3BAAA

Structural basis for the inhibition of bacterial nad+ dependent dna ligase
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
312
structure length
312
Chain Sequence
LTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
publication title Structural Basis for the Inhibition of Bacterial NAD+ Dependent DNA Ligase
rcsb
source organism Enterococcus faecalis
molecule tags Ligase
total genus 103
structure length 312
sequence length 312
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3baaA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3baaA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3baaA02
4LF8B 4JI4B 4X62B 4TOIA 4EFBA 4GKKB 3NBYB 3QWUA 3JSNA 4X64B 1CKNA 4DR6B 4GLXA 1ZAUA 4LF6B 1CKMA 4KHPB 5D1PA 4LFCB 1XDNA 1TAEA 4EEQA 4UCSA 4DR4B 4UCUA 2HVRA 3VNNA 4DR3B 4UCRA 1N34B 4GKJB 1P8LA 2UUCB 5D1OA 5D1OB 4EQ5A 3TY5A 2Q2UA 1B04A 1IBKB 3BA8A 2Q2TA 1DGSA 4JI5B 3GDEA 4JI0B 3UQ8A 4LF7B 4DV4B 1S68A 5FPOA 4JI3B 4DRFA 4B3RB 4UCTA 1XMOB 3PN1A 1XMQB 3T1HB 4DUYB 4LH7A 1N36B 4JYAB 3NC0B 4LH6A 4UCVA 1TA8A 4X65B 1VS0A 1HR0B 2VUGA 4DV0B 4DV5B 4E6NA 1XNRB 4LFBB 2VQEB 3T1YB 2OWOA 4B3TB 2VQFB 4LFAB 3BA9A 1HNWB 1IBMB 4NXNB 5IWAB 4YY3B 4UFZA 1X9NA 2UUBB 4LF5B 2UXDB 2CFMA 3L2PA 4DV2B 1N33B 4JI1B 1XK5A 4LF9B 1P16A 4PZ6A 4DR7B 5BR8B 2UUAB 3W1GA 4JI7B 4JI8B 1HNZB 4K0KB 1IBLB 3OTOB 4CC5A 4YHHB 4AQYB 1FVIA 5FPRA 3TY8A 4DR1B 1FJGB 4NXMB 1HNXB 4B3SB 4X66B 2HVSA 3S24A 1I94B 4OX9B 4JI6B 3KYHC 2HVQA 1CKOA 4DV1B 4DV6B 2F4VB 3GB8B 4DV7B 3JSLA 4JI2B 3W5OA 2ZM6B 4DR5B 2HHHB 4B3MB 4DUZB 1CKNB 2HIVA 3NBZB 2UU9B 5DISC 3W1BA 2HIXA 3BAAA 3TY9A 2UXCB 2UXBB 3RR5A 4PZ8A 4JV5B 4PZ7A 3SGIA 2E5LB 5LMNB 3RTXA 1V9PA 4DV3B 4DR2B 3GJXB 4CC6A 4LF4B 4EFEA 1XNQB 1A0IA 1J5EB 1N32B 5LMUB 3BABA 4UCOA
chains in the Genus database with same CATH superfamily
3CCRV 4CZZA 5LYJF 4J42A 3RB0A 4EB6B 2WLIB 3RBEA 4O4LB 2BQRA 3GTKA 1D5NA 2W0XA 2AXTZ 3ZIAG 4FM2A 3CC4V 4LF6B 1HNXO 4EBEA 2YZNA 5LOVA 2WLLB 3DF7A 3DXRB 5IYDG 1H2KA 4LF5O 2HVRA 3B2EE 5DECA 5A9GA 5H6RA 5BPFA 1SKVA 1BNCA 1N34B 4J9KA 4PELA 3VA7A 5LP6B 2J9GA 1WSCA 1S0NA 4JTAB 3K9SA 3BA8A 3FX7A 3CCJV 4P9OA 2YS8A 3I12A 3PVXA 3RBDA 4JI3H 1XMQH 1S10A 5KFNA 4NLGA 4FU0A 3GTMA 2JA8G 3WB1A 3CJHB 2NVXA 3EPIA 1QR8A 2IU3A 1T94A 2PBZA 4HYKA 4DV6O 2R86A 2X6AA 1P7BA 4EGQA 4JI2O 1E1QG 2V58A 1HNXH 2GTSA 2E75B 3JARB 5H2FZ 4I9QA 1V54B 3R23A 1KD1W 1O9GA 2DWEC 4J10A 5LP6C 5L3EA 5IYDO 2GTAA 4LF5H 4HYOA 2IM9A 3BQ1A 4YXWG 4FFOA 5BYAA 5D5QA 4ED8A 1FS0G 4LF9B 4ECXA 1PP9H 4LR3A 4P9PA 4DK1A 5FLMG 1QLEB 5HFLA 1JPXA 4MTDA 1FXKA 2Y0SA 2NU8B 1K97A 4RB3C 4UVAA 4X62O 4QWBA 3IC7A 1IXBA 1FFXB 2EJ2A 4Q44A 4P2ZA 3E8HA 4MS2A 4DV6H 3S24A 4TUYB 1TWHA 1CKOA 2FK2A 1OCRB 4DV7B 4Z2WA 4JV2A 3C3TA 1KU9A 3CXCU 3D36A 4ZHQF 4I0XA 1WB7A 2WA4A 4TV9F 2CW7A 2DWCA 4ZHQA 5CA1B 4MV7A 4TV9A 4PA4A 3L70H 4AYBA 2H8PC 4QE7A 2FPGB 4Q0YA 4A3JG 2JS5A 2HJWA 1AVMA 4NTYA 1BGWA 2RMKB 1PL4A 4DUYO 1Q86W 1GO3E 2OH2A 1NH2B 3J80W 1URFA 4DRXB 1SZXA 2GPWA 1TUEB 4EFBA 2HGWA 3QWUA 2XAQA 2B1GA 1WA8A 3O9OA 1VQLV 1TWCA 4J9OA 1XDNA 4EEQA 4NXNO 2QF7A 4NTXA 2QKAA 2R87A 2JGUA 2ZCEA 4HQ6A 2XD4A 2HDKA 5FD5A 2PTMA 2KQXA 4NB5A 4FVMA 1W96A 2UXXA 1I2KA 1MZEA 2Q0AA 4F6RB 1NU1H 1VQKV 1OCOB 2FMAA 4L1KA 3E8GA 3H01A 4YJ2F 1XL6A 2WB1A 4DL5A 5E79Z 4X88A 4ED1A 2V4DA 3OSPA 3IAYA 2DPIA 3PW7A 5BWUA 2F66C 4JI6O 2AU0A 2MW2B 3AW8A 3UZOA 4B3MO 2E74B 3BRCA 2C00A 2JA7G 3N2GB 4JZGA 2XHBA 4NXNH 2YXHA 2HEPA 1M6VA 3D8CA 3U10A 1I2LA 3VPDA 2CGNA 3LULA 1FFTB 1OCOC 3RYCA 2LGQA 4O2BF 3M7MX 1A0GA 2QKCA 4HNVA 4O2BA 2Z0AA 5BR8B 3OUUA 4GYCB 3P3NA 2B1IA 1YTFB 1N32O 2MCTA 4HN2A 1IZ3A 1SQBH 1MSDA 3CCQV 3MR2A 4JI6H 4DR6O 5KT2A 1AILA 3ZJZA 3HOXG 4B3MH 1NBMG 2DW4A 5BMVF 4JYYA 4CH4A 3JASB 3ZRVA 5BMVA 1A3GA 4O2AF 3AG2B 4W4LA 3MR6A 3TY9A 1RJQA 4JPRA 2PN1A 2HP8A 3HOVG 4IAJA 3JATA 3RT3C 2ZDHA 4PZ7A 1XHXA 3HR0A 1Q5OA 4BR6A 2RJZA 4I55B 2JGDB 4CC6A 3LMLA 2WPDG 1RM1C 3N40P 3K3VA 1N32H 4LNUA 2ASLA 3RB6A 1N36O 2W8LA 2CH7A 2R7ZG 1K4CC 3GV7B 3T99A 1Z5VA 4DR6H 1NT2B 4JAVA 3N27A 5IY5C 2VS0A 3HO8A 1OCCB 3GTLA 2N05A 4O4IA 4C5BA 4KHPB 2ZNJA 5GONF 4MTOA 4AILC 2R72A 1QNMA 3ZMZA 1TAEA 5GONA 5J2UA 4DR4B 4YY3O 1GN6A 4ICGA 5BWRA 1K8AW 1CQJB 4MA5A 1Z2GA 1VQ9V 5DGBA 1J95A 3X2QB 3ORRA 1UC8A 1KECA 4I50F 4J9YB 1H2MA 1NVPB 1B6QA 3UFXB 1NR1A 3ZS8C 4E4EA 4FFPA 2D2CB 1E4FT 3QVNA 1DGSA 1HNZO 2DAAA 3S3XA 3LSSA 3E5NA 3KG2A 1N36H 5EZYF 1OCCC 4H0LB 1WP7A 1ZWIC 5EZYA 4JYAB 2ADPA 5CBFA 2BTQA 2PI5A 2FK1A 2ZKOA 4G28B 1NKDA 1GN4A 4ZOLF 3SDLA 3RYHB 3A8TA 5C8YB 4WFAV 1Q6UA 3MWMA 1YDXA 3ABMC 2EZPA 1MSWD 2C22A 4UFZA 4F4YA 2EZOA 2UUBB 3CP1A 2ZGIA 2H3OA 1KYOF 3ASNC 4LWSB 1N33B 5FNVF 5KFFA 5HFMA 1VF5B 4Q20A 5B1BB 1BHAA 3B09A 5LXTF 1RFYA 3CQZA 4O7WA 1HNZH 5JH7F 4U7OA 3OAAG 4FFBA 4CH6A 4O4JF 3OEEG 4JI7B 5JH7A 3FAVA 1YI2V 1P84F 2E2HA 2SCUB 1FVIA 3THOA 4H13B 1GSHA 3HKZE 3RV3A 2RDCA 1YJNV 1RK5A 4N23A 1JDEA 1AJQA 3HKDB 4WFHA 3T2MA 2CQYA 4DW1A 3TQTA 4LMYA 3M9OB 2B5UA 2EIKB 3LUTB 2ASDA 3ABUA 3F7YC 5LBQA 2GUZB 2X7RB 2YDEA 3ZMVA 4G3IA 3KHGA 3ZHUA 4ECUA 3SR2C 1PNMA 1K33A 2V4RA 3WWHA 5LMNB 2VUMA 1FXVA 4UB6Z 4DV4O 2V4QA 4K8XA 1W0JG 3MJFA 4NYEA 3T9FA 5FLXW 2FLNA 1V55C 2CFMA 3L9DA 2P6JA 4X65O 4TOIA 1KEEA 4GKKB 2FPIB 3NBYB 1DF4A 5DAAA 5JVLA 2HJFC 1CKNA 1Q8IA 3ETJA 4Q8FA 5EBLC 5L3BA 2KSDA 1KT8A 4MW3A 4TV8B 2YZGA 2DOSA 4DAAA 2JA7A 2QM8A 3CRMA 4DL6A 1RSOA 3OFNG 3KZIZ 3U11A 1HWYA 2R7MA 4NZNA 3F8NA 3M9NB 4XZ3B 5DG8A 1JA8A 1B3QA 3BEHA 4X89A 3V4SA 2ZQMA 4IR1A 4J0MA 3QO5A 5EBMC 1RJPA 4DV4H 5J2TA 4ZI7F 2X0SA 3H1HH 3T5JA 2H94A 2DN9A 1EZ1A 1Y74B 4ZI7A 4AQYO 1BQ0A 4ED2A 1E4EA 1GK9A 3T1HB 1P7GA 4FMTA 3SJCC 3BACA 3N42B 3IN5A 1VP7A 1VQMV 4X65H 2QGNA 1NTMH 2WSSG 2ODMA 1EZJA 1PD3A 2NN4A 4LSXA 1H2NA 4DV0B 2W6ZA 2JJ1G 2VQEB 1IYEA 1AJNA 2ZDIA 4O3RA 4H37A 3E22A 5CM0A 5FL7G 1HNWB 1ZETA 2CE4A 5B1NA 4R8UB 3T9EA 3OEHG 1ROPA 2MK3A 1DTOA 2BOBC 3CS5A 3HB3B 2BCCH 1K1QA 2W9BB 4CBCA 3ZHRA 1CXZB 1GN3A 5KX5A 5IJ0B 4K0KB 1TWAA 5T14A 1K34A 1WAZA 1JFFA 5F9LA 5DLGA 4J9ZB 1Y14B 1PNKA 3TY8A 2R7ZA 1JX9A 3ORQA 2Y69C 1N48A 5LGNA 4A3CG 2JK5C 5KFBA 5GW7A 3AX6A 4J9MA 2AZ2A 2JEFA 4UUGA 2WAQA 5BWWA 2HVJC 3LDCA 1SEIA 3L4KA 4IIJF 3T5KA 5KFYA 1VF6C 3G4SV 4IIJA 5LYJB 3QTCA 2XUMA 1IOVA 4MV1A 1JIHA 1YJWV 5KG4A 1IXMA 4NZOA 5LHHA 1BE3H 4I5SA 3G67A 1TWGA 4DR2B 4DV3B 1Y76A 5L3GA 3GTOA 2R92G 3H1JH 1AROP 1OZ0A 3JSNA 2QTOA 4GLXA 2FKXA 4QPJA 2VPSA 1I1MA 5KFIA 4O4HF 2HHFB 3ML0A 5L1LA 4DV0H 3JD0A 5KG2A 2JJ2G 2PYJA 5F9NA 2CDYA 1M0WA 3SYOA 4PD4F 2UXDO 1NR7A 5E25A 2V9WA 2YIBA 3JAWA 5DQIA 2CK3G 1NJIW 4A93G 4TM5A 4X1KB 3QZ8A 3ABTA 3N2KB 3ETHA 5LA6F 3VMMA 2P4VA 1UNNC 2JS3A 5LA6A 4PBCA 1JX4A 5IJ9A 3A0BZ 2F1MA 5FD6A 3B8NA 3B4SA 3LNMB 2WDTA 5IP7G 1ET0A 3TCUA 5IYZA 4OX9O 3ZN0A 4GX0A 2R85A 2AHZA 4WBNF 1GM7A 1XNRB 3C90A 2W6OA 1RPOA 4FZ1A 5CBHA 2R9AA 4OPHA 1R73A 3R66A 2UU9O 3T5LA 3BVOA 2M7WA 1XEQA 4GLWA 2UXDH 4YJ3F 2UXCO 5JJEB 3W7UA 2COIA 3K5OA 3HKCA 4FIPC 1KKCA 4XYMB 1NS1A 1U97A 4GCZA 1AR5A 1QR9A 4ZHQB 1SA0A 3QNEA 1TUBA 4TV9B 1Y1WG 2UUAB 4LF4O 4E2LA 5JWPA 3SYCA 1J5EO 5LMUO 2CKZB 4R7RA 1FXKC 4QIWF 3G6BA 4DL4A 3HKBA 2IP4A 3AG3B 4QIWA 1VQPV 4X64O 4ETSA 4OX9H 3L4JA 1BZKA 2HVSA 4X20A 5KT5A 3HKEB 2DQ3A 1GTOA 2YS7A 1E4GT 2Y4TA 4DUZB 2FP4B 2UU9H 3D36C 1WA8B 3JAKB 3NBZB 4K8ZA 1I5YA 2UXCH 4JV0A 3RUPA 1GM8A 2UUCO 3E86A 3CYOA 3RN4A 3JRWA 2CZGA 1IBKO 1F4NA 1TGOA 1IX9A 3JD1A 4Q4DA 1YHQV 2KG7A 1F51A 1MZFA 3BJYA 3AG3C 4LF4H 1Q6IA 5CA3A 1GN2A 2CUGA 4B3RO 1J5EH 4ME6A 3VOTA 1YSCA 4H33A 3CE2A 4QJFA 1BMFG 4IL6Z 4O7VA 4JI4B 4X64H 5EC1C 2NNUA 3KALA 5I5UA 4DV5O 1JJOA 3H0GA 4YJ2B 4G2KA 4B3TO 1XOUA 2QE7G 5B5EZ 4DLKA 1IBMO 2LO1A 4UCUA 1KJIA 1YITV 2JA5A 2COJA 1P49A 1QLNA 1N56A 4R7CA 2UUCH 2Q8VA 1WB8A 3PO3G 1P8LA 5D1OB 4QNHB 1IBKH 4NVPA 4DR7O 5KFKA 2P90A 3FFQA 2UVVA 2W71A 3CCMV 3BPZA 5KFVA 3VOUA 4B3RH 2WWWA 4LF7B 4EEYA 1SESA 4UCTA 1Z2OX 3UM7A 2RGRA 4O2BB 2P67A 4MTXA 2C2AA 4FE2A 3RWRD 5LOVF 3NC0B 3F7VC 1QQCA 