3BAAA

Structural basis for the inhibition of bacterial nad+ dependent dna ligase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
312
structure length
312
Chain Sequence
b'LTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
publication title Structural Basis for the Inhibition of Bacterial NAD+ Dependent DNA Ligase
rcsb
source organism Enterococcus faecalis
molecule tags Ligase
total genus 103
structure length 312
sequence length 312
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3baaA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3baaA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3baaA02
3T1YB 1CKNB 4DV7B 2UU9B 4TOIA 4DR2B 3NC0B 4X66B 4EFBA 4EEQA 4X65B 1J5EB 4LFCB 4DV3B 2HVRA 1HNZB 3RR5A 4JV5B 1CKOA 4LFBB 4DR7B 3GB8B 3TY9A 4PZ8A 5FPRA 3GJXB 2HHHB 4NXMB 1XNQB 1V9PA 4JI7B 1N32B 4LF6B 4UCUA 4JI6B 4B3TB 1S68A 2CFMA 1XNRB 3JSNA 4YY3B 4B3RB 4DRFA 1TAEA 2ZM6B 1N34B 1HR0B 2UUCB 3NBYB 3RTXA 4EFEA 2UUBB 1N33B 2Q2TA 1IBMB 4LFAB 3L2PA 1XMOB 4JI1B 4LF5B 3VNNA 4PZ6A 5FPOA 4LF7B 4B3MB 3T1HB 5IWAB 1HNWB 4DR4B 1IBKB 3KYHC 4JI2B 1XK5A 2UXBB 3S24A 2UXCB 5BR8B 5DISC 4UFZA 1X9NA 4EQ5A 2HIVA 4JI5B 3BABA 4LF9B 4DUZB 4DR6B 1P16A 1A0IA 2F4VB 4GKKB 2VQFB 4DUYB 3TY5A 4B3SB 4JI4B 4DR5B 4UCRA 4LH6A 4KHPB 4OX9B 4X62B 4CC5A 3UQ8A 4UCSA 4UCTA 4AQYB 1ZAUA 2UXDB 4NXNB 5D1OA 4GKJB 2OWOA 3BA9A 2HVSA 3PN1A 4DV1B 2UUAB 3TY8A 3BAAA 3SGIA 4DV6B 1XDNA 1P8LA 5LMNB 4X64B 4DV4B 5D1OB 4UCVA 5D1PA 3OTOB 2HVQA 1CKMA 3BA8A 3W1GA 3NBZB 4UCOA 3JSLA 4JI0B 4PZ7A 4LF4B 2VUGA 4DV5B 3W5OA 4E6NA 1FJGB 1B04A 4LH7A 4JI8B 1FVIA 4DR3B 4JI3B 2E5LB 4DR1B 4CC6A 3GDEA 1I94B 4GLXA 1DGSA 4DV2B 1VS0A 5LMUB 1TA8A 1CKNA 4YHHB 4DV0B 4JYAB 1HNXB 3W1BA 2VQEB 2Q2UA 1IBLB 4LF8B 1N36B 3QWUA 1XMQB 2HIXA 4K0KB
chains in the Genus database with same CATH superfamily
2QKAA 1CQIB 5KA6A 5KKNB 2GHYA 2NU7B 3DAAA 5DQGA 3VMMA 5B66Z 2R9IA 3RVYA 3PW4A 4F6EA 1JQ0A 2EINB 3V6KA 1JLLB 3WG7B 1SESA 4DR7O 2V1DA 3E22B 2ZIMA 1HNZB 2R82A 5EBLC 5C8YA 2AW9A 1WH2A 5D5QA 4UV9A 1F51A 4B3SH 4YJ3B 4AI8A 3LQSA 1FJGH 5KT6A 4JI7B 1N34O 4UCUA 5CBHA 5C5JA 4HNUA 3ZHTA 4BWAA 2ZE5A 4DR2O 2E74B 1SC5B 3HKBB 1EBOA 4M9UA 3J7AK 4EFEA 3TETA 2JA5A 5IJ0B 2VWJA 4DR4O 1DF4A 1AI6A 4DV0H 1ZL8B 4EYHB 1S5LZ 5F9NA 1SFOA 5KG2A 2R6FA 4TV8A 1KJ8A 4DV4H 1JFFA 3QVNA 1CEZA 3HOXG 2V5AA 4X1KB 4J9KA 3N40P 2VUMG 4O7SA 1NJIW 3T9EA 3C3TA 3AG2C 3ZRXA 5KX5A 4F50A 2JA6G 2HP8A 2DIKA 1P16A 2WLLA 1I2KA 4ZHQB 3HOUG 3CC7V 5HNEA 1DV2A 4JI1O 3K57A 3PW7A 4BWSC 2YZLA 1QQCA 3M8AA 4QSHA 5LP6A 1M57C 3K59A 3CEBA 2Q9LA 1P84F 2EJRA 4NXNB 4PI0A 4I55A 2WLIB 1JVMA 1M90W 4LF8H 1Y66A 3PN1A 4BR6A 2DYRC 2JEIA 3VQWA 3BJYA 4UCVA 1XILA 1JDBB 5JQGA 1CKMA 3NBZB 3FAVB 2UXXA 1GGOA 1UC9A 2CNUA 2XAHA 1CXZB 4JGSA 1VQMV 3N44B 2CK3G 4JI3O 4DV3H 3RFRA 2JA5G 5DM6V 4UUGA 5EZYA 5BYAA 4B7KA 5J2TF 4GLXA 2IH1C 3T4DA 5LOVA 4CMDA 2C2DA 4RUEA 4WFFA 3BPZA 2R8KA 5GONA 4IIJF 1R3IC 3ABMC 5I5XA 1XREA 1KYOF 2L35A 1N36B 5LP6F 5LGUA 3WB1A 1Q8IA 4A3LG 4OGQB 4MV9A 5L3FA 2IP4A 4X66B 4I55F 2CTQA 3K9SA 5B1BC 3ZRWA 3Q2OA 1Q81W 4X64H 4JYYA 3P3PA 3ZX6A 3MD0A 4I7ZB 2W9CA 4LFBB 4UB8Z 1N32O 4LC1A 4LF6O 1WLEA 5JJEB 1QU7A 2KB1A 1XNRO 3CB2A 3MAQA 2Z02A 4AYBA 4FZ0A 4Q43A 2V9WA 2M6YA 4QWAA 2UUBO 3HB3B 2VPSA 3IC9A 4YY3B 1WR2A 3HKDB 3HR0A 3MDSA 3BG5A 2ODMA 2QWQB 1IBMB 3FD9A 3GIKA 5EBWC 3L2PA 4N21A 5LOVF 4LF5B 3VNNA 5DAAA 1HNWO 3HOWG 2ABJA 5GONF 3QO7A 4IYIA 2UXBO 4ZQIA 2KG7A 4QPKA 3ML0A 3GWOA 4O7RA 5KUKA 2RDIA 3BFRA 2UU9H 3IJ4A 2WE6A 4RNNA 2PGGA 4O3RA 3WFVA 2Q4PA 3AYHB 1K8AW 3H3VH 2XD4A 2VQFB 4DUYB 3RBZA 3OUZA 4O3OA 1XEQA 3LDCA 4NTWA 4IRDA 5L3GA 4O4LA 1WNSA 3W7TA 4CC5A 5B1AB 3CCSV 4HNTA 1EKFA 1PKXA 1N8RW 1ZAUA 3JASA 1XQ8A 5LBQA 1FXHA 4X1IA 4PBCA 1KC7A 3AG3B 2UUAB 4DV6B 1EUCB 4O82A 2VA3A 4H37A 3W1GA 4TV9B 3W7WA 1ZX3A 3JSLA 3TINA 3Q8SB 4JZGA 2XT9A 3CCQV 4HQ6A 1FJGO 4K3AA 1T36A 2ITDC 4DR3O 3TGUH 5E25A 2XCLA 2ZXWB 1MOFA 4NVPA 3K5LA 1JPXA 4JV5H 3JAMW 1SQXH 3OW2U 4LBEC 4DR1B 2W9BB 3BY6A 4MS2A 3R65A 5DECA 2R8JA 1X59A 3ETEA 4DV0O 2XGQA 2WSSG 1TA8A 3GV7B 2EIJC 2YIBA 2B1GA 3V6JA 1NR7A 3ETGA 3ORQA 3LSUA 5LP6C 1N48A 3BRCA 1THZA 4O4LF 3K5IA 3RYHB 5JUMA 2P22C 1Q7YW 4A3BG 4FLZA 3V4ZA 3ZMUA 5KFJA 4RB1A 2DWDC 1T94A 3SNOA 2YIAA 4X1YA 1X4TA 2WYOA 3T5JA 4O83A 1AUXA 3SE7A 2OIEA 2ZKOA 1Q82W 5LHHA 1W0JG 4FBTA 4J7KA 3WNZA 5LYJB 3CMAV 2JGUA 1E4GT 3F8NA 1E79G 2CFMA 3UT5B 4FLWA 5DG8A 3P3NA 2IJKA 2DW4A 2OCHA 1TAEA 4J7ZA 2EULA 2CH7A 4LFAB 4K8ZA 2DQ3A 4BIUA 4A3CG 1SQPH 3OEHG 3JCUZ 1KJQA 3AG4C 1RK6A 3BACA 3RYCA 2Q7HA 1VQ5V 4JI2O 3I12A 1PP9H 3JAKA 1E4EB 5BZBA 3H1KH 3THOA 2GLTA 1ZUQA 5H9CA 4K0KH 3RYFB 2GUZA 1E4FT 2VQDA 2Q0AA 4J9NA 4MV7A 2DQ0A 5B3SC 3BABA 4DR5O 2OLSA 3CYOA 4DW1A 3G8DA 1COWG 4LNUA 3U54A 4CKCA 4IRCA 5HBRB 4RCNA 4GYCB 1I94H 4D7SA 4CS2A 4Q8EA 2VA2A 5KFCA 1NVPD 5EK0A 2EILC 4CH4A 1R3LC 2Z04A 4RO2A 2EBOA 1IZ3A 5KFSA 2HHHH 3J81N 3LDDA 3OEEG 3W7XA 1GYFA 4X64O 4QE7A 2EJ2A 1GM8A 5BWWA 4DLKA 5L9XA 2E2HA 3L72H 4FE2A 3BQ1A 2XUMA 5IY5B 4ZIBA 2YIBD 2DLNA 4PZ7A 1AROP 4JI8O 3DF7A 2PBZA 3QZ8A 2ZJTA 4X65H 3J80W 1J5EH 2RCVA 5KFLA 4H13B 4O4HB 5DQIA 2JEJA 3K58A 3A2FA 5KFNA 5IYCO 4ECUA 3VPCA 4NR1A 4X89A 3R66A 5EOYA 2JRIA 2LO1A 4PDLA 1VS0A 4B7EA 3EHBB 3HKEB 4JV0A 2I80A 4MTDA 2BTQA 3RYIB 3L4KA 1SQVH 2UUCH 5BWUA 2QKSA 1B06A 2UU9O 1XMQB 2FPIB 1TUEB 2FK3A 2E76B 5H80A 1VQLV 4RQEA 3EFFK 4DR2B 3T5HA 5LXTB 3AX6A 2LFRA 1RK5A 1IBKH 1Z5WA 4OPAA 4WFEA 3I55V 3T4ZA 3GIJA 4O7YA 2OIGA 5KAFZ 4XYMB 3OSNA 3NXSA 1Z2OX 2CQYA 2ZDGA 3TW7A 3I4MG 5L3BA 1KT8A 1ZHQA 3RB3A 1S68A 4NZMA 5J2TB 1I6UA 2V4RA 2C2RA 5C1OA 5IYCG 4J9MA 2Q2TA 1QLEB 1M0WA 2WLIA 5EYPB 2W6IG 5H5NA 1D2DA 4JI1B 3ETHA 3N2GB 2AZ2A 3QF7A 1EUDB 4PWQA 4RNOA 3HKCA 5KG3A 3HT5A 3JZFA 1TUBA 1G4YB 2B5UA 4B3MB 4QWBA 5KFVA 1YCIA 1QR9A 4G27B 1EZ1A 3FAVA 3HPLC 3D3IA 2QF7A 2ADPA 2DPIA 2CNQA 5KFYA 1SQBH 1IXMA 4DV7H 1P7GA 1SRYA 3RN4A 4LF9B 1CE8A 1A0IA 4BBSG 2QKCA 4GKKB 4F4YA 3TY5A 2Y0PA 3T9BA 2V59A 2XC9A 1RP3B 3P32A 5IT9N 3MR3A 1P49A 3VQVA 2P4KA 2JJ2G 5EC2C 1B6RA 2J9GA 1H2MA 2CKZB 1JIHA 3BQ2A 1FXKA 3JALA 1E1QG 2VOBA 3OR7C 4YHHH 4EEYA 5HFMA 4ED3A 1EHIA 1RM1C 1I5YA 4DV1B 1I7FA 5TISZ 4DV5O 4GC7A 1S0NA 4XBFA 1EYZA 4A93G 3UO2A 4LF4B 4YAKB 1I3QA 2LGQA 3N2KB 2XAGA 4GUNA 4IHJB 5BWTA 2J6UA 3FB7C 1BHAA 2YC0A 4E6NA 2DJVA 3AK2A 2E5LO 1NTMH 5FNVA 4FFMA 5KFIA 1CP9A 1NU1H 4A3KG 4CKBA 4DR7H 3LNMB 2YRWA 4UV8A 5K2MA 5BR8H 3G6YA 3H1HH 5DLFA 4FFLA 1V4YA 4O3PA 2RDJA 1VF6A 1ULZA 4TUYA 3AK3A 3UCSC 2FTKA 3OR6C 5H2FZ 1VQ7V 4K0KO 2W6PA 3G8CA 2W7OA 1N34H 2JEFA 4CS4A 4TQDA 4YIPA 4X62H 3RAXA 2XAJA 3D36A 1Y76B 4FJCC 3MWEA 4AHCA 1YI2V 4TOIA 1ZHSA 5KFRA 2H94A 4DQNA 1Y4MA 2PN1A 3TEKA 1I94O 3KXYT 4F4WA 2ZD9A 2OCCB 3B8NA 3JYCA 3MHHC 3T5LA 5EWGA 5KT7A 3ZHSA 4ABMA 1K7DA 2HHHO 3OUFA 1Y74B 2F66C 1XNQO 1KC8W 3VOTA 4JAVA 4HN2A 3ZHQA 4RUCA 3T99A 3CQZA 1L0NH 4AILC 1BJTA 1KP2A 4R7RA 5FNVF 4PDMA 5JWPA 3P30A 3ICXA 1KUQA 4I4TA 2QDOA 4K35A 1PL4A 4JYCA 3SI8A 5A2QW 2YSUB 4L8JA 4GX2A 4HYOA 4LF7O 2PYJA 1N56A 2W71A 1KTAA 5KG4A 3GILA 3D3QA 1VAJA 3SYPA 4TUYF 4TV9A 3JATB 3T1HB 4FK5C 5CA0A 4DL3A 4JTDB 1IBLH 1AI7A 1F7YA 5CA3A 3Q8RB 1VP7A 2X6BA 2HKOA 2GTSA 1FS0G 4DUZO 4RB2C 4APMA 1YTFD 1HP8A 4GX0A 4ED7A 2HVKC 4L1KA 4UXNA 3PR4A 4EYIB 3OUUA 2UVWA 4B3SB 3J7AU 4O81A 5I60A 4Q4CA 4KHPB 3Q4HB 1K4DC 1S10A 3OGIB 1AI5A 1NVPB 1K9MW 5CM0A 5I5VA 2H3OA 5H6QA 4GT1A 3SR2C 3ZS8C 2COGA 4GCZA 2W8LA 5LMNO 1OCZC 3CRMA 4CH6A 4TM5A 4JI6H 4FFBA 3SGIA 4DYLA 3DTFA 4PD4F 5BY1A 4B3RH 4I4TF 4DV4B 5D1OB 3ZN0A 5KUMA 1DV1A 1FKAO 2I8CA 2YZGA 1AB3A 3CVZA 5KT5A 4ZOLA 4ECRA 3U9TA 1JOYA 3CPWU 1U97A 2FKXA 3CSWA 2R7ZA 3Q1KA 5I47A 5CA0F 4QPJA 2PTMA 1AILA 1C3OA 2YIDA 3E8FA 4XDKA 3H0GA 1YSCA 1Q86W 4JI5H 2HHFA 4LF6H 4QWDA 5DGAA 3ABTA 2MCTA 1PL0A 4FLTA 4U7OA 3MR5A 4FGRA 2Q2UA 1FXKC 5EC1C 4LF8B 2UUBH 4DV7O 4IGGA 5KT3A 4OX9H 2KSWA 2IJJA 2YRXA 1PNMA 3EYYA 5JH7A 4AQYH 4FPPA 3SJBC 5J9PC 4LFCO 1UJWB 3K0DA 4MTEA 2KSDA 1AJQA 3ZRSA 