 3CPWU 4TV9F 4A3DG 1IBLO 3ZMVA 1HNXB 5I5WA 5F2VO 5CA0B 1I6UA 1XNQO 3AW8A 3JSNA 1OBDA 2JIZG 4FVMA 1NU1H 4R8CA 2P90A 4H13B 3G71V 4B7EA 1I5XA 3OTOO 1D5AA 2ZINA 4K8ZA 5CBFA 2WA4A 4LNUB 1DF5A 1XQ8A 3E83A 3JD0A 2CW8A 2R8JA 1CS0A 4RNNA 4YXWG 3N6RA 4EKWA 3TQTA 5DG8A 3NBYB 3T9AA 2W0XA 4JV5H 4LF7H 5KFRA 2BTOA 1KKDA 1M1KW 1FXKB 3AG1B 4YY3B 4JI1B 2Q0AA 2R85A 4EBEA 1CP9A 2ZE7A 1T36A 2V59A 4NLGA 2EJ7A 3K59A 2LO1A 5B1BC 3SPGA 2UVVA 2HGXA 4JYAB 2ITDC 2Q69A 2Y69B 2GQSA 3G8CA 4DV3O 4XX0B 5EIBD 5KAIZ 4DR4B 3JZIA 1Y6XA 4IZOA 4J9YB 1ZETA 1EZ1A 3RYCA 4H44B 4BWSC 3F7YC 2A0LA 3QO8A 1TWFA 2GV9A 1KEEA 1EKVA 3BY6A 5LHHA 5B1AC 1UNNC 2FLLA 2JDIG 1IOWA 2CUGA 4CMDA 2WB1A 1YITV 1N36O 1PL0A 3ICXA 5KA6A 5FNVF 1P84F 3HKCA 2JA7G 4MTOA 2CTWA 1Z2GA 2VQFH 4ZKIA 3IG0A 5IJ0A 1PNKA 5KA5A 2HVRA 1WPBA 4NXMH 1DLBA 4IRCA 3GIQA 5KX5B 1UPGA 1L8DA 1HR0O 1S76D 5CM0A 2GQRA 4B3TB 3V6JA 4D6TH 5LMNO 3GIKA 3LULA 4BXXG 3H0GA 4LF4B 5KFNA 1N0JA 4A3CG 2XAGA 3M9MB 3TY5A 5BPFA 3I12A 3T9CA 3CXHF 1YJ9V 1S5HC 3CX5F 5JCOA 4RAIA 5KUKA 4QIWE 4MVZA 5LMUO 3MR2A 2R7MA 4CS3A 2FTKA 4DR3O 5ITZB 5JQGF 2FKXA 4M0JA 1FPOA 1VIBA 2Z5UA 2FPIB 5JCOC 2EJ0A 1IBKH 3U55A 2Y4UA 2UUAH 3SPIA 4DIMA 4CH6A 5L3DA 3UFXB 4RZQA 4YR2A 5J2TF 3QTCA 4NTYA 5JJNB 4LFCB 2WE6A 5IYCG 2ARHA 4GCZA 2E5LO 3SPJA 3N2KB 1W0JG 4FFBA 5EC1C 3L72H 3CMAV 3ABLB 5DGHA 3D8CA 3F8NA 5DGIA 1E79G 2XUMA 3DTGA 2N74A 4ZHQB 4LFAB 4YIOA 2FJZA 5KG1A 4IR9A 1B06A 2X6AA 5KG6A 5CMUA 1I3QA 3RN4A 3JAKB 2B1GA 4JI3H 5DISC 3SYQA 2V4QA 2WPDG 5CR5A 1VF6C 4X20B 4QE7A 4YJ3B 2KSWA 1IOVA 1XUQA 1XDNA 4I55F 4EB6B 4F4WA 1N8RW 1AVMA 4HBNA 4R7CA 2R93G 1K4DC 3RYIB 5CB4B 5KFVA 3V6HA 2WLIB 1VQPV 3FKIA 3AK1A 1QLEB 5LMNB 2C00A 2BQ3A 2E75B 3PW0A 1KKCA 2JGDA 4UCSA 2UXCB 5LXTA 2H94A 5KFWA 2D3OW 3KHLA 3K06A 4A3GG 1SETA 1WA8A 5KFLA 4DV0B 5EZYB 4X65B 4KHPB 5J2UB 5GONF 2A79B 2PZSA 4JI6B 4B3MO 2JEIA 2YWVA 5JQWA 5B1AB 4MW3A 4RB3C 3D3QA 3T4ZA 4MV6A 3CEIA 2DAAA 3TIIA 3TINA 1NVPD 4RWUA 4I55A 5J9PC 2RDCA 4JTAB 2IMWP 4Q0YA 1I50A 1XNQB 1SEIA 3QFFA 1WP7A 2DZDA 1YZBA 2JJ2G 3GWKC 1VS0A 5KG3A 1SZTA 4X89A 3DXRA 4DR1B 4LF5B 1TWAA 3WU2Z 5KHKA 2BQUA 4MV1A 3BEHA 2HIXA 2JS3A 1B04A 1BZKA 2RMKB 1JDBB 1ROPA 2YZLA 5LL6Y 3AG3B 3V4SA 1XNRO 3W7UA 2EJ2A 2AZ2A 1C30A 3W1BA 3VA7A 2Q68A 4HYKA 2W71A 3O9OA 5EDWA 4NYEA 1M0WA 4QW9A 4CHIA 2I8CA 1VQKV 1AUVA 3GQCA 3OM3B 1T5EA 3QNEA 2BSKB 2LFSA 3SGIA 2Q2UA 3R9RA 4JI0O 3OE7G 2RGVA 4L87A 5LYJB 4JPRA 3ZMSA 2W6IG 4MTXA 2IJJA 4HYOA 4A5UB 5L1IA 3AG2C 1SC5B 5BWWA 2DPIA 3IGAC 1GN2A 3RW0A 1VBGA 5BY1A 5LOVA 1AP6A 1L0NH 3J81W 5DLFA 3HOUG 1FXVA 2GTAA 1P7GA 5DECA 3ZIAG 3G6VA 3J80N 4ECRA 3FX7A 2ZR2A 4CZZA 2Y0SA 3RB0A 3H1IH 1MABG 4JI1H 5D8DA 1URFA 3LNNA 1I1MA 4DQNA 2ATLA 3EYYA 2Q4PA 3CQZA 2CH7B 2V9WA 1TUBA 4JI7O 4QW8A 5C1OA 2AGQA 1S0VA 1M7JA 4CH5A 5B3SC 2DYSB 3VPBA 2VA3A 4J9OA 4I4TA 4EGJA 2J6UA 4Z1VA 3I55V 1H2KA 3B4SA 5FLXW 4F4ZA 3QO5A 1KUQA 4HNAB 3GJXB 1A0IA 3K0GA 1G1XB 4O7TA 4X1KA 5LA6A 4J9SA 2UU9O 1WSCA 3ORQA 4DR2H 5A9GA 5J2UA 1WRVA 2UUCO 1NJIW 1WH2A 5KFKA 5EOYA 5IWAH 2EINC 1EM1A 3SYCA 2DQ3A 3RYFA 4DL7A 4PI0A 3T2MA 2ZIOA 3LWBA 4O2BF 2RNBA 4K6NA 2CNUA 2V5AA 2EJRA 2XAHA 5BWRA 5IJ0B 2YS6A 2VQEB 5K1PA 1RP3B 3GB7C 3JASB 1K97A 5FR9A 2W6ZA 3TIGA 3AG4B 2QTSA 4ECUA 3AG2B 4J9MA 3QZ7A 1CQIB 3M9NB 1HP8A 4WFEA 4LFCO 5B1BB 4IR1A 2WAQA 4NXNB 1LUVA 2CAZC 2W6JG 1Y1WA 5IP7G 2NU8B 4E4EA 4PZ8A 2M7WA 3ZMZA 3R5XA 3BABA 2FPGB 1MZBA 4ZI7B 1TWHA 3D36A 3BCCH 1OZ0A 1JXLA 5KHGA 2A06H 4LFAH 1AILA 1NBMG 3BA9A 2YS8A 4AI8A 2UXBO 3EPGA 2Z3YA 4J80A 1XNQH 1DGSA 1IDSA 2YU9A 4YR0A 4JI5H 4X9QA 2NVXA 3M99B 4LF6B 2OCCC 4O3RA 1HNZO 3LMLA 4WD3A 4FBTA 4WBNF 2HR3A 4F6RA 4DR7B 2HHHH 1RJPA 1KC8W 3AK2A 3I4MG 4H33A 4FPPA 4YY3H 2W6QA 1QHTA 3NGDA 2XCLA 5KMGB 1EN4A 1KB9F 3WB2A 4FFKA 1N56A 4YJ2B 3CMEV 3PJSK 1K92A 3ZJZA 4P2ZA 4JYAH 5LMNH 3JARA 1AI7A 2CE4A 1I0HA 3IC7A 1NVPB 3QZ8A 4RNOA 4E4TA 2CK3G 2YC0A 4K3AA 1XL4A 4JV1A 3JALA 2F1MA 3Q8SB 2P5OA 1SQVH 1GMGA 3VOUA 2QWNB 3PO3G 1M93A 1YJWV 4O4IB 3KREA 2ABJA 5IY5C 1MMMA 2EZOA 5KS8A 2Y48A 2X0LA 2V1DA 4R8UA 1VQNV 3JZ6A 4DR5O 4M7EA 1RSOB 3TCUA 1P7BA 4JI4H 4J7KA 2ZNJA 3ZS8C 3APOA 4ZI7A 4YJ3A 2NU9B 1OCCC 5B1NA 3K3WA 2PYLA 2I80A 2Y4TA 1XL6A 3T9EA 1CPYA 1HWYA 3WFVA 2LJ2A 4RNMA 3JAMW 4TQFA 4I0XA 3T99A 3GTGA 2GUZB 1E4FT 4PD4F 4O7YA 3G6YA 1ZL8B 1O9GA 4MVOA 4QNHB 2O03A 4YJ3F 1FXKA 1GK9A 2R8HA 1QNMA 1GM9A 2PY5A 3LNMB 4O2BA 2QDOA 4O7ZA 2WTFA 4DV0H 2C28A 3D3IA 2R82A 1WJZA 3RBDA 4LF7O 5CA0F 5IE9A 3SNOA 4K35A 2SCUB 1TVKB 2IJKA 1XDCA 5I47A 4XYMB 4BW9A 3M8AA 3AK3A 5DMXA 5HNEA 4OPAA 3JD4A 5DG9A 1S68A 4O2AF 1ULZA 4UCOA 1W2BU 3EXAA 3SJQC 1KTAA 1VQOV 4EEYA 3MJFA 2JA5A 3STLC 1HDJA 4DR7O 1SQQH 1HNWO 2N04A 4Q20A 3BPZA 3EHBB 1A32A 5C93A 1G6UA 2F93B 4A3KG 2DOSA 2RF4A 5KG2A 4LF9O 4O3SA 1GAXA 1OCOB 4GX2A 1NQTA 4DR1O 4LF5O 4I5SA 4A3BG 1Q7YW 3SJCC 4ECWA 2QM8A 4PDVA 3ETGA 1N0NA 1ZSPA 4LH7A 2F4VO 3R5FA 1A3GA 3FB8C 4RB2C 1TVKA 1WP8A 4I9WA 5JVDF 4LH6A 4JI8O 5EIBC 4AQYB 2Y0SE 3LSQA 1VQMV 3AYHB 4Z1MG 5LBQA 4OX9H 2WLNA 3JCUZ 1QLEC 4E2LA 2Y69C 3UQ8A 4JAUA 2C2DA 3T5LA 5KHHA 3BHPA 4B3MH 1NT2B 3GV8B 3MAQA 3T5HA 1JJOA 5C8YB 2LW7A 3PN1A 2P4KA 4FFOA 1JFFB 4FS2A 4J11A 4A3EG 4LNUA 1WCMA 2EJ3A 4MVRA 3R65A 1GN3A 1KU9A 3E2EA 3PR4A 2HJFC 4O4IF 5FJ8G 2YRXA 2UXBB 5FLXN 2OYQA 5C1PA 1F4NA 4QWBA 3U9TA 3VOTA 5DEDA 3RYHB 4EEQA 2ZQMA 4D7SA 2XCPA 4FS1A 2HKOA 1MNGA 4DV7H 1L0LH 4UFZA 2DE0X 3E22B 4UVBA 4DR5H 3RAXA 4YHHB 4FE2A 5TISZ 2EZPA 3JD2A 2RN9A 3LQSA 4LC1A 4ZBMA 1MG1A 4P9PA 1BS3A 4GC7A 2R9RB 3Q2OA 4Y8VB 5DQHA 4K8XA 3RV4A 3VMMA 4I7ZB 3PFFA 4FZ0A 1RJRA 4MTFA 3RAQA 5C5JA 3C3SA 3H01A 3RF2A 4GC6A 1RFYA 4WFGA 2F4VH 4PA6A 3GTKA 1VKZA 1H8HG 4PBCA 4O4HB 2JEGA 5KFJA 4OGQB 5JJJB 4IHJA 4F4XA 4UV9A 3OSNA 3NUAA 3H1LH 2DWDC 2AGPA 4DRXA 2F66C 3KKYA 3K03A 4O7NA 2CTPA 4X1IB 1Q8IA 3IAYA 4O4HF 3GTOA 2IU3A 5D5QA 3L74H 1XMOO 1X59A 4L1KA 1SZXA 4F4YA 4Q8EA 3IN5A 5J2TA 1YEWA 1JCHA 1B3QA 2EIJB 1S0OA 3VQXA 4BIOA 4PDLA 2M05A 1HR0H 2ZGIA 3QF7A 4PA7A 2FKLA 4EBCA 2ODTX 1PNMA 4IHJF 4DO2A 2ZDIA 1XMQH 2CFMA 3I5DA 3K79A 3AG3C 4RUEA 2A3QA 2EIJC 1M5IA 3A0RA 3CCJV 4R7RA 4NZNA 2RGRA 5DG7A 3FYIB 3I56V 4MA0A 3S3XA 2UVWA 4DV1B 5D1OA 2XC9A 2W6PA 1SF9A 1IYDA 3ZMTA 1B6RA 4UUJC 4DV7O 4W4KA 2ZDQA 