3T54A 3U0ZA 4DV5H 5B1AB 4BY7G 1MABG 2R6FA 4JI4O 4B3TH 4FLVA 2K1EA 5I5WA 3E35A 2FKLA 2KB1A 4ECSA 1IBMH 1D2DA 2V5AA 5L3FA 2D3OW 5IWAB 1SETA 4HNAA 1AI4A 3KKYA 5EK0A 2CNQA 3BFRA 3GIDA 3U0GA 1X9NA 1PV0A 4DL2A 3GWKC 5BMVB 4DR7H 1VQ8V 4IWXA 1GMGA 3Q1KA 1K1SA 1I50A 5K3WA 3L72H 4O2AB 4F4LA 1ZL8A 4F4XA 4A3GG 1JQ0A 3GTGA 3JATB 4CKEA 4FBTA 2WA3A 1IBLB 5K2MA 5B1AC 3OM3B 2AW9A 2R92A 2Q6AA 1SQPH 3A2FA 1JCHA 2IH1C 4OGQB 4B3SB 4X66B 1CS0A 2C2RA 3RB3A 2CH7B 4LF6O 3KREA 1MMMA 4JI4H 4N21A 1YTFD 3Q4HA 2ZM6B 2HHHB 4RWUA 3JAMN 4FFLA 2XGPA 5KKNB 4UVCA 4C5CA 1N34O 3BAAA 3ZHSA 2UVRA 4FFKA 5GONB 3AK1A 3ZX6A 3F5WC 5KFWA 2X0LA 4FLZA 2JA6G 1VQOV 4JV5B 2P22C 3JD3A 2W57A 4DYLA 2WLNA 3CEIA 3OGCC 5KMGA 1KBHA 2ZNIA 2OIEA 3PW2A 2PF4E 4IGGA 4I50B 5LGTA 2HLDG 5IT9W 2CTWA 4W4KA 1JR9A 4WHXA 4L8JA 3N6XA 4LF8B 2ZDQA 3ZBHA 4BIOA 4U7CA 4O3QA 2XOKG 2F43G 5CB4A 4ECZA 4LF6H 2B63G 1CKMA 5EZYB 2J6TA 2BTQB 4IRKA 5C4XG 3BCCH 3HOYG 1NI8A 3N44B 3V6KA 1WPBA 1N34H 3DGEA 4ZOLB 2YU9A 1AN7A 2Y0SE 4GKJB 5DN6G 1EUDB 2HGXA 4LF9O 3PZPA 1RP3B 1SQXH 2XCLA 4DK0A 1DV2A 3OUFA 2ITDC 4XX0B 1YEWA 4X1IB 2EIMB 2R8JA 3PFFA 1K3EA 5LHIA 2IMWP 3DAAA 3ICXA 3RAXA 5LL6Y 1XMOB 5FNVB 3WFVA 4TQDA 3QO7A 2DMXA 5LXTB 5C1PA 5KG7A 3RBZA 5LL6b 1Y1VA 1O9HA 1IBLH 3JZFA 5JH7B 3T9DA 4UCVA 5KFPA 4O4JB 4LBEC 3OD4A 4DV7O 1AR1B 4TQRA 2ASJA 1R3KC 2AGPA 3T1YB 2K9PA 5BWTA 2VQFB 1DIKA 2Z04A 3APQA 5KT6A 1A48A 2HHHH 2LFSA 1DLBA 2ITCC 2EX3A 2EIMC 2PGGA 2UXNA 1EUCB 3W7TA 1WRVA 4DV2B 4LF9H 4O7NA 4RB1A 1XK5A 1DF5A 2IJIA 2XAHA 2R8GA 2YIBD 5H5NA 4F4WA 4CS4A 5BZBA 4BW5A 4KFMA 1Y67A 3RGBA 2W9CA 1OBDA 2N74A 4NZMA 2NR5A 2GHYA 4YHHB 4TT3G 5JJNB 3FYEB 4JV1A 4JASA 3PW4A 1X59A 1K5QA 2ZXWB 2XC9A 1FJGB 3V6JA 2YIAA 1G6UA 2YYAA 1FXHA 4DV7H 4X1YB 4J7ZA 2QYZA 3VQWA 3RYFA 3IC9A 3WB0A 4KP4A 3W5OA 5DLFA 4RAIA 2Q7HA 3H1LH 1CKNB 4BXXG 5KG6A 3T1CA 3U55A 2A1HA 2JEIA 4UVBA 1WP8A 2WB1E 1KTAA 1SQVH 2UXBB 2XNDG 3VQYA 3GIKA 5EBWC 3SGIA 1G8MA 1THZA 3DTUB 1M90W 1S03G 3K0GA 5IT9N 1BGYH 2ZXWC 3I5DA 3RB4A 4IRCA 1RM1B 4YAJB 5KFMA 3IFXA 2YICA 5CA0A 3KAJA 1GYFA 5GTIZ 2IBZH 2R8IA 3DC5A 4ZI7B 4EG0A 3FKIG 2WLIA 5IY5B 5BYBA 1E4EB 4O4LA 1BJTA 2P4KA 3CRAA 4UCSA 4TVIA 3L71H 3T9AA 3GILA 4XDKA 5D5PA 2VQFH 3FB5C 4YQWA 1RYRA 3E22B 3FB6C 3BY6A 1B04A 3OR7C 4XBFA 1KC8W 1CP9A 2UXBO 3TETA 5BR8O 3K9AA 3GDEA 4JI0B 1XREA 3N43B 4IR9A 1VIBA 2YZLA 2OYQA 1COWG 3M99B 2FLPA 5E1AC 3ZRXA 3NUAA 3PN1A 4O4IF 4FLYA 4Z1MG 3EFFK 1L8DA 1S5JA 5B3SB 5J2UF 1W93A 4YHHH 1TA8A 1PKXA 2VA2A 2L35A 3K03A 4QPKA 4B08A 2R93G 2A9HA 4M9UA 1H2GA 1N0NA 2ZE7A 2ZDIC 2IH3C 2OWOA 5KHKA 4LFAB 3ABMB 3AG1B 5KG5A 2W7OA 3P3PA 3M8AA 3RVYA 5KFRA 4IIJB 1Y6XA 1VBHA 3QFFA 3ASNB 2M6YA 2VPQA 3UO2A 2UXBH 3LSUA 5BR8H 4FFMA 3CD6V 2E2IA 2R82A 5B3SC 4BBRG 1KC7A 3LWBA 3Q8PB 1VQ4V 3OTOB 1XILA 3R9RA 1Y76B 2RQ6A 4JI0O 1FFXA 3RJ0A 3PW0A 3VQXA 3WO0A 2QKSA 4PDVA 5KFHA 4TUYA 3NGDA 4MVQA 1MZBA 3AG1C 3SJBC 4KHPO 4CKBA 4MVRA 4DV1B 2PMZA 4FM1A 3GTJA 2ZR2A 1YF2A 2X6CA 1V51A 4DR4O 1LR1A 4O7LA 3EYYA 3FB7C 3SI8A 3CC7V 2P0AA 5EIBD 5CA1A 3SYAA 2YRXA 3RR5A 2ATKC 4YR0A 4O4HB 3JD2A 1O75A 2DYSB 1K92A 3OTFA 3RTXA 1U96A 3AK3A 4GX2A 4GUNA 3ETGA 3GIMA 3JAWB 4LC1A 3MHSC 1Z2NX 1TVKB 4UV8A 2R7LA 1A0IA 4JI0H 2LQTA 4JYAO 3BABA 1V55B 3CRCA 4DRXA 5KUKA 1FPOA 5LA6B 4A3FG 4KHPH 1ZAUA 5CN0A 1GSAA 1EM1A 4DR4H 2Q73A 4J7KA 4JAAA 1AI5A 4IHJF 5I5TA 1C30A 3TJTA 4BIZA 2DYSC 4IHJA 2UUBO 1IOWA 4UCRA 3U9TA 4WBNB 4Q8EA 1N33O 1S76D 2A7WA 3CCEV 1K5SA 4GC6A 2DLNA 2AQ4A 4QW9A 3H20A 4JI7O 1EHIA 4JI5B 3R5XA 1F4MA 4YJ3B 4F6RA 3QF7A 4GZRB 2Q9LA 3RFRA 3K57A 1S68A 5L1IA 1Q90D 4U3FH 4JYAH 2YEVB 2LFRA 4LH7A 2Y0PA 2W6MA 1I08A 4HR7A 3QZ7A 4WFFA 2DE0X 4DXWA 2BR0A 1Q3EA 1AI6A 2XT9A 4GX5A 4MV6A 3J7AU 4MVMA 3LQSA 3ZHTA 4RQFA 2Q4PA 2WLKA 5L9XA 1M0TA 3LP8A 4O82A 4PA9A 4DV1H 4X20B 1BHBA 2EBOA 3GV8B 4UB8Z 2UUBH 4GT1A 1S97A 5J2TF 1N33H 3L2PA 1OHHG 3ZRSA 4MTGA 3RGXA 5LMNO 2OCCB 5I5VA 1BS3A 4J80A 4R6ZA 5EWGA 3OHBA 4JI7H 1PX2A 1VMGA 3G6EV 4DO2A 2FB9A 2FB5A 4JGSA 2L6LA 3ASOC 2KG7B 5ITZA 5FPRA 4GKKO 4NKGB 4DR1B 2Y69B 4EGJA 1JOYA 2LW1A 2YL2A 2DYRC 4CS2A 1I94B 5JQGF 5CBGA 3FKIA 3FYIB 4RUEA 2F4VB 3M9MB 1XUQA 5JQGA 3MD0A 1B6SA 5L1JA 3KTMA 2HFEC 5DEDA 4IWYA 1GAXA 2IU0A 5J9PC 1OV9A 5KAFZ 3K5HA 2OCCC 2LP7A 4MAMA 3TIIA 5KX5F 2ALZA 3T7AA 3NXSA 2DABA 1L0LH 4ZBMA 3ZRWA 3CPWU 5DMXA 3CMEV 5LMNH 4ECVA 1H8HG 3DSQA 3TK1A 3KHHA 2R8HA 2GQSA 2E5LB 1CQIB 4BY1G 3CHXA 5A2QN 3GIIA 2EILB 2QM7A 3UZBA 4HNUA 2ZDGA 1ZX3A 2Q5ZA 4KL1A 3T1HO 3F5TA 4I7HA 3RF2A 2EJ7A 4UCOA 1M1KW 2QR4A 5H6QA 1ZHQA 4GKKH 4HZ3A 2W7PA 2LGWA 4MSWC 4DV0O 2VRZA 1EN4A 3EXAA 2VQEO 4QWEA 1XQ8A 4DR1O 3STLC 1HNWO 5LOVB 5KFXA 3K3WA 3EHBB 3T9CA 3VNNA 2RDIA 2EILC 1GH6A 4MVSA 1KJ8A 4YIOA 2FMLA 3VPCA 4QSHA 3L74H 5JUMA 1YVWA 1S72V 4HNAB 2EIJB 2XTAA 2YXYA 2P06A 1SERA 2WAQE 4K0KO 1ZUQA 4C7UA 3HOUG 2E5LO 1UC9A 3T1HH 4J9LA 2W70A 2ZIOA 2E76B 1ZL8B 3TGUH 1ZLZA 1MA1A 4PDRA 4PDMA 5HV6A 4ED6A 3LNNA 2EJ3A 4J11A 3E89A 4MW8A 4MTEA 1W59A 3U9SA 2VUGA 1HR0B 5I47A 3AK2A 2VQEH 3RYHA 4DR1H 1CPYA 4MV9A 4F50A 1HNWH 3VBBA 1S0OA 2ZINA 3RYIA 3TEKA 4O7TA 4J9NA 2EIJC 2PUSA 4BBSG 3K5IA 2JEJA 1AR4A 5IP9G 2JEUA 3K0DA 4JI1B 2FLLA 1KP2A 3HPLC 2WLHA 4RNNA 4DR2O 4DV3O 2YI8A 4RO2A 2X6BA 4BAYA 5L3CA 4K0KH 4JI8B 5IYZF 1IVSA 3HBLA 2IJJA 2OLSA 2E5LH 1OCZB 2EINC 4A2AA 4AHCA 1VQ6V 3ETDA 1FXKB 3J81N 4A3BG 2EIYA 1QVGU 4NXMB 2C35B 3CCVV 4P30A 4AI8A 4K6NA 2NVYA 2O03A 2O57A 1R6NA 4FK5C 5K1XA 1VAJA 4WFEA 4UXNA 1EYZA 1PNLA 3C3SA 4DR5B 2A0LA 4C2MA 1VQ5V 3FDSA 4B7EA 5BWXA 3E83A 2C2DA 4NR1A 2I87A 1WJZA 2E3CA 4I0XB 4K35A 3W1BA 2Q67A 1F23A 3D3IA 3T9BA 2QA4V 1GM9A 4L87A 2GUZA 5KHHA 4ED0A 1C3OA 1OCZC 4DR2H 4DV3H 3OT7A 1N0JA 1B33N 1V4YA 2YXLA 2GV9A 4O3SA 3I4NG 2HGSA 5F2VO 4JYCA 3W7WA 1QU7A 1PL0A 4EFEA 4ECTA 3MR5A 3FB8C 2RF4A 3SNOA 3KCYA 3RV4A 4FFNA 2OTLV 1SQGA 3B40A 4FJCC 5KT7A 1RYSA 3K06A 3Q8SB 5FR9A 3JAMW 3K58A 1XNRO 2FJZA 3A0RA 4O7YA 4RB0A 1PK8A 2Y0IA 3UT5A 2IBKA 1I7FA 4FS2A 3UYYA 3SPGA 1M5IA 3CWBH 4O3PA 4ECRA 1EKPA 4MT8A 2OTJV 4DQNA 1S77D 3KAKA 4WD3A 2QSAA 1Y4MA 5DM6V 2UUAO 1YJ9V 4MTFA 2HG5C 4Y8VB 1AP5A 1VQ7V 4R8CA 3FD9A 3UQ8A 1NQTA 1P4RA 1SF9A 4OPAA 4JI3B 5KFEA 2YC0A 1XMQB 4APMA 2Q0OC 4O7SA 1JMKC 2JIZG 4LH6A 2OCHA 5L3DA 4FPPA 1ENVA 1NH2D 1XNRH 3MFHA 4CKCA 1QHTA 4DUZO 4QE9A 2W6PA 1MG1A 3V4ZA 5LHGA 5EWFA 2WAMA 5I60A 1AUVA 4QW8A 4RUCA 1UJWB 4LF5B 1SQQH 4PA6A 5HNEA 2OIGA 2W9BA 3RYCB 4EBDA 1R3LC 2UUAH 1G2WA 3JALA 4I4TF 2QWPB 4I4TA 4RAYA 2R9RB 2ZE6A 1XHZA 3CSXA 5JQWA 4J7JA 3WG7C 1CEZA 2VQDA 3O65A 5KT4A 3KYHC 1M7JA 4DV6B 3ABLB 4Z1VA 1GLVA 5KFAA 2QDOA 4DUZH 4JI2B 4U7NA 5KFOA 1Z2PX 1SYXB 5LYJA 1A9XA 3HB9A 4QWCA 4U6PA 5HBRB 3CRRA 2DQ0A 2R70A 4HBNA 5L1KA 2A3QA 5KG1A 1N4CA 3QG5A 4WCEV 5B1OA 3WO1A 4LF7O 4BWAA 3ABKB 3MR3A 4ED7A 3PR5B 5EDWA 1XNQB 4LNUB 3LDDA 3CSWA 3ABLC 4J9QA 4A5UB 4X62B 4ASUG 1OJHA 2I8CA 3EVKA 2P7TC 5JCOA 5C93A 4O4IB 4WFGA 3RVZA 2HHFA 3R65A 4D7TA 2Z3YA 5J2UB 5IWAO 2BSKA 3SJAC 1XBLA 3CEBA 4IYHA 2YUAA 5BWVA 2N04A 3ABKC 3RIZA 3K04A 2HJDA 2RGVA 1BSMA 2QEXV 4RB2C 5AG2A 5IYCG 1WNSA 4X1KA 2Q7DA 4LF7H 2F95B 3N2KA 4TQFA 1IBLO 3K79A 1T36A 5CB4F 4YP3A 5FPOA 2NUAB 2NU6B 4CMFA 3I55V 3K5LA 4DUYB 4QWDA 1GRJA 2ZIMA 4B3SO 4X66O 1XNQO 4YAKB 1VS0A 2QM4A 3ETQA 4J9RA 4F4ZA 2VWKA 5KG0A 4QWAA 3FKSG 3H1IH 2ZM6O 4I7ZB 2HHHO 3U54A 3RGZA 4EYIB 1V54C 2B9ZA 3ZMTA 1GO3F 2BOCC 1EKVA 3G8DA 3JZIA 3BA9A 5IWAH 4NXNB 4JI2H 5KFJA 1KJQA 2NU9B 3WWIA 2QTSA 4PDLA 1DK1A 1H2LA 4PJ0Z 3GVMA 3NR7A 4RZRA 2YI9A 4JV5O 1Y1WA 4JF3A 2F93B 3STZC 1SS3A 3T4DA 5JVDF 4O3NA 5IYCO 2GDSA 1WPXA 1NVPD 5JVDA 4FFBB 1MNGA 4U3JA 1L0NH 1RPRA 1QLEC 1S0MA 4FLUA 3FAVB 1G4YB 2ODTX 4LF8O 2FYUH 4O7ZA 4B3SH 1LUVA 3MWDA 3W7XA 4AYBE 4X66H 1XNQH 5H80A 1UPGA 2R7KA 4JI6B 1WLEA 3HKEA 4FLWA 1OCRC 1RK6A 4X62H 2ZM6H 3JSLA 3CRQA 1AUXA 4B3MB 2WLJA 3JAKA 2ILMA 3T5HA 3Q8RB 1BCCH 2NU7B 1G1XB 4PA7A 4CH3A 4GKJO 2ZT9B 1LUWA 3D3QA 1KMIZ 4JV5H 4ECWA 4IHJB 3L75H 3MDSA 4JAUA 1VBGA 3GTPA 4F6EA 4RAZA 1Y66A 2JVDA 