3ZMZA 1RYRA 1HNWH 4Q6GA 2P0AA 2QSAA 3TCUA 2UXBH 4DV3B 3T9FA 1WB7A 4Q4DA 2DPJA 4MV6A 2R93A 4ZOLF 2EIKB 1Q6HA 2W6JG 1KJIA 2QM8A 1KQSU 1TWHA 1M56B 2Y69C 5FPRA 2X5RA 2L6LA 4WBNB 4NXMB 2ZM6O 4DRXB 4QGPA 3CS5A 2CGNA 1K33A 5DG9A 2R7ZG 4N23A 1XMOO 1VF6C 3RTXA 1SA0B 3PW5A 1OJHA 4Q0YA 1V54C 1MMMA 3H0GG 3V6HA 3RIZA 5IP7G 1SYXB 1MNGA 1DF5A 2HEPA 5GW7A 3TXQA 2A79B 4O7WA 3SPHA 1WA8B 5BR8O 4QWEA 3E8GA 3ABUA 1AVMA 3ABLB 4JTAB 3KYHC 1OCCB 4E4TA 1RJPA 1OZ0A 4DR6O 1EN5A 3WB0A 4KP4A 2R7NA 3RB0A 2F4VO 4O4HA 1WP8A 4W4LA 3U0ZA 4ZI7F 5KAIZ 4DR3H 3MR2A 2DYSB 2QWPB 2RJZA 4X62O 1S72V 4JI4B 5FLXW 4I0XB 3GIPA 2B63A 2AGOA 1R6KA 3T5KA 1H8EG 3GTLA 4EGQA 1VQ9V 3BHPA 2UXDO 4GKJO 5JVDA 1NH2D 2AHZA 4CS3A 4TQSA 2R93G 2HR3A 4U3JB 3E86A 1CQJB 4TVIA 1PPJH 4H33A 4DAAA 5FD5A 1L0LH 4NYEA 3UFXB 2FLPA 3JD1A 2ZR2A 4O2BA 1D5AA 1K3EA 2HGXA 2HDKA 5BMVB 3K5MA 2HVQA 1N33H 3TQ1A 4JI0B 5IJ9A 1V51A 3G67A 4I7HA 1M0TA 1K5QA 2JGDB 3ZMTA 1OCOB 1DK1A 4J9ZB 3E8BA 1M1KW 2OT5A 4MVQA 5KG6A 2ZDIA 5C8YF 4PA7A 4O4JA 3WU2Z 2VRZA 4O3QA 3R9RA 1H8HG 2VQEO 4FM0A 3R23A 1IBLO 3ZMSA 1IVSA 3CC2V 3W1BA 4PV1B 1UNNC 3ASOC 1RSOA 4O4IA 2YZMA 1JJ2U 4FZ1A 2LW1A 5CA1B 4MTOA 5JVDF 4J0MA 2B63G 2LJ2A 2VR1A 3A0HZ 4HBNA 3MFHA 3L4JA 4TV8F 1KMIZ 4NZNA 4JI2H 4O2BF 3OTOH 5KX5F 1NTKH 4JV5B 3GB8B 2RF4A 1AN7A 5DG7A 4PZ8A 4B3TO 4JI6O 4J9PA 3HXLA 4DK0A 5KMGA 4L87A 4DR5H 4B3RO 2EIMC 1HR0O 3UKMA 4R8CA 5KHIA 5ITZB 5IYZA 4O4JF 3G6EV 3CRRA 1AI4A 4BBRG 3RBDA 3IC7A 2FMAA 3T1CA 1QCEA 2JVDA 2P4VA 2YXLA 2JEXA 2JDIG 2YEVB 4X88A 2CTPA 4J42A 2UVRA 4F6RB 2DMXA 3GV5B 2GBOA 4PA3A 1I08A 1KD1W 4O4IF 4TWKA 5JQGF 3CJHB 3HKZA 2R86A 3N2KA 2GSMB 4JI5O 2JEUA 3TJTA 2BQRA 4YIOA 3E35A 3CHXA 4UFZA 1X9NA 3SPIA 4JZ2A 3FX7A 2X0LA 4JI8H 1Y1VA 1FFXB 3ZN1A 4YR2A 5EZYF 1L2ZA 4OX9O 4FS2A 3HO8A 2Q5ZA 4AQYO 5LA6B 4CH5A 1ZQ7A 2BSKA 3N27A 3RB4A 4E2LA 4JAUA 3FDSA 4IL6Z 1ZSPA 3AG1C 1B6SA 1SKVA 3L73H 3OM3B 4J9SA 1BL8A 4MV3A 4X20A 2NU8B 4CKEA 2PYLA 3OSPA 4BAYA 4WCEV 5IYZF 3T2MA 3JAWB 4A3JG 3AK1A 5EDWA 3OGCC 4FU0A 1P7BA 4HNAB 2ZIOA 1S76D 1OCRC 3SPGA 3ZBHA 5KFZA 2HGSA 5L1LA 4PDRA 1B04A 4LH7A 3G6VA 3DXRA 5FD6A 1JMKC 4YJ2A 3HBLA 5T14A 3I4NG 4FLYA 3OMNB 1I94B 1Z2PX 3T9AA 2QM4A 1OBGA 2AQ4A 5FLMG 1W2BU 2ZDHA 3HOVG 4IWYA 2IJHA 3WO1A 1R9TA 1S0VA 5K1PA 1RYSA 1OBDA 1SF9A 4QE9A 1Y1VG 1Q3EA 1CKNB 1TVKA 2Q7GA 4NXNH 1SETA 3ABKB 3CCMV 4PJ0Z 4RUAA 1NI8A 3EPIA 4X65B 1J5EB 1YDXA 2QWOB 4MSWC 4DL7A 3QFFA 2JK5C 3G4SV 4O7LA 2VS0A 2Z3YA 4JPRA 1VQ4V 2PZSA 4I50A 2ASJA 2ZDIC 3AG2B 3SJQC 3GTMA 2HG8A 1VIBA 4O2AA 3MHSC 3CCVV 1V55C 1G1XB 3EVKA 1V9PA 2AGAA 3FFQA 2GTAA 1N33O 4YJ2F 3N8DA 2R92A 4PA9A 1UC8A 4A3MG 2UUCB 1IOVA 1M57B 3FB5C 4HYKA 2E2IA 5LHIA 1JA8A 1K1SA 4A3EG 2W70A 3O65A 4PI2A 4F4LA 2ASLA 4NKGB 4GZRB 5IWAB 2IM9A 2UXCO 2DYRB 1LUVA 3KHGA 1IBKB 4CH3A 2CTWA 5CR5A 2NNUA 4MAMA 4DV5H 2UVUA 1XHZA 5BPFA 1XUQA 2HIVA 1MABG 2O57A 1EKPA 5KFHA 3TXSA 1YF2A 1IURA 3LULA 2NU9B 4EBCA 2DN9A 2ZE6A 3O9OA 1I1MA 3KAKA 3RBEA 2B9ZA 2E5LH 4WFHA 4CBCA 2XOKG 2MW2B 4I50F 1U96A 5CB4A 3CMEV 1JCHA 3HB9A 4R8UA 3JARB 5IT9W 3JCZA 2XIGA 1YZBA 2IW5A 3L74H 1VEWA 3OTOO 4QW8A 1WP7A 3ABMB 4FFNA 2MK3A 3ZRVA 1VF5B 2SCUB 2IJIA 3RAQA 2N04A 1YXBA 3CX5F 4LF5H 2R92G 2Y0IA 2FPPB 5GTIZ 1K4CC 2N05A 3HOZG 2R8GA 5B1BB 1ET0A 2AGPA 2BQ3A 5KFDA 1AJNA 2JA8G 2OH2A 2GDSA 1C30A 5I5YA 4F4ZA 1AP5A 2UXNA 4DV2O 3ZEDA 3B40A 1PX2A 2F1MA 5J2UA 4ZI7B 1OWTA 4DRXA 4JYAO 2WTFA 3GQCA 3G80A 1HNXO 1H2SB 4Q20A 3E2EA 5LMUB 1IYEA 4HR7A 1XNQH 2IMWP 3UM7A 4YHHB 1DAAA 2KKWA 1SA0A 3ZIAG 2VPQA 1VKZA 4HZ3A 5C1PA 3DTUB 5L1KA 2IU0A 3T1YB 3KTMA 5CB4F 2NR5A 3DGEA 5DLGA 2FB9A 1QR8A 3E22A 2YL2A 2YS6A 4LF7H 4WFGA 1MZEA 1I2LA 1HNZO 2K9PA 3B4SA 1XOUA 3GIMA 3DSQA 4YJ3A 2WA3A 4GLWA 1QHTA 1Q43A 4MW8A 3RT3C 3HKZE 3S3XA 5IYBG 5E79Z 1KECA 4DR7B 3RUPA 4DUZH 4JI7O 3H1LH 3HKBA 5KFWA 1GM9A 3DTGA 1GM7A 1AR5A 3OT7A 4AYBE 4PDBA 4QW9A 4RUFA 3ASNC 2D3OW 5IJ0A 1FYJA 2OYQA 1IYDA 5KFBA 4DR1H 1N34B 1ZL8A 4JV1A 4EB6B 5J2UF 1JX9A 1S97A 1M93A 1EZVH 4CE5A 1Q5OA 1LR1A 4X1KA 1YJ9V 2ZINA 3LUTB 3WWHA 3N42B 5LMNH 1VQ8V 1CPYA 1H2LA 4DR4B 4XDJA 2PI5A 4TT3G 3A0RA 3B09A 4ZHQA 1BQZA 4ECZA 1FKAH 3U55A 4TV8B 3K3PA 1JFFB 2WLJA 3DC5A 3X2QC 3JD4A 2LGWA 3H4BA 3CCEV 1A0GA 1ZETA 1ENVA 3GTOA 5IDJA 2N74A 5KX5B 4UCRA 4YJ3F 2EZOA 3IN5A 2WLLB 4NXNO 1XL4A 4IIJB 4GC6A 1KUTA 5CAEB 2OWOA 2P7TC 2EIJB 3A8TA 4NTXA 4MVZA 2NLJC 1GO3E 2WA4A 2NUAB 5LP6B 3RGZA 5KG5A 1P4RA 4LCUC 3EXAA 1K97A 4PDVA 3KKYA 2YW2A 4YR3A 3NR7A 3K5NA 2E75B 4J9OA 4I55B 4IRKA 4LFAH 2CDYA 1GTOA 2ITCC 3UZBA 4RU9A 2A9HA 2YS8A 4LMYA 4EBEA 4LFCH 1G6UA 5KHKA 3CCLV 3GVMA 2Z0AA 3VBBA 5JVLA 2XAQA 4KUMA 4JI3B 5IP9G 4ZHQF 2RNBA 4CC6A 3D8CA 2HJWA 2Q67A 4EGJA 2W6NA 1VQOV 5EZYB 4RZQA 1N36O 3QQMA 1BQ0A 1F4MA 1SEIA 2XNDG 2ZM6H 3HOYG 5LOVB 5L1IA 4ECXA 2W8KA 1XMOH 4X66O 1EZJA 5GONB 2X7RB 3AG4B 1R6NA 2C2EA 4EFBA 3H20A 2JEGA 1YJNV 5KLVH 3JZ6A 3IAYA 1NTZH 4LFBO 2F93B 4J80A 5DGIA 1PM9A 1MZBA 3ZRWB 2FKLA 4DR6H 5KFUA 2F4VH 2YI9A 5B3SB 3HKDA 3RGXA 1S0MA 2QJ1A 4IT5A 3GB7C 4YY3O 2AGQA 3QTCA 1N32B 2W9CB 4LF6B 1JDEA 2YU9A 1XNRB 4PELA 3TIIA 2NN4A 5LL6b 1O75A 4LF5O 5JQWA 2UUBB 1PD3A 3B8MA 3ZHVA 2W6OA 2UXDH 4GKJH 4C5AA 2EILB 1A32A 1GN6A 4YR0A 4LWSB 4ED6A 2FLLA 2OTJV 3F7VC 2EINC 1VQKV 3ETJA 2Z5UA 4FM2A 5KFAA 3WG7C 1RFYA 1HNWB 1XBLA 2EZPA 2C22A 4RB0A 4ME6A 3J80N 1XMQH 3G71V 2UXBB 2IU3A 1URFA 5KHHA 3LSQA 5KFXA 4QIWA 2VQFO 4DUYO 1H2GA 3VQYA 3RV3A 1HDJA 2KG7B 1HW7A 2F43G 2DAAA 1EN6A 3IGAC 3SPCA 3FYIB 1MG1A 1S9FA 4NZOA 4UCTA 3ZHUA 5L3DA 3TK1A 5A9GA 2UUAO 1S03G 4DV6O 2Q0OC 2Q73A 4O4LB 2VQEH 3C3SA 1M6VA 3TY8A 3K0GA 4EKWA 1LNQA 2PMZA 5JJNB 3CCUV 4A2BA 4C5BA 4NYKA 4X1IB 3BA8A 4XX0B 1TWGA 4WFAV 4FM9A 3LWBA 2XCAA 2VUGA 1ROPA 1M9NA 4WFBV 2W9BA 4B3MH 5KA5A 3F7YC 4ZKIA 1FJGB 2DWEC 1LUWA 4DR1O 4O86A 2RDCA 4DR3B 1FD9A 1MZFA 2C35B 3C0FB 4J9YB 5L3CA 1H2NA 4MA5A 4IAJA 4QIWF 2WPDG 2NVYA 1BS3A 1SQFA 4J41A 1DGSA 3RYHA 2AZ0A 4GKKH 2K1EA 4B3TH 2CW7A 4DV0B 5KFKA 3GV8B 1HR0H 4R7CA 3M9MB 1GMGA 1AR1B 3H1JH 2VWKA 2HGWA 1VMGA 1DTOA 4O7TA 2BOCC 3EPGA 5KT4A 3I5DA 4TV9F 4ECWA 4R50A 1XL6A 4DL5A 4TQRA 4ED1A 3CD6V 2FK2A 4U7NA 5GTHZ 4KXRA 4Q44A 2LW7A 3CE2A 2QEXV 1N0JA 5LYJA 1Q6UA 3RR5A 3LNNA 1IOWA 4G28B 1YHQV 3UT5A 4LF4H 1GAXA 3T9CA 2BOBC 1O9HA 4X1YB 2UVVA 4HNVA 2XTAA 1WB8A 1G8MA 5DGHA 3KHRA 5F9LA 4LFAO 4IWXA 5C44G 5L3EA 3NBYB 3SPJA 4I9WA 4BY1G 3GTKA 3B77A 1E4EA 1A9XA 4U6PA 2B1IA 2LFSA 4MVUA 5HFLA 2KQXA 1NQTA 1NZ6A 3RYFA 1RM1B 4PZ6A 2JIZG 3OHBA 2CH7B 1YITV 4BIZA 1T5EA 4FMTA 3RVZA 2QTSA 1VBGA 3GTQA 4JI2B 1GN3A 2YI8A 3RYCB 2WB1A 1IDSA 5KFGA 2R8HA 3JAKB 2FJZA 2J6TA 3TQTA 1QNMA 2QE7G 2GUZB 3GWKC 4IR1A 5IYDG 4DR5B 1FFTB 5LYJF 1RJQA 2Q7DA 3FKSG 4O84A 2R8IA 4ECTA 1GN4A 1YIJV 2ZNIA 1H38A 3VPDA 3D36C 4Z1VA 3STZC 3CXCU 5JH7F 4X64B 1UPGA 3FB8C 2Q6AA 3RGBA 1KJ9A 2E3CA 4ECVA 3M4IA 1NS1A 2P6JA 3L71H 4NB5A 4RNMA 2EJ3A 3T1HH 2O03A 3U9SA 2RGVA 1AR4A 4JI8B 5AG2A 1FVIA 2WLNA 4RB3C 2ZR3A 3K06A 2HVJC 3HKEA 3ETQA 5B1AC 3RYIA 1R3JC 2QTOA 4TQFA 4DL2A 1Y67A 2IBKA 2Q68A 2FE3A 2CZGA 4JAAA 5FR9A 5KFOA 3AG3C 3K03A 4DK1A 5A2QN 1XMQO 4EB6A 4FFRA 2V58A 4LSAA 4KHPH 5LXTA 3LDEA 4UB6Z 1GK9A 2BTQB 2UU9B 2ZXWC 3ABKC 4UVCA 3Q8QB 4WHXA 2BR0A 1IX9A 2XASA 1BZKA 1I7NA 1WRVA 2UXCH 2C28A 1J95A 3ZMVA 4O4HF 2R9AA 4DIMA 2Y4RA 4XYLB 3U11A 5CBFA 1BGWA 2C00A 1XHXA 5J2TA 3QNEA 2QA4V 4QIWE 4K6NA 2WDTA 3K79A 5EYPA 3N2GA 5L1JA 3JSNA 2Q8VA 4IIJA 4DL4A 4IR9A 2YYAA 3M99B 2ZE7A 4B3MO 3OTFA 3M9OB 1W59A 1OCZB 4U3FH 5EIBD 1M7JA 1M4UA 1S0OA 4EG0A 2R84A 2PMZE 5LXTF 1NR1A 3HKCB 1A3GA 3GTPA 4LF9O 2WLMA 1TUBB 4GKKO 5KFFA 2I87A 5BPHA 2PVPA 1YEWA 1ZLZA 3PW2A 4MVSA 1TWAA 3OHAA 3SYOA 5CBGA 3T54A 3ZCCA 4M0JA 4I5SA 4X9QA 2COJA 4MV1A 4GX5A 4LP8A 4PHZA 3M9NB 3UQ8A 1K73W 4DV2H 1KB9F 2IBZH 3K5HA 4ICGA 1K83A 3JZIA 2PUSA 1GSAA 2D2CB 4DV1O 1K34A 2A7WA 2DZDA 1IXBA 1SQGA 2WAQA 1HNXH 1XI1A 2HFEC 4NXMH 2P06A 4G2KA 1DIKA 2EX3A 2CUGA 2V4DA 3RWRD 3VQXA 3BAAA 3H9VA 1FXKB 3JALB 1XDNA 4IHJA 4C5CA 4LF4O 2QYZA 2CW8A 