2R7ZA 1G2WA 3ZCCA 4MV7A 1SESA 3ZBHA 1ZHQA 1KJJA 1G8MA 5KG4A 2R6FA 1XEQA 4IWYA 5B3SB 3ETQA 5GONA 5HFLA 1AI5A 1C3OA 2DQ0A 3OMNB 5L3EA 5L1JA 4LF8O 1YF2A 3UKMA 4TWKA 1F7YA 2JA5G 4KL1A 1VQ6V 4X1IA 5IY5B 3ZHRA 2ZD9A 2ZT9B 2XCAA 4MV3A 3L71H 3HOZG 5EC2C 4JI2O 4JV5O 3CSWA 2R93A 2XTAA 1Q82W 1K9MW 3IJ4A 1U96A 2XASA 1WA8B 4JYCA 3T1YB 1YI2V 5IYBO 5CA1B 4C5BA 1MZFA 4YAKB 4NTWA 4IWXA 2Q9LA 1NKDA 4QIWF 1JX4A 1OCOC 4CKEA 3CP1A 5KT3A 3E8FA 4RUFA 3JSLA 3HBLA 1QR9A 2IU0A 4X8AA 1GM7A 2JJ1G 4I9QA 3ABLC 4EBDA 1FVIA 2A1HA 2W57A 1AI6A 1VBHA 1IXBA 4JI1O 2E2IA 4YY3O 2W7OA 1OV9A 3RTXA 3E86A 2R86A 5I5UA 4X64H 2ZM6H 3R23A 1NH2B 3V6KA 2W6MA 4A93G 1SA0A 1HNZB 5JH7B 1KD1W 3P32A 4UV8A 3ZRXA 3DXRB 1EN5A 3Q8QB 4GLXA 1RPOA 1Y67A 4LBEC 1M6VA 3MR6A 4B3RH 4DR4O 4FLWA 1RJQA 1MSDA 4YP3A 1S3JA 1TGOA 2YICA 1FD9A 2PI5A 1EYZA 1SQGA 5KHJA 3W7TA 1KP3A 4WCEV 5KFGA 4U3JA 1IZ3A 2KQXA 5EYPA 3H4BA 5IYCO 1EUCB 3M7MX 4C5CA 2AHYA 1CQJB 3FMAA 3NR7A
chains in the Genus database with same CATH topology
3M4IA 4B3MB 4UCUA 4CH5A 2QJ1A 3JAWA 1Z2PX 1Q5OA 1N32B 4I4TA 2R70A 1FFXB 2Q7HA 3U11A 4O2AB 3S24A 1N32H 3BA8A 4DR6B 5FLXW 3H20A 2YIAA 4DV4H 4RAZA 1O9HA 1M0TA 4HNAB 3GJXB 3RIZA 4DV7B 4DR5B 1A0IA 3N6XA 3N2KA 4FFBB 4X1KA 4O4IA 4Q6GA 5LA6A 5J2TB 4LF8H 4DR2H 4EFEA 5J2UA 2YI9A 4NVPA 4LMYA 4DR4H 1WH2A 5IWAH 5EOYA 1O75A 2VOBA 3RYFA 3K5NA 1SKVA 4PI0A 5IWAB 2ZIOA 3OTFA 4NXMB 4GKJH 4UCTA 4B08A 5IJ0B 5LP6C 2WDTA 2VQEB 5K1PA 4KHPH 1Z2NX 5C8YA 3JASB 2Q7GA 4LF4H 3U0ZA 1XMOB 2VQEH 2R72A 4LSAA 4J0MA 1FKAH 1I94H 4AILC 4UCVA 4X1YB 3ZEDA 4X66B 4FM2A 1X4TA 4DK0A 1J5EH 2HVQA 1Q3EA 5EZYA 3RGBA 4NXNB 4JI8B 1J5EB 3K5OA 2CAZC 4O4HA 3K5LA 3KYHC 4IHJB 5ITZA 1ZHSA 5KHIA 4PZ8A 2YIBD 1P16A 5LP6B 1SYXB 3RYFB 1WN7A 4DR3B 4JI8H 4CC6A 3BABA 4FLYA 1MZBA 4ZI7B 4DUYB 2JGUA 2PTMA 5JQGA 4DV5B 4DUZB 5JQGB 5KHGA 4FM1A 4B3SH 4DV6B 2HGSA 2QM4A 4LFAH 3BA9A 3J80W 5IYZB 2MCTA 1XNQH 3RR5A 4LF6H 1HNWH 1DGSA 1I7FA 4TUYA 4JI5H 4APMA 2R9AA 2UUCH 5IJ9A 4LF6B 1N34B 4X64B 2ZM6B 3LMLA 3QWUA 4F6RA 2HHHH 4DR7B 3JAKA 2XHBA 4FLZA 5LXTB 1IBKB 2UUBB 2UU9B 3DF7A 1IBMB 3E22A 5BMVB 2RQ6A 3BAAA 4YY3H 4JI0H 4RAYA 1QHTA 5KMGB 2YXLA 3WB2A 3CB2A 1RSOA 4YJ2B 3FMAA 2IM9A 3JARB 4JYAH 5LMNH 3JARA 1XHZA 5CA0A 5FNVA 1Z5WA 3VQWA 3HKEA 3HKBB 5FD5A 3RYCB 4O2AA 1P8LA 1XI1A 4I7HA 3JALA 1CKOA 3THOA 4Q0YA 5FPRA 4JV5B 4ZIBA 2F1MA 4IAJA 2P5OA 4PZ7A 3OTOB 5IT9W 1S5JA 3RJ0A 5JH7A 4X1YA 3FFQA 4DV3B 4A2AA 1S03G 1M93A 4O4IB 5LA6B 4JI7H 4FLXA 1FJGB 3GDEA 1TUBB 4LFCH 4FLTA 4IIJA 4M7EA 4FLVA 3CHXA 5BR8H 4DRFA 1FJGH 3HKDA 4I55B 4EB6A 4JI4H 2ZNJA 3ZS8C 2UXCH 4ZI7A 3RGZA 3QG5A 4WBNB 1BJTA 4YJ3A 4LR3A 1CKNB 2E5LH 1CKNA 4CS4A 2PYLA 3HKBA 1IBLH 1JFFA 3N40P 3K58A 5KX5A 1N33B 3JATA 1VF7A 3JAMW 4TQFA 3GB8B 2JS5A 2ZIMA 4TV8A 1E4FT 3N41B 3K5MA 1O9GA 2O03A 3RGXA 5JVDA 5JVDB 3KALA 3TY9A 2PY5A 4O2BA 2HIVA 5BMVA 3NBZB 4LFBB 4D7TA 4DV6H 4DV0H 3N42B 2VUGA 4JI2H 4EFBA 3L2PA 5GONB 2PGGA 1QQCA 1M4UA 4X20A 1SA0B 4RB0A 4JI2B 1TVKB 2BTQA 2E3CA 4ETSA 1N34H 4RB1A 4BW9A 3B2EE 4I50A 5IYZA 4TQDA 4GKJB 4DV2B 1S68A 3K57A 4UCOA 5JJEB 3JASA 5D5PA 3T1HB 3SJAC 4DR1H 4LF5H 1GYFA 3N44B 3A2FA 1XMOH 4JI3B 5CA1A 2ZCEA 2UUAB 1E4GT 3BPZA 2ZNIA 1KMIZ 2V4DA 4K0KB 1G6UA 2F93B 4LF9H 2UU9H 4JI5B 3L4KA 3JAWB 4WBNA 4O4JA 3N2GA 1HNXB 5FNVB 1TA8A 1N36B 2HHHB 5CA0B 4X62B 1I6UA 4CS2A 2UXDH 3SJCC 3JSNA 2F4VB 4LH7A 4FVMA 4DUZH 4RB2C 1XNRH 1TVKA 3J7AK 3HXLA 1HR0B 4LH6A 4I50B 1D5AA 1Q43A 2ZINA 4K8ZA 4F6RB 1HNWB 3OTOH 4LNUB 4MTDA 5EIBC 3VQVA 1XQ8A 4AQYB 2CW8A 2UUCB 5FPOA 3W1GA 4OX9H 3NBYB 3SR2C 4JV5H 4FM9A 3UQ8A 4LF7H 3CSXA 2BTOA 5LYJA 4YY3B 4JI0B 5KHHA 4JI1B 2Q0AA 4E6NA 3BHPA 3W5OA 4B3MH 3RWRD 1NT2B 3MAQA 1JJOA 3K59A 3NC0B 4JYAB 5C8YB 3PN1A 1JFFB 1FFXA 3N2GB 4O4JB 5EIBD 4LNUA 4DR4B 2BTQB 3L4JA 4DR6H 1KU9A 3RYCA 4BWSC 2YIBA 1ZAUA 2VWKA 2VWJA 5LMUH 2GV9A 2UXBB 2OYQA 4JI6H 2F95B 3UT5A 4LF8B 4EQ5A 3MWMA 2ZJTA 4EEQA 4TV9B 3RYHB 4D7SA 4GKKB 1AN7A 4MV9A 4UFZA 3ICXA 4DV7H 3E22B 3HKCA 4DR5H 4YHHB 2VQFH 4B3SB 5IJ0A 2VPSA 3IG0A 2HVRA 1I94B 4NXNH 1WPBA 3KXYT 4ZOLB 4NXMH 5KX5B 1BGWA 1L8DA 4L8JA 4BWAA 4TUYB 4FM0A 4B3TB 5FD6A 4K8XA 4A2BA 4LF4B 4CH4A 4B3TH 3TY5A 3N43B 1IBMH 4X1KB 3UT5B 3RF2A 5JCOA 4MTEA 2F4VH 4O4HB 4CS3A 5JJJB 4IHJA 5ITZB 4LF9B 4O4LA 5JCOC 4DV3H 1IBKH 1HNZH 4DRXA 4UCRA 2F66C 4DUYH 2UUAH 4CH6A 1HNXH 2HEPA 5LL6b 4RZQA 4B3RB 4DK1A 3QTCA 4CH3A 4X1IB 1Q8IA 5JJNB 3IAYA 4LFCB 4K0KH 2WE6A 5D5QA 1P49A 4CC5A 5BR8B 3N2KB 4FFBA 5J2TA 1YEWA 3F8NA 3RYIA 3C0FB 4HNAA 4X62H 3VQXA 2P22C 4PI2A 4U3JB 5EYPB 4ZHQB 4LFAB 3QF7A 1HR0H 1Z2OX 1XNRB 1XMQH 1IBLB 2CFMA 3JAKB 4JI3H 1TAEA 5DISC 1M5IA 4DRXB 4X20B 4R7RA 1XMQB 4YJ3B 2KSWA 4LF7B 1XDNA 2RGRA 4O4LB 3WB0A 4EB6B 3HKEB 3WB1A 4AQYH 4ZOLA 4GYCB 4HBNA 5CB4A 4DV1B 5D1OA 3RYIB 5CB4B 4DV4B 5D1OB 1H2SB 2UXDB 4LFBH 4DV1H 5LMNB 2E5LB 3BRCA 4DR2B 4UCSA 4JI4B 5LXTA 2UXCB 4MV7A 4X65H 1ZHQA 4PHZA 5LP6A 1CKMA 1XK5A 4DR3H 4LSXA 2YCHA 2UXBH 4DV0B 5EZYB 4X65B 3ETQA 5J2UB 4KHPB 2PZSA 5GONA 4JI6B 4RB3C 4DV2H 1N33H 3KAKA 3SJBC 5LMUB 4YJ2A 2OWOA 4JI7B 3K3VA 3HKDB 4I55A 5A2QW 4X66H 2VQFB 1XNQB 4KL1A 1SEIA 2XIGA 4X1IA 1VS0A 3T1YH 4PDBA 1SQFA 4TV8B 5LOVB 4DR1B 4LF5B 3T1HH 5KHKA 3JATB 5IJ9B 4YHHH 4TOIA 2HIXA 3T1YB 1B04A 1JMKC 5CA1B 2YI8A 4PZ6A 3W1BA 1X9NA 1N36H 2PUSA 1M0WA 5K1XA 2FE3A 3JSLA 3HKCB 4I9QA 1T5EA 5KMGA 1FVIA 3CVZA 2PYJA 3SGIA 2W57A 2Q2UA 2RJZA 4FLUA 2RGVA 4GKKH 5LYJB 1L2ZA 3DSQA 3RTXA 2Q2TA 4X64H 2ZM6H 2JVDA 3KAJA 1SA0A 4DR7H 2Q7EA 1HNZB 5JH7B 5D1PA 1XHXA 2UUBH 3VNNA 5LOVA 4OX9B 3J81W 4GLXA 4B3RH 3JALB 1V9PA 4I4TB 4FLWA 4DV5H 2HVSA 1WNSA 2EX3A 1TGOA 3TY8A 1Z5VA 2KKWA 4JI1H 1SQGA 4O2BB 5KHJA 3VQYA 4ZHQA 4U3JA 5EYPA 1HW7A 3LNNA 4IIJB 3M7MX 4TV9A 3RYHA 2CW7A 3EYYA 4AHCA 3U10A 1TUBA 3RFRA 2WYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA B;  4B3M B;  4UCU A;  1HR0 B;  4LH6 A;  1XNR B;  1P8L A;  1IBL B;  2CFM A;  1CKO A;  1HNW B;  1N32 B;  1TAE A;  5DIS C;  5FPR A;  4AQY B;  4JV5 B;  4PZ7 A;  3OTO B;  2UUC B;  5FPO A;  1XMQ B;  3W1G A;  4LF7 B;  1XDN A;  4DV3 B;  3NBY B;  3S24 A;  3BA8 A;  4DR6 B;  3UQ8 A;  4DV1 B;  4YY3 B;  4DV7 B;  4DR5 B;  4JI1 B;  4DV4 B;  4JI0 B;  1FJG B;  1A0I A;  3GDE A;  5D1O B;  4E6N A;  3W5O