1I7NA 5BXZA 2DWDC 5FJ8G 1XMOO 5EYPA 1IURA 1Q82W 4JUZA 1US6A 1N32B 4LF8H 2VUMG 2EULA 3SPHA 5KHGA 2JDIG 1WH2A 3TXSA 1OBGA 2UVWA 4DUYH 3ZN1A 3N41B 4DR6B 4YJ2A 3T1YO 5D1PA 3VQVA 4TQSA 2VQFO 5EC2C 4LP8A 4FLXA 3SPIA 4O86A 3SPCA 3TIGA 2W9AA 3SYPA 4A3IG 1RSOB 4M0JA 1GGOA 2AGQA 4PDBA 4DR3B 4GKJH 1I5XA 3C0FB 2F23A 4DV2O 4J9PA 3IJ4A 5D1OA 4CHIA 3GQCA 3GWOA 2BE3A 1I1KA 1VQNV 5CA0F 1QVFU 2V59A 3G6XA 1T3NA 4PI0A 2Q2TA 2PZSA 3DTGA 3S3WA 5J2TB 1XMOH 3L73H 4O4LF 4YHHO 4EB6A 1DV1A 4YR3A 4WF9V 1N36B 4RZQA 1FJGO 4CS3A 2BTOA 2NLJC 4ABMA 2UVUA 3JCUZ 2YSUB 1OWTA 2WLLA 3DXRA 3P30A 4JTCB 5ITZB 3T1YH 2CNUA 1S3JA 1M56B 5LP6F 5CMUA 2XIGA 4FZ0A 5LP6A 4RQEA 4YY3B 1YXBA 2FL4A 5JQGB 4EYHB 4DV2H 5H9CA 2RNBA 1WCMG 3P32A 1KKDA 4DR3O 2I80A 4O83A 4EKWA 3I4MG 1P16A 4PZ6A 2VOBA 4O2AA 4ECYA 3M4IA 3AEIA 4K3AA 1S9FA 3ZRWB 5KX5B 3OW2U 2W6IG 2XCPA 1HNZB 3CJHA 5GTHZ 1TWFA 3GTQA 2RN9A 1JFFB 2R84A 1JVMA 3Q8QB 3AYHB 4DL3A 1FJGH 1SFOA 2QWRB 1M56C 3HOWG 3JARA 1NZ6A 1KUTA 3OR6C 3CCSV 3J80N 5KHIA 4ZKIA 1GKFA 1SZTA 1R6TA 4NYKA 4BWSC 2DPJA 2Q69A 3AG2C 2JA6A 1WR2A 5IDJA 4PHZA 2CGOA 1NTKH 4YB8B 5KS8A 4DR3H 1YIJV 1HW7A 2GBOA 3WB2A 2CTPA 4I50A 4TUYF 4QGPA 1M93A 3W7SA 1M57B 1CE8A 4A3EG 4DW0A 4A3DG 2WYOA 3OSNA 2B63A 4MVOA 1Q43A 2LW7A 5EWEA 5DGIA 4RNOA 3K08A 2YS6A 3PW5A 3E8FA 5CA1F 3SJQC 4Q45A 4A3LG 2W0FC 3EPGA 3OUSA 4LFCB 4LFAO 2GPSA 4HAMA 2QJ1A 1IYDA 4IYIA 3CB2A 1AB3A 3H4BA 3HKZA 3DC6A 4MVZA 1PPJH 1W2BU 4ZOLA 3X2QC 3GV5B 4YY3H 3RYIB 4EQ5A 5A2QW 3TY5A 4R50A 1M57C 4JZ2A 4X1IA 1KJ9A 2PMZE 1H2SB 2Z02A 4JYBA 3BG5A 4OXSA 3G71V 2JEGA 5KFUA 4RU9A 3OTOO 4DV4B 1I7LA 5FNVA 1SC5B 2AGOA 1GSOA 5IJ9B 5LXTA 3VPBA 1SCUB 4X9QA 2HVKC 2OT5A 1ULZA 2XCAA 4O4JA 5IYZB 4PA3A 4X65B 4UV9A 4DV1O 1EN5A 3TW6A 3BQ2A 2RDJA 2CTQA 4E6NA 1ZTEA 4LFAH 3HXLA 3B8MA 4YR2A 1BXRA 3HT5A 3K5MA 4LFCO 4O3OA 3H1KH 3UCSC 3OMIB 3RW0A 3BQ0A 3ZEDA 3HKCB 1KP3A 5B1BC 4GX1A 3V6HA 3OE7G 1SA0B 3H4DA 1TUBB 3W1GA 1FYJA 3OTOH 1M4UA 4E4TA 1LNQA 2IW5A 2RCVA 5KA6A 2ADQB 3ASOB 3JD4A 4AQYB 3HKBB 2XASA 2Q7EA 5KG3A 2YIDA 2AGAA 3N2GA 1EKFA 5IE9A 2DYRB 4X1YA 1KJJA 5KHJA 5D8DA 1Q7YW 3RAQA 5C5JA 4MA0A 3H3VH 2HIVA 2EIKC 2XGQA 4LFCH 2GQRA 2DJVA 3UT5B 2PI4A 4MVUA 2WLMA 4EBCA 5B66Z 1S5LZ 2QWOB 4RUFA 3SPJA 2HG8A 2YRWA 4PZ8A 1XDCA 4JI5O 1V9PA 3JYCA 2CW8A 1FAFA 3PJSK 2WE6A 3GIPA 3J81W 5KFLA 3G6YA 2Q7GA 4MV3A 3ZMSA 1IDSA 2A06H 4FS1A 2W6JG 1EBOA 2ZD9A 4UUJC 4QJFB 1S0VA 1YCIA 1R3IC 2COGA 1KB9F 3AG4B 2EJ0A 3KCXA 2X5RA 5CR5A 2ZE8A 1B06A 5BPHA 3GLKA 1WN7A 3CVZA 3JASA 2VA3A 2CAZC 2FK3A 3PR4A 1KQSU 3B77A 1JLLB 3A0HZ 3GIJA 2KKWA 2XAGA 2ZE5A 2C2EA 3H0GG 2R8KA 4CH5A 2Q68A 4RUAA 2AZ0A 5KLVH 5KFSA 3OGIB 3RFCA 2FTKA 4X8AA 4I55F 4Q43A 1HP8A 5DQGA 3JZ6A 1NTZH 1WCMA 4I55A 3QQMA 5C1OA 2JGDA 2Q2UA 2JA5G 1AJPA 3Q2OA 4JI5H 2HKOA 2R9IA 1K83A 2QWNB 1EN6A 4BIUA 1R3JC 4H44B 3AG4C 3DTFA 1R6KA 5BY1A 3GIQA 4JTDB 3JALB 2R93A 4FGRA 4I4TB 2WTFA 1I94O 3J7AK 4B7KA 3N6RA 4AQYH 1ZSPA 2F4VO 2Y4UA 2IJKA 2Y48A 4LFBB 4MV8A 3IGAC 5TISZ 4A2BA 4M7EA 3KHLA 3MAQA 2C28A 4FBUA 2DZDA 4O7RA 4ZIBA 4D6TH 4FFRA 3K5NA 2UXDB 2GSMB 2VWJA 2AHYA 1I6UA 2ABJA 1SQFA 1QCEA 2ETNA 5DGHA 5LGUA 3PO2G 3CC2V 3OMNB 4A3KG 4GC7A 5CE8A 2EINB 3UKMA 2W6QA 1A32A 5C8YF 1BT8A 2IJHA 3T4ZA 4PWQA 1D5AA 5C8YA 2CNVA 3ZCCA 1I94H 5FLXN 5DG7A 5EIBC 3K3PA 2Y4RA 2F4VH 1ORQC 4OX9B 2W8KA 3SE7A 1HDJA 3ETEA 5IYBG 3Q4HB 3K59A 5CAEB 4FM9A 1BQZA 4LWSA 2UU9B 4LFBO 1I0HA 1JJ2U 3OUZA 2XAFA 1T5EA 4BW9A 1L2ZA 4ZQIA 3QO8A 2UXCB 3TINA 4O4HA 2BSKB 4RCNA 5JJJB 3ZHQA 1AP6A 1W0KG 3GJXB 2HR3A 5KFCA 1EZVH 1ZHSA 3TXQA 5KMGB 2VR1A 1TVKA 4YIPA 4LF4B 3MHHC 5DQHA 1XI1A 1R1BA 1J5EB 3HKDA 1AI7A 5LMUB 2KSWA 1I1LA 5DGAA 3G80A 4XYLB 3JRXA 5I5XA 3BHPA 3I56V 1HR0O 1H38A 5KA5A 1K7DA 3H40A 4X64B 5JCOC 2EJRA 5CB4B 4WFBV 3ZHVA 4O81A 1H8EG 3GB7C 2J6SA 5KFDA 5IYBO 1MOFA 3IG0A 1FKAO 4C5AA 4LFBH 3LDEA 1YZBA 4TWKA 2PVPA 2FE3A 2BQ3A 3CXHF 4KXRA 4PV1B 4Q4CA 4XDLA 4WBNA 5KFTA 4JI1O 4NTWA 2UUCB 3WWJA 4JXUA 5KFZA 1IBKB 1I3QA 2GLTA 1PM9A 3TQ1A 2ZJTA 4JI8O 3KHRA 1Q6HA 4YJ3A 1SRYA 1RJRA 1BL8A 2G38A 4MV4A 3MWEA 4DRFA 5C3EG 1K4DC 4B3RB 3R5FA 2BQUA 3CX5F 1VF7A 2JRIA 2YEVA 4I9WA 4DIMA 5JVDB 1DAAA 1XL4A 4U3JB 1EFRG 1K9MW 4TV8F 4NXMO 4ECQA 1HR0H 1Q81W 4TV8A 5I5SA 1VEWA 1ZQ7A 4PI2A 1FD9A 2V7QG 1Y1VG 3R5HA 4DV5B 3G6VA 4DR5O 4YBZB 3ZMUA 4DL7A 4CE5A 2P5OA 4B3TB 1FKAH 4D7SA 1JXLA 2Z5UA 3SYQA 1X4TA 5C44G 1IBMB 4QIWE 4LCUC 1L1FA 1JDBB 4RNMA 3APOA 1K73W 4JI1H 3JCZA 1M9NA 2YW2A 2DIKA 1JKJB 3E2EA 2YCHA 2W6NA 4LSAA 3H9VA 2YWVA 1Y74A 4DR7B 1Z5WA 3MFIA 4JI8H 2YZMA 2PY5A 3AG7A 2IA6A 5EOYA 4J9SA 2LJ2A 2W9CB 3HOZG 4IRDA 1E1RG 5DG9A 2ZR3A 4CC5A 3CCUV 3KXYT 1R9TA 1KUQA 2J6UA 2XAJA 4NXMH 5KFQA 1VKZA 3WG7B 2M05A 2R7NA 5EYPB 3UO3A 1HNXB 3OHAA 5LMUH 3N8DA 4IT5A 5I5YA 3OMAB 2QWQB 2HVQA 4DR5H 3RYFB 4KUMA 3GB8B 1E79G 3E8BA 4R8UA 1VF6A 4ED3A 2FPPB 1QBZA 4FLTA 5DISC 5KAIZ 4CMDA 2CTRA 2HIXA 5KT3A 3CCLV 3LSQA 5IJ0A 4O84A 4TSFG 2V1DA 1N8RW 3WU2Z 4FM0A 3G8CA 4Q6GA 2ARHA 3TW7A 4HNTA 5KUMA 3CMAV 2JEXA 2ATLA 4IZOA 3FMAA 1KBLA 1VARA 4JI3O 2QB5A 5KFGA 2QK4A 4J41A 1XMQO 1S5HC 4G27B 3WNZA 4XDJA 1UFIA 2A79B 5K1PA 2PYLA 1B6RA 1F7YA 5CA0B 4A3MG
chains in the Genus database with same CATH topology
4DRXA 5KHGA 1WH2A 3JSNA 4DUYH 5LA6B 4EB6B 3N41B 4DR6B 4KHPH 4O4LB 1ZAUA 4GLXA 4YJ2A 2VPSA 4LF6B 5D1PA 4FM2A 3VQVA 4DR4H 5LOVA 4FLXA 4DV0H 3DF7A 2PYJA 4IHJA 1M0WA 2HVRA 3B2EE 4DR3B 4UCRA 4PDBA 4GKJH 1SKVA 3C0FB 4WBNB 2YIBA 1N34B 3JAWA 5D1OA 5LP6B 3BA8A 4PI0A 2Q2TA 2PZSA 3H20A 4X1KB 4JI5B 4YJ3B 4F6RA 3QF7A 3N2KB 5J2TB 3RFRA 4JI3H 1XMOH 1XMQH 3K57A 1S68A 5LA6A 4EB6A 4JYAH 5IJ9A 2F1MA 5FD6A 4LH7A 1N36B 3WB1A 4RZQA 4CS3A 2WDTA 2BTOA 5IYZA 1Q3EA 3T1YH 5ITZB 1XNRB 1HNXH 3JARB 4I9QA 1M0TA 2XIGA 4DV1H 2R9AA 1O9GA 4X20B 5LP6C 5LP6A 2UUBH 4LF5H 4YY3B 5JQGB 2UXDH 2IM9A 5JJEB 4DV2H 3K5OA 1N33H 5D5QA 3HKCA 3L2PA 3RGXA 4LF9B 1P16A 4ZHQB 4PZ6A 4O2AA 1SA0A 2VOBA 4JI7H 1TUBA 4LR3A 3M4IA 4TV9B 4DK1A 5KX5B 2UUAB 1HNZB 4R7RA 1JFFB 4MTDA 5ITZA 3HKBA 4RB3C 1FJGH 5FPRA 1FFXB 3JARA 4DR1B 4ETSA 4OX9H 3L4JA 4DV6H 2HVSA 4X20A 4CS2A 1I94B 3S24A 4TUYB 3HKEB 1CKOA 2F4VB 4DV7B 5JQGA 5KHIA 1E4GT 1KU9A 4DUZB 2UU9H 4BWSC 3JAKB 3NBZB 4K8ZA 2UXCH 2CW7A 4ZHQA 4PHZA 5CA1B 4MV7A 4TV9A 4DR3H 5LMNH 3DSQA 1HW7A 1TGOA 2E5LB 3CHXA 4LF4H 3WB2A 4Q0YA 2JS5A 4I50A 1J5EH 1M93A 4KL1A 1BGWA 4I7HA 2WYOA 3RF2A 4UCOA 1ZHQA 3J80W 4GKKH 1Q43A 4DRXB 4JI4B 4X64H 3KALA 4EFBA 3QWUA 1JJOA 4YJ2B 1XQ8A 4LFCB 1XDNA 2QJ1A 4EEQA 5LOVB 3CB2A 4UCUA 1P49A 3VNNA 2JGUA 4ZOLA 2ZCEA 2UUCH 4YY3H 3RYIB 1P8LA 4EQ5A 5D1OB 2PTMA 5FD5A 3TY5A 5A2QW 1IBKH 4FVMA 4NVPA 4HNAB 3FFQA 2Q0AA 4X1IA 3BPZA 1H2SB 4F6RB 4B3RH 4LF7B 4DV4B 3T1HH 4UCTA 5FNVA 1Z2OX 2ZIOA 2RGRA 5IJ9B 4O2BB 5LXTA 2V4DA 3RWRD 3IAYA 3LNNA 3NC0B 1QQCA 2F66C 4MTEA 4O4JA 5IYZB 4X65B 3U0ZA 1HR0B 2VUGA 4DV5H 2VQEH 3RYHA 4DR1H 4E6NA 4B3TH 4FLVA 3BRCA 4LFAH 3HXLA 3N2GB 4MV9A 1HNWH 2XHBA 1IBMH 4NXNH 2HEPA 2ZINA 3RYIA 5IWAB 3K5MA 3U10A 4HNAA 2PUSA 1X9NA 3ZEDA 3HKCB 4JI1B 5BMVB 4DR7H 3RYCA 3M7MX 2YI8A 4O2AB 1SA0B 4K0KH 1TUBB 4O2BA 5BR8B 3W1GA 4JI8B 3JATB 2E5LH 4GYCB 3OTOH 1M4UA 4A2AA 1IBLB 4AHCA 2MCTA 4AQYB 3HKBB 2Q7EA 3A2FA 3N2GA 4JI6H 4NXMB 4B3SB 4X66B 2O03A 4X1YA 4JI4H 5K1XA 5KHJA 4B3MH 2ZM6B 4DR5B 2HHHB 4CH4A 3JASB 2HIVA 5BMVA 4LFCH 2E3CA 3W1BA 3UT5B 3BAAA 3TY9A 5GONB 4IAJA 3JATA 4FLZA 5KHHA 4PZ8A 4JV5B 4DR2H 4DV3H 4PZ7A 2P22C 1XHXA 1V9PA 2W57A 1Q5OA 2YXLA 2GV9A 2CW8A 2RJZA 4I55B 5KMGA 4CC6A 2ZNIA 2HGSA 3LMLA 3N40P 4I50B 2WE6A 3K3VA 3J81W 1N32H 2Q7GA 4EFEA 5IT9W 4LNUA 4L8JA 3N6XA 4LF8B 1SQGA 1Z5VA 4DR6H 1NT2B 1WN7A 4LF6H 5CB4A 3CVZA 3JASA 3JAMW 3K58A 2CAZC 4O4IA 1CKMA 5EZYB 4KHPB 4RB0A 2ZNJA 3UT5A 4AILC 2BTQB 2R72A 1I7FA 2KKWA 1TAEA 5GONA 5J2UA 4DR4B 1M5IA 4CH5A 3N44B 1WPBA 1N34H 4ZOLB 1AN7A 4GKJB 4I55A 3ZS8C 2Q2UA 3KAKA 4DK0A 4JI5H 1E4FT 1YEWA 1DGSA 4X1IB 3ICXA 3UQ8A 4JI3B 1XMOB 5FNVB 1N36H 1XMQB 4APMA 4TQDA 5LXTB 3JALB 5LL6b 1O9HA 5EZYA 4JYAB 1IBLH 1JMKC 5JH7B 4I4TB 