3BABA

Structural basis for the inhibition of bacterial nad+ dependent dna ligase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
312
structure length
312
Chain Sequence
LTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Inhibition of Bacterial NAD+ Dependent DNA Ligase
rcsb
source organism Enterococcus faecalis
molecule tags Ligase
molecule keywords DNA ligase
total genus 99
structure length 312
sequence length 312
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3babA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3babA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3babA02
4YHHB 4K0KB 4GKJB 4LF8B 4DV7B 3S24A 4EFBA 1XNRB 2F4VB 2VQEB 2OWOA 1IBKB 4DUZB 4DR2B 4PZ7A 1N32B 1B04A 5LMUB 1N34B 1TA8A 4EFEA 3UQ8A 2CFMA 3GB8B 4EQ5A 4LH7A 4DV0B 1X9NA 4DV5B 4JI3B 4UCVA 3JSNA 1CKNA 5D1OB 4NXMB 1P8LA 4AQYB 1HNZB 2UUAB 1DGSA 3NBYB 4YY3B 3L2PA 1S68A 1XK5A 3JSLA 4B3TB 2Q2TA 3W1BA 1XDNA 4B3MB 4LF9B 4JI0B 4DR5B 1VS0A 4DRFA 1HNWB 1CKMA 2HIXA 4LH6A 1TAEA 1V9PA 1HNXB 1IBLB 2ZM6B 4JYAB 4CC5A 4GLXA 4EEQA 4B3RB 4JV5B 4LF4B 3BA8A 4X66B 4NXNB 4DV4B 2HVRA 4JI7B 4LF7B 4UCTA 2HIVA 1ZAUA 3BABA 3VNNA 4JI8B 2UXDB 5IWAB 4LF5B 2UU9B 1CKNB 5D1OA 5FPRA 4JI4B 3T1YB 4LF6B 4DV6B 2UUCB 3NBZB 3TY9A 4DV1B 3W1GA 2UXCB 4KHPB 1FJGB 1XMOB 3W5OA 2HVQA 4TOIA 3KYHC 3OTOB 5DISC 1XMQB 3GDEA 3TY5A 4PZ8A 4X64B 4DR6B 4E6NA 4UFZA 4UCOA 1N36B 4UCSA 1XNQB 2VUGA 2UXBB 1FVIA 1P16A 3RR5A 2E5LB 4LFBB 4DV3B 4DV2B 4LFCB 4GKKB 3BA9A 4UCRA 4JI6B 1N33B 4JI1B 4X65B 4OX9B 3PN1A 4B3SB 4DR7B 2VQFB 3GJXB 4X62B 3NC0B 1CKOA 4JI2B 3QWUA 4PZ6A 3T1HB 4DUYB 4CC6A 4DR1B 2HVSA 1HR0B 2UUBB 1J5EB 3BAAA 5FPOA 3RTXA 4DR3B 1I94B 5LMNB 1A0IA 4UCUA 5D1PA 2Q2UA 4DR4B 3SGIA 4LFAB 4JI5B 5BR8B 3TY8A 1IBMB 2HHHB
chains in the Genus database with same CATH superfamily
4AYBA 3SJBC 2RQ6A 5TISZ 2FMLA 2EIMB 1KC7A 5KFIA 2F4VB 1ZHQA 3RYHB 5KFWA 2C28A 4YIPA 1AILA 4TV9A 4BXXG 1YI2V 1HNWO 4A3KG 1GRJA 2F23A 2L35A 2EIKB 3PW0A 3JZ6A 3DC6A 3H4BA 4WFAV 3KTMA 2QYZA 3J81N 3JD1A 3ZMVA 1ZX3A 3ZHSA 4MT8A 1VAJA 3HKZE 2VRZA 2CQYA 3G6VA 4ED3A 1IBMO 1NTKH 4IR9A 2DLNA 3CRQA 5KX5F 1WN7A 4RUAA 4JASA 5KFFA 1Y67A 2Y0IA 2EX3A 1AR4A 1QVFU 2UUBO 4J9RA 3B09A 3S3XA 2UVRA 2ITDC 2WLIA 3K3WA 4UV8A 4EEYA 3OMNB 1BZKA 1T36A 5B5EZ 2DE0X 2WYOA 1KTAA 4CMDA 4O2BB 3BQ1A 4LFCH 4I4TB 4CS3A 4CHIA 4DV6B 2UU9O 3RYFA 3Q1KA 2IU0A 1Y1WG 1K92A 4KHPB 1JKJB 1QCEA 5KT4A 4JI0H 1E1RG 2LP7A 3R5XA 4X9QA 3DXRB 2C2RA 1IBMH 5DECA 2Q6AA 4O84A 2QTSA 1VQNV 4GX0A 3GIIA 2WTFA 1M4UA 5CR5A 1WSCA 3O9OA 5EBWC 1RFYA 1O9HA 2NLJC 1DV2A 1V55B 4HQ6A 3U9SA 1EKFA 3FFQA 4P9OA 1Q3EA 4JTDB 4O4IB 1N32O 3ABLC 1N33B 1M5IA 3KHGA 2BSKA 1WP8A 2NN4A 4X89A 2YIBA 5IYZA 2W9CA 1AVMA 2JS5A 3WWHA 4WBNB 3N2KA 4RAIA 4CC6A 1OBGA 4Q8FA 2ZDQA 4R8CA 5JQGA 2YI9A 1N8RW 2UXCH 5B1BC 2QK4A 3CSXA 1JR9A 3CCRV 1SCUB 1OWTA 2LGWA 2BOBC 4ZKIA 1YHQV 2QKSA 5KFYA 2EIJC 1IXMA 3FAVA 2PTMA 1F51A 1IBMB 5JJEB 4AQYO 1D5NA 4JI4O 3P3NA 1VQPV 2KKWA 1TWHA 3K5NA 3IFXA 3AK3A 3SYOA 4MSWC 3RW0A 4EGJA 5CA0F 2OYQA 3JZIA 4QE9A 4FBUA 3HB9A 3GQCA 3N6XA 4WFFA 5LMUB 1W93A 5B1OA 3UQ8A 1I1LA 1JX4A 2P5OA 1KBLA 2WLNA 4DQNA 1Y1VG 1WAZA 4FM0A 1I6UA 4L8JA 4ME6A 2E3CA 4GKJO 4QJFA 1IURA 2PBZA 5J9PC 3RUPA 4C7UA 5JUMA 4GX2A 1BXRA 2MW2B 3GTKA 1VMGA 2R7LA 4DR3H 5GW7A 4FFBA 3ZHRA 1Z2OX 3RB0A 3H1HH 4BW5A 4QWBA 3L74H 2DWDC 2B63G 5EOYA 1OCZC 2WB1A 4Y8VB 1Y1VA 2DPJA 4MTGA 4X20A 2QDOA 4JYCA 2YSUB 1XUQA 2JA7G 5KS8A 2HVRA 5DGAA 5KFDA 1M90W 4BBRG 4DR4O 4FU0A 2LW7A 1PP9H 5BWWA 2WLLB 4O7YA 5IYDO 2GHYA 2UXDB 2Y4RA 2UUCO 3UZOA 3LSUA 2YC0A 2QEXV 5H80A 1BQ0A 2A06H 2AGOA 5BMVB 3RYCB 4TV8F 1WJZA 4CH5A 3W1GA 1PNKA 2VWKA 2YXYA 3RT3C 1DTOA 2V4DA 3PW7A 2ODTX 3FYIB 2CGOA 5LYJB 1FXKC 2GUZA 3HT5A 1IDSA 3ZMTA 1I1KA 2Q73A 2QM4A 4Z1VA 3HOVG 3L9DA 2ZT9B 2NU9B 2R93A 4X62O 1Z2GA 2W9BB 4MS2A 1SC5B 3WB2A 1R6KA 3G8CA 4UFZA 4X65H 2HG8A 5EZYA 2JGUA 2CDYA 4I4TA 3K03A 3RR5A 1EZVH 4DV2B 3B40A 3T9BA 5CAEB 3FKIG 5LP6A 1AB3A 1RSOA 5K3WA 4GKKB 2LQTA 4PDMA 1K97A 3PN1A 2CKZB 1H2MA 3E8FA 2ASLA 5GONF 2JS3A 2JA8G 1JVMA 4QWCA 4YJ2B 3LSSA 3ETJA 3RFCA 1JLLB 3VPDA 1AI5A 1AJQA 1LUWA 1L1FA 4C5CA 1LR1A 1ROPA 3VQXA 5J2UF 5D5PA 2FJZA 4GC7A 2J6SA 3CC2V 1SA0A 3T9CA 4N23A 1RPOA 3G80A 4DR3B 4X64H 4O3RA 3PJSK 1COWG 4FLXA 2XC9A 3LMLA 2PGGA 4LFAB 3VPBA 4I0XB 2ZR2A 2ZE5A 4GT1A 3BRCA 2DYRB 2GUZB 4U7CA 2ATKC 2ZGIA 5LA6F 2XASA 1I2LA 4H33A 2DABA 1QBZA 4IWYA 4RUCA 4RUFA 1Q90D 4A3JG 3HOWG 3EPIA 2UXXA 3L75H 1IBKO 5DGIA 5KG5A 5DGBA 3QTCA 3EYYA 3TIGA 4JTAB 3K0GA 1P8LA 4JYAO 1HNZB 2IJJA 2G38A 4LF7H 2FLPA 3OUFA 2X6CA 2Z5UA 4R6ZA 1AUXA 2WAQA 4R7RA 1T3NA 2W9AA 1GYFA 4DV5O 4DR5B 3SPHA 4AILC 2FKLA 1I0HA 4JI3H 2XAJA 3M9OB 3JASB 3CCVV 2R6FA 1MZFA 4X1YA 4GLXA 1OCOC 2N04A 1Y74B 4ETSA 4F4WA 1S03G 4B3RB 2W9CB 2M7WA 1XOUA 4ZHQB 1KJJA 3UO2A 1NVPD 4LF7B 4G3IA 2ZIOA 1G6UA 2A9HA 3CRMA 2V5AA 3OUUA 2Q5ZA 1DK1A 5KG2A 3SDLA 2ASJA 4U7NA 2YS6A 4JI8B 4DR2H 3MR5A 5B3SB 2DQ3A 1B6QA 4LF6B 2VOBA 4Q8EA 1NTZH 4GZRB 2DZDA 3T4ZA 2SCUB 1RJQA 3ZHQA 1QHTA 2C00A 3KAKA 3T1HH 1V51A 4QWAA 1GN2A 1JFFB 4TWKA 3MAQA 1T94A 3JRWA 2AXTZ 1UFIA 4G28B 4TUYF 4ECXA 2YIAA 4ECYA 4M0JA 3HKZA 4FFNA 4M7EA 1XNQB 5L3BA 3JAWB 1R9TA 1E4EB 5FD5A 4MVSA 4QNHB 2UXDO 3TQ1A 1ORQC 1K83A 3DC5A 5I47A 3JZFA 4LFCO 2XT9A 3OW2U 3JD3A 1DF4A 2L6LA 2F4VO 4IRDA 2ZIMA 1K4CC 2NR5A 4JYYA 4KP4A 2HKOA 5KFQA 2JDIG 3C3TA 3T9AA 2EJ2A 2ADQB 5J2TB 1D2DA 1EYZA 1GO3E 3K5HA 3Q2OA 1J5EB 3J7AK 5FPOA 5C4XG 2HG5C 3PW2A 4IL6Z 4F6RB 1N36O 1SEIA 1GM9A 2R87A 4DR5H 4TV9F 1K1QA 4FPPA 1VF7A 4YIOA 3R9RA 4GKJB 5DAAA 1RJPA 1EKPA 3W7XA 1DAAA 1KEEA 5EK0A 4BAYA 3PFFA 2IJIA 5FLXN 2M05A 2OT5A 1CP9A 4I5SA 5F9LA 4BIOA 3H01A 4DV1H 3RF2A 4X1IA 3JSNA 4NXMB 4HR7A 2BCCH 2ZR3A 2QB5A 2AHYA 4LP8A 4B7EA 5D5QA 3UM7A 2YZNA 4TQRA 1FFXB 1XMOH 4JAVA 3W7SA 1EN4A 3SPIA 4FZ1A 1EUCB 4JI7H 5LHIA 1LNQA 1JDBB 4DUZH 3FDSA 2KB1A 4FLUA 3J80N 1EZ1A 1UC8A 4JV5B 3T9DA 3BA8A 4DV3O 1VQOV 3ORQA 2J6UA 2WLJA 3QO8A 1IOWA 2DPIA 2E74B 4RB3C 3BABA 3VNNA 4B08A 4LFAO 1ET0A 4DO2A 4U6PA 1SQGA 1Z5VA 1THZA 3DTUB 3F5TA 2BQ3A 4IHJF 2R8GA 4JAUA 3K3PA 5GTHZ 4PA4A 1FFTB 4DUZO 2HJWA 2DMXA 4A3CG 1JQ0A 1NKDA 2UUAH 2Q69A 3CCSV 4ZHQF 3F7VC 4F4XA 5LP6C 3RYHA 4JI5O 5FNVB 4LWSA 5B66Z 4FMTA 4YB8B 4OX9H 3SYPA 2VUGA 3B8NA 4DL3A 2P4KA 4QWDA 2IU3A 4HNAB 2EULA 1VF6C 3JALB 2IJKA 4B3SO 2QF7A 3ML0A 5CA0A 2PUSA 3GLKA 3Q8RB 2R72A 4TVIA 1N56A 4WHXA 3IGAC 3KZIZ 3QWUA 1GM7A 2Q0AA 2XD4A 4HNUA 5KT2A 2R7KA 4Q44A 2EJRA 2Q7GA 3JD2A 4UVCA 1M1KW 1Y6XA 3GWKC 4J7KA 3CJHA 1HDJA 3NR7A 4BBSG 3GB7C 4QSHA 4J42A 2CNUA 3BAAA 5DLFA 4WF9V 1O75A 1FKAH 2W6JG 5KFRA 1GGOA 1XNQO 4A2AA 2Y4UA 2JEXA 3SGIA 2FPIB 1N33O 3LDCA 1VQ8V 1F7YA 3N42B 3HOUG 4A3FG 1Y74A 3ZMSA 4RZQA 4DL2A 2F4VH 2DYSC 1M57B 3T99A 5C93A 3CCUV 4WCEV 4DR2B 3GTMA 1N32B 3M7MX 4DRXB 3HB3B 5DEDA 3T1CA 3H3VH 4HNAA 1I94O 2FK1A 1FJGH 3ZS8C 3ASNB 4BY1G 3VQWA 3FAVB 5L1KA 2LFRA 1ZLZA 5JH7F 4LF7O 2Z02A 3JSLA 4UXNA 2EJ3A 2YZMA 4DW0A 4LH6A 4O82A 4EBCA 1IBLB 1CE8A 2ZM6B 4RNNA 3N43B 2IM9A 4UV9A 3U0ZA 2HJDA 4U3FH 4PJ0Z 4NXNO 2UXCO 4PI0A 4GC6A 3BEHA 2E5LO 1EN6A 1YVWA 1SESA 1X59A 2FPPB 4W4KA 4A3MG 4OX9O 1W59A 1VQ5V 3QZ8A 3GTQA 3B77A 4O4HB 3ZRVA 4DUYH 3DTGA 4L1KA 2E75B 4Q45A 5GONA 3TCUA 2UUCB 2RGVA 3MFIA 5I5TA 1K73W 1AJPA 3FD9A 1A9XA 4PDRA 2HLDG 4FBTA 1M0TA 1ZSPA 2A0LA 3K59A 3Q8SB 1YJWV 3GDEA 5KFGA 2C2AA 2Y0SA 3CMAV 2QWRB 4NZNA 4FE2A 4X88A 3APQA 4PI2A 5BYAA 2W6IG 1KD1W 2LW1A 1GK9A 3ETHA 4JV2A 3G4SV 3MHSC 4MTDA 3APOA 4J9KA 4CH3A 4JI6B 4JI1B 3GJXB 4JI2B 1C30A 4PA3A 3BCCH 4R50A 4A2BA 4DR6O 3V6JA 1KC8W 2W6PA 1NI8A 3T1HB 1WRVA 4DUYB 1CS0A 3WO1A 5KUMA 3WFVA 1Q7YW 4DR7H 4EKWA 3D36A 1CEZA 5KFSA 3CS5A 5KG3A 4GKKO 3RIZA 3VOUA 1CQIB 1I94B 2HJFC 4I55B 4LSXA 5JQWA 5D1PA 4DV1O 4MV7A 5DISC 1SERA 4QPKA 2WLLA 1I08A 4X20B 1C3OA 5C8YA 5HFMA 2YWVA 3MWDA 3RV3A 3GV7B 4MA0A 3PW4A 4WFGA 1IBKB 4UUGA 3ZMUA 5CBHA 1ENVA 3GB8B 1OCZB 5FLXW 1X9NA 4DV5B 4DR5O 1WB7A 4JI3B 5KFZA 2KG7A 3H1LH 4B3SH 