A;  2UXD B;  4DRF A;  3NC0 B;  4JYA B;  4EFE A;  5LMN B;  3PN1 A;  2E5L B;  4DR2 B;  4UCS A;  4JI4 B;  2UXC B;  1CKN B;  4DR4 B;  1CKN A;  3GJX B;  5IWA B;  1CKM A;  1XK5 A;  1ZAU A;  4DV0 B;  4X65 B;  4KHP B;  4NXM B;  1N33 B;  4JI6 B;  2UXB B;  3GB8 B;  4UCT A;  2VQE B;  5LMU B;  4LF8 B;  4EQ5 A;  2OWO A;  4JI7 B;  4EEQ A;  4GKK B;  2VQF B;  4UFZ A;  1XMO B;  1XNQ B;  3TY9 A;  4YHH B;  2HIV A;  3NBZ B;  4UCV A;  4LFB B;  1VS0 A;  4X66 B;  4B3S B;  2HVR A;  1I94 B;  2HVQ A;  4DR1 B;  4LF5 B;  2VUG A;  4EFB A;  4TOI A;  3L2P A;  2HIX A;  3T1Y B;  4NXN B;  1B04 A;  4JI8 B;  1J5E B;  3KYH C;  4PZ6 A;  4B3T B;  4JI2 B;  4PZ8 A;  3W1B A;  1P16 A;  1X9N A;  4DR3 B;  4LF4 B;  4CC6 A;  3BAB A;  4GKJ B;  3TY5 A;  4DUY B;  4DV5 B;  4DV2 B;  4DUZ B;  3JSL A;  1S68 A;  4UCO A;  1FVI A;  4DV6 B;  3SGI A;  2Q2U A;  3BA9 A;  3T1H B;  3RR5 A;  3RTX A;  2Q2T A;  4JI3 B;  1DGS A;  2UUA B;  4LF9 B;  1HNZ B;  5D1P A;  4LF6 B;  1N34 B;  4X64 B;  2ZM6 B;  4K0K B;  3VNN A;  4OX9 B;  4GLX A;  3QWU A;  1V9P A;  4UCR A;  4JI5 B;  4DR7 B;  2HVS A;  1IBK B;  2UUB B;  2UU9 B;  4B3R B;  1IBM B;  3TY8 A;  3BAA A;  1HNX B;  4LFC B;  1TA8 A;  1N36 B;  2HHH B;  5D1O A;  4X62 B;  4CC5 A;  5BR8 B;  3JSN A;  2F4V B;  4LH7 A; 
#chains in the Genus database with same CATH topology
 1EN6 A;  1N4C A;  3M4I A;  3PW5 A;  5KG0 A;  2HVJ C;  4CKC A;  4ED3 A;  4DYL A;  4YJ2 F;  1Q5O A;  1V55 B;  3TGU H;  3ASO B;  2JRI A;  4O7V A;  1GKF A;  2A7W A;  1N32 O;  3B77 A;  3HKZ E;  3KTM A;  2WWW A;  4J9Z B;  3U11 A;  4YHH O;  4QGP A;  4DR6 B;  1P4R A;  3OHA A;  4OPH A;  1KC7 A;  1NTZ H;  4DV7 B;  4DR5 B;  3T1H O;  3CXC U;  5FL7 G;  1UC8 A;  1M57 B;  2GPW A;  1FAF A;  4LF8 H;  1CXZ B;  3ZHV A;  1IBK O;  2NNU A;  1I08 A;  1MOF A;  3JCZ A;  4LMY A;  5LGN A;  2HHH O;  1O75 A;  5DAA A;  2KSD A;  3G80 A;  2LQT A;  3K5H A;  3K5N A;  2ASL A;  4N21 A;  4QJF B;  5IWA B;  1S0N A;  2EIL B;  3OTF A;  3QQM A;  1EKP A;  5DN6 G;  5EWF A;  4RUA A;  2VQD A;  2FLP A;  4TV8 F;  3PW4 A;  4KHP H;  1WCM G;  1IXM A;  3F7V C;  2ADP A;  1GO3 F;  2CDY A;  2H8P C;  2Q7G A;  5C8Y A;  4Q45 A;  3H3V H;  5L3F A;  1VMG A;  2GTS A;  1GN6 A;  5LGT A;  4J0M A;  3FYE B;  3BJY A;  1PP9 H;  1X4T A;  2NN4 A;  1PV0 A;  4DK0 A;  1J5E H;  5B5E Z;  1Q3E A;  3T5J A;  5DQI A;  3MFH A;  4NXN O;  2DWC A;  2CTR A;  2VRZ A;  4YAJ B;  2XT9 A;  1RM1 B;  4BR6 A;  4JI8 B;  3SPH A;  1BHB A;  5ITZ A;  1V51 A;  2YIB D;  3VBB A;  3W7W A;  3RYF B;  4DR3 B;  1VQ7 V;  4LP8 A;  2KB1 A;  4FLY A;  3MR5 A;  3H9V A;  3OEH G;  1FKA O;  5C3E G;  4A3J G;  3E89 A;  1RYS A;  4DUY B;  1PPJ H;  2JGU A;  5JQG A;  4QPK A;  2QM4 A;  1Q6H A;  5KFT A;  5HBR B;  1KJI A;  3J80 W;  2QWQ B;  4LWS B;  4C7U A;  3QO7 A;  5KFZ A;  4DL4 A;  2R87 A;  2Q67 A;  2XOK G;  2QE7 G;  5CA1 F;  4TUY A;  5F9N A;  4PA4 A;  4APM A;  3JD3 A;  2R9A A;  2EIL C;  3ZHU A;  3H1K H;  3ETE A;  3QWU A;  5DM6 V;  3JAK A;  4LFB O;  3BFR A;  2XHB A;  1Y76 B;  5LXT B;  4B3S O;  2RQ6 A;  3BAA A;  4MV8 A;  4CBC A;  2CTQ A;  1YDX A;  4FMT A;  2HGW A;  2XD4 A;  3AEI A;  3MHS C;  1KUT A;  1NR7 A;  3TXQ A;  4JXU A;  5DQG A;  2NVY A;  1PL4 A;  5CA0 A;  2ZE8 A;  5I5X A;  5FNV A;  2X6B A;  1FXH A;  3VQW A;  4TUY F;  5FD5 A;  4JZ2 A;  4O2A A;  3OW2 U;  4FFM A;  4I7H A;  4FJC C;  3THO A;  2O57 A;  5FPR A;  4IAJ A;  4ZIB A;  2JGD B;  1N34 O;  3ASO C;  4PA3 A;  5EK0 A;  3HT5 A;  4O84 A;  2JEF A;  1VQ5 V;  3CRC A;  3ABK C;  3FFQ A;  3ZHT A;  3T1Y O;  4DV3 B;  4X88 A;  4A3L G;  1OWT A;  2NLJ C;  3APQ A;  2UXD O;  2WLH A;  3PZP A;  2ZE5 A;  3TXS A;  1FJG B;  3GDE A;  4ECY A;  4IIJ A;  4KP4 A;  4PDM A;  4J9L A;  4FLV A;  3CHX A;  4MSW C;  4XDL A;  4DRF A;  4I55 B;  2CKZ B;  1YJN V;  3H0G G;  1ZUQ A;  4WBN B;  2HG5 C;  1US6 A;  3GIM A;  3WWI A;  4LR3 A;  1CKN B;  2E5L H;  1ORQ C;  5LYJ F;  5KFD A;  4TVI A;  5C44 G;  1IBL H;  3CJH B;  3LDC A;  2PI4 A;  3N40 P;  3K58 A;  5KT5 A;  5KX5 A;  3JAT A;  1QU7 A;  4IIJ F;  1QCE A;  1VF7 A;  2WLK A;  3GB8 B;  1LUW A;  2IP4 A;  3N41 B;  4BIZ A;  1QR8 A;  4R8U B;  2JEJ A;  2HG8 A;  3ASN C;  3CCU V;  2LW1 A;  1MSW D;  3RGX A;  5JVD A;  4ZI7 F;  2B5U A;  3ABM B;  4ME6 A;  3KAL A;  5E25 A;  3TY9 A;  3NBZ B;  1B33 N;  4LFB B;  4D7T A;  3R66 A;  3W7X A;  2K1E A;  4NXM O;  2K9P A;  1BGY H;  3N42 B;  3ABK B;  2VUG A;  1S77 D;  3FKI G;  2YYA A;  5HFM A;  2NR5 A;  2PGG A;  1QQC A;  1M4U A;  4RB0 A;  4JI2 B;  1AP5 A;  5KFQ A;  3R5H A;  2BTQ A;  1OCR C;  3Q4H B;  4LWS A;  1YTF D;  3T4D A;  4EG0 A;  4ETS A;  4RB1 A;  3B2E E;  5IYZ A;  1I7L A;  4TQD A;  4BY1 G;  4X66 O;  2PBZ A;  4DV2 B;  4GX5 A;  4PJ0 Z;  4XBF A;  2ZE6 A;  1S10 A;  3DGE A;  3JAS A;  4DR1 H;  4LF5 H;  2QGN A;  5L3G A;  3DTU B;  3RBE A;  3A2F A;  3KHH A;  1XMO H;  3HO8 A;  2R7L A;  1D2D A;  1AR1 B;  1AJP A;  2OTL V;  1E4G T;  1VQ9 V;  2DMX A;  2UXC O;  4I50 F;  2V4D A;  4K0K B;  5BWX A;  3CD6 V;  3CCQ V;  1AJN A;  4JI5 B;  2LGW A;  3KZI Z;  1AI4 A;  4WBN A;  1AB3 A;  3N2G A;  4O4J A;  3WWJ A;  4HQ6 A;  1YXB A;  2N05 A;  3G6E V;  1TA8 A;  5FNV B;  4IL6 Z;  1N36 B;  1EBO A;  4X62 B;  5H2F Z;  2HHH B;  2HDK A;  4CS2 A;  2UXD H;  4WFA V;  2F4V B;  1FYJ A;  2DJV A;  5IT9 N;  1DV1 A;  5BXZ A;  2EIK B;  3ZMU A;  1XNR H;  2OT5 A;  2LFR A;  3GVM A;  5EZY F;  4Q4C A;  4DL3 A;  2YRW A;  1H38 A;  1HR0 B;  4DAA A;  2QYZ A;  2HHF A;  1W96 A;  3OTO H;  4MTD A;  1WB7 A;  3VQV A;  1SQB H;  5GTH Z;  1BT8 A;  1PM9 A;  3RB4 A;  4ECZ A;  4JTD B;  4FM9 A;  2YXH A;  3CSX A;  2A9H A;  2CZG A;  1KJQ A;  2AGO A;  3RWR D;  1WLE A;  2I87 A;  2AU0 A;  2QR4 A;  1DV2 A;  1R9T A;  2GLT A;  3N2G B;  4O4J B;  1R3I C;  3H4D A;  5KFY A;  1PNL A;  4O3Q A;  1NTK H;  3C3T A;  2W8L A;  4R6Z A;  2BTQ B;  2G38 A;  3L4J A;  3FB5 C;  4DR6 H;  2BOC C;  4YBZ B;  1E4E A;  4QPJ A;  1ZAU A;  2VWK A;  1V55 C;  3ZRW A;  1QBZ A;  1Y74 B;  2AQ4 A;  5JH7 F;  2RDJ A;  2Y0I A;  4JI6 H;  2F95 B;  1THZ A;  3UT5 A;  4EQ5 A;  4BBR G;  2X6C A;  3MWM A;  1NTM H;  1UFI A;  4TV9 B;  1VQL V;  1I2L A;  1A9X A;  1S9F A;  1AN7 A;  4MV9 A;  4GKK O;  4HNU A;  1FS0 G;  5I5V A;  5CBH A;  5LP6 