2BTQA 4LH6A 4UCVA 3J7AK 4O4JB 4AQYH 1XNRH 3RYHB 4LFBB 1QHTA 5C8YB 3T1YB 3MWMA 4A2BA 4M7EA 2VQFB 3MAQA 2HHHH 4ZIBA 4UFZA 2UUBB 4LF5B 2EX3A 2PGGA 3K5NA 2UXDB 2VWJA 4DV2B 1N33B 4LF9H 4RB1A 1I6UA 1XK5A 3RYCB 1SQFA 2YIBD 2UUAH 4CS4A 1HNZH 3JALA 4FFBA 4CH6A 4JI7B 3RGBA 5JH7A 4I4TA 4RAYA 4YHHB 5JJNB 1XHZA 1D5AA 3CSXA 3THOA 1FVIA 5C8YA 1I94H 1FJGB 2YIAA 5EIBC 1G6UA 2F4VH 4DV7H 4OX9B 4X1YB 3HKDB 3KYHC 3VQWA 4DV6B 3RYFA 4DUZH 3WB0A 4JI2B 4LMYA 3W5OA 3K59A 1Z2PX 1SYXB 5LYJA 4FM9A 2Q7HA 1CKNB 2UU9B 1T5EA 4BW9A 1L2ZA 2UXCB 2UXBB 4O4HA 3VQYA 2R70A 4HBNA 3SR2C 3SGIA 5JJJB 5LMNB 3QG5A 3GJXB 1S03G 4BWAA 1ZHSA 5KMGB 4K8XA 1TVKA 4LF4B 1XNQB 4LNUB 1XI1A 1J5EB 5FLXW 3HKDA 5LMUB 2CFMA 2KSWA 5CA0A 3KAJA 1GYFA 4X62B 3BHPA 4TOIA 4GKKB 3NBYB 4X64B 4ZI7B 5JCOC 1CKNA 5JCOA 1Q8IA 4O4LA 5CB4B 4O4IB 1BJTA 3IG0A 4TV8B 4D7TA 4UCSA 5J2UB 4LFBH 3SJAC 2FE3A 1RSOA 5D5PA 2VQFH 3U11A 3F8NA 4WBNA 3E22B 2UUCB 3RIZA 2RGVA 4RB2C 1B04A 1IBKB 2ZJTA 1WNSA 4X1KA 4J0MA 4YJ3A 4LF7H 2F95B 3GDEA 4DV4H 3N2KA 4TQFA 5J2TA 4JI0B 3N43B 2OYQA 4DRFA 5FPOA 4B3RB 4ZI7A 3PN1A 4FLYA 1VF7A 3T1HB 5JVDB 3K5LA 1L8DA 3SJCC 4U3JB 1S5JA 2ZIMA 4DUYB 3N42B 4X65H 1HR0H 4TV8A 4YHHH 1TA8A 1VS0A 2QM4A 3ETQA 4PI2A 4LSXA 2VWKA 4B08A 4DV0B 4DV5B 3RGZA 2VQEB 2OWOA 4B3TB 5KHKA 2P5OA 1FKAH 4D7SA 3E22A 4LFAB 3BA9A 5IWAH 1X4TA 1HNWB 1IBMB 4NXNB 4JI2H 4IIJB 4JI1H 2YI9A 2YCHA 4LSAA 2F93B 2UXBH 4DR7B 1Z5WA 5BR8H 4JI8H 2PY5A 5JVDA 5IJ0B 5KX5A 4FFBB 4U3JA 5EOYA 4K0KB 4FLUA 1JFFA 3OTOB 4CC5A 2RQ6A 3KXYT 3TY8A 4NXMH 1FFXA 4B3SH 4X66H 3RJ0A 1XNQH 3VQXA 5LMUH 5EYPB 1HNXB 4TUYA 4JI6B 1MZBA 3L4KA 3SJBC 3HKEA 2HVQA 4DV1B 4FLWA 1SEIA 3RYFB 4FM1A 3GB8B 4X62H 2ZM6H 3JSLA 4DR5H 4IIJA 4B3MB 5LYJB 4FLTA 3EYYA 3JAKA 5DISC 3QTCA 2HIXA 5EIBD 5CA1A 4CH3A 5IJ0A 3RR5A 1KMIZ 4O4HB 4JV5H 4FM0A 1O75A 4Q6GA 4IHJB 3OTFA 3RTXA 4RAZA 4DR2B 4DV3B 2JVDA 3JAWB 3FMAA 1Z2NX 1TVKB 5EYPA 1A0IA 5K1PA 1N32B 2PYLA 4JI0H 3BABA 4LF8H 5CA0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF8 B;  4JI4 B;  4X62 B;  4TOI A;  4EFB A;  4GKK B;  3NBY B;  3QWU A;  3JSN A;  4X64 B;  1CKN A;  4DR6 B;  4GLX A;  1ZAU A;  4LF6 B;  1CKM A;  4KHP B;  5D1P A;  4LFC B;  1XDN A;  1TAE A;  4EEQ A;  4UCS A;  4DR4 B;  4UCU A;  2HVR A;  3VNN A;  4DR3 B;  4UCR A;  1N34 B;  4GKJ B;  1P8L A;  2UUC B;  5D1O A;  5D1O B;  4EQ5 A;  3TY5 A;  2Q2U A;  1B04 A;  1IBK B;  3BA8 A;  2Q2T A;  1DGS A;  4JI5 B;  3GDE A;  4JI0 B;  3UQ8 A;  4LF7 B;  4DV4 B;  1S68 A;  5FPO A;  4JI3 B;  4DRF A;  4B3R B;  4UCT A;  1XMO B;  3PN1 A;  1XMQ B;  3T1H B;  4DUY B;  4LH7 A;  1N36 B;  4JYA B;  3NC0 B;  4LH6 A;  4UCV A;  1TA8 A;  4X65 B;  1VS0 A;  1HR0 B;  2VUG A;  4DV0 B;  4DV5 B;  4E6N A;  1XNR B;  4LFB B;  2VQE B;  3T1Y B;  2OWO A;  4B3T B;  2VQF B;  4LFA B;  3BA9 A;  1HNW B;  1IBM B;  4NXN B;  5IWA B;  4YY3 B;  4UFZ A;  1X9N A;  2UUB B;  4LF5 B;  2UXD B;  2CFM A;  3L2P A;  4DV2 B;  1N33 B;  4JI1 B;  1XK5 A;  4LF9 B;  1P16 A;  4PZ6 A;  4DR7 B;  5BR8 B;  2UUA B;  3W1G A;  4JI7 B;  4JI8 B;  1HNZ B;  4K0K B;  1IBL B;  3OTO B;  4CC5 A;  4YHH B;  4AQY B;  1FVI A;  5FPR A;  3TY8 A;  4DR1 B;  1FJG B;  4NXM B;  1HNX B;  4B3S B;  4X66 B;  2HVS A;  3S24 A;  1I94 B;  4OX9 B;  4JI6 B;  3KYH C;  2HVQ A;  1CKO A;  4DV1 B;  4DV6 B;  2F4V B;  3GB8 B;  4DV7 B;  3JSL A;  4JI2 B;  3W5O A;  2ZM6 B;  4DR5 B;  2HHH B;  4B3M B;  4DUZ B;  1CKN B;  2HIV A;  3NBZ B;  2UU9 B;  5DIS C;  3W1B A;  2HIX A;  3BAA A;  3TY9 A;  2UXC B;  2UXB B;  3RR5 A;  4PZ8 A;  4JV5 B;  4PZ7 A;  3SGI A;  2E5L B;  5LMN B;  3RTX A;  1V9P A;  4DV3 B;  4DR2 B;  3GJX B;  4CC6 A;  4LF4 B;  4EFE A;  1XNQ B;  1A0I A;  1J5E B;  1N32 B;  5LMU B;  3BAB A;  4UCO A; 
#chains in the Genus database with same CATH topology
 3CCR V;  4CZZ A;  5LYJ F;  4J42 A;  3RB0 A;  4EB6 B;  2WLI B;  3RBE A;  4O4L B;  2BQR A;  3GTK A;  1D5N A;  2W0X A;  2AXT Z;  3ZIA G;  4FM2 A;  3CC4 V;  4LF6 B;  1HNX O;  4EBE A;  2YZN A;  5LOV A;  2WLL B;  3DF7 A;  3DXR B;  5IYD G;  1H2K A;  4LF5 O;  2HVR A;  3B2E E;  5DEC A;  5A9G A;  5H6R A;  5BPF A;  1SKV A;  1BNC A;  1N34 B;  4J9K A;  4PEL A;  3VA7 A;  5LP6 B;  2J9G A;  1WSC A;  1S0N A;  4JTA B;  3K9S A;  3BA8 A;  3FX7 A;  3CCJ V;  4P9O A;  2YS8 A;  3I12 A;  3PVX A;  3RBD A;  4JI3 H;  1XMQ H;  1S10 A;  5KFN A;  4NLG A;  4FU0 A;  3GTM A;  2JA8 G;  3WB1 A;  3CJH B;  2NVX A;  3EPI A;  1QR8 A;  2IU3 A;  1T94 A;  2PBZ A;  4HYK A;  4DV6 O;  2R86 A;  2X6A A;  1P7B A;  4EGQ A;  4JI2 O;  1E1Q G;  2V58 A;  1HNX H;  2GTS A;  2E75 B;  3JAR B;  5H2F Z;  4I9Q A;  1V54 B;  3R23 A;  1KD1 W;  1O9G A;  2DWE C;  4J10 A;  5LP6 C;  5L3E A;  5IYD O;  2GTA A;  4LF5 H;  4HYO A;  2IM9 A;  3BQ1 A;  4YXW G;  4FFO A;  5BYA A;  5D5Q A;  4ED8 A;  1FS0 G;  4LF9 B;  4ECX A;  1PP9 H;  4LR3 A;  4P9P A;  4DK1 A;  5FLM G;  1QLE B;  5HFL A;  1JPX A;  4MTD A;  1FXK A;  2Y0S A;  2NU8 B;  1K97 A;  4RB3 C;  4UVA A;  4X62 O;  4QWB A;  3IC7 A;  1IXB A;  1FFX B;  2EJ2 A;  4Q44 A;  4P2Z A;  3E8H A;  4MS2 A;  4DV6 H;  3S24 A;  4TUY B;  1TWH A;  1CKO A;  2FK2 A;  1OCR B;  4DV7 B;  4Z2W A;  4JV2 A;  3C3T A;  1KU9 A;  3CXC U;  3D36 A;  4ZHQ F;  4I0X A;  1WB7 A;  2WA4 A;  4TV9 F;  2CW7 A;  2DWC A;  4ZHQ A;  5CA1 B;  4MV7 A;  4TV9 A;  4PA4 A;  3L70 H;  4AYB A;  2H8P C;  4QE7 A;  2FPG B;  4Q0Y A;  4A3J G;  2JS5 A;  2HJW A;  1AVM A;  4NTY A;  1BGW A;  2RMK B;  1PL4 A;  4DUY O;  1Q86 W;  1GO3 E;  2OH2 A;  1NH2 B;  3J80 W;  1URF A;  4DRX B;  1SZX A;  2GPW A;  1TUE B;  4EFB A;  2HGW A;  3QWU A;  2XAQ A;  2B1G A;  1WA8 A;  3O9O A;  1VQL V;  1TWC A;  4J9O A;  1XDN A;  4EEQ A;  4NXN O;  2QF7 A;  4NTX A;  2QKA A;  2R87 A;  2JGU A;  2ZCE A;  4HQ6 A;  2XD4 A;  2HDK A;  5FD5 A;  2PTM A;  2KQX A;  4NB5 A;  4FVM A;  1W96 A;  2UXX A;  1I2K A;  1MZE A;  2Q0A A;  4F6R B;  1NU1 H;  1VQK V;  1OCO B;  2FMA A;  4L1K A;  3E8G A;  3H01 A;  4YJ2 F;  1XL6 A;  2WB1 A;  4DL5 A;  5E79 Z;  4X88 A;  4ED1 A;  2V4D A;  3OSP A;  3IAY A;  2DPI A;  3PW7 A;  5BWU A;  2F66 C;  4JI6 O;  2AU0 A;  2MW2 B;  3AW8 A;  3UZO A;  4B3M O;  2E74 B;  3BRC A;  2C00 A;  2JA7 G;  3N2G B;  4JZG A;  2XHB A;  4NXN H;  2YXH A;  2HEP A;  1M6V A;  3D8C A;  3U10 A;  1I2L A;  3VPD A;  2CGN A;  3LUL A;  1FFT B;  1OCO C;  3RYC A;  2LGQ A;  4O2B F;  3M7M X;  1A0G A;  2QKC A;  4HNV A;  4O2B A;  2Z0A A;  5BR8 B;  3OUU A;  4GYC B;  3P3N A;  2B1I A;  1YTF B;  1N32 O;  2MCT A;  4HN2 A;  1IZ3 A;  1SQB H;  1MSD A;  3CCQ V;  3MR2 A;  4JI6 H;  4DR6 O;  5KT2 A;  1AIL A;  3ZJZ A;  3HOX G;  4B3M H;  1NBM G;  2DW4 A;  5BMV F;  4JYY A;  4CH4 A;  3JAS B;  3ZRV A;  5BMV A;  1A3G A;  4O2A F;  3AG2 B;  4W4L A;  3MR6 A;  3TY9 A;  1RJQ A;  4JPR A;  2PN1 A;  2HP8 A;  3HOV G;  4IAJ A;  3JAT A;  3RT3 C;  2ZDH A;  4PZ7 A;  1XHX A;  3HR0 A;  1Q5O A;  4BR6 A;  2RJZ A;  4I55 B;  2JGD B;  4CC6 A;  3LML A;  2WPD G;  1RM1 C;  3N40 P;  3K3V A;  1N32 H;  4LNU A;  2ASL A;  3RB6 A;  1N36 O;  2W8L A;  2CH7 A;  2R7Z G;  1K4C C;  3GV7 B;  3T99 A;  1Z5V A;  4DR6 H;  1NT2 B;  4JAV A;  3N27 A;  5IY5 C;  2VS0 A;  3HO8 A;  1OCC B;  3GTL A;  2N05 A;  4O4I A;  4C5B A;  4KHP B;  2ZNJ A;  5GON F;  4MTO A;  4AIL C;  2R72 A;  1QNM A;  3ZMZ A;  1TAE A;  5GON A;  5J2U A;  4DR4 B;  4YY3 O;  1GN6 A;  4ICG A;  5BWR A;  1K8A W;  1CQJ B;  4MA5 A;  1Z2G A;  1VQ9 V;  5DGB A;  1J95 A;  3X2Q B;  3ORR A;  1UC8 A;  1KEC A;  4I50 F;  4J9Y B;  1H2M A;  1NVP B;  1B6Q A;  3UFX B;  1NR1 A;  3ZS8 C;  4E4E A;  4FFP A;  2D2C B;  1E4F T;  3QVN A;  1DGS A;  1HNZ O;  2DAA A;  3S3X A;  3LSS A;  3E5N A;  3KG2 A;  1N36 H;  5EZY F;  1OCC C;  4H0L B;  1WP7 A;  1ZWI C;  5EZY A;  4JYA B;  2ADP A;  5CBF A;  2BTQ A;  2PI5 A;  2FK1 A;  2ZKO A;  4G28 B;  1NKD A;  1GN4 A;  4ZOL F;  3SDL A;  3RYH B;  3A8T A;  5C8Y B;  4WFA V;  1Q6U A;  3MWM A;  1YDX A;  3ABM C;  2EZP A;  1MSW D;  2C22 A;  4UFZ A;  4F4Y A;  2EZO A;  2UUB B;  3CP1 