1K7DA 1XEQA 5K1PA 5BMVA 3RYCA 5J2UA 1YITV 3I56V 2EJ7A 2HFEC 1AR5A 5IDJA 2XOKG 1B6RA 3BJYA 3SYQA 5JH7B 1YIJV 2HGWA 2OIEA 5KFVA 3L2PA 1ZWIC 1S68A 3AG3B 4LF8O 4O83A 4X62H 4JI5H 2Y48A 4YY3O 1J95A 4DR3O 4B3MB 4XZ3B 3W7WA 5BWXA 4DR6H 1CKMA 5L3FA 4FGRA 2RDIA 5EWFA 3OTFA 2W9BA 4YXWG 4MVQA 4J10A 4MTOA 1TUBB 4FIPC 4FZ0A 4X66B 1FAFA 4N21A 4YJ2A 2E2HA 2XAFA 2QSAA 5IYDG 3BY6A 4NB5A 1Y14B 4LFAH 2RMKB 5JVLA 4ECQA 3ABTA 1K4DC 4JI4H 1PL4A 3JAWA 2PZSA 3UO3A 4X1KB 1YTFB 1KU9A 3V4ZA 5KFOA 3TETA 2ITCC 2NU8B 4JI7O 1VQMV 5I5UA 4TOIA 2YL2A 4B3RO 2WB1E 1H2NA 5E1AC 2VA2A 2WWWA 4PA7A 1ZTEA 5KFLA 1I7FA 1KECA 3A0BZ 2F93B 4TV9B 4DUYO 1N34O 1W96A 5I5XA 4A3LG 4MV8A 3PO2G 3T54A 3HKDB 3CC4V 4DV3B 5LMUH 4LFCB 2LJ2A 2QKCA 3CHXA 4NXNH 1NR1A 4MVMA 4X65B 5DMXA 4X66H 4IHJB 1YXBA 3SYAA 5LMNO 3G6EV 1YJ9V 4AHCA 4APMA 1Q6UA 4PZ6A 3OHBA 5L3CA 2WE6A 1J5EH 2FB5A 4DV0H 4JXUA 1EHIA 2AZ0A 3HKCB 3K79A 1W0KG 2OIGA 4LFBH 4LSAA 3E89A 2ZKOA 3KHLA 2R85A 3QO7A 4JI0O 4NXMO 2NVYA 1WH2A 4Q6GA 1R3JC 3JARB 2GPSA 1MNGA 2EILC 4DR4B 2Q2UA 2ASDA 3JASA 3HBLA 4RCNA 4K0KB 2ZXWC 3QG5A 5K2MA 3SE7A 4LF4O 3JALA 4MVRA 3U9TA 5HNEA 3RYFB 3RVYA 2UVUA 2EZOA 3RB6A 5LGUA 1TWCA 5KHHA 5KG7A 1MSWD 4EFEA 2COIA 2CFMA 4P2ZA 4O4JB 3MHHC 3ETQA 1WLEA 2V4QA 2W8KA 3K5OA 2QWNB 1VQLV 4LF5O 4R7CA 3HOXG 1KJ9A 3UT5B 2P06A 1RSOB 2YEVB 4IHJA 3NBYB 1KKDA 3NUAA 2Q2TA 1Q82W 1VQ9V 2Q0OC 3E8GA 3ASOB 1VARA 2Q7DA 3TGUH 4H37A 2HIXA 1HNXB 2D3OW 3F7YC 2A7WA 4PWQA 3H9VA 4PDBA 3ABKB 3N6RA 4EEQA 2IJHA 1VQ4V 2W6QA 4PELA 3UFXB 2EIMC 4O3OA 5DLGA 3WNZA 1OCCB 2X5RA 5KX5B 2CTPA 4X65O 3BFRA 3KCYA 5IWAB 4ECUA 4F50A 3T9EA 2BE3A 4F6RA 2P22C 1EFRG 1V55C 1F23A 2UXCB 3GIPA 4I7ZB 2GBOA 2X0SA 5FL7G 5C1OA 3W5OA 2Y69C 5IP7G 4HBNA 4KL1A 4JI3O 1KJIA 1QU7A 3ZN1A 3CQZA 2JEUA 4O7LA 3RYIA 4CZZA 1GN4A 1S0NA 5DQHA 2EZPA 3OEHG 5BR8O 1QLEC 1XMQO 2YEVA 1IBLO 2COJA 4DR4H 2XTAA 4A3BG 2XAQA 4WFEA 1OBDA 1H8HG 5IJ9B 1HR0H 5J2UB 4O3NA 3EPGA 1IXBA 3T5KA 1HNWH 4FS2A 4UCRA 4FLTA 3T2MA 4IAJA 1GN6A 3OE7G 4DK0A 2JIZG 3RGBA 1AI4A 2R92G 2ZNJA 3RGXA 4CS2A 3LNNA 3CVZA 1XMOO 2Y69B 5I5YA 1S0OA 1XL4A 1GM8A 3EFFK 3K5IA 4HZ3A 2O03A 1DLBA 3ZHTA 4A3IG 4CKCA 2BTQB 4JYBA 3OTOO 1HR0B 4BIUA 1US6A 2KQXA 2XHBA 1MG1A 1R3LC 1ULZA 2ZE7A 1PM9A 1IYDA 3IC9A 4U7OA 1BHAA 3BACA 5JJNB 4ED7A 1V54B 1X4TA 4NKGB 5LHHA 2XGQA 5KAFZ 3Q8PB 5CB4A 3JATA 5LOVB 4J9YB 4EFBA 4Q43A 3N40P 1I50A 2FKXA 3U55A 3ORRA 2IH3C 1JFFA 3X2QC 4GX5A 1FJGO 4UUJC 4NZOA 2WAQE 1B04A 1IX9A 1N34B 4YHHH 4WBNF 4TQSA 4LF6H 2P7TC 2KSDA 4O7WA 5IY5C 2XUMA 5IYZF 4ECWA 2CUGA 3ASOC 3HXLA 3VBBA 3JD0A 2JJ1G 1Q86W 2V7QG 1TWFA 4YY3H 4A3EG 5JVDB 1XHZA 4PA6A 4UVBA 3OD4A 3P30A 1Q81W 4J11A 2V4RA 2DIKA 3MDSA 3RB3A 2CH7A 5KHKA 1JJOA 3TXQA 1TAEA 1S5HC 4I50A 2VQFO 5H9CA 5KFUA 4XBFA 1EZJA 3K08A 5EDWA 4NYKA 1KP3A 3RJ0A 1JPXA 3RAXA 2ABJA 2A1HA 5EYPA 4DL6A 2PYLA 5KHJA 2PMZE 4FFPA 1PK8A 2ZE6A 1ZAUA 4JUZA 4O7VA 4EBEA 1SA0B 2RCVA 4O2AF 2HVKC 3ABMB 3AG4B 1CKNB 1BHBA 2PI5A 5KFAA 3ABMC 3AG4C 1Q5OA 5KFPA 4I9QA 1PNMA 4O4LF 1N4CA 1QQCA 5JH7A 4A93G 1NH2D 3ZMZA 2F43G 2WLMA 3PR5B 2QM7A 3N2GB 2R7ZG 2RJZA 3K3VA 4GKKH 1M0WA 1VKZA 4X1IB 3KAJA 4C5BA 4CMFA 2IW5A 4IZOA 1AP6A 3GILA 3V4SA 4LF9H 1NTMH 2DJVA 3MD0A 3HPLC 2Q8VA 2Z3YA 1NBMG 1XBLA 4F4LA 3OHAA 2E5LB 1L0NH 1WA8B 3E22B 4ED1A 5CMUA 2OTLV 2GQRA 4ED2A 4OX9B 4DL4A 3KHHA 4DR7B 2YDEA 2F95B 1JX9A 1BNCA 4EB6A 3RYIB 3Q8QB 1S9FA 1S5JA 4MTEA 1AUVA 3R66A 3X2QB 1M57C 4JGSA 4FM2A 1AROP 1YEWA 5HFLA 2WLHA 3C0FB 3I12A 1L0LH 3G71V 5GTIZ 5KG0A 4J9LA 3M8AA 5BZBA 5H5NA 4JI6O 1KKCA 3KHRA 1QR9A 2HHHB 2NU6B 5B1BB 1W0JG 4LF8H 2DW4A 3CXCU 4YBZB 4I4TF 3QNEA 2ARHA 4E4EA 1H38A 5GONB 1GO3F 1R6TA 1SYXB 4DUZB 4W4LA 3FB6C 3JAKB 4DV0B 2PY5A 1S3JA 3IN5A 1K5SA 4UCVA 4JI2O 4E4TA 1KQSU 4I55A 3E83A 1WPBA 4MVUA 5EIBD 1ZQ7A 2W71A 2A79B 4JZ2A 2UUAB 3QQMA 1DGSA 3MR2A 4KFMA 4YY3B 4J7JA 5CA0B 3K06A 3K58A 1YJNV 5BR8H 3T7AA 4J0MA 1S72V 2H3OA 4BWAA 4ZOLF 1H2GA 1PL0A 4X1KA 4LF5H 1F4NA 1OZ0A 1QLEB 2XCPA 3N27A 3RB4A 1GSOA 1I94H 2YIDA 4JF3A 5KT6A 5IYBG 4RAYA 3CJHB 2KG7B 3KG2A 3CCQV 2Y4TA 1E1QG 3CEIA 1I5YA 2CTQA 4CH6A 4IIJB 2HP8A 4F4ZA 4QIWE 2YRWA 1Y76B 4TM5A 3VQYA 5B1AC 3ZN0A 4XYMB 1HWYA 4FFBB 1EUDB 1UNNC 3RBEA 5D1OA 5FPRA 2ZDIC 3T1YB 1N33H 3HR0A 3CEBA 1GMGA 4J9SA 4L87A 3AK1A 2HGSA 1FXHA 4QIWA 3JATB 3LULA 3GWOA 4DV4O 2R82A 5FD6A 1O9GA 4GCZA 5BYBA 2HVQA 3QZ7A 2XNDG 2PN1A 1PNLA 3BHPA 2W6ZA 2YW2A 2PMZA 4IRKA 4K8ZA 5ITZB 1MZEA 1V54C 4B3MH 3WO0A 4DR6B 4E6NA 4HNTA 2K9PA 3QFFA 2FMAA 2YICA 1P16A 2CNVA 3G67A 3L70H 2DOSA 2W7OA 5LYJF 1LUVA 2YS8A 5L1IA 5LMUO 1GH6A 4DV2O 1Z2NX 3DF7A 1P7BA 2VQEH 3ETDA 5A2QW 4ED0A 2VA3A 1CKOA 4JV5O 2R93G 3SNOA 4K3AA 5LL6b 1L8DA 5IJ0B 2GTSA 1S76D 4FS1A 4E2LA 2UUBB 2CZGA 3E5NA 5EYPB 4O2BA 3T5HA 2HR3A 4MVOA 2FE3A 2ZM6H 1IYEA 2Q67A 1Z2PX 3T5LA 2VS0A 2W57A 5KT5A 2UVVA 3CX5F 1N48A 5FJ8G 3WG7C 3M9MB 3G6YA 4DR1O 3LQSA 4DV7B 4O7ZA 2JVDA 4WD3A 5KFXA 4NTWA 4O4IA 2UXBH 4RNOA 1JMKC 2EBOA 3AG2B 4DV3H 4PA9A 1G1XB 5KMGB 2GPWA 1IZ3A 5J2TF 2GSMB 4YR3A 3CPWU 4TUYA 2DN9A 2FB9A 4FVMA 4LMYA 4YJ3A 5KX5A 3KALA 5KFKA 4GUNA 1WB8A 3KKYA 3QO5A 1NS1A 1VS0A 4JV5H 3H20A 3FB8C 5IWAH 4RB0A 4FLZA 1GLVA 5C1PA 3N2KB 3OMAB 3JAKA 1M56C 3JD4A 2VQEO 4ZI7B 1FKAO 4IYIA 2JA5G 2DYSB 1R3KC 3PW5A 1S77D 4MTFA 4LF4B 4FFOA 4RAZA 1R3IC 1XDCA 1VQKV 3D3IA 5E25A 4H0LB 2P4VA 3TEKA 1XNRH 1RM1B 2F66C 3BPZA 2HIVA 3K5MA 2R7MA 3TW6A 1UJWB 5H2FZ 1UC9A 1G8MA 2IH1C 2ZD9A 2Q4PA 3OEEG 4YP3A 4B3TO 4JAAA 3RBZA 1KBHA 3OT7A 1SF9A 3NBZB 1N0JA 1VBGA 2Y0PA 5KG6A 3ZRXA 2V58A 4DV4H 3CD6V 3SYCA 5FR9A 4LBEC 3KYHC 3RGZA 3JCZA 5KUKA 1NVPB 4CS4A 1OCOB 4H44B 4DRXA 1HNXO 1I7NA 2HHHO 3JARA 2R7ZA 3ABUA 4BWSC 2YCHA 1SKVA 1FVIA 3F8NA 2A3QA 5CB4F 3R23A 4QPJA 3GIKA 1HW7A 1VQ6V 5FNVF 2VUMA 2IMWP 2B5UA 3RN4A 4B3TH 2OCCB 5CB4B 5D8DA 1YF2A 3GV8B 3TIIA 4RZRA 1VEWA 4EBDA 2Z0AA 3G6XA 5BPFA 1KP2A 2FTKA 4DR1B 4KHPO 2HVSA 3PR4A 1M56B 2XAHA 2W6MA 1BCCH 3ZX6A 1P49A 3CCJV 3E2EA 2CK3G 1W2BU 1R1BA 4DYLA 5BR8B 1QNMA 4O4HA 4NVPA 2R84A 1JCHA 1SRYA 2AHZA 5KA5A 1OCRB 4J80A 1HNZO 4K0KH 4X8AA 4DV6H 1BMFG 2HEPA 1VIBA 3OGIB 1TVKA 2IBZH 4LCUC 4LNUB 1GSAA 4YR2A 2DWEC 3U10A 3DAAA 4LF4H 2LGQA 5FNVA 2CW7A 3HO8A 3CC7V 1CQJB 4K6NA 2VPSA 3GIQA 5KFBA 2YU9A 2X0LA 1R73A 4J9PA 4EYHB 1RK6A 5D1OB 3VPCA 3WB0A 3HKDA 4NXMH 1K1SA 4IR1A 3IC7A 4JI8H 5KFTA 4Z1MG 1OCRC 4I50F 1Y1WA 5B1NA 1IBLH 3DGEA 3ZRWB 4DR1H 4B3TB 2W6NA 4AQYH 2ZQMA 4LF9B 3M4IA 4DV0O 2JEJA 4JI8O 1S10A 5ITZA 3HKCA 4Q0YA 1TUEB 3AYHB 2GTAA 3BVOA 4YR0A 2UVWA 1IBKH 1SQQH 4B7KA 1E4GT 5I5VA 3K5LA 2DQ0A 5KAIZ 4WBNA 5IJ9A 2M6YA 2ZXWB 3DSQA 5JVDA 1HNZH 2CNQA 3N44B 2JA7A 2AZ2A 3HKEA 4XX0B 4DV7O 1OJHA 3L73H 3STLC 3T5JA 4HN2A 1B3QA 1B6SA 3A0RA 1XQ8A 4ZOLB 3C90A 3CYOA 5EIBC 3E35A 4MV4A 5LXTB 4C5AA 2RGRA 3VQVA 4FLWA 4B3MO 4MV1A 1EBOA 4KHPH 1GAXA 1SQBH 2EJ0A 3OUZA 3TINA 1BE3H 1P7GA 2C2DA 1B33N 4F4YA 2Q7HA 4IIJF 3JAMN 4JI1H 4JZGA 4ZHQA 2UXBB 4FLVA 1YTFD 1Z5WA 2P90A 4J9ZB 2XIGA 5F9NA 1M7JA 3HKBA 2CW8A 4IWXA 2EIYA 1SQPH 3AG1B 4ZBMA 2ILMA 1FD9A 4I0XA 3AW8A 3NC0B 1M9NA 3E8HA 2EIKC 4EGQA 2BR0A 4HAMA 1I7LA 2HGXA 3SPJA 2YRXA 1SFOA 1OV9A 1SZXA 2HHHH 2VQDA 2B63A 2JEFA 1XL6A 2BQUA 4LR3A 2HVJC 3R5FA 2QKAA 4UB8Z 3B8MA 1YCIA 2W7PA 5KA6A 4MW8A 3TXSA 2RF4A 5KFEA 3PZPA 4YAKB 5JWPA 4ZOLA 2QR4A 2ZDIA 1YSCA 4LFBO 2R86A 1ZL8B 3IJ4A 1VQ7V 1E4EA 2AW9A 4RB2C 3KREA 5CA3A 1OHHG 4O4LB 1J5EO 3FX7A 5JCOA 4A3DG 1DIKA 1TA8A 4EQ5A 4LH7A 2JA5A 2EINB 3OM3B 1CKNA 2FL4A 4ECRA 4TV8A 3E8BA 5IWAO 5I60A 4OGQB 1AI7A 3THOA 2QA4V 4DV6O 3OTOH 1P4RA 3P32A 2PYJA 4QIWF 3WWIA 2QM8A 1XDNA 5BWRA 2W0XA 2MK3A 4PD4F 3UYYA 2JGDB 3U0GA 4O3QA 1JXLA 2J6TA 4X64O 4PBCA 4JYAB 1SZTA 3GIMA 2LFSA 2OCCC 5JQGB 4CH4A 5C5JA 4ECSA 4RWUA 3E86A 3N41B 5KT7A 1IVSA 2W8LA 3RFRA 5KMGA 2YZGA 1FXKA 1K5QA 2DYRC 3C3SA 3HOYG 2YZLA 3ASNC 4XDKA 4LF5B 4DIMA 2R70A 3OR7C 4AYBE 2RN9A 3V6KA 3LSQA 1XMOB 5IY5B 5C8YF 5IYCG 2N74A 1GKFA 3OTOB 3CCLV 4O2BF 4J9OA 3FKSG 4YQWA 5HBRB 4P9PA 4RO2A 4NR1A 5IE9A 1KYOF 2JA6A 1SETA 