F;  1K8A W;  4M9U A;  4B3S B;  1RPR A;  3Q4H A;  1I94 B;  1ZLZ A;  2COI A;  4ZOL B;  1W93 A;  3X2Q B;  2ILM A;  1BGW A;  4ED6 A;  2D2C B;  2W8K A;  4L8J A;  4BWA A;  2GPS A;  3OUF A;  4HNT A;  4FU0 A;  3RB6 A;  4FM0 A;  5FD6 A;  1JIH A;  4A2B A;  3Q1K A;  4NZO A;  4CH4 A;  5I5S A;  2HHF B;  2HJW A;  1H2L A;  2CGN A;  4B3T H;  3P3N A;  1R6N A;  1KJ9 A;  1Q86 W;  2CQY A;  1IBM H;  5CAE B;  4HAM A;  2DYS C;  4JGS A;  2ZDG A;  4KUM A;  5AG2 A;  1YHQ V;  3OUZ A;  5LGU A;  4U7C A;  3CC4 V;  2R92 G;  4LF9 B;  2L35 A;  4O4L A;  2FK1 A;  4DV3 H;  2W9A A;  4UCR A;  3HOV G;  3ETJ A;  4J9N A;  1HNX H;  1QVG U;  5LL6 b;  2CNV A;  4CH3 A;  4K0K H;  3KHR A;  2LP7 A;  2YXY A;  1EHI A;  4ASU G;  4JYB A;  4EGQ A;  2GHY A;  4CC5 A;  5BR8 B;  4QIW A;  2GDS A;  2DN9 A;  3MR3 A;  3C0F B;  1VEW A;  2EUL A;  2LGQ A;  4HNA A;  4UB6 Z;  4TT3 G;  4YR3 A;  1OBG A;  4PI2 A;  1D5N A;  2OLS A;  5JUM A;  3TJT A;  2WLM A;  3G8D A;  2C2A A;  3ZRW B;  2HLD G;  1Y76 A;  5C8Y F;  3B09 A;  4OXS A;  4O82 A;  3BQ1 A;  1BSM A;  2ODM A;  4DRX B;  3G4S V;  3FDS A;  4YB8 B;  2J6S A;  1XMQ B;  3BG5 A;  5IYD O;  2AHZ A;  4LF7 B;  1K5Q A;  4G28 B;  4UVA A;  2RDI A;  2P6J A;  4AQY H;  3HKE B;  3WB1 A;  3MWD A;  3IFX A;  4ZOL A;  5KG5 A;  4DV6 O;  2W6O A;  1OCZ B;  4O3P A;  4GYC B;  3B8N A;  4C2M A;  5D1O B;  3SE7 A;  4C5A A;  3OGC C;  2UXD B;  4LFB H;  4EYH B;  4FZ1 A;  1EUD B;  4Q44 A;  1GLV A;  4MVU A;  3GTP A;  3MFI A;  1B6Q A;  2WAM A;  4QWC A;  2EIM B;  3BRC A;  1Q6U A;  4DR2 B;  4JI4 B;  4X65 H;  5KT7 A;  4PHZ A;  5LP6 A;  4FFL A;  4BBS G;  1XK5 A;  1JPX A;  4DR3 H;  4LSX A;  3OFN G;  3H1J H;  2IH1 C;  1BQZ A;  1F23 A;  4H0L B;  4LF6 O;  4ECQ A;  3CCR V;  2UVR A;  4XYL B;  4J9K A;  4DV2 H;  1N33 H;  5BWT A;  3ZHS A;  2FP4 B;  5LHG A;  2FMA A;  3K3V A;  2X5R A;  5LXT F;  3HKD B;  4G27 B;  5A2Q W;  4X66 H;  3ASN B;  4CMF A;  2EIN B;  2IJH A;  4GX0 A;  2DLN A;  2XIG A;  5IP9 G;  2AGA A;  2Q8V A;  1SQF A;  5B1O A;  2Z02 A;  4TV8 B;  3UO2 A;  3T1H H;  3JAT B;  3OGI B;  3E8G A;  4YHH H;  1S5L Z;  1BL8 A;  1H2G A;  1ZX3 A;  3OAA G;  4ZHQ F;  4O3N A;  1JMK C;  3ORR A;  1Y4M A;  3CC7 V;  1ZQ7 A;  4JI3 O;  1VQ8 V;  1X9N A;  2YW2 A;  4JUZ A;  2BR0 A;  5F9L A;  1JLL B;  2PUS A;  2RCV A;  1ENV A;  1DTO A;  1K7D A;  5B66 Z;  3GV5 B;  1VF5 B;  1G4Y B;  3AG7 A;  3JYC A;  3HKC B;  4WFH A;  1M57 C;  5KFM A;  5KMG A;  2PYJ A;  4FLU A;  3G6B A;  4GKK H;  2EIM C;  4F50 A;  4IYI A;  1ARO P;  3DSQ A;  2Q2T A;  2UXX A;  5KT2 A;  2R92 A;  5KLV H;  4ECS A;  2R8K A;  3KAJ A;  4NZM A;  2Q7E A;  2B63 G;  2UUB H;  3VNN A;  4OX9 B;  2OCH A;  3JAL B;  3GIL A;  3PW2 A;  1IVS A;  1OCZ C;  4DV5 H;  5DGA A;  2EX3 A;  3MDS A;  3FKS G;  3DTF A;  2ZXW C;  2WB1 E;  4ED7 A;  3RBZ A;  1Z5V A;  2KKW A;  3VQY A;  4ZHQ A;  1HW7 A;  2VUM A;  4IIJ B;  4Q4D A;  3UCS C;  1GO3 E;  3HOY G;  3RYH A;  2ZKO A;  2CW7 A;  5E79 Z;  1OCC B;  3U10 A;  1SS3 A;  1S0M A;  2WYO A;  1M56 B;  2ZR3 A;  3U54 A;  2HP8 A;  2AZ0 A;  4DW1 A;  1N32 B;  5IYB G;  1I94 O;  1FFX B;  2Q7H A;  3CRM A;  1I5Y A;  1KP2 A;  4NKG B;  1SRY A;  5GTI Z;  4DV4 H;  3VPC A;  1M0T A;  3RIZ A;  5KFC A;  4FIP C;  4O4I A;  4Q6G A;  5H6Q A;  1NZ6 A;  2M6Y A;  3H1H H;  5J2T B;  1DK1 A;  2P4V A;  4HNV A;  3SI8 A;  2H3O A;  4DR4 H;  4NB5 A;  3BAC A;  3B40 A;  3RUP A;  5CB4 F;  3U9S A;  5IWA O;  4ED8 A;  2R84 A;  4ZOL F;  1AUX A;  1JVM A;  2XGP A;  2DPJ A;  3K0D A;  2MW2 B;  4BIU A;  4GKJ H;  1J95 A;  4UCT A;  2Z0A A;  3SDL A;  5LP6 C;  3U0G A;  2WDT A;  2WLI A;  2HFE C;  4JTC B;  5K2M A;  1Z2N X;  4LF4 H;  2DAB A;  4HZ3 A;  3E5N A;  3MHH C;  1XMO B;  2VQE H;  1FKA H;  2DW4 A;  2GUZ A;  3TEK A;  1ZWI C;  4UCV A;  4X1Y B;  1ZL8 A;  3ZED A;  4FM2 A;  4IYH A;  1PD3 A;  2PVP A;  1Y74 A;  2XAJ A;  5EZY A;  3RGB A;  5JWP A;  3K5O A;  4O4H A;  3K5L A;  1V54 C;  4IHJ B;  2R8I A;  5KHI A;  4J42 A;  1SYX B;  1P16 A;  1WN7 A;  2W9B A;  1EZJ A;  3WG7 B;  4CC6 A;  2P0A A;  3RB3 A;  5H9C A;  2QTO A;  3E8H A;  2PTM A;  4DV5 B;  3WWH A;  3DC6 A;  3AG4 C;  1BMF G;  3HKZ A;  5JQG B;  4ECV A;  3LDE A;  4F6E A;  2FL4 A;  4FM1 A;  4B3S H;  1NI8 A;  1R3K C;  2HGS A;  4J9R A;  3P30 A;  1WPX A;  4UUG A;  1LNQ A;  4FFN A;  3GIJ A;  3RR5 A;  4A3F G;  2R8G A;  1HNW H;  4UB8 Z;  2UUC H;  5IJ9 A;  2IBK A;  4X64 B;  2ZM6 B;  4JI5 O;  1FXK C;  1OJH A;  2XND G;  3AG1 C;  4O4J F;  3SYA A;  2UUA O;  2B9Z A;  4FLZ A;  1IBK B;  2UUB B;  3DF7 A;  3UO3 A;  1IBM B;  2IH3 C;  4O7R A;  1S97 A;  2BSK A;  2AW9 A;  2C35 B;  2YXL A;  5KFU A;  3CB2 A;  1BQ0 A;  4J7Z A;  1ET0 A;  3JRX A;  5BYA A;  1R3J C;  1TUE B;  2FK2 A;  2W0F C;  1XHZ A;  3PVX A;  2QKS A;  1DF4 A;  1Z5W A;  4AYB E;  2PN1 A;  1WB8 A;  3HKE A;  1F4M A;  1H2N A;  3HKB B;  4FK5 C;  3RYC B;  1P8L A;  3KCX A;  1XI1 A;  1EFR G;  5BZB A;  5IYZ F;  4JV5 B;  5IT9 W;  1S5J A;  4OX9 O;  2IBZ H;  5JH7 A;  4X1Y A;  2P06 A;  2Q73 A;  2YSU B;  4A2A A;  2ZDH A;  3JAM N;  1VAJ A;  5LA6 B;  4FGR A;  3T9D A;  4RO2 A;  3CS5 A;  2QWP B;  2ETN A;  1TUB B;  3OR7 C;  4FLT A;  3TET A;  4DL2 A;  1QLN A;  4QE9 A;  5H6R A;  1H2M A;  3Q8R B;  3ZX6 A;  5BMV F;  1FJG H;  3FAV A;  2UXC H;  1TWC A;  1LR1 A;  3RGZ A;  2CNQ A;  4UVC A;  2OIE A;  2VUM G;  5LHI A;  2E2H A;  1CKN A;  4CS4 A;  4RQF A;  5KFI A;  1B6S A;  4J7J A;  3CJH A;  1JFF A;  4O81 A;  1NH2 D;  5KG7 A;  2Y0P A;  3CRR A;  4TV8 A;  3L75 H;  2IA6 A;  3CE2 A;  1FJG O;  1Q90 D;  4YIP A;  5L1K A;  5CA3 A;  5JVD B;  1VQ4 V;  1I7N A;  2C2E A;  1R1B A;  3GLK A;  3HOX G;  4DV6 H;  2XAF A;  4DL6 A;  3ABU A;  3M9O B;  3OMA B;  2W9B B;  2W6N A;  4G3I A;  3KHG A;  3CRQ A;  3L2P A;  4X20 A;  4MAM A;  1SA0 B;  3TW7 A;  2YEV B;  1K4C C;  2E3C A;  1SQP H;  3QVN A;  4ED1 A;  4I50 A;  4GKJ B;  4MA5 A;  4ED0 A;  5A2Q N;  1XRE A;  3K57 A;  3B8M A;  3GID A;  3HB3 B;  4PEL A;  4CE5 A;  5D5P A;  1AR5 A;  3SJA C;  3ZN1 A;  5I60 A;  5BWV A;  3N44 B;  2VS0 A;  1GYF A;  1OHH G;  3BVO A;  2VPQ A;  4U7N A;  4XDK A;  2UUA B;  2QWO B;  2C2R A;  1IX9 A;  2ZNI A;  3OMI B;  4Z2W A;  4QJF A;  1K1S A;  4LF9 H;  2UU9 H;  3PO2 G;  2PMZ A;  2WLL B;  1Y1W