A;  2ZGI A;  2H3O A;  1KYO F;  3ASN C;  4LWS B;  1N33 B;  5FNV F;  5KFF A;  5HFM A;  1VF5 B;  4Q20 A;  5B1B B;  1BHA A;  3B09 A;  5LXT F;  1RFY A;  3CQZ A;  4O7W A;  1HNZ H;  5JH7 F;  4U7O A;  3OAA G;  4FFB A;  4CH6 A;  4O4J F;  3OEE G;  4JI7 B;  5JH7 A;  3FAV A;  1YI2 V;  1P84 F;  2E2H A;  2SCU B;  1FVI A;  3THO A;  4H13 B;  1GSH A;  3HKZ E;  3RV3 A;  2RDC A;  1YJN V;  1RK5 A;  4N23 A;  1JDE A;  1AJQ A;  3HKD B;  4WFH A;  3T2M A;  2CQY A;  4DW1 A;  3TQT A;  4LMY A;  3M9O B;  2B5U A;  2EIK B;  3LUT B;  2ASD A;  3ABU A;  3F7Y C;  5LBQ A;  2GUZ B;  2X7R B;  2YDE A;  3ZMV A;  4G3I A;  3KHG A;  3ZHU A;  4ECU A;  3SR2 C;  1PNM A;  1K33 A;  2V4R A;  3WWH A;  5LMN B;  2VUM A;  1FXV A;  4UB6 Z;  4DV4 O;  2V4Q A;  4K8X A;  1W0J G;  3MJF A;  4NYE A;  3T9F A;  5FLX W;  2FLN A;  1V55 C;  2CFM A;  3L9D A;  2P6J A;  4X65 O;  4TOI A;  1KEE A;  4GKK B;  2FPI B;  3NBY B;  1DF4 A;  5DAA A;  5JVL A;  2HJF C;  1CKN A;  1Q8I A;  3ETJ A;  4Q8F A;  5EBL C;  5L3B A;  2KSD A;  1KT8 A;  4MW3 A;  4TV8 B;  2YZG A;  2DOS A;  4DAA A;  2JA7 A;  2QM8 A;  3CRM A;  4DL6 A;  1RSO A;  3OFN G;  3KZI Z;  3U11 A;  1HWY A;  2R7M A;  4NZN A;  3F8N A;  3M9N B;  4XZ3 B;  5DG8 A;  1JA8 A;  1B3Q A;  3BEH A;  4X89 A;  3V4S A;  2ZQM A;  4IR1 A;  4J0M A;  3QO5 A;  5EBM C;  1RJP A;  4DV4 H;  5J2T A;  4ZI7 F;  2X0S A;  3H1H H;  3T5J A;  2H94 A;  2DN9 A;  1EZ1 A;  1Y74 B;  4ZI7 A;  4AQY O;  1BQ0 A;  4ED2 A;  1E4E A;  1GK9 A;  3T1H B;  1P7G A;  4FMT A;  3SJC C;  3BAC A;  3N42 B;  3IN5 A;  1VP7 A;  1VQM V;  4X65 H;  2QGN A;  1NTM H;  2WSS G;  2ODM A;  1EZJ A;  1PD3 A;  2NN4 A;  4LSX A;  1H2N A;  4DV0 B;  2W6Z A;  2JJ1 G;  2VQE B;  1IYE A;  1AJN A;  2ZDI A;  4O3R A;  4H37 A;  3E22 A;  5CM0 A;  5FL7 G;  1HNW B;  1ZET A;  2CE4 A;  5B1N A;  4R8U B;  3T9E A;  3OEH G;  1ROP A;  2MK3 A;  1DTO A;  2BOB C;  3CS5 A;  3HB3 B;  2BCC H;  1K1Q A;  2W9B B;  4CBC A;  3ZHR A;  1CXZ B;  1GN3 A;  5KX5 A;  5IJ0 B;  4K0K B;  1TWA A;  5T14 A;  1K34 A;  1WAZ A;  1JFF A;  5F9L A;  5DLG A;  4J9Z B;  1Y14 B;  1PNK A;  3TY8 A;  2R7Z A;  1JX9 A;  3ORQ A;  2Y69 C;  1N48 A;  5LGN A;  4A3C G;  2JK5 C;  5KFB A;  5GW7 A;  3AX6 A;  4J9M A;  2AZ2 A;  2JEF A;  4UUG A;  2WAQ A;  5BWW A;  2HVJ C;  3LDC A;  1SEI A;  3L4K A;  4IIJ F;  3T5K A;  5KFY A;  1VF6 C;  3G4S V;  4IIJ A;  5LYJ B;  3QTC A;  2XUM A;  1IOV A;  4MV1 A;  1JIH A;  1YJW V;  5KG4 A;  1IXM A;  4NZO A;  5LHH A;  1BE3 H;  4I5S A;  3G67 A;  1TWG A;  4DR2 B;  4DV3 B;  1Y76 A;  5L3G A;  3GTO A;  2R92 G;  3H1J H;  1ARO P;  1OZ0 A;  3JSN A;  2QTO A;  4GLX A;  2FKX A;  4QPJ A;  2VPS A;  1I1M A;  5KFI A;  4O4H F;  2HHF B;  3ML0 A;  5L1L A;  4DV0 H;  3JD0 A;  5KG2 A;  2JJ2 G;  2PYJ A;  5F9N A;  2CDY A;  1M0W A;  3SYO A;  4PD4 F;  2UXD O;  1NR7 A;  5E25 A;  2V9W A;  2YIB A;  3JAW A;  5DQI A;  2CK3 G;  1NJI W;  4A93 G;  4TM5 A;  4X1K B;  3QZ8 A;  3ABT A;  3N2K B;  3ETH A;  5LA6 F;  3VMM A;  2P4V A;  1UNN C;  2JS3 A;  5LA6 A;  4PBC A;  1JX4 A;  5IJ9 A;  3A0B Z;  2F1M A;  5FD6 A;  3B8N A;  3B4S A;  3LNM B;  2WDT A;  5IP7 G;  1ET0 A;  3TCU A;  5IYZ A;  4OX9 O;  3ZN0 A;  4GX0 A;  2R85 A;  2AHZ A;  4WBN F;  1GM7 A;  1XNR B;  3C90 A;  2W6O A;  1RPO A;  4FZ1 A;  5CBH A;  2R9A A;  4OPH A;  1R73 A;  3R66 A;  2UU9 O;  3T5L A;  3BVO A;  2M7W A;  1XEQ A;  4GLW A;  2UXD H;  4YJ3 F;  2UXC O;  5JJE B;  3W7U A;  2COI A;  3K5O A;  3HKC A;  4FIP C;  1KKC A;  4XYM B;  1NS1 A;  1U97 A;  4GCZ A;  1AR5 A;  1QR9 A;  4ZHQ B;  1SA0 A;  3QNE A;  1TUB A;  4TV9 B;  1Y1W G;  2UUA B;  4LF4 O;  4E2L A;  5JWP A;  3SYC A;  1J5E O;  5LMU O;  2CKZ B;  4R7R A;  1FXK C;  4QIW F;  3G6B A;  4DL4 A;  3HKB A;  2IP4 A;  3AG3 B;  4QIW A;  1VQP V;  4X64 O;  4ETS A;  4OX9 H;  3L4J A;  1BZK A;  2HVS A;  4X20 A;  5KT5 A;  3HKE B;  2DQ3 A;  1GTO A;  2YS7 A;  1E4G T;  2Y4T A;  4DUZ B;  2FP4 B;  2UU9 H;  3D36 C;  1WA8 B;  3JAK B;  3NBZ B;  4K8Z A;  1I5Y A;  2UXC H;  4JV0 A;  3RUP A;  1GM8 A;  2UUC O;  3E86 A;  3CYO A;  3RN4 A;  3JRW A;  2CZG A;  1IBK O;  1F4N A;  1TGO A;  1IX9 A;  3JD1 A;  4Q4D A;  1YHQ V;  2KG7 A;  1F51 A;  1MZF A;  3BJY A;  3AG3 C;  4LF4 H;  1Q6I A;  5CA3 A;  1GN2 A;  2CUG A;  4B3R O;  1J5E H;  4ME6 A;  3VOT A;  1YSC A;  4H33 A;  3CE2 A;  4QJF A;  1BMF G;  4IL6 Z;  4O7V A;  4JI4 B;  4X64 H;  5EC1 C;  2NNU A;  3KAL A;  5I5U A;  4DV5 O;  1JJO A;  3H0G A;  4YJ2 B;  4G2K A;  4B3T O;  1XOU A;  2QE7 G;  5B5E Z;  4DLK A;  1IBM O;  2LO1 A;  4UCU A;  1KJI A;  1YIT V;  2JA5 A;  2COJ A;  1P49 A;  1QLN A;  1N56 A;  4R7C A;  2UUC H;  2Q8V A;  1WB8 A;  3PO3 G;  1P8L A;  5D1O B;  4QNH B;  1IBK H;  4NVP A;  4DR7 O;  5KFK A;  2P90 A;  3FFQ A;  2UVV A;  2W71 A;  3CCM V;  3BPZ A;  5KFV A;  3VOU A;  4B3R H;  2WWW A;  4LF7 B;  4EEY A;  1SES A;  4UCT A;  1Z2O X;  3UM7 A;  2RGR A;  4O2B B;  2P67 A;  4MTX A;  2C2A A;  4FE2 A;  3RWR D;  5LOV F;  3NC0 B;  3F7V C;  1QQC A;  3T54 A;  3U0Z A;  4DV5 H;  5B1A B;  4BY7 G;  1MAB G;  2R6F A;  4JI4 O;  4B3T H;  4FLV A;  2K1E A;  5I5W A;  3E35 A;  2FKL A;  2KB1 A;  4ECS A;  1IBM H;  1D2D A;  2V5A A;  5L3F A;  2D3O W;  5IWA B;  1SET A;  4HNA A;  1AI4 A;  3KKY A;  5EK0 A;  2CNQ A;  3BFR A;  3GID A;  3U0G A;  1X9N A;  1PV0 A;  4DL2 A;  3GWK C;  5BMV B;  4DR7 H;  1VQ8 V;  4IWX A;  1GMG A;  3Q1K A;  1K1S A;  1I50 A;  5K3W A;  3L72 H;  4O2A B;  4F4L A;  1ZL8 A;  4F4X A;  4A3G G;  1JQ0 A;  3GTG A;  3JAT B;  4CKE A;  4FBT A;  2WA3 A;  1IBL B;  5K2M A;  5B1A C;  3OM3 B;  2AW9 A;  2R92 A;  2Q6A A;  1SQP H;  3A2F A;  1JCH A;  2IH1 C;  4OGQ B;  4B3S B;  4X66 B;  1CS0 A;  2C2R A;  3RB3 A;  2CH7 B;  4LF6 O;  3KRE A;  1MMM A;  4JI4 H;  4N21 A;  1YTF D;  3Q4H A;  2ZM6 B;  2HHH B;  4RWU A;  3JAM N;  4FFL A;  2XGP A;  5KKN B;  4UVC A;  4C5C A;  1N34 O;  3BAA A;  3ZHS A;  2UVR A;  4FFK A;  5GON B;  3AK1 A;  3ZX6 A;  3F5W C;  5KFW A;  2X0L A;  4FLZ A;  2JA6 G;  1VQO V;  4JV5 B;  2P22 C;  3JD3 A;  2W57 A;  4DYL A;  2WLN A;  3CEI A;  3OGC C;  5KMG A;  1KBH A;  2ZNI A;  2OIE A;  3PW2 A;  2PF4 E;  4IGG A;  4I50 B;  5LGT A;  2HLD G;  5IT9 W;  2CTW A;  4W4K A;  1JR9 A;  4WHX A;  4L8J A;  3N6X A;  4LF8 B;  2ZDQ A;  3ZBH A;  4BIO A;  4U7C A;  4O3Q A;  2XOK G;  2F43 G;  5CB4 A;  4ECZ A;  4LF6 H;  2B63 G;  1CKM A;  5EZY B;  2J6T A;  2BTQ B;  4IRK A;  5C4X G;  3BCC H;  3HOY G;  1NI8 A;  3N44 B;  3V6K A;  1WPB A;  1N34 H;  3DGE A;  4ZOL B;  2YU9 A;  1AN7 A;  2Y0S E;  4GKJ B;  5DN6 G;  1EUD B;  2HGX A;  4LF9 O;  3PZP A;  1RP3 B;  1SQX H;  2XCL A;  4DK0 A;  1DV2 A;  3OUF A;  2ITD C;  4XX0 B;  1YEW A;  4X1I B;  2EIM B;  2R8J A;  3PFF A;  1K3E A;  5LHI A;  2IMW P;  3DAA A;  3ICX A;  3RAX A;  5LL6 Y;  1XMO B;  5FNV B;  3WFV A;  4TQD A;  3QO7 A;  2DMX A;  5LXT B;  5C1P A;  5KG7 A;  3RBZ A;  5LL6 b;  1Y1V A;  1O9H A;  1IBL H;  3JZF A;  5JH7 B;  3T9D A;  4UCV A;  5KFP A;  4O4J B;  4LBE C;  3OD4 A;  4DV7 O;  1AR1 B;  4TQR A;  2ASJ A;  1R3K C;  2AGP A;  3T1Y B;  2K9P A;  5BWT A;  2VQF B;  1DIK A;  2Z04 A;  3APQ A;  5KT6 A;  1A48 A;  2HHH H;  2LFS A;  1DLB A;  2ITC C;  2EX3 A;  2EIM C;  2PGG A;  2UXN A;  1EUC B;  3W7T A;  1WRV A;  4DV2 B;  4LF9 H;  4O7N A;  4RB1 A;  1XK5 A;  1DF5 A;  2IJI A;  2XAH A;  2R8G A;  2YIB D;  5H5N A;  4F4W A;  4CS4 A;  5BZB A;  4BW5 A;  4KFM A;  1Y67 A;  3RGB A;  2W9C A;  1OBD A;  2N74 A;  4NZM A;  2NR5 A;  2GHY A;  4YHH B;  4TT3 G;  5JJN B;  3FYE B;  4JV1 A;  4JAS A;  3PW4 A;  1X59 A;  1K5Q A;  2ZXW B;  2XC9 A;  1FJG B;  3V6J A;  2YIA A;  1G6U A;  2YYA A;  1FXH A;  4DV7 H;  4X1Y B;  4J7Z A;  2QYZ A;  3VQW A;  3RYF A;  3IC9 A;  3WB0 A;  4KP4 A;  3W5O A;  5DLF A;  4RAI A;  2Q7H A;  3H1L H;  1CKN B;  4BXX G;  5KG6 A;  3T1C A;  3U55 A;  2A1H A;  2JEI A;  4UVB A;  1WP8 A;  2WB1 E;  1KTA A;  1SQV H;  2UXB B;  2XND G;  3VQY A;  3GIK A;  5EBW C;  3SGI A;  1G8M A;  1THZ A;  3DTU B;  1M90 W;  1S03 G;  