3BABA

Structural basis for the inhibition of bacterial nad+ dependent dna ligase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
312
structure length
312
Chain Sequence
b'LTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
publication title Structural Basis for the Inhibition of Bacterial NAD+ Dependent DNA Ligase
rcsb
source organism Enterococcus faecalis
molecule tags Ligase
total genus 99
structure length 312
sequence length 312
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3babA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3babA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3babA02
1I94B 4X64B 3BA9A 1P8LA 3S24A 2VQFB 4LF5B 4X66B 3W1BA 1N36B 4LFCB 4LH6A 4GKKB 2UXBB 4EEQA 3JSNA 3W5OA 4JI1B 4JI3B 4DV0B 1XMQB 4YHHB 2VQEB 5BR8B 2UUCB 4LFBB 3GB8B 1TAEA 1DGSA 3BAAA 1CKOA 2VUGA 4JI6B 2Q2TA 4DV3B 5IWAB 5LMUB 4GKJB 4UCTA 2HIVA 4YY3B 5FPOA 1N33B 3TY8A 4KHPB 1ZAUA 4JI7B 1A0IA 3W1GA 4LH7A 4UCVA 2UXCB 3JSLA 2UUBB 3OTOB 4LF8B 2ZM6B 3PN1A 4DUYB 4PZ6A 2E5LB 1CKMA 2HVSA 2UXDB 2HVQA 4DUZB 4JI2B 4JI5B 1XNQB 1XMOB 1J5EB 4DV5B 4LF9B 3T1YB 3L2PA 3RTXA 4EFEA 1XK5A 4DR7B 4NXNB 2UUAB 4DR5B 2CFMA 3NBZB 1HR0B 5LMNB 4EFBA 4X62B 1XDNA 1VS0A 4DV7B 1HNWB 4B3TB 3SGIA 4CC6A 4NXMB 5D1OB 1HNXB 2OWOA 4DV4B 3RR5A 4LF7B 4JI8B 4UCOA 4UCSA 1IBKB 1XNRB 1IBMB 2HHHB 2F4VB 1CKNA 4E6NA 4DR3B 4JI0B 3BA8A 3QWUA 5DISC 3KYHC 4UCUA 1P16A 1N32B 4UCRA 5D1PA 4CC5A 3GDEA 4X65B 4JYAB 3TY5A 3VNNA 4DV2B 1V9PA 4AQYB 1X9NA 2Q2UA 1HNZB 4EQ5A 1B04A 4OX9B 2HIXA 4LFAB 3T1HB 1N34B 3NBYB 5FPRA 3TY9A 4DRFA 1TA8A 4B3SB 1IBLB 4DR2B 4JV5B 1S68A 4DV6B 4LF6B 3GJXB 4DR1B 2UU9B 4B3RB 1FVIA 4PZ7A 3NC0B 4JI4B 4DR6B 1FJGB 4K0KB 4DR4B 4PZ8A 3UQ8A 4DV1B 4GLXA 4LF4B 3BABA 4TOIA 4B3MB 4UFZA 5D1OA 2HVRA 1CKNB
