3BABA

Structural basis for the inhibition of bacterial nad+ dependent dna ligase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
312
structure length
312
Chain Sequence
LTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Inhibition of Bacterial NAD+ Dependent DNA Ligase
rcsb
source organism Enterococcus faecalis
molecule tags Ligase
molecule keywords DNA ligase
total genus 99
structure length 312
sequence length 312
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3babA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3babA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3babA02
3GB8B 5BR8B 4PZ7A 4DR7B 3TY9A 4DV7B 3W1GA 3KYHC 1TAEA 3BA8A 2UXDB 1XDNA 1VS0A 4UCUA 4JV5B 4PZ8A 1V9PA 4EFEA 1XNQB 4UCRA 2UUBB 2VUGA 3VNNA 4JI5B 4LF9B 4EFBA 4NXNB 5IWAB 4DR3B 3T1HB 4OX9B 4DV0B 4X66B 4EQ5A 4CC6A 4E6NA 1CKNA 1HR0B 1P16A 4JYAB 2HVQA 4LFCB 3UQ8A 4JI4B 4GKJB 4JI2B 4DR6B 3RTXA 1J5EB 4DV6B 3NBYB 3W1BA 1CKNB 1TA8A 4DUZB 4LF6B 1I94B 1A0IA 4DR1B 1XK5A 2E5LB 5D1OA 3TY5A 5D1PA 4B3TB 3SGIA 2VQEB 4UFZA 4DRFA 3GDEA 1X9NA 4DV4B 4LF5B 4X65B 4DR5B 3BA9A 2UUCB 2HHHB 1XNRB 4LF4B 1CKOA 1S68A 3S24A 5DISC 1N32B 4JI0B 3NBZB 5FPOA 3GJXB 1HNWB 1N34B 4UCTA 1IBKB 2VQFB 1CKMA 4PZ6A 4AQYB 2HIVA 3BABA 4DV5B 2HVSA 4LH7A 4LFAB 3NC0B 3JSNA 4LFBB 3OTOB 1FVIA 2Q2TA 2UU9B 4DV3B 2CFMA 1IBMB 4DV1B 3PN1A 4GKKB 4B3MB 1N33B 2UXBB 4DR4B 2HVRA 4LH6A 1XMOB 2Q2UA 3L2PA 4X62B 1HNZB 3JSLA 4YY3B 3T1YB 1B04A 1P8LA 4UCOA 4UCSA 1IBLB 2ZM6B 2F4VB 5LMUB 4B3SB 4UCVA 4K0KB 4NXMB 4KHPB 2HIXA 3QWUA 4JI7B 1DGSA 4JI8B 4CC5A 4LF7B 4B3RB 4TOIA 2UUAB 3BAAA 3W5OA 4DR2B 4JI1B 4GLXA 4YHHB 4LF8B 2UXCB 3RR5A 5FPRA 1HNXB 5LMNB 1XMQB 1ZAUA 5D1OB 4JI6B 3TY8A 1FJGB 2OWOA 4DUYB 1N36B 4DV2B 4JI3B 4X64B 4EEQA
chains in the Genus database with same CATH superfamily
4JI6H 2R7ZA 2HR3A 1GK9A 1ZWIC 3EPGA 1R3LC 4DR2O 4LF9H 5DGHA 4GX2A 5KHKA 3AK1A 4UCUA 1D5AA 4X1IB 4LF8H 5KFCA 5BMVF 3DC5A 4MSWC 2R8GA 3NUAA 2UXDH 3QF7A 1WB7A 4X64H 3RGZA 4QE7A 1TWAA 1GN2A 4CC6A 1XMQH 4ECUA 3W7TA 4LR3A 5IT9W 2VUMA 4TQFA 1LNQA 2JK5C 3K0GA 5LHHA 5KFVA 5C4XG 1YDXA 4MT8A 4DV6B 2RMKB 1IDSA 1XBLA 4NKGB 5CBGA 2CTWA 2UXCH 1Q81W 3J81W 4O83A 2C2EA 2OTLV 1K1SA 3FKIA 2QM4A 4IHJB 4DUZO 4JZ2A 3OR6C 3SGIA 5E79Z 4EB6B 2R7KA 4DRFA 2NU6B 3T4ZA 4WBNF 2QWQB 4O4IA 3O9OA 1KUTA 3RIZA 2HHHB 1S68A 3AEIA 4FK5C 2F66C 4FFRA 3JD0A 5LYJA 4FE2A 3IFXA 2GQSA 5L9XA 3BHPA 4HZ3A 4PHZA 2AU0A 4QE9A 1FD9A 3JAMW 5B1BB 4O4JA 1N32H 1X59A 3RFCA 2P7TC 3HOVG 4DV4H 2AGPA 2OTJV 5IJ9A 4Q20A 3PO2G 3WNZA 4JI5O 1P8LA 2WAQA 4MV1A 4HYKA 2EIYA 4UCVA 1HNZO 1JKJB 4R6ZA 4MVQA 1Y1WG 3BQ0A 1PD3A 1KC7A 4B3RB 4TOIA 4ZOLF 2RN9A 5CB4A 1RPOA 2R8JA 4RQFA 1Q8IA 4B3RO 2R70A 3X2QC 4HNVA 4J9LA 1N36O 2EZPA 4KP4A 3SJBC 5B3SB 1WCMG 4JI2H 4X1KB 5FPRA 1OCZC 2ZNIA 3QFFA 2WA4A 5KFIA 5CR5A 2XHBA 4K8XA 2EZOA 1VQ5V 1I5XA 1OHHG 3JALA 2YS7A 1AJPA 5DGIA 4DR7B 5KFMA 1W0JG 3QNEA 2WLLA 1RK6A 1XUQA 4JV5B 1UPGA 5B1AB 3K3PA 4DR1O 5JJJB 4O86A 5GONA 4YJ3A 3QZ7A 2WB1E 3JRXA 1XNRO 2WB1A 2Q6AA 2C2AA 4KHPO 4NLGA 4DL3A 2ZE6A 3IC9A 5EIBC 5IP7G 2OCCB 1JFFB 4NR1A 1D2DA 3IGAC 4JYAB 4XYMB 3TW6A 5LP6C 1LR1A 2PBZA 5B1AC 5DGAA 4GKJB 1HDJA 3HOWG 1IZ3A 3RTXA 3ZHTA 1F4NA 4Q0YA 3GIKA 2EILB 3UZBA 3CCEV 1MMMA 2GLTA 5BWTA 4JI7H 2PYJA 4TQRA 2BOBC 4TV9B 3CRCA 2Q4PA 1K33A 5I47A 3J7AK 4F4WA 2F4VH 4I50F 2NU7B 4OPAA 3FB5C 3U0GA 1Q6HA 3N44B 3QZ8A 2DPIA 5DISC 1V55C 4AILC 1JJ2U 1V55B 4RCNA 2ZE7A 1KKDA 1MSDA 5H80A 4IHJA 4B7EA 2OYQA 1BS3A 3T5JA 2UXXA 1KJQA 4LFAB 2I80A 2IA6A 4OX9O 3SYQA 2D3OW 4A3JG 4LFAH 4YIOA 3ICXA 2DOSA 4LWSB 3N8DA 2R6FA 3CP1A 4J80A 1S5LZ 2Q9LA 4TV8F 2QTOA 2JDIG 5J2UF 1BGWA 4O4LF 1FXKB 3ASOB 1VQPV 4LF9O 3L2PA 1IURA 1BNCA 4DK0A 2M7WA 4O7LA 1BQZA 4UCOA 2V5AA 1FXKA 3AG4C 4IIJA 4KHPB 1CQIB 3GV7B 2KG7B 4H13B 4LF7B 2F4VO 4ED1A 4DR2B 4ED3A 2V58A 4PV1B 2Y69C 4OXSA 2GHYA 1N48A 1FYJA 2E3CA 3A0RA 2R92A 4YR2A 3CCLV 1WR2A 2KSWA 4GC7A 1XDCA 2JJ2G 5BYBA 4EEQA 3LSQA 1BZKA 2FPIB 4GX0A 2ETNA 3HKDA 1OZ0A 1I2KA 4X8AA 3CQZA 5A2QW 3KYHC 2UXDB 2R7NA 3SYAA 2QKAA 3RV3A 3ABKC 3RBEA 4QW9A 4EFEA 4FLTA 2LW1A 3HB3B 1N0NA 2J9GA 1EZVH 5KFSA 1KB9F 3TIIA 1YSCA 2YIBA 4HYOA 5J2TF 4O4HA 3TQ1A 4PWQA 3SYCA 4JI3H 3AK3A 1FJGH 4I4TA 4EEYA 2EJ0A 4LFCB 5KFDA 1JLLB 1KP3A 3ORRA 3K5NA 3N41B 1S5JA 2GQRA 4FFBA 4C2MA 2JEXA 2NLJC 5I5YA 1TA8A 4MAMA 3OSNA 4J7KA 1PK8A 4PA3A 3BG5A 3ETDA 2Q7DA 1PP9H 4QIWA 3WWIA 4GT1A 5BMVB 3V6HA 3OFNG 1CS0A 2FP4B 2HVJC 5KG6A 5EC1C 3CCMV 4YY3H 4LF4B 2IM9A 1L0NH 3R5XA 3S24A 2WPDG 4Q45A 1K1QA 1B6SA 2W7PA 2VOBA 4UCTA 4A2AA 2LFSA 3G6VA 3T7AA 2ABJA 3WG7C 3ZMTA 2A0LA 1VF6A 2RNBA 1OBDA 2X6AA 1DK1A 5BMVA 3CCUV 1FXVA 2WLKA 5IYZF 3RB4A 3FMAA 3RGXA 3G67A 3KREA 1G8MA 2QA4V 2UXBB 3VQVA 4DR4B 5CA3A 3TJTA 4TUYB 4FLYA 3AG1B 2ZDIC 3OE7G 5C1OA 3B77A 2XUMA 3ZN1A 4BXXG 2QR4A 4NYKA 1EHIA 1NTMH 4MVSA 1Z2NX 4ZHQF 5ITZB 1GGOA 4WFFA 4IRKA 4O3OA 2UXBO 1J5EO 5KFZA 1L8DA 4O4HB 2BSKB 4IYHA 2X5RA 4DR6H 4JF3A 4QPKA 3RR5A 2YEVB 5L3BA 3D3IA 5FNVB 4JI1O 4Q43A 3JAWA 2LO1A 4O4IF 2ZIOA 5LP6F 1EN6A 1H2GA 4O7TA 2ATKC 4RQEA 2JEJA 5KX5F 3SJCC 3A8TA 1SESA 3ABMC 5IWAH 1WNSA 5L3GA 4B3TO 2ITDC 2L6LA 2R9IA 5BXZA 2UUBH 4A2BA 2CH7A 2AGQA 4I55F 3BA8A 4O3PA 2F43G 5KFWA 1VAJA 4O2BA 1OJHA 1SRYA 3MAQA 5KHGA 4J41A 3R66A 4JUZA 4FLVA 2AGAA 4O7YA 3AG2C 3T9CA 3G6BA 3MR6A 4L1KA 3V6KA 3ZMZA 4I7ZB 1WPBA 4GLWA 1Y1VG 2NU8B 3CCQV 3M9OB 3W7UA 4DV5O 1NI8A 2R8HA 4DK1A 3GILA 4JXUA 3PO3G 3QO8A 1GKFA 4ED2A 1WB8A 2W9BB 4X66O 2F1MA 4DUZB 1IBKO 1S5HC 4RAYA 4U3FH 2HDKA 5I60A 4CMFA 3T5LA 4JI8H 3GTJA 2B63G 4JZGA 1XK5A 5D1OA 4XDKA 5KHJA 1XEQA 1B6RA 5IY5C 5EWFA 2VQFH 2CTRA 2DPJA 1GN6A 1BHAA 1K97A 2UUCB 2GBOA 1IBLO 4B3MO 4IRCA 3LP8A 4MVUA 3UCSC 3L73H 5KAIZ 5L3EA 1XHXA 1M9NA 2VRZA 4NXNO 2JA8G 1TWFA 3OUFA 2NUAB 4LFBB 1Y4MA 1OWTA 1FVIA 5GONF 2Q2TA 2FMLA 4UB8Z 1NR1A 2C00A 4ED7A 4X1IA 3K0DA 3CCRV 2D2CB 3HOUG 2CTQA 1TUBA 5FLMG 5JH7A 3AG4B 3OEHG 2Q2UA 3SDLA 1QNMA 1JR9A 2PZSA 4JI7O 4A5UB 1QR9A 3UYYA 3QO5A 2WLNA 4NXMB 2HIXA 3ZIAG 3T9AA 2A79B 3C3TA 1U96A 4JI8B 2HHFA 4ECQA 3GTLA 2ZNJA 3VBBA 2ZM6O 2W6OA 3ZMSA 5JUMA 1OCRC 2UXNA 4QW8A 1Z2OX 2VWKA 2PN1A 4QIWE 5EIBD 3A0HZ 2FK3A 3N43B 3LNMB 5C8YB 3MJFA 4JV5H 4JAUA 4RB0A 3SJAC 4N23A 1KP2A 2FTKA 4Q44A 4O7SA 2XCPA 1HNXB 5BPHA 1AR4A 4BW5A 2BSKA 4ECSA 1BMFG 4JI3B 2ZXWC 4PD4F 3MFHA 2JEUA 3ZX6A 5K3WA 4G2KA 3AK2A 1CEZA 3U9SA 1I5YA 5B1OA 2ZR2A 5LGUA 1OCRB 4MTFA 2ZDIA 2I87A 4DRXB 4X1KA 5KA6A 3J80W 2EX3A 1XNQB 3CWBH 2UUBB 4TV8A 3EVKA 2UUAO 3VNNA 4F4YA 2AZ0A 3CRRA 5EDWA 4FIPC 4YXWG 1K73W 4J9YB 3I5DA 5LP6B 4LP8A 3T99A 2HEPA 2IU0A 4F4LA 1G4YB 4ECZA 1IYEA 3VPDA 5IJ9B 3T4DA 2HGWA 2HHHO 2FKLA 2EINC 4GKKH 1PL4A 3TINA 2Q7GA 1VEWA 2DQ3A 2WTFA 4I55B 1BT8A 3RBZA 2V4QA 1AI4A 1AP6A 1YEWA 2DWDC 3GDEA 4MV9A 5C1PA 1X9NA 2FKXA 5DQGA 3BCCH 4Q6GA 3DXRB 5IYDO 5KHHA 3H0GA 2HJDA 1TWCA 2QWNB 4DR4H 2ITCC 5EBMC 5JQGA 2GSMB 4RB2C 2FLNA 5CB4F 3OHAA 5FNVF 2CAZC 4PI2A 2J6TA 1EKFA 3H1JH 2HVSA 4DV3H 2RDIA 4LH7A 4X1YA 3CYOA 1E4FT 1YJNV 1VQOV 5CA1B 2XOKG 5J2TA 3OTOO 4WFHA 1JVMA 4CKBA 2IJIA 1QQCA 1ZX3A 3K03A 4LH6A 1HNWO 2LW7A 4YQWA 3JSLA 3STLC 1ZHQA 3CJHA 5HFMA 1G2WA 1M56B 2HKOA 3Q8PB 3AG2B 1B33N 2F4VB 4K0KB 2DYRC 2IJHA 3LSUA 3P3PA 2QWPB 5JCOA 4CC5A 5B1BC 2W6ZA 2QK4A 4DO2A 1A32A 2IJKA 1XILA 5F9LA 1FPOA 3CD6V 1I1KA 1GSAA 2W9AA 3B4SA 1Y76B 1KTAA 1BJTA 3ABMB 4W4LA 3UT5B 2QJ1A 2W8KA 5LMUO 4B3SO 4ECXA 5FD6A 1ULZA 5D1OB 3PW7A 4JYAH 2Q8VA 2Q5ZA 1M57B 1W59A 4DUYH 3CC2V 2G38A 3T9BA 3H4BA 2UUBO 5IYCO 3RYHA 4JV1A 4CH4A 1YZBA 2B9ZA 2XAFA 5CE8A 4RB3C 4PZ8A 5CAEB 3E8HA 3E86A 5LL6Y 4F6RA 1M5IA 3OMNB 3T1HB 1WAZA 3ABLC 3CMAV 2YZLA 3JARB 5BR8H 5IP9G 4ZKIA 2NU9B 5LXTB 4Q4DA 1N56A 5T14A 3WFVA 5CBHA 3RYCA 4DR6O 3LSSA 1DIKA 1WN7A 4TT3G 5A9GA 2GUZA 1ROPA 4CS3A 1MZFA 2EIKB 5J2TB 3E22B 5KFEA 4D6TH 1KT8A 2QKSA 2P5OA 4YJ2A 4Y8VB 4PDBA 2P0AA 3MWDA 4LFBH 3CMEV 2FB9A 1GO3F 2Z3YA 1S3JA 4K0KH 2GV9A 5KAFZ 4X65B 2W6MA 1IBLH 4TWKA 3B40A 4A93G 4K3AA 5DMXA 3SYOA 