3K0G A;  5IT9 N;  1BGY H;  2ZXW C;  3I5D A;  3RB4 A;  4IRC A;  1RM1 B;  4YAJ B;  5KFM A;  3IFX A;  2YIC A;  5CA0 A;  3KAJ A;  1GYF A;  5GTI Z;  2IBZ H;  2R8I A;  3DC5 A;  4ZI7 B;  4EG0 A;  3FKI G;  2WLI A;  5IY5 B;  5BYB A;  1E4E B;  4O4L A;  1BJT A;  2P4K A;  3CRA A;  4UCS A;  4TVI A;  3L71 H;  3T9A A;  3GIL A;  4XDK A;  5D5P A;  2VQF H;  3FB5 C;  4YQW A;  1RYR A;  3E22 B;  3FB6 C;  3BY6 A;  1B04 A;  3OR7 C;  4XBF A;  1KC8 W;  1CP9 A;  2UXB O;  3TET A;  5BR8 O;  3K9A A;  3GDE A;  4JI0 B;  1XRE A;  3N43 B;  4IR9 A;  1VIB A;  2YZL A;  2OYQ A;  1COW G;  3M99 B;  2FLP A;  5E1A C;  3ZRX A;  3NUA A;  3PN1 A;  4O4I F;  4FLY A;  4Z1M G;  3EFF K;  1L8D A;  1S5J A;  5B3S B;  5J2U F;  1W93 A;  4YHH H;  1TA8 A;  1PKX A;  2VA2 A;  2L35 A;  3K03 A;  4QPK A;  4B08 A;  2R93 G;  2A9H A;  4M9U A;  1H2G A;  1N0N A;  2ZE7 A;  2ZDI C;  2IH3 C;  2OWO A;  5KHK A;  4LFA B;  3ABM B;  3AG1 B;  5KG5 A;  2W7O A;  3P3P A;  3M8A A;  3RVY A;  5KFR A;  4IIJ B;  1Y6X A;  1VBH A;  3QFF A;  3ASN B;  2M6Y A;  2VPQ A;  3UO2 A;  2UXB H;  3LSU A;  5BR8 H;  4FFM A;  3CD6 V;  2E2I A;  2R82 A;  5B3S C;  4BBR G;  1KC7 A;  3LWB A;  3Q8P B;  1VQ4 V;  3OTO B;  1XIL A;  3R9R A;  1Y76 B;  2RQ6 A;  4JI0 O;  1FFX A;  3RJ0 A;  3PW0 A;  3VQX A;  3WO0 A;  2QKS A;  4PDV A;  5KFH A;  4TUY A;  3NGD A;  4MVQ A;  1MZB A;  3AG1 C;  3SJB C;  4KHP O;  4CKB A;  4MVR A;  4DV1 B;  2PMZ A;  4FM1 A;  3GTJ A;  2ZR2 A;  1YF2 A;  2X6C A;  1V51 A;  4DR4 O;  1LR1 A;  4O7L A;  3EYY A;  3FB7 C;  3SI8 A;  3CC7 V;  2P0A A;  5EIB D;  5CA1 A;  3SYA A;  2YRX A;  3RR5 A;  2ATK C;  4YR0 A;  4O4H B;  3JD2 A;  1O75 A;  2DYS B;  1K92 A;  3OTF A;  3RTX A;  1U96 A;  3AK3 A;  4GX2 A;  4GUN A;  3ETG A;  3GIM A;  3JAW B;  4LC1 A;  3MHS C;  1Z2N X;  1TVK B;  4UV8 A;  2R7L A;  1A0I A;  4JI0 H;  2LQT A;  4JYA O;  3BAB A;  1V55 B;  3CRC A;  4DRX A;  5KUK A;  1FPO A;  5LA6 B;  4A3F G;  4KHP H;  1ZAU A;  5CN0 A;  1GSA A;  1EM1 A;  4DR4 H;  2Q73 A;  4J7K A;  4JAA A;  1AI5 A;  4IHJ F;  5I5T A;  1C30 A;  3TJT A;  4BIZ A;  2DYS C;  4IHJ A;  2UUB O;  1IOW A;  4UCR A;  3U9T A;  4WBN B;  4Q8E A;  1N33 O;  1S76 D;  2A7W A;  3CCE V;  1K5S A;  4GC6 A;  2DLN A;  2AQ4 A;  4QW9 A;  3H20 A;  4JI7 O;  1EHI A;  4JI5 B;  3R5X A;  1F4M A;  4YJ3 B;  4F6R A;  3QF7 A;  4GZR B;  2Q9L A;  3RFR A;  3K57 A;  1S68 A;  5L1I A;  1Q90 D;  4U3F H;  4JYA H;  2YEV B;  2LFR A;  4LH7 A;  2Y0P A;  2W6M A;  1I08 A;  4HR7 A;  3QZ7 A;  4WFF A;  2DE0 X;  4DXW A;  2BR0 A;  1Q3E A;  1AI6 A;  2XT9 A;  4GX5 A;  4MV6 A;  3J7A U;  4MVM A;  3LQS A;  3ZHT A;  4RQF A;  2Q4P A;  2WLK A;  5L9X A;  1M0T A;  3LP8 A;  4O82 A;  4PA9 A;  4DV1 H;  4X20 B;  1BHB A;  2EBO A;  3GV8 B;  4UB8 Z;  2UUB H;  4GT1 A;  1S97 A;  5J2T F;  1N33 H;  3L2P A;  1OHH G;  3ZRS A;  4MTG A;  3RGX A;  5LMN O;  2OCC B;  5I5V A;  1BS3 A;  4J80 A;  4R6Z A;  5EWG A;  3OHB A;  4JI7 H;  1PX2 A;  1VMG A;  3G6E V;  4DO2 A;  2FB9 A;  2FB5 A;  4JGS A;  2L6L A;  3ASO C;  2KG7 B;  5ITZ A;  5FPR A;  4GKK O;  4NKG B;  4DR1 B;  2Y69 B;  4EGJ A;  1JOY A;  2LW1 A;  2YL2 A;  2DYR C;  4CS2 A;  1I94 B;  5JQG F;  5CBG A;  3FKI A;  3FYI B;  4RUE A;  2F4V B;  3M9M B;  1XUQ A;  5JQG A;  3MD0 A;  1B6S A;  5L1J A;  3KTM A;  2HFE C;  5DED A;  4IWY A;  1GAX A;  2IU0 A;  5J9P C;  1OV9 A;  5KAF Z;  3K5H A;  2OCC C;  2LP7 A;  4MAM A;  3TII A;  5KX5 F;  2ALZ A;  3T7A A;  3NXS A;  2DAB A;  1L0L H;  4ZBM A;  3ZRW A;  3CPW U;  5DMX A;  3CME V;  5LMN H;  4ECV A;  1H8H G;  3DSQ A;  3TK1 A;  3KHH A;  2R8H A;  2GQS A;  2E5L B;  1CQI B;  4BY1 G;  3CHX A;  5A2Q N;  3GII A;  2EIL B;  2QM7 A;  3UZB A;  4HNU A;  2ZDG A;  1ZX3 A;  2Q5Z A;  4KL1 A;  3T1H O;  3F5T A;  4I7H A;  3RF2 A;  2EJ7 A;  4UCO A;  1M1K W;  2QR4 A;  5H6Q A;  1ZHQ A;  4GKK H;  4HZ3 A;  2W7P A;  2LGW A;  4MSW C;  4DV0 O;  2VRZ A;  1EN4 A;  3EXA A;  2VQE O;  4QWE A;  1XQ8 A;  4DR1 O;  3STL C;  1HNW O;  5LOV B;  5KFX A;  3K3W A;  3EHB B;  3T9C A;  3VNN A;  2RDI A;  2EIL C;  1GH6 A;  4MVS A;  1KJ8 A;  4YIO A;  2FML A;  3VPC A;  4QSH A;  3L74 H;  5JUM A;  1YVW A;  1S72 V;  4HNA B;  2EIJ B;  2XTA A;  2YXY A;  2P06 A;  1SER A;  2WAQ E;  4K0K O;  1ZUQ A;  4C7U A;  3HOU G;  2E5L O;  1UC9 A;  3T1H H;  4J9L A;  2W70 A;  2ZIO A;  2E76 B;  1ZL8 B;  3TGU H;  1ZLZ A;  1MA1 A;  4PDR A;  4PDM A;  5HV6 A;  4ED6 A;  3LNN A;  2EJ3 A;  4J11 A;  3E89 A;  4MW8 A;  4MTE A;  1W59 A;  3U9S A;  2VUG A;  1HR0 B;  5I47 A;  3AK2 A;  2VQE H;  3RYH A;  4DR1 H;  1CPY A;  4MV9 A;  4F50 A;  1HNW H;  3VBB A;  1S0O A;  2ZIN A;  3RYI A;  3TEK A;  4O7T A;  4J9N A;  2EIJ C;  2PUS A;  4BBS G;  3K5I A;  2JEJ A;  1AR4 A;  5IP9 G;  2JEU A;  3K0D A;  4JI1 B;  2FLL A;  1KP2 A;  3HPL C;  2WLH A;  4RNN A;  4DR2 O;  4DV3 O;  2YI8 A;  4RO2 A;  2X6B A;  4BAY A;  5L3C A;  4K0K H;  4JI8 B;  5IYZ F;  1IVS A;  3HBL A;  2IJJ A;  2OLS A;  2E5L H;  1OCZ B;  2EIN C;  4A2A A;  4AHC A;  1VQ6 V;  3ETD A;  1FXK B;  3J81 N;  4A3B G;  2EIY A;  1QVG U;  4NXM B;  2C35 B;  3CCV V;  4P30 A;  4AI8 A;  4K6N A;  2NVY A;  2O03 A;  2O57 A;  1R6N A;  4FK5 C;  5K1X A;  1VAJ A;  4WFE A;  4UXN A;  1EYZ A;  1PNL A;  3C3S A;  4DR5 B;  2A0L A;  4C2M A;  1VQ5 V;  3FDS A;  4B7E A;  5BWX A;  3E83 A;  2C2D A;  4NR1 A;  2I87 A;  1WJZ A;  2E3C A;  4I0X B;  4K35 A;  3W1B A;  2Q67 A;  1F23 A;  3D3I A;  3T9B A;  2QA4 V;  1GM9 A;  4L87 A;  2GUZ A;  5KHH A;  4ED0 A;  1C3O A;  1OCZ C;  4DR2 H;  4DV3 H;  3OT7 A;  1N0J A;  1B33 N;  1V4Y A;  2YXL A;  2GV9 A;  4O3S A;  3I4N G;  2HGS A;  5F2V O;  4JYC A;  3W7W A;  1QU7 A;  1PL0 A;  4EFE A;  4ECT A;  3MR5 A;  3FB8 C;  2RF4 A;  3SNO A;  3KCY A;  3RV4 A;  4FFN A;  2OTL V;  1SQG A;  3B40 A;  4FJC C;  5KT7 A;  1RYS A;  3K06 A;  3Q8S B;  5FR9 A;  3JAM W;  3K58 A;  1XNR O;  2FJZ A;  3A0R A;  4O7Y A;  4RB0 A;  1PK8 A;  2Y0I A;  3UT5 A;  2IBK A;  1I7F A;  4FS2 A;  3UYY A;  3SPG A;  1M5I A;  3CWB H;  4O3P A;  4ECR A;  1EKP A;  4MT8 A;  2OTJ V;  4DQN A;  1S77 D;  3KAK A;  4WD3 A;  2QSA A;  1Y4M A;  5DM6 V;  2UUA O;  1YJ9 V;  4MTF A;  2HG5 C;  4Y8V B;  1AP5 A;  1VQ7 V;  4R8C A;  3FD9 A;  3UQ8 A;  1NQT A;  1P4R A;  1SF9 A;  4OPA A;  4JI3 B;  5KFE A;  2YC0 A;  1XMQ B;  4APM A;  2Q0O C;  4O7S A;  1JMK C;  2JIZ G;  4LH6 A;  2OCH A;  5L3D A;  4FPP A;  1ENV A;  1NH2 D;  1XNR H;  3MFH A;  4CKC A;  1QHT A;  4DUZ O;  4QE9 A;  2W6P A;  1MG1 A;  3V4Z A;  5LHG A;  5EWF A;  2WAM A;  5I60 A;  1AUV A;  4QW8 A;  4RUC A;  1UJW B;  4LF5 B;  1SQQ H;  4PA6 A;  5HNE A;  2OIG A;  2W9B A;  3RYC B;  4EBD A;  1R3L C;  2UUA H;  1G2W A;  3JAL A;  4I4T F;  2QWP B;  4I4T A;  4RAY A;  2R9R B;  2ZE6 A;  1XHZ A;  3CSX A;  5JQW A;  4J7J A;  3WG7 C;  1CEZ A;  2VQD A;  3O65 A;  5KT4 A;  3KYH C;  1M7J A;  4DV6 B;  3ABL B;  4Z1V A;  1GLV A;  5KFA A;  2QDO A;  4DUZ H;  4JI2 B;  4U7N A;  5KFO A;  1Z2P X;  1SYX B;  5LYJ A;  1A9X A;  3HB9 A;  4QWC A;  4U6P A;  5HBR B;  3CRR A;  2DQ0 A;  2R70 A;  4HBN A;  5L1K A;  2A3Q A;  5KG1 A;  1N4C A;  3QG5 A;  4WCE V;  5B1O A;  3WO1 A;  4LF7 O;  4BWA A;  3ABK B;  3MR3 A;  4ED7 A;  3PR5 B;  5EDW A;  1XNQ B;  4LNU B;  3LDD A;  3CSW A;  3ABL C;  4J9Q A;  4A5U B;  4X62 B;  4ASU G;  1OJH A;  2I8C A;  3EVK A;  2P7T C;  5JCO A;  5C93 A;  4O4I B;  4WFG A;  3RVZ A;  2HHF A;  3R65 A;  4D7T A;  2Z3Y A;  5J2U B;  5IWA O;  2BSK A;  3SJA C;  1XBL A;  3CEB A;  4IYH A;  2YUA A;  5BWV A;  2N04 A;  3ABK C;  3RIZ A;  3K04 A;  2HJD A;  2RGV A;  1BSM A;  2QEX V;  4RB2 C;  5AG2 A;  5IYC G;  1WNS A;  4X1K A;  2Q7D A;  4LF7 H;  2F95 B;  3N2K A;  4TQF A;  1IBL O;  3K79 A;  1T36 A;  5CB4 F;  4YP3 A;  5FPO A;  2NUA B;  2NU6 B;  4CMF A;  3I55 V;  3K5L A;  4DUY B;  4QWD A;  1GRJ A;  2ZIM A;  4B3S O;  4X66 O;  1XNQ O;  4YAK B;  1VS0 A;  2QM4 A;  3ETQ A;  4J9R A;  4F4Z A;  2VWK A;  5KG0 A;  4QWA A;  3FKS G;  3H1I H;  2ZM6 O;  4I7Z B;  2HHH O;  3U54 A;  3RGZ A;  4EYI B;  1V54 C;  2B9Z A;  3ZMT A;  1GO3 F;  2BOC C;  1EKV A;  3G8D A;  3JZI A;  3BA9 A;  5IWA H;  4NXN B;  4JI2 H;  5KFJ A;  1KJQ A;  2NU9 B;  3WWI A;  2QTS A;  4PDL A;  1DK1 A;  1H2L A;  4PJ0 Z;  3GVM A;  3NR7 A;  4RZR A;  2YI9 A;  4JV5 O;  1Y1W A;  4JF3 A;  2F93 B;  3STZ C;  1SS3 A;  3T4D A;  5JVD F;  4O3N A;  5IYC O;  2GDS A;  1WPX A;  1NVP D;  5JVD A;  4FFB B;  1MNG A;  4U3J A;  1L0N H;  1RPR A;  1QLE C;  1S0M A;  4FLU A;  3FAV B;  1G4Y B;  2ODT X;  4LF8 O;  2FYU H;  4O7Z A;  4B3S H;  1LUV A;  3MWD A;  3W7X A;  4AYB E;  4X66 H;  1XNQ H;  5H80 A;  1UPG A;  2R7K A;  4JI6 B;  1WLE A;  3HKE A;  4FLW A;  1OCR C;  1RK6 A;  4X62 H;  2ZM6 H;  3JSL A;  3CRQ A;  1AUX A;  4B3M B;  2WLJ A;  3JAK A;  2ILM A;  3T5H A;  3Q8R B;  1BCC H;  2NU7 B;  1G1X B;  4PA7 A;  4CH3 A;  4GKJ O;  2ZT9 B;  1LUW A;  3D3Q A;  1KMI Z;  4JV5 H;  4ECW A;  4IHJ B;  3L75 H;  3MDS A;  4JAU A;  1VBG A;  3GTP A;  4F6E A;  4RAZ A;  1Y66 A;  2JVD A;  1I7N A;  5BXZ A;  2DWD C;  5FJ8 G;  1XMO O;  5EYP A;  1IUR A;  1Q82 W;  4JUZ A;  1US6 A;  1N32 B;  4LF8 H;  2VUM G;  2EUL A;  3SPH A;  5KHG A;  2JDI G;  1WH2 A;  3TXS A;  1OBG A;  2UVW A;  4DUY H;  3ZN1 A;  3N41 B;  4DR6 B;  4YJ2 A;  3T1Y O;  5D1P A;  3VQV A;  4TQS A;  2VQF O;  5EC2 C;  4LP8 A;  4FLX A;  3SPI A;  4O86 A;  3SPC A;  3TIG A;  2W9A A;  3SYP A;  4A3I G;  1RSO B;  4M0J A;  1GGO A;  2AGQ A;  4PDB A;  4DR3 B;  4GKJ H;  1I5X A;  3C0F B;  2F23 A;  4DV2 O;  4J9P A;  3IJ4 A;  5D1O A;  4CHI A;  3GQC A;  3GWO A;  2BE3 A;  1I1K A;  1VQN V;  5CA0 F;  1QVF U;  2V59 A;  3G6X A;  1T3N A;  4PI0 A;  2Q2T A;  2PZS A;  3DTG A;  3S3W A;  5J2T B;  1XMO H;  3L73 H;  4O4L F;  4YHH O;  4EB6 A;  1DV1 A;  4YR3 A;  4WF9 V;  1N36 B;  4RZQ A;  1FJG O;  4CS3 A;  2BTO A;  2NLJ C;  4ABM A;  2UVU A;  3JCU Z;  2YSU B;  1OWT A;  2WLL A;  3DXR A;  3P30 A;  4JTC B;  5ITZ B;  3T1Y H;  2CNU A;  1S3J A;  1M56 B;  5LP6 F;  5CMU A;  2XIG A;  4FZ0 A;  5LP6 A;  4RQE A;  4YY3 B;  1YXB A;  2FL4 A;  5JQG B;  4EYH B;  4DV2 H;  5H9C A;  2RNB A;  1WCM G;  3P32 A;  1KKD A;  4DR3 O;  2I80 A;  4O83 A;  4EKW A;  3I4M G;  1P16 A;  4PZ6 A;  2VOB A;  4O2A A;  4ECY A;  3M4I A;  3AEI A;  4K3A A;  1S9F A;  3ZRW B;  5KX5 B;  3OW2 U;  2W6I G;  2XCP A;  1HNZ B;  3CJH A;  5GTH Z;  1TWF A;  3GTQ A;  2RN9 A;  1JFF B;  2R84 A;  1JVM A;  3Q8Q B;  3AYH B;  4DL3 A;  1FJG H;  1SFO A;  2QWR B;  1M56 C;  3HOW G;  3JAR A;  1NZ6 A;  1KUT A;  3OR6 C;  3CCS V;  3J80 N;  5KHI A;  4ZKI A;  1GKF A;  1SZT A;  1R6T A;  4NYK A;  4BWS C;  2DPJ A;  2Q69 A;  3AG2 C;  2JA6 A;  1WR2 A;  5IDJ A;  4PHZ A;  2CGO A;  1NTK H;  4YB8 B;  5KS8 A;  4DR3 H;  1YIJ V;  1HW7 A;  2GBO A;  3WB2 A;  2CTP A;  4I50 A;  4TUY F;  4QGP A;  1M93 A;  3W7S A;  1M57 B;  1CE8 A;  4A3E G;  4DW0 A;  4A3D G;  2WYO A;  3OSN A;  2B63 A;  4MVO A;  1Q43 A;  2LW7 A;  5EWE A;  5DGI A;  4RNO A;  3K08 A;  2YS6 A;  3PW5 A;  3E8F A;  5CA1 F;  3SJQ C;  4Q45 A;  4A3L G;  2W0F C;  3EPG A;  3OUS A;  4LFC B;  4LFA O;  2GPS A;  4HAM A;  2QJ1 A;  1IYD A;  4IYI A;  3CB2 A;  1AB3 A;  3H4B A;  3HKZ A;  3DC6 A;  4MVZ A;  1PPJ H;  1W2B U;  4ZOL A;  3X2Q C;  3GV5 B;  4YY3 H;  3RYI B;  4EQ5 A;  5A2Q W;  3TY5 A;  4R50 A;  1M57 C;  4JZ2 A;  4X1I A;  1KJ9 A;  2PMZ E;  1H2S B;  2Z02 A;  4JYB A;  3BG5 A;  4OXS A;  3G71 V;  2JEG A;  5KFU A;  4RU9 A;  3OTO O;  4DV4 B;  1I7L A;  5FNV A;  1SC5 B;  2AGO A;  1GSO A;  5IJ9 B;  5LXT A;  3VPB A;  1SCU B;  4X9Q A;  2HVK C;  2OT5 A;  1ULZ A;  2XCA A;  4O4J A;  5IYZ B;  4PA3 A;  4X65 B;  4UV9 A;  4DV1 O;  1EN5 A;  3TW6 A;  3BQ2 A;  2RDJ A;  2CTQ A;  4E6N A;  1ZTE A;  4LFA H;  3HXL A;  3B8M A;  4YR2 A;  1BXR A;  3HT5 A;  3K5M A;  4LFC O;  4O3O A;  3H1K H;  3UCS C;  3OMI B;  3RW0 A;  3BQ0 A;  3ZED A;  3HKC B;  1KP3 A;  5B1B C;  4GX1 A;  3V6H A;  3OE7 G;  1SA0 B;  3H4D A;  1TUB B;  3W1G A;  1FYJ A;  3OTO H;  1M4U A;  4E4T A;  1LNQ A;  2IW5 A;  2RCV A;  5KA6 A;  2ADQ B;  3ASO B;  3JD4 A;  4AQY B;  3HKB B;  2XAS A;  2Q7E A;  5KG3 A;  2YID A;  2AGA A;  3N2G A;  1EKF A;  5IE9 A;  2DYR B;  4X1Y A;  1KJJ A;  5KHJ A;  5D8D A;  1Q7Y W;  3RAQ A;  5C5J A;  4MA0 A;  3H3V H;  2HIV A;  2EIK C;  2XGQ A;  4LFC H;  2GQR A;  2DJV A;  3UT5 B;  2PI4 A;  4MVU A;  2WLM A;  4EBC A;  5B66 Z;  1S5L Z;  2QWO B;  4RUF A;  3SPJ A;  2HG8 A;  2YRW A;  4PZ8 A;  1XDC A;  4JI5 O;  1V9P A;  3JYC A;  2CW8 A;  1FAF A;  3PJS K;  2WE6 A;  3GIP A;  3J81 W;  5KFL A;  3G6Y A;  2Q7G A;  4MV3 A;  3ZMS A;  1IDS A;  2A06 H;  4FS1 A;  2W6J G;  1EBO A;  2ZD9 A;  4UUJ C;  4QJF B;  1S0V A;  1YCI A;  1R3I C;  2COG A;  1KB9 F;  3AG4 B;  2EJ0 A;  3KCX A;  2X5R A;  5CR5 A;  2ZE8 A;  1B06 A;  5BPH A;  3GLK A;  1WN7 A;  3CVZ A;  3JAS A;  2VA3 A;  2CAZ C;  2FK3 A;  3PR4 A;  1KQS U;  3B77 A;  1JLL B;  3A0H Z;  3GIJ A;  2KKW A;  2XAG A;  2ZE5 A;  2C2E A;  3H0G G;  2R8K A;  4CH5 A;  2Q68 A;  4RUA A;  2AZ0 A;  5KLV H;  5KFS A;  3OGI B;  3RFC A;  2FTK A;  4X8A A;  4I55 F;  4Q43 A;  1HP8 A;  5DQG A;  3JZ6 A;  1NTZ H;  1WCM A;  4I55 A;  3QQM A;  5C1O A;  2JGD A;  2Q2U A;  2JA5 G;  1AJP A;  3Q2O A;  4JI5 H;  2HKO A;  2R9I A;  1K83 A;  2QWN B;  1EN6 A;  4BIU A;  1R3J C;  4H44 B;  3AG4 C;  3DTF A;  1R6K A;  5BY1 A;  3GIQ A;  4JTD B;  3JAL B;  2R93 A;  4FGR A;  4I4T B;  2WTF A;  1I94 O;  3J7A K;  4B7K A;  3N6R A;  4AQY H;  1ZSP A;  2F4V O;  2Y4U A;  2IJK A;  2Y48 A;  4LFB B;  4MV8 A;  3IGA C;  5TIS Z;  4A2B A;  4M7E A;  3KHL A;  3MAQ A;  2C28 A;  4FBU A;  2DZD A;  4O7R A;  4ZIB A;  4D6T H;  4FFR A;  3K5N A;  2UXD B;  2GSM B;  2VWJ A;  2AHY A;  1I6U A;  2ABJ A;  1SQF A;  1QCE A;  2ETN A;  5DGH A;  5LGU A;  3PO2 G;  3CC2 V;  3OMN B;  4A3K G;  4GC7 A;  5CE8 A;  2EIN B;  3UKM A;  2W6Q A;  1A32 A;  5C8Y F;  1BT8 A;  2IJH A;  3T4Z A;  4PWQ A;  1D5A A;  5C8Y A;  2CNV A;  3ZCC A;  1I94 H;  5FLX N;  5DG7 A;  5EIB C;  3K3P A;  2Y4R A;  2F4V H;  1ORQ C;  4OX9 B;  2W8K A;  3SE7 A;  1HDJ A;  3ETE A;  5IYB G;  3Q4H B;  3K59 A;  5CAE B;  4FM9 A;  1BQZ A;  4LWS A;  2UU9 B;  4LFB O;  1I0H A;  1JJ2 U;  3OUZ A;  2XAF A;  1T5E A;  4BW9 A;  1L2Z A;  4ZQI A;  3QO8 A;  2UXC B;  3TIN A;  4O4H A;  2BSK B;  4RCN A;  5JJJ B;  3ZHQ A;  1AP6 A;  1W0K G;  3GJX B;  2HR3 A;  5KFC A;  1EZV H;  1ZHS A;  3TXQ A;  5KMG B;  2VR1 A;  1TVK A;  4YIP A;  4LF4 B;  3MHH C;  5DQH A;  1XI1 A;  1R1B A;  1J5E B;  3HKD A;  1AI7 A;  5LMU B;  2KSW A;  1I1L A;  5DGA A;  3G80 A;  4XYL B;  3JRX A;  5I5X A;  3BHP A;  3I56 V;  1HR0 O;  1H38 A;  5KA5 A;  1K7D A;  3H40 A;  4X64 B;  5JCO C;  2EJR A;  5CB4 B;  4WFB V;  3ZHV A;  4O81 A;  1H8E G;  3GB7 C;  2J6S A;  5KFD A;  5IYB O;  1MOF A;  3IG0 A;  1FKA O;  4C5A A;  4LFB H;  3LDE A;  1YZB A;  4TWK A;  2PVP A;  2FE3 A;  2BQ3 A;  3CXH F;  4KXR A;  4PV1 B;  4Q4C A;  4XDL A;  4WBN A;  5KFT A;  4JI1 O;  4NTW A;  2UUC B;  3WWJ A;  4JXU A;  5KFZ A;  1IBK B;  1I3Q A;  2GLT A;  1PM9 A;  3TQ1 A;  2ZJT A;  4JI8 O;  3KHR A;  1Q6H A;  4YJ3 A;  1SRY A;  1RJR A;  1BL8 A;  2G38 A;  4MV4 A;  3MWE A;  4DRF A;  5C3E G;  1K4D C;  4B3R B;  3R5F A;  2BQU A;  3CX5 F;  1VF7 A;  2JRI A;  2YEV A;  4I9W A;  4DIM A;  5JVD B;  1DAA A;  1XL4 A;  4U3J B;  1EFR G;  1K9M W;  4TV8 F;  4NXM O;  4ECQ A;  1HR0 H;  1Q81 W;  4TV8 A;  5I5S A;  1VEW A;  1ZQ7 A;  4PI2 A;  1FD9 A;  2V7Q G;  1Y1V G;  3R5H A;  4DV5 B;  3G6V A;  4DR5 O;  4YBZ B;  3ZMU A;  4DL7 A;  4CE5 A;  2P5O A;  4B3T B;  1FKA H;  4D7S A;  1JXL A;  2Z5U A;  3SYQ A;  1X4T A;  5C44 G;  1IBM B;  4QIW E;  4LCU C;  1L1F A;  1JDB B;  4RNM A;  3APO A;  1K73 W;  4JI1 H;  3JCZ A;  1M9N A;  2YW2 A;  2DIK A;  1JKJ B;  3E2E A;  2YCH A;  2W6N A;  4LSA A;  3H9V A;  2YWV A;  1Y74 A;  4DR7 B;  1Z5W A;  3MFI A;  4JI8 H;  2YZM A;  2PY5 A;  3AG7 A;  2IA6 A;  5EOY A;  4J9S A;  2LJ2 A;  2W9C B;  3HOZ G;  4IRD A;  1E1R G;  5DG9 A;  2ZR3 A;  4CC5 A;  3CCU V;  3KXY T;  1R9T A;  1KUQ A;  2J6U A;  2XAJ A;  4NXM H;  5KFQ A;  1VKZ A;  3WG7 B;  2M05 A;  2R7N A;  5EYP B;  3UO3 A;  1HNX B;  3OHA A;  5LMU H;  3N8D A;  4IT5 A;  5I5Y A;  3OMA B;  2QWQ B;  2HVQ A;  4DR5 H;  3RYF B;  4KUM A;  3GB8 B;  1E79 G;  3E8B A;  4R8U A;  1VF6 A;  4ED3 A;  2FPP B;  1QBZ A;  4FLT A;  5DIS C;  5KAI Z;  4CMD A;  2CTR A;  2HIX A;  5KT3 A;  3CCL V;  3LSQ A;  5IJ0 A;  4O84 A;  4TSF G;  2V1D A;  1N8R W;  3WU2 Z;  4FM0 A;  3G8C A;  4Q6G A;  2ARH A;  3TW7 A;  4HNT A;  5KUM A;  3CMA V;  2JEX A;  2ATL A;  4IZO A;  3FMA A;  1KBL A;  1VAR A;  4JI3 O;  2QB5 A;  5KFG A;  2QK4 A;  4J41 A;  1XMQ O;  1S5H C;  4G27 B;  3WNZ A;  4XDJ A;  1UFI A;  2A79 B;  5K1P A;  2PYL A;  1B6R A;  1F7Y A;  5CA0 B;  4A3M G; 