2V7QG 1XDCA 4W4KA 1VF7A 1YTFB 4DV5B 2W0XA 3CXHF 1Q6IA 4YBZB 2R70A 3L70H 1VBHA 4ETSA 1JXLA 1HNZH 4BIOA 1VQ6V 2M05A 2F23A 3STLC 1JKJB 2E5LB 2YZNA 3OUSA 1JR9A 4FIPC 5DMXA 4J9LA 4MTGA 5FNVB 4FLVA 1PV0A 2ZQMA 2Y69B 1YJWV 3WWIA 3PW0A 4JI7H 1R3KC 3F5TA 5EIBC 3K5OA 1Y76A 2RQ6A 4JI4H 2R7KA 4LWSA 4OPHA 2AHYA 5IY5C 4JUZA 1I0HA 3J81W 4K0KB 4OXSA 4PA4A 4TUYB 1V54B 3CP1A 2DOSA 1Z2NX 3PFFA 1Y74A 2XAFA 1BT8A 3VA7A 1QBZA 4IHJF 1I1LA 1EKVA 2QR4A 4G3IA 2X0SA 3KHHA 3FB6C 4JI0H 4YQWA 3BVOA 1CKOA 2W9AA 5FLXN 3U0GA 2BQUA 4FFPA 2WB1E 4H0LB 3K9AA 2HHHB 2ZCEA 1XNQB 1GSOA 1BGYH 1PNLA 2OTLV 1D5NA 2W6QA 2CE4A 3JATA 1QVGU 5BXZA 3T1HO 3UYYA 3OAAG 5KG7A 3PR5B 4FBUA 4H44B 3KCYA 2ETNA 4I4TB 5FPOA 4LF7B 1RPRA 5IE9A 5KFPA 1S5HC 3ETDA 3GIQA 1RPOA 1WAZA 1MA1A 1XK5A 3MWMA 3TIGA 4WD3A 4JYAH 2YS7A 5CN0A 1PK8A 2J6SA 5DISC 2Q69A 5CA0B 5JCOA 4PA6A 4B3SO 3OMAB 4DUZB 3Q4HA 5C93A 4O7NA 5KG0A 4KHPO 4A5UB 3W7SA 2PI4A 4A3FG 4Z1MG 2DE0X 3OE7G 3PVXA 1QLEC 2P90A 2YXHA 4X8AA 5KFMA 1GO3F 3H40A 3UZOA 5D1OA 2X6CA 1I7LA 1VQNV 4QNHB 2ARHA 4DV4O 1GSHA 4Q45A 1N36H 2WAMA 3ASOB 4QJFB 2JA7A 5LMNB 3R5XA 4UCOA 4IYHA 4CMFA 3G6XA 3AG7A 4FFBB 4X66H 2CNVA 1JJOA 1BNCA 3M7MX 2GPWA 3W5OA 2JS3A 3E83A 2A3QA 2CTRA 4ZOLB 2PF4E 5B1NA 4ECYA 5KHGA 2FMLA 2RMKB 5FJ8G 4LFBH 4A3DG 1NH2B 4C2MA 4RAYA 3WB2A 4KFMA 4O2AF 3Q8PB 3NUAA 2LQTA 4LF8O 4DXWA 4XZ3B 2A1HA 5K3WA 2WLHA 2WLKA 4YY3H 2EIMB 3ZJZA 3U10A 3GTGA 5IYBO 3T9DA 1IBMH 2HHFB 3AW8A 1SZTA 1GH6A 3KZIZ 3SJAC 4MT8A 1O9GA 4P2ZA 4DV7B 1SCUB 1VARA 3H01A 2H8PC 3NC0B 4Y8VB 3OFNG 4DV3O 1A48A 2QWNB 2W7PA 4O3NA 5JH7B 3GTJA 3PJSK 4LFCB 2ZNJA 4F4XA 5C4XG 1SERA 4P9PA 4HAMA 2HVRA 4WBNA 1GKFA 4NXMO 3R5FA 3TY9A 5EWEA 1WCMA 2JA7G 3GLKA 4A3IG 5LHGA 2VQFH 3S3WA 4CZZA 4DUYH 3PO3G 3QO5A 5B5EZ 2Y4UA 4FM1A 2XCPA 5BWRA 4FFKA 2FYUH 4RWUA 1FAFA 4J9QA 2JS5A 2ZM6B 1B6QA 2R72A 4JASA 4MV8A 3E89A 5H6RA 4BW9A 3AG1B 1WA8A 1XMOB 4I9QA 2ZE8A 2G38A 2ADQB 4MV4A 2UUAH 2WAQE 4DV6H 1EFRG 1KP3A 2R9RB 4ED8A 5D8DA 3AEIA 2OCCC 5HV6A 2Y48A 4O7VA 3L75H 2GQSA 1K5SA 1KEEA 4LR3A 2Y0SA 5BR8B 4I0XA 2QK4A 1OCRB 4D6TH 2GPSA 3SYQA 4JI4O 4DR6B 4MW3A 2GQRA 5C8YB 2F4VB 1YVWA 2HG5C 4YXWG 2R85A 3LP8A 4WBNF 4U3JA 1VQPV 4ED2A 3W7UA 2LP7A 1ORQC 4X62B 1F23A 3DC6A 3BEHA 1SS3A 4MTXA 2UXDB 1TWCA 4GKJB 2HLDG 5BMVA 5LL6Y 2XHBA 2A0LA 3QZ7A 1WCMG 3QG5A 5JVDB 3SYCA 2ALZA 4JI0O 3MJFA 4EBDA 5EWFA 4O7ZA 2ASDA 2JGDA 1F4NA 1W0KG 3WO0A 4MVMA 3JAMN 5DN6G 2YCHA 1MSWD 4O2BB 4YAJB 2W57A 4FVMA 1NT2B 3K04A 5IWAH 4IZOA 5IJ9B 4DL6A 1KJJA 3IG0A 1MSDA 5JCOC 1W96A 1E1RG 3N41B 3VPBA 3UO3A 1Z2GA 4UVBA 1S3JA 5E1AC 1BE3H 3MR6A 5B1OA 3CRCA 1B33N 3OMIB 4K8XA 5BYBA 5BWXA 2IH3C 3JD2A 2YUAA 1QLNA 5CA1A 4O4JB 1UFIA 1K92A 1V55B 5KT2A 2JJ1G 3BQ0A 3LMLA 2IA6A 3B2EE 4JF3A 2VQEB 1S77D 4UVAA 1IBLB 3FYEB 1WPBA 3KALA 2FLNA 1Y1WA 1G2WA 1NKDA 5DQHA 2Y4TA 1W93A 3L9DA 3S24A 4U7CA 4FS1A 3K3WA 4O3SA 1FPOA 1RSOB 4O4IB 5EBMC 5JQGB 5BMVF 4FFOA 3KAJA 1L8DA 3F5WC 3H1IH 4DW0A 1GN2A 4C7UA 1JX4A 4EEQA 1Y14B 2Q7EA 4JV5O 2HJDA 4BY7G 1HWYA 1PNKA 3T7AA 3JRWA 3APOA 4ZBMA 2CAZC 4LSXA 5D5PA 1CS0A 3QO8A 1BXRA 4Z2WA 5ITZA 3LSSA 2COIA 3GJXB 4NLGA 4JI6B 3SDLA 4B3TB 2X6AA 2YEVA 3CRQA 2ATLA 4B3RB 4F6RA 5KMGB 1HR0B 4D7TA 4RZRA 3K08A 3CJHA 5KG1A 5LMUH 5CA1F 5IYZB 1K1QA 1ZTEA 4P30A 1AUVA 5CE8A 3JD0A 3IFXA 1Q90D 2YDEA 2M7WA 1FXVA 1OV9A 2CGOA 1FFXA 2ZDQA 3E5NA 3T1YH 2EIKC 2QB5A 4EQ5A 3GIIA 1M56C 1Y1WG 4JI5B 5LA6A 2YWVA 2NU6B 5F2VO 4J10A 1IBMO 2ZT9B 4J7JA 4QWCA 1ZWIC 1BHBA 2QWRB 2FP4B 5JJJB 3CWBH 3ZHRA 4BXXG 4JYBA 4JTCB 4P9OA 1AJPA 2RN9A 4OX9B 2ODTX 1WSCA 4XDLA 2BTOA 4AQYB 3SYAA 3JAWA 3R5HA 2PY5A 3WWJA 4KL1A 1BSMA 2BSKB 2HVSA 4HNAA 5FL7G 1US6A 5DGBA 2EJ0A 1P8LA 3ABLC 4A2AA 1OCCC 5D1PA 1M5IA 4X20B 4DR2H 1WN7A 2P5OA 5I5UA 1EM1A 2FB5A 1SZXA 3NGDA 3CRAA 2DYSC 2P67A 4ED0A 3CC4V 4DR4H 3N43B 1R73A 1TWFA 1TGOA 1BMFG 3DXRB 2XGPA 4J11A 5LA6F 4YJ2B 1KU9A 3CCRV 4NTYA 1NBMG 3SJCC 1CKNA 4MTFA 4RAZA 4MVRA 3VOUA 5KS8A 3JASB 4RAIA 2FPGB 2RGRA 3ASNB 1N4CA 1GLVA 2WWWA 3QWUA 2AU0A 5I5WA 1I50A 4JI1H 2QGNA 2DWCA 3RF2A 1DLBA 4J9RA 1BCCH 4X65O 1SQQH 1J5EO 2DABA 2FL4A 3BCCH 4WF9V 1KKDA 3RW0A 3JD3A 1OCOC 3ORRA 2ILMA 1TVKB 3A0BZ 5LGTA 5I5TA 4B08A 4Q8FA 4LF9H 4JV2A 2AXTZ 3K3VA 1I5XA 2Y0SE 3X2QB 2ZGIA 4FLXA 3RFCA 4TSFG 2UUCO 4I50B 2EIYA 3N6RA 2HJFC 3CCJV 3OD4A 4YP3A 4FLUA 2EJ7A 3FKIA 4JI3H 5K1XA 4DRFA 4O2AB 3TW6A 4M7EA 1N33B 4RQFA 1GRJA 3GIDA 3PO2G 3KHLA 5IWAO 5IYDO 4QJFA 2V4QA 4DV1H 3V4SA 3APQA 3E8HA 1IBKO 1WPXA 5LGNA 5KFEA 1R1BA 3C90A 3CEIA 1R6TA 3G6BA 4YB8B 2C2AA 2UXCB 2YICA 3KG2A 2BE3A 1H2KA 3H4DA 5KFTA 1I1KA 4ASUG 4CHIA 2BCCH 4JXUA 4MVOA 3MWDA 1N0NA 4ECSA 2NVXA 1Z5VA 1Y6XA 4DO2A 5KHJA 5CMUA 3JARA 4LH6A 1T3NA 1QVFU 2R7MA 3JRXA 4E4EA 4UCSA 5BWVA 5I5SA 1B3QA 2W0FC 2GV9A 1RJRA 3BA9A 2R87A 3FMAA 1N32H 3KREA 4A3GG 3N6XA 5CB4B 4ECQA 1XNRH 2F95B 1KBLA 4R6ZA 4R8UB 3OTOB 2A06H 2YXYA 2ATKC 2W6ZA 4MA0A 4GX1A 3FKIG 3RJ0A 1S5JA 1EN4A 3KCXA 4ZI7A 2FK1A 4BW5A 2R7LA 1KBHA 3RB6A 5C3EG 3GDEA 5LMUO 1L1FA 4LNUB 5DEDA 3I56V 1WJZA 4YHHO 1AP6A 4DV2B 1KKCA 4JYAB 2VUMA 1HNXB 2W6MA 5J2UB 3T1YO 3RV4A 3MFIA 3CSXA 5KFQA 3PZPA 4UUJC 2HIXA 2JA6A 1OHHG 2QM7A
chains in the Genus database with same CATH topology
3T1YB 4TUYB 4AHCA 4TOIA 1ZHSA 3E22A 4LF7H 1Z2NX 3KXYT 3DSQA 3E22B 2ZIMA 4YJ3A 1HNZB 4JI0H 1QHTA 1Q43A 5C8YA 1CKOA 4DR7B 2F66C 4DUZH 1WH2A 5D5QA 3HKBA 4B3SH 4YJ3B 2HHHB 4AILC 1BJTA 1FJGH 2ZCEA 1XNQB 4PDBA 4JI7B 4R7RA 4UCUA 5IJ0A 4BWAA 3HKBB 3ICXA 2OYQA 4DR1H 4I4TA 1N34B 3J7AK 4EFEA 3JATA 4EB6B 5A2QW 4L8JA 1M93A 2PYJA 5IJ0B 1Q5OA 4X1KA 2VWJA 4I4TB 4DV0H 2ZINA 5FPOA 4LF7B 4TV9A 3N42B 3JATB 3T1HB 5LMNH 4TV8A 4DV4H 5CA0A 1IBLH 1JFFA 4DR4B 4X1KB 1XK5A 3MWMA 3N40P 4ZHQA 1FKAH 5DISC 4RB2C 4TV8B 5CA0B 5KX5A 4APMA 1JFFB 5JCOA 4DUZB 1P16A 4ZHQB 4B3SB 3K57A 5KX5B 4UCRA 4BWSC 4KHPB 1QQCA 5LP6A 3K59A 4IIJB 3ZS8C 3SR2C 4NXNB 4PI0A 5D1OA 2OWOA 4I55A 4LF8H 4CH6A 1N36H 4JI6H 4FFBA 3PN1A 5LP6B 3RGZA 3SGIA 4B3RH 5LMNB 1N33H 3VQWA 4DV4B 5D1OB 4UCVA 5JQGA 3K5NA 1CKMA 3CVZA 4I55B 4UCOA 3NBZB 4LFAH 4ZOLA 4FFBB 4X66H 1JJOA 4LMYA 3M7MX 3W5OA 4LFCH 1G6UA 3N44B 5KHKA 4DV3H 3RFRA 4ZOLB 2PTMA 5KHGA 5EZYA 4JI3B 4LFBH 4CC6A 4GLXA 4RAYA 3WB2A 4JI5H 5LOVA 5EZYB 4RZQA 3BPZA 4LF6H 2MCTA 4FLTA 5GONA 4YY3H 1SEIA 2Q2UA 2ZM6H 3U10A 4LF8B 2UUBH 1N36B 5LOVB 1IBMH 4OX9H 2KSWA 3EYYA 1XMOH 5JH7A 4AQYH 3SJAC 1O9GA 5GONB 3SJBC 4DV7B 3WB1A 1Q8IA 4MTEA 3NC0B 4MV9A 4X66B 4EFBA 3H20A 1HNWH 5JH7B 4Q6GA 4LFCB 2ZNJA 3IAYA 2UXBH 4X64H 4DV3B 2HVRA 2F93B 4WBNA 1MZBA 4LFBB 4DR6H 3TY9A 2F4VH 2VQFH 4DUYH 2YI9A 3HKDA 5JJEB 3RGXA 5FPRA 2QJ1A 3CB2A 3MAQA 4WBNB 4NXMB 3QTCA 4FM1A 1N32B 4DRXB 4LF6B 2VPSA 1XNRB 4YY3B 3HKDB 5LL6b 1O75A 2JS5A 2ZM6B 3RTXA 1SA0B 2UUBB 2UXDH 2R72A 1IBMB 4GKJH 4Q0YA 4BW9A 3L2PA 1XMOB 4I9QA 4LF5B 3VNNA 3RIZA 2UUAH 1SYXB 4DV6H 2HEPA 4FM2A 1HNWB 4RB0A 1XMQH 3KYHC 2UXBB 5KHHA 3WB0A 4LR3A 5BR8B 2UU9H 4O4HA 2WE6A 2PGGA 3VQYA 3U0ZA 4DR6B 4DR3H 5C8YB 2F4VB 2VQFB 4DUYB 2RJZA 1HW7A 4JI4B 5FLXW 4O4LA 4U3JA 3BHPA 1WNSA 4X62B 4CC5A 5JVDA 4UCTA 1ZAUA 3JASA 1XQ8A 2UXDB 1S03G 4GKJB 4CS3A 4X1IA 5BMVA 4O4LB 4U3JB 2VQEH 2XHBA 5FD5A 3QG5A 5JVDB 3TY8A 2UUAB 4DV6B 4O2BA 5JJNB 4A2BA 1D5AA 3W1GA 4X1IB 4TV9B 3BA8A 5BMVB 3K5MA 2HVQA 4FM9A 3JSLA 5IJ9A 4JI0B 2VUGA 2YCHA 4O2BB 4I7HA 2W57A 4FVMA 4NVPA 3K5LA 1M0TA 1NT2B 4B3MH 5IWAH 1FJGB 5IJ9B 4DR3B 3IG0A 5JCOC 4JV5H 3JAMW 3N41B 3C0FB 4O4JA 4IAJA 4DR1B 4K8XA 1SQFA 1DGSA 3RYHA 5CA1A 1TA8A 4FM0A 2YIBA 4GKKH 4O4JB 4B3TH 2CW7A 4DV0B 3LMLA 5LP6C 3B2EE 3BRCA 2VQEB 4O4IA 1RSOA 3W1BA 1HR0H 1IBLB 1WPBA 3KALA 3RYHB 5CA1B 3S24A 2VWKA 4J0MA 2P22C 4O4IB 4HBNA 5JQGB 3L4JA 3KAJA 1L8DA 4FLZA 4RB1A 1KMIZ 4EEQA 2Q7EA 4JI2H 2YIAA 4X1YA 3OTOH 1X4TA 2WYOA 5LYJA 3RR5A 3LNNA 2CAZC 4JV5B 4LSXA 3UT5A 3GB8B 4LF4H 5D5PA 1AN7A 4PZ8A 5ITZA 4X1YB 1O9HA 4DK0A 5KMGA 3HXLA 3GJXB 5LYJB 2JGUA 4DR5H 1E4GT 3F8NA 2CFMA 4JI6B 3UT5B 5KHIA 4FLWA 4B3TB 5ITZB 5IYZA 4B3RB 1TAEA 4F6RA 5KMGB 1HR0B 4D7TA 3NBYB 