4KUMA 5L3CA 3FDSA 3VOUA 1W96A 2WWWA 4X65O 1VQMV 1N33H 3DC6A 2E76B 4LF7O 1QLEC 2R86A 3L4KA 3M8AA 2VQFB 5KS8A 3KHGA 1VF5B 1XNQO 1THZA 2ASLA 4O82A 3SE7A 3JSNA 1ZL8B 4GYCB 2DYRB 3MFIA 4J11A 4U3JB 5KT4A 4A3CG 2EBOA 3T9DA 4DV1B 2I8CA 4LF6H 4B3MB 4DAAA 1U97A 5LBQA 3TCUA 2DJVA 1Q43A 1M0TA 4LF8O 4I50B 2RGVA 1QBZA 1SQPH 5KFOA 1HNXO 1KJ8A 2XAHA 1NH2B 1NTZH 4J0MA 1HR0H 2Z02A 2LGWA 4X9QA 2X0LA 4IL6Z 2YL2A 4TV8B 3DTUB 4FLZA 2V4DA 3T2MA 3QQMA 4ZBMA 2EIJB 3G8CA 2H3OA 2C35B 3GTPA 2EULA 4H37A 1N8RW 1NT2B 2MK3A 5HFLA 1EKVA 2VPSA 4PA6A 1AI6A 3CS5A 4RU9A 1URFA 4QJFB 4DW1A 5KLVH 4LSAA 2IW5A 4NVPA 5LYJB 2HFEC 1F23A 2KKWA 2QTSA 3CRQA 4YAKB 3JRWA 3RB3A 2JA6G 5C8YA 1IOWA 4TV9F 3ZMVA 1I6UA 4RNMA 1TAEA 1UJWB 1NS1A 4UCRA 5IT9N 5EWEA 3I4MG 1KC8W 3MD0A 2XCLA 3RBDA 4LF9B 5JCOC 3OUSA 1N4CA 1EZ1A 1RK5A 2P06A 2ASJA 4EGJA 2VUMG 1KKCA 4J42A 5IYBG 1ZHSA 5BY1A 1T36A 1M56C 1YVWA 3U11A 3M99B 1PPJH 4WFGA 1E79G 4CMDA 3K59A 2WYOA 5KG7A 1RYRA 2A3QA 4O4IB 4R7CA 2H94A 2E5LB 4J9OA 3TIGA 2W6PA 3F8NA 2UVWA 2PMZA 1JCHA 3GTGA 1JIHA 3FX7A 3K3WA 4LF5B 4DQNA 2Q67A 2YIAA 4MVOA 4DR4O 5KFGA 3CEBA 1Z5VA 2C22A 4U7OA 5BPFA 3RFRA 4JI0B 4APMA 5L1JA 4U6PA 5C44G 1V54C 1TWGA 1V51A 1COWG 5LXTA 1VBGA 1IYDA 1P49A 4ASUG 4JI1H 3NC0B 4IIJB 1JX9A 1RJPA 1SYXB 2Q0AA 1FFXB 3OTOH 1IBMB 2QE7G 4FMTA 4JI8O 2DE0X 4TUYF 4EBCA 4ZOLB 3JYCA 3J7AU 4FFKA 3R23A 4FFOA 1QLNA 4D7SA 1JMKC 1YJWV 1HNWH 2ZD9A 3QTCA 2ZCEA 2RJZA 3DF7A 1NVPD 2FL4A 4IYIA 2WAQE 2HGXA 2YEVA 2UUCH 1XNRH 1WP8A 4JYCA 4OGQB 4X89A 2XGQA 1L1FA 4WFBV 3RVYA 3BAAA 1AI5A 2GDSA 1Q6IA 1UNNC 2Y48A 1Q6UA 5H2FZ 4DL5A 4BWSC 4K0KO 1V54B 2K9PA 5CA0F 5DLGA 4HNAB 2ARHA 3AG3B 2W7OA 3F7VC 1N36B 5KUMA 4X64B 2RDJA 4ECWA 5GTIZ 1CQJB 5B3SC 3X2QB 2GTSA 4IHJF 4FFPA 3CCSV 5KFJA 5D8DA 1UC9A 3UO3A 2LP7A 3WB1A 1B6QA 5KFKA 1JFFA 4CE5A 4O7NA 4EFBA 3TXQA 5KFYA 4DV7H 4F50A 3VPBA 2WLIA 5H9CA 3AW8A 4FS1A 5J2UA 1YTFB 1AUXA 4DV0H 2EJ2A 3ZN0A 5KFPA 1CKNA 4EYHB 1HNXH 3W7XA 2RGRA 5BWUA 4Z1MG 1AILA 4ZI7B 5CA0B 3K04A 1AI7A 2DABA 3V4ZA 4MTEA 2ADPA 4PA4A 2COJA 5LOVB 1K92A 3HKCA 2OLSA 5DG8A 3ABUA 2X7RB 1IXMA 3N2KB 3Q4HB 2Q68A 4I55A 4DR7H 2DYSC 4LFBO 2W9CA 4O2BF 4PA7A 4U3JA 1S0NA 1EM1A 5CA1F 1FFTB 2ZM6H 2QF7A 4W4KA 4HNTA 4DR5B 5JWPA 4UUJC 3MR3A 3BJYA 2R85A 1K4CC 1H38A 2X0SA 2ZGIA 4KL1A 3NBZB 1MZEA 5CB4B 3ZRSA 2IP4A 1HNWB 1VBHA 2R92G 3GLKA 2NR5A 4AQYB 3VMMA 4ZI7A 2YI9A 5IY5B 3OTOB 4IR1A 4GZRB 4FM2A 1VQ8V 2YXLA 4FJCC 4FU0A 4LF6O 1P84F 3HKBA 3LDDA 4O4LB 5L3FA 5FL7G 3I56V 4M7EA 5FLXW 3Q8QB 2PI5A 3AG1C 3U10A 1GMGA 4BW9A 3N2GB 4QNHB 3VPCA 4BIOA 5LA6F 4BBRG 4I4TB 1EUDB 3OAAG 4L87A 3Q8RB 1FKAO 3PW2A 4JI3O 5JVDA 2PY5A 1E4EB 4GKJH 4RUCA 2WLHA 5LMNO 2KB1A 3L9DA 4GX5A 4IR9A 4JYBA 2CGOA 3KCXA 1FS0G 1VIBA 1DGSA 3WG7B 4FZ0A 1H8EG 3ZHRA 3OEEG 2HJWA 3HKEA 5KG4A 5EYPA 5IJ0B 3G4SV 4NYEA 1I50A 3GTOA 1KMIZ 4YAJB 1D5NA 1XL4A 4A3DG 3SR2C 4CHIA 2IMWP 3MR5A 1GN4A 1XL6A 3T9FA 4FFLA 5H6RA 2P4VA 3L72H 3SPGA 4YY3O 4RZQA 1FJGB 2W57A 5JH7F 4FLWA 4FZ1A 4DUYB 4OX9H 2YUAA 2H8PC 5I5UA 4PDMA 3GB8B 5LHGA 4PZ7A 2UUCO 5CN0A 3CXCU 3PW0A 5A2QN 3QG5A 1KJIA 3FAVB 3APQA 2YIBD 4K6NA 3FKSG 2XCAA 1Y76A 1EKPA 1W93A 1R73A 3F7YC 4X20A 3O65A 2XT9A 2QEXV 1H2MA 4PI0A 2K1EA 3OW2U 4NXNB 4DR3B 3NGDA 1IBMO 2KSDA 1R9TA 5JQGF 3BPZA 1JOYA 3TEKA 1GYFA 2B1GA 1P4RA 5EBLC 1AN7A 1NZ6A 2CZGA 3TQTA 4AYBA 1Z5WA 3ABLB 1M4UA 3CJHB 4DR6B 2XGPA 4A3MG 1RSOA 4UVAA 4Q4CA 3FB6C 2VA3A 3T1HO 4R8UA 5B1NA 1G1XB 4NTYA 4FVMA 3UKMA 3F5TA 3E5NA 1B3QA 2JA7G 2DWEC 1AJNA 1WA8A 3OHBA 5KFNA 1Y14B 4X1YB 5L1KA 2BTQA 3H3VH 1PNLA 4HNUA 2ZDGA 4YJ3B 2FLPA 1M90W 2COGA 4UUGA 2OCHA 3GWKC 1H8HG 4BY7G 1EN5A 3S3XA 5KHIA 2CFMA 4RZRA 1H2KA 2HG5C 1TVKA 4E4EA 4ECYA 2ZDQA 5DG7A 1FJGO 5KUKA 3E89A 1RM1C 1ET0A 1SQXH 1RJRA 4ED8A 4WFAV 3RN4A 2DWCA 3LQSA 1VQ9V 3K5LA 1B04A 3ASNB 5IYCG 3GIPA 1PKXA 3TXSA 4FFNA 4UCSA 1IBLB 4X65H 4RNOA 3KHHA 4RUFA 4FGRA 3K5IA 3H01A 5FJ8G 1TUEB 3RV4A 4BBSG 3IC7A 5DQIA 1GSHA 3JAWB 1I94H 4NXNH 3K9AA 3RJ0A 5FNVA 2JA5G 2FMAA 1SC5B 4DIMA 3P30A 4ICGA 3AYHB 4DV0O 2WE6A 4J7ZA 1GLVA 4LF8B 1OCOC 3JZIA 1F51A 2NN4A 3ABKB 3OGCC 2QYZA 3G80A 4BIZA 5CBFA 2SCUB 4DR5H 1SZXA 4JI6B 1BHBA 4ED6A 4O81A 4WF9V 4B3TH 2HVKC 3Q4HA 4C5BA 1HR0O 5LXTF 4A3GG 3UO2A 5BR8B 1KJ9A 5EOYA 4J9QA 5BWVA 4J10A 2OIGA 1S9FA 3G6XA 2HJFC 2JA7A 1K34A 2XIGA 1VMGA 2ZIMA 3U0ZA 1T3NA 4QWBA 2RF4A 1ORQC 1VQLV 3TK1A 3KKYA 4JI5B 3GIIA 2YYAA 4C5CA 1MZBA 1M6VA 3RGBA 1DTOA 2C28A 4P30A 1DLBA 4ABMA 4YJ2B 1NJIW 4FPPA 4C7UA 3JZ6A 2W70A 2AW9A 1XMOH 2GUZB 1SEIA 4XBFA 4E4TA 4YR0A 4MW8A 1R6KA 1KBLA 3T54A 1JJOA 3LMLA 3FB7C 1I3QA 2R8IA 2YZNA 3VOTA 4DL6A 1FKAH 4A3BG 4XX0B 3B8MA 2A9HA 2V9WA 2L35A 1RYSA 1VQ6V 4PDVA 4XZ3B 1K7DA 2UXCO 2Z04A 3K08A 3PR5B 5EK0A 1EUCB 3HR0A 2PVPA 3IG0A 3E8BA 4WD3A 1OCOB 4JI4O 3PW4A 4DR3O 2QDOA 1M0WA 3CC4V 1MSWD 3DGEA 2R87A 1M7JA 1MA1A 2B5UA 3HB9A 3I55V 2DAAA 2Q7EA 2HIVA 4R8UB 2C2RA 4O3SA 4FM9A 3KTMA 2BE3A 4FLUA 3ZRXA 1L0LH 4JASA 1WCMA 2ALZA 4K35A 4YJ2F 2VWJA 2CNUA 3CSWA 3ETHA 4GKJO 4JV0A 4IWXA 4O2AF 3RF2A 3L70H 1RM1B 1BE3H 1KJJA 2UXBH 3U54A 1XHZA 1JA8A 3GB7C 4GX1A 4MV7A 3ZJZA 3BY6A 1J95A 2A7WA 1Y1VA 3W7SA 4X88A 4JI7B 1BCCH 2IH3C 3IN5A 4YHHO 4UV9A 1SERA 4R50A 2YWVA 1QVFU 4NZOA 2R7ZG 2X6CA 4JI1B 3G71V 3T5KA 2RCVA 5BZBA 4MA5A 3GTMA 4PDRA 1Q3EA 3U9TA 4BWAA 4LF4H 4MVRA 4EYIB 3GIQA 5LMNB 3TY8A 1GM7A 3ZRWA 2OWOA 4O7RA 1YXBA 1SS3A 4A3IG 2R93G 1N36H 1W2BU 1KYOF 3C3SA 3WU2Z 3OUZA 1S10A 5CMUA 1S97A 4ZQIA 4PDLA 3FFQA 2NVYA 3VQYA 1NH2D 3UFXB 4J9ZB 3W1GA 2ZR3A 2EIJC 4P2ZA 1J5EH 5I5SA 1YIJV 3B2EE 2A1HA 2R7MA 3OR7C 3GVMA 3U55A 2DW4A 5LA6A 2EJ7A 4LF5O 2FB5A 1OV9A 5H5NA 2UXDO 1UFIA 1NU1H 4X66H 2UU9O 1ZETA 4X66B 2COIA 5L1IA 1E1RG 2OT5A 3VA7A 3E83A 5KFLA 4KXRA 4MS2A 4TV9A 5GONB 5JQGB 5C8YF 3HXLA 1I94B 1AP5A 2PUSA 2JGDB 1IX9A 1I7NA 4L8JA 1GO3E 2WLLB 4DR1B 3MWMA 1PV0A 1XREA 3ZHSA 2VQEB 1IVSA 1US6A 2ZE5A 5D5QA 3DTGA 3E8GA 4FFMA 4PJ0Z 5EZYB 2IU3A 3OM3B 4DV4B 4A3EG 4Z1VA 4JYAO 2WLIB 1NBMG 1CKOA 2WDTA 4JI0H 3OSPA 1IXBA 3M9NB 5KX5A 3H1LH 1N32B 2B1IA 2YZMA 5C3EG 3QVNA 4Q8EA 2XTAA 2W9CB 1VQ7V 3M4IA 1V4YA 1XI1A 4CKCA 2JEFA 2R9RB 2AHYA 1NKDA 3PFFA 4XDJA 1DV2A 4B08A 3V4SA 1SQGA 2IJJA 4ECRA 2FK2A 3JAMN 5KFQA 1B06A 3TGUH 5TISZ 3PN1A 3GV5B 1EYZA 4DW0A 3APOA 3CCJV 1T94A 5LGTA 5BR8O 4WCEV 3G6YA 2HHHH 4QWEA 3UZOA 1HNZB 4YP3A 2XAQA 3JALB 5IDJA 2VS0A 2HHFB 2MCTA 5KFRA 2OH2A 3THOA 2ZM6B 1NR7A 3P3NA 4H44B 1A3GA 3QWUA 3JD3A 3GIMA 1R3IC 3SI8A 2CE4A 2FYUH 3JAKB 1I2LA 1WP7A 5JH7B 5LA6B 4FBTA 4AHCA 3RVZA 1GSOA 4WFEA 4LMYA 4DUZH 4X64O 1JPXA 2HLDG 4BIUA 3GIJA 4IAJA 1O9HA 1S76D 1CP9A 3K5HA 3ZHQA 2WLJA 5JJNB 2Z5UA 4DV2B 4NB5A 1WSCA 2DYSB 2QM8A 1VF6C 4J9NA 1FFXA 1ZSPA 2Y0SE 3TY9A 5KFUA 1XNQH 4O4JB 3SPHA 3S3WA 3ZS8C 4TSFG 4TVIA 2BOCC 2CTPA 1F7YA 3F5WC 1FAFA 4FM1A 1YTFD 2VUGA 3SYPA 2QSAA 1Q86W 2ZDHA 4BR6A 2QKCA 1EBOA 1I94O 4EBDA 4F4ZA 4OX9B 1XQ8A 4G27B 4DV6O 2JA5A 2E2IA 2EIMC 3K57A 4KHPH 4ETSA 1HR0B 3PZPA 1ENVA 3KALA 4O4JF 2W9BA 1KBHA 2CGNA 4JI5H 2JS5A 3H1IH 3RAQA 2N74A 4JI4B 4YB8B 4ZI7F 3N6XA 2BTQB 2E75B 1AR5A 4YHHH 2W0FC 3FB8C 1NVPB 1S03G 5EBWC 3CEIA 5H6QA 2QGNA 4LF6B 5LGNA 2R82A 3FAVA 5HV6A 3MDSA 1AROP 1I7FA 4PELA 1JX4A 4G3IA 4UFZA 5D5PA 4J9KA 2YSUB 3D3QA 4X62O 2AXTZ 4TQSA 5DG9A 5K1PA 4O2BB 2R8KA 3T1YH 3E8FA 3SPCA 5KG1A 3FYEB 2Q7HA 1N33O 5LOVF 3LDEA 2B63A 3OTFA 4DYLA 3ML0A 1CKMA 3RW0A 4O84A 2N04A 5LHIA 4DV5B 4LSXA 1W0KG 1WLEA 4LF4O 1GN3A 1G6UA 4B3RH 2EINB 4I9QA 5KT7A 4X20B 4AQYH 3BFRA 2RQ6A 3JCZA 3P32A 5EYPB 5IJ0A 3N40P 4WBNB 2YW2A 4QPJA 1BL8A 2F95B 3E2EA 4HR7A 3Q8SB 2YXYA 4JGSA 4ECVA 5I5XA 1YITV 4ED0A 3JATA 1S0VA 2FLLA 1KQSU 3JAKA 2DIKA 4JAVA 5CA1A 3HOXG 2PTMA 4YY3B 2QWRB 3I12A 4M9UA 1H2LA 1FXKC 1S77D 5K1XA 3C0FB 2JEGA 4MVMA 3H1HH 2PMZE 2AGOA 3E35A 1C30A 1A48A 5EC2C 5DLFA 1N34H 5KFFA 2IH1C 4JV2A 3GTKA 2AZ2A 4DL2A 3CHXA 2ZXWB 3HKEB 2JJ1G 1I08A 4I50A 3BRCA 1JXLA 4LFCH 4IWYA 4J9RA 4IRDA 1ZAUA 3K79A 4FLXA 1YJ9V 5KG2A 2LFRA 2ZQMA 2CUGA 1I1LA 5JVDF 1K4DC 1QU7A 1Q7YW 