3ABLB 4OPAA 2AGQA 3I4NG 4LFBB 1YDXA 2E5LH 5BXZA 1TVKB 4LNUA 4PDVA 5EBMC 2DAAA 5LA6B 3JYCA 5LXTA 4AI8A 3U11A 2KSWA 5BY1A 2ZNIA 3CRAA 1WR2A 4ECVA 4FFMA 2GLTA 2OLSA 1RP3B 4ED8A 2R9AA 4KXRA 5KLVH 1K8AW 4K35A 3MFHA 5CA1B 2VUMG 4JV1A 5C44G 1N36H 4JV0A 3FKIA 1YZBA 4J9QA 4FM9A 3AG7A 2AU0A 1AI6A 1NT2B 3D36C 4EG0A 4O3SA 1KUTA 3VA7A 2VWJA 4U3JA 5EBLC 4LF8B 3H0GG 2R8KA 3OMIB 3ETEA 3N2GA 5BWUA 4DLKA 4O81A 2E2IA 2ZDGA 4ED6A 5IYBO 2NUAB 1MSDA 4TSFG 4UVAA 5T14A 4DAAA 5A9GA 3ZHVA 3R5HA 2R7NA 1AJNA 4MTXA 3HOZG 1XNQH 1FPOA 4YHHO 2Q68A 5L9XA 1K3EA 1PKXA 1WA8A 3E22A 1KMIZ 4DV5H 3NXSA 1K9MW 1PPJH 4XDJA 4J7ZA 5LOVF 1OCCC 2COGA 2W0FC 2R8HA 1PX2A 3HKBB 3FMAA 1URFA 2HHFA 1S97A 1V9PA 3G6BA 1RYSA 3PVXA 2R8JA 3FB5C 3GTPA 3W7UA 3T1HO 3STZC 2D2CB 1WCMG 2ZJTA 5CA1A 3F5WC 5IYZB 1SS3A 2WA4A 3CB2A 1I2KA 1QR8A 2ADPA 3AEIA 3K9SA 4HYKA 1UPGA 4DV4B 5L1JA 2W70A 2PF4E 2C22A 4PHZA 4UCTA 2BTQA 3LDEA 5J2TA 4DR2O 4O2AB 4FFRA 4IGGA 1K34A 4ASUG 1WNSA 4JI4B 3AG1C 4MW3A 3AX6A 4YJ3F 5KFMA 4JI6H 3ZHUA 2X7RB 3MR3A 3BQ2A 3V6HA 4TT3G 4J9MA 2H94A 4FJCC 1FJGB 2UUAO 1ZL8A 4MV9A 3ZRWA 5LOVA 4RQFA 1XILA 1T5EA 3RVZA 2B1IA 2R92A 1XMQH 3J81W 2W6OA 2CTWA 5H6RA 1TWAA 3SJAC 4DXWA 3H40A 1DV1A 4H13B 1H2KA 4UB6Z 1M6VA 3M99B 3IAYA 3FYEB 1NH2B 2WPDG 1BGYH 1A32A 1NZ6A 2UU9H 3ETGA 4B3SB 2UXNA 3L71H 2VQFB 5LBQA 2QTOA 2R9RB 4ECTA 3EHBB 2C2EA 4CKEA 1ZUQA 2CH7B 2B1GA 1HNXH 4O7SA 4K0KO 1AN7A 1RPRA 2YYAA 3CRCA 5LGNA 3DXRA 3RTXA 1Q43A 1Q6IA 5EC1C 5DG8A 3FB7C 5IT9W 4K8XA 4JTCB 5KFNA 3WB1A 4R8UB 2BQRA 1P84F 4JI5B 1SQXH 4DL7A 5KHIA 2P6JA 4YHHB 2LO1A 3R65A 1H2LA 4Q4DA 1MA1A 4A3GG 5I5WA 4CBCA 2AQ4A 3O65A 1I1MA 2V9WA 4PZ7A 5DG9A 5AG2A 4HYOA 1EM1A 5CBFA 3SJCC 1G4YB 1H8EG 1U97A 2YS7A 2Z04A 3KCXA 5L3EA 3MWEA 1JOYA 4DW1A 4QWEA 2EIJB 2VQFH 4AQYB 1GTOA 4D7SA 5B3SC 1H2SB 1KJ8A 2BOCC 3OGCC 3A0HZ 1KB9F 1VBHA 1TWGA 1KUQA 5K1XA 3VOTA 1RM1C 4U3JB 4NTYA 3W1BA 5L3DA 1FYJA 4TQDA 4O4HF 1HNWB 3GTJA 2HDKA 3GVMA 2JJ2G 3GTOA 5JVDF 4WFBV 4RQEA 4FM1A 4EB6B 2WA3A 2UXDH 2FK2A 4XDLA 1HP8A 4NXNB 2QJ1A 2K1EA 4JI7B 2UUCH 2E76B 1RK5A 5IP9G 3P3PA 4PV1B 1EN5A 2ZCEA 2WLKA 3ZEDA 2AGPA 2H8PC 2UU9B 3GIDA 4ECZA 5CM0A 4GLWA 5LMNH 2V59A 1B06A 3BG5A 1N0NA 1G2WA 3TY9A 4DV1B 4CKBA 1WCMA 3K0DA 3W7TA 1QVGU 4Q4CA 1Q8IA 3AG2C 2ZM6O 3QF7A 4I7HA 4M9UA 5EWGA 1AR1B 2BSKB 3Q4HA 2PI4A 4LF9O 4TQFA 1XMQB 4QJFB 4QW9A 2FLNA 3WG7B 4G2KA 2NNUA 5L3GA 1N36B 4UCOA 1TUBA 2XCLA 2OTJV 3GV5B 3HKEB 5DN6G 4BY7G 3ZJZA 3SI8A 2FYUH 4GYCB 4DV2H 5H6QA 1E4FT 3BA9A 4I50B 3D3QA 2EINC 4IYHA 4ICGA 3CCMV 5DQIA 2RNBA 4XYLB 1BS3A 2HHFB 1VP7A 2GV9A 5LL6Y 3MWMA 3T4DA 2Y0SE 1BT8A 2IBKA 5FLMG 5DG7A 2DWCA 4X1YB 3TQTA 5F2VO 2RDCA 3IG0A 3ABKC 4RNMA 3I55V 4G27B 1F4MA 3K57A 5KFHA 2F1MA 1U96A 2QWPB 5LMNB 4JYAH 1A0IA 2IP4A 4UCUA 3L72H 4DK1A 3SR2C 2QE7G 4TV8B 4IIJA 4O2AA 3L4KA 5A2QN 5E79Z 5JQGF 2YXHA 2ODMA 5JJJB 3CRRA 1WP7A 5BWTA 3G8DA 2VR1A 3RV4A 3S24A 1XNRB 2Q7EA 2FK3A 3H1IH 5L1LA 2VQEB 4FFLA 3B4SA 2FLLA 2I8CA 2YI8A 4YAJB 4OXSA 3LUTB 2NU7B 2X6BA 4LF6O 1Q6HA 1JDEA 4DL5A 1FXVA 2CAZC 3RWRD 3OSPA 2AGAA 5EWEA 1RYRA 1GSHA 4FK5C 5CE8A 2YXLA 4Q20A 4FFKA 2BTOA 5BWVA 2XCAA 4D7TA 2N05A 3TJTA 2JK5C 3K9AA 5CN0A 3OUSA 5KHGA 3EXAA 4JI0B 3A2FA 4YJ2F 1R6NA 3SPGA 2FP4B 4J9NA 3WWJA 5KFCA 3PO3G 3K04A 1PD3A 1MOFA 4JI2H 4IRCA 4RB1A 3H4DA 4DV7H 3CP1A 4O7RA 3S3WA 3I5DA 1S0MA 5IJ0A 3WU2Z 5LP6F 2RDJA 1VF6A 2YIBD 4I9WA 4JPRA 1E79G 4BW9A 5LXTF 3H1JH 2JGDA 3CWBH 2UUBH 5LP6B 1HR0O 3H1KH 4ZIBA 5LA6A 3M9NB 2J9GA 3CSWA 4O3PA 2O57A 1KT8A 2NVXA 3LP8A 4O4JF 4MV3A 2VPQA 5IT9N 5LHGA 3TY5A 3B2EE 4O4LA 3RBDA 2QWOB 3CE2A 1FXKB 1JJ2U 3UT5A 3MJFA 4UCSA 4BR6A 4I55F 3J7AU 3KXYT 5HV6A 3OFNG 1XNRO 3JRXA 1K33A 4QW8A 3UKMA 4TUYB 4X66O 5KKNB 1JA8A 1A48A 2B9ZA 3LWBA 4YJ3B 2I80A 2JRIA 2OH2A 2JA6G 4LC1A 2ATLA 1ZHSA 5B1AB 5JCOC 4X62B 1A0GA 2PVPA 1FFXA 5DQGA 2QGNA 4QE7A 1NR7A 1XI1A 1VF5B 1N34H 2WLIB 4MAMA 1Y4MA 5BMVF 3ZCCA 1Y76A 3JCUZ 1M93A 3CXHF 1FS0G 4MA5A 2IA6A 4B3RH 1D5AA 5EZYB 5KG1A 4O4JA 4GKJH 3T1YH 3VMMA 1L2ZA 4KUMA 1BJTA 3UCSC 3OSNA 5EZYF 4ZQIA 3JAMW 3J80W 3OAAG 2XGPA 4OPHA 3L4JA 2R9IA 2UXBO 5DM6V 5CBGA 2OWOA 1GN3A 4MVZA 4C2MA 3ZBHA 3BQ0A 5EC2C 4WFHA 4P30A 3RAQA 1KJQA 5LGTA 2Q9LA 1BL8A 3GIJA 2EILB 1SQFA 4CE5A 2ETNA 5KFJA 4NYEA 3GTGA 1MABG 3U54A 4IT5A 2P0AA 1XK5A 5LYJA 3SJQC 4ABMA 4R8UA 4DRFA 5KT3A 3LDDA 1NJIW 3SPCA 1NU1H 2X6AA 3CCEV 3T9FA 4CC5A 1I3QA 1NQTA 1N32H 3ICXA 1XHXA 3OR6C 2ZINA 3UZBA 3D8CA 4O4IF 3I4MG 5DGHA 5BPHA 1S0VA 4BIZA 2CTRA 1BSMA 3TW7A 4MV6A 1RJRA 3QVNA 4JI1O 2C35B 2I87A 4ZI7F 2GDSA 3LNMB 3H0GA 1AP5A 2GQSA 5C8YB 2MCTA 2CE4A 4RUEA 1A3GA 4O7NA 3TK1A 5IYCO 3NGDA 3ZIAG 1TGOA 1Y66A 2YUAA 1I5XA 4O86A 1IOVA 1QLNA 3MR6A 1CXZB 4DR7O 2JEIA 1BGWA 2OCHA 2WDTA 3ZRSA 4PZ8A 4O7TA 4X64B 2ZDHA 3A8TA 3AG3C 1PV0A 2CGNA 1MZBA 4GX1A 4EYIB 2WSSG 1DF5A 1S5LZ 4Z2WA 2V1DA 5C3EG 1WPXA 1BQZA 1ZETA 1EKVA 4NZMA 4HNVA 1XREA 4FLYA 4ZI7A 2QWQB 3DTFA 2XAGA 5I5SA 3CMEV 1V4YA 1MMMA 4NLGA 3N8DA 2FPGB 5CA1F 2ALZA 3AK2A 1CPYA 4RU9A 2JEGA 4NTXA 4D6TH 1SQVH 3GTLA 5KG4A 1JIHA 4A5UB 3Q4HB 4J41A 4F6EA 2ZE8A 2R8IA 4QGPA 3T1YO 4LWSB 2P67A 2WAMA 3TY8A 3EVKA 4PDLA
chains in the Genus database with same CATH topology
3SJBC 4LF8H 2VWJA 2RQ6A 4U3JA 4LF8B 3N42B 3N2GA 4RZQA 2F4VB 1ZHQA 2F4VH 5GONB 3RYHB 1SYXB 4DUZB 4DR2B 1N32B 4TV9A 3M7MX 4DRXB 3JAKB 4DV0B 2PY5A 4UCVA 1XNQH 4HNAA 4I55A 1WPBA 1FJGH 3ZS8C 5EIBD 3E22A 3VQWA 2UUAB 1KMIZ 4DV5H 1DGSA 4YY3B 5CA0B 3K58A 5BR8H 3JSLA 4J0MA 3HKBB 4BWAA 3FMAA 4LH6A 4X1KA 4LF5H 1V9PA 1IBLB 2ZM6B 3N43B 1WN7A 1I94H 2IM9A 3U0ZA 4RAYA 2EX3A 5CA1A 2ZJTA 5IYZB 4PI0A 3CB2A 4DV4B 4CH6A 4IIJB 4PHZA 4UCTA 2BTQA 2WYOA 5J2TA 3VQYA 4O2AB 4FFBB 4O2BB 4O4HB 5D1OA 1WNSA 5FPRA 4DUYH 4JI4B 3T1YB 4LFCH 4I4TB 4CS3A 4DV6B 5GONA 2UUCB 4JI6H 3RYFA 1N33H 2RGVA 4KHPB 2HGSA 1FJGB 4MV9A 3JATB 5FD6A 5LOVA 4JI0H 1O9GA 1T5EA 2HVQA 1M0TA 3K59A 3BHPA 1XMQH 3J81W 1IBMH 3GDEA 4K8ZA 5ITZB 3SJAC 4B3MH 4DR6B 1M4UA 4E6NA 4PI2A 1O9HA 1P16A 4MTDA 3IAYA 3FFQA 1Q3EA 4O4IB 2UU9H 4CH3A 4JI6B 1N33B 1Z2NX 4JI1B 3DF7A 2VQEH 4B3SB 5A2QW 3GJXB 1M5IA 2VQFB 1CKOA 2YIBA 4JI2B 5IYZA 4A2BA 2JS5A 1HNXH 4WBNB 3T1HB 3N2KA 4DUYB 4CC6A 1AN7A 5LL6b 4DR7H 1L8DA 5IJ0B 5JQGA 2YI9A 2UUBB 2UXCH 3RIZA 5EYPB 3CSXA 4O2BA 3RTXA 1Q43A 1I94B 2FE3A 4I55B 2ZM6H 4K8XA 4LSXA 5IT9W 3WB1A 5D1PA 1Z2PX 2W57A 4MV7A 4JI5B 2PTMA 1IBMB 5DISC 5JJEB 5KHIA 4YHHB 2KKWA 4DV7B 4X20B 3K5NA 2JVDA 4O4IA 5C8YA 2UXBH 2OYQA 1JMKC 1IBKB 4PZ7A 3N6XA 5LMUB 3UQ8A 3SJCC 3GB8B 4DV3H 2P5OA 5FLXW 1X9NA 4DV5B 5KMGB 4JI3B 4B3SH 4FM0A 4TUYA 1I6UA 2VQFH 4AQYB 4L8JA 4D7SA 2E3CA 4FVMA 1H2SB 5K1PA 5BMVA 3RYCA 5J2UA 4YJ3A 4LMYA 5KX5A 3KALA 4DR3H 5K1XA 5JH7B 4U3JB 4FFBA 1Z2OX 3L2PA 1S68A 4JI5H 4X62H 3W1BA 4B3MB 1VS0A 4TQDA 4JV5H 3H20A 4DR6H 1HNWB 1CKMA 5EOYA 4RB0A 5IWAH 4FLZA 3OTFA 3N2KB 3JAKA 4ZI7B 4X20A 4FM1A 4EB6B 4LF4B 2UXDH 1TUBB 4RAZA 4X66B 4NXNB 2QJ1A 4YJ2A 2HVRA 4JI7B 1XNRH 2F66C 2UUCH 3BPZA 2HIVA 3K5MA 2ZCEA 4LFAH 3ZEDA 2UXDB 2UU9B 4JI4H 5LMNH 3JAWA 2PZSA 5BMVB 3RYCB 3NBZB 4X1KB 3TY9A 1KU9A 4CH5A 4DV1B 3W1GA 2VWKA 1Q8IA 2V4DA 3QF7A 4I7HA 4DV4H 5LYJB 4TOIA 3KYHC 3RGZA 2QM4A 4TQFA 4CS4A 1XMQB 1I7FA 4TV9B 2F93B 4DRXA 3JARA 3WB2A 4UFZA 4UCOA 1N36B 4BWSC 4X65H 1TUBA 2YCHA 1SKVA 2JGUA 3HKEB 4I4TA 3HKDB 5EZYA 1FVIA 3F8NA 3RR5A 4GYCB 4DV2H 4DV3B 4DV2B 5LMUH 1E4FT 5LP6A 4LFCB 1RSOA 3CHXA 4GKKB 3BA9A 1HW7A 4I50B 4NXNH 4X66H 4X65B 3PN1A 4IHJB 4APMA 4B3TH 4AHCA 5CB4B 4PZ6A 2WE6A 1J5EH 4DV0H 2GV9A 3MWMA 4YJ2B 3HKCB 4X1YB 4DR1B 2HVSA 3IG0A 4LFBH 4LSAA 3VQXA 5D5PA 1SA0A 3K57A 1P49A 2F1MA 4DR3B 4JYAH 5LMNB 1A0IA 4UCUA 4X64H 4DK1A 4Q6GA 4TV8B 3JARB 4IIJA 3SR2C 4FLXA 4DR4B 2Q2UA 1WH2A 2PGGA 4O2AA 5BR8B 4LFAB 3LMLA 3L4KA 4O4HA 3JASA 4NVPA 3BRCA 4K0KB 5JJJB 3QG5A 4K0KH 3S24A 3JALA 4DV6H 1XNRB 2HEPA 2Q7EA 1TVKA 4LNUB 2VQEB 3RYFB 3U10A 4LF4H 5FNVA 5KHHA 2CW7A 2YI8A 4EFEA 2CFMA 2VPSA 3QTCA 4O4JB 3EYYA 3ETQA 5D1OB 1P8LA 3RWRD 2CAZC 3HKDA 3K5OA 3WB0A 4NXMH 1HNZB 