G;  3LSS A;  3JAW B;  4DW0 A;  1H8E G;  2JA6 G;  4U3F H;  1GRJ A;  2DWE C;  1MZE A;  4MVQ A;  3FAV B;  4UXN A;  1CE8 A;  4P9O A;  4DV4 O;  4JAS A;  1SER A;  4AYB A;  4DUZ H;  5DGB A;  3T54 A;  4MV4 A;  1N48 A;  5K3W A;  3J7A K;  3HXL A;  2FK3 A;  1K73 W;  1Y14 B;  1WR2 A;  1PKX A;  4I50 B;  3W7S A;  1Q43 A;  4F6R B;  1HNW B;  3J81 N;  1YCI A;  4DV0 O;  2UUC B;  3UZB A;  5FPO A;  3W1G A;  3T9F A;  5L3C A;  4JAA A;  3CCS V;  3SR2 C;  4RUC A;  3D36 C;  1PK8 A;  1RK5 A;  5LYJ A;  1T3N A;  3PR5 B;  4JI0 B;  4E6N A;  3MD0 A;  3W5O A;  3UM7 A;  4DV2 O;  4B3R O;  3JZF A;  3KCY A;  3NC0 B;  3OD4 A;  1K1Q A;  2VQE O;  4PWQ A;  1W59 A;  1M90 W;  4MVS A;  5JVL A;  2QM7 A;  1FFX A;  4FFR A;  1KQS U;  4TQS A;  2Q6A A;  4I0X B;  3CRA A;  2KG7 A;  1GH6 A;  3JRW A;  2YIB A;  5KFE A;  5LA6 F;  2VWJ A;  5LMU H;  4J41 A;  1K83 A;  2PMZ E;  4GZR B;  1TWG A;  4LF8 B;  2ZJT A;  2EIK C;  2FML A;  4PV1 B;  1Y1V A;  1NR1 A;  2ATK C;  4MS2 A;  4GKK B;  3G6X A;  1YVW A;  4O7S A;  2VPS A;  2ASJ A;  4DL5 A;  1IBM O;  3OEE G;  2WLL A;  1CEZ A;  4NXN H;  3KXY T;  2L6L A;  2PF4 E;  5CN0 A;  2NU7 B;  2ADQ B;  2X0S A;  1R6T A;  1E4E B;  2OIG A;  4EYI B;  4TUY B;  5KKN B;  4RCN A;  5KT6 A;  2QKC A;  4I4T F;  4FBU A;  1OCR B;  2CGO A;  3O65 A;  3N43 B;  1I2K A;  5HV6 A;  5EBM C;  2VR1 A;  4X1K B;  3UT5 B;  2V4R A;  2GSM B;  4MTE A;  1BCC H;  4DUZ O;  2ZXW B;  4H37 A;  2UVU A;  4O7L A;  3I4N G;  4KHP O;  2IW5 A;  3K3P A;  5EWE A;  2QF7 A;  4JI6 O;  3A0B Z;  4GLW A;  1N33 O;  4J9Q A;  2VA2 A;  1HNZ H;  2Z04 A;  5CBG A;  4DUY H;  2Y4R A;  2HEP A;  4N23 A;  1Q81 W;  4MT8 A;  4B3R B;  4DK1 A;  4TSF G;  3GTQ A;  1P49 A;  3ZRV A;  4QWA A;  2YDE A;  2XGQ A;  3T1C A;  4JYY A;  3RYI A;  3ZHQ A;  4ED2 A;  4X62 H;  3A0H Z;  2P22 C;  4U3J B;  5EYP B;  4O4L F;  1Z2O X;  2Q5Z A;  1K33 A;  1JOY A;  2QK4 A;  2MK3 A;  4U6P A;  1XNR B;  3LUT B;  1IBL B;  2E76 B;  1TAE A;  4LCU C;  1U97 A;  1XMQ O;  4WHX A;  1AR4 A;  3WO0 A;  1RK6 A;  2QWR B;  4DLK A;  4MW8 A;  4O4L B;  3WB0 A;  2NU6 B;  3RT3 C;  4U7O A;  3TK1 A;  4ECT A;  1JR9 A;  5CB4 A;  4DV4 B;  4RZR A;  1H2S B;  1I1K A;  4DV5 O;  2V7Q G;  4DV1 H;  1VAR A;  2E5L B;  3T9B A;  5BWU A;  4LF4 O;  1BXR A;  4P30 A;  1JQ0 A;  3OUU A;  1CKM A;  2UXB H;  2YCH A;  2COJ A;  2GBO A;  5IYD G;  4QWD A;  4BW5 A;  1BHA A;  3KAK A;  1K5S A;  3NXS A;  3SJB C;  3CCE V;  5LMU B;  1WAZ A;  2FB9 A;  4YJ2 A;  2OWO A;  4JI7 B;  4DV1 O;  3RV3 A;  1GN4 A;  2YID A;  2VQF B;  1DIK A;  3K5I A;  2X7R B;  4WFB V;  3GV7 B;  3T1Y H;  4PDB A;  3ABT A;  1GM8 A;  3ZRS A;  2BOB C;  5H5N A;  5LOV B;  3CCL V;  3EFF K;  3LSU A;  5IJ9 B;  2DYR B;  4TOI A;  4A3M G;  4Q8F A;  1KJ8 A;  3X2Q C;  5EBW C;  4RQE A;  3EVK A;  2YI8 A;  4PDR A;  3ETD A;  4PZ6 A;  2JA7 A;  4TQR A;  1A0G A;  1N36 H;  3V4Z A;  2C22 A;  3PW7 A;  5LOV F;  1DAA A;  1IUR A;  5K1X A;  2W70 A;  3CWB H;  2FE3 A;  4QWE A;  3CVZ A;  3L73 H;  2BE3 A;  4G2K A;  2RJZ A;  1T94 A;  1K3E A;  3DC5 A;  4Q43 A;  4JZG A;  1L2Z A;  2JVD A;  2YEV A;  3MWE A;  4DR7 H;  4X64 O;  2ZM6 O;  5I5Y A;  5D1P A;  1XHX A;  3IC9 A;  5KAF Z;  1RM1 C;  4DR2 O;  1AJQ A;  3TW6 A;  3LP8 A;  1V9P A;  4I4T B;  2YS7 A;  2W7P A;  2HVS A;  1WNS A;  3FB6 C;  3J7A U;  3TY8 A;  3OR6 C;  4O2B B;  3T5K A;  1SQX H;  5KUM A;  5KFO A;  4ECX A;  4TV9 A;  2CH7 A;  4AHC A;  3GTL A;  3WO1 A;  4GUN A;  3RFR A;  2DYR C;  5BR8 H;  1FFT B;  1K34 A;  2P67 A;  2Q0O C;  2YZM A;  4O86 A;  4B3M B;  4UCU A;  4RU9 A;  2E74 B;  2QJ1 A;  3JAW A;  1Z2P X;  3N8D A;  4B3T O;  1V54 B;  1ZTE A;  2OCC B;  2AXT Z;  3CCV V;  2R70 A;  3CEB A;  3GII A;  4IGG A;  4O2A B;  3S24 A;  1N32 H;  3BA8 A;  3CCM V;  2J6T A;  4WFF A;  3H20 A;  2YIA A;  1I1L A;  4RAZ A;  1O9H A;  1MA1 A;  2WLJ A;  3HR0 A;  3ZN0 A;  2FPP B;  3G67 A;  3HPL C;  3E35 A;  4IRD A;  5BR8 O;  1KBL A;  4O83 A;  4GKJ O;  3N2K A;  4FFB B;  3N6X A;  4CKB A;  1R73 A;  1GSO A;  4MVM A;  3RVZ A;  4O3O A;  1Y66 A;  4EFE A;  1E1Q G;  2YI9 A;  4NVP A;  3F5T A;  1HNX O;  4F4L A;  5KFH A;  4PA9 A;  4O7W A;  2VOB A;  1JX9 A;  5L9X A;  1SKV A;  2JA8 G;  3AX6 A;  4NXM B;  3N27 A;  4GX1 A;  5KFB A;  5EWG A;  1JA8 A;  5KFX A;  4B08 A;  3HOW G;  5I5T A;  1YTF B;  2BQR A;  1A48 A;  2IJI A;  3STZ C;  1XOU A;  2YZN A;  2OH2 A;  2EBO A;  3U0Z A;  2HVK C;  3LDD A;  2R72 A;  4LSA A;  2YZG A;  2QKA A;  1I94 H;  4AIL C;  4X66 B;  2FB5 A;  4TM5 A;  3OSP A;  2ALZ A;  4NTX A;  2HVQ A;  2ITC C;  4AQY O;  4BY7 G;  2YL2 A;  1J5E O;  4XZ3 B;  1J5E B;  3KYH C;  5L3B A;  1ZHS A;  3FD9 A;  1KBH A;  3GTJ A;  1JJ2 U;  5LP6 B;  3ML0 A;  1Q6I A;  4MTG A;  4JI8 H;  1E1R G;  3WNZ A;  4DUZ B;  2ZDI C;  4JF3 A;  3EPI A;  4ICG A;  4DV6 B;  3RFC A;  1YIJ V;  1GGO A;  2VQF O;  1GTO A;  5IYZ B;  5E1A C;  2W9C B;  4X62 O;  2MCT A;  5KFS A;  4LF6 H;  4J9P A;  3TQ1 A;  1I7F A;  4DXW A;  1S72 V;  3BQ2 A;  2ASD A;  1COW G;  5IDJ A;  1N34 B;  1BNC A;  3K04 A;  3CYO A;  3E8B A;  1XIL A;  2WAQ E;  3JD1 A;  3H40 A;  1PX2 A;  2UU9 B;  4FFP A;  2FYU H;  3E22 A;  5BMV B;  4JI0 H;  3BQ0 A;  4RAY A;  2NUA B;  1RSO A;  3ABM C;  2FLN A;  4BAY A;  2UXN A;  5DLG A;  1Y1V G;  2IM9 A;  3JAR B;  1R3L C;  4HR7 A;  1GSA A;  3SYO A;  4HN2 A;  3UYY A;  1RYR A;  4W4L A;  3RVY A;  2QA4 V;  3K08 A;  1JDE A;  1KT8 A;  2R7Z G;  1BE3 H;  2YUA A;  1M56 C;  5T14 A;  3SPC A;  5CE8 A;  2P7T C;  2QB5 A;  2KG7 B;  1CKO A;  5EBL C;  4B7K A;  4PZ7 A;  3GWO A;  3OTO B;  4ZQI A;  3RJ0 A;  4R50 A;  3K9A A;  4NYK A;  3UZO A;  3K9S A;  4KFM A;  4YQW A;  1S03 G;  4J10 A;  4JI7 H;  3L70 H;  1XBL A;  2JK5 C;  3SYP A;  1R6K A;  4FLX A;  1EKF A;  5L1L A;  2QSA A;  4LFC H;  2R7K A;  1JKJ B;  2XAQ A;  4DUY O;  2B63 A;  1W0K G;  4WF9 V;  3HKD A;  4EB6 A;  2WA3 A;  1VP7 A;  4JV0 A;  3QG5 A;  1BJT A;  4K0K O;  4X65 O;  4A3I G;  4DR6 O;  4IRK A;  5KFF A;  5BPH A;  3HKB A;  1YSC A;  2BCC H;  1QVF U;  1N33 B;  4LFA O;  1M9N A;  1UC9 A;  5KX5 F;  5KFA A;  5GW7 A;  1SFO A;  4JV2 A;  3OUS A;  3T7A A;  4IT5 A;  3WG7 C;  3FB7 C;  2JEX A;  2JS5 A;  2R9I A;  2ZIM A;  5KT4 A;  3OHB A;  5H80 A;  3K5M A;  3OT7 A;  5BYB A;  