4LFAB 4K8ZA 2JVDA 2YXLA 5LMUH 5IYZB 3RYCA 3RYFA 4PZ6A 2Q7HA 4F6RB 1T5EA 3JAKA 3THOA 3N2KA 4JI2B 2YI8A 1FFXA 3RYCB 3RYFB 3T1YH 4K0KH 1E4FT 3CHXA 2Q0AA 4UFZA 1X9NA 4MV7A 4EQ5A 3JAKB 4JI5B 3BABA 5LA6A 4JI8H 1FFXB 1L2ZA 4LNUA 4DR5B 4GYCB 1I94H 4D7SA 5JJJB 5LA6B 4CH5A 4CS2A 4OX9B 2BTOA 4CH4A 4AQYB 2ZNIA 1SKVA 3JAWA 2PY5A 2HHHH 4KL1A 1GYFA 4X20A 2HVSA 4HNAA 2PYLA 1P8LA 3JAWB 4X64B 4A2AA 5D1PA 4ZIBA 2YIBD 1M5IA 4X20B 3RGBA 1WN7A 4DR2H 2E3CA 2ZIOA 4HNAB 2P5OA 4PZ7A 3M4IA 3DF7A 2ZJTA 4X65H 3J80W 1J5EH 2HGSA 3T1HH 4O4HB 2O03A 2RGVA 1B04A 4LH7A 3K58A 3A2FA 4JI8B 1FVIA 5FD6A 4RB3C 1JMKC 4YJ2A 3N43B 4DR4H 4FLYA 3HKEA 3ETQA 1I94B 1TGOA 3RYIA 1Z2PX 5EOYA 4TQFA 2QM4A 2FE3A 4YJ2B 1KU9A 1VS0A 3HKEB 1CKNA 3SJCC 4MTDA 4DK1A 3RYIB 2BTQA 4RAZA 3L4KA 3JASB 4EB6A 2RGRA 5K1PA 2UUCH 4LSAA 4KHPH 3QWUA 1Q3EA 5LXTA 1XMQB 4JI1H 1CKNB 2BTQB 1TVKA 3RF2A 2UU9B 2Q7GA 4DR2B 4NXNH 5LXTB 4X65B 1IBKH 1J5EB 1Z5WA 1TVKB 2UXCH 4B08A 2R9AA 3U11A 2PZSA 4I50A 1BGWA 4LF9H 3K3VA 1XHXA 5J2TA 4O2AA 1Z2OX 4FLXA 1V9PA 2WDTA 5EYPA 1ZHQA 4I50B 3FFQA 1S68A 3N2GA 5J2TB 3JSNA 4FLUA 4IIJA 4JI3H 1I6UA 5K1XA 4DRFA 4O2AB 2UUCB 2Q2TA 4M7EA 1N33B 1M0WA 5EYPB 4JI1B 3N2GB 3OTFA 3QF7A 3HKCA 4DV1H 4PI2A 1TUBA 4B3MB 5EIBD 5IWAB 2IM9A 1M4UA 1IBKB 4CH3A 3HKCB 2UXCB 4DV5H 1TUBB 1XHZA 4DV7H 1YEWA 2HIVA 4LF9B 1A0IA 4GKKB 3KAKA 3TY5A 1Z5VA 2E5LH 1P49A 3VQVA 5KHJA 3JARA 4LH6A 4PHZA 3UQ8A 4DV2H 4UCSA 5CB4A 3JALA 2VOBA 2PUSA 4YHHH 2GV9A 4JYAH 1SQGA 1HNXH 3BA9A 3JARB 1XI1A 4NXMH 5IT9W 3FMAA 1N32H 2XIGA 2EX3A 2V4DA 3RWRD 3VQXA 4DV1B 3N6XA 5CB4B 3BAAA 1XNRH 1I7FA 2F95B 3JALB 4IHJA 1XDNA 3OTOB 2CW8A 4LF4B 1VF7A 4LF5H 4DV5B 3N2KB 4IHJB 3RJ0A 1S5JA 4E6NA 2R70A 4ZI7A 4ETSA 5FNVA 1HNZH 4DR7H 2E5LB 3GDEA 3ZEDA 5BR8H 4LNUB 2F1MA 5J2UA 4ZI7B 4DRXA 5FNVB 4FLVA 4DV2B 1H2SB 1XNQH 5LMUB 4JI7H 5EIBC 3K5OA 4YHHB 4JYAB 2KKWA 4TUYA 1SA0A 1HNXB 2RQ6A 4JI4H 5J2UB 1N34H 4CS4A 4TQDA 3CSXA 2HIXA 4X62H 3J81W 4K0KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1Y B;  1CKN B;  4DV7 B;  2UU9 B;  4TOI A;  4DR2 B;  3NC0 B;  4X66 B;  4EFB A;  4EEQ A;  4X65 B;  1J5E B;  4LFC B;  4DV3 B;  2HVR A;  1HNZ B;  3RR5 A;  4JV5 B;  1CKO A;  4LFB B;  4DR7 B;  3GB8 B;  3TY9 A;  4PZ8 A;  5FPR A;  3GJX B;  2HHH B;  4NXM B;  1XNQ B;  1V9P A;  4JI7 B;  1N32 B;  4LF6 B;  4UCU A;  4JI6 B;  4B3T B;  1S68 A;  2CFM A;  1XNR B;  3JSN A;  4YY3 B;  4B3R B;  4DRF A;  1TAE A;  2ZM6 B;  1N34 B;  1HR0 B;  2UUC B;  3NBY B;  3RTX A;  4EFE A;  2UUB B;  1N33 B;  2Q2T A;  1IBM B;  4LFA B;  3L2P A;  1XMO B;  4JI1 B;  4LF5 B;  3VNN A;  4PZ6 A;  5FPO A;  4LF7 B;  4B3M B;  3T1H B;  5IWA B;  1HNW B;  4DR4 B;  1IBK B;  3KYH C;  4JI2 B;  1XK5 A;  2UXB B;  3S24 A;  2UXC B;  5BR8 B;  5DIS C;  4UFZ A;  1X9N A;  4EQ5 A;  2HIV A;  4JI5 B;  3BAB A;  4LF9 B;  4DUZ B;  4DR6 B;  1P16 A;  1A0I A;  2F4V B;  4GKK B;  2VQF B;  4DUY B;  3TY5 A;  4B3S B;  4JI4 B;  4DR5 B;  4UCR A;  4LH6 A;  4KHP B;  4OX9 B;  4X62 B;  4CC5 A;  3UQ8 A;  4UCS A;  4UCT A;  4AQY B;  1ZAU A;  2UXD B;  4NXN B;  5D1O A;  4GKJ B;  2OWO A;  3BA9 A;  2HVS A;  3PN1 A;  4DV1 B;  2UUA B;  3TY8 A;  3BAA A;  3SGI A;  4DV6 B;  1XDN A;  1P8L A;  5LMN B;  4X64 B;  4DV4 B;  5D1O B;  4UCV A;  5D1P A;  3OTO B;  2HVQ A;  1CKM A;  3BA8 A;  3W1G A;  3NBZ B;  4UCO A;  3JSL A;  4JI0 B;  4PZ7 A;  4LF4 B;  2VUG A;  4DV5 B;  3W5O A;  4E6N A;  1FJG B;  1B04 A;  4LH7 A;  4JI8 B;  1FVI A;  4DR3 B;  4JI3 B;  2E5L B;  4DR1 B;  4CC6 A;  3GDE A;  1I94 B;  4GLX A;  1DGS A;  4DV2 B;  1VS0 A;  5LMU B;  1TA8 A;  1CKN A;  4YHH B;  4DV0 B;  4JYA B;  1HNX B;  3W1B A;  2VQE B;  2Q2U A;  1IBL B;  4LF8 B;  1N36 B;  3QWU A;  1XMQ B;  2HIX A;  4K0K B; 
#chains in the Genus database with same CATH topology
 2QKA A;  1CQI B;  5KA6 A;  5KKN B;  2GHY A;  2NU7 B;  3DAA A;  5DQG A;  3VMM A;  5B66 Z;  2R9I A;  3RVY A;  3PW4 A;  4F6E A;  1JQ0 A;  2EIN B;  3V6K A;  1JLL B;  3WG7 B;  1SES A;  4DR7 O;  2V1D A;  3E22 B;  2ZIM A;  1HNZ B;  2R82 A;  5EBL C;  5C8Y A;  2AW9 A;  1WH2 A;  5D5Q A;  4UV9 A;  1F51 A;  4B3S H;  4YJ3 B;  4AI8 A;  3LQS A;  1FJG H;  5KT6 A;  4JI7 B;  1N34 O;  4UCU A;  5CBH A;  5C5J A;  4HNU A;  3ZHT A;  4BWA A;  2ZE5 A;  4DR2 O;  2E74 B;  1SC5 B;  3HKB B;  1EBO A;  4M9U A;  3J7A K;  4EFE A;  3TET A;  2JA5 A;  5IJ0 B;  2VWJ A;  4DR4 O;  1DF4 A;  1AI6 A;  4DV0 H;  1ZL8 B;  4EYH B;  1S5L Z;  5F9N A;  1SFO A;  5KG2 A;  2R6F A;  4TV8 A;  1KJ8 A;  4DV4 H;  1JFF A;  3QVN A;  1CEZ A;  3HOX G;  2V5A A;  4X1K B;  4J9K A;  3N40 P;  2VUM G;  4O7S A;  1NJI W;  3T9E A;  3C3T A;  3AG2 C;  3ZRX A;  5KX5 A;  4F50 A;  2JA6 G;  2HP8 A;  2DIK A;  1P16 A;  2WLL A;  1I2K A;  4ZHQ B;  3HOU G;  3CC7 V;  5HNE A;  1DV2 A;  4JI1 O;  3K57 A;  3PW7 A;  4BWS C;  2YZL A;  1QQC A;  3M8A A;  4QSH A;  5LP6 A;  1M57 C;  3K59 A;  3CEB A;  2Q9L A;  1P84 F;  2EJR A;  4NXN B;  4PI0 A;  4I55 A;  2WLI B;  1JVM A;  1M90 W;  4LF8 H;  1Y66 A;  3PN1 A;  4BR6 A;  2DYR C;  2JEI A;  3VQW A;  3BJY A;  4UCV A;  1XIL A;  1JDB B;  5JQG A;  1CKM A;  3NBZ B;  3FAV B;  2UXX A;  1GGO A;  1UC9 A;  2CNU A;  2XAH A;  1CXZ B;  4JGS A;  1VQM V;  3N44 B;  2CK3 G;  4JI3 O;  4DV3 H;  3RFR A;  2JA5 G;  5DM6 V;  4UUG A;  5EZY A;  5BYA A;  4B7K A;  5J2T F;  4GLX A;  2IH1 C;  3T4D A;  5LOV A;  4CMD A;  2C2D A;  4RUE A;  4WFF A;  3BPZ A;  2R8K A;  5GON A;  4IIJ F;  1R3I C;  3ABM C;  5I5X A;  1XRE A;  1KYO F;  2L35 A;  1N36 B;  5LP6 F;  5LGU A;  3WB1 A;  1Q8I A;  4A3L G;  4OGQ B;  4MV9 A;  5L3F A;  2IP4 A;  4X66 B;  4I55 F;  2CTQ A;  3K9S A;  5B1B C;  3ZRW A;  3Q2O A;  1Q81 W;  4X64 H;  4JYY A;  3P3P A;  3ZX6 A;  3MD0 A;  4I7Z B;  2W9C A;  4LFB B;  4UB8 Z;  1N32 O;  4LC1 A;  4LF6 O;  1WLE A;  5JJE B;  1QU7 A;  2KB1 A;  1XNR O;  3CB2 A;  3MAQ A;  2Z02 A;  4AYB A;  4FZ0 A;  4Q43 A;  2V9W A;  2M6Y A;  4QWA A;  2UUB O;  3HB3 B;  2VPS A;  3IC9 A;  4YY3 B;  1WR2 A;  3HKD B;  3HR0 A;  3MDS A;  3BG5 A;  2ODM A;  2QWQ B;  1IBM B;  3FD9 A;  3GIK A;  5EBW C;  3L2P A;  4N21 A;  5LOV F;  4LF5 B;  3VNN A;  5DAA A;  1HNW O;  3HOW G;  2ABJ A;  5GON F;  3QO7 A;  4IYI A;  2UXB O;  4ZQI A;  2KG7 A;  4QPK A;  3ML0 A;  3GWO A;  4O7R A;  5KUK A;  2RDI A;  3BFR A;  2UU9 H;  3IJ4 A;  2WE6 A;  4RNN A;  2PGG A;  4O3R A;  3WFV A;  2Q4P A;  3AYH B;  1K8A W;  3H3V H;  2XD4 A;  2VQF B;  4DUY B;  3RBZ A;  3OUZ A;  4O3O A;  1XEQ A;  3LDC A;  4NTW A;  4IRD A;  5L3G A;  4O4L A;  1WNS A;  3W7T A;  4CC5 A;  5B1A B;  3CCS V;  4HNT A;  1EKF A;  1PKX A;  1N8R W;  1ZAU A;  3JAS A;  1XQ8 A;  5LBQ A;  1FXH A;  4X1I A;  4PBC A;  1KC7 A;  3AG3 B;  2UUA B;  4DV6 B;  1EUC B;  4O82 A;  2VA3 A;  4H37 A;  3W1G A;  4TV9 B;  3W7W A;  1ZX3 A;  3JSL A;  3TIN A;  3Q8S B;  4JZG A;  2XT9 A;  3CCQ V;  4HQ6 A;  1FJG O;  4K3A A;  1T36 A;  2ITD C;  4DR3 O;  3TGU H;  5E25 A;  2XCL A;  2ZXW B;  1MOF A;  4NVP A;  3K5L A;  1JPX A;  4JV5 H;  3JAM W;  1SQX H;  3OW2 U;  4LBE C;  4DR1 B;  2W9B B;  3BY6 A;  4MS2 A;  3R65 A;  5DEC A;  2R8J A;  1X59 A;  3ETE A;  4DV0 O;  2XGQ A;  2WSS G;  1TA8 A;  3GV7 B;  2EIJ C;  2YIB A;  2B1G A;  3V6J A;  1NR7 A;  3ETG A;  3ORQ A;  3LSU A;  5LP6 C;  1N48 A;  3BRC A;  1THZ A;  4O4L F;  3K5I A;  3RYH B;  5JUM A;  2P22 C;  1Q7Y W;  4A3B G;  4FLZ A;  3V4Z A;  3ZMU A;  5KFJ A;  4RB1 A;  2DWD C;  1T94 A;  3SNO A;  2YIA A;  4X1Y A;  1X4T A;  2WYO A;  3T5J A;  4O83 A;  1AUX A;  3SE7 A;  2OIE A;  2ZKO A;  1Q82 W;  5LHH A;  1W0J G;  4FBT A;  4J7K A;  3WNZ A;  5LYJ B;  3CMA V;  2JGU A;  1E4G T;  3F8N A;  1E79 G;  2CFM A;  3UT5 B;  4FLW A;  5DG8 A;  3P3N A;  2IJK A;  2DW4 A;  2OCH A;  1TAE A;  4J7Z A;  2EUL A;  2CH7 A;  4LFA B;  4K8Z A;  2DQ3 A;  4BIU A;  4A3C G;  1SQP H;  3OEH G;  3JCU Z;  1KJQ A;  3AG4 C;  1RK6 A;  3BAC A;  3RYC A;  2Q7H A;  1VQ5 V;  4JI2 O;  3I12 A;  1PP9 H;  3JAK A;  1E4E B;  5BZB A;  3H1K H;  3THO A;  2GLT A;  1ZUQ A;  5H9C