#chains in the Genus database with same CATH homology
 4DRX A;  5KHG A;  1WH2 A;  3JSN A;  4DUY H;  5LA6 B;  4EB6 B;  3N41 B;  4DR6 B;  4KHP H;  4O4L B;  1ZAU A;  4GLX A;  4YJ2 A;  2VPS A;  4LF6 B;  5D1P A;  4FM2 A;  3VQV A;  4DR4 H;  5LOV A;  4FLX A;  4DV0 H;  3DF7 A;  2PYJ A;  4IHJ A;  1M0W A;  2HVR A;  3B2E E;  4DR3 B;  4UCR A;  4PDB A;  4GKJ H;  1SKV A;  3C0F B;  4WBN B;  2YIB A;  1N34 B;  3JAW A;  5D1O A;  5LP6 B;  3BA8 A;  4PI0 A;  2Q2T A;  2PZS A;  3H20 A;  4X1K B;  4JI5 B;  4YJ3 B;  4F6R A;  3QF7 A;  3N2K B;  5J2T B;  3RFR A;  4JI3 H;  1XMO H;  1XMQ H;  3K57 A;  1S68 A;  5LA6 A;  4EB6 A;  4JYA H;  5IJ9 A;  2F1M A;  5FD6 A;  4LH7 A;  1N36 B;  3WB1 A;  4RZQ A;  4CS3 A;  2WDT A;  2BTO A;  5IYZ A;  1Q3E A;  3T1Y H;  5ITZ B;  1XNR B;  1HNX H;  3JAR B;  4I9Q A;  1M0T A;  2XIG A;  4DV1 H;  2R9A A;  1O9G A;  4X20 B;  5LP6 C;  5LP6 A;  2UUB H;  4LF5 H;  4YY3 B;  5JQG B;  2UXD H;  2IM9 A;  5JJE B;  4DV2 H;  3K5O A;  1N33 H;  5D5Q A;  3HKC A;  3L2P A;  3RGX A;  4LF9 B;  1P16 A;  4ZHQ B;  4PZ6 A;  4O2A A;  1SA0 A;  2VOB A;  4JI7 H;  1TUB A;  4LR3 A;  3M4I A;  4TV9 B;  4DK1 A;  5KX5 B;  2UUA B;  1HNZ B;  4R7R A;  1JFF B;  4MTD A;  5ITZ A;  3HKB A;  4RB3 C;  1FJG H;  5FPR A;  1FFX B;  3JAR A;  4DR1 B;  4ETS A;  4OX9 H;  3L4J A;  4DV6 H;  2HVS A;  4X20 A;  4CS2 A;  1I94 B;  3S24 A;  4TUY B;  3HKE B;  1CKO A;  2F4V B;  4DV7 B;  5JQG A;  5KHI A;  1E4G T;  1KU9 A;  4DUZ B;  2UU9 H;  4BWS C;  3JAK B;  3NBZ B;  4K8Z A;  2UXC H;  2CW7 A;  4ZHQ A;  4PHZ A;  5CA1 B;  4MV7 A;  4TV9 A;  4DR3 H;  5LMN H;  3DSQ A;  1HW7 A;  1TGO A;  2E5L B;  3CHX A;  4LF4 H;  3WB2 A;  4Q0Y A;  2JS5 A;  4I50 A;  1J5E H;  1M93 A;  4KL1 A;  1BGW A;  4I7H A;  2WYO A;  3RF2 A;  4UCO A;  1ZHQ A;  3J80 W;  4GKK H;  1Q43 A;  4DRX B;  4JI4 B;  4X64 H;  3KAL A;  4EFB A;  3QWU A;  1JJO A;  4YJ2 B;  1XQ8 A;  4LFC B;  1XDN A;  2QJ1 A;  4EEQ A;  5LOV B;  3CB2 A;  4UCU A;  1P49 A;  3VNN A;  2JGU A;  4ZOL A;  2ZCE A;  2UUC H;  4YY3 H;  3RYI B;  1P8L A;  4EQ5 A;  5D1O B;  2PTM A;  5FD5 A;  3TY5 A;  5A2Q W;  1IBK H;  4FVM A;  4NVP A;  4HNA B;  3FFQ A;  2Q0A A;  4X1I A;  3BPZ A;  1H2S B;  4F6R B;  4B3R H;  4LF7 B;  4DV4 B;  3T1H H;  4UCT A;  5FNV A;  1Z2O X;  2ZIO A;  2RGR A;  5IJ9 B;  4O2B B;  5LXT A;  2V4D A;  3RWR D;  3IAY A;  3LNN A;  3NC0 B;  1QQC A;  2F66 C;  4MTE A;  4O4J A;  5IYZ B;  4X65 B;  3U0Z A;  1HR0 B;  2VUG A;  4DV5 H;  2VQE H;  3RYH A;  4DR1 H;  4E6N A;  4B3T H;  4FLV A;  3BRC A;  4LFA H;  3HXL A;  3N2G B;  4MV9 A;  1HNW H;  2XHB A;  1IBM H;  4NXN H;  2HEP A;  2ZIN A;  3RYI A;  5IWA B;  3K5M A;  3U10 A;  4HNA A;  2PUS A;  1X9N A;  3ZED A;  3HKC B;  4JI1 B;  5BMV B;  4DR7 H;  3RYC A;  3M7M X;  2YI8 A;  4O2A B;  1SA0 B;  4K0K H;  1TUB B;  4O2B A;  5BR8 B;  3W1G A;  4JI8 B;  3JAT B;  2E5L H;  4GYC B;  3OTO H;  1M4U A;  4A2A A;  1IBL B;  4AHC A;  2MCT A;  4AQY B;  3HKB B;  2Q7E A;  3A2F A;  3N2G A;  4JI6 H;  4NXM B;  4B3S B;  4X66 B;  2O03 A;  4X1Y A;  4JI4 H;  5K1X A;  5KHJ A;  4B3M H;  2ZM6 B;  4DR5 B;  2HHH B;  4CH4 A;  3JAS B;  2HIV A;  5BMV A;  4LFC H;  2E3C A;  3W1B A;  3UT5 B;  3BAA A;  3TY9 A;  5GON B;  4IAJ A;  3JAT A;  4FLZ A;  5KHH A;  4PZ8 A;  4JV5 B;  4DR2 H;  4DV3 H;  4PZ7 A;  2P22 C;  1XHX A;  1V9P A;  2W57 A;  1Q5O A;  2YXL A;  2GV9 A;  2CW8 A;  2RJZ A;  4I55 B;  5KMG A;  4CC6 A;  2ZNI A;  2HGS A;  3LML A;  3N40 P;  4I50 B;  2WE6 A;  3K3V A;  3J81 W;  1N32 H;  2Q7G A;  4EFE A;  5IT9 W;  4LNU A;  4L8J A;  3N6X A;  4LF8 B;  1SQG A;  1Z5V A;  4DR6 H;  1NT2 B;  1WN7 A;  4LF6 H;  5CB4 A;  3CVZ A;  3JAS A;  3JAM W;  3K58 A;  2CAZ C;  4O4I A;  1CKM A;  5EZY B;  4KHP B;  4RB0 A;  2ZNJ A;  3UT5 A;  4AIL C;  2BTQ B;  2R72 A;  1I7F A;  2KKW A;  1TAE A;  5GON A;  5J2U A;  4DR4 B;  1M5I A;  4CH5 A;  3N44 B;  1WPB A;  1N34 H;  4ZOL B;  1AN7 A;  4GKJ B;  4I55 A;  3ZS8 C;  2Q2U A;  3KAK A;  4DK0 A;  4JI5 H;  1E4F T;  1YEW A;  1DGS A;  4X1I B;  3ICX A;  3UQ8 A;  4JI3 B;  1XMO B;  5FNV B;  1N36 H;  1XMQ B;  4APM A;  4TQD A;  5LXT B;  3JAL B;  5LL6 b;  1O9H A;  5EZY A;  4JYA B;  1IBL H;  1JMK C;  5JH7 B;  4I4T B;  2BTQ A;  4LH6 A;  4UCV A;  3J7A K;  4O4J B;  4AQY H;  1XNR H;  3RYH B;  4LFB B;  1QHT A;  5C8Y B;  3T1Y B;  3MWM A;  4A2B A;  4M7E A;  2VQF B;  3MAQ A;  2HHH H;  4ZIB A;  4UFZ A;  2UUB B;  4LF5 B;  2EX3 A;  2PGG A;  3K5N A;  2UXD B;  2VWJ A;  4DV2 B;  1N33 B;  4LF9 H;  4RB1 A;  1I6U A;  1XK5 A;  3RYC B;  1SQF A;  2YIB D;  2UUA H;  4CS4 A;  1HNZ H;  3JAL A;  4FFB A;  4CH6 A;  4JI7 B;  3RGB A;  5JH7 A;  4I4T A;  4RAY A;  4YHH B;  5JJN B;  1XHZ A;  1D5A A;  3CSX A;  3THO A;  1FVI A;  5C8Y A;  1I94 H;  1FJG B;  2YIA A;  5EIB C;  1G6U A;  2F4V H;  4DV7 H;  4OX9 B;  4X1Y B;  3HKD B;  3KYH C;  3VQW A;  4DV6 B;  3RYF A;  4DUZ H;  3WB0 A;  4JI2 B;  4LMY A;  3W5O A;  3K59 A;  1Z2P X;  1SYX B;  5LYJ A;  4FM9 A;  2Q7H A;  1CKN B;  2UU9 B;  1T5E A;  4BW9 A;  1L2Z A;  2UXC B;  2UXB B;  4O4H A;  3VQY A;  2R70 A;  4HBN A;  3SR2 C;  3SGI A;  5JJJ B;  5LMN B;  3QG5 A;  3GJX B;  1S03 G;  4BWA A;  1ZHS A;  5KMG B;  4K8X A;  1TVK A;  4LF4 B;  1XNQ B;  4LNU B;  1XI1 A;  1J5E B;  5FLX W;  3HKD A;  5LMU B;  2CFM A;  2KSW A;  5CA0 A;  3KAJ A;  1GYF A;  4X62 B;  3BHP A;  4TOI A;  4GKK B;  3NBY B;  4X64 B;  4ZI7 B;  5JCO C;  1CKN A;  5JCO A;  1Q8I A;  4O4L A;  5CB4 B;  4O4I B;  1BJT A;  3IG0 A;  4TV8 B;  4D7T A;  4UCS A;  5J2U B;  4LFB H;  3SJA C;  2FE3 A;  1RSO A;  5D5P A;  2VQF H;  3U11 A;  3F8N A;  4WBN A;  3E22 B;  2UUC B;  3RIZ A;  2RGV A;  4RB2 C;  1B04 A;  1IBK B;  2ZJT A;  1WNS A;  4X1K A;  4J0M A;  4YJ3 A;  4LF7 H;  2F95 B;  3GDE A;  4DV4 H;  3N2K A;  4TQF A;  5J2T A;  4JI0 B;  3N43 B;  2OYQ A;  4DRF A;  5FPO A;  4B3R B;  4ZI7 A;  3PN1 A;  4FLY A;  1VF7 A;  3T1H B;  5JVD B;  3K5L A;  1L8D A;  3SJC C;  4U3J B;  1S5J A;  2ZIM A;  4DUY B;  3N42 B;  4X65 H;  1HR0 H;  4TV8 A;  4YHH H;  1TA8 A;  1VS0 A;  2QM4 A;  3ETQ A;  4PI2 A;  4LSX A;  2VWK A;  4B08 A;  4DV0 B;  4DV5 B;  3RGZ A;  2VQE B;  2OWO A;  4B3T B;  5KHK A;  2P5O A;  1FKA H;  4D7S A;  3E22 A;  4LFA B;  3BA9 A;  5IWA H;  1X4T A;  1HNW B;  1IBM B;  4NXN B;  4JI2 H;  4IIJ B;  4JI1 H;  2YI9 A;  2YCH A;  4LSA A;  2F93 B;  2UXB H;  4DR7 B;  1Z5W A;  5BR8 H;  4JI8 H;  2PY5 A;  5JVD A;  5IJ0 B;  5KX5 A;  4FFB B;  4U3J A;  5EOY A;  4K0K B;  4FLU A;  1JFF A;  3OTO B;  4CC5 A;  2RQ6 A;  3KXY T;  3TY8 A;  4NXM H;  1FFX A;  4B3S H;  4X66 H;  3RJ0 A;  1XNQ H;  3VQX A;  5LMU H;  5EYP B;  1HNX B;  4TUY A;  4JI6 B;  1MZB A;  3L4K A;  3SJB C;  3HKE A;  2HVQ A;  4DV1 B;  4FLW A;  1SEI A;  3RYF B;  4FM1 A;  3GB8 B;  4X62 H;  2ZM6 H;  3JSL A;  4DR5 H;  4IIJ A;  4B3M B;  5LYJ B;  4FLT A;  3EYY A;  3JAK A;  5DIS C;  3QTC A;  2HIX A;  5EIB D;  5CA1 A;  4CH3 A;  5IJ0 A;  3RR5 A;  1KMI Z;  4O4H B;  4JV5 H;  4FM0 A;  1O75 A;  4Q6G A;  4IHJ B;  3OTF A;  3RTX A;  4RAZ A;  4DR2 B;  4DV3 B;  2JVD A;  3JAW B;  3FMA A;  1Z2N X;  1TVK B;  5EYP A;  1A0I A;  5K1P A;  1N32 B;  2PYL A;  4JI0 H;  3BAB A;  4LF8 H;  5CA0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...