5I5WA 2XD4A 3JASA 4F4XA 1SFOA 4DV1O 1NQTA 5KX5B 3R5FA 1TWHA 3N2GA 1QR8A 2Y0SA 2Y4TA 3ZRVA 3L74H 3K3VA 4UV8A 3AX6A 2GPWA 5BYAA 3OMIB 3HKCB 2IBKA 1Y74A 4TUYA 4J9PA 2VPQA 3BVOA 4EBEA 5IWAB 1R3KC 1Y67A 3CSXA 4O2AA 3RYIB 4DV2H 5GW7A 4U7NA 1ZTEA 4EQ5A 3KAKA 4E6NA 4GCZA 3J81N 4MV3A 4FFBB 2DN9A 1P16A 2HVQA 3OGIB 4BAYA 2OCCC 3RAXA 4XDLA 4IIJF 2JGUA 5FLXN 2F93B 2J6UA 3NBYB 4FS2A 3W1BA 5BWWA 2JVDA 4MVZA 4DL4A 2YS8A 4LFCO 1T5EA 1EFRG 2DQ0A 2P22C 2M05A 5DGBA 1BSMA 1HP8A 2PF4E 2YIDA 1NTKH 1SQVH 3LNNA 1JQ0A 4G28B 2FPGB 5EZYA 3GIDA 3N2KA 1GH6A 1R6TA 2WSSG 2W6NA 4LF7H 1I1MA 4MTOA 3WB2A 3GV8B 4BY1G 3EPIA 1IBKH 4JI0O 3ZHVA 2F23A 1PX2A 3T9EA 3B8NA 4ZIBA 5CA0A 3D36A 4D7TA 1H2NA 4LFAO 2YS6A 4MTDA 2ATLA 1AR1B 1MABG 3FD9A 3FKIG 4CZZA 1VQ4V 5FPOA 3GJXB 1XMOO 1N34B 1IBKB 1RP3B 5J2UB 1ZUQA 3RWRD 2E5LO 1PL0A 4JPRA 3LUTB 2UU9B 3ETGA 4J9SA 3RYHB 5KG0A 1BQ0A 2NNUA 1E4GT 4DV7O 4GKKB 2BQ3A 1R3JC 2YRWA 2YI8A 1F4MA 5CM0A 4DV6H 1RFYA 5KT3A 4NTWA 2PI4A 4WBNA 3K58A 3JARA 2YU9A 2A06H 4LCUC 1LUWA 2R72A 2YXHA 4QWAA 4KFMA 3V6JA 3SPIA 2XASA 4RUEA 4RO2A 4DV5H 4MA0A 1YCIA 4CH5A 1KU9A 5BWRA 5LYJF 4JTAB 1E1QG 3KG2A 1O75A 1AUVA 5C93A 1XOUA 2JIZG 4I7HA 1SCUB 5E1AC 3OUUA 1AJQA 2P90A 2M6YA 1CXZB 3T1YO 3IAYA 3KAJA 3H20A 1SKVA 2W8LA 3H0GG 4MV4A 1EZJA 4P9PA 3K06A 1GAXA 3HPLC 5DQHA 4CH3A 3H4DA 1R6NA 1XDNA 3KHLA 2EIKC 2V1DA 1V9PA 4ZOLA 4F6EA 1PNKA 4JI4H 4EKWA 4DL7A 1N34O 4NZMA 3JD1A 2CDYA 4LNUA 1HWYA 5EWGA 4DV0B 2ZE8A 1K3EA 2JRIA 4NXMH 4N21A 5KFXA 4LWSA 5LMNH 3T5HA 2BQUA 2EJ3A 3UQ8A 4JI2B 3QO7A 3MHHC 1Q82W 1P7GA 5JVDB 1E4EA 4IT5A 4UVCA 4RUAA 4O7WA 3TW7A 3GTQA 2CK3G 2ZINA 5KG5A 3PVXA 4M0JA 4JTCB 4AI8A 3TY5A 2VQDA 5IYDG 5D1PA 5LL6b 4CS2A 2R93A 1JDEA 3PJSK 5LP6A 3CB2A 4O2AB 4JYYA 3JZFA 1SF9A 5J9PC 4MTXA 4JV5O 3SNOA 3T1CA 3DAAA 5DN6G 5IWAO 4QJFA 2YDEA 3WB0A 4B3MH 1P7BA 1A9XA 3HBLA 2WA3A 4DV1H 1S0OA 5KT2A 1BXRA 4PZ6A 1MOFA 3BABA 5JJEB 4K8ZA 1RJQA 5ITZA 3JD4A 3MR2A 1QHTA 2QWOB 4H0LB 4I5SA 5IYBO 3KCYA 2UVUA 4WHXA 1HW7A 1N0JA 1S72V 1OBGA 3H40A 3GQCA 3EXAA 5DECA 1N33B 3CCVV 2YZGA 1K5QA 4FBUA 1OCCC 5B5EZ 2HVRA 1Y6XA 3H9VA 1Q90D 4X62B 5KKNB 4O3QA 4DR7O 4CH6A 5F9NA 1IBMH 2XC9A 3AG7A 1Y74B 3ZMUA 4XYLB 1LUVA 3W5OA 1FXHA 4TQDA 4I9WA 3UM7A 4PA9A 3D36C 3JD2A 3C90A 3TETA 2LGQA 3RYFA 1MNGA 1IOVA 4RAIA 3BEHA 2UXCB 3NR7A 2JEIA 1SETA 3A2FA 3K5MA 4RWUA 1JDBB 2W6JG 5L3DA 2VQFO 3JATB 4AQYO 5HNEA 3HT5A 2P67A 3CVZA 4CKEA 1VQNV 3VQWA 1DF5A 3EHBB 2VR1A 3STZC 2DLNA 4R8CA 1GM8A 2WAMA 2PYLA 3SJQC 2JGDA 1YHQV 4O7VA 1M57C 2CW8A 4B7KA 5C5JA 4LBEC 1K5SA 1WPXA 4I0XA 2Q73A 2Y69B 3BQ2A 2DMXA 4EG0A 5GTHZ 4DR5O 3VQXA 1VS0A 1X4TA 3A0BZ 3L4JA 1SA0B 2BTOA 3CXHF 1CPYA 4QIWF 2E2HA 4R7RA 3HOYG 3EYYA 5KFHA 1Q5OA 3IJ4A 3G6EV 3MHSC 2QB5A 2UUAH 4TM5A 4H33A 2VQEO 3CRMA 1TVKB 4OPHA 4DXWA 3ASOC 2E74B 1Y1WA 2C2DA 3DSQA 1TUBB 3DTFA 3RB0A 4LNUB 4P9OA 2WLMA 4O3NA 3WWHA 3OT7A 1J5EB 3HOZG 1DF4A 2YRXA 2J6SA 3Q2OA 3WWJA 2Y4RA 4DLKA 2Q69A 3HKDB 3ZBHA 3WO1A 5KMGB 2XNDG 4JI6O 1UC8A 2HG8A 3ZRWB 2ZJTA 4A3LG 4Q8FA 4JAAA 2FJZA 4RNNA 4GUNA 3K9SA 4RAZA 1KD1W 2YCHA 1MG1A 3GWOA 3H1KH 2YC0A 1VQKV 1K8AW 1ZLZA 1K9MW 2V59A 4QSHA 1GRJA 5HBRB 3AG3C 1TGOA 4UXNA 1RPRA 3RYCB 3UT5A 2CQYA 1RSOB 2ADQB 2W6QA 1VF7A 1VKZA 3L75H 4DR2H 2BCCH 2QM7A 3HKZE 2VQEH 4C5AA 2CH7B 3R9RA 2EILC 3ETJA 4NZNA 2VA2A 2AHZA 4MW3A 5KFBA 4DV3B 3M7MX 3LDCA 5IE9A 2PGGA 1Z2PX 4YBZB 4YJ3F 2W6IG 3WO0A 2XAJA 5L1LA 3K5OA 5KMGA 5KT5A 4A3FG 4X62H 5JQWA 4CBCA 2AQ4A 3SPJA 1SQFA 2IBZH 4NTXA 5JVLA 4YR3A 3T1YB 2BQRA 1WJZA 2XAGA 5LMUB 4B3SB 2DZDA 2W0XA 1A0GA 5KFAA 2HP8A 2UUAB 3R65A 1C3OA 2CNVA 4ME6A 3EFFK 2R7LA 2ZT9B 1QVGU 1EN4A 3W7WA 5EZYF 3ABTA 5E25A 4EGQA 3ZEDA 5IYZA 5DAAA 1PNMA 5K2MA 4ECTA 2KQXA 1SA0A 1XMQB 4JI2O 3RT3C 1OCZB 1K83A 3D8CA 4I0XB 2Y0IA 4DR3H 3DXRA 3ETQA 1H2SB 3JCUZ 3LWBA 1GM9A 1AVMA 4J7JA 5B66Z 3G8DA 3CX5F 4DV7B 4GKKO 4ZHQA 3ZHUA 2LJ2A 3I4NG 2FK1A 5AG2A 4MV8A 1Y66A 2UVVA 4O7ZA 4QWDA 1YI2V 3RYFB 2N05A 4LC1A 3M9MB 1PM9A 2EIMB 3ASNC 5DEDA 4NXMO 5KT6A 3N27A 2O57A 5I5TA 2Q0OC 3HKBB 4O4LA 4FM0A 4AYBE 4GC6A 4U7CA 4MTGA 4O3RA 3FYIB 5LOVA 2HGSA 4DV4O 1KUQA 4J9MA 1I0HA 1VARA 3T1HH 1CE8A 2ILMA 3RYIA 1YF2A 2FE3A 2W71A 1VP7A 2V7QG 1AB3A 5KA5A 4QWCA 1CKNB 3HKZA 3PR4A 2P6JA 1QCEA 1SQBH 4HBNA 3BACA 3Q1KA 2Y4UA 5KG3A 1O9GA 1A0IA 1N32O 5BWXA 3MWEA 2LQTA 2MW2B 4B3TB 2V4RA 4Z2WA 3JASB 1DV1A 2R9AA 1ZL8A 3CRAA 4DV2O 4DV3O 5LMUH 2UVRA 4B3SH 2X6BA 3BA9A 4HQ6A 1KEEA 5KFTA 3NXSA 1XNRB 4HN2A 5I5VA 2JA6A 3ZCCA 1HNZH 1WRVA 3L71H 1M1KW 5F2VO 3KHRA 1BGYH 1WH2A 3PW5A 3CPWU 2ASDA 2GPSA 3HO8A 3ORQA 2NVXA 3CE2A 1R1BA 4JTDB 2BR0A 1DAAA 2EJRA 4UB6Z 1L2ZA 4DRXA 4IGGA 4O4HF 4QGPA 1M93A 2YICA 2R84A 1XMOB 3E22A 2ODTX 2O03A 1S0MA 4A3KG 2CKZB 5DM6V 4I4TF 4LF5H 3OMAB 4ZHQB 3ETEA 4IZOA 2ZKOA 2CNQA 1OCCB 1Z2GA 3R5HA 4RB1A 4HAMA 3LULA 3BQ1A 2UU9H 2JS3A 3CC7V 2E5LH 2P4KA 3J80N 4DR1H 3B09A 1KECA 2KG7A 2Z0AA 1XMQO 4UVBA 3RUPA 2GTAA 3N6RA 4PBCA 4GLXA 3N42B 1GTOA 4YHHB 4F6RB 1ZQ7A 1SQQH 4HNAA 4E2LA 4DUYO 1I7LA 2CW7A 2OIEA 2RDCA 2FPPB 3KXYT 4CS4A 5IYZB 1QLEB 4EB6A 3OD4A 1WA8B 2Y0PA 1SZTA 3KZIZ 4MV6A 2ODMA 4YIPA 3RB6A 5FD5A 5FR9A
chains in the Genus database with same CATH topology
3GB8B 4JI6H 4PZ7A 3JASA 3QG5A 4LF9H 5KX5B 3N2GA 5KHKA 4DRXB 4UCUA 4X1KA 3J80W 1D5AA 2YIBD 2EX3A 4X1IB 3K3VA 4LF8H 1XNQB 2UUBB 3HKCB 4X20A 4TV8A 4TUYA 3VNNA 2UXDH 3QF7A 4NXNB 4PI0A 5IWAB 4DR3B 3RGZA 4X64H 4O2AA 3CSXA 4DV2H 3RYIB 5LP6B 4EQ5A 4CC6A 3KAKA 4E6NA 1XMQH 2HEPA 3BPZA 4FFBB 4LR3A 5IT9W 1P16A 2HVQA 1GYFA 4TQFA 1AN7A 2JGUA 1Z5WA 2F93B 1M4UA 5IJ9B 4DR6B 3NBYB 4DV6B 3W1BA 1RSOA 2JVDA 2UXCH 1T5EA 4GKKH 3J81W 2P22C 2QM4A 2Q7GA 4IHJB 4FVMA 3LNNA 4I55B 5EZYA 3N2KA 4LF7H 3SGIA 4EB6B 1YEWA 4DRFA 3WB2A 4MV9A 3GDEA 1X9NA 4X1YB 4Q6GA 1IBKH 4O4IA 5KHHA 2BTQA 3RIZA 4ZIBA 5CA0A 4D7TA 2HHHB 1S68A 4MTDA 4DR4H 5JQGA 4RB2C 2F66C 4YJ3B 5FPOA 3GJXB 1N34B 1IBKB 2CAZC 5J2UB 4PI2A 3RWRD 5LYJA 4DV3H 2HVSA 4LH7A 4X1YA 2UU9B 1E4FT 3RYHB 5KHIA 2CFMA 5CA1B 1TVKA 3BHPA 4PHZA 5J2TA 3JAMW 1E4GT 4GKKB 4O4JA 1N32H 2YI8A 1QQCA 4DV6H 4LH6A 4DV4H 3JSLA 4WBNA 3K58A 1ZHQA 5IJ9A 3JARA 3K5LA 1B04A 1P8LA 4UCSA 1IBLB 2F4VB 4X65H 4K0KB 4UCVA 2R72A 5JCOA 4CC5A 4B3RB 4TOIA 3JAWB 1I94H 5CB4A 4NXNH 3RJ0A 5FNVA 4DV5H 4CH5A 1KU9A 1Q8IA 2WE6A 2R70A 4LF8B 1O75A 3SJBC 4I7HA 1BJTA 3UT5B 4JI2H 2QJ1A 4X1KB 5FPRA 4DR5H 2ZNIA 5FD6A 5D1OB 4JI6B 3IAYA 4JYAH 3KAJA 2XHBA 3H20A 4B3TH 4K8XA 1SKVA 4DUYH 5BR8B 3JALA 3RYHA 4CH4A 5EOYA 4DR7B 4CH3A 1XDNA 4RB3C 2XIGA 2ZIMA 4JV5B 4PZ8A 1V9PA 4ZOLA 5JJJB 3U0ZA 5GONA 4YJ3A 4JI4H 4JI5B 4F6RA 1MZBA 1M5IA 3RGBA 3T1HB 4LNUA 3JARB 4DV0B 5BR8H 4YJ2B 5EIBC 4NXMH 5LXTB 1JFFB 3RYCA 5LMNH 4JYAB 1WN7A 5LP6C 3UQ8A 4GKJB 1XMOH 4JI2B 4CS3A 5J2TB 3RTXA 1SEIA 3E22B 5JVDB 1JJOA 4Q0YA 3LMLA 2P5OA 4YJ2A 2ZINA 1FKAH 4PDBA 4JI7H 3TY5A 4LFBH 2PYJA 4TV9B 5D1PA 4CS2A 5LL6b 5LP6A 4K0KH 3J7AK 2GV9A 4X65B 1IBLH 2F4VH 3CB2A 4O2AB 3IG0A 3N44B 5DISC 4AILC 1M0WA 3WB0A 4B3MH 1N33H 4DV1H 3L4KA 2VQFB 4PZ6A 4IHJA 2OYQA 2HIVA 3BABA 2Q7EA 5JJEB 4K8ZA 4LFAB 5ITZA 4FM9A 3JSNA 1QHTA 4FLUA 4GYCB 4LFAH 3ICXA 4U3JB 1HW7A 4DV1B 2VWJA 4LF6H 4B3MB 1N33B 1BGWA 2HVRA 1Q43A 1M0TA 3RF2A 4I50B 2RGVA 3L2PA 4X62B 2UXBH 1XHZA 4DK0A 4MV7A 4UCOA 4J0MA 1HR0H 4CH6A 1IBMH 4IIJA 4KHPB 4JI7B 4TV8B 4LF7B 4FLZA 2V4DA 3W5OA 4TQDA 4DR2B 4JI1B 3RYFA 2UXCB 1Q3EA 1NT2B 2VPSA 3A2FA 3K5MA 4BWAA 4LF4H 2E3CA 5LMNB 4LSAA 3JATB 3TY8A 3CVZA 2KSWA 2OWOA 3VQWA 4NVPA 5LYJB 2PYLA 1N36H 4EEQA 2KKWA 2CW8A 3HKDA 3FFQA 5C8YA 3VQYA 5A2QW 1I6UA 3W1GA 3KYHC 1TAEA 3VQXA 2UXDB 1VS0A 1X4TA 3L4JA 1SA0B 2BTOA 1J5EH 4EFEA 4FLTA 4R7RA 4UCRA 3B2EE 3EYYA 1Q5OA 2YIBA 4LF9B 4O4HA 5LA6A 5JCOC 2UUAH 4X66H 1TVKB 4X66B 4JI3H 1FJGH 4I4TA 1ZHSA 3DSQA 1TUBB 4LFCB 4LNUB 1J5EB 3K5NA 3N41B 1S5JA 4FFBA 3U11A 1TA8A 3HKDB 5JQGB 4TV9A 5GONB 3K59A 2WYOA 3HXLA 1I94B 2PUSA 5KMGB 4L8JA 2ZJTA 4O4IB 4DR1B 3MWMA 2E5LB 2VQEB 3F8NA 5D5QA 5BMVB 4RAZA 5EZYB 4DV4B 4LF5B 2YCHA 2YIAA 4YY3H 2WDTA 