4KXR A;  2B1I A;  2J9G A;  1IYE A;  1GSH A;  4GT1 A;  2HIV A;  5BMV A;  2R7N A;  2HJD A;  2JEU A;  2WSS G;  2F23 A;  2JA6 A;  3S3W A;  1EZV H;  4EFB A;  4JI2 H;  3F5W C;  2QEX V;  5GON B;  5J2U F;  1UJW B;  3L9D A;  3GTM A;  1SCU B;  4JYA O;  4JAV A;  3KG2 A;  4QSH A;  3GIP A;  1N34 H;  2W9C A;  3C90 A;  2V58 A;  3A8T A;  3ETH A;  1KYO F;  1F51 A;  3Q8P B;  1V4Y A;  5C4X G;  2DIK A;  3DAA A;  1KEC A;  5JJE B;  1NS1 A;  1VF6 A;  3T1H B;  2EIY A;  3VPD A;  2COG A;  5FLM G;  2F43 G;  4JI3 B;  5CA1 A;  3HB9 A;  2ZCE A;  5KFP A;  3P3P A;  1L1F A;  2UUB O;  3CC2 V;  1KMI Z;  4XDJ A;  4JI4 O;  4NR1 A;  2Q7D A;  2OTJ V;  3L4K A;  4ABM A;  3CPW U;  4TV9 F;  4A3D G;  1IBL O;  3ZMV A;  1HNX B;  5I5W A;  5F2V O;  5CA0 B;  1I6U A;  1XNQ O;  3AW8 A;  3JSN A;  1OBD A;  2JIZ G;  4FVM A;  1NU1 H;  4R8C A;  2P90 A;  4H13 B;  3G71 V;  4B7E A;  1I5X A;  3OTO O;  1D5A A;  2ZIN A;  4K8Z A;  5CBF A;  2WA4 A;  4LNU B;  1DF5 A;  1XQ8 A;  3E83 A;  3JD0 A;  2CW8 A;  2R8J A;  1CS0 A;  4RNN A;  4YXW G;  3N6R A;  4EKW A;  3TQT A;  5DG8 A;  3NBY B;  3T9A A;  2W0X A;  4JV5 H;  4LF7 H;  5KFR A;  2BTO A;  1KKD A;  1M1K W;  1FXK B;  3AG1 B;  4YY3 B;  4JI1 B;  2Q0A A;  2R85 A;  4EBE A;  1CP9 A;  2ZE7 A;  1T36 A;  2V59 A;  4NLG A;  2EJ7 A;  3K59 A;  2LO1 A;  5B1B C;  3SPG A;  2UVV A;  2HGX A;  4JYA B;  2ITD C;  2Q69 A;  2Y69 B;  2GQS A;  3G8C A;  4DV3 O;  4XX0 B;  5EIB D;  5KAI Z;  4DR4 B;  3JZI A;  1Y6X A;  4IZO A;  4J9Y B;  1ZET A;  1EZ1 A;  3RYC A;  4H44 B;  4BWS C;  3F7Y C;  2A0L A;  3QO8 A;  1TWF A;  2GV9 A;  1KEE A;  1EKV A;  3BY6 A;  5LHH A;  5B1A C;  1UNN C;  2FLL A;  2JDI G;  1IOW A;  2CUG A;  4CMD A;  2WB1 A;  1YIT V;  1N36 O;  1PL0 A;  3ICX A;  5KA6 A;  5FNV F;  1P84 F;  3HKC A;  2JA7 G;  4MTO A;  2CTW A;  1Z2G A;  2VQF H;  4ZKI A;  3IG0 A;  5IJ0 A;  1PNK A;  5KA5 A;  2HVR A;  1WPB A;  4NXM H;  1DLB A;  4IRC A;  3GIQ A;  5KX5 B;  1UPG A;  1L8D A;  1HR0 O;  1S76 D;  5CM0 A;  2GQR A;  4B3T B;  3V6J A;  4D6T H;  5LMN O;  3GIK A;  3LUL A;  4BXX G;  3H0G A;  4LF4 B;  5KFN A;  1N0J A;  4A3C G;  2XAG A;  3M9M B;  3TY5 A;  5BPF A;  3I12 A;  3T9C A;  3CXH F;  1YJ9 V;  1S5H C;  3CX5 F;  5JCO A;  4RAI A;  5KUK A;  4QIW E;  4MVZ A;  5LMU O;  3MR2 A;  2R7M A;  4CS3 A;  2FTK A;  4DR3 O;  5ITZ B;  5JQG F;  2FKX A;  4M0J A;  1FPO A;  1VIB A;  2Z5U A;  2FPI B;  5JCO C;  2EJ0 A;  1IBK H;  3U55 A;  2Y4U A;  2UUA H;  3SPI A;  4DIM A;  4CH6 A;  5L3D A;  3UFX B;  4RZQ A;  4YR2 A;  5J2T F;  3QTC A;  4NTY A;  5JJN B;  4LFC B;  2WE6 A;  5IYC G;  2ARH A;  4GCZ A;  2E5L O;  3SPJ A;  3N2K B;  1W0J G;  4FFB A;  5EC1 C;  3L72 H;  3CMA V;  3ABL B;  5DGH A;  3D8C A;  3F8N A;  5DGI A;  1E79 G;  2XUM A;  3DTG A;  2N74 A;  4ZHQ B;  4LFA B;  4YIO A;  2FJZ A;  5KG1 A;  4IR9 A;  1B06 A;  2X6A A;  5KG6 A;  5CMU A;  1I3Q A;  3RN4 A;  3JAK B;  2B1G A;  4JI3 H;  5DIS C;  3SYQ A;  2V4Q A;  2WPD G;  5CR5 A;  1VF6 C;  4X20 B;  4QE7 A;  4YJ3 B;  2KSW A;  1IOV A;  1XUQ A;  1XDN A;  4I55 F;  4EB6 B;  4F4W A;  1N8R W;  1AVM A;  4HBN A;  4R7C A;  2R93 G;  1K4D C;  3RYI B;  5CB4 B;  5KFV A;  3V6H A;  2WLI B;  1VQP V;  3FKI A;  3AK1 A;  1QLE B;  5LMN B;  2C00 A;  2BQ3 A;  2E75 B;  3PW0 A;  1KKC A;  2JGD A;  4UCS A;  2UXC B;  5LXT A;  2H94 A;  5KFW A;  2D3O W;  3KHL A;  3K06 A;  4A3G G;  1SET A;  1WA8 A;  5KFL A;  4DV0 B;  5EZY B;  4X65 B;  4KHP B;  5J2U B;  5GON F;  2A79 B;  2PZS A;  4JI6 B;  4B3M O;  2JEI A;  2YWV A;  5JQW A;  5B1A B;  4MW3 A;  4RB3 C;  3D3Q A;  3T4Z A;  4MV6 A;  3CEI A;  2DAA A;  3TII A;  3TIN A;  1NVP D;  4RWU A;  4I55 A;  5J9P C;  2RDC A;  4JTA B;  2IMW P;  4Q0Y A;  1I50 A;  1XNQ B;  1SEI A;  3QFF A;  1WP7 A;  2DZD A;  1YZB A;  2JJ2 G;  3GWK C;  1VS0 A;  5KG3 A;  1SZT A;  4X89 A;  3DXR A;  4DR1 B;  4LF5 B;  1TWA A;  3WU2 Z;  5KHK A;  2BQU A;  4MV1 A;  3BEH A;  2HIX A;  2JS3 A;  1B04 A;  1BZK A;  2RMK B;  1JDB B;  1ROP A;  2YZL A;  5LL6 Y;  3AG3 B;  3V4S A;  1XNR O;  3W7U A;  2EJ2 A;  2AZ2 A;  1C30 A;  3W1B A;  3VA7 A;  2Q68 A;  4HYK A;  2W71 A;  3O9O A;  5EDW A;  4NYE A;  1M0W A;  4QW9 A;  4CHI A;  2I8C A;  1VQK V;  1AUV A;  3GQC A;  3OM3 B;  1T5E A;  3QNE A;  2BSK B;  2LFS A;  3SGI A;  2Q2U A;  3R9R A;  4JI0 O;  3OE7 G;  2RGV A;  4L87 A;  5LYJ B;  4JPR A;  3ZMS A;  2W6I G;  4MTX A;  2IJJ A;  4HYO A;  4A5U B;  5L1I A;  3AG2 C;  1SC5 B;  5BWW A;  2DPI A;  3IGA C;  1GN2 A;  3RW0 A;  1VBG A;  5BY1 A;  5LOV A;  1AP6 A;  1L0N H;  3J81 W;  5DLF A;  3HOU G;  1FXV A;  2GTA A;  1P7G A;  5DEC A;  3ZIA G;  3G6V A;  3J80 N;  4ECR A;  3FX7 A;  2ZR2 A;  4CZZ A;  2Y0S A;  3RB0 A;  3H1I H;  1MAB G;  4JI1 H;  5D8D A;  1URF A;  3LNN A;  1I1M A;  4DQN A;  2ATL A;  3EYY A;  2Q4P A;  3CQZ A;  2CH7 B;  2V9W A;  1TUB A;  4JI7 O;  4QW8 A;  5C1O A;  2AGQ A;  1S0V A;  1M7J A;  4CH5 A;  5B3S C;  2DYS B;  3VPB A;  2VA3 A;  4J9O A;  4I4T A;  4EGJ A;  2J6U A;  4Z1V A;  3I55 V;  1H2K A;  3B4S A;  5FLX W;  4F4Z A;  3QO5 A;  1KUQ A;  4HNA B;  3GJX B;  1A0I A;  3K0G A;  1G1X B;  4O7T A;  4X1K A;  5LA6 A;  4J9S A;  2UU9 O;  1WSC A;  3ORQ A;  4DR2 H;  5A9G A;  5J2U A;  1WRV A;  2UUC O;  1NJI W;  1WH2 A;  5KFK A;  5EOY A;  5IWA H;  2EIN C;  1EM1 A;  3SYC A;  2DQ3 A;  3RYF A;  4DL7 A;  4PI0 A;  3T2M A;  2ZIO A;  3LWB A;  4O2B F;  2RNB A;  4K6N A;  2CNU A;  2V5A A;  2EJR A;  2XAH A;  5BWR A;  5IJ0 B;  2YS6 A;  2VQE B;  5K1P A;  1RP3 B;  3GB7 C;  3JAS B;  1K97 A;  5FR9 A;  2W6Z A;  3TIG A;  3AG4 B;  2QTS A;  4ECU A;  3AG2 B;  4J9M A;  3QZ7 A;  1CQI B;  3M9N B;  1HP8 A;  4WFE A;  4LFC O;  5B1B B;  4IR1 A;  2WAQ A;  4NXN B;  1LUV A;  2CAZ C;  2W6J G;  1Y1W A;  5IP7 G;  2NU8 B;  4E4E A;  4PZ8 A;  2M7W A;  3ZMZ A;  3R5X A;  3BAB A;  2FPG B;  1MZB A;  4ZI7 B;  1TWH A;  3D36 A;  3BCC H;  1OZ0 A;  1JXL A;  5KHG A;  2A06 H;  4LFA H;  1AIL A;  1NBM G;  3BA9 A;  2YS8 A;  4AI8 A;  2UXB O;  3EPG A;  2Z3Y A;  4J80 A;  1XNQ H;  1DGS A;  1IDS A;  2YU9 A;  4YR0 A;  4JI5 H;  4X9Q A;  2NVX A;  3M99 B;  4LF6 B;  2OCC C;  4O3R A;  1HNZ O;  3LML A;  4WD3 A;  4FBT A;  4WBN F;  2HR3 A;  4F6R A;  4DR7 B;  2HHH H;  1RJP A;  1KC8 W;  3AK2 A;  3I4M G;  