A;  4K0K H;  3RYF B;  2GUZ A;  1E4F T;  2VQD A;  2Q0A A;  4J9N A;  4MV7 A;  2DQ0 A;  5B3S C;  3BAB A;  4DR5 O;  2OLS A;  3CYO A;  4DW1 A;  3G8D A;  1COW G;  4LNU A;  3U54 A;  4CKC A;  4IRC A;  5HBR B;  4RCN A;  4GYC B;  1I94 H;  4D7S A;  4CS2 A;  4Q8E A;  2VA2 A;  5KFC A;  1NVP D;  5EK0 A;  2EIL C;  4CH4 A;  1R3L C;  2Z04 A;  4RO2 A;  2EBO A;  1IZ3 A;  5KFS A;  2HHH H;  3J81 N;  3LDD A;  3OEE G;  3W7X A;  1GYF A;  4X64 O;  4QE7 A;  2EJ2 A;  1GM8 A;  5BWW A;  4DLK A;  5L9X A;  2E2H A;  3L72 H;  4FE2 A;  3BQ1 A;  2XUM A;  5IY5 B;  4ZIB A;  2YIB D;  2DLN A;  4PZ7 A;  1ARO P;  4JI8 O;  3DF7 A;  2PBZ A;  3QZ8 A;  2ZJT A;  4X65 H;  3J80 W;  1J5E H;  2RCV A;  5KFL A;  4H13 B;  4O4H B;  5DQI A;  2JEJ A;  3K58 A;  3A2F A;  5KFN A;  5IYC O;  4ECU A;  3VPC A;  4NR1 A;  4X89 A;  3R66 A;  5EOY A;  2JRI A;  2LO1 A;  4PDL A;  1VS0 A;  4B7E A;  3EHB B;  3HKE B;  4JV0 A;  2I80 A;  4MTD A;  2BTQ A;  3RYI B;  3L4K A;  1SQV H;  2UUC H;  5BWU A;  2QKS A;  1B06 A;  2UU9 O;  1XMQ B;  2FPI B;  1TUE B;  2FK3 A;  2E76 B;  5H80 A;  1VQL V;  4RQE A;  3EFF K;  4DR2 B;  3T5H A;  5LXT B;  3AX6 A;  2LFR A;  1RK5 A;  1IBK H;  1Z5W A;  4OPA A;  4WFE A;  3I55 V;  3T4Z A;  3GIJ A;  4O7Y A;  2OIG A;  5KAF Z;  4XYM B;  3OSN A;  3NXS A;  1Z2O X;  2CQY A;  2ZDG A;  3TW7 A;  3I4M G;  5L3B A;  1KT8 A;  1ZHQ A;  3RB3 A;  1S68 A;  4NZM A;  5J2T B;  1I6U A;  2V4R A;  2C2R A;  5C1O A;  5IYC G;  4J9M A;  2Q2T A;  1QLE B;  1M0W A;  2WLI A;  5EYP B;  2W6I G;  5H5N A;  1D2D A;  4JI1 B;  3ETH A;  3N2G B;  2AZ2 A;  3QF7 A;  1EUD B;  4PWQ A;  4RNO A;  3HKC A;  5KG3 A;  3HT5 A;  3JZF A;  1TUB A;  1G4Y B;  2B5U A;  4B3M B;  4QWB A;  5KFV A;  1YCI A;  1QR9 A;  4G27 B;  1EZ1 A;  3FAV A;  3HPL C;  3D3I A;  2QF7 A;  2ADP A;  2DPI A;  2CNQ A;  5KFY A;  1SQB H;  1IXM A;  4DV7 H;  1P7G A;  1SRY A;  3RN4 A;  4LF9 B;  1CE8 A;  1A0I A;  4BBS G;  2QKC A;  4GKK B;  4F4Y A;  3TY5 A;  2Y0P A;  3T9B A;  2V59 A;  2XC9 A;  1RP3 B;  3P32 A;  5IT9 N;  3MR3 A;  1P49 A;  3VQV A;  2P4K A;  2JJ2 G;  5EC2 C;  1B6R A;  2J9G A;  1H2M A;  2CKZ B;  1JIH A;  3BQ2 A;  1FXK A;  3JAL A;  1E1Q G;  2VOB A;  3OR7 C;  4YHH H;  4EEY A;  5HFM A;  4ED3 A;  1EHI A;  1RM1 C;  1I5Y A;  4DV1 B;  1I7F A;  5TIS Z;  4DV5 O;  4GC7 A;  1S0N A;  4XBF A;  1EYZ A;  4A93 G;  3UO2 A;  4LF4 B;  4YAK B;  1I3Q A;  2LGQ A;  3N2K B;  2XAG A;  4GUN A;  4IHJ B;  5BWT A;  2J6U A;  3FB7 C;  1BHA A;  2YC0 A;  4E6N A;  2DJV A;  3AK2 A;  2E5L O;  1NTM H;  5FNV A;  4FFM A;  5KFI A;  1CP9 A;  1NU1 H;  4A3K G;  4CKB A;  4DR7 H;  3LNM B;  2YRW A;  4UV8 A;  5K2M A;  5BR8 H;  3G6Y A;  3H1H H;  5DLF A;  4FFL A;  1V4Y A;  4O3P A;  2RDJ A;  1VF6 A;  1ULZ A;  4TUY A;  3AK3 A;  3UCS C;  2FTK A;  3OR6 C;  5H2F Z;  1VQ7 V;  4K0K O;  2W6P A;  3G8C A;  2W7O A;  1N34 H;  2JEF A;  4CS4 A;  4TQD A;  4YIP A;  4X62 H;  3RAX A;  2XAJ A;  3D36 A;  1Y76 B;  4FJC C;  3MWE A;  4AHC A;  1YI2 V;  4TOI A;  1ZHS A;  5KFR A;  2H94 A;  4DQN A;  1Y4M A;  2PN1 A;  3TEK A;  1I94 O;  3KXY T;  4F4W A;  2ZD9 A;  2OCC B;  3B8N A;  3JYC A;  3MHH C;  3T5L A;  5EWG A;  5KT7 A;  3ZHS A;  4ABM A;  1K7D A;  2HHH O;  3OUF A;  1Y74 B;  2F66 C;  1XNQ O;  1KC8 W;  3VOT A;  4JAV A;  4HN2 A;  3ZHQ A;  4RUC A;  3T99 A;  3CQZ A;  1L0N H;  4AIL C;  1BJT A;  1KP2 A;  4R7R A;  5FNV F;  4PDM A;  5JWP A;  3P30 A;  3ICX A;  1KUQ A;  4I4T A;  2QDO A;  4K35 A;  1PL4 A;  4JYC A;  3SI8 A;  5A2Q W;  2YSU B;  4L8J A;  4GX2 A;  4HYO A;  4LF7 O;  2PYJ A;  1N56 A;  2W71 A;  1KTA A;  5KG4 A;  3GIL A;  3D3Q A;  1VAJ A;  3SYP A;  4TUY F;  4TV9 A;  3JAT B;  3T1H B;  4FK5 C;  5CA0 A;  4DL3 A;  4JTD B;  1IBL H;  1AI7 A;  1F7Y A;  5CA3 A;  3Q8R B;  1VP7 A;  2X6B A;  2HKO A;  2GTS A;  1FS0 G;  4DUZ O;  4RB2 C;  4APM A;  1YTF D;  1HP8 A;  4GX0 A;  4ED7 A;  2HVK C;  4L1K A;  4UXN A;  3PR4 A;  4EYI B;  3OUU A;  2UVW A;  4B3S B;  3J7A U;  4O81 A;  5I60 A;  4Q4C A;  4KHP B;  3Q4H B;  1K4D C;  1S10 A;  3OGI B;  1AI5 A;  1NVP B;  1K9M W;  5CM0 A;  5I5V A;  2H3O A;  5H6Q A;  4GT1 A;  3SR2 C;  3ZS8 C;  2COG A;  4GCZ A;  2W8L A;  5LMN O;  1OCZ C;  3CRM A;  4CH6 A;  4TM5 A;  4JI6 H;  4FFB A;  3SGI A;  4DYL A;  3DTF A;  4PD4 F;  5BY1 A;  4B3R H;  4I4T F;  4DV4 B;  5D1O B;  3ZN0 A;  5KUM A;  1DV1 A;  1FKA O;  2I8C A;  2YZG A;  1AB3 A;  3CVZ A;  5KT5 A;  4ZOL A;  4ECR A;  3U9T A;  1JOY A;  3CPW U;  1U97 A;  2FKX A;  3CSW A;  2R7Z A;  3Q1K A;  5I47 A;  5CA0 F;  4QPJ A;  2PTM A;  1AIL A;  1C3O A;  2YID A;  3E8F A;  4XDK A;  3H0G A;  1YSC A;  1Q86 W;  4JI5 H;  2HHF A;  4LF6 H;  4QWD A;  5DGA A;  3ABT A;  2MCT A;  1PL0 A;  4FLT A;  4U7O A;  3MR5 A;  4FGR A;  2Q2U A;  1FXK C;  5EC1 C;  4LF8 B;  2UUB H;  4DV7 O;  4IGG A;  5KT3 A;  4OX9 H;  2KSW A;  2IJJ A;  2YRX A;  1PNM A;  3EYY A;  5JH7 A;  4AQY H;  4FPP A;  3SJB C;  5J9P C;  4LFC O;  1UJW B;  3K0D A;  4MTE A;  2KSD A;  1AJQ A;  3ZRS A;  3ZMZ A;  1RYR A;  1HNW H;  4Q6G A;  2P0A A;  2QSA A;  3TCU A;  2UXB H;  4DV3 B;  3T9F A;  1WB7 A;  4Q4D A;  2DPJ A;  4MV6 A;  2R93 A;  4ZOL F;  2EIK B;  1Q6H A;  2W6J G;  1KJI A;  2QM8 A;  1KQS U;  1TWH A;  1M56 B;  2Y69 C;  5FPR A;  2X5R A;  2L6L A;  4WBN B;  4NXM B;  2ZM6 O;  4DRX B;  4QGP A;  3CS5 A;  2CGN A;  1K33 A;  5DG9 A;  2R7Z G;  4N23 A;  1XMO O;  1VF6 C;  3RTX A;  1SA0 B;  3PW5 A;  1OJH A;  4Q0Y A;  1V54 C;  1MMM A;  3H0G G;  3V6H A;  3RIZ A;  5IP7 G;  1SYX B;  1MNG A;  1DF5 A;  2HEP A;  5GW7 A;  3TXQ A;  2A79 B;  4O7W A;  3SPH A;  1WA8 B;  5BR8 O;  4QWE A;  3E8G A;  3ABU A;  1AVM A;  3ABL B;  4JTA B;  3KYH C;  1OCC B;  4E4T A;  1RJP A;  1OZ0 A;  4DR6 O;  1EN5 A;  3WB0 A;  4KP4 A;  2R7N A;  3RB0 A;  2F4V O;  4O4H A;  1WP8 A;  4W4L A;  3U0Z A;  4ZI7 F;  5KAI Z;  4DR3 H;  3MR2 A;  2DYS B;  2QWP B;  2RJZ A;  4X62 O;  1S72 V;  4JI4 B;  5FLX W;  4I0X B;  3GIP A;  2B63 A;  2AGO A;  1R6K A;  3T5K A;  1H8E G;  3GTL A;  4EGQ A;  1VQ9 V;  3BHP A;  2UXD O;  4GKJ O;  5JVD A;  1NH2 D;  2AHZ A;  4CS3 A;  4TQS A;  2R93 G;  2HR3 A;  4U3J B;  3E86 A;  1CQJ B;  4TVI A;  1PPJ H;  4H33 A;  4DAA A;  5FD5 A;  1L0L H;  4NYE A;  3UFX B;  2FLP A;  3JD1 A;  2ZR2 A;  4O2B A;  1D5A A;  1K3E A;  2HGX A;  2HDK A;  5BMV B;  3K5M A;  2HVQ A;  1N33 H;  3TQ1 A;  4JI0 B;  5IJ9 A;  1V51 A;  3G67 A;  4I7H A;  1M0T A;  1K5Q A;  2JGD B;  3ZMT A;  1OCO B;  1DK1 A;  4J9Z B;  3E8B A;  1M1K W;  2OT5 A;  4MVQ A;  5KG6 A;  2ZDI A;  5C8Y F;  4PA7 A;  4O4J A;  3WU2 Z;  2VRZ A;  4O3Q A;  3R9R A;  1H8H G;  2VQE O;  4FM0 A;  3R23 A;  1IBL O;  3ZMS A;  1IVS A;  3CC2 V;  3W1B A;  4PV1 B;  1UNN C;  3ASO C;  1RSO A;  4O4I A;  2YZM A;  1JJ2 U;  4FZ1 A;  2LW1 A;  5CA1 B;  4MTO A;  5JVD F;  4J0M A;  2B63 G;  2LJ2 A;  2VR1 A;  3A0H Z;  4HBN A;  3MFH A;  3L4J A;  4TV8 F;  1KMI Z;  4NZN A;  4JI2 H;  4O2B F;  3OTO H;  5KX5 F;  1NTK H;  4JV5 B;  3GB8 B;  2RF4 A;  1AN7 A;  5DG7 A;  4PZ8 A;  4B3T O;  4JI6 O;  4J9P A;  3HXL A;  4DK0 A;  5KMG A;  4L87 A;  4DR5 H;  4B3R O;  2EIM C;  1HR0 O;  3UKM A;  4R8C A;  5KHI A;  5ITZ B;  5IYZ A;  4O4J F;  3G6E V;  3CRR A;  1AI4 A;  4BBR G;  3RBD A;  3IC7 A;  2FMA A;  3T1C A;  1QCE A;  2JVD A;  2P4V A;  2YXL A;  2JEX A;  2JDI G;  2YEV B;  4X88 A;  2CTP A;  4J42 A;  2UVR A;  4F6R B;  2DMX A;  3GV5 B;  2GBO A;  4PA3 A;  1I08 A;  1KD1 W;  4O4I F;  4TWK A;  5JQG F;  3CJH B;  3HKZ A;  2R86 A;  3N2K A;  2GSM B;  4JI5 O;  2JEU A;  3TJT A;  2BQR A;  4YIO A;  3E35 A;  3CHX A;  4UFZ A;  1X9N A;  3SPI A;  4JZ2 A;  3FX7 A;  2X0L A;  4JI8 H;  1Y1V A;  1FFX B;  3ZN1 A;  4YR2 A;  5EZY F;  1L2Z A;  4OX9 O;  4FS2 A;  3HO8 A;  2Q5Z A;  4AQY O;  5LA6 B;  4CH5 A;  1ZQ7 A;  2BSK A;  3N27 A;  3RB4 A;  4E2L A;  4JAU A;  3FDS A;  4IL6 Z;  1ZSP A;  3AG1 C;  1B6S A;  1SKV A;  3L73 H;  3OM3 B;  4J9S A;  1BL8 A;  4MV3 A;  4X20 A;  2NU8 B;  4CKE A;  2PYL A;  3OSP A;  4BAY A;  4WCE V;  5IYZ F;  