4LF4B 1Z5VA 2IM9A 1CKOA 4JI0H 5KX5A 3S24A 1TGOA 1N32B 3RFRA 4JI0B 2VOBA 4APMA 3RYCB 3UT5A 5LXTA 4UCTA 1P49A 4A2AA 1VF7A 3M4IA 4JI1H 1XI1A 4DR2H 2VQEH 3NC0B 4IIJB 4B08A 5BMVA 1SQGA 1SYXB 2Q0AA 4DV3B 3M7MX 1FFXB 3OTOH 1IBMB 1Z2PX 2PGGA 3FMAA 3RGXA 4ZOLB 3PN1A 4D7SA 1JMKC 3K5OA 3VQVA 5KMGA 4DR4B 2UXBB 4X62H 1HNWH 4TUYB 4FLYA 3QTCA 2HHHH 1SQFA 2ZCEA 2RJZA 1HNZB 3DF7A 3JALB 1XNRH 3T1YB 2MCTA 2UUCH 3THOA 2ZM6B 5LMUB 4B3SB 1Z2NX 5ITZB 3QWUA 2UUAB 3BAAA 3JAKB 1L8DA 5JH7B 4O4HB 5LA6B 4AHCA 4DR6H 4LMYA 4DUZH 3RR5A 3ZEDA 5IYZA 5FNVB 3JAWA 4IAJA 4BWSC 1O9HA 1SA0A 2ZIOA 1XMQB 4HNAB 5JJNB 1N36B 3SJCC 4DV2B 4X64B 5IWAH 4DR3H 1WNSA 1H2SB 3ETQA 1FFXA 3TY9A 2UUBH 4A2BA 4DV7B 1XNQH 3BA8A 4ZHQA 4O4JB 3ZS8C 4O2BA 3MAQA 5KHGA 3WB1A 2VUGA 4FM1A 4FLVA 1JFFA 3RYFB 4EFBA 4DV7H 4OX9B 1XQ8A 1WPBA 5J2UA 3K57A 4KHPH 3HKBB 4O4LA 4FM0A 4DV0H 5LOVA 1CKNA 1HR0B 2HGSA 4ETSA 3T1HH 1HNXH 3KALA 2RGRA 4DK1A 4JI5H 2JS5A 3RYIA 4ZI7B 5CA0B 4JI4B 3N6XA 2BTQB 2FE3A 4MTEA 4YHHH 1S03G 5LOVB 2F1MA 3HKCA 4DUZB 1CKNB 4RAYA 4LF6B 3N2KB 4HBNA 4DR7H 4I55A 4JI8H 1O9GA 1A0IA 1XK5A 5D1OA 1I7FA 5KHJA 4B3TB 4U3JA 4UFZA 5D5PA 3JASB 2R9AA 2VQFH 5LMUH 5K1PA 4O2BB 2ZM6H 4B3SH 4DR5B 3BA9A 2UUCB 3T1YH 1XNRB 2Q7HA 1HNZH 4KL1A 1WH2A 3NBZB 5CB4B 1HNWB 1XHXA 3OTFA 1CKMA 4AQYB 4DV5B 4ZI7A 4LSXA 2YI9A 1G6UA 4LFBB 4B3RH 3OTOB 1FVIA 2Q2TA 4I9QA 4FM2A 4X20B 2YXLA 4AQYH 2RQ6A 5EYPB 5IJ0A 3N40P 4WBNB 3HKBA 4O4LB 5FLXW 4M7EA 4X1IA 1L2ZA 2F95B 4DRXA 3U10A 3N2GB 4BW9A 1TUBA 3JATA 5JH7A 1M93A 4I4TB 3JAKA 1XMOB 4GKJH 2Q2UA 2PY5A 3E22A 5JVDA 2O03A 5CA1A 2PZSA 2PTMA 4YY3B 4LF5H 4ZHQB 4NXMB 2HIXA 1DGSA 4JI8B 4RB1A 2UU9H 5K1XA 3C0FB 2E5LH 2ZNJA 3HKEA 4DR1H 5EYPA 5IJ0B 1KMIZ 1Z2OX 4GLXA 2VWKA 4YHHB 3N42B 1N34H 4F6RB 5EIBD 4HNAA 3N43B 5C8YB 3SR2C 2CW7A 4JV5H 3CHXA 4RB0A 3SJAC 3HKEB 3KXYT 4I50A 4CS4A 5IYZB 3BRCA 4EB6A 1HNXB 4LFCH 1ZAUA 2W57A 4FLXA 4RZQA 1FJGB 4FLWA 4DUYB 4OX9H 4JI3B 5FD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GB8 B;  5BR8 B;  4PZ7 A;  4DR7 B;  3TY9 A;  4DV7 B;  3W1G A;  3KYH C;  1TAE A;  3BA8 A;  2UXD B;  1XDN A;  1VS0 A;  4UCU A;  4JV5 B;  4PZ8 A;  1V9P A;  4EFE A;  1XNQ B;  4UCR A;  2UUB B;  2VUG A;  3VNN A;  4JI5 B;  4LF9 B;  4EFB A;  4NXN B;  5IWA B;  4DR3 B;  3T1H B;  4OX9 B;  4DV0 B;  4X66 B;  4EQ5 A;  4CC6 A;  4E6N A;  1CKN A;  1HR0 B;  1P16 A;  4JYA B;  2HVQ A;  4LFC B;  3UQ8 A;  4JI4 B;  4GKJ B;  4JI2 B;  4DR6 B;  3RTX A;  1J5E B;  4DV6 B;  3NBY B;  3W1B A;  1CKN B;  1TA8 A;  4DUZ B;  4LF6 B;  1I94 B;  1A0I A;  4DR1 B;  1XK5 A;  2E5L B;  5D1O A;  3TY5 A;  5D1P A;  4B3T B;  3SGI A;  2VQE B;  4UFZ A;  4DRF A;  3GDE A;  1X9N A;  4DV4 B;  4LF5 B;  4X65 B;  4DR5 B;  3BA9 A;  2UUC B;  2HHH B;  1XNR B;  4LF4 B;  1CKO A;  1S68 A;  3S24 A;  5DIS C;  1N32 B;  4JI0 B;  3NBZ B;  5FPO A;  3GJX B;  1HNW B;  1N34 B;  4UCT A;  1IBK B;  2VQF B;  1CKM A;  4PZ6 A;  4AQY B;  2HIV A;  3BAB A;  4DV5 B;  2HVS A;  4LH7 A;  4LFA B;  3NC0 B;  3JSN A;  4LFB B;  3OTO B;  1FVI A;  2Q2T A;  2UU9 B;  4DV3 B;  2CFM A;  1IBM B;  4DV1 B;  3PN1 A;  4GKK B;  4B3M B;  1N33 B;  2UXB B;  4DR4 B;  2HVR A;  4LH6 A;  1XMO B;  2Q2U A;  3L2P A;  4X62 B;  1HNZ B;  3JSL A;  4YY3 B;  3T1Y B;  1B04 A;  1P8L A;  4UCO A;  4UCS A;  1IBL B;  2ZM6 B;  2F4V B;  5LMU B;  4B3S B;  4UCV A;  4K0K B;  4NXM B;  4KHP B;  2HIX A;  3QWU A;  4JI7 B;  1DGS A;  4JI8 B;  4CC5 A;  4LF7 B;  4B3R B;  4TOI A;  2UUA B;  3BAA A;  3W5O A;  4DR2 B;  4JI1 B;  4GLX A;  4YHH B;  4LF8 B;  2UXC B;  3RR5 A;  5FPR A;  1HNX B;  5LMN B;  1XMQ B;  1ZAU A;  5D1O B;  4JI6 B;  3TY8 A;  1FJG B;  2OWO A;  4DUY B;  1N36 B;  4DV2 B;  4JI3 B;  4X64 B;  4EEQ A; 
#chains in the Genus database with same CATH topology
 4JI6 H;  2R7Z A;  2HR3 A;  1GK9 A;  1ZWI C;  3EPG A;  1R3L C;  4DR2 O;  4LF9 H;  5DGH A;  4GX2 A;  5KHK A;  3AK1 A;  4UCU A;  1D5A A;  4X1I B;  4LF8 H;  5KFC A;  5BMV F;  3DC5 A;  4MSW C;  2R8G A;  3NUA A;  2UXD H;  3QF7 A;  1WB7 A;  4X64 H;  3RGZ A;  4QE7 A;  1TWA A;  1GN2 A;  4CC6 A;  1XMQ H;  4ECU A;  3W7T A;  4LR3 A;  5IT9 W;  2VUM A;  4TQF A;  1LNQ A;  2JK5 C;  3K0G A;  5LHH A;  5KFV A;  5C4X G;  1YDX A;  4MT8 A;  4DV6 B;  2RMK B;  1IDS A;  1XBL A;  4NKG B;  5CBG A;  2CTW A;  2UXC H;  1Q81 W;  3J81 W;  4O83 A;  2C2E A;  2OTL V;  1K1S A;  3FKI A;  2QM4 A;  4IHJ B;  4DUZ O;  4JZ2 A;  3OR6 C;  3SGI A;  5E79 Z;  4EB6 B;  2R7K A;  4DRF A;  2NU6 B;  3T4Z A;  4WBN F;  2QWQ B;  4O4I A;  3O9O A;  1KUT A;  3RIZ A;  2HHH B;  1S68 A;  3AEI A;  4FK5 C;  2F66 C;  4FFR A;  3JD0 A;  5LYJ A;  4FE2 A;  3IFX A;  2GQS A;  5L9X A;  3BHP A;  4HZ3 A;  4PHZ A;  2AU0 A;  4QE9 A;  1FD9 A;  3JAM W;  5B1B B;  4O4J A;  1N32 H;  1X59 A;  3RFC A;  2P7T C;  3HOV G;  4DV4 H;  2AGP A;  2OTJ V;  5IJ9 A;  4Q20 A;  3PO2 G;  3WNZ A;  4JI5 O;  1P8L A;  2WAQ A;  4MV1 A;  4HYK A;  2EIY A;  4UCV A;  1HNZ O;  1JKJ B;  4R6Z A;  4MVQ A;  1Y1W G;  3BQ0 A;  1PD3 A;  1KC7 A;  4B3R B;  4TOI A;  4ZOL F;  2RN9 A;  5CB4 A;  1RPO A;  2R8J A;  4RQF A;  1Q8I A;  4B3R O;  2R70 A;  3X2Q C;  4HNV A;  4J9L A;  1N36 O;  2EZP A;  4KP4 A;  3SJB C;  5B3S B;  1WCM G;  4JI2 H;  4X1K B;  5FPR A;  1OCZ C;  2ZNI A;  3QFF A;  2WA4 A;  5KFI A;  5CR5 A;  2XHB A;  4K8X A;  2EZO A;  1VQ5 V;  1I5X A;  1OHH G;  3JAL A;  2YS7 A;  1AJP A;  5DGI A;  4DR7 B;  5KFM A;  1W0J G;  3QNE A;  2WLL A;  1RK6 A;  1XUQ A;  4JV5 B;  1UPG A;  5B1A B;  3K3P A;  4DR1 O;  5JJJ B;  4O86 A;  5GON A;  4YJ3 A;  3QZ7 A;  2WB1 E;  3JRX A;  1XNR O;  2WB1 A;  2Q6A A;  2C2A A;  4KHP O;  4NLG A;  4DL3 A;  2ZE6 A;  3IC9 A;  5EIB C;  5IP7 G;  2OCC B;  1JFF B;  4NR1 A;  1D2D A;  3IGA C;  4JYA B;  4XYM B;  3TW6 A;  5LP6 C;  1LR1 A;  2PBZ A;  5B1A C;  5DGA A;  4GKJ B;  1HDJ A;  3HOW G;  1IZ3 A;  3RTX A;  3ZHT A;  1F4N A;  4Q0Y A;  3GIK A;  2EIL B;  3UZB A;  3CCE V;  1MMM A;  2GLT A;  5BWT A;  4JI7 H;  2PYJ A;  4TQR A;  2BOB C;  4TV9 B;  3CRC A;  2Q4P A;  1K33 A;  5I47 A;  3J7A K;  4F4W A;  2F4V H;  4I50 F;  2NU7 B;  4OPA A;  3FB5 C;  3U0G A;  1Q6H A;  3N44 B;  3QZ8 A;  2DPI A;  5DIS C;  1V55 C;  4AIL C;  1JJ2 U;  1V55 B;  4RCN A;  2ZE7 A;  1KKD A;  1MSD A;  5H80 A;  4IHJ A;  4B7E A;  2OYQ A;  1BS3 A;  3T5J A;  2UXX A;  1KJQ A;  4LFA B;  2I80 A;  2IA6 A;  4OX9 O;  3SYQ A;  2D3O W;  4A3J G;  4LFA H;  4YIO A;  3ICX A;  2DOS A;  4LWS B;  3N8D A;  2R6F A;  3CP1 A;  4J80 A;  1S5L Z;  2Q9L A;  4TV8 F;  2QTO A;  2JDI G;  5J2U F;  1BGW A;  4O4L F;  1FXK B;  3ASO B;  1VQP V;  4LF9 O;  3L2P A;  1IUR A;  1BNC A;  4DK0 A;  2M7W A;  4O7L A;  1BQZ A;  4UCO A;  2V5A A;  1FXK A;  3AG4 C;  4IIJ A;  4KHP B;  1CQI B;  3GV7 B;  2KG7 B;  4H13 B;  4LF7 B;  2F4V O;  4ED1 A;  4DR2 B;  4ED3 A;  2V58 A;  4PV1 B;  2Y69 C;  4OXS A;  2GHY A;  1N48 A;  1FYJ A;  2E3C A;  3A0R A;  2R92 A;  4YR2 A;  3CCL V;  1WR2 A;  2KSW A;  4GC7 A;  1XDC A;  2JJ2 G;  5BYB A;  4EEQ A;  3LSQ A;  1BZK A;  2FPI B;  4GX0 A;  2ETN A;  3HKD A;  1OZ0 A;  1I2K A;  4X8A A;  3CQZ A;  5A2Q W;  3KYH C;  2UXD B;  2R7N A;  3SYA A;  2QKA A;  3RV3 A;  3ABK C;  3RBE A;  4QW9 A;  4EFE A;  4FLT A;  2LW1 A;  3HB3 B;  1N0N A;  2J9G A;  1EZV H;  5KFS A;  1KB9 F;  3TII A;  1YSC A;  2YIB A;  4HYO A;  5J2T F;  4O4H A;  3TQ1 A;  4PWQ A;  3SYC A;  4JI3 H;  3AK3 A;  1FJG H;  4I4T A;  4EEY A;  2EJ0 A;  4LFC B;  5KFD A;  1JLL B;  1KP3 A;  3ORR A;  3K5N A;  3N41 B;  1S5J A;  2GQR A;  4FFB A;  4C2M A;  2JEX A;  2NLJ C;  5I5Y A;  1TA8 A;  4MAM A;  3OSN A;  4J7K A;  1PK8 A;  4PA3 A;  3BG5 A;  3ETD A;  2Q7D A;  1PP9 H;  4QIW A;  3WWI A;  4GT1 A;  5BMV B;  3V6H A;  3OFN G;  1CS0 A;  2FP4 B;  2HVJ C;  5KG6 A;  5EC1 C;  3CCM V;  4YY3 H;  4LF4 B;  2IM9 A;  1L0N H;  3R5X A;  3S24 A;  2WPD G;  4Q45 A;  1K1Q A;  1B6S A;  2W7P A;  2VOB A;  4UCT A;  4A2A A;  2LFS A;  3G6V A;  3T7A A;  2ABJ A;  3WG7 C;  3ZMT A;  2A0L A;  1VF6 A;  2RNB A;  1OBD