4H33 A;  4FPP A;  4YY3 H;  2W6Q A;  1QHT A;  3NGD A;  2XCL A;  5KMG B;  1EN4 A;  1KB9 F;  3WB2 A;  4FFK A;  1N56 A;  4YJ2 B;  3CME V;  3PJS K;  1K92 A;  3ZJZ A;  4P2Z A;  4JYA H;  5LMN H;  3JAR A;  1AI7 A;  2CE4 A;  1I0H A;  3IC7 A;  1NVP B;  3QZ8 A;  4RNO A;  4E4T A;  2CK3 G;  2YC0 A;  4K3A A;  1XL4 A;  4JV1 A;  3JAL A;  2F1M A;  3Q8S B;  2P5O A;  1SQV H;  1GMG A;  3VOU A;  2QWN B;  3PO3 G;  1M93 A;  1YJW V;  4O4I B;  3KRE A;  2ABJ A;  5IY5 C;  1MMM A;  2EZO A;  5KS8 A;  2Y48 A;  2X0L A;  2V1D A;  4R8U A;  1VQN V;  3JZ6 A;  4DR5 O;  4M7E A;  1RSO B;  3TCU A;  1P7B A;  4JI4 H;  4J7K A;  2ZNJ A;  3ZS8 C;  3APO A;  4ZI7 A;  4YJ3 A;  2NU9 B;  1OCC C;  5B1N A;  3K3W A;  2PYL A;  2I80 A;  2Y4T A;  1XL6 A;  3T9E A;  1CPY A;  1HWY A;  3WFV A;  2LJ2 A;  4RNM A;  3JAM W;  4TQF A;  4I0X A;  3T99 A;  3GTG A;  2GUZ B;  1E4F T;  4PD4 F;  4O7Y A;  3G6Y A;  1ZL8 B;  1O9G A;  4MVO A;  4QNH B;  2O03 A;  4YJ3 F;  1FXK A;  1GK9 A;  2R8H A;  1QNM A;  1GM9 A;  2PY5 A;  3LNM B;  4O2B A;  2QDO A;  4O7Z A;  2WTF A;  4DV0 H;  2C28 A;  3D3I A;  2R82 A;  1WJZ A;  3RBD A;  4LF7 O;  5CA0 F;  5IE9 A;  3SNO A;  4K35 A;  2SCU B;  1TVK B;  2IJK A;  1XDC A;  5I47 A;  4XYM B;  4BW9 A;  3M8A A;  3AK3 A;  5DMX A;  5HNE A;  4OPA A;  3JD4 A;  5DG9 A;  1S68 A;  4O2A F;  1ULZ A;  4UCO A;  1W2B U;  3EXA A;  3SJQ C;  1KTA A;  1VQO V;  4EEY A;  3MJF A;  2JA5 A;  3STL C;  1HDJ A;  4DR7 O;  1SQQ H;  1HNW O;  2N04 A;  4Q20 A;  3BPZ A;  3EHB B;  1A32 A;  5C93 A;  1G6U A;  2F93 B;  4A3K G;  2DOS A;  2RF4 A;  5KG2 A;  4LF9 O;  4O3S A;  1GAX A;  1OCO B;  4GX2 A;  1NQT A;  4DR1 O;  4LF5 O;  4I5S A;  4A3B G;  1Q7Y W;  3SJC C;  4ECW A;  2QM8 A;  4PDV A;  3ETG A;  1N0N A;  1ZSP A;  4LH7 A;  2F4V O;  3R5F A;  1A3G A;  3FB8 C;  4RB2 C;  1TVK A;  1WP8 A;  4I9W A;  5JVD F;  4LH6 A;  4JI8 O;  5EIB C;  4AQY B;  2Y0S E;  3LSQ A;  1VQM V;  3AYH B;  4Z1M G;  5LBQ A;  4OX9 H;  2WLN A;  3JCU Z;  1QLE C;  4E2L A;  2Y69 C;  3UQ8 A;  4JAU A;  2C2D A;  3T5L A;  5KHH A;  3BHP A;  4B3M H;  1NT2 B;  3GV8 B;  3MAQ A;  3T5H A;  1JJO A;  5C8Y B;  2LW7 A;  3PN1 A;  2P4K A;  4FFO A;  1JFF B;  4FS2 A;  4J11 A;  4A3E G;  4LNU A;  1WCM A;  2EJ3 A;  4MVR A;  3R65 A;  1GN3 A;  1KU9 A;  3E2E A;  3PR4 A;  2HJF C;  4O4I F;  5FJ8 G;  2YRX A;  2UXB B;  5FLX N;  2OYQ A;  5C1P A;  1F4N A;  4QWB A;  3U9T A;  3VOT A;  5DED A;  3RYH B;  4EEQ A;  2ZQM A;  4D7S A;  2XCP A;  4FS1 A;  2HKO A;  1MNG A;  4DV7 H;  1L0L H;  4UFZ A;  2DE0 X;  3E22 B;  4UVB A;  4DR5 H;  3RAX A;  4YHH B;  4FE2 A;  5TIS Z;  2EZP A;  3JD2 A;  2RN9 A;  3LQS A;  4LC1 A;  4ZBM A;  1MG1 A;  4P9P A;  1BS3 A;  4GC7 A;  2R9R B;  3Q2O A;  4Y8V B;  5DQH A;  4K8X A;  3RV4 A;  3VMM A;  4I7Z B;  3PFF A;  4FZ0 A;  1RJR A;  4MTF A;  3RAQ A;  5C5J A;  3C3S A;  3H01 A;  3RF2 A;  4GC6 A;  1RFY A;  4WFG A;  2F4V H;  4PA6 A;  3GTK A;  1VKZ A;  1H8H G;  4PBC A;  4O4H B;  2JEG A;  5KFJ A;  4OGQ B;  5JJJ B;  4IHJ A;  4F4X A;  4UV9 A;  3OSN A;  3NUA A;  3H1L H;  2DWD C;  2AGP A;  4DRX A;  2F66 C;  3KKY A;  3K03 A;  4O7N A;  2CTP A;  4X1I B;  1Q8I A;  3IAY A;  4O4H F;  3GTO A;  2IU3 A;  5D5Q A;  3L74 H;  1XMO O;  1X59 A;  4L1K A;  1SZX A;  4F4Y A;  4Q8E A;  3IN5 A;  5J2T A;  1YEW A;  1JCH A;  1B3Q A;  2EIJ B;  1S0O A;  3VQX A;  4BIO A;  4PDL A;  2M05 A;  1HR0 H;  2ZGI A;  3QF7 A;  4PA7 A;  2FKL A;  4EBC A;  2ODT X;  1PNM A;  4IHJ F;  4DO2 A;  2ZDI A;  1XMQ H;  2CFM A;  3I5D A;  3K79 A;  3AG3 C;  4RUE A;  2A3Q A;  2EIJ C;  1M5I A;  3A0R A;  3CCJ V;  4R7R A;  4NZN A;  2RGR A;  5DG7 A;  3FYI B;  3I56 V;  4MA0 A;  3S3X A;  2UVW A;  4DV1 B;  5D1O A;  2XC9 A;  2W6P A;  1SF9 A;  1IYD A;  3ZMT A;  1B6R A;  4UUJ C;  4DV7 O;  4W4K A;  2ZDQ A;  2R7Z A;  1G2W A;  3ZCC A;  4MV7 A;  1SES A;  3ZBH A;  1ZHQ A;  1KJJ A;  1G8M A;  5KG4 A;  2R6F A;  1XEQ A;  4IWY A;  5B3S B;  3ETQ A;  5GON A;  5HFL A;  1AI5 A;  1C3O A;  2DQ0 A;  3OMN B;  5L3E A;  5L1J A;  4LF8 O;  1YF2 A;  3UKM A;  4TWK A;  1F7Y A;  2JA5 G;  4KL1 A;  1VQ6 V;  4X1I A;  5IY5 B;  3ZHR A;  2ZD9 A;  2ZT9 B;  2XCA A;  4MV3 A;  3L71 H;  3HOZ G;  5EC2 C;  4JI2 O;  4JV5 O;  3CSW A;  2R93 A;  2XTA A;  1Q82 W;  1K9M W;  3IJ4 A;  1U96 A;  2XAS A;  1WA8 B;  4JYC A;  3T1Y B;  1YI2 V;  5IYB O;  5CA1 B;  4C5B A;  1MZF A;  4YAK B;  4NTW A;  4IWX A;  2Q9L A;  1NKD A;  4QIW F;  1JX4 A;  1OCO C;  4CKE A;  3CP1 A;  5KT3 A;  3E8F A;  4RUF A;  3JSL A;  3HBL A;  1QR9 A;  2IU0 A;  4X8A A;  1GM7 A;  2JJ1 G;  4I9Q A;  3ABL C;  4EBD A;  1FVI A;  2A1H A;  2W57 A;  1AI6 A;  1VBH A;  1IXB A;  4JI1 O;  2E2I A;  4YY3 O;  2W7O A;  1OV9 A;  3RTX A;  3E86 A;  2R86 A;  5I5U A;  4X64 H;  2ZM6 H;  3R23 A;  1NH2 B;  3V6K A;  2W6M A;  4A93 G;  1SA0 A;  1HNZ B;  5JH7 B;  1KD1 W;  3P32 A;  4UV8 A;  3ZRX A;  3DXR B;  1EN5 A;  3Q8Q B;  4GLX A;  1RPO A;  1Y67 A;  4LBE C;  1M6V A;  3MR6 A;  4B3R H;  4DR4 O;  4FLW A;  1RJQ A;  1MSD A;  4YP3 A;  1S3J A;  1TGO A;  2YIC A;  1FD9 A;  2PI5 A;  1EYZ A;  1SQG A;  5KHJ A;  3W7T A;  1KP3 A;  4WCE V;  5KFG A;  4U3J A;  1IZ3 A;  2KQX A;  5EYP A;  3H4B A;  5IYC O;  1EUC B;  3M7M X;  4C5C A;  2AHY A;  1CQJ B;  3FMA A;  3NR7 A; 
#chains in the Genus database with same CATH homology