3T2M A;  3JAW B;  4A3J G;  3AK1 A;  5EDW A;  3OGC C;  4FU0 A;  1P7B A;  4HNA B;  2ZIO A;  1S76 D;  1OCR C;  3SPG A;  3ZBH A;  5KFZ A;  2HGS A;  5L1L A;  4PDR A;  1B04 A;  4LH7 A;  3G6V A;  3DXR A;  5FD6 A;  1JMK C;  4YJ2 A;  3HBL A;  5T14 A;  3I4N G;  4FLY A;  3OMN B;  1I94 B;  1Z2P X;  3T9A A;  2QM4 A;  1OBG A;  2AQ4 A;  5FLM G;  1W2B U;  2ZDH A;  3HOV G;  4IWY A;  2IJH A;  3WO1 A;  1R9T A;  1S0V A;  5K1P A;  1RYS A;  1OBD A;  1SF9 A;  4QE9 A;  1Y1V G;  1Q3E A;  1CKN B;  1TVK A;  2Q7G A;  4NXN H;  1SET A;  3ABK B;  3CCM V;  4PJ0 Z;  4RUA A;  1NI8 A;  3EPI A;  4X65 B;  1J5E B;  1YDX A;  2QWO B;  4MSW C;  4DL7 A;  3QFF A;  2JK5 C;  3G4S V;  4O7L A;  2VS0 A;  2Z3Y A;  4JPR A;  1VQ4 V;  2PZS A;  4I50 A;  2ASJ A;  2ZDI C;  3AG2 B;  3SJQ C;  3GTM A;  2HG8 A;  1VIB A;  4O2A A;  3MHS C;  3CCV V;  1V55 C;  1G1X B;  3EVK A;  1V9P A;  2AGA A;  3FFQ A;  2GTA A;  1N33 O;  4YJ2 F;  3N8D A;  2R92 A;  4PA9 A;  1UC8 A;  4A3M G;  2UUC B;  1IOV A;  1M57 B;  3FB5 C;  4HYK A;  2E2I A;  5LHI A;  1JA8 A;  1K1S A;  4A3E G;  2W70 A;  3O65 A;  4PI2 A;  4F4L A;  2ASL A;  4NKG B;  4GZR B;  5IWA B;  2IM9 A;  2UXC O;  2DYR B;  1LUV A;  3KHG A;  1IBK B;  4CH3 A;  2CTW A;  5CR5 A;  2NNU A;  4MAM A;  4DV5 H;  2UVU A;  1XHZ A;  5BPF A;  1XUQ A;  2HIV A;  1MAB G;  2O57 A;  1EKP A;  5KFH A;  3TXS A;  1YF2 A;  1IUR A;  3LUL A;  2NU9 B;  4EBC A;  2DN9 A;  2ZE6 A;  3O9O A;  1I1M A;  3KAK A;  3RBE A;  2B9Z A;  2E5L H;  4WFH A;  4CBC A;  2XOK G;  2MW2 B;  4I50 F;  1U96 A;  5CB4 A;  3CME V;  1JCH A;  3HB9 A;  4R8U A;  3JAR B;  5IT9 W;  3JCZ A;  2XIG A;  1YZB A;  2IW5 A;  3L74 H;  1VEW A;  3OTO O;  4QW8 A;  1WP7 A;  3ABM B;  4FFN A;  2MK3 A;  3ZRV A;  1VF5 B;  2SCU B;  2IJI A;  3RAQ A;  2N04 A;  1YXB A;  3CX5 F;  4LF5 H;  2R92 G;  2Y0I A;  2FPP B;  5GTI Z;  1K4C C;  2N05 A;  3HOZ G;  2R8G A;  5B1B B;  1ET0 A;  2AGP A;  2BQ3 A;  5KFD A;  1AJN A;  2JA8 G;  2OH2 A;  2GDS A;  1C30 A;  5I5Y A;  4F4Z A;  1AP5 A;  2UXN A;  4DV2 O;  3ZED A;  3B40 A;  1PX2 A;  2F1M A;  5J2U A;  4ZI7 B;  1OWT A;  4DRX A;  4JYA O;  2WTF A;  3GQC A;  3G80 A;  1HNX O;  1H2S B;  4Q20 A;  3E2E A;  5LMU B;  1IYE A;  4HR7 A;  1XNQ H;  2IMW P;  3UM7 A;  4YHH B;  1DAA A;  2KKW A;  1SA0 A;  3ZIA G;  2VPQ A;  1VKZ A;  4HZ3 A;  5C1P A;  3DTU B;  5L1K A;  2IU0 A;  3T1Y B;  3KTM A;  5CB4 F;  2NR5 A;  3DGE A;  5DLG A;  2FB9 A;  1QR8 A;  3E22 A;  2YL2 A;  2YS6 A;  4LF7 H;  4WFG A;  1MZE A;  1I2L A;  1HNZ O;  2K9P A;  3B4S A;  1XOU A;  3GIM A;  3DSQ A;  4YJ3 A;  2WA3 A;  4GLW A;  1QHT A;  1Q43 A;  4MW8 A;  3RT3 C;  3HKZ E;  3S3X A;  5IYB G;  5E79 Z;  1KEC A;  4DR7 B;  3RUP A;  4DUZ H;  4JI7 O;  3H1L H;  3HKB A;  5KFW A;  1GM9 A;  3DTG A;  1GM7 A;  1AR5 A;  3OT7 A;  4AYB E;  4PDB A;  4QW9 A;  4RUF A;  3ASN C;  2D3O W;  5IJ0 A;  1FYJ A;  2OYQ A;  1IYD A;  5KFB A;  4DR1 H;  1N34 B;  1ZL8 A;  4JV1 A;  4EB6 B;  5J2U F;  1JX9 A;  1S97 A;  1M93 A;  1EZV H;  4CE5 A;  1Q5O A;  1LR1 A;  4X1K A;  1YJ9 V;  2ZIN A;  3LUT B;  3WWH A;  3N42 B;  5LMN H;  1VQ8 V;  1CPY A;  1H2L A;  4DR4 B;  4XDJ A;  2PI5 A;  4TT3 G;  3A0R A;  3B09 A;  4ZHQ A;  1BQZ A;  4ECZ A;  1FKA H;  3U55 A;  4TV8 B;  3K3P A;  1JFF B;  2WLJ A;  3DC5 A;  3X2Q C;  3JD4 A;  2LGW A;  3H4B A;  3CCE V;  1A0G A;  1ZET A;  1ENV A;  3GTO A;  5IDJ A;  2N74 A;  5KX5 B;  4UCR A;  4YJ3 F;  2EZO A;  3IN5 A;  2WLL B;  4NXN O;  1XL4 A;  4IIJ B;  4GC6 A;  1KUT A;  5CAE B;  2OWO A;  2P7T C;  2EIJ B;  3A8T A;  4NTX A;  4MVZ A;  2NLJ C;  1GO3 E;  2WA4 A;  2NUA B;  5LP6 B;  3RGZ A;  5KG5 A;  1P4R A;  4LCU C;  3EXA A;  1K97 A;  4PDV A;  3KKY A;  2YW2 A;  4YR3 A;  3NR7 A;  3K5N A;  2E75 B;  4J9O A;  4I55 B;  4IRK A;  4LFA H;  2CDY A;  1GTO A;  2ITC C;  3UZB A;  4RU9 A;  2A9H A;  2YS8 A;  4LMY A;  4EBE A;  4LFC H;  1G6U A;  5KHK A;  3CCL V;  3GVM A;  2Z0A A;  3VBB A;  5JVL A;  2XAQ A;  4KUM A;  4JI3 B;  5IP9 G;  4ZHQ F;  2RNB A;  4CC6 A;  3D8C A;  2HJW A;  2Q67 A;  4EGJ A;  2W6N A;  1VQO V;  5EZY B;  4RZQ A;  1N36 O;  3QQM A;  1BQ0 A;  1F4M A;  1SEI A;  2XND G;  2ZM6 H;  3HOY G;  5LOV B;  5L1I A;  4ECX A;  2W8K A;  1XMO H;  4X66 O;  1EZJ A;  5GON B;  2X7R B;  3AG4 B;  1R6N A;  2C2E A;  4EFB A;  3H20 A;  2JEG A;  1YJN V;  5KLV H;  3JZ6 A;  3IAY A;  1NTZ H;  4LFB O;  2F93 B;  4J80 A;  5DGI A;  1PM9 A;  1MZB A;  3ZRW B;  2FKL A;  4DR6 H;  5KFU A;  2F4V H;  2YI9 A;  5B3S B;  3HKD A;  3RGX A;  1S0M A;  2QJ1 A;  4IT5 A;  3GB7 C;  4YY3 O;  2AGQ A;  3QTC A;  1N32 B;  2W9C B;  4LF6 B;  1JDE A;  2YU9 A;  1XNR B;  4PEL A;  3TII A;  2NN4 A;  5LL6 b;  1O75 A;  4LF5 O;  5JQW A;  2UUB B;  1PD3 A;  3B8M A;  3ZHV A;  2W6O A;  2UXD H;  4GKJ H;  4C5A A;  2EIL B;  1A32 A;  1GN6 A;  4YR0 A;  4LWS B;  4ED6 A;  2FLL A;  2OTJ V;  3F7V C;  2EIN C;  1VQK V;  3ETJ A;  2Z5U A;  4FM2 A;  5KFA A;  3WG7 C;  1RFY A;  1HNW B;  1XBL A;  2EZP A;  2C22 A;  4RB0 A;  4ME6 A;  3J80 N;  1XMQ H;  3G71 V;  2UXB B;  2IU3 A;  1URF A;  5KHH A;  3LSQ A;  5KFX A;  4QIW A;  2VQF O;  4DUY O;  1H2G A;  3VQY A;  3RV3 A;  1HDJ A;  2KG7 B;  1HW7 A;  2F43 G;  2DAA A;  1EN6 A;  3IGA C;  3SPC A;  3FYI B;  1MG1 A;  1S9F A;  4NZO A;  4UCT A;  3ZHU A;  5L3D A;  3TK1 A;  5A9G A;  2UUA O;  1S03 G;  4DV6 O;  2Q0O C;  2Q73 A;  4O4L B;  2VQE H;  3C3S A;  1M6V A;  3TY8 A;  3K0G A;  4EKW A;  1LNQ A;  2PMZ A;  5JJN B;  3CCU V;  4A2B A;  4C5B A;  4NYK A;  4X1I B;  3BA8 A;  4XX0 B;  1TWG A;  4WFA V;  4FM9 A;  3LWB A;  2XCA A;  2VUG A;  1ROP A;  1M9N A;  4WFB V;  2W9B A;  4B3M H;  5KA5 A;  3F7Y C;  4ZKI A;  1FJG B;  2DWE C;  1LUW A;  4DR1 O;  4O86 A;  2RDC A;  4DR3 B;  1FD9 A;  1MZF A;  2C35 B;  3C0F B;  4J9Y B;  5L3C A;  1H2N A;  4MA5 A;  4IAJ A;  4QIW F;  2WPD G;  2NVY A;  1BS3 A;  1SQF A;  4J41 A;  1DGS A;  3RYH A;  2AZ0 A;  4GKK H;  2K1E A;  4B3T H;  2CW7 A;  4DV0 B;  5KFK A;  3GV8 B;  1HR0 H;  4R7C A;  3M9M B;  1GMG A;  1AR1 B;  3H1J H;  2VWK A;  2HGW A;  1VMG A;  1DTO A;  4O7T A;  2BOC C;  3EPG A;  5KT4 A;  3I5D A;  4TV9 F;  4ECW A;  4R50 A;  1XL6 A;  4DL5 A;  4TQR A;  4ED1 A;  3CD6 V;  2FK2 A;  4U7N A;  5GTH Z;  4KXR A;  4Q44 A;  2LW7 A;  3CE2 A;  2QEX V;  1N0J A;  5LYJ A;  1Q6U A;  3RR5 A;  3LNN A;  1IOW A;  4G28 B;  1YHQ V;  3UT5 A;  4LF4 H;  1GAX A;  3T9C A;  2BOB C;  1O9H A;  4X1Y B;  2UVV A;  4HNV A;  2XTA A;  1WB8 A;  1G8M A;  5DGH A;  3KHR A;  5F9L A;  4LFA O;  4IWX A;  5C44 G;  5L3E A;  3NBY B;  3SPJ A;  4I9W A;  4BY1 G;  3GTK A;  3B77 A;  1E4E A;  1A9X A;  4U6P A;  2B1I A;  2LFS A;  4MVU A;  5HFL A;  2KQX A;  1NQT A;  1NZ6 A;  3RYF A;  1RM1 B;  4PZ6 A;  2JIZ G;  3OHB A;  2CH7 B;  1YIT V;  4BIZ A;  1T5E A;  4FMT A;  3RVZ A;  2QTS A;  1VBG A;  3GTQ A;  4JI2 B;  1GN3 A;  2YI8 A;  3RYC B;  2WB1 A;  1IDS A;  5KFG A;  2R8H A;  3JAK B;  2FJZ A;  2J6T A;  3TQT A;  1QNM A;  2QE7 G;  2GUZ B;  3GWK C;  4IR1 A;  5IYD G;  4DR5 B;  1FFT B;  5LYJ F;  1RJQ A;  2Q7D A;  3FKS G;  4O84 A;  2R8I A;  4ECT A;  1GN4 A;  1YIJ V;  2ZNI A;  1H38 A;  3VPD A;  3D36 C;  4Z1V A;  3STZ C;  3CXC U;  5JH7 F;  4X64 B;  1UPG A;  3FB8 C;  2Q6A A;  3RGB A;  1KJ9 A;  2E3C A;  4ECV A;  3M4I A;  1NS1 A;  2P6J A;  3L71 H;  4NB5 A;  4RNM A;  2EJ3 A;  3T1H H;  2O03 A;  3U9S A;  2RGV A;  1AR4 A;  4JI8 B;  5AG2 A;  1FVI A;  2WLN A;  4RB3 C;  2ZR3 A;  3K06 A;  2HVJ C;  3HKE A;  3ETQ A;  5B1A C;  3RYI A;  1R3J C;  2QTO A;  4TQF A;  4DL2 A;  1Y67 A;  2IBK A;  2Q68 A;  2FE3 A;  2CZG A;  4JAA A;  5FR9 A;  5KFO A;  3AG3 C;  3K03 A;  4DK1 A;  5A2Q N;  1XMQ O;  4EB6 A;  4FFR A;  2V58 A;  4LSA A;  4KHP H;  5LXT A;  3LDE A;  4UB6 Z;  1GK9 A;  2BTQ B;  2UU9 B;  2ZXW C;  3ABK C;  4UVC A;  3Q8Q B;  4WHX A;  2BR0 A;  1IX9 A;  2XAS A;  1BZK A;  1I7N A;  1WRV A;  2UXC H;  2C28 A;  1J95 A;  3ZMV A;  4O4H F;  2R9A A;  4DIM A;  2Y4R A;  4XYL B;  3U11 A;  5CBF A;  1BGW A;  2C00 A;  1XHX A;  5J2T