A;  2X6A A;  1DK1 A;  5BMV A;  3CCU V;  1FXV A;  2WLK A;  5IYZ F;  3RB4 A;  3FMA A;  3RGX A;  3G67 A;  3KRE A;  1G8M A;  2QA4 V;  2UXB B;  3VQV A;  4DR4 B;  5CA3 A;  3TJT A;  4TUY B;  4FLY A;  3AG1 B;  2ZDI C;  3OE7 G;  5C1O A;  3B77 A;  2XUM A;  3ZN1 A;  4BXX G;  2QR4 A;  4NYK A;  1EHI A;  1NTM H;  4MVS A;  1Z2N X;  4ZHQ F;  5ITZ B;  1GGO A;  4WFF A;  4IRK A;  4O3O A;  2UXB O;  1J5E O;  5KFZ A;  1L8D A;  4O4H B;  2BSK B;  4IYH A;  2X5R A;  4DR6 H;  4JF3 A;  4QPK A;  3RR5 A;  2YEV B;  5L3B A;  3D3I A;  5FNV B;  4JI1 O;  4Q43 A;  3JAW A;  2LO1 A;  4O4I F;  2ZIO A;  5LP6 F;  1EN6 A;  1H2G A;  4O7T A;  2ATK C;  4RQE A;  2JEJ A;  5KX5 F;  3SJC C;  3A8T A;  1SES A;  3ABM C;  5IWA H;  1WNS A;  5L3G A;  4B3T O;  2ITD C;  2L6L A;  2R9I A;  5BXZ A;  2UUB H;  4A2B A;  2CH7 A;  2AGQ A;  4I55 F;  3BA8 A;  4O3P A;  2F43 G;  5KFW A;  1VAJ A;  4O2B A;  1OJH A;  1SRY A;  3MAQ A;  5KHG A;  4J41 A;  3R66 A;  4JUZ A;  4FLV A;  2AGA A;  4O7Y A;  3AG2 C;  3T9C A;  3G6B A;  3MR6 A;  4L1K A;  3V6K A;  3ZMZ A;  4I7Z B;  1WPB A;  4GLW A;  1Y1V G;  2NU8 B;  3CCQ V;  3M9O B;  3W7U A;  4DV5 O;  1NI8 A;  2R8H A;  4DK1 A;  3GIL A;  4JXU A;  3PO3 G;  3QO8 A;  1GKF A;  4ED2 A;  1WB8 A;  2W9B B;  4X66 O;  2F1M A;  4DUZ B;  1IBK O;  1S5H C;  4RAY A;  4U3F H;  2HDK A;  5I60 A;  4CMF A;  3T5L A;  4JI8 H;  3GTJ A;  2B63 G;  4JZG A;  1XK5 A;  5D1O A;  4XDK A;  5KHJ A;  1XEQ A;  1B6R A;  5IY5 C;  5EWF A;  2VQF H;  2CTR A;  2DPJ A;  1GN6 A;  1BHA A;  1K97 A;  2UUC B;  2GBO A;  1IBL O;  4B3M O;  4IRC A;  3LP8 A;  4MVU A;  3UCS C;  3L73 H;  5KAI Z;  5L3E A;  1XHX A;  1M9N A;  2VRZ A;  4NXN O;  2JA8 G;  1TWF A;  3OUF A;  2NUA B;  4LFB B;  1Y4M A;  1OWT A;  1FVI A;  5GON F;  2Q2T A;  2FML A;  4UB8 Z;  1NR1 A;  2C00 A;  4ED7 A;  4X1I A;  3K0D A;  3CCR V;  2D2C B;  3HOU G;  2CTQ A;  1TUB A;  5FLM G;  5JH7 A;  3AG4 B;  3OEH G;  2Q2U A;  3SDL A;  1QNM A;  1JR9 A;  2PZS A;  4JI7 O;  4A5U B;  1QR9 A;  3UYY A;  3QO5 A;  2WLN A;  4NXM B;  2HIX A;  3ZIA G;  3T9A A;  2A79 B;  3C3T A;  1U96 A;  4JI8 B;  2HHF A;  4ECQ A;  3GTL A;  2ZNJ A;  3VBB A;  2ZM6 O;  2W6O A;  3ZMS A;  5JUM A;  1OCR C;  2UXN A;  4QW8 A;  1Z2O X;  2VWK A;  2PN1 A;  4QIW E;  5EIB D;  3A0H Z;  2FK3 A;  3N43 B;  3LNM B;  5C8Y B;  3MJF A;  4JV5 H;  4JAU A;  4RB0 A;  3SJA C;  4N23 A;  1KP2 A;  2FTK A;  4Q44 A;  4O7S A;  2XCP A;  1HNX B;  5BPH A;  1AR4 A;  4BW5 A;  2BSK A;  4ECS A;  1BMF G;  4JI3 B;  2ZXW C;  4PD4 F;  3MFH A;  2JEU A;  3ZX6 A;  5K3W A;  4G2K A;  3AK2 A;  1CEZ A;  3U9S A;  1I5Y A;  5B1O A;  2ZR2 A;  5LGU A;  1OCR B;  4MTF A;  2ZDI A;  2I87 A;  4DRX B;  4X1K A;  5KA6 A;  3J80 W;  2EX3 A;  1XNQ B;  3CWB H;  2UUB B;  4TV8 A;  3EVK A;  2UUA O;  3VNN A;  4F4Y A;  2AZ0 A;  3CRR A;  5EDW A;  4FIP C;  4YXW G;  1K73 W;  4J9Y B;  3I5D A;  5LP6 B;  4LP8 A;  3T99 A;  2HEP A;  2IU0 A;  4F4L A;  1G4Y B;  4ECZ A;  1IYE A;  3VPD A;  5IJ9 B;  3T4D A;  2HGW A;  2HHH O;  2FKL A;  2EIN C;  4GKK H;  1PL4 A;  3TIN A;  2Q7G A;  1VEW A;  2DQ3 A;  2WTF A;  4I55 B;  1BT8 A;  3RBZ A;  2V4Q A;  1AI4 A;  1AP6 A;  1YEW A;  2DWD C;  3GDE A;  4MV9 A;  5C1P A;  1X9N A;  2FKX A;  5DQG A;  3BCC H;  4Q6G A;  3DXR B;  5IYD O;  5KHH A;  3H0G A;  2HJD A;  1TWC A;  2QWN B;  4DR4 H;  2ITC C;  5EBM C;  5JQG A;  2GSM B;  4RB2 C;  2FLN A;  5CB4 F;  3OHA A;  5FNV F;  2CAZ C;  4PI2 A;  2J6T A;  1EKF A;  3H1J H;  2HVS A;  4DV3 H;  2RDI A;  4LH7 A;  4X1Y A;  3CYO A;  1E4F T;  1YJN V;  1VQO V;  5CA1 B;  2XOK G;  5J2T A;  3OTO O;  4WFH A;  1JVM A;  4CKB A;  2IJI A;  1QQC A;  1ZX3 A;  3K03 A;  4LH6 A;  1HNW O;  2LW7 A;  4YQW A;  3JSL A;  3STL C;  1ZHQ A;  3CJH A;  5HFM A;  1G2W A;  1M56 B;  2HKO A;  3Q8P B;  3AG2 B;  1B33 N;  2F4V B;  4K0K B;  2DYR C;  2IJH A;  3LSU A;  3P3P A;  2QWP B;  5JCO A;  4CC5 A;  5B1B C;  2W6Z A;  2QK4 A;  4DO2 A;  1A32 A;  2IJK A;  1XIL A;  5F9L A;  1FPO A;  3CD6 V;  1I1K A;  1GSA A;  2W9A A;  3B4S A;  1Y76 B;  1KTA A;  1BJT A;  3ABM B;  4W4L A;  3UT5 B;  2QJ1 A;  2W8K A;  5LMU O;  4B3S O;  4ECX A;  5FD6 A;  1ULZ A;  5D1O B;  3PW7 A;  4JYA H;  2Q8V A;  2Q5Z A;  1M57 B;  1W59 A;  4DUY H;  3CC2 V;  2G38 A;  3T9B A;  3H4B A;  2UUB O;  5IYC O;  3RYH A;  4JV1 A;  4CH4 A;  1YZB A;  2B9Z A;  2XAF A;  5CE8 A;  4RB3 C;  4PZ8 A;  5CAE B;  3E8H A;  3E86 A;  5LL6 Y;  4F6R A;  1M5I A;  3OMN B;  3T1H B;  1WAZ A;  3ABL C;  3CMA V;  2YZL A;  3JAR B;  5BR8 H;  5IP9 G;  4ZKI A;  2NU9 B;  5LXT B;  4Q4D A;  1N56 A;  5T14 A;  3WFV A;  5CBH A;  3RYC A;  4DR6 O;  3LSS A;  1DIK A;  1WN7 A;  4TT3 G;  5A9G A;  2GUZ A;  1ROP A;  4CS3 A;  1MZF A;  2EIK B;  5J2T B;  3E22 B;  5KFE A;  4D6T H;  1KT8 A;  2QKS A;  2P5O A;  4YJ2 A;  4Y8V B;  4PDB A;  2P0A A;  3MWD A;  4LFB H;  3CME V;  2FB9 A;  1GO3 F;  2Z3Y A;  1S3J A;  4K0K H;  2GV9 A;  5KAF Z;  4X65 B;  2W6M A;  1IBL H;  4TWK A;  3B40 A;  4A93 G;  4K3A A;  5DMX A;  3SYO A;  4KUM A;  5L3C A;  3FDS A;  3VOU A;  1W96 A;  2WWW A;  4X65 O;  1VQM V;  1N33 H;  3DC6 A;  2E76 B;  4LF7 O;  1QLE C;  2R86 A;  3L4K A;  3M8A A;  2VQF B;  5KS8 A;  3KHG A;  1VF5 B;  1XNQ O;  1THZ A;  2ASL A;  4O82 A;  3SE7 A;  3JSN A;  1ZL8 B;  4GYC B;  2DYR B;  3MFI A;  4J11 A;  4U3J B;  5KT4 A;  4A3C G;  2EBO A;  3T9D A;  4DV1 B;  2I8C A;  4LF6 H;  4B3M B;  4DAA A;  1U97 A;  5LBQ A;  3TCU A;  2DJV A;  1Q43 A;  1M0T A;  4LF8 O;  4I50 B;  2RGV A;  1QBZ A;  1SQP H;  5KFO A;  1HNX O;  1KJ8 A;  2XAH A;  1NH2 B;  1NTZ H;  4J0M A;  1HR0 H;  2Z02 A;  2LGW A;  4X9Q A;  2X0L A;  4IL6 Z;  2YL2 A;  4TV8 B;  3DTU B;  4FLZ A;  2V4D A;  3T2M A;  3QQM A;  4ZBM A;  2EIJ B;  3G8C A;  2H3O A;  2C35 B;  3GTP A;  2EUL A;  4H37 A;  1N8R W;  1NT2 B;  2MK3 A;  5HFL A;  1EKV A;  2VPS A;  4PA6 A;  1AI6 A;  3CS5 A;  4RU9 A;  1URF A;  4QJF B;  4DW1 A;  5KLV H;  4LSA A;  2IW5 A;  4NVP A;  5LYJ B;  2HFE C;  1F23 A;  2KKW A;  2QTS A;  3CRQ A;  4YAK B;  3JRW A;  3RB3 A;  2JA6 G;  5C8Y A;  1IOW A;  4TV9 F;  3ZMV A;  1I6U A;  4RNM A;  1TAE A;  1UJW B;  1NS1 A;  4UCR A;  5IT9 N;  5EWE A;  3I4M G;  1KC8 W;  3MD0 A;  2XCL A;  3RBD A;  4LF9 B;  5JCO C;  3OUS A;  1N4C A;  1EZ1 A;  1RK5 A;  2P06 A;  2ASJ A;  4EGJ A;  2VUM G;  1KKC A;  4J42 A;  5IYB G;  1ZHS A;  5BY1 A;  1T36 A;  1M56 C;  1YVW A;  3U11 A;  3M99 B;  1PPJ H;  4WFG A;  1E79 G;  4CMD A;  3K59 A;  2WYO A;  5KG7 A;  1RYR A;  2A3Q A;  4O4I B;  4R7C A;  2H94 A;  2E5L B;  4J9O A;  3TIG A;  2W6P A;  3F8N A;  2UVW A;  2PMZ A;  1JCH A;  3GTG A;  1JIH A;  3FX7 A;  3K3W A;  4LF5 B;  4DQN A;  2Q67 A;  2YIA A;  4MVO A;  4DR4 O;  5KFG A;  3CEB A;  1Z5V A;  2C22 A;  4U7O A;  5BPF A;  3RFR A;  4JI0 B;  4APM A;  5L1J A;  4U6P A;  5C44 G;  1V54 C;  1TWG A;  1V51 A;  1COW G;  5LXT A;  1VBG A;  1IYD A;  1P49 A;  4ASU G;  4JI1 H;  3NC0 B;  4IIJ B;  1JX9 A;  1RJP A;  1SYX B;  2Q0A A;  1FFX B;  3OTO H;  1IBM B;  2QE7 G;  4FMT A;  4JI8 O;  2DE0 X;  4TUY F;  4EBC A;  4ZOL B;  3JYC A;  3J7A U;  4FFK A;  3R23 A;  4FFO A;  1QLN A;  4D7S A;  1JMK C;  1YJW V;  1HNW H;  2ZD9 A;  3QTC A;  2ZCE A;  2RJZ A;  3DF7 A;  1NVP D;  2FL4 A;  4IYI A;  2WAQ E;  2HGX A;  2YEV A;  2UUC H;  1XNR H;  1WP8 A;  4JYC A;  4OGQ B;  4X89 A;  2XGQ A;  1L1F A;  4WFB V;  3RVY A;  3BAA A;  1AI5 A;  2GDS A;  1Q6I A;  1UNN C;  2Y48 A;  1Q6U A;  5H2F Z;  4DL5 A;  4BWS C;  4K0K O;  1V54 B;  2K9P A;  5CA0 F;  5DLG A;  4HNA B;  2ARH A;  3AG3 B;  2W7O A;  3F7V C;  1N36 B;  5KUM A;  4X64 B;  2RDJ A;  4ECW A;  5GTI Z;  1CQJ B;  5B3S C;  3X2Q B;  2GTS A;  4IHJ F;  4FFP A;  3CCS V;  5KFJ A;  5D8D A;  1UC9 A;  3UO3 A;  2LP7 A;  3WB1 A;  1B6Q A;  5KFK A;  1JFF A;  4CE5 A;  4O7N A;  4EFB A;  3TXQ A;  5KFY A;  4DV7 H;  4F50 A;  3VPB A;  2WLI A;  5H9C A;  3AW8 A;  4FS1 A;  5J2U A;  1YTF B;  1AUX A;  4DV0 H;  2EJ2 A;  3ZN0 A;  5KFP A;  1CKN A;  4EYH B;  1HNX H;  3W7X A;  2RGR A;  