4JI8H 3UT5B 2YXLA 4IHJA 2BTOA 3NBYB 1IBLH 4D7TA 4LF7H 4DR1H 4B3TB 4AQYH 2Q2TA 4R7RA 5KHGA 4LF9B 4JI0B 4DR5B 4AILC 3M4IA 1GYFA 3A2FA 2HIXA 4JI3H 3JASB 1HNXB 5ITZA 3HKCA 4X1YA 4GLXA 4Q0YA 4PDBA 4ETSA 4EEQA 4JI2H 1S03G 4B3RB 1IBKH 1E4GT 4ZHQB 4RB1A 4DV7H 3K5LA 4LF7B 4WBNA 5IJ9A 2ZIOA 1G6UA 5KX5B 5IJ0A 3DSQA 5JVDA 4JI8B 4DR2H 2YIBD 5IWAB 1HNZH 3N44B 4BW9A 3HKEA 4LF6B 2VOBA 4F6RA 2P22C 2UXCB 2UUBH 5LP6B 1XQ8A 4ZOLB 4ZIBA 5EIBC 5LA6A 1QHTA 3KAKA 3W5OA 3T1HH 5LXTB 4HBNA 4KL1A 2RGRA 3VQVA 4FLWA 1JFFB 3MAQA 3RYIA 3TY5A 3B2EE 4O4LA 4KHPH 2YIAA 3UT5A 2Q7HA 4DR4H 4UCSA 4M7EA 4JI1H 1XNQB 3KXYT 4ZHQA 2UXBB 4FLVA 3JAWB 1Z5WA 4TUYB 2XIGA 5IJ9B 1HR0H 5FD5A 5J2UB 3HKBA 2CW8A 1HNWH 4YJ3B 4UCRA 4FLTA 4IAJA 1ZHSA 3NC0B 4DK0A 3RGBA 5JCOC 4X62B 2ZNJA 1FFXA 3RGXA 4CS2A 3LNNA 3CVZA 2ZIMA 1XI1A 2HHHH 1N34H 2O03A 5J2TB 2BTQB 1HR0B 4LR3A 1M93A 4B3RH 1J5EB 1D5AA 5EZYB 2XHBA 5FPOA 3J7AK 4O4JA 4GKJH 3T1YH 4F6RB 1L2ZA 1SEIA 4ZOLA 1BJTA 5JJNB 4DR5H 1X4TA 1VF7A 5CB4A 3JATA 3JAMW 4GKJB 5LOVB 4RB2C 3J80W 4EFBA 3L4JA 3N40P 2OWOA 4O4LB 5JCOA 1JFFA 4YHHH 1B04A 1N34B 1TA8A 4EQ5A 4LH7A 4LF6H 4DV1H 3RF2A 4X1IA 3JSNA 1CKNA 4NXMB 1SQFA 4TV8A 3HXLA 5D5QA 3THOA 4YY3H 3OTOH 5JVDB 1XHZA 1XK5A 5LYJA 2PYJA 1XDNA 1FFXB 4DRFA 1XMOH 5KHKA 1JJOA 1TAEA 4I50A 4JI7H 4JYAB 4CC5A 4DUZH 4FLUA 1N32H 3ICXA 1XHXA 4CH4A 5JQGB 3RJ0A 4JV5B 2ZINA 3BA8A 5EYPA 2PYLA 5KHJA 3N41B 1ZAUA 4RB3C 3BABA 3RFRA 5KMGA 3VNNA 4B08A 1SA0B 4LF5B 1CKNB 2R70A 1SQGA 1Z5VA 1Q5OA 5C8YB 4I9QA 2MCTA 1QQCA 5JH7A 1TGOA 1XMOB 2UUAH 3N2GB 2RJZA 3K3VA 4GKKH 1M0WA 4X1IB 3OTOB 3KAJA 5LP6C 3RYHA 1BGWA 2WDTA 5FNVB 4PZ8A 4LF9H 4X64B 4OX9H 1MZBA 2VUGA 4HNAB 2E5LB 4LFBB 3JALB 3E22B 2E5LH 1TVKB 4LNUA 5LA6B 5CA0A 4OX9B 2PUSA 2R72A 4FLYA 4ZI7A 4DR7B 5LXTA 3QWUA 2F95B 2Q0AA 3U11A 4EB6A 2KSWA 2ZNIA 2Q7GA 3RYIB 1S5JA 4MTEA 2R9AA 4FM2A 5CA1B 3BAAA 1YEWA 1O75A 1FKAH 3C0FB 1N36H 4FM9A 4A2AA 3SGIA 3TY8A 1NT2B 2HHHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH B;  4K0K B;  4GKJ B;  4LF8 B;  4DV7 B;  3S24 A;  4EFB A;  1XNR B;  2F4V B;  2VQE B;  2OWO A;  1IBK B;  4DUZ B;  4DR2 B;  4PZ7 A;  1N32 B;  1B04 A;  5LMU B;  1N34 B;  1TA8 A;  4EFE A;  3UQ8 A;  2CFM A;  3GB8 B;  4EQ5 A;  4LH7 A;  4DV0 B;  1X9N A;  4DV5 B;  4JI3 B;  4UCV A;  3JSN A;  1CKN A;  5D1O B;  4NXM B;  1P8L A;  4AQY B;  1HNZ B;  2UUA B;  1DGS A;  3NBY B;  4YY3 B;  3L2P A;  1S68 A;  1XK5 A;  3JSL A;  4B3T B;  2Q2T A;  3W1B A;  1XDN A;  4B3M B;  4LF9 B;  4JI0 B;  4DR5 B;  1VS0 A;  4DRF A;  1HNW B;  1CKM A;  2HIX A;  4LH6 A;  1TAE A;  1V9P A;  1HNX B;  1IBL B;  2ZM6 B;  4JYA B;  4CC5 A;  4GLX A;  4EEQ A;  4B3R B;  4JV5 B;  4LF4 B;  3BA8 A;  4X66 B;  4NXN B;  4DV4 B;  2HVR A;  4JI7 B;  4LF7 B;  4UCT A;  2HIV A;  1ZAU A;  3BAB A;  3VNN A;  4JI8 B;  2UXD B;  5IWA B;  4LF5 B;  2UU9 B;  1CKN B;  5D1O A;  5FPR A;  4JI4 B;  3T1Y B;  4LF6 B;  4DV6 B;  2UUC B;  3NBZ B;  3TY9 A;  4DV1 B;  3W1G A;  2UXC B;  4KHP B;  1FJG B;  1XMO B;  3W5O A;  2HVQ A;  4TOI A;  3KYH C;  3OTO B;  5DIS C;  1XMQ B;  3GDE A;  3TY5 A;  4PZ8 A;  4X64 B;  4DR6 B;  4E6N A;  4UFZ A;  4UCO A;  1N36 B;  4UCS A;  1XNQ B;  2VUG A;  2UXB B;  1FVI A;  1P16 A;  3RR5 A;  2E5L B;  4LFB B;  4DV3 B;  4DV2 B;  4LFC B;  4GKK B;  3BA9 A;  4UCR A;  4JI6 B;  1N33 B;  4JI1 B;  4X65 B;  4OX9 B;  3PN1 A;  4B3S B;  4DR7 B;  2VQF B;  3GJX B;  4X62 B;  3NC0 B;  1CKO A;  4JI2 B;  3QWU A;  4PZ6 A;  3T1H B;  4DUY B;  4CC6 A;  4DR1 B;  2HVS A;  1HR0 B;  2UUB B;  1J5E B;  3BAA A;  5FPO A;  3RTX A;  4DR3 B;  1I94 B;  5LMN B;  1A0I A;  4UCU A;  5D1P A;  2Q2U A;  4DR4 B;  3SGI A;  4LFA B;  4JI5 B;  5BR8 B;  3TY8 A;  1IBM B;  2HHH B; 
#chains in the Genus database with same CATH topology
 4AYB A;  3SJB C;  2RQ6 A;  5TIS Z;  2FML A;  2EIM B;  1KC7 A;  5KFI A;  2F4V B;  1ZHQ A;  3RYH B;  5KFW A;  2C28 A;  4YIP A;  1AIL A;  4TV9 A;  4BXX G;  1YI2 V;  1HNW O;  4A3K G;  1GRJ A;  2F23 A;  2L35 A;  2EIK B;  3PW0 A;  3JZ6 A;  3DC6 A;  3H4B A;  4WFA V;  3KTM A;  2QYZ A;  3J81 N;  3JD1 A;  3ZMV A;  1ZX3 A;  3ZHS A;  4MT8 A;  1VAJ A;  3HKZ E;  2VRZ A;  2CQY A;  3G6V A;  4ED3 A;  1IBM O;  1NTK H;  4IR9 A;  2DLN A;  3CRQ A;  5KX5 F;  1WN7 A;  4RUA A;  4JAS A;  5KFF A;  1Y67 A;  2Y0I A;  2EX3 A;  1AR4 A;  1QVF U;  2UUB O;  4J9R A;  3B09 A;  3S3X A;  2UVR A;  2ITD C;  2WLI A;  3K3W A;  4UV8 A;  4EEY A;  3OMN B;  1BZK A;  1T36 A;  5B5E Z;  2DE0 X;  2WYO A;  1KTA A;  4CMD A;  4O2B B;  3BQ1 A;  4LFC H;  4I4T B;  4CS3 A;  4CHI A;  4DV6 B;  2UU9 O;  3RYF A;  3Q1K A;  2IU0 A;  1Y1W G;  1K92 A;  4KHP B;  1JKJ B;  1QCE A;  5KT4 A;  4JI0 H;  1E1R G;  2LP7 A;  3R5X A;  4X9Q A;  3DXR B;  2C2R A;  1IBM H;  5DEC A;  2Q6A A;  4O84 A;  2QTS A;  1VQN V;  4GX0 A;  3GII A;  2WTF A;  1M4U A;  5CR5 A;  1WSC A;  3O9O A;  5EBW C;  1RFY A;  1O9H A;  2NLJ C;  1DV2 A;  1V55 B;  4HQ6 A;  3U9S A;  1EKF A;  3FFQ A;  4P9O A;  1Q3E A;  4JTD B;  4O4I B;  1N32 O;  3ABL C;  1N33 B;  1M5I A;  3KHG A;  2BSK A;  1WP8 A;  2NN4 A;  4X89 A;  2YIB A;  5IYZ A;  2W9C A;  1AVM A;  2JS5 A;  3WWH A;  4WBN B;  3N2K A;  4RAI A;  4CC6 A;  1OBG A;  4Q8F A;  2ZDQ A;  4R8C A;  5JQG A;  2YI9 A;  1N8R W;  2UXC H;  5B1B C;  2QK4 A;  3CSX A;  1JR9 A;  3CCR V;  1SCU B;  1OWT A;  2LGW A;  2BOB C;  4ZKI A;  1YHQ V;  2QKS A;  5KFY A;  2EIJ C;  1IXM A;  3FAV A;  2PTM A;  1F51 A;  1IBM B;  5JJE B;  4AQY O;  1D5N A;  4JI4 O;  3P3N A;  1VQP V;  2KKW A;  1TWH A;  3K5N A;  3IFX A;  3AK3 A;  3SYO A;  4MSW C;  3RW0 A;  4EGJ A;  5CA0 F;  2OYQ A;  3JZI A;  4QE9 A;  4FBU A;  3HB9 A;  3GQC A;  3N6X A;  4WFF A;  5LMU B;  1W93 A;  5B1O A;  3UQ8 A;  1I1L A;  1JX4 A;  2P5O A;  1KBL A;  2WLN A;  4DQN A;  1Y1V G;  1WAZ A;  4FM0 A;  1I6U A;  4L8J A;  4ME6 A;  2E3C A;  4GKJ O;  4QJF A;  1IUR A;  2PBZ A;  5J9P C;  3RUP A;  4C7U A;  5JUM A;  4GX2 A;  1BXR A;  2MW2 B;  3GTK A;  1VMG A;  2R7L A;  4DR3 H;  5GW7 A;  4FFB A;  3ZHR A;  1Z2O X;  3RB0 A;  3H1H H;  4BW5 A;  4QWB A;  3L74 H;  2DWD C;  2B63 G;  5EOY A;  1OCZ C;  2WB1 A;  4Y8V B;  1Y1V A;  2DPJ A;  4MTG A;  4X20 A;  2QDO A;  4JYC A;  2YSU B;  1XUQ A;  2JA7 G;  5KS8 A;  2HVR A;  5DGA A;  5KFD A;  1M90 W;  4BBR G;  4DR4 O;  4FU0 A;  2LW7 A;  1PP9 H;  5BWW A;  2WLL B;  4O7Y A;  5IYD O;  2GHY A;  2UXD B;  2Y4R A;  2UUC O;  3UZO A;  3LSU A;  2YC0 A;  2QEX V;  5H80 A;  1BQ0 A;  2A06 H;  2AGO A;  5BMV B;  3RYC B;  4TV8 F;  1WJZ A;  4CH5 A;  3W1G A;  1PNK A;  2VWK A;  2YXY A;  3RT3 C;  1DTO A;  2V4D A;  3PW7 A;  2ODT X;  3FYI B;  2CGO A;  5LYJ B;  1FXK C;  2GUZ A;  3HT5 A;  1IDS A;  3ZMT A;  1I1K A;  2Q73 A;  2QM4 A;  4Z1V A;  3HOV G;  3L9D A;  2ZT9 B;  2NU9 B;  2R93 A;  4X62 O;  1Z2G A;  2W9B B;  4MS2 A;  1SC5 B;  3WB2 A;  1R6K A;  3G8C A;  4UFZ A;  4X65 H;  2HG8 A;  5EZY A;  2JGU A;  2CDY A;  4I4T A;  3K03 A;  3RR5 A;  1EZV H;  4DV2 B;  3B40 A;  3T9B A;  5CAE B;  3FKI G;  5LP6 A;  1AB3 A;  1RSO A;  5K3W A;  4GKK B;  2LQT A;  4PDM A;  1K97 A;  3PN1 A;  2CKZ B;  1H2M A;  3E8F A;  2ASL A;  5GON F;  2JS3 A;  2JA8 G;  1JVM A;  4QWC A;  4YJ2 B;  3LSS A;  3ETJ A;  3RFC A;  1JLL B;  3VPD A;  1AI5 A;  1AJQ A;  1LUW A;  1L1F A;  4C5C A;  1LR1 A;  1ROP A;  3VQX A;  5J2U F;  5D5P A;  2FJZ A;  4GC7 A;  2J6S A;  3CC2 V;  1SA0 A;  3T9C A;  4N23 A;  1RPO A;  3G80 A;  4DR3 B;  4X64 H;  4O3R A;  3PJS K;  1COW G;  4FLX A;  2XC9 A;  3LML A;  2PGG A;  4LFA B;  3VPB A;  4I0X B;  2ZR2 A;  2ZE5 A;  4GT1 A;  3BRC A;  2DYR B;  2GUZ B;  4U7C A;  2ATK C;  2ZGI A;  5LA6 F;  2XAS A;  1I2L A;  4H33 A;  2DAB A;  1QBZ A;  4IWY A;  4RUC A;  4RUF A;  1Q90 D;  4A3J G;  3HOW G;  3EPI A;  2UXX A;  3L75 H;  1IBK O;  5DGI A;  5KG5 A;  5DGB A;  3QTC A;  3EYY A;  3TIG A;  4JTA B;  3K0G A;  1P8L A;  4JYA O;  1HNZ B;  2IJJ A;  2G38 A;  4LF7 H;  2FLP A;  3OUF A;  2X6C A;  2Z5U A;  4R6Z A;  1AUX A;  2WAQ A;  4R7R A;  1T3N A;  2W9A A;  1GYF A;  4DV5 O;  4DR5 B;  3SPH A;  4AIL C;  2FKL A;  1I0H A;  4JI3 H;  2XAJ A;  3M9O B;  3JAS B;  3CCV V;  2R6F A;  1MZF A;  4X1Y A;  4GLX A;  1OCO C;  2N04 A;  1Y74 B;  4ETS A;  4F4W A;  1S03 G;  4B3R B;  2W9C B;  2M7W A;  1XOU A;  4ZHQ B;  1KJJ A;  3UO2 A;  1NVP D;  4LF7 B;  4G3I A;  2ZIO A;  1G6U A;  2A9H A;  3CRM A;  2V5A A;  3OUU A;  2Q5Z A;  1DK1 A;  5KG2 A;  3SDL A;  2ASJ A;  4U7N A;  2YS6 A;  4JI8 B;  4DR2 H;  3MR5 A;  5B3S B;  2DQ3 A;  1B6Q A;  4LF6 B;  2VOB A;  4Q8E A;  1NTZ H;  4GZR B;  2DZD A;  3T4Z A;  2SCU B;  1RJQ A;  3ZHQ A;  1QHT A;  2C00 A;  3KAK A;  3T1H H;  1V51 A;  4QWA A;  1GN2 A;  1JFF B;  4TWK A;  3MAQ A;  1T94 A;  3JRW A;  2AXT Z;  1UFI A;  4G28 B;  4TUY F;  4ECX A;  2YIA A;  4ECY A;  4M0J A;  3HKZ A;  4FFN A;  4M7E A;  1XNQ B;  5L3B A;  3JAW B;  1R9T A;  1E4E B;  5FD5 A;  4MVS A;  4QNH B;  2UXD O;  3TQ1 A;  1ORQ C;  1K83 A;  3DC5 A;  5I47 A;  3JZF A;  4LFC O;  2XT9 A;  3OW2 U;  3JD3 A;  1DF4 A;  2L6L A;  2F4V O;  4IRD A;  2ZIM A;  1K4C C;  2NR5 A;  4JYY A;  4KP4 A;  2HKO A;  5KFQ A;  2JDI G;  3C3T A;  3T9A A;  2EJ2 A;  2ADQ B;  5J2T B;  1D2D A;  1EYZ A;  1GO3 E;  3K5H A;  3Q2O A;  1J5E B;  3J7A K;  5FPO A;  5C4X G;  2HG5 C;  3PW2 A;  4IL6 Z;  4F6R B;  1N36 O;  1SEI A;  1GM9 A;  2R87 A;  4DR5 H;  4TV9 F;  1K1Q A;  4FPP A;  1VF7 A;  4YIO A;  3R9R A;  4GKJ B;  5DAA A;  1RJP A;  1EKP A;  3W7X A;  1DAA A;  1KEE A;  5EK0 A;  4BAY A;  3PFF A;  2IJI A;  5FLX N;  2M05 A;  2OT5 A;  1CP9 A;  4I5S A;  5F9L A;  4BIO A;  3H01 A;  4DV1 H;  3RF2 A;  4X1I A;  3JSN A;  4NXM B;  4HR7 A;  2BCC H;  2ZR3 A;  2QB5 A;  2AHY A;  4LP8 A;  4B7E A;  5D5Q A;  3UM7 A;  2YZN A;  4TQR A;  1FFX B;  1XMO H;  4JAV A;  3W7S A;  1EN4 A;  3SPI A;  4FZ1 A;  1EUC B;  4JI7 H;  5LHI A;  1LNQ A;  1JDB B;  4DUZ H;  3FDS A;  2KB1 A;  4FLU A;  3J80 N;  1EZ1 A;  1UC8 A;  4JV5 B;  3T9D A;  3BA8 A;  4DV3 O;  1VQO V;  3ORQ A;  2J6U A;  2WLJ A;  3QO8 A;  1IOW A;  2DPI A;  2E74 B;  4RB3 C;  3BAB A;  3VNN A;  4B08 A;  4LFA O;  1ET0 A;  4DO2 A;  4U6P A;  1SQG A;  1Z5V A;  1THZ A;  3DTU B;  3F5T A;  2BQ3 A;  4IHJ F;  2R8G A;  4JAU A;  3K3P A;  5GTH Z;  4PA4 A;  1FFT B;  4DUZ O;  2HJW A;  2DMX A;  4A3C G;  1JQ0 A;  1NKD A;  2UUA H;  2Q69 A;  3CCS V;  4ZHQ F;  3F7V C;  4F4X A;  5LP6 C;  3RYH A;  4JI5 O;  5FNV B;  4LWS A;  5B66 Z;  4FMT A;  4YB8 B;  4OX9 H;  3SYP A;  2VUG A;  3B8N A;  4DL3 A;  2P4K A;  4QWD A;  2IU3 A;  4HNA B;  2EUL A;  1VF6 C;  3JAL B;  2IJK A;  4B3S O;  2QF7 A;  3ML0 A;  5CA0 A;  2PUS A;  3GLK A;  3Q8R B;  2R72 A;  4TVI A;  1N56 A;  4WHX A;  3IGA C;  3KZI Z;  3QWU A;  1GM7 A;  2Q0A A;  2XD4 A;  4HNU A;  5KT2 A;  2R7K A;  4Q44 A;  2EJR A;  2Q7G A;  3JD2 A;  4UVC A;  1M1K W;  1Y6X A;  3GWK C;  4J7K A;  3CJH A;  1HDJ A;  3NR7 A;  4BBS G;  3GB7 C;  4QSH A;  4J42 A;  2CNU A;  3BAA A;  5DLF A;  4WF9 V;  1O75 A;  1FKA H;  2W6J G;  5KFR A;  1GGO A;  1XNQ O;  4A2A A;  2Y4U A;  2JEX A;  3SGI A;  2FPI B;  1N33 O;  3LDC A;  1VQ8 V;  1F7Y A;  3N42 B;  3HOU G;  4A3F G;  1Y74 A;  3ZMS A;  4RZQ A;  4DL2 A;  2F4V H;  2DYS C;  1M57 B;  3T99 A;  5C93 A;  3CCU V;  4WCE V;  4DR2 B;  3GTM A;  1N32 B;  3M7M X;  4DRX B;  3HB3 B;  5DED A;  3T1C A;  3H3V H;  4HNA A;  1I94 O;  2FK1 A;  1FJG H;  3ZS8 C;  3ASN B;  4BY1 G;  3VQW A;  3FAV B;  5L1K A;  2LFR A;  1ZLZ A;  5JH7 F;  4LF7 O;  2Z02 A;  3JSL A;  4UXN A;  2EJ3 A;  2YZM A;  4DW0 A;  4LH6 A;  4O82 A;  4EBC A;  1IBL B;  1CE8 A;  2ZM6 B;  4RNN A;  3N43 B;  2IM9 A;  4UV9 A;  3U0Z A;  2HJD A;  4U3F H;  4PJ0 Z;  4NXN O;  2UXC O;  4PI0 A;  4GC6 A;  3BEH A;  2E5L O;  1EN6 A;  1YVW A;  1SES A;  1X59 A;  2FPP B;  4W4K A;  4A3M G;  4OX9 O;  1W59 A;  1VQ5 V;  3QZ8 A;  3GTQ A;  3B77 A;  4O4H B;  3ZRV A;  4DUY H;  3DTG A;  4L1K A;  2E75 B;  4Q45 A;  5GON A;  3TCU A;  2UUC B;  2RGV A;  3MFI A;  5I5T A;  1K73 W;  1AJP A;  3FD9 A;  1A9X A;  4PDR A;  2HLD G;  4FBT A;  1M0T A;  1ZSP A;  2A0L A;  3K59 A;  3Q8S B;  1YJW V;  3GDE A;  5KFG A;  2C2A A;  2Y0S A;  3CMA V;  2QWR B;  4NZN A;  4FE2 A;  4X88 A;  3APQ A;  4PI2 A;  5BYA A;  2W6I G;  1KD1 W;  2LW1 A;  1GK9 A;  3ETH A;  4JV2 A;  3G4S V;  3MHS C;  4MTD A;  3APO A;  4J9K A;  4CH3 A;  4JI6 B;  4JI1 B;  3GJX B;  4JI2 B;  1C30 A;  4PA3 A;  3BCC H;  4R50 A;  4A2B A;  4DR6 O;  3V6J A;  1KC8 W;  2W6P A;  1NI8 A;  3T1H B;  1WRV A;  4DUY B;  1CS0 A;  3WO1 A;  5KUM A;  3WFV A;  1Q7Y W;  4DR7 H;  4EKW A;  3D36 A;  1CEZ A;  5KFS A;  3CS5 A;  5KG3 A;  4GKK O;  3RIZ A;  3VOU A;  1CQI B;  1I94 B;  2HJF C;  4I55 B;  4LSX A;  5JQW A;  5D1P A;  4DV1 O;  4MV7 A;  5DIS C;  1SER A;  4QPK A;  2WLL A;  1I08 A;  4X20 B;  1C3O A;  5C8Y A;  5HFM A;  2YWV A;  3MWD A;  3RV3 A;  3GV7 B;  4MA0 A;  3PW4 A;  4WFG A;  1IBK B;  4UUG A;  3ZMU A;  5CBH A;  1ENV A;  3GB8 B;  1OCZ B;  5FLX W;  1X9N A;  4DV5 B;  4DR5 O;  1WB7 A;  4JI3 B;  5KFZ A;  2KG7 A;  3H1L H;  4B3S H;  1K7D A;  1XEQ A;  5K1P A;  5BMV A;  3RYC A;  5J2U A;  1YIT V;  3I56 V;  2EJ7 A;  2HFE C;  1AR5 A;  5IDJ A;  2XOK G;  1B6R A;  3BJY A;  3SYQ A;  5JH7 B;  1YIJ V;  2HGW A;  2OIE A;  5KFV A;  3L2P A;  1ZWI C;  1S68 A;  3AG3 B;  4LF8 O;  4O83 A;  4X62 H;  4JI5 H;  2Y48 A;  4YY3 O;  1J95 A;  4DR3 O;  4B3M B;  4XZ3 B;  3W7W A;  5BWX A;  4DR6 H;  1CKM A;  5L3F A;  4FGR A;  2RDI A;  5EWF A;  3OTF A;  2W9B A;  4YXW G;  4MVQ A;  4J10 A;  4MTO A;  1TUB B;  4FIP C;  4FZ0 A;  4X66 B;  1FAF A;  4N21 A;  4YJ2 A;  2E2H A;  2XAF A;  2QSA A;  5IYD G;  3BY6 A;  4NB5 A;  1Y14 B;  4LFA H;  2RMK B;  5JVL A;  4ECQ A;  3ABT A;  1K4D C;  4JI4 H;  1PL4 A;  3JAW A;  2PZS A;  3UO3 A;  4X1K B;  1YTF B;  1KU9 A;  3V4Z A;  5KFO A;  3TET A;  2ITC C;  2NU8 B;  4JI7 O;  1VQM V;  5I5U A;  4TOI A;  2YL2 A;  4B3R O;  2WB1 E;  1H2N A;  5E1A C;  2VA2 A;  2WWW A;  4PA7 A;  1ZTE A;  5KFL A;  1I7F A;  1KEC A;  3A0B Z;  2F93 B;  4TV9 B;  4DUY O;  1N34 O;  1W96 A;  5I5X A;  4A3L G;  4MV8 A;  3PO2 G;  3T54 A;  3HKD B;  3CC4 V;  4DV3 B;  5LMU H;  4LFC B;  2LJ2 A;  2QKC A;  3CHX A;  4NXN H;  1NR1 A;  4MVM A;  4X65 B;  5DMX A;  4X66 H;  4IHJ B;  1YXB A;  3SYA A;  5LMN O;  3G6E V;  1YJ9 V;  4AHC A;  4APM A;  1Q6U A;  4PZ6 A;  3OHB A;  5L3C A;  2WE6 A;  1J5E H;  2FB5 A;  4DV0 H;  4JXU A;  1EHI A;  2AZ0 A;  3HKC B;  3K79 A;  1W0K G;  2OIG A;  4LFB H;  4LSA A;  3E89 A;  2ZKO A;  3KHL A;  2R85 A;  3QO7 A;  4JI0 O;  4NXM O;  2NVY A;  1WH2 A;  4Q6G A;  1R3J C;  3JAR B;  2GPS A;  1MNG A;  2EIL C;  4DR4 B;  2Q2U A;  2ASD A;  3JAS A;  3HBL A;  4RCN A;  4K0K B;  2ZXW C;  3QG5 A;  5K2M A;  3SE7 A;  4LF4 O;  3JAL A;  4MVR A;  3U9T A;  5HNE A;  3RYF B;  3RVY A;  2UVU A;  2EZO A;  3RB6 A;  5LGU A;  1TWC A;  5KHH A;  5KG7 A;  1MSW D;  4EFE A;  2COI A;  2CFM A;  4P2Z A;  4O4J B;  3MHH C;  3ETQ A;  1WLE A;  2V4Q A;  2W8K A;  3K5O A;  2QWN B;  1VQL V;  4LF5 O;  4R7C A;  3HOX G;  1KJ9 A;  3UT5 B;  2P06 A;  1RSO B;  2YEV B;  4IHJ A;  3NBY B;  1KKD A;  3NUA A;  2Q2T A;  1Q82 W;  1VQ9 V;  2Q0O C;  3E8G A;  3ASO B;  1VAR A;  2Q7D A;  3TGU H;  4H37 A;  2HIX A;  1HNX B;  2D3O W;  3F7Y C;  2A7W A;  4PWQ A;  3H9V A;  4PDB A;  3ABK B;  3N6R A;  4EEQ A;  2IJH A;  1VQ4 V;  2W6Q A;  4PEL A;  3UFX B;  2EIM C;  4O3O A;  5DLG A;  3WNZ A;  1OCC B;  2X5R A;  5KX5 B;  2CTP A;  4X65 O;  3BFR A;  3KCY A;  5IWA B;  4ECU A;  4F50 A;  3T9E A;  2BE3 A;  4F6R A;  2P22 C;  1EFR G;  1V55 C;  1F23 A;  2UXC B;  3GIP A;  4I7Z B;  2GBO A;  2X0S A;  5FL7 G;  5C1O A;  3W5O A;  2Y69 C;  5IP7 G;  4HBN A;  4KL1 A;  4JI3 O;  1KJI A;  1QU7 A;  3ZN1 A;  3CQZ A;  2JEU A;  4O7L A;  3RYI A;  4CZZ A;  1GN4 A;  1S0N A;  5DQH A;  2EZP A;  3OEH G;  5BR8 O;  1QLE C;  1XMQ O;  2YEV A;  1IBL O;  2COJ A;  4DR4 H;  2XTA A;  4A3B G;  2XAQ A;  4WFE A;  1OBD A;  1H8H G;  5IJ9 B;  1HR0 H;  5J2U B;  4O3N A;  3EPG A;  1IXB A;  3T5K A;  1HNW H;  4FS2 A;  