chains in the Genus database with same CATH superfamily
1IDSA 3UCSC 4J9MA 3W7XA 3J81N 4UUJC 1OCOC 2Y0PA 4LFCB 2KSDA 3QO5A 3CCSV 1BS3A 4B08A 3F8NA 3L73H 1QVFU 1RSOA 2NN4A 4JI1B 3T4DA 4O4JA 1XMOO 4DV5O 5I60A 1IBMH 2UXNA 3FD9A 4I55B 3H1LH 4JZGA 4DR4H 1I0HA 4CS2A 1KP2A 2Q7GA 1VQMV 3MJFA 4JXUA 1GRJA 4Q8FA 3I56V 4L1KA 1IX9A 1AR1B 4TQRA 2MW2B 1DK1A 2BTQB 4N23A 3ETGA 3BY6A 4X64H 2Y4RA 2V4RA 2VQFH 1QCEA 1N36H 5EZYA 2IP4A 4B3TO 4QGPA 1S76D 2IH1C 1XL6A 4NTWA 4O4HB 4C5CA 3HKCB 5KLVH 2QYZA 4J80A 1A9XA 3UZBA 5LGNA 4ED0A 4K8XA 5FD5A 4ECVA 4KL1A 3A0RA 1DIKA 3N44B 1NH2B 2FKXA 4ECQA 2Q0AA 4LF9B 2X6CA 5KFKA 2WLIB 3GTJA 1KJJA 4TUYA 5JQWA 4B3MH 1HNZO 3L74H 2PMZE 4EFBA 1FAFA 3H3VH 2JVDA 5K2MA 4O3OA 3SPIA 3AK1A 1K34A 4ECUA 3CSXA 1Q6HA 4DR2O 1XI1A 2OYQA 4JV5O 2R86A 4O4IF 5I5XA 1HWYA 1VQ7V 2YXLA 2AXTZ 4J9SA 2WLHA 3WG7B 2B5UA 4UCSA 4K3AA 4FU0A 2J6TA 5KAIZ 3HKZA 3KZIZ 3X2QB 4R7RA 4R8UB 4I50F 2HG8A 4J9NA 3U0ZA 4CC5A 3G80A 4KP4A 2Q68A 3TY5A 3ORQA 4X88A 1A48A 2Y0SA 3L9DA 1B6QA 1M0WA 3BACA 3RN4A 4HN2A 1N34B 3DTFA 2EIJB 3CCRV 2DJVA 3C90A 1H2SB 4DV0O 1I1MA 1IBLB 5LP6F 5C44G 5IYZA 2NU8B 5EZYB 4LP8A 1R6KA 2NU9B 1XNRH 2DAAA 1VIBA 4X9QA 2GUZB 2HHHH 3ZRXA 1Y1WA 3UM7A 5IT9W 3T4ZA 4FFBA 5GONA 5I5UA 1HP8A 5KUKA 1I7LA 4Z1VA 1K3EA 3LDCA 4QE7A 4DK0A 4KHPO 1E4GT 3AG4B 1PL4A 2V1DA 3P3NA 5LA6F 1I5YA 3MDSA 4IZOA 1S03G 4WF9V 3NXSA 4BIOA 1US6A 4TUYB 4ABMA 2UUBO 4LF5B 1P8LA 4TM5A 5IYCG 2CH7A 3CSWA 5H2FZ 3T2MA 4TQFA 3T9DA 1AP5A 5DM6V 3NGDA 4MTGA 1JDBB 1D5NA 5JH7A 1F4MA 1MABG 1BMFG 2GDSA 5IYCO 4MA0A 3BQ2A 3Q8PB 2R7KA 3KG2A 5EWEA 2EJ0A 2Z04A 1CQIB 5K1XA 3QNEA 3QVNA 3N2GA 1IVSA 4X62O 4ZOLF 1CP9A 4WBNB 2LGWA 2GQRA 3TY8A 5FL7G 1URFA 1YJNV 1A0IA 3NR7A 2SCUB 1UNNC 4DL4A 4DV4O 1JX9A 3PFFA 