 3M4I A;  4B3M B;  4UCU A;  4CH5 A;  2QJ1 A;  3JAW A;  1Z2P X;  1Q5O A;  1N32 B;  4I4T A;  2R70 A;  1FFX B;  2Q7H A;  3U11 A;  4O2A B;  3S24 A;  1N32 H;  3BA8 A;  4DR6 B;  5FLX W;  3H20 A;  2YIA A;  4DV4 H;  4RAZ A;  1O9H A;  1M0T A;  4HNA B;  3GJX B;  3RIZ A;  4DV7 B;  4DR5 B;  1A0I A;  3N6X A;  3N2K A;  4FFB B;  4X1K A;  4O4I A;  4Q6G A;  5LA6 A;  5J2T B;  4LF8 H;  4DR2 H;  4EFE A;  5J2U A;  2YI9 A;  4NVP A;  4LMY A;  4DR4 H;  1WH2 A;  5IWA H;  5EOY A;  1O75 A;  2VOB A;  3RYF A;  3K5N A;  1SKV A;  4PI0 A;  5IWA B;  2ZIO A;  3OTF A;  4NXM B;  4GKJ H;  4UCT A;  4B08 A;  5IJ0 B;  5LP6 C;  2WDT A;  2VQE B;  5K1P A;  4KHP H;  1Z2N X;  5C8Y A;  3JAS B;  2Q7G A;  4LF4 H;  3U0Z A;  1XMO B;  2VQE H;  2R72 A;  4LSA A;  4J0M A;  1FKA H;  1I94 H;  4AIL C;  4UCV A;  4X1Y B;  3ZED A;  4X66 B;  4FM2 A;  1X4T A;  4DK0 A;  1J5E H;  2HVQ A;  1Q3E A;  5EZY A;  3RGB A;  4NXN B;  4JI8 B;  1J5E B;  3K5O A;  2CAZ C;  4O4H A;  3K5L A;  3KYH C;  4IHJ B;  5ITZ A;  1ZHS A;  5KHI A;  4PZ8 A;  2YIB D;  1P16 A;  5LP6 B;  1SYX B;  3RYF B;  1WN7 A;  4DR3 B;  4JI8 H;  4CC6 A;  3BAB A;  4FLY A;  1MZB A;  4ZI7 B;  4DUY B;  2JGU A;  2PTM A;  5JQG A;  4DV5 B;  4DUZ B;  5JQG B;  5KHG A;  4FM1 A;  4B3S H;  4DV6 B;  2HGS A;  2QM4 A;  4LFA H;  3BA9 A;  3J80 W;  5IYZ B;  2MCT A;  1XNQ H;  3RR5 A;  4LF6 H;  1HNW H;  1DGS A;  1I7F A;  4TUY A;  4JI5 H;  4APM A;  2R9A A;  2UUC H;  5IJ9 A;  4LF6 B;  1N34 B;  4X64 B;  2ZM6 B;  3LML A;  3QWU A;  4F6R A;  2HHH H;  4DR7 B;  3JAK A;  2XHB A;  4FLZ A;  5LXT B;  1IBK B;  2UUB B;  2UU9 B;  3DF7 A;  1IBM B;  3E22 A;  5BMV B;  2RQ6 A;  3BAA A;  4YY3 H;  4JI0 H;  4RAY A;  1QHT A;  5KMG B;  2YXL A;  3WB2 A;  3CB2 A;  1RSO A;  4YJ2 B;  3FMA A;  2IM9 A;  3JAR B;  4JYA H;  5LMN H;  3JAR A;  1XHZ A;  5CA0 A;  5FNV A;  1Z5W A;  3VQW A;  3HKE A;  3HKB B;  5FD5 A;  3RYC B;  4O2A A;  1P8L A;  1XI1 A;  4I7H A;  3JAL A;  1CKO A;  3THO A;  4Q0Y A;  5FPR A;  4JV5 B;  4ZIB A;  2F1M A;  4IAJ A;  2P5O A;  4PZ7 A;  3OTO B;  5IT9 W;  1S5J A;  3RJ0 A;  5JH7 A;  4X1Y A;  3FFQ A;  4DV3 B;  4A2A A;  1S03 G;  1M93 A;  4O4I B;  5LA6 B;  4JI7 H;  4FLX A;  1FJG B;  3GDE A;  1TUB B;  4LFC H;  4FLT A;  4IIJ A;  4M7E A;  4FLV A;  3CHX A;  5BR8 H;  4DRF A;  1FJG H;  3HKD A;  4I55 B;  4EB6 A;  4JI4 H;  2ZNJ A;  3ZS8 C;  2UXC H;  4ZI7 A;  3RGZ A;  3QG5 A;  4WBN B;  1BJT A;  4YJ3 A;  4LR3 A;  1CKN B;  2E5L H;  1CKN A;  4CS4 A;  2PYL A;  3HKB A;  1IBL H;  1JFF A;  3N40 P;  3K58 A;  5KX5 A;  1N33 B;  3JAT A;  1VF7 A;  3JAM W;  4TQF A;  3GB8 B;  2JS5 A;  2ZIM A;  4TV8 A;  1E4F T;  3N41 B;  3K5M A;  1O9G A;  2O03 A;  3RGX A;  5JVD A;  5JVD B;  3KAL A;  3TY9 A;  2PY5 A;  4O2B A;  2HIV A;  5BMV A;  3NBZ B;  4LFB B;  4D7T A;  4DV6 H;  4DV0 H;  3N42 B;  2VUG A;  4JI2 H;  4EFB A;  3L2P A;  5GON B;  2PGG A;  1QQC A;  1M4U A;  4X20 A;  1SA0 B;  4RB0 A;  4JI2 B;  1TVK B;  2BTQ A;  2E3C A;  4ETS A;  1N34 H;  4RB1 A;  4BW9 A;  3B2E E;  4I50 A;  5IYZ A;  4TQD A;  4GKJ B;  4DV2 B;  1S68 A;  3K57 A;  4UCO A;  5JJE B;  3JAS A;  5D5P A;  3T1H B;  3SJA C;  4DR1 H;  4LF5 H;  1GYF A;  3N44 B;  3A2F A;  1XMO H;  4JI3 B;  5CA1 A;  2ZCE A;  2UUA B;  1E4G T;  3BPZ A;  2ZNI A;  1KMI Z;  2V4D A;  4K0K B;  1G6U A;  2F93 B;  4LF9 H;  2UU9 H;  4JI5 B;  3L4K A;  3JAW B;  4WBN A;  4O4J A;  3N2G A;  1HNX B;  5FNV B;  1TA8 A;  1N36 B;  2HHH B;  5CA0 B;  4X62 B;  1I6U A;  4CS2 A;  2UXD H;  3SJC C;  3JSN A;  2F4V B;  4LH7 A;  4FVM A;  4DUZ H;  4RB2 C;  1XNR H;  1TVK A;  3J7A K;  3HXL A;  1HR0 B;  4LH6 A;  4I50 B;  1D5A A;  1Q43 A;  2ZIN A;  4K8Z A;  4F6R B;  1HNW B;  3OTO H;  4LNU B;  4MTD A;  5EIB C;  3VQV A;  1XQ8 A;  4AQY B;  2CW8 A;  2UUC B;  5FPO A;  3W1G A;  4OX9 H;  3NBY B;  3SR2 C;  4JV5 H;  4FM9 A;  3UQ8 A;  4LF7 H;  3CSX A;  2BTO A;  5LYJ A;  4YY3 B;  4JI0 B;  5KHH A;  4JI1 B;  2Q0A A;  4E6N A;  3BHP A;  3W5O A;  4B3M H;  3RWR D;  1NT2 B;  3MAQ A;  1JJO A;  3K59 A;  3NC0 B;  4JYA B;  5C8Y B;  3PN1 A;  1JFF B;  1FFX A;  3N2G B;  4O4J B;  5EIB D;  4LNU A;  4DR4 B;  2BTQ B;  3L4J A;  4DR6 H;  1KU9 A;  3RYC A;  4BWS C;  2YIB A;  1ZAU A;  2VWK A;  2VWJ A;  5LMU H;  2GV9 A;  2UXB B;  2OYQ A;  4JI6 H;  2F95 B;  3UT5 A;  4LF8 B;  4EQ5 A;  3MWM A;  2ZJT A;  4EEQ A;  4TV9 B;  3RYH B;  4D7S A;  4GKK B;  1AN7 A;  4MV9 A;  4UFZ A;  3ICX A;  4DV7 H;  3E22 B;  3HKC A;  4DR5 H;  4YHH B;  2VQF H;  4B3S B;  5IJ0 A;  2VPS A;  3IG0 A;  2HVR A;  1I94 B;  4NXN H;  1WPB A;  3KXY T;  4ZOL B;  4NXM H;  5KX5 B;  1BGW A;  1L8D A;  4L8J A;  4BWA A;  4TUY B;  4FM0 A;  4B3T B;  5FD6 A;  4K8X A;  4A2B A;  4LF4 B;  4CH4 A;  4B3T H;  3TY5 A;  3N43 B;  1IBM H;  4X1K B;  3UT5 B;  3RF2 A;  5JCO A;  4MTE A;  2F4V H;  4O4H B;  4CS3 A;  5JJJ B;  4IHJ A;  5ITZ B;  4LF9 B;  4O4L A;  5JCO C;  4DV3 H;  1IBK H;  1HNZ H;  4DRX A;  4UCR A;  2F66 C;  4DUY H;  2UUA H;  4CH6 A;  1HNX H;  2HEP A;  5LL6 b;  4RZQ A;  4B3R B;  4DK1 A;  3QTC A;  4CH3 A;  4X1I B;  1Q8I A;  5JJN B;  3IAY A;  4LFC B;  4K0K H;  2WE6 A;  5D5Q A;  1P49 A;  4CC5 A;  5BR8 B;  3N2K B;  4FFB A;  5J2T A;  1YEW A;  3F8N A;  3RYI A;  3C0F B;  4HNA A;  4X62 H;  3VQX A;  2P22 C;  4PI2 A;  4U3J B;  5EYP B;  4ZHQ B;  4LFA B;  3QF7 A;  1HR0 H;  1Z2O X;  1XNR B;  1XMQ H;  1IBL B;  2CFM A;  3JAK B;  4JI3 H;  1TAE A;  5DIS C;  1M5I A;  4DRX B;  4X20 B;  4R7R A;  1XMQ B;  4YJ3 B;  2KSW A;  4LF7 B;  1XDN A;  2RGR A;  4O4L B;  3WB0 A;  4EB6 B;  3HKE B;  3WB1 A;  4AQY H;  4ZOL A;  4GYC B;  4HBN A;  5CB4 A;  4DV1 B;  5D1O A;  3RYI B;  5CB4 B;  4DV4 B;  5D1O B;  1H2S B;  2UXD B;  4LFB H;  4DV1 H;  5LMN B;  2E5L B;  3BRC A;  4DR2 B;  4UCS A;  4JI4 B;  5LXT A;  2UXC B;  4MV7 A;  4X65 H;  1ZHQ A;  4PHZ A;  5LP6 A;  1CKM A;  1XK5 A;  4DR3 H;  4LSX A;  2YCH A;  2UXB H;  4DV0 B;  5EZY B;  4X65 B;  3ETQ A;  5J2U B;  4KHP B;  2PZS A;  5GON A;  4JI6 B;  4RB3 C;  4DV2 H;  1N33 H;  3KAK A;  3SJB C;  5LMU B;  4YJ2 A;  2OWO A;  4JI7 B;  3K3V A;  3HKD B;  4I55 A;  5A2Q W;  4X66 H;  2VQF B;  1XNQ B;  4KL1 A;  1SEI A;  2XIG A;  4X1I A;  1VS0 A;  3T1Y H;  4PDB A;  1SQF A;  4TV8 B;  5LOV B;  4DR1 B;  4LF5 B;  3T1H H;  5KHK A;  3JAT B;  5IJ9 B;  4YHH H;  4TOI A;  2HIX A;  3T1Y B;  1B04 A;  1JMK C;  5CA1 B;  2YI8 A;  4PZ6 A;  3W1B A;  1X9N A;  1N36 H;  2PUS A;  1M0W A;  5K1X A;  2FE3 A;  3JSL A;  3HKC B;  4I9Q A;  1T5E A;  5KMG A;  1FVI A;  3CVZ A;  2PYJ A;  3SGI A;  2W57 A;  2Q2U A;  2RJZ A;  4FLU A;  2RGV A;  4GKK H;  5LYJ B;  1L2Z A;  3DSQ A;  3RTX A;  2Q2T A;  4X64 H;  2ZM6 H;  2JVD A;  3KAJ A;  1SA0 A;  4DR7 H;  2Q7E A;  1HNZ B;  5JH7 B;  5D1P A;  1XHX A;  2UUB H;  3VNN A;  5LOV A;  4OX9 B;  3J81 W;  4GLX A;  4B3R H;  3JAL B;  1V9P A;  4I4T B;  4FLW A;  4DV5 H;  2HVS A;  1WNS A;  2EX3 A;  1TGO A;  3TY8 A;  1Z5V A;  2KKW A;  4JI1 H;  1SQG A;  4O2B B;  5KHJ A;  3VQY A;  4ZHQ A;  4U3J A;  5EYP A;  1HW7 A;  3LNN A;  4IIJ B;  3M7M X;  4TV9 A;  3RYH A;  2CW7 A;  3EYY A;  4AHC A;  3U10 A;  1TUB A;  3RFR A;  2WYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...