5BWU A;  4Z1M G;  1AIL A;  4ZI7 B;  5CA0 B;  3K04 A;  1AI7 A;  2DAB A;  3V4Z A;  4MTE A;  2ADP A;  4PA4 A;  2COJ A;  5LOV B;  1K92 A;  3HKC A;  2OLS A;  5DG8 A;  3ABU A;  2X7R B;  1IXM A;  3N2K B;  3Q4H B;  2Q68 A;  4I55 A;  4DR7 H;  2DYS C;  4LFB O;  2W9C A;  4O2B F;  4PA7 A;  4U3J A;  1S0N A;  1EM1 A;  5CA1 F;  1FFT B;  2ZM6 H;  2QF7 A;  4W4K A;  4HNT A;  4DR5 B;  5JWP A;  4UUJ C;  3MR3 A;  3BJY A;  2R85 A;  1K4C C;  1H38 A;  2X0S A;  2ZGI A;  4KL1 A;  3NBZ B;  1MZE A;  5CB4 B;  3ZRS A;  2IP4 A;  1HNW B;  1VBH A;  2R92 G;  3GLK A;  2NR5 A;  4AQY B;  3VMM A;  4ZI7 A;  2YI9 A;  5IY5 B;  3OTO B;  4IR1 A;  4GZR B;  4FM2 A;  1VQ8 V;  2YXL A;  4FJC C;  4FU0 A;  4LF6 O;  1P84 F;  3HKB A;  3LDD A;  4O4L B;  5L3F A;  5FL7 G;  3I56 V;  4M7E A;  5FLX W;  3Q8Q B;  2PI5 A;  3AG1 C;  3U10 A;  1GMG A;  4BW9 A;  3N2G B;  4QNH B;  3VPC A;  4BIO A;  5LA6 F;  4BBR G;  4I4T B;  1EUD B;  3OAA G;  4L87 A;  3Q8R B;  1FKA O;  3PW2 A;  4JI3 O;  5JVD A;  2PY5 A;  1E4E B;  4GKJ H;  4RUC A;  2WLH A;  5LMN O;  2KB1 A;  3L9D A;  4GX5 A;  4IR9 A;  4JYB A;  2CGO A;  3KCX A;  1FS0 G;  1VIB A;  1DGS A;  3WG7 B;  4FZ0 A;  1H8E G;  3ZHR A;  3OEE G;  2HJW A;  3HKE A;  5KG4 A;  5EYP A;  5IJ0 B;  3G4S V;  4NYE A;  1I50 A;  3GTO A;  1KMI Z;  4YAJ B;  1D5N A;  1XL4 A;  4A3D G;  3SR2 C;  4CHI A;  2IMW P;  3MR5 A;  1GN4 A;  1XL6 A;  3T9F A;  4FFL A;  5H6R A;  2P4V A;  3L72 H;  3SPG A;  4YY3 O;  4RZQ A;  1FJG B;  2W57 A;  5JH7 F;  4FLW A;  4FZ1 A;  4DUY B;  4OX9 H;  2YUA A;  2H8P C;  5I5U A;  4PDM A;  3GB8 B;  5LHG A;  4PZ7 A;  2UUC O;  5CN0 A;  3CXC U;  3PW0 A;  5A2Q N;  3QG5 A;  1KJI A;  3FAV B;  3APQ A;  2YIB D;  4K6N A;  3FKS G;  2XCA A;  1Y76 A;  1EKP A;  1W93 A;  1R73 A;  3F7Y C;  4X20 A;  3O65 A;  2XT9 A;  2QEX V;  1H2M A;  4PI0 A;  2K1E A;  3OW2 U;  4NXN B;  4DR3 B;  3NGD A;  1IBM O;  2KSD A;  1R9T A;  5JQG F;  3BPZ A;  1JOY A;  3TEK A;  1GYF A;  2B1G A;  1P4R A;  5EBL C;  1AN7 A;  1NZ6 A;  2CZG A;  3TQT A;  4AYB A;  1Z5W A;  3ABL B;  1M4U A;  3CJH B;  4DR6 B;  2XGP A;  4A3M G;  1RSO A;  4UVA A;  4Q4C A;  3FB6 C;  2VA3 A;  3T1H O;  4R8U A;  5B1N A;  1G1X B;  4NTY A;  4FVM A;  3UKM A;  3F5T A;  3E5N A;  1B3Q A;  2JA7 G;  2DWE C;  1AJN A;  1WA8 A;  3OHB A;  5KFN A;  1Y14 B;  4X1Y B;  5L1K A;  2BTQ A;  3H3V H;  1PNL A;  4HNU A;  2ZDG A;  4YJ3 B;  2FLP A;  1M90 W;  2COG A;  4UUG A;  2OCH A;  3GWK C;  1H8H G;  4BY7 G;  1EN5 A;  3S3X A;  5KHI A;  2CFM A;  4RZR A;  1H2K A;  2HG5 C;  1TVK A;  4E4E A;  4ECY A;  2ZDQ A;  5DG7 A;  1FJG O;  5KUK A;  3E89 A;  1RM1 C;  1ET0 A;  1SQX H;  1RJR A;  4ED8 A;  4WFA V;  3RN4 A;  2DWC A;  3LQS A;  1VQ9 V;  3K5L A;  1B04 A;  3ASN B;  5IYC G;  3GIP A;  1PKX A;  3TXS A;  4FFN A;  4UCS A;  1IBL B;  4X65 H;  4RNO A;  3KHH A;  4RUF A;  4FGR A;  3K5I A;  3H01 A;  5FJ8 G;  1TUE B;  3RV4 A;  4BBS G;  3IC7 A;  5DQI A;  1GSH A;  3JAW B;  1I94 H;  4NXN H;  3K9A A;  3RJ0 A;  5FNV A;  2JA5 G;  2FMA A;  1SC5 B;  4DIM A;  3P30 A;  4ICG A;  3AYH B;  4DV0 O;  2WE6 A;  4J7Z A;  1GLV A;  4LF8 B;  1OCO C;  3JZI A;  1F51 A;  2NN4 A;  3ABK B;  3OGC C;  2QYZ A;  3G80 A;  4BIZ A;  5CBF A;  2SCU B;  4DR5 H;  1SZX A;  4JI6 B;  1BHB A;  4ED6 A;  4O81 A;  4WF9 V;  4B3T H;  2HVK C;  3Q4H A;  4C5B A;  1HR0 O;  5LXT F;  4A3G G;  3UO2 A;  5BR8 B;  1KJ9 A;  5EOY A;  4J9Q A;  5BWV A;  4J10 A;  2OIG A;  1S9F A;  3G6X A;  2HJF C;  2JA7 A;  1K34 A;  2XIG A;  1VMG A;  2ZIM A;  3U0Z A;  1T3N A;  4QWB A;  2RF4 A;  1ORQ C;  1VQL V;  3TK1 A;  3KKY A;  4JI5 B;  3GII A;  2YYA A;  4C5C A;  1MZB A;  1M6V A;  3RGB A;  1DTO A;  2C28 A;  4P30 A;  1DLB A;  4ABM A;  4YJ2 B;  1NJI W;  4FPP A;  4C7U A;  3JZ6 A;  2W70 A;  2AW9 A;  1XMO H;  2GUZ B;  1SEI A;  4XBF A;  4E4T A;  4YR0 A;  4MW8 A;  1R6K A;  1KBL A;  3T54 A;  1JJO A;  3LML A;  3FB7 C;  1I3Q A;  2R8I A;  2YZN A;  3VOT A;  4DL6 A;  1FKA H;  4A3B G;  4XX0 B;  3B8M A;  2A9H A;  2V9W A;  2L35 A;  1RYS A;  1VQ6 V;  4PDV A;  4XZ3 B;  1K7D A;  2UXC O;  2Z04 A;  3K08 A;  3PR5 B;  5EK0 A;  1EUC B;  3HR0 A;  2PVP A;  3IG0 A;  3E8B A;  4WD3 A;  1OCO B;  4JI4 O;  3PW4 A;  4DR3 O;  2QDO A;  1M0W A;  3CC4 V;  1MSW D;  3DGE A;  2R87 A;  1M7J A;  1MA1 A;  2B5U A;  3HB9 A;  3I55 V;  2DAA A;  2Q7E A;  2HIV A;  4R8U B;  2C2R A;  4O3S A;  4FM9 A;  3KTM A;  2BE3 A;  4FLU A;  3ZRX A;  1L0L H;  4JAS A;  1WCM A;  2ALZ A;  4K35 A;  4YJ2 F;  2VWJ A;  2CNU A;  3CSW A;  3ETH A;  4GKJ O;  4JV0 A;  4IWX A;  4O2A F;  3RF2 A;  3L70 H;  1RM1 B;  1BE3 H;  1KJJ A;  2UXB H;  3U54 A;  1XHZ A;  1JA8 A;  3GB7 C;  4GX1 A;  4MV7 A;  3ZJZ A;  3BY6 A;  1J95 A;  2A7W A;  1Y1V A;  3W7S A;  4X88 A;  4JI7 B;  1BCC H;  2IH3 C;  3IN5 A;  4YHH O;  4UV9 A;  1SER A;  4R50 A;  2YWV A;  1QVF U;  4NZO A;  2R7Z G;  2X6C A;  4JI1 B;  3G71 V;  3T5K A;  2RCV A;  5BZB A;  4MA5 A;  3GTM A;  4PDR A;  1Q3E A;  3U9T A;  4BWA A;  4LF4 H;  4MVR A;  4EYI B;  3GIQ A;  5LMN B;  3TY8 A;  1GM7 A;  3ZRW A;  2OWO A;  4O7R A;  1YXB A;  1SS3 A;  4A3I G;  2R93 G;  1N36 H;  1W2B U;  1KYO F;  3C3S A;  3WU2 Z;  3OUZ A;  1S10 A;  5CMU A;  1S97 A;  4ZQI A;  4PDL A;  3FFQ A;  2NVY A;  3VQY A;  1NH2 D;  3UFX B;  4J9Z B;  3W1G A;  2ZR3 A;  2EIJ C;  4P2Z A;  1J5E H;  5I5S A;  1YIJ V;  3B2E E;  2A1H A;  2R7M A;  3OR7 C;  3GVM A;  3U55 A;  2DW4 A;  5LA6 A;  2EJ7 A;  4LF5 O;  2FB5 A;  1OV9 A;  5H5N A;  2UXD O;  1UFI A;  1NU1 H;  4X66 H;  2UU9 O;  1ZET A;  4X66 B;  2COI A;  5L1I A;  1E1R G;  2OT5 A;  3VA7 A;  3E83 A;  5KFL A;  4KXR A;  4MS2 A;  4TV9 A;  5GON B;  5JQG B;  5C8Y F;  3HXL A;  1I94 B;  1AP5 A;  2PUS A;  2JGD B;  1IX9 A;  1I7N A;  4L8J A;  1GO3 E;  2WLL B;  4DR1 B;  3MWM A;  1PV0 A;  1XRE A;  3ZHS A;  2VQE B;  1IVS A;  1US6 A;  2ZE5 A;  5D5Q A;  3DTG A;  3E8G A;  4FFM A;  4PJ0 Z;  5EZY B;  2IU3 A;  3OM3 B;  4DV4 B;  4A3E G;  4Z1V A;  4JYA O;  2WLI B;  1NBM G;  1CKO A;  2WDT A;  4JI0 H;  3OSP A;  1IXB A;  3M9N B;  5KX5 A;  3H1L H;  1N32 B;  2B1I A;  2YZM A;  5C3E G;  3QVN A;  4Q8E A;  2XTA A;  2W9C B;  1VQ7 V;  3M4I A;  1V4Y A;  1XI1 A;  4CKC A;  2JEF A;  2R9R B;  2AHY A;  1NKD A;  3PFF A;  4XDJ A;  1DV2 A;  4B08 A;  3V4S A;  1SQG A;  2IJJ A;  4ECR A;  2FK2 A;  3JAM N;  5KFQ A;  1B06 A;  3TGU H;  5TIS Z;  3PN1 A;  3GV5 B;  1EYZ A;  4DW0 A;  3APO A;  3CCJ V;  1T94 A;  5LGT A;  5BR8 O;  4WCE V;  3G6Y A;  2HHH H;  4QWE A;  3UZO A;  1HNZ B;  4YP3 A;  2XAQ A;  3JAL B;  5IDJ A;  2VS0 A;  2HHF B;  2MCT A;  5KFR A;  2OH2 A;  3THO A;  2ZM6 B;  1NR7 A;  3P3N A;  4H44 B;  1A3G A;  3QWU A;  3JD3 A;  3GIM A;  1R3I C;  3SI8 A;  2CE4 A;  2FYU H;  3JAK B;  1I2L A;  1WP7 A;  5JH7 B;  5LA6 B;  4FBT A;  4AHC A;  3RVZ A;  1GSO A;  4WFE A;  4LMY A;  4DUZ H;  4X64 O;  1JPX A;  2HLD G;  4BIU A;  3GIJ A;  4IAJ A;  1O9H A;  1S76 D;  1CP9 A;  3K5H A;  3ZHQ A;  2WLJ A;  5JJN B;  2Z5U A;  4DV2 B;  4NB5 A;  1WSC A;  2DYS B;  2QM8 A;  1VF6 C;  4J9N A;  1FFX A;  1ZSP A;  2Y0S E;  3TY9 A;  5KFU A;  1XNQ H;  4O4J B;  3SPH A;  3S3W A;  3ZS8 C;  4TSF G;  4TVI A;  2BOC C;  2CTP A;  1F7Y A;  3F5W C;  1FAF A;  4FM1 A;  1YTF D;  2VUG A;  3SYP A;  2QSA A;  1Q86 W;  2ZDH A;  4BR6 A;  2QKC A;  1EBO A;  1I94 O;  4EBD A;  4F4Z A;  4OX9 B;  1XQ8 A;  4G27 B;  4DV6 O;  2JA5 A;  2E2I A;  2EIM C;  3K57 A;  4KHP H;  4ETS A;  1HR0 B;  3PZP A;  1ENV A;  3KAL A;  4O4J F;  2W9B A;  1KBH A;  2CGN A;  4JI5 H;  2JS5 A;  3H1I H;  3RAQ A;  2N74 A;  4JI4 B;  4YB8 B;  4ZI7 F;  3N6X A;  2BTQ B;  2E75 B;  1AR5 A;  4YHH H;  2W0F C;  3FB8 C;  1NVP B;  1S03 G;  5EBW C;  3CEI A;  5H6Q A;  2QGN A;  4LF6 B;  5LGN A;  2R82 A;  3FAV A;  5HV6 A;  3MDS A;  1ARO P;  1I7F A;  4PEL A;  1JX4 A;  4G3I A;  4UFZ A;  5D5P A;  4J9K A;  2YSU B;  3D3Q A;  4X62 O;  2AXT Z;  4TQS A;  5DG9 A;  5K1P A;  4O2B B;  2R8K A;  3T1Y H;  3E8F A;  3SPC A;  5KG1 A;  3FYE B;  2Q7H A;  1N33 O;  