1YF2A 5KFZA 3JSLA 3NUAA 5CA0F 4BWSC 5B1AB 3CRCA 1TWAA 3M7MX 3H1KH 4CS4A 2E5LB 1G1XB 5DGAA 4DUZB 1O75A 1SEIA 1H2LA 5J9PC 1DAAA 1ZHQA 4K6NA 4GKJH 3T1YB 2K1EA 2YIDA 5BPFA 1WLEA 4Q45A 4IAJA 4PDBA 4JYAO 4DR7B 2QA4V 1T36A 1S0VA 2CNQA 4XDLA 4DR5B 4A3EG 1BHAA 3H4DA 1QBZA 3ZHQA 4FFBB 5GONB 5IJ9A 2DQ0A 1XDNA 4GC6A 1ENVA 3JATA 4UVBA 4G3IA 2HGSA 4ECYA 1BCCH 3CMEV 4DUYH 1FS0G 3CX5F 1JMKC 5JCOA 4HNTA 3DTUB 3K03A 1FJGO 1KU9A 4R7CA 1OCOB 4GX1A 5EDWA 1M57C 2PF4E 5DLFA 4A2BA 4NZMA 3CCMV 4XX0B 3QWUA 4P9PA 5C93A 5JH7B 2CZGA 4O7VA 2BQUA 2PI5A 2BE3A 2WB1A 2VWKA 4JI7H 5DQIA 1FXKA 4X66O 3CCEV 5FLXW 3CXCU 3L71H 4IT5A 1X4TA 2F95B 2W6OA 3G6XA 4ED3A 4DRFA 3MD0A 3G8DA 2FB9A 3W7SA 3F7YC 4B3SB 4LF7H 2WTFA 1M9NA 4JI8H 4YHHO 3R9RA 3BRCA 1UC9A 1RJQA 1R1BA 1IBKH 2F4VH 1WP8A 2IU3A 4I0XA 4B3RB 4JI4B 2VQDA 1XOUA 4MV7A 4J7KA 3AW8A 4WFAV 3DGEA 3K59A 2ABJA 4A3CG 2Q7HA 4A3MG 1CKNB 4RNNA 4H37A 1YIJV 2R84A 2N04A 3R5XA 1P7BA 3BA9A 4TV8F 3OTOO 1I6UA 3VOUA 1BL8A 2P5OA 4E2LA 3V6HA 2ZNJA 2IU0A 4F4LA 4K0KH 1KQSU 2C22A 3BQ1A 1DGSA 3ORRA 2E2IA 3M9MB 4JI0H 4O3RA 5KFTA 3KHRA 1HDJA 3LMLA 4A3IG 3GTGA 1RYRA 1ZAUA 1XQ8A 1AI7A 2PZSA 1RFYA 2RCVA 1VF6A 2WAQA 4WFHA 1OCZC 3U9TA 4JI1H 2A06H 3L75H 3CB2A 5CBFA 1ZWIC 5KFGA 3ABKC 2R7ZA 5KFAA 1IBMO 1NT2B 2WLLA 3RAQA 1Z5VA 3HB3B 5J2UA 3L70H 2A7WA 4BBSG 2XAGA 4PDMA 4EFEA 5E79Z 1WRVA 1DV1A 5BWUA 4DV2O 2GPSA 3OR7C 5KG7A 4I0XB 3ZJZA 1VKZA 4MTDA 1S77D 3RUPA 2OH2A 4O7ZA 1S5HC 5JQGA 4DV7B 2LFRA 4DO2A 3APQA 1BE3H 2F66C 4CC6A 3GV8B 1SFOA 3H1IH 2OWOA 2ZDIC 2UU9O 4O4LB 5LHHA 4EB6A 2CNUA 4ECTA 4ECZA 4LF9H 3OUUA 3PW2A 2KKWA 2ZE5A 3OD4A 2YEVA 3D3QA 3GILA 3JD0A 4X1IA 4DL2A 5LMUH 5KA5A 2Q7EA 4E6NA 3K5OA 4B3MO 1NVPD 2RDJA 3K79A 4UB8Z 4UCRA 3JARA 3RYIA 3U10A 1X9NA 1S5JA 3WO0A 