4UCR A;  4FLT A;  3T2M A;  4IAJ A;  1GN6 A;  3OE7 G;  4DK0 A;  2JIZ G;  3RGB A;  1AI4 A;  2R92 G;  2ZNJ A;  3RGX A;  4CS2 A;  3LNN A;  3CVZ A;  1XMO O;  2Y69 B;  5I5Y A;  1S0O A;  1XL4 A;  1GM8 A;  3EFF K;  3K5I A;  4HZ3 A;  2O03 A;  1DLB A;  3ZHT A;  4A3I G;  4CKC A;  2BTQ B;  4JYB A;  3OTO O;  1HR0 B;  4BIU A;  1US6 A;  2KQX A;  2XHB A;  1MG1 A;  1R3L C;  1ULZ A;  2ZE7 A;  1PM9 A;  1IYD A;  3IC9 A;  4U7O A;  1BHA A;  3BAC A;  5JJN B;  4ED7 A;  1V54 B;  1X4T A;  4NKG B;  5LHH A;  2XGQ A;  5KAF Z;  3Q8P B;  5CB4 A;  3JAT A;  5LOV B;  4J9Y B;  4EFB A;  4Q43 A;  3N40 P;  1I50 A;  2FKX A;  3U55 A;  3ORR A;  2IH3 C;  1JFF A;  3X2Q C;  4GX5 A;  1FJG O;  4UUJ C;  4NZO A;  2WAQ E;  1B04 A;  1IX9 A;  1N34 B;  4YHH H;  4WBN F;  4TQS A;  4LF6 H;  2P7T C;  2KSD A;  4O7W A;  5IY5 C;  2XUM A;  5IYZ F;  4ECW A;  2CUG A;  3ASO C;  3HXL A;  3VBB A;  3JD0 A;  2JJ1 G;  1Q86 W;  2V7Q G;  1TWF A;  4YY3 H;  4A3E G;  5JVD B;  1XHZ A;  4PA6 A;  4UVB A;  3OD4 A;  3P30 A;  1Q81 W;  4J11 A;  2V4R A;  2DIK A;  3MDS A;  3RB3 A;  2CH7 A;  5KHK A;  1JJO A;  3TXQ A;  1TAE A;  1S5H C;  4I50 A;  2VQF O;  5H9C A;  5KFU A;  4XBF A;  1EZJ A;  3K08 A;  5EDW A;  4NYK A;  1KP3 A;  3RJ0 A;  1JPX A;  3RAX A;  2ABJ A;  2A1H A;  5EYP A;  4DL6 A;  2PYL A;  5KHJ A;  2PMZ E;  4FFP A;  1PK8 A;  2ZE6 A;  1ZAU A;  4JUZ A;  4O7V A;  4EBE A;  1SA0 B;  2RCV A;  4O2A F;  2HVK C;  3ABM B;  3AG4 B;  1CKN B;  1BHB A;  2PI5 A;  5KFA A;  3ABM C;  3AG4 C;  1Q5O A;  5KFP A;  4I9Q A;  1PNM A;  4O4L F;  1N4C A;  1QQC A;  5JH7 A;  4A93 G;  1NH2 D;  3ZMZ A;  2F43 G;  2WLM A;  3PR5 B;  2QM7 A;  3N2G B;  2R7Z G;  2RJZ A;  3K3V A;  4GKK H;  1M0W A;  1VKZ A;  4X1I B;  3KAJ A;  4C5B A;  4CMF A;  2IW5 A;  4IZO A;  1AP6 A;  3GIL A;  3V4S A;  4LF9 H;  1NTM H;  2DJV A;  3MD0 A;  3HPL C;  2Q8V A;  2Z3Y A;  1NBM G;  1XBL A;  4F4L A;  3OHA A;  2E5L B;  1L0N H;  1WA8 B;  3E22 B;  4ED1 A;  5CMU A;  2OTL V;  2GQR A;  4ED2 A;  4OX9 B;  4DL4 A;  3KHH A;  4DR7 B;  2YDE A;  2F95 B;  1JX9 A;  1BNC A;  4EB6 A;  3RYI B;  3Q8Q B;  1S9F A;  1S5J A;  4MTE A;  1AUV A;  3R66 A;  3X2Q B;  1M57 C;  4JGS A;  4FM2 A;  1ARO P;  1YEW A;  5HFL A;  2WLH A;  3C0F B;  3I12 A;  1L0L H;  3G71 V;  5GTI Z;  5KG0 A;  4J9L A;  3M8A A;  5BZB A;  5H5N A;  4JI6 O;  1KKC A;  3KHR A;  1QR9 A;  2HHH B;  2NU6 B;  5B1B B;  1W0J G;  4LF8 H;  2DW4 A;  3CXC U;  4YBZ B;  4I4T F;  3QNE A;  2ARH A;  4E4E A;  1H38 A;  5GON B;  1GO3 F;  1R6T A;  1SYX B;  4DUZ B;  4W4L A;  3FB6 C;  3JAK B;  4DV0 B;  2PY5 A;  1S3J A;  3IN5 A;  1K5S A;  4UCV A;  4JI2 O;  4E4T A;  1KQS U;  4I55 A;  3E83 A;  1WPB A;  4MVU A;  5EIB D;  1ZQ7 A;  2W71 A;  2A79 B;  4JZ2 A;  2UUA B;  3QQM A;  1DGS A;  3MR2 A;  4KFM A;  4YY3 B;  4J7J A;  5CA0 B;  3K06 A;  3K58 A;  1YJN V;  5BR8 H;  3T7A A;  4J0M A;  1S72 V;  2H3O A;  4BWA A;  4ZOL F;  1H2G A;  1PL0 A;  4X1K A;  4LF5 H;  1F4N A;  1OZ0 A;  1QLE B;  2XCP A;  3N27 A;  3RB4 A;  1GSO A;  1I94 H;  2YID A;  4JF3 A;  5KT6 A;  5IYB G;  4RAY A;  3CJH B;  2KG7 B;  3KG2 A;  3CCQ V;  2Y4T A;  1E1Q G;  3CEI A;  1I5Y A;  2CTQ A;  4CH6 A;  4IIJ B;  2HP8 A;  4F4Z A;  4QIW E;  2YRW A;  1Y76 B;  4TM5 A;  3VQY A;  5B1A C;  3ZN0 A;  4XYM B;  1HWY A;  4FFB B;  1EUD B;  1UNN C;  3RBE A;  5D1O A;  5FPR A;  2ZDI C;  3T1Y B;  1N33 H;  3HR0 A;  3CEB A;  1GMG A;  4J9S A;  4L87 A;  3AK1 A;  2HGS A;  1FXH A;  4QIW A;  3JAT B;  3LUL A;  3GWO A;  4DV4 O;  2R82 A;  5FD6 A;  1O9G A;  4GCZ A;  5BYB A;  2HVQ A;  3QZ7 A;  2XND G;  2PN1 A;  1PNL A;  3BHP A;  2W6Z A;  2YW2 A;  2PMZ A;  4IRK A;  4K8Z A;  5ITZ B;  1MZE A;  1V54 C;  4B3M H;  3WO0 A;  4DR6 B;  4E6N A;  4HNT A;  2K9P A;  3QFF A;  2FMA A;  2YIC A;  1P16 A;  2CNV A;  3G67 A;  3L70 H;  2DOS A;  2W7O A;  5LYJ F;  1LUV A;  2YS8 A;  5L1I A;  5LMU O;  1GH6 A;  4DV2 O;  1Z2N X;  3DF7 A;  1P7B A;  2VQE H;  3ETD A;  5A2Q W;  4ED0 A;  2VA3 A;  1CKO A;  4JV5 O;  2R93 G;  3SNO A;  4K3A A;  5LL6 b;  1L8D A;  5IJ0 B;  2GTS A;  1S76 D;  4FS1 A;  4E2L A;  2UUB B;  2CZG A;  3E5N A;  5EYP B;  4O2B A;  3T5H A;  2HR3 A;  4MVO A;  2FE3 A;  2ZM6 H;  1IYE A;  2Q67 A;  1Z2P X;  3T5L A;  2VS0 A;  2W57 A;  5KT5 A;  2UVV A;  3CX5 F;  1N48 A;  5FJ8 G;  3WG7 C;  3M9M B;  3G6Y A;  4DR1 O;  3LQS A;  4DV7 B;  4O7Z A;  2JVD A;  4WD3 A;  5KFX A;  4NTW A;  4O4I A;  2UXB H;  4RNO A;  1JMK C;  2EBO A;  3AG2 B;  4DV3 H;  4PA9 A;  1G1X B;  5KMG B;  2GPW A;  1IZ3 A;  5J2T F;  2GSM B;  4YR3 A;  3CPW U;  4TUY A;  2DN9 A;  2FB9 A;  4FVM A;  4LMY A;  4YJ3 A;  5KX5 A;  3KAL A;  5KFK A;  4GUN A;  1WB8 A;  3KKY A;  3QO5 A;  1NS1 A;  1VS0 A;  4JV5 H;  3H20 A;  3FB8 C;  5IWA H;  4RB0 A;  4FLZ A;  1GLV A;  5C1P A;  3N2K B;  3OMA B;  3JAK A;  1M56 C;  3JD4 A;  2VQE O;  4ZI7 B;  1FKA O;  4IYI A;  2JA5 G;  2DYS B;  1R3K C;  3PW5 A;  1S77 D;  4MTF A;  4LF4 B;  4FFO A;  4RAZ A;  1R3I C;  1XDC A;  1VQK V;  3D3I A;  5E25 A;  4H0L B;  2P4V A;  3TEK A;  1XNR H;  1RM1 B;  2F66 C;  3BPZ A;  2HIV A;  3K5M A;  2R7M A;  3TW6 A;  1UJW B;  5H2F Z;  1UC9 A;  1G8M A;  2IH1 C;  2ZD9 A;  2Q4P A;  3OEE G;  4YP3 A;  4B3T O;  4JAA A;  3RBZ A;  1KBH A;  3OT7 A;  1SF9 A;  3NBZ B;  1N0J A;  1VBG A;  2Y0P A;  5KG6 A;  3ZRX A;  2V58 A;  4DV4 H;  3CD6 V;  3SYC A;  5FR9 A;  4LBE C;  3KYH C;  3RGZ A;  3JCZ A;  5KUK A;  1NVP B;  4CS4 A;  1OCO B;  4H44 B;  4DRX A;  1HNX O;  1I7N A;  2HHH O;  3JAR A;  2R7Z A;  3ABU A;  4BWS C;  2YCH A;  1SKV A;  1FVI A;  3F8N A;  2A3Q A;  5CB4 F;  3R23 A;  4QPJ A;  3GIK A;  1HW7 A;  1VQ6 V;  5FNV F;  2VUM A;  2IMW P;  2B5U A;  3RN4 A;  4B3T H;  2OCC B;  5CB4 B;  5D8D A;  1YF2 A;  3GV8 B;  3TII A;  4RZR A;  1VEW A;  4EBD A;  2Z0A A;  3G6X A;  5BPF A;  1KP2 A;  2FTK A;  4DR1 B;  4KHP O;  2HVS A;  3PR4 A;  1M56 B;  2XAH A;  2W6M A;  1BCC H;  3ZX6 A;  1P49 A;  3CCJ V;  3E2E A;  2CK3 G;  1W2B U;  1R1B A;  4DYL A;  5BR8 B;  1QNM A;  4O4H A;  4NVP A;  2R84 A;  1JCH A;  1SRY A;  2AHZ A;  5KA5 A;  1OCR B;  4J80 A;  1HNZ O;  4K0K H;  4X8A A;  4DV6 H;  1BMF G;  2HEP A;  1VIB A;  3OGI B;  1TVK A;  2IBZ H;  4LCU C;  4LNU B;  1GSA A;  4YR2 A;  2DWE C;  3U10 A;  3DAA A;  4LF4 H;  2LGQ A;  5FNV A;  2CW7 A;  3HO8 A;  3CC7 V;  1CQJ B;  4K6N A;  2VPS A;  3GIQ A;  5KFB A;  2YU9 A;  2X0L A;  1R73 A;  4J9P A;  4EYH B;  1RK6 A;  5D1O B;  3VPC A;  3WB0 A;  3HKD A;  4NXM H;  1K1S A;  4IR1 A;  3IC7 A;  4JI8 H;  5KFT A;  4Z1M G;  1OCR C;  4I50 F;  1Y1W A;  5B1N A;  1IBL H;  3DGE A;  3ZRW B;  4DR1 H;  4B3T B;  2W6N A;  4AQY H;  2ZQM A;  4LF9 B;  3M4I A;  4DV0 O;  2JEJ A;  4JI8 O;  1S10 A;  5ITZ A;  3HKC A;  4Q0Y A;  1TUE B;  3AYH B;  2GTA A;  3BVO A;  4YR0 A;  2UVW A;  1IBK H;  1SQQ H;  4B7K A;  1E4G T;  5I5V A;  3K5L A;  2DQ0 A;  5KAI Z;  4WBN A;  5IJ9 A;  2M6Y A;  2ZXW B;  3DSQ A;  5JVD A;  1HNZ H;  2CNQ A;  3N44 B;  2JA7 A;  2AZ2 A;  3HKE A;  4XX0 B;  4DV7 O;  1OJH A;  3L73 H;  3STL C;  3T5J A;  4HN2 A;  1B3Q A;  1B6S A;  3A0R A;  1XQ8 A;  4ZOL B;  3C90 A;  3CYO A;  5EIB C;  3E35 A;  4MV4 A;  5LXT B;  4C5A A;  2RGR A;  3VQV A;  4FLW A;  4B3M O;  4MV1 A;  1EBO A;  4KHP H;  1GAX A;  1SQB H;  2EJ0 A;  3OUZ A;  3TIN A;  1BE3 H;  1P7G A;  2C2D A;  1B33 N;  4F4Y A;  2Q7H A;  4IIJ F;  3JAM N;  4JI1 H;  4JZG A;  4ZHQ A;  2UXB B;  4FLV A;  1YTF D;  1Z5W A;  2P90 A;  4J9Z B;  2XIG A;  5F9N A;  1M7J A;  3HKB A;  2CW8 A;  4IWX A;  2EIY A;  1SQP H;  3AG1 B;  4ZBM A;  2ILM A;  1FD9 A;  4I0X A;  3AW8 A;  3NC0 B;  1M9N A;  3E8H A;  2EIK C;  4EGQ A;  2BR0 A;  4HAM A;  1I7L A;  2HGX A;  3SPJ A;  2YRX A;  1SFO A;  1OV9 A;  1SZX A;  2HHH H;  2VQD A;  2B63 A;  2JEF A;  1XL6 A;  2BQU A;  4LR3 A;  2HVJ C;  3R5F A;  2QKA A;  4UB8 Z;  3B8M A;  1YCI A;  2W7P A;  5KA6 A;  4MW8 A;  3TXS A;  2RF4 A;  5KFE A;  3PZP A;  4YAK B;  5JWP A;  4ZOL A;  2QR4 A;  2ZDI A;  1YSC A;  4LFB O;  2R86 A;  1ZL8 B;  