5LOV F;  3LDE A;  2B63 A;  3OTF A;  4DYL A;  3ML0 A;  1CKM A;  3RW0 A;  4O84 A;  2N04 A;  5LHI A;  4DV5 B;  4LSX A;  1W0K G;  1WLE A;  4LF4 O;  1GN3 A;  1G6U A;  4B3R H;  2EIN B;  4I9Q A;  5KT7 A;  4X20 B;  4AQY H;  3BFR A;  2RQ6 A;  3JCZ A;  3P32 A;  5EYP B;  5IJ0 A;  3N40 P;  4WBN B;  2YW2 A;  4QPJ A;  1BL8 A;  2F95 B;  3E2E A;  4HR7 A;  3Q8S B;  2YXY A;  4JGS A;  4ECV A;  5I5X A;  1YIT V;  4ED0 A;  3JAT A;  1S0V A;  2FLL A;  1KQS U;  3JAK A;  2DIK A;  4JAV A;  5CA1 A;  3HOX G;  2PTM A;  4YY3 B;  2QWR B;  3I12 A;  4M9U A;  1H2L A;  1FXK C;  1S77 D;  5K1X A;  3C0F B;  2JEG A;  4MVM A;  3H1H H;  2PMZ E;  2AGO A;  3E35 A;  1C30 A;  1A48 A;  5EC2 C;  5DLF A;  1N34 H;  5KFF A;  2IH1 C;  4JV2 A;  3GTK A;  2AZ2 A;  4DL2 A;  3CHX A;  2ZXW B;  3HKE B;  2JJ1 G;  1I08 A;  4I50 A;  3BRC A;  1JXL A;  4LFC H;  4IWY A;  4J9R A;  4IRD A;  1ZAU A;  3K79 A;  4FLX A;  1YJ9 V;  5KG2 A;  2LFR A;  2ZQM A;  2CUG A;  1I1L A;  5JVD F;  1K4D C;  1QU7 A;  1Q7Y W;  5I5W A;  2XD4 A;  3JAS A;  4F4X A;  1SFO A;  4DV1 O;  1NQT A;  5KX5 B;  3R5F A;  1TWH A;  3N2G A;  1QR8 A;  2Y0S A;  2Y4T A;  3ZRV A;  3L74 H;  3K3V A;  4UV8 A;  3AX6 A;  2GPW A;  5BYA A;  3OMI B;  3HKC B;  2IBK A;  1Y74 A;  4TUY A;  4J9P A;  2VPQ A;  3BVO A;  4EBE A;  5IWA B;  1R3K C;  1Y67 A;  3CSX A;  4O2A A;  3RYI B;  4DV2 H;  5GW7 A;  4U7N A;  1ZTE A;  4EQ5 A;  3KAK A;  4E6N A;  4GCZ A;  3J81 N;  4MV3 A;  4FFB B;  2DN9 A;  1P16 A;  2HVQ A;  3OGI B;  4BAY A;  2OCC C;  3RAX A;  4XDL A;  4IIJ F;  2JGU A;  5FLX N;  2F93 B;  2J6U A;  3NBY B;  4FS2 A;  3W1B A;  5BWW A;  2JVD A;  4MVZ A;  4DL4 A;  2YS8 A;  4LFC O;  1T5E A;  1EFR G;  2DQ0 A;  2P22 C;  2M05 A;  5DGB A;  1BSM A;  1HP8 A;  2PF4 E;  2YID A;  1NTK H;  1SQV H;  3LNN A;  1JQ0 A;  4G28 B;  2FPG B;  5EZY A;  3GID A;  3N2K A;  1GH6 A;  1R6T A;  2WSS G;  2W6N A;  4LF7 H;  1I1M A;  4MTO A;  3WB2 A;  3GV8 B;  4BY1 G;  3EPI A;  1IBK H;  4JI0 O;  3ZHV A;  2F23 A;  1PX2 A;  3T9E A;  3B8N A;  4ZIB A;  5CA0 A;  3D36 A;  4D7T A;  1H2N A;  4LFA O;  2YS6 A;  4MTD A;  2ATL A;  1AR1 B;  1MAB G;  3FD9 A;  3FKI G;  4CZZ A;  1VQ4 V;  5FPO A;  3GJX B;  1XMO O;  1N34 B;  1IBK B;  1RP3 B;  5J2U B;  1ZUQ A;  3RWR D;  2E5L O;  1PL0 A;  4JPR A;  3LUT B;  2UU9 B;  3ETG A;  4J9S A;  3RYH B;  5KG0 A;  1BQ0 A;  2NNU A;  1E4G T;  4DV7 O;  4GKK B;  2BQ3 A;  1R3J C;  2YRW A;  2YI8 A;  1F4M A;  5CM0 A;  4DV6 H;  1RFY A;  5KT3 A;  4NTW A;  2PI4 A;  4WBN A;  3K58 A;  3JAR A;  2YU9 A;  2A06 H;  4LCU C;  1LUW A;  2R72 A;  2YXH A;  4QWA A;  4KFM A;  3V6J A;  3SPI A;  2XAS A;  4RUE A;  4RO2 A;  4DV5 H;  4MA0 A;  1YCI A;  4CH5 A;  1KU9 A;  5BWR A;  5LYJ F;  4JTA B;  1E1Q G;  3KG2 A;  1O75 A;  1AUV A;  5C93 A;  1XOU A;  2JIZ G;  4I7H A;  1SCU B;  5E1A C;  3OUU A;  1AJQ A;  2P90 A;  2M6Y A;  1CXZ B;  3T1Y O;  3IAY A;  3KAJ A;  3H20 A;  1SKV A;  2W8L A;  3H0G G;  4MV4 A;  1EZJ A;  4P9P A;  3K06 A;  1GAX A;  3HPL C;  5DQH A;  4CH3 A;  3H4D A;  1R6N A;  1XDN A;  3KHL A;  2EIK C;  2V1D A;  1V9P A;  4ZOL A;  4F6E A;  1PNK A;  4JI4 H;  4EKW A;  4DL7 A;  1N34 O;  4NZM A;  3JD1 A;  2CDY A;  4LNU A;  1HWY A;  5EWG A;  4DV0 B;  2ZE8 A;  1K3E A;  2JRI A;  4NXM H;  4N21 A;  5KFX A;  4LWS A;  5LMN H;  3T5H A;  2BQU A;  2EJ3 A;  3UQ8 A;  4JI2 B;  3QO7 A;  3MHH C;  1Q82 W;  1P7G A;  5JVD B;  1E4E A;  4IT5 A;  4UVC A;  4RUA A;  4O7W A;  3TW7 A;  3GTQ A;  2CK3 G;  2ZIN A;  5KG5 A;  3PVX A;  4M0J A;  4JTC B;  4AI8 A;  3TY5 A;  2VQD A;  5IYD G;  5D1P A;  5LL6 b;  4CS2 A;  2R93 A;  1JDE A;  3PJS K;  5LP6 A;  3CB2 A;  4O2A B;  4JYY A;  3JZF A;  1SF9 A;  5J9P C;  4MTX A;  4JV5 O;  3SNO A;  3T1C A;  3DAA A;  5DN6 G;  5IWA O;  4QJF A;  2YDE A;  3WB0 A;  4B3M H;  1P7B A;  1A9X A;  3HBL A;  2WA3 A;  4DV1 H;  1S0O A;  5KT2 A;  1BXR A;  4PZ6 A;  1MOF A;  3BAB A;  5JJE B;  4K8Z A;  1RJQ A;  5ITZ A;  3JD4 A;  3MR2 A;  1QHT A;  2QWO B;  4H0L B;  4I5S A;  5IYB O;  3KCY A;  2UVU A;  4WHX A;  1HW7 A;  1N0J A;  1S72 V;  1OBG A;  3H40 A;  3GQC A;  3EXA A;  5DEC A;  1N33 B;  3CCV V;  2YZG A;  1K5Q A;  4FBU A;  1OCC C;  5B5E Z;  2HVR A;  1Y6X A;  3H9V A;  1Q90 D;  4X62 B;  5KKN B;  4O3Q A;  4DR7 O;  4CH6 A;  5F9N A;  1IBM H;  2XC9 A;  3AG7 A;  1Y74 B;  3ZMU A;  4XYL B;  1LUV A;  3W5O A;  1FXH A;  4TQD A;  4I9W A;  3UM7 A;  4PA9 A;  3D36 C;  3JD2 A;  3C90 A;  3TET A;  2LGQ A;  3RYF A;  1MNG A;  1IOV A;  4RAI A;  3BEH A;  2UXC B;  3NR7 A;  2JEI A;  1SET A;  3A2F A;  3K5M A;  4RWU A;  1JDB B;  2W6J G;  5L3D A;  2VQF O;  3JAT B;  4AQY O;  5HNE A;  3HT5 A;  2P67 A;  3CVZ A;  4CKE A;  1VQN V;  3VQW A;  1DF5 A;  3EHB B;  2VR1 A;  3STZ C;  2DLN A;  4R8C A;  1GM8 A;  2WAM A;  2PYL A;  3SJQ C;  2JGD A;  1YHQ V;  4O7V A;  1M57 C;  2CW8 A;  4B7K A;  5C5J A;  4LBE C;  1K5S A;  1WPX A;  4I0X A;  2Q73 A;  2Y69 B;  3BQ2 A;  2DMX A;  4EG0 A;  5GTH Z;  4DR5 O;  3VQX A;  1VS0 A;  1X4T A;  3A0B Z;  3L4J A;  1SA0 B;  2BTO A;  3CXH F;  1CPY A;  4QIW F;  2E2H A;  4R7R A;  3HOY G;  3EYY A;  5KFH A;  1Q5O A;  3IJ4 A;  3G6E V;  3MHS C;  2QB5 A;  2UUA H;  4TM5 A;  4H33 A;  2VQE O;  3CRM A;  1TVK B;  4OPH A;  4DXW A;  3ASO C;  2E74 B;  1Y1W A;  2C2D A;  3DSQ A;  1TUB B;  3DTF A;  3RB0 A;  4LNU B;  4P9O A;  2WLM A;  4O3N A;  3WWH A;  3OT7 A;  1J5E B;  3HOZ G;  1DF4 A;  2YRX A;  2J6S A;  3Q2O A;  3WWJ A;  2Y4R A;  4DLK A;  2Q69 A;  3HKD B;  3ZBH A;  3WO1 A;  5KMG B;  2XND G;  4JI6 O;  1UC8 A;  2HG8 A;  3ZRW B;  2ZJT A;  4A3L G;  4Q8F A;  4JAA A;  2FJZ A;  4RNN A;  4GUN A;  3K9S A;  4RAZ A;  1KD1 W;  2YCH A;  1MG1 A;  3GWO A;  3H1K H;  2YC0 A;  1VQK V;  1K8A W;  1ZLZ A;  1K9M W;  2V59 A;  4QSH A;  1GRJ A;  5HBR B;  3AG3 C;  1TGO A;  4UXN A;  1RPR A;  3RYC B;  3UT5 A;  2CQY A;  1RSO B;  2ADQ B;  2W6Q A;  1VF7 A;  1VKZ A;  3L75 H;  4DR2 H;  2BCC H;  2QM7 A;  3HKZ E;  2VQE H;  4C5A A;  2CH7 B;  3R9R A;  2EIL C;  3ETJ A;  4NZN A;  2VA2 A;  2AHZ A;  4MW3 A;  5KFB A;  4DV3 B;  3M7M X;  3LDC A;  5IE9 A;  2PGG A;  1Z2P X;  4YBZ B;  4YJ3 F;  2W6I G;  3WO0 A;  2XAJ A;  5L1L A;  3K5O A;  5KMG A;  5KT5 A;  4A3F G;  4X62 H;  5JQW A;  4CBC A;  2AQ4 A;  3SPJ A;  1SQF A;  2IBZ H;  4NTX A;  5JVL A;  4YR3 A;  3T1Y B;  2BQR A;  1WJZ A;  2XAG A;  5LMU B;  4B3S B;  2DZD A;  2W0X A;  1A0G A;  5KFA A;  2HP8 A;  2UUA B;  3R65 A;  1C3O A;  2CNV A;  4ME6 A;  3EFF K;  2R7L A;  2ZT9 B;  1QVG U;  1EN4 A;  3W7W A;  5EZY F;  3ABT A;  5E25 A;  4EGQ A;  3ZED A;  5IYZ A;  5DAA A;  1PNM A;  5K2M A;  4ECT A;  2KQX A;  1SA0 A;  1XMQ B;  4JI2 O;  3RT3 C;  1OCZ B;  1K83 A;  3D8C A;  4I0X B;  2Y0I A;  4DR3 H;  3DXR A;  3ETQ A;  1H2S B;  3JCU Z;  3LWB A;  1GM9 A;  1AVM A;  4J7J A;  5B66 Z;  3G8D A;  3CX5 F;  4DV7 B;  4GKK O;  4ZHQ A;  3ZHU A;  2LJ2 A;  3I4N G;  2FK1 A;  5AG2 A;  4MV8 A;  1Y66 A;  2UVV A;  4O7Z A;  4QWD A;  1YI2 V;  3RYF B;  2N05 A;  4LC1 A;  3M9M B;  1PM9 A;  2EIM B;  3ASN C;  5DED A;  4NXM O;  5KT6 A;  3N27 A;  2O57 A;  5I5T A;  2Q0O C;  3HKB B;  4O4L A;  4FM0 A;  4AYB E;  4GC6 A;  4U7C A;  4MTG A;  4O3R A;  3FYI B;  5LOV A;  2HGS A;  4DV4 O;  1KUQ A;  4J9M A;  1I0H A;  1VAR A;  3T1H H;  1CE8 A;  2ILM A;  3RYI A;  1YF2 A;  2FE3 A;  2W71 A;  1VP7 A;  2V7Q G;  1AB3 A;  5KA5 A;  4QWC A;  1CKN B;  3HKZ A;  3PR4 A;  2P6J A;  1QCE A;  1SQB H;  4HBN A;  3BAC A;  3Q1K A;  2Y4U A;  5KG3 A;  1O9G A;  1A0I A;  1N32 O;  5BWX A;  3MWE A;  2LQT A;  2MW2 B;  4B3T B;  2V4R A;  4Z2W A;  3JAS B;  1DV1 A;  2R9A A;  1ZL8 A;  3CRA A;  4DV2 O;  4DV3 O;  5LMU H;  2UVR A;  4B3S H;  2X6B A;  3BA9 A;  4HQ6 A;  1KEE A;  5KFT A;  3NXS A;  1XNR B;  4HN2 A;  5I5V A;  2JA6 A;  3ZCC A;  1HNZ H;  1WRV A;  3L71 H;  1M1K W;  5F2V O;  3KHR A;  1BGY H;  1WH2 A;  3PW5 A;  3CPW U;  2ASD A;  2GPS A;  3HO8 A;  3ORQ A;  2NVX A;  3CE2 A;  1R1B A;  4JTD B;  2BR0 A;  1DAA A;  2EJR A;  4UB6 Z;  1L2Z A;  4DRX A;  4IGG A;  4O4H F;  4QGP A;  1M93 A;  2YIC A;  2R84 A;  1XMO B;  3E22 A;  2ODT X;  2O03 A;  1S0M A;  4A3K G;  2CKZ B;  5DM6 V;  4I4T F;  4LF5 H;  3OMA B;  4ZHQ B;  3ETE A;  4IZO A;  2ZKO A;  2CNQ A;  1OCC B;  1Z2G A;  3R5H A;  4RB1 A;  4HAM A;  3LUL A;  3BQ1 A;  2UU9 H;  2JS3 A;  3CC7 V;  2E5L H;  2P4K A;  3J80 N;  4DR1 H;  3B09 A;  1KEC A;  2KG7 A;  2Z0A A;  1XMQ O;  4UVB A;  3RUP A;  2GTA A;  3N6R A;  4PBC A;  4GLX A;  3N42 B;  1GTO A;  4YHH B;  4F6R B;  1ZQ7 A;  1SQQ H;  4HNA A;  4E2L A;  4DUY O;  1I7L A;  2CW7 A;  2OIE A;  2RDC A;  2FPP B;  3KXY T;  4CS4 A;  5IYZ B;  1QLE B;  4EB6 A;  3OD4 A;  1WA8 B;  2Y0P A;  1SZT A;  3KZI Z;  4MV6 A;  2ODM A;  4YIP A;  3RB6 A;  5FD5 A;  5FR9 A; 