A;  3QNE A;  2QA4 V;  4QIW E;  4K6N A;  2WDT A;  3K79 A;  5EYP A;  3N2G A;  5L1J A;  3JSN A;  2Q8V A;  4IIJ A;  4DL4 A;  4IR9 A;  2YYA A;  3M99 B;  2ZE7 A;  4B3M O;  3OTF A;  3M9O B;  1W59 A;  1OCZ B;  4U3F H;  5EIB D;  1M7J A;  1M4U A;  1S0O A;  4EG0 A;  2R84 A;  2PMZ E;  5LXT F;  1NR1 A;  3HKC B;  1A3G A;  3GTP A;  4LF9 O;  2WLM A;  1TUB B;  4GKK O;  5KFF A;  2I87 A;  5BPH A;  2PVP A;  1YEW A;  1ZLZ A;  3PW2 A;  4MVS A;  1TWA A;  3OHA A;  3SYO A;  5CBG A;  3T54 A;  3ZCC A;  4M0J A;  4I5S A;  4X9Q A;  2COJ A;  4MV1 A;  4GX5 A;  4LP8 A;  4PHZ A;  3M9N B;  3UQ8 A;  1K73 W;  4DV2 H;  1KB9 F;  2IBZ H;  3K5H A;  4ICG A;  1K83 A;  3JZI A;  2PUS A;  1GSA A;  2D2C B;  4DV1 O;  1K34 A;  2A7W A;  2DZD A;  1IXB A;  1SQG A;  2WAQ A;  1HNX H;  1XI1 A;  2HFE C;  4NXM H;  2P06 A;  4G2K A;  1DIK A;  2EX3 A;  2CUG A;  2V4D A;  3RWR D;  3VQX A;  3BAA A;  3H9V A;  1FXK B;  3JAL B;  1XDN A;  4IHJ A;  4C5C A;  4LF4 O;  2QYZ A;  2CW8 A;  2V7Q G;  1XDC A;  4W4K A;  1VF7 A;  1YTF B;  4DV5 B;  2W0X A;  3CXH F;  1Q6I A;  4YBZ B;  2R70 A;  3L70 H;  1VBH A;  4ETS A;  1JXL A;  1HNZ H;  4BIO A;  1VQ6 V;  2M05 A;  2F23 A;  3STL C;  1JKJ B;  2E5L B;  2YZN A;  3OUS A;  1JR9 A;  4FIP C;  5DMX A;  4J9L A;  4MTG A;  5FNV B;  4FLV A;  1PV0 A;  2ZQM A;  2Y69 B;  1YJW V;  3WWI A;  3PW0 A;  4JI7 H;  1R3K C;  3F5T A;  5EIB C;  3K5O A;  1Y76 A;  2RQ6 A;  4JI4 H;  2R7K A;  4LWS A;  4OPH A;  2AHY A;  5IY5 C;  4JUZ A;  1I0H A;  3J81 W;  4K0K B;  4OXS A;  4PA4 A;  4TUY B;  1V54 B;  3CP1 A;  2DOS A;  1Z2N X;  3PFF A;  1Y74 A;  2XAF A;  1BT8 A;  3VA7 A;  1QBZ A;  4IHJ F;  1I1L A;  1EKV A;  2QR4 A;  4G3I A;  2X0S A;  3KHH A;  3FB6 C;  4JI0 H;  4YQW A;  3BVO A;  1CKO A;  2W9A A;  5FLX N;  3U0G A;  2BQU A;  4FFP A;  2WB1 E;  4H0L B;  3K9A A;  2HHH B;  2ZCE A;  1XNQ B;  1GSO A;  1BGY H;  1PNL A;  2OTL V;  1D5N A;  2W6Q A;  2CE4 A;  3JAT A;  1QVG U;  5BXZ A;  3T1H O;  3UYY A;  3OAA G;  5KG7 A;  3PR5 B;  4FBU A;  4H44 B;  3KCY A;  2ETN A;  4I4T B;  5FPO A;  4LF7 B;  1RPR A;  5IE9 A;  5KFP A;  1S5H C;  3ETD A;  3GIQ A;  1RPO A;  1WAZ A;  1MA1 A;  1XK5 A;  3MWM A;  3TIG A;  4WD3 A;  4JYA H;  2YS7 A;  5CN0 A;  1PK8 A;  2J6S A;  5DIS C;  2Q69 A;  5CA0 B;  5JCO A;  4PA6 A;  4B3S O;  3OMA B;  4DUZ B;  3Q4H A;  5C93 A;  4O7N A;  5KG0 A;  4KHP O;  4A5U B;  3W7S A;  2PI4 A;  4A3F G;  4Z1M G;  2DE0 X;  3OE7 G;  3PVX A;  1QLE C;  2P90 A;  2YXH A;  4X8A A;  5KFM A;  1GO3 F;  3H40 A;  3UZO A;  5D1O A;  2X6C A;  1I7L A;  1VQN V;  4QNH B;  2ARH A;  4DV4 O;  1GSH A;  4Q45 A;  1N36 H;  2WAM A;  3ASO B;  4QJF B;  2JA7 A;  5LMN B;  3R5X A;  4UCO A;  4IYH A;  4CMF A;  3G6X A;  3AG7 A;  4FFB B;  4X66 H;  2CNV A;  1JJO A;  1BNC A;  3M7M X;  2GPW A;  3W5O A;  2JS3 A;  3E83 A;  2A3Q A;  2CTR A;  4ZOL B;  2PF4 E;  5B1N A;  4ECY A;  5KHG A;  2FML A;  2RMK B;  5FJ8 G;  4LFB H;  4A3D G;  1NH2 B;  4C2M A;  4RAY A;  3WB2 A;  4KFM A;  4O2A F;  3Q8P B;  3NUA A;  2LQT A;  4LF8 O;  4DXW A;  4XZ3 B;  2A1H A;  5K3W A;  2WLH A;  2WLK A;  4YY3 H;  2EIM B;  3ZJZ A;  3U10 A;  3GTG A;  5IYB O;  3T9D A;  1IBM H;  2HHF B;  3AW8 A;  1SZT A;  1GH6 A;  3KZI Z;  3SJA C;  4MT8 A;  1O9G A;  4P2Z A;  4DV7 B;  1SCU B;  1VAR A;  3H01 A;  2H8P C;  3NC0 B;  4Y8V B;  3OFN G;  4DV3 O;  1A48 A;  2QWN B;  2W7P A;  4O3N A;  5JH7 B;  3GTJ A;  3PJS K;  4LFC B;  2ZNJ A;  4F4X A;  5C4X G;  1SER A;  4P9P A;  4HAM A;  2HVR A;  4WBN A;  1GKF A;  4NXM O;  3R5F A;  3TY9 A;  5EWE A;  1WCM A;  2JA7 G;  3GLK A;  4A3I G;  5LHG A;  2VQF H;  3S3W A;  4CZZ A;  4DUY H;  3PO3 G;  3QO5 A;  5B5E Z;  2Y4U A;  4FM1 A;  2XCP A;  5BWR A;  4FFK A;  2FYU H;  4RWU A;  1FAF A;  4J9Q A;  2JS5 A;  2ZM6 B;  1B6Q A;  2R72 A;  4JAS A;  4MV8 A;  3E89 A;  5H6R A;  4BW9 A;  3AG1 B;  1WA8 A;  1XMO B;  4I9Q A;  2ZE8 A;  2G38 A;  2ADQ B;  4MV4 A;  2UUA H;  2WAQ E;  4DV6 H;  1EFR G;  1KP3 A;  2R9R B;  4ED8 A;  5D8D A;  3AEI A;  2OCC C;  5HV6 A;  2Y48 A;  4O7V A;  3L75 H;  2GQS A;  1K5S A;  1KEE A;  4LR3 A;  2Y0S A;  5BR8 B;  4I0X A;  2QK4 A;  1OCR B;  4D6T H;  2GPS A;  3SYQ A;  4JI4 O;  4DR6 B;  4MW3 A;  2GQR A;  5C8Y B;  2F4V B;  1YVW A;  2HG5 C;  4YXW G;  2R85 A;  3LP8 A;  4WBN F;  4U3J A;  1VQP V;  4ED2 A;  3W7U A;  2LP7 A;  1ORQ C;  4X62 B;  1F23 A;  3DC6 A;  3BEH A;  1SS3 A;  4MTX A;  2UXD B;  1TWC A;  4GKJ B;  2HLD G;  5BMV A;  5LL6 Y;  2XHB A;  2A0L A;  3QZ7 A;  1WCM G;  3QG5 A;  5JVD B;  3SYC A;  2ALZ A;  4JI0 O;  3MJF A;  4EBD A;  5EWF A;  4O7Z A;  2ASD A;  2JGD A;  1F4N A;  1W0K G;  3WO0 A;  4MVM A;  3JAM N;  5DN6 G;  2YCH A;  1MSW D;  4O2B B;  4YAJ B;  2W57 A;  4FVM A;  1NT2 B;  3K04 A;  5IWA H;  4IZO A;  5IJ9 B;  4DL6 A;  1KJJ A;  3IG0 A;  1MSD A;  5JCO C;  1W96 A;  1E1R G;  3N41 B;  3VPB A;  3UO3 A;  1Z2G A;  4UVB A;  1S3J A;  5E1A C;  1BE3 H;  3MR6 A;  5B1O A;  3CRC A;  1B33 N;  3OMI B;  4K8X A;  5BYB A;  5BWX A;  2IH3 C;  3JD2 A;  2YUA A;  1QLN A;  5CA1 A;  4O4J B;  1UFI A;  1K92 A;  1V55 B;  5KT2 A;  2JJ1 G;  3BQ0 A;  3LML A;  2IA6 A;  3B2E E;  4JF3 A;  2VQE B;  1S77 D;  4UVA A;  1IBL B;  3FYE B;  1WPB A;  3KAL A;  2FLN A;  1Y1W A;  1G2W A;  1NKD A;  5DQH A;  2Y4T A;  1W93 A;  3L9D A;  3S24 A;  4U7C A;  4FS1 A;  3K3W A;  4O3S A;  1FPO A;  1RSO B;  4O4I B;  5EBM C;  5JQG B;  5BMV F;  4FFO A;  3KAJ A;  1L8D A;  3F5W C;  3H1I H;  4DW0 A;  1GN2 A;  4C7U A;  1JX4 A;  4EEQ A;  1Y14 B;  2Q7E A;  4JV5 O;  2HJD A;  4BY7 G;  1HWY A;  1PNK A;  3T7A A;  3JRW A;  3APO A;  4ZBM A;  2CAZ C;  4LSX A;  5D5P A;  1CS0 A;  3QO8 A;  1BXR A;  4Z2W A;  5ITZ A;  3LSS A;  2COI A;  3GJX B;  4NLG A;  4JI6 B;  3SDL A;  4B3T B;  2X6A A;  2YEV A;  3CRQ A;  2ATL A;  4B3R B;  4F6R A;  5KMG B;  1HR0 B;  4D7T A;  4RZR A;  3K08 A;  3CJH A;  5KG1 A;  5LMU H;  5CA1 F;  5IYZ B;  1K1Q A;  1ZTE A;  4P30 A;  1AUV A;  5CE8 A;  3JD0 A;  3IFX A;  1Q90 D;  2YDE A;  2M7W A;  1FXV A;  1OV9 A;  2CGO A;  1FFX A;  2ZDQ A;  3E5N A;  3T1Y H;  2EIK C;  2QB5 A;  4EQ5 A;  3GII A;  1M56 C;  1Y1W G;  4JI5 B;  5LA6 A;  2YWV A;  2NU6 B;  5F2V O;  4J10 A;  1IBM O;  2ZT9 B;  4J7J A;  4QWC A;  1ZWI C;  1BHB A;  2QWR B;  2FP4 B;  5JJJ B;  3CWB H;  3ZHR A;  4BXX G;  4JYB A;  4JTC B;  4P9O A;  1AJP A;  2RN9 A;  4OX9 B;  2ODT X;  1WSC A;  4XDL A;  2BTO A;  4AQY B;  3SYA A;  3JAW A;  3R5H A;  2PY5 A;  3WWJ A;  4KL1 A;  1BSM A;  2BSK B;  2HVS A;  4HNA A;  5FL7 G;  1US6 A;  5DGB A;  2EJ0 A;  1P8L A;  3ABL C;  4A2A A;  1OCC C;  5D1P A;  1M5I A;  4X20 B;  4DR2 H;  1WN7 A;  2P5O A;  5I5U A;  1EM1 A;  2FB5 A;  1SZX A;  3NGD A;  3CRA A;  2DYS C;  2P67 A;  4ED0 A;  3CC4 V;  4DR4 H;  3N43 B;  1R73 A;  1TWF A;  1TGO A;  1BMF G;  3DXR B;  2XGP A;  4J11 A;  5LA6 F;  4YJ2 B;  1KU9 A;  3CCR V;  4NTY A;  1NBM G;  3SJC C;  1CKN A;  4MTF A;  4RAZ A;  4MVR A;  3VOU A;  5KS8 A;  3JAS B;  4RAI A;  2FPG B;  2RGR A;  3ASN B;  1N4C A;  1GLV A;  2WWW A;  3QWU A;  2AU0 A;  5I5W A;  1I50 A;  4JI1 H;  2QGN A;  2DWC A;  3RF2 A;  1DLB A;  4J9R A;  1BCC H;  4X65 O;  1SQQ H;  1J5E O;  2DAB A;  2FL4 A;  3BCC H;  4WF9 V;  1KKD A;  3RW0 A;  3JD3 A;  1OCO C;  3ORR A;  2ILM A;  1TVK B;  3A0B Z;  5LGT A;  5I5T A;  4B08 A;  4Q8F A;  4LF9 H;  4JV2 A;  2AXT Z;  3K3V A;  1I5X A;  2Y0S E;  3X2Q B;  2ZGI A;  4FLX A;  3RFC A;  4TSF G;  2UUC O;  4I50 B;  2EIY A;  3N6R A;  2HJF C;  3CCJ V;  3OD4 A;  4YP3 A;  4FLU A;  2EJ7 A;  3FKI A;  4JI3 H;  5K1X A;  4DRF A;  4O2A B;  3TW6 A;  4M7E A;  1N33 B;  4RQF A;  1GRJ A;  3GID A;  3PO2 G;  3KHL A;  5IWA O;  5IYD O;  4QJF A;  2V4Q A;  4DV1 H;  3V4S A;  3APQ A;  3E8H A;  1IBK O;  1WPX A;  5LGN A;  5KFE A;  1R1B A;  3C90 A;  3CEI A;  1R6T A;  3G6B A;  4YB8 B;  2C2A A;  2UXC B;  2YIC A;  3KG2 A;  2BE3 A;  1H2K A;  3H4D A;  5KFT A;  1I1K A;  4ASU G;  4CHI A;  2BCC H;  4JXU A;  4MVO A;  3MWD A;  1N0N A;  4ECS A;  2NVX A;  1Z5V A;  1Y6X A;  4DO2 A;  5KHJ A;  5CMU A;  3JAR A;  4LH6 A;  1T3N A;  1QVF U;  2R7M A;  3JRX A;  4E4E A;  4UCS A;  5BWV A;  5I5S A;  1B3Q A;  2W0F C;  2GV9 A;  1RJR A;  3BA9 A;  2R87 A;  3FMA A;  1N32 H;  3KRE A;  4A3G G;  3N6X A;  5CB4 B;  4ECQ A;  1XNR H;  2F95 B;  1KBL A;  4R6Z A;  4R8U B;  3OTO B;  2A06 H;  2YXY A;  2ATK C;  2W6Z A;  4MA0 A;  4GX1 A;  3FKI G;  3RJ0 A;  1S5J A;  1EN4 A;  3KCX A;  4ZI7 A;  2FK1 A;  4BW5 A;  2R7L A;  1KBH A;  3RB6 A;  5C3E G;  3GDE A;  5LMU O;  1L1F A;  4LNU B;  5DED A;  3I56 V;  1WJZ A;  4YHH O;  1AP6 A;  4DV2 B;  1KKC A;  4JYA B;  2VUM A;  1HNX B;  2W6M A;  5J2U B;  3T1Y O;  3RV4 A;  3MFI A;  3CSX A;  5KFQ A;  3PZP A;  4UUJ C;  2HIX A;  2JA6 A;  1OHH G;  2QM7 A; 