3IJ4 A;  1VQ7 V;  1E4E A;  2AW9 A;  4RB2 C;  3KRE A;  5CA3 A;  1OHH G;  4O4L B;  1J5E O;  3FX7 A;  5JCO A;  4A3D G;  1DIK A;  1TA8 A;  4EQ5 A;  4LH7 A;  2JA5 A;  2EIN B;  3OM3 B;  1CKN A;  2FL4 A;  4ECR A;  4TV8 A;  3E8B A;  5IWA O;  5I60 A;  4OGQ B;  1AI7 A;  3THO A;  2QA4 V;  4DV6 O;  3OTO H;  1P4R A;  3P32 A;  2PYJ A;  4QIW F;  3WWI A;  2QM8 A;  1XDN A;  5BWR A;  2W0X A;  2MK3 A;  4PD4 F;  3UYY A;  2JGD B;  3U0G A;  4O3Q A;  1JXL A;  2J6T A;  4X64 O;  4PBC A;  4JYA B;  1SZT A;  3GIM A;  2LFS A;  2OCC C;  5JQG B;  4CH4 A;  5C5J A;  4ECS A;  4RWU A;  3E86 A;  3N41 B;  5KT7 A;  1IVS A;  2W8L A;  3RFR A;  5KMG A;  2YZG A;  1FXK A;  1K5Q A;  2DYR C;  3C3S A;  3HOY G;  2YZL A;  3ASN C;  4XDK A;  4LF5 B;  4DIM A;  2R70 A;  3OR7 C;  4AYB E;  2RN9 A;  3V6K A;  3LSQ A;  1XMO B;  5IY5 B;  5C8Y F;  5IYC G;  2N74 A;  1GKF A;  3OTO B;  3CCL V;  4O2B F;  4J9O A;  3FKS G;  4YQW A;  5HBR B;  4P9P A;  4RO2 A;  4NR1 A;  5IE9 A;  1KYO F;  2JA6 A;  1SET A;  3ABL B;  4OPA A;  2AGQ A;  3I4N G;  4LFB B;  1YDX A;  2E5L H;  5BXZ A;  1TVK B;  4LNU A;  4PDV A;  5EBM C;  2DAA A;  5LA6 B;  3JYC A;  5LXT A;  4AI8 A;  3U11 A;  2KSW A;  5BY1 A;  2ZNI A;  3CRA A;  1WR2 A;  4ECV A;  4FFM A;  2GLT A;  2OLS A;  1RP3 B;  4ED8 A;  2R9A A;  4KXR A;  5KLV H;  1K8A W;  4K35 A;  3MFH A;  5CA1 B;  2VUM G;  4JV1 A;  5C44 G;  1N36 H;  4JV0 A;  3FKI A;  1YZB A;  4J9Q A;  4FM9 A;  3AG7 A;  2AU0 A;  1AI6 A;  1NT2 B;  3D36 C;  4EG0 A;  4O3S A;  1KUT A;  3VA7 A;  2VWJ A;  4U3J A;  5EBL C;  4LF8 B;  3H0G G;  2R8K A;  3OMI B;  3ETE A;  3N2G A;  5BWU A;  4DLK A;  4O81 A;  2E2I A;  2ZDG A;  4ED6 A;  5IYB O;  2NUA B;  1MSD A;  4TSF G;  4UVA A;  5T14 A;  4DAA A;  5A9G A;  3ZHV A;  3R5H A;  2R7N A;  1AJN A;  4MTX A;  3HOZ G;  1XNQ H;  1FPO A;  4YHH O;  2Q68 A;  5L9X A;  1K3E A;  1PKX A;  1WA8 A;  3E22 A;  1KMI Z;  4DV5 H;  3NXS A;  1K9M W;  1PPJ H;  4XDJ A;  4J7Z A;  5LOV F;  1OCC C;  2COG A;  2W0F C;  2R8H A;  1PX2 A;  3HKB B;  3FMA A;  1URF A;  2HHF A;  1S97 A;  1V9P A;  3G6B A;  1RYS A;  3PVX A;  2R8J A;  3FB5 C;  3GTP A;  3W7U A;  3T1H O;  3STZ C;  2D2C B;  1WCM G;  2ZJT A;  5CA1 A;  3F5W C;  5IYZ B;  1SS3 A;  2WA4 A;  3CB2 A;  1I2K A;  1QR8 A;  2ADP A;  3AEI A;  3K9S A;  4HYK A;  1UPG A;  4DV4 B;  5L1J A;  2W70 A;  2PF4 E;  2C22 A;  4PHZ A;  4UCT A;  2BTQ A;  3LDE A;  5J2T A;  4DR2 O;  4O2A B;  4FFR A;  4IGG A;  1K34 A;  4ASU G;  1WNS A;  4JI4 B;  3AG1 C;  4MW3 A;  3AX6 A;  4YJ3 F;  5KFM A;  4JI6 H;  3ZHU A;  2X7R B;  3MR3 A;  3BQ2 A;  3V6H A;  4TT3 G;  4J9M A;  2H94 A;  4FJC C;  1FJG B;  2UUA O;  1ZL8 A;  4MV9 A;  3ZRW A;  5LOV A;  4RQF A;  1XIL A;  1T5E A;  3RVZ A;  2B1I A;  2R92 A;  1XMQ H;  3J81 W;  2W6O A;  2CTW A;  5H6R A;  1TWA A;  3SJA C;  4DXW A;  3H40 A;  1DV1 A;  4H13 B;  1H2K A;  4UB6 Z;  1M6V A;  3M99 B;  3IAY A;  3FYE B;  1NH2 B;  2WPD G;  1BGY H;  1A32 A;  1NZ6 A;  2UU9 H;  3ETG A;  4B3S B;  2UXN A;  3L71 H;  2VQF B;  5LBQ A;  2QTO A;  2R9R B;  4ECT A;  3EHB B;  2C2E A;  4CKE A;  1ZUQ A;  2CH7 B;  2B1G A;  1HNX H;  4O7S A;  4K0K O;  1AN7 A;  1RPR A;  2YYA A;  3CRC A;  5LGN A;  3DXR A;  3RTX A;  1Q43 A;  1Q6I A;  5EC1 C;  5DG8 A;  3FB7 C;  5IT9 W;  4K8X A;  4JTC B;  5KFN A;  3WB1 A;  4R8U B;  2BQR A;  1P84 F;  4JI5 B;  1SQX H;  4DL7 A;  5KHI A;  2P6J A;  4YHH B;  2LO1 A;  3R65 A;  1H2L A;  4Q4D A;  1MA1 A;  4A3G G;  5I5W A;  4CBC A;  2AQ4 A;  3O65 A;  1I1M A;  2V9W A;  4PZ7 A;  5DG9 A;  5AG2 A;  4HYO A;  1EM1 A;  5CBF A;  3SJC C;  1G4Y B;  1H8E G;  1U97 A;  2YS7 A;  2Z04 A;  3KCX A;  5L3E A;  3MWE A;  1JOY A;  4DW1 A;  4QWE A;  2EIJ B;  2VQF H;  4AQY B;  1GTO A;  4D7S A;  5B3S C;  1H2S B;  1KJ8 A;  2BOC C;  3OGC C;  3A0H Z;  1KB9 F;  1VBH A;  1TWG A;  1KUQ A;  5K1X A;  3VOT A;  1RM1 C;  4U3J B;  4NTY A;  3W1B A;  5L3D A;  1FYJ A;  4TQD A;  4O4H F;  1HNW B;  3GTJ A;  2HDK A;  3GVM A;  2JJ2 G;  3GTO A;  5JVD F;  4WFB V;  4RQE A;  4FM1 A;  4EB6 B;  2WA3 A;  2UXD H;  2FK2 A;  4XDL A;  1HP8 A;  4NXN B;  2QJ1 A;  2K1E A;  4JI7 B;  2UUC H;  2E76 B;  1RK5 A;  5IP9 G;  3P3P A;  4PV1 B;  1EN5 A;  2ZCE A;  2WLK A;  3ZED A;  2AGP A;  2H8P C;  2UU9 B;  3GID A;  4ECZ A;  5CM0 A;  4GLW A;  5LMN H;  2V59 A;  1B06 A;  3BG5 A;  1N0N A;  1G2W A;  3TY9 A;  4DV1 B;  4CKB A;  1WCM A;  3K0D A;  3W7T A;  1QVG U;  4Q4C A;  1Q8I A;  3AG2 C;  2ZM6 O;  3QF7 A;  4I7H A;  4M9U A;  5EWG A;  1AR1 B;  2BSK B;  3Q4H A;  2PI4 A;  4LF9 O;  4TQF A;  1XMQ B;  4QJF B;  4QW9 A;  2FLN A;  3WG7 B;  4G2K A;  2NNU A;  5L3G A;  1N36 B;  4UCO A;  1TUB A;  2XCL A;  2OTJ V;  3GV5 B;  3HKE B;  5DN6 G;  4BY7 G;  3ZJZ A;  3SI8 A;  2FYU H;  4GYC B;  4DV2 H;  5H6Q A;  1E4F T;  3BA9 A;  4I50 B;  3D3Q A;  2EIN C;  4IYH A;  4ICG A;  3CCM V;  5DQI A;  2RNB A;  4XYL B;  1BS3 A;  2HHF B;  1VP7 A;  2GV9 A;  5LL6 Y;  3MWM A;  3T4D A;  2Y0S E;  1BT8 A;  2IBK A;  5FLM G;  5DG7 A;  2DWC A;  4X1Y B;  3TQT A;  5F2V O;  2RDC A;  3IG0 A;  3ABK C;  4RNM A;  3I55 V;  4G27 B;  1F4M A;  3K57 A;  5KFH A;  2F1M A;  1U96 A;  2QWP B;  5LMN B;  4JYA H;  1A0I A;  2IP4 A;  4UCU A;  3L72 H;  4DK1 A;  3SR2 C;  2QE7 G;  4TV8 B;  4IIJ A;  4O2A A;  3L4K A;  5A2Q N;  5E79 Z;  5JQG F;  2YXH A;  2ODM A;  5JJJ B;  3CRR A;  1WP7 A;  5BWT A;  3G8D A;  2VR1 A;  3RV4 A;  3S24 A;  1XNR B;  2Q7E A;  2FK3 A;  3H1I H;  5L1L A;  2VQE B;  4FFL A;  3B4S A;  2FLL A;  2I8C A;  2YI8 A;  4YAJ B;  4OXS A;  3LUT B;  2NU7 B;  2X6B A;  4LF6 O;  1Q6H A;  1JDE A;  4DL5 A;  1FXV A;  2CAZ C;  3RWR D;  3OSP A;  2AGA A;  5EWE A;  1RYR A;  1GSH A;  4FK5 C;  5CE8 A;  2YXL A;  4Q20 A;  4FFK A;  2BTO A;  5BWV A;  2XCA A;  4D7T A;  2N05 A;  3TJT A;  2JK5 C;  3K9A A;  5CN0 A;  3OUS A;  5KHG A;  3EXA A;  4JI0 B;  3A2F A;  4YJ2 F;  1R6N A;  3SPG A;  2FP4 B;  4J9N A;  3WWJ A;  5KFC A;  3PO3 G;  3K04 A;  1PD3 A;  1MOF A;  4JI2 H;  4IRC A;  4RB1 A;  3H4D A;  4DV7 H;  3CP1 A;  4O7R A;  3S3W A;  3I5D A;  1S0M A;  5IJ0 A;  3WU2 Z;  5LP6 F;  2RDJ A;  1VF6 A;  2YIB D;  4I9W A;  4JPR A;  1E79 G;  4BW9 A;  5LXT F;  3H1J H;  2JGD A;  3CWB H;  2UUB H;  5LP6 B;  1HR0 O;  3H1K H;  4ZIB A;  5LA6 A;  3M9N B;  2J9G A;  3CSW A;  4O3P A;  2O57 A;  1KT8 A;  2NVX A;  3LP8 A;  4O4J F;  4MV3 A;  2VPQ A;  5IT9 N;  5LHG A;  3TY5 A;  3B2E E;  4O4L A;  3RBD A;  2QWO B;  3CE2 A;  1FXK B;  1JJ2 U;  3UT5 A;  3MJF A;  4UCS A;  4BR6 A;  4I55 F;  3J7A U;  3KXY T;  5HV6 A;  3OFN G;  1XNR O;  3JRX A;  1K33 A;  4QW8 A;  3UKM A;  4TUY B;  4X66 O;  5KKN B;  1JA8 A;  1A48 A;  2B9Z A;  3LWB A;  4YJ3 B;  2I80 A;  2JRI A;  2OH2 A;  2JA6 G;  4LC1 A;  2ATL A;  1ZHS A;  5B1A B;  5JCO C;  4X62 B;  1A0G A;  2PVP A;  1FFX A;  5DQG A;  2QGN A;  4QE7 A;  1NR7 A;  1XI1 A;  1VF5 B;  1N34 H;  2WLI B;  4MAM A;  1Y4M A;  5BMV F;  3ZCC A;  1Y76 A;  3JCU Z;  1M93 A;  3CXH F;  1FS0 G;  4MA5 A;  2IA6 A;  4B3R H;  1D5A A;  5EZY B;  5KG1 A;  4O4J A;  4GKJ H;  3T1Y H;  3VMM A;  1L2Z A;  4KUM A;  1BJT A;  3UCS C;  3OSN A;  5EZY F;  4ZQI A;  3JAM W;  3J80 W;  3OAA G;  2XGP A;  4OPH A;  3L4J A;  2R9I A;  2UXB O;  5DM6 V;  5CBG A;  2OWO A;  1GN3 A;  4MVZ A;  4C2M A;  3ZBH A;  3BQ0 A;  5EC2 C;  4WFH A;  4P30 A;  3RAQ A;  1KJQ A;  5LGT A;  2Q9L A;  1BL8 A;  3GIJ A;  2EIL B;  1SQF A;  4CE5 A;  2ETN A;  5KFJ A;  4NYE A;  3GTG A;  1MAB G;  3U54 A;  4IT5 A;  2P0A A;  1XK5 A;  5LYJ A;  3SJQ C;  4ABM A;  4R8U A;  4DRF A;  5KT3 A;  3LDD A;  1NJI W;  3SPC A;  1NU1 H;  2X6A A;  3CCE V;  3T9F A;  4CC5 A;  1I3Q A;  1NQT A;  1N32 H;  3ICX A;  1XHX A;  3OR6 C;  2ZIN A;  3UZB A;  3D8C A;  4O4I F;  3I4M G;  5DGH A;  5BPH A;  1S0V A;  4BIZ A;  2CTR A;  1BSM A;  3TW7 A;  4MV6 A;  1RJR A;  3QVN A;  4JI1 O;  2C35 B;  2I87 A;  4ZI7 F;  2GDS A;  3LNM B;  3H0G A;  1AP5 A;  2GQS A;  5C8Y B;  2MCT A;  2CE4 A;  4RUE A;  1A3G A;  4O7N A;  3TK1 A;  5IYC O;  3NGD A;  3ZIA G;  1TGO A;  1Y66 A;  2YUA A;  1I5X A;  4O86 A;  1IOV A;  1QLN A;  3MR6 A;  1CXZ B;  4DR7 O;  2JEI A;  1BGW A;  2OCH A;  2WDT A;  3ZRS A;  4PZ8 A;  4O7T A;  4X64 B;  2ZDH A;  3A8T A;  3AG3 C;  1PV0 A;  2CGN A;  1MZB A;  4GX1 A;  4EYI B;  2WSS G;  1DF5 A;  1S5L Z;  4Z2W A;  2V1D A;  5C3E G;  1WPX A;  1BQZ A;  1ZET A;  1EKV A;  4NZM A;  4HNV A;  1XRE A;  4FLY A;  4ZI7 A;  2QWQ B;  3DTF A;  2XAG A;  5I5S A;  3CME V;  1V4Y A;  1MMM A;  4NLG A;  3N8D A;  2FPG B;  5CA1 F;  2ALZ A;  3AK2 A;  1CPY A;  4RU9 A;  2JEG A;  4NTX A;  4D6T H;  1SQV H;  3GTL A;  5KG4 A;  1JIH A;  4A5U B;  3Q4H B;  4J41 A;  4F6E A;  2ZE8 A;  2R8I A;  4QGP A;  3T1Y O;  4LWS B;  2P67 A;  2WAM A;  3TY8 A;  3EVK A;  4PDL A; 