#chains in the Genus database with same CATH homology
 3GB8 B;  4JI6 H;  4PZ7 A;  3JAS A;  3QG5 A;  4LF9 H;  5KX5 B;  3N2G A;  5KHK A;  4DRX B;  4UCU A;  4X1K A;  3J80 W;  1D5A A;  2YIB D;  2EX3 A;  4X1I B;  3K3V A;  4LF8 H;  1XNQ B;  2UUB B;  3HKC B;  4X20 A;  4TV8 A;  4TUY A;  3VNN A;  2UXD H;  3QF7 A;  4NXN B;  4PI0 A;  5IWA B;  4DR3 B;  3RGZ A;  4X64 H;  4O2A A;  3CSX A;  4DV2 H;  3RYI B;  5LP6 B;  4EQ5 A;  4CC6 A;  3KAK A;  4E6N A;  1XMQ H;  2HEP A;  3BPZ A;  4FFB B;  4LR3 A;  5IT9 W;  1P16 A;  2HVQ A;  1GYF A;  4TQF A;  1AN7 A;  2JGU A;  1Z5W A;  2F93 B;  1M4U A;  5IJ9 B;  4DR6 B;  3NBY B;  4DV6 B;  3W1B A;  1RSO A;  2JVD A;  2UXC H;  1T5E A;  4GKK H;  3J81 W;  2P22 C;  2QM4 A;  2Q7G A;  4IHJ B;  4FVM A;  3LNN A;  4I55 B;  5EZY A;  3N2K A;  4LF7 H;  3SGI A;  4EB6 B;  1YEW A;  4DRF A;  3WB2 A;  4MV9 A;  3GDE A;  1X9N A;  4X1Y B;  4Q6G A;  1IBK H;  4O4I A;  5KHH A;  2BTQ A;  3RIZ A;  4ZIB A;  5CA0 A;  4D7T A;  2HHH B;  1S68 A;  4MTD A;  4DR4 H;  5JQG A;  4RB2 C;  2F66 C;  4YJ3 B;  5FPO A;  3GJX B;  1N34 B;  1IBK B;  2CAZ C;  5J2U B;  4PI2 A;  3RWR D;  5LYJ A;  4DV3 H;  2HVS A;  4LH7 A;  4X1Y A;  2UU9 B;  1E4F T;  3RYH B;  5KHI A;  2CFM A;  5CA1 B;  1TVK A;  3BHP A;  4PHZ A;  5J2T A;  3JAM W;  1E4G T;  4GKK B;  4O4J A;  1N32 H;  2YI8 A;  1QQC A;  4DV6 H;  4LH6 A;  4DV4 H;  3JSL A;  4WBN A;  3K58 A;  1ZHQ A;  5IJ9 A;  3JAR A;  3K5L A;  1B04 A;  1P8L A;  4UCS A;  1IBL B;  2F4V B;  4X65 H;  4K0K B;  4UCV A;  2R72 A;  5JCO A;  4CC5 A;  4B3R B;  4TOI A;  3JAW B;  1I94 H;  5CB4 A;  4NXN H;  3RJ0 A;  5FNV A;  4DV5 H;  4CH5 A;  1KU9 A;  1Q8I A;  2WE6 A;  2R70 A;  4LF8 B;  1O75 A;  3SJB C;  4I7H A;  1BJT A;  3UT5 B;  4JI2 H;  2QJ1 A;  4X1K B;  5FPR A;  4DR5 H;  2ZNI A;  5FD6 A;  5D1O B;  4JI6 B;  3IAY A;  4JYA H;  3KAJ A;  2XHB A;  3H20 A;  4B3T H;  4K8X A;  1SKV A;  4DUY H;  5BR8 B;  3JAL A;  3RYH A;  4CH4 A;  5EOY A;  4DR7 B;  4CH3 A;  1XDN A;  4RB3 C;  2XIG A;  2ZIM A;  4JV5 B;  4PZ8 A;  1V9P A;  4ZOL A;  5JJJ B;  3U0Z A;  5GON A;  4YJ3 A;  4JI4 H;  4JI5 B;  4F6R A;  1MZB A;  1M5I A;  3RGB A;  3T1H B;  4LNU A;  3JAR B;  4DV0 B;  5BR8 H;  4YJ2 B;  5EIB C;  4NXM H;  5LXT B;  1JFF B;  3RYC A;  5LMN H;  4JYA B;  1WN7 A;  5LP6 C;  3UQ8 A;  4GKJ B;  1XMO H;  4JI2 B;  4CS3 A;  5J2T B;  3RTX A;  1SEI A;  3E22 B;  5JVD B;  1JJO A;  4Q0Y A;  3LML A;  2P5O A;  4YJ2 A;  2ZIN A;  1FKA H;  4PDB A;  4JI7 H;  3TY5 A;  4LFB H;  2PYJ A;  4TV9 B;  5D1P A;  4CS2 A;  5LL6 b;  5LP6 A;  4K0K H;  3J7A K;  2GV9 A;  4X65 B;  1IBL H;  2F4V H;  3CB2 A;  4O2A B;  3IG0 A;  3N44 B;  5DIS C;  4AIL C;  1M0W A;  3WB0 A;  4B3M H;  1N33 H;  4DV1 H;  3L4K A;  2VQF B;  4PZ6 A;  4IHJ A;  2OYQ A;  2HIV A;  3BAB A;  2Q7E A;  5JJE B;  4K8Z A;  4LFA B;  5ITZ A;  4FM9 A;  3JSN A;  1QHT A;  4FLU A;  4GYC B;  4LFA H;  3ICX A;  4U3J B;  1HW7 A;  4DV1 B;  2VWJ A;  4LF6 H;  4B3M B;  1N33 B;  1BGW A;  2HVR A;  1Q43 A;  1M0T A;  3RF2 A;  4I50 B;  2RGV A;  3L2P A;  4X62 B;  2UXB H;  1XHZ A;  4DK0 A;  4MV7 A;  4UCO A;  4J0M A;  1HR0 H;  4CH6 A;  1IBM H;  4IIJ A;  4KHP B;  4JI7 B;  4TV8 B;  4LF7 B;  4FLZ A;  2V4D A;  3W5O A;  4TQD A;  4DR2 B;  4JI1 B;  3RYF A;  2UXC B;  1Q3E A;  1NT2 B;  2VPS A;  3A2F A;  3K5M A;  4BWA A;  4LF4 H;  2E3C A;  5LMN B;  4LSA A;  3JAT B;  3TY8 A;  3CVZ A;  2KSW A;  2OWO A;  3VQW A;  4NVP A;  5LYJ B;  2PYL A;  1N36 H;  4EEQ A;  2KKW A;  2CW8 A;  3HKD A;  3FFQ A;  5C8Y A;  3VQY A;  5A2Q W;  1I6U A;  3W1G A;  3KYH C;  1TAE A;  3VQX A;  2UXD B;  1VS0 A;  1X4T A;  3L4J A;  1SA0 B;  2BTO A;  1J5E H;  4EFE A;  4FLT A;  4R7R A;  4UCR A;  3B2E E;  3EYY A;  1Q5O A;  2YIB A;  4LF9 B;  4O4H A;  5LA6 A;  5JCO C;  2UUA H;  4X66 H;  1TVK B;  4X66 B;  4JI3 H;  1FJG H;  4I4T A;  1ZHS A;  3DSQ A;  1TUB B;  4LFC B;  4LNU B;  1J5E B;  3K5N A;  3N41 B;  1S5J A;  4FFB A;  3U11 A;  1TA8 A;  3HKD B;  5JQG B;  4TV9 A;  5GON B;  3K59 A;  2WYO A;  3HXL A;  1I94 B;  2PUS A;  5KMG B;  4L8J A;  2ZJT A;  4O4I B;  4DR1 B;  3MWM A;  2E5L B;  2VQE B;  3F8N A;  5D5Q A;  5BMV B;  4RAZ A;  5EZY B;  4DV4 B;  4LF5 B;  2YCH A;  2YIA A;  4YY3 H;  2WDT A;  4LF4 B;  1Z5V A;  2IM9 A;  1CKO A;  4JI0 H;  5KX5 A;  3S24 A;  1TGO A;  1N32 B;  3RFR A;  4JI0 B;  2VOB A;  4APM A;  3RYC B;  3UT5 A;  5LXT A;  4UCT A;  1P49 A;  4A2A A;  1VF7 A;  3M4I A;  4JI1 H;  1XI1 A;  4DR2 H;  2VQE H;  3NC0 B;  4IIJ B;  4B08 A;  5BMV A;  1SQG A;  1SYX B;  2Q0A A;  4DV3 B;  3M7M X;  1FFX B;  3OTO H;  1IBM B;  1Z2P X;  2PGG A;  3FMA A;  3RGX A;  4ZOL B;  3PN1 A;  4D7S A;  1JMK C;  3K5O A;  3VQV A;  5KMG A;  4DR4 B;  2UXB B;  4X62 H;  1HNW H;  4TUY B;  4FLY A;  3QTC A;  2HHH H;  1SQF A;  2ZCE A;  2RJZ A;  1HNZ B;  3DF7 A;  3JAL B;  1XNR H;  3T1Y B;  2MCT A;  2UUC H;  3THO A;  2ZM6 B;  5LMU B;  4B3S B;  1Z2N X;  5ITZ B;  3QWU A;  2UUA B;  3BAA A;  3JAK B;  1L8D A;  5JH7 B;  4O4H B;  5LA6 B;  4AHC A;  4DR6 H;  4LMY A;  4DUZ H;  3RR5 A;  3ZED A;  5IYZ A;  5FNV B;  3JAW A;  4IAJ A;  4BWS C;  1O9H A;  1SA0 A;  2ZIO A;  1XMQ B;  4HNA B;  5JJN B;  1N36 B;  3SJC C;  4DV2 B;  4X64 B;  5IWA H;  4DR3 H;  1WNS A;  1H2S B;  3ETQ A;  1FFX A;  3TY9 A;  2UUB H;  4A2B A;  4DV7 B;  1XNQ H;  3BA8 A;  4ZHQ A;  4O4J B;  3ZS8 C;  4O2B A;  3MAQ A;  5KHG A;  3WB1 A;  2VUG A;  4FM1 A;  4FLV A;  1JFF A;  3RYF B;  4EFB A;  4DV7 H;  4OX9 B;  1XQ8 A;  1WPB A;  5J2U A;  3K57 A;  4KHP H;  3HKB B;  4O4L A;  4FM0 A;  4DV0 H;  5LOV A;  1CKN A;  1HR0 B;  2HGS A;  4ETS A;  3T1H H;  1HNX H;  3KAL A;  2RGR A;  4DK1 A;  4JI5 H;  2JS5 A;  3RYI A;  4ZI7 B;  5CA0 B;  4JI4 B;  3N6X A;  2BTQ B;  2FE3 A;  4MTE A;  4YHH H;  1S03 G;  5LOV B;  2F1M A;  3HKC A;  4DUZ B;  1CKN B;  4RAY A;  4LF6 B;  3N2K B;  4HBN A;  4DR7 H;  4I55 A;  4JI8 H;  1O9G A;  1A0I A;  1XK5 A;  5D1O A;  1I7F A;  5KHJ A;  4B3T B;  4U3J A;  4UFZ A;  5D5P A;  3JAS B;  2R9A A;  2VQF H;  5LMU H;  5K1P A;  4O2B B;  2ZM6 H;  4B3S H;  4DR5 B;  3BA9 A;  2UUC B;  3T1Y H;  1XNR B;  2Q7H A;  1HNZ H;  4KL1 A;  1WH2 A;  3NBZ B;  5CB4 B;  1HNW B;  1XHX A;  3OTF A;  1CKM A;  4AQY B;  4DV5 B;  4ZI7 A;  4LSX A;  2YI9 A;  1G6U A;  4LFB B;  4B3R H;  3OTO B;  1FVI A;  2Q2T A;  4I9Q A;  4FM2 A;  4X20 B;  2YXL A;  4AQY H;  2RQ6 A;  5EYP B;  5IJ0 A;  3N40 P;  4WBN B;  3HKB A;  4O4L B;  5FLX W;  4M7E A;  4X1I A;  1L2Z A;  2F95 B;  4DRX A;  3U10 A;  3N2G B;  4BW9 A;  1TUB A;  3JAT A;  5JH7 A;  1M93 A;  4I4T B;  3JAK A;  1XMO B;  4GKJ H;  2Q2U A;  2PY5 A;  3E22 A;  5JVD A;  2O03 A;  5CA1 A;  2PZS A;  2PTM A;  4YY3 B;  4LF5 H;  4ZHQ B;  4NXM B;  2HIX A;  1DGS A;  4JI8 B;  4RB1 A;  2UU9 H;  5K1X A;  3C0F B;  2E5L H;  2ZNJ A;  3HKE A;  4DR1 H;  5EYP A;  5IJ0 B;  1KMI Z;  1Z2O X;  4GLX A;  2VWK A;  4YHH B;  3N42 B;  1N34 H;  4F6R B;  5EIB D;  4HNA A;  3N43 B;  5C8Y B;  3SR2 C;  2CW7 A;  4JV5 H;  3CHX A;  4RB0 A;  3SJA C;  3HKE B;  3KXY T;  4I50 A;  4CS4 A;  5IYZ B;  3BRC A;  4EB6 A;  1HNX B;  4LFC H;  1ZAU A;  2W57 A;  4FLX A;  4RZQ A;  1FJG B;  4FLW A;  4DUY B;  4OX9 H;  4JI3 B;  5FD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...