#chains in the Genus database with same CATH homology
 3T1Y B;  4TUY B;  4AHC A;  4TOI A;  1ZHS A;  3E22 A;  4LF7 H;  1Z2N X;  3KXY T;  3DSQ A;  3E22 B;  2ZIM A;  4YJ3 A;  1HNZ B;  4JI0 H;  1QHT A;  1Q43 A;  5C8Y A;  1CKO A;  4DR7 B;  2F66 C;  4DUZ H;  1WH2 A;  5D5Q A;  3HKB A;  4B3S H;  4YJ3 B;  2HHH B;  4AIL C;  1BJT A;  1FJG H;  2ZCE A;  1XNQ B;  4PDB A;  4JI7 B;  4R7R A;  4UCU A;  5IJ0 A;  4BWA A;  3HKB B;  3ICX A;  2OYQ A;  4DR1 H;  4I4T A;  1N34 B;  3J7A K;  4EFE A;  3JAT A;  4EB6 B;  5A2Q W;  4L8J A;  1M93 A;  2PYJ A;  5IJ0 B;  1Q5O A;  4X1K A;  2VWJ A;  4I4T B;  4DV0 H;  2ZIN A;  5FPO A;  4LF7 B;  4TV9 A;  3N42 B;  3JAT B;  3T1H B;  5LMN H;  4TV8 A;  4DV4 H;  5CA0 A;  1IBL H;  1JFF A;  4DR4 B;  4X1K B;  1XK5 A;  3MWM A;  3N40 P;  4ZHQ A;  1FKA H;  5DIS C;  4RB2 C;  4TV8 B;  5CA0 B;  5KX5 A;  4APM A;  1JFF B;  5JCO A;  4DUZ B;  1P16 A;  4ZHQ B;  4B3S B;  3K57 A;  5KX5 B;  4UCR A;  4BWS C;  4KHP B;  1QQC A;  5LP6 A;  3K59 A;  4IIJ B;  3ZS8 C;  3SR2 C;  4NXN B;  4PI0 A;  5D1O A;  2OWO A;  4I55 A;  4LF8 H;  4CH6 A;  1N36 H;  4JI6 H;  4FFB A;  3PN1 A;  5LP6 B;  3RGZ A;  3SGI A;  4B3R H;  5LMN B;  1N33 H;  3VQW A;  4DV4 B;  5D1O B;  4UCV A;  5JQG A;  3K5N A;  1CKM A;  3CVZ A;  4I55 B;  4UCO A;  3NBZ B;  4LFA H;  4ZOL A;  4FFB B;  4X66 H;  1JJO A;  4LMY A;  3M7M X;  3W5O A;  4LFC H;  1G6U A;  3N44 B;  5KHK A;  4DV3 H;  3RFR A;  4ZOL B;  2PTM A;  5KHG A;  5EZY A;  4JI3 B;  4LFB H;  4CC6 A;  4GLX A;  4RAY A;  3WB2 A;  4JI5 H;  5LOV A;  5EZY B;  4RZQ A;  3BPZ A;  4LF6 H;  2MCT A;  4FLT A;  5GON A;  4YY3 H;  1SEI A;  2Q2U A;  2ZM6 H;  3U10 A;  4LF8 B;  2UUB H;  1N36 B;  5LOV B;  1IBM H;  4OX9 H;  2KSW A;  3EYY A;  1XMO H;  5JH7 A;  4AQY H;  3SJA C;  1O9G A;  5GON B;  3SJB C;  4DV7 B;  3WB1 A;  1Q8I A;  4MTE A;  3NC0 B;  4MV9 A;  4X66 B;  4EFB A;  3H20 A;  1HNW H;  5JH7 B;  4Q6G A;  4LFC B;  2ZNJ A;  3IAY A;  2UXB H;  4X64 H;  4DV3 B;  2HVR A;  2F93 B;  4WBN A;  1MZB A;  4LFB B;  4DR6 H;  3TY9 A;  2F4V H;  2VQF H;  4DUY H;  2YI9 A;  3HKD A;  5JJE B;  3RGX A;  5FPR A;  2QJ1 A;  3CB2 A;  3MAQ A;  4WBN B;  4NXM B;  3QTC A;  4FM1 A;  1N32 B;  4DRX B;  4LF6 B;  2VPS A;  1XNR B;  4YY3 B;  3HKD B;  5LL6 b;  1O75 A;  2JS5 A;  2ZM6 B;  3RTX A;  1SA0 B;  2UUB B;  2UXD H;  2R72 A;  1IBM B;  4GKJ H;  4Q0Y A;  4BW9 A;  3L2P A;  1XMO B;  4I9Q A;  4LF5 B;  3VNN A;  3RIZ A;  2UUA H;  1SYX B;  4DV6 H;  2HEP A;  4FM2 A;  1HNW B;  4RB0 A;  1XMQ H;  3KYH C;  2UXB B;  5KHH A;  3WB0 A;  4LR3 A;  5BR8 B;  2UU9 H;  4O4H A;  2WE6 A;  2PGG A;  3VQY A;  3U0Z A;  4DR6 B;  4DR3 H;  5C8Y B;  2F4V B;  2VQF B;  4DUY B;  2RJZ A;  1HW7 A;  4JI4 B;  5FLX W;  4O4L A;  4U3J A;  3BHP A;  1WNS A;  4X62 B;  4CC5 A;  5JVD A;  4UCT A;  1ZAU A;  3JAS A;  1XQ8 A;  2UXD B;  1S03 G;  4GKJ B;  4CS3 A;  4X1I A;  5BMV A;  4O4L B;  4U3J B;  2VQE H;  2XHB A;  5FD5 A;  3QG5 A;  5JVD B;  3TY8 A;  2UUA B;  4DV6 B;  4O2B A;  5JJN B;  4A2B A;  1D5A A;  3W1G A;  4X1I B;  4TV9 B;  3BA8 A;  5BMV B;  3K5M A;  2HVQ A;  4FM9 A;  3JSL A;  5IJ9 A;  4JI0 B;  2VUG A;  2YCH A;  4O2B B;  4I7H A;  2W57 A;  4FVM A;  4NVP A;  3K5L A;  1M0T A;  1NT2 B;  4B3M H;  5IWA H;  1FJG B;  5IJ9 B;  4DR3 B;  3IG0 A;  5JCO C;  4JV5 H;  3JAM W;  3N41 B;  3C0F B;  4O4J A;  4IAJ A;  4DR1 B;  4K8X A;  1SQF A;  1DGS A;  3RYH A;  5CA1 A;  1TA8 A;  4FM0 A;  2YIB A;  4GKK H;  4O4J B;  4B3T H;  2CW7 A;  4DV0 B;  3LML A;  5LP6 C;  3B2E E;  3BRC A;  2VQE B;  4O4I A;  1RSO A;  3W1B A;  1HR0 H;  1IBL B;  1WPB A;  3KAL A;  3RYH B;  5CA1 B;  3S24 A;  2VWK A;  4J0M A;  2P22 C;  4O4I B;  4HBN A;  5JQG B;  3L4J A;  3KAJ A;  1L8D A;  4FLZ A;  4RB1 A;  1KMI Z;  4EEQ A;  2Q7E A;  4JI2 H;  2YIA A;  4X1Y A;  3OTO H;  1X4T A;  2WYO A;  5LYJ A;  3RR5 A;  3LNN A;  2CAZ C;  4JV5 B;  4LSX A;  3UT5 A;  3GB8 B;  4LF4 H;  5D5P A;  1AN7 A;  4PZ8 A;  5ITZ A;  4X1Y B;  1O9H A;  4DK0 A;  5KMG A;  3HXL A;  3GJX B;  5LYJ B;  2JGU A;  4DR5 H;  1E4G T;  3F8N A;  2CFM A;  4JI6 B;  3UT5 B;  5KHI A;  4FLW A;  4B3T B;  5ITZ B;  5IYZ A;  4B3R B;  1TAE A;  4F6R A;  5KMG B;  1HR0 B;  4D7T A;  3NBY B;  4LFA B;  4K8Z A;  2JVD A;  2YXL A;  5LMU H;  5IYZ B;  3RYC A;  3RYF A;  4PZ6 A;  2Q7H A;  4F6R B;  1T5E A;  3JAK A;  3THO A;  3N2K A;  4JI2 B;  2YI8 A;  1FFX A;  3RYC B;  3RYF B;  3T1Y H;  4K0K H;  1E4F T;  3CHX A;  2Q0A A;  4UFZ A;  1X9N A;  4MV7 A;  4EQ5 A;  3JAK B;  4JI5 B;  3BAB A;  5LA6 A;  4JI8 H;  1FFX B;  1L2Z A;  4LNU A;  4DR5 B;  4GYC B;  1I94 H;  4D7S A;  5JJJ B;  5LA6 B;  4CH5 A;  4CS2 A;  4OX9 B;  2BTO A;  4CH4 A;  4AQY B;  2ZNI A;  1SKV A;  3JAW A;  2PY5 A;  2HHH H;  4KL1 A;  1GYF A;  4X20 A;  2HVS A;  4HNA A;  2PYL A;  1P8L A;  3JAW B;  4X64 B;  4A2A A;  5D1P A;  4ZIB A;  2YIB D;  1M5I A;  4X20 B;  3RGB A;  1WN7 A;  4DR2 H;  2E3C A;  2ZIO A;  4HNA B;  2P5O A;  4PZ7 A;  3M4I A;  3DF7 A;  2ZJT A;  4X65 H;  3J80 W;  1J5E H;  2HGS A;  3T1H H;  4O4H B;  2O03 A;  2RGV A;  1B04 A;  4LH7 A;  3K58 A;  3A2F A;  4JI8 B;  1FVI A;  5FD6 A;  4RB3 C;  1JMK C;  4YJ2 A;  3N43 B;  4DR4 H;  4FLY A;  3HKE A;  3ETQ A;  1I94 B;  1TGO A;  3RYI A;  1Z2P X;  5EOY A;  4TQF A;  2QM4 A;  2FE3 A;  4YJ2 B;  1KU9 A;  1VS0 A;  3HKE B;  1CKN A;  3SJC C;  4MTD A;  4DK1 A;  3RYI B;  2BTQ A;  4RAZ A;  3L4K A;  3JAS B;  4EB6 A;  2RGR A;  5K1P A;  2UUC H;  4LSA A;  4KHP H;  3QWU A;  1Q3E A;  5LXT A;  1XMQ B;  4JI1 H;  1CKN B;  2BTQ B;  1TVK A;  3RF2 A;  2UU9 B;  2Q7G A;  4DR2 B;  4NXN H;  5LXT B;  4X65 B;  1IBK H;  1J5E B;  1Z5W A;  1TVK B;  2UXC H;  4B08 A;  2R9A A;  3U11 A;  2PZS A;  4I50 A;  1BGW A;  4LF9 H;  3K3V A;  1XHX A;  5J2T A;  4O2A A;  1Z2O X;  4FLX A;  1V9P A;  2WDT A;  5EYP A;  1ZHQ A;  4I50 B;  3FFQ A;  1S68 A;  3N2G A;  5J2T B;  3JSN A;  4FLU A;  4IIJ A;  4JI3 H;  1I6U A;  5K1X A;  4DRF A;  4O2A B;  2UUC B;  2Q2T A;  4M7E A;  1N33 B;  1M0W A;  5EYP B;  4JI1 B;  3N2G B;  3OTF A;  3QF7 A;  3HKC A;  4DV1 H;  4PI2 A;  1TUB A;  4B3M B;  5EIB D;  5IWA B;  2IM9 A;  1M4U A;  1IBK B;  4CH3 A;  3HKC B;  2UXC B;  4DV5 H;  1TUB B;  1XHZ A;  4DV7 H;  1YEW A;  2HIV A;  4LF9 B;  1A0I A;  4GKK B;  3KAK A;  3TY5 A;  1Z5V A;  2E5L H;  1P49 A;  3VQV A;  5KHJ A;  3JAR A;  4LH6 A;  4PHZ A;  3UQ8 A;  4DV2 H;  4UCS A;  5CB4 A;  3JAL A;  2VOB A;  2PUS A;  4YHH H;  2GV9 A;  4JYA H;  1SQG A;  1HNX H;  3BA9 A;  3JAR B;  1XI1 A;  4NXM H;  5IT9 W;  3FMA A;  1N32 H;  2XIG A;  2EX3 A;  2V4D A;  3RWR D;  3VQX A;  4DV1 B;  3N6X A;  5CB4 B;  3BAA A;  1XNR H;  1I7F A;  2F95 B;  3JAL B;  4IHJ A;  1XDN A;  3OTO B;  2CW8 A;  4LF4 B;  1VF7 A;  4LF5 H;  4DV5 B;  3N2K B;  4IHJ B;  3RJ0 A;  1S5J A;  4E6N A;  2R70 A;  4ZI7 A;  4ETS A;  5FNV A;  1HNZ H;  4DR7 H;  2E5L B;  3GDE A;  3ZED A;  5BR8 H;  4LNU B;  2F1M A;  5J2U A;  4ZI7 B;  4DRX A;  5FNV B;  4FLV A;  4DV2 B;  1H2S B;  1XNQ H;  5LMU B;  4JI7 H;  5EIB C;  3K5O A;  4YHH B;  4JYA B;  2KKW A;  4TUY A;  1SA0 A;  1HNX B;  2RQ6 A;  4JI4 H;  5J2U B;  1N34 H;  4CS4 A;  4TQD A;  3CSX A;  2HIX A;  4X62 H;  3J81 W;  4K0K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...