#chains in the Genus database with same CATH homology
 3SJB C;  4LF8 H;  2VWJ A;  2RQ6 A;  4U3J A;  4LF8 B;  3N42 B;  3N2G A;  4RZQ A;  2F4V B;  1ZHQ A;  2F4V H;  5GON B;  3RYH B;  1SYX B;  4DUZ B;  4DR2 B;  1N32 B;  4TV9 A;  3M7M X;  4DRX B;  3JAK B;  4DV0 B;  2PY5 A;  4UCV A;  1XNQ H;  4HNA A;  4I55 A;  1WPB A;  1FJG H;  3ZS8 C;  5EIB D;  3E22 A;  3VQW A;  2UUA B;  1KMI Z;  4DV5 H;  1DGS A;  4YY3 B;  5CA0 B;  3K58 A;  5BR8 H;  3JSL A;  4J0M A;  3HKB B;  4BWA A;  3FMA A;  4LH6 A;  4X1K A;  4LF5 H;  1V9P A;  1IBL B;  2ZM6 B;  3N43 B;  1WN7 A;  1I94 H;  2IM9 A;  3U0Z A;  4RAY A;  2EX3 A;  5CA1 A;  2ZJT A;  5IYZ B;  4PI0 A;  3CB2 A;  4DV4 B;  4CH6 A;  4IIJ B;  4PHZ A;  4UCT A;  2BTQ A;  2WYO A;  5J2T A;  3VQY A;  4O2A B;  4FFB B;  4O2B B;  4O4H B;  5D1O A;  1WNS A;  5FPR A;  4DUY H;  4JI4 B;  3T1Y B;  4LFC H;  4I4T B;  4CS3 A;  4DV6 B;  5GON A;  2UUC B;  4JI6 H;  3RYF A;  1N33 H;  2RGV A;  4KHP B;  2HGS A;  1FJG B;  4MV9 A;  3JAT B;  5FD6 A;  5LOV A;  4JI0 H;  1O9G A;  1T5E A;  2HVQ A;  1M0T A;  3K59 A;  3BHP A;  1XMQ H;  3J81 W;  1IBM H;  3GDE A;  4K8Z A;  5ITZ B;  3SJA C;  4B3M H;  4DR6 B;  1M4U A;  4E6N A;  4PI2 A;  1O9H A;  1P16 A;  4MTD A;  3IAY A;  3FFQ A;  1Q3E A;  4O4I B;  2UU9 H;  4CH3 A;  4JI6 B;  1N33 B;  1Z2N X;  4JI1 B;  3DF7 A;  2VQE H;  4B3S B;  5A2Q W;  3GJX B;  1M5I A;  2VQF B;  1CKO A;  2YIB A;  4JI2 B;  5IYZ A;  4A2B A;  2JS5 A;  1HNX H;  4WBN B;  3T1H B;  3N2K A;  4DUY B;  4CC6 A;  1AN7 A;  5LL6 b;  4DR7 H;  1L8D A;  5IJ0 B;  5JQG A;  2YI9 A;  2UUB B;  2UXC H;  3RIZ A;  5EYP B;  3CSX A;  4O2B A;  3RTX A;  1Q43 A;  1I94 B;  2FE3 A;  4I55 B;  2ZM6 H;  4K8X A;  4LSX A;  5IT9 W;  3WB1 A;  5D1P A;  1Z2P X;  2W57 A;  4MV7 A;  4JI5 B;  2PTM A;  1IBM B;  5DIS C;  5JJE B;  5KHI A;  4YHH B;  2KKW A;  4DV7 B;  4X20 B;  3K5N A;  2JVD A;  4O4I A;  5C8Y A;  2UXB H;  2OYQ A;  1JMK C;  1IBK B;  4PZ7 A;  3N6X A;  5LMU B;  3UQ8 A;  3SJC C;  3GB8 B;  4DV3 H;  2P5O A;  5FLX W;  1X9N A;  4DV5 B;  5KMG B;  4JI3 B;  4B3S H;  4FM0 A;  4TUY A;  1I6U A;  2VQF H;  4AQY B;  4L8J A;  4D7S A;  2E3C A;  4FVM A;  1H2S B;  5K1P A;  5BMV A;  3RYC A;  5J2U A;  4YJ3 A;  4LMY A;  5KX5 A;  3KAL A;  4DR3 H;  5K1X A;  5JH7 B;  4U3J B;  4FFB A;  1Z2O X;  3L2P A;  1S68 A;  4JI5 H;  4X62 H;  3W1B A;  4B3M B;  1VS0 A;  4TQD A;  4JV5 H;  3H20 A;  4DR6 H;  1HNW B;  1CKM A;  5EOY A;  4RB0 A;  5IWA H;  4FLZ A;  3OTF A;  3N2K B;  3JAK A;  4ZI7 B;  4X20 A;  4FM1 A;  4EB6 B;  4LF4 B;  2UXD H;  1TUB B;  4RAZ A;  4X66 B;  4NXN B;  2QJ1 A;  4YJ2 A;  2HVR A;  4JI7 B;  1XNR H;  2F66 C;  2UUC H;  3BPZ A;  2HIV A;  3K5M A;  2ZCE A;  4LFA H;  3ZED A;  2UXD B;  2UU9 B;  4JI4 H;  5LMN H;  3JAW A;  2PZS A;  5BMV B;  3RYC B;  3NBZ B;  4X1K B;  3TY9 A;  1KU9 A;  4CH5 A;  4DV1 B;  3W1G A;  2VWK A;  1Q8I A;  2V4D A;  3QF7 A;  4I7H A;  4DV4 H;  5LYJ B;  4TOI A;  3KYH C;  3RGZ A;  2QM4 A;  4TQF A;  4CS4 A;  1XMQ B;  1I7F A;  4TV9 B;  2F93 B;  4DRX A;  3JAR A;  3WB2 A;  4UFZ A;  4UCO A;  1N36 B;  4BWS C;  4X65 H;  1TUB A;  2YCH A;  1SKV A;  2JGU A;  3HKE B;  4I4T A;  3HKD B;  5EZY A;  1FVI A;  3F8N A;  3RR5 A;  4GYC B;  4DV2 H;  4DV3 B;  4DV2 B;  5LMU H;  1E4F T;  5LP6 A;  4LFC B;  1RSO A;  3CHX A;  4GKK B;  3BA9 A;  1HW7 A;  4I50 B;  4NXN H;  4X66 H;  4X65 B;  3PN1 A;  4IHJ B;  4APM A;  4B3T H;  4AHC A;  5CB4 B;  4PZ6 A;  2WE6 A;  1J5E H;  4DV0 H;  2GV9 A;  3MWM A;  4YJ2 B;  3HKC B;  4X1Y B;  4DR1 B;  2HVS A;  3IG0 A;  4LFB H;  4LSA A;  3VQX A;  5D5P A;  1SA0 A;  3K57 A;  1P49 A;  2F1M A;  4DR3 B;  4JYA H;  5LMN B;  1A0I A;  4UCU A;  4X64 H;  4DK1 A;  4Q6G A;  4TV8 B;  3JAR B;  4IIJ A;  3SR2 C;  4FLX A;  4DR4 B;  2Q2U A;  1WH2 A;  2PGG A;  4O2A A;  5BR8 B;  4LFA B;  3LML A;  3L4K A;  4O4H A;  3JAS A;  4NVP A;  3BRC A;  4K0K B;  5JJJ B;  3QG5 A;  4K0K H;  3S24 A;  3JAL A;  4DV6 H;  1XNR B;  2HEP A;  2Q7E A;  1TVK A;  4LNU B;  2VQE B;  3RYF B;  3U10 A;  4LF4 H;  5FNV A;  5KHH A;  2CW7 A;  2YI8 A;  4EFE A;  2CFM A;  2VPS A;  3QTC A;  4O4J B;  3EYY A;  3ETQ A;  5D1O B;  1P8L A;  3RWR D;  2CAZ C;  3HKD A;  3K5O A;  3WB0 A;  4NXM H;  1HNZ B;  4JI8 H;  3UT5 B;  2YXL A;  4IHJ A;  2BTO A;  3NBY B;  1IBL H;  4D7T A;  4LF7 H;  4DR1 H;  4B3T B;  4AQY H;  2Q2T A;  4R7R A;  5KHG A;  4LF9 B;  4JI0 B;  4DR5 B;  4AIL C;  3M4I A;  1GYF A;  3A2F A;  2HIX A;  4JI3 H;  3JAS B;  1HNX B;  5ITZ A;  3HKC A;  4X1Y A;  4GLX A;  4Q0Y A;  4PDB A;  4ETS A;  4EEQ A;  4JI2 H;  1S03 G;  4B3R B;  1IBK H;  1E4G T;  4ZHQ B;  4RB1 A;  4DV7 H;  3K5L A;  4LF7 B;  4WBN A;  5IJ9 A;  2ZIO A;  1G6U A;  5KX5 B;  5IJ0 A;  3DSQ A;  5JVD A;  4JI8 B;  4DR2 H;  2YIB D;  5IWA B;  1HNZ H;  3N44 B;  4BW9 A;  3HKE A;  4LF6 B;  2VOB A;  4F6R A;  2P22 C;  2UXC B;  2UUB H;  5LP6 B;  1XQ8 A;  4ZOL B;  4ZIB A;  5EIB C;  5LA6 A;  1QHT A;  3KAK A;  3W5O A;  3T1H H;  5LXT B;  4HBN A;  4KL1 A;  2RGR A;  3VQV A;  4FLW A;  1JFF B;  3MAQ A;  3RYI A;  3TY5 A;  3B2E E;  4O4L A;  4KHP H;  2YIA A;  3UT5 A;  2Q7H A;  4DR4 H;  4UCS A;  4M7E A;  4JI1 H;  1XNQ B;  3KXY T;  4ZHQ A;  2UXB B;  4FLV A;  3JAW B;  1Z5W A;  4TUY B;  2XIG A;  5IJ9 B;  1HR0 H;  5FD5 A;  5J2U B;  3HKB A;  2CW8 A;  1HNW H;  4YJ3 B;  4UCR A;  4FLT A;  4IAJ A;  1ZHS A;  3NC0 B;  4DK0 A;  3RGB A;  5JCO C;  4X62 B;  2ZNJ A;  1FFX A;  3RGX A;  4CS2 A;  3LNN A;  3CVZ A;  2ZIM A;  1XI1 A;  2HHH H;  1N34 H;  2O03 A;  5J2T B;  2BTQ B;  1HR0 B;  4LR3 A;  1M93 A;  4B3R H;  1J5E B;  1D5A A;  5EZY B;  2XHB A;  5FPO A;  3J7A K;  4O4J A;  4GKJ H;  3T1Y H;  4F6R B;  1L2Z A;  1SEI A;  4ZOL A;  1BJT A;  5JJN B;  4DR5 H;  1X4T A;  1VF7 A;  5CB4 A;  3JAT A;  3JAM W;  4GKJ B;  5LOV B;  4RB2 C;  3J80 W;  4EFB A;  3L4J A;  3N40 P;  2OWO A;  4O4L B;  5JCO A;  1JFF A;  4YHH H;  1B04 A;  1N34 B;  1TA8 A;  4EQ5 A;  4LH7 A;  4LF6 H;  4DV1 H;  3RF2 A;  4X1I A;  3JSN A;  1CKN A;  4NXM B;  1SQF A;  4TV8 A;  3HXL A;  5D5Q A;  3THO A;  4YY3 H;  3OTO H;  5JVD B;  1XHZ A;  1XK5 A;  5LYJ A;  2PYJ A;  1XDN A;  1FFX B;  4DRF A;  1XMO H;  5KHK A;  1JJO A;  1TAE A;  4I50 A;  4JI7 H;  4JYA B;  4CC5 A;  4DUZ H;  4FLU A;  1N32 H;  3ICX A;  1XHX A;  4CH4 A;  5JQG B;  3RJ0 A;  4JV5 B;  2ZIN A;  3BA8 A;  5EYP A;  2PYL A;  5KHJ A;  3N41 B;  1ZAU A;  4RB3 C;  3BAB A;  3RFR A;  5KMG A;  3VNN A;  4B08 A;  1SA0 B;  4LF5 B;  1CKN B;  2R70 A;  1SQG A;  1Z5V A;  1Q5O A;  5C8Y B;  4I9Q A;  2MCT A;  1QQC A;  5JH7 A;  1TGO A;  1XMO B;  2UUA H;  3N2G B;  2RJZ A;  3K3V A;  4GKK H;  1M0W A;  4X1I B;  3OTO B;  3KAJ A;  5LP6 C;  3RYH A;  1BGW A;  2WDT A;  5FNV B;  4PZ8 A;  4LF9 H;  4X64 B;  4OX9 H;  1MZB A;  2VUG A;  4HNA B;  2E5L B;  4LFB B;  3JAL B;  3E22 B;  2E5L H;  1TVK B;  4LNU A;  5LA6 B;  5CA0 A;  4OX9 B;  2PUS A;  2R72 A;  4FLY A;  4ZI7 A;  4DR7 B;  5LXT A;  3QWU A;  2F95 B;  2Q0A A;  3U11 A;  4EB6 A;  2KSW A;  2ZNI A;  2Q7G A;  3RYI B;  1S5J A;  4MTE A;  2R9A A;  4FM2 A;  5CA1 B;  3BAA A;  1YEW A;  1O75 A;  1FKA H;  3C0F B;  1N36 H;  4FM9 A;  4A2A A;  3SGI A;  3TY8 A;  1NT2 B;  2HHH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...