4I4TB 3O9OA 5K1PA 4JV2A 4RZRA 5KT6A 1F23A 2YZNA 2BQRA 4YB8B 5CBHA 1PL0A 4W4KA 4TT3G 3A0HZ 4NTXA 2ASDA 4LWSA 2F93B 1EM1A 2DWDC 4G28B 5CBGA 3D36C 4JV0A 5EBLC 2FPGB 1H2MA 3OR6C 3M99B 3TJTA 3G6EV 2Q6AA 2YZLA 3RJ0A 3LSSA 5LMNH 3KXYT 5J2UB 3Q8SB 2XCLA 2XAHA 3C0FB 1N34H 3J7AK 1SRYA 1NU1H 1IBLH 4LF8O 4Q4CA 5D8DA 4EEQA 2OIEA 4QWDA 1XEQA 5JQGB 2EILC 2JA7G 3T5KA 1O9GA 4LFBB 1SZTA 2JA6A 1W0JG 2ZE7A 5IWAO 4FJCC 2Z0AA 2KG7A 2HGXA 1HW7A 5F9NA 4NVPA 3JD1A 3RWRD 4EB6B 2C2AA 4TQSA 2W6QA 1ROPA 3JAMN 1Q5OA 3DAAA 3UO3A 4YY3B 4YJ3F 1DLBA 3JASA 4LSAA 1NI8A 2XCAA 4LF5H 2XOKG 1VQ9V 2R85A 2XAQA 3CCJV 4LH7A 1HNXO 1Q6UA 2UVRA 2DQ3A 3ETHA 3AK3A 3JARB 3D8CA 1BGWA 3RYIB 1SERA 4UVAA 2CTPA 4IIJF 3SYOA 3FAVA 4DR1H 3T1CA 4PZ6A 2Y48A 3CYOA 4EBCA 3CE2A 1QR9A 2QM8A 4IGGA 3MR2A 4CS3A 3N42B 2FK1A 3J81W 5E1AC 2CW8A 4J0MA 5EC2C 3OAAG 3E5NA 1SQFA 2W57A 2UUAB 4LWSB 3SJCC 2QM4A 2EJ3A 3CC7V 1S0MA 2E76B 1Y76B 3BCCH 1I94H 3AG1B 2F23A 4FZ0A 5HFLA 4GLWA 4DL6A 2A3QA 4ZHQA 2E74B 1YXBA 2HFEC 3CVZA 4J7JA 4O3NA 4JYCA 4EBDA 5J2TB 3QZ7A 1U97A 4TVIA 1TUEB 4Z1MG 4RZQA 4F50A 1VQ6V 3JYCA 4APMA 2WLKA 2E5LH 1AB3A 1XMQH 4DUZH 3P3PA 3N6XA 3FX7A 1I5XA 5KFHA 2GSMB 4DW1A 4I7ZB 4EGQA 2NNUA 2XCPA 1GSHA 4UUGA 4RB2C 4NYEA 1Z5WA 2R93A 2EIYA 4DR5H 1GH6A 3W7UA 1T3NA 5CA1F 3GDEA 4HZ3A 5CA3A 2B1IA 1SQGA 3HB9A 4GKKO 3FFQA 5KAFZ 1GMGA 2Q67A 2UXBO 3K08A 2A9HA 5KFNA 3SR2C 3LWBA 5DG9A 4ECWA 3LNNA 4O83A 4PI2A 4UVCA 2D2CB 3JASB 2CQYA 4ECXA 2NU6B 3WB1A 4MTXA 4JI2H 1Y4MA 3P32A 3JRWA 4A3DG 4J7ZA 4DR6B 4H33A 1WA8A 2X7RB 2FPPB 2V4QA 4O2AA 5B5EZ 2OTLV 1S0NA 4TOIA 3PO2G 3QTCA 4JI7O 4J9QA 4UFZA 4IR9A 1BGYH 4J11A 2YUAA 2HVRA 2EJ2A 4JTDB 2VA3A 2UXCO 1F51A 4GYCB 5A2QN 3QQMA 4O7RA 2DWEC 2DPIA 1AILA 2W6MA 5DGIA 1EUCB 3TGUH 4CKBA 1H2GA 4I7HA 1JPXA 2HVJC 4O4JF 4JI5O 3KTMA 4ZHQB 5I5VA 3HKZE 1A32A 2R9AA 5BR8B 4RNMA 5C4XG 3Q8RB 3MR5A 1MMMA 4HAMA 3UO2A 5IWAB 3T54A 3GIMA 2Y0SE 4YXWG 1WCMG 1P84F 1N33B 3ZCCA 5KG1A 5EZYF 3UT5B 2JEGA 4GCZA 3QO7A 4UCVA 2P67A 2EJRA 1GLVA 2CKZB 3TQTA 3E22B 3HOVG 1BZKA 4FLZA 4K35A 2W8KA 3ZHVA 2VWJA 2UXDB 3LP8A 4YR3A 2YWVA 4B7KA 5LBQA 1XNQB 1J95A 3N2KB 3ETDA 4JI0O 5ITZB 2RJZA 1E4EA 4FFPA 4ICGA 2XGPA 4TUYF 2X5RA 2C35B 5L1JA 1QR8A 2R8IA 3H0GA 3RB4A 1AVMA 2UVVA 3OFNG 4X1YA 4IRCA 5KMGA 3TINA 2QWPB 4CKEA 2YSUB 1Y74A 3GVMA 4HBNA 3ASNC 4DV6O 4B7EA 5B1NA 4BWAA 4JI3H 4TV9F 1R6NA 2QK4A 3DF7A 5KFRA 4JAAA 1M6VA 4UCOA 2QSAA 1FKAH 4DV1O 2COGA 1R6TA 2YCHA 2NVXA 2X0SA 5IE9A 2JGUA 5L3CA 3KYHC 1QLEC 4CH5A 1N32B 1K5QA 3Q4HA 2R92A 4DV7H 1B04A 4OX9B 2HJFC 4LFAB 3T1HB 5DEDA 5KT2A 4UV8A 1MA1A 3MFHA 3V6KA 1PKXA 2IJHA 1T5EA 1WNSA 4LF6O 5IYZF 3ABMB 1M1KW 5KG6A 4RUCA 3KHHA 1QU7A 3TCUA 2ZIOA 1JLLB 5LMUO 3TXQA 2P4VA 5BWRA 1R73A 2RDCA 5DGBA 4QJFA 3H01A 3SPJA 3T9BA 4O2BA 5D1OA 5L3DA 3JAKA 4O4HA 3HKCA 4MVRA 3ZN1A 1M90W 2R6FA 1E4EB 1B33N 3QG5A 1ORQC 5KFYA 1KUTA 3S24A 3SE7A 1V54B 3ZEDA 4YR0A 1ZQ7A 5BYAA 5JUMA 2AGQA 3JSNA 4MV3A 3HXLA 3TETA 3SJQC 2H94A 5KMGB 2WLIA 1J5EO 4C2MA 5JH7F 2VQEB 2X6BA 1Y74B 1RPRA 2Q2TA 5L3EA 4NXNO 2FE3A 3FB8C 3KKYA 3OW2U 4DV3B 3K5IA 2EIKB 2WB1E 3RF2A 5FNVF 5LMNO 4RWUA 4CMDA 3IC9A 2DOSA 3PW4A 3K5LA 1NBMG 2ITCC 2CE4A 2ZDGA 3G6VA 3FYEB 3OEEG 1KKDA 5E25A 3CXHF 1KTAA 2IA6A 3BEHA 4EBEA 3Q4HB 4LFBH 5B1BB 4R8UA 3E2EA 1EN5A 2HVSA 2VA2A 2EINB 2YL2A 5KFVA 2DE0X 1ZLZA 4X65O 1VBGA 2R8GA 5K3WA 3T9EA 1VAJA 2LW1A 1M56C 4UB6Z 4AQYO 1KBLA 2RGVA 5LOVB 3PR5B 3I4MG 1TWFA 3GTPA 1GTOA 2DW4A 1HR0B 3ZN0A 1FFXB 1RPOA 4QJFB 3ASOB 2GUZA 2HEPA 4D6TH 1EYZA 3RV3A 4O2BB 5D1OB 3JAKB 4J41A 3OGIB 3SPGA 2W9BA 4DR1O 2JK5C 2C00A 1GN4A 2DN9A 4CZZA 5LL6Y 1NS1A 1BQZA 1FPOA 2BOCC 4LF4O 3JCZA 3BQ0A 1SKVA 3RBEA 3OSNA 1CPYA 5EWFA 2O57A 4O7WA 4ECRA 3M9NB 2A0LA 3B77A 3UYYA 1I94O 3VNNA 2QWOB 2WAQE 3ABUA 2ZDHA 3LDEA 2QKCA 5D5QA 4CH6A 1OCRB 1YCIA 1Y1WG 3ZRSA 5JVDF 1XMQO 1U96A 1MZBA 2KQXA 2AGOA 3MWMA 2QF7A 3JCUZ 4LF6B 1LR1A 2DZDA 4PA4A 4FZ1A 3NC0B 4A3JG 5KFDA 4FLUA 4WBNA 1EN6A 1VF7A 4A5UB 3K3WA 3HT5A 2NLJC 2ZJTA 3PW7A 4JYBA 3IC7A 3RB0A 1VBHA 3KAJA 2JJ1G 2V5AA 3ZRWA 2FK3A 2JA5A 1RYSA 4IHJB 4OXSA 2JEJA 1B06A 2YI9A 5EYPB 1RK5A 5KX5A 3U0GA 4U6PA 4OPAA 1JIHA 4DYLA 4P9OA 5IY5B 2K9PA 4JI2O 4DR6H 3M4IA 2EULA 3LDDA 5EK0A 2W9BB 2PN1A 5LHIA 1YITV 2ZDQA 4X1KB 3CP1A 1Y1VG 4ME6A 3HPLC 3R5FA 3ZMSA 4ED6A 2ZNIA 5BMVA 4J9RA 3GLKA 1I1LA 1EN4A 1SYXB 1QLEB 2ZM6O 1IZ3A 1M7JA 1WAZA 3IAYA 1S3JA 5BR8H 3K5MA 4M7EA 1KJ8A 1W96A 3TQ1A 2HVKC 3N43B 4A3KG 5J2UF 3GIKA 1XMOB 4DV5B 4NZNA 4F6RA 1H2KA 1MOFA 3LULA 3F5TA 1N33H 1GYFA 3A0BZ 5FLMG 3NBZB 1MNGA 5DECA 2VUMA 5JQGF 4YBZB 4O7NA 4FM0A 3OUFA 3BHPA 5LGTA 5EBMC 1QNMA 5LP6C 3VQXA 4PHZA 3U54A 3ZRWB 4AI8A 5LYJB 4B3TB 4NB5A 3RBZA 3FKIA 4AYBA 5KT7A 5KG0A 4PA9A 3B8MA 2UUCH 1XNQH 3JAMW 3SJAC 2M7WA 5BWXA 3GQCA 2OCCC 5LHGA 4IWYA 4EG0A 1MG1A 5KX5B 4U7CA 1CKNA 1M4UA 2M6YA 3BA8A 3GIJA 1P16A 1FXVA 1YJWV 2YXHA 3ABTA 1OJHA 1HNZB 4Q8EA 4PI0A 1EZVH 3E89A 3SYCA 2Q69A 3GTMA 5KFXA 4J9OA 4JI3O 3CQZA 3FYIB 1VQ4V 4DR2B 4JV5B 3TXSA 2VPSA 4ED7A 5KFCA 4JI6O 5BMVB 2XD4A 2YIAA 2JGDB 2YICA 4ZQIA 1N32H 1A3GA 4PZ8A 5CE8A 5EOYA 3R5HA 3T1HH 2PUSA 3S3XA 4A3BG 4F6RB 2Z5UA 4A3GG 1ZETA 3E83A 4HNAA 1M56B 5JJJB 4O84A 3VPBA 4LR3A 4DV0B 5CR5A 3GIQA 5C8YA 3GB8B 1TAEA 1EBOA 2CW7A 2QTSA 4FS1A 4H13B 2IBKA 4DR3H 2EX3A 4F4XA 3AX6A 2Q9LA 3RB6A 4NKGB 2HHFB 5IYDG 4YR2A 3H40A 3BFRA 5JJNB 2P22C 2YIBD 2VPQA 5A9GA 3RFCA 1ZTEA 3V4ZA 4KHPB 3ZHSA 3HO8A 4JV1A 1EZ1A 1HNWO 5IYDO 4NXMO 3WWJA 4O4LA 2P7TC 2HG5C 4FLVA 3RVYA 1YI2V 1XL4A 2PTMA 2UUBB 2VQEH 2ZM6B 1YEWA 3I4NG 1OBGA 3FMAA 3ZHUA 3PR4A 3ZBHA 1MZFA 1KJ9A 5KHJA 5FD6A 4FFRA 5DG7A 3L2PA 4A3LG 2FKLA 1XK5A 4XYMB 2JA8G 5A2QW 2ZXWC 1VQKV 3N40P 2YRXA 1XREA 4I4TA 4JZ2A 3CWBH 3A2FA 5B3SC 3Q8QB 4X62B 3C3TA 3TIGA 4ZHQF 2KB1A 4LFCH 5KHHA 4RQFA 3K0GA 2J6UA 3EYYA 3AG3C 3FB5C 4DV4B 2FTKA 1T94A 3QF7A 3B40A 3VBBA 3J7AU 4HNAB 4QPKA 3JZ6A 3DXRA 2QGNA 4DR4O 1Q8IA 5IDJA 1VMGA 2IBZH 4YIPA 1BQ0A 5BWVA 3PW5A 3HOUG 2VS0A 4MVSA 4UCUA 1HR0H 2NUAB 1CS0A 5C8YB 3BJYA 5LA6A 4JYAB 4TQDA 3CCQV 4X64O 4MS2A 3GV7B 2VQFO 1N36O 2YU9A 1W2BU 3RB3A 4HYOA 2EIMC 3CCVV 4F4ZA 1BSMA 3JD4A 1P7GA 1AROP 3HR0A 1K9MW 2FB5A 3RGZA 4GZRB 5KFJA 2QEXV 2W70A 2B63A 1SQBH 1FVIA 2B9ZA 2CGNA 2IJIA 1FJGB 1NJIW 4TWKA 3ML0A 2W8LA 3ZMVA 4A3FG 4O2AF 1KECA 2DMXA 2CTWA 4P2ZA 5H5NA 4QNHB 4BW9A 3Q2OA 5LXTA 4FFNA 5HNEA 1E1QG 2KSWA 5DQGA 1IOWA 4JTAB 2NU7B 4E4TA 2Q0OC 4G27B 4X66B 3RT3C 5KUMA 3E8GA 2FK2A 4QWAA 4GT1A 2AW9A 1LNQA 1ZL8A 4XYLB 5F9LA 4FM2A 4YHHB 2ZQMA 1KP3A 4KUMA 1E1RG 1Y76A 3HKDA 4FLYA 2BQ3A 1S72V 1NR7A 5GTHZ 4X89A 5J2TA 2EZPA 3DXRB 3U55A 5KFMA 2OCCB 4FK5C 2UVWA 3B4SA 4NZOA 4LBEC 2XTAA 4TSFG 1XILA 5LA6B 5KG5A 3WB0A 1PPJH 2ZGIA 2I80A 4QW8A 3OTOB 1SQQH 3VQVA 2ASLA 2Y4TA 3T5JA 1XNRO 3SYPA 2HHHO 2WYOA 4K8ZA 1N48A 3DC6A 2N74A 4MW3A 4O86A 3RTXA 1VF5B 1L0NH 2WWWA 1K4DC 3OHBA 2R7LA 4ETSA 3OUSA 2JS5A 2DPJA 4MA5A 4GUNA 1M57B 5LXTB 4ZOLB 3GIIA 4AILC 2WDTA 5HBRB 4RNOA 1NZ6A 1WSCA 1XMOH 2R93G 3EHBB 4BR6A 3JALB 1Q6IA 5CA0B 1IBMB 3N41B 5CMUA 5GW7A 1ZL8B 1XHZA 4HYKA 3N27A 3RBDA 4Q4DA 1RP3B 5EC1C 4U3JB 4WFGA 3HKEA 4DV2B 2FMAA 1XBLA 4DQNA 3HKDB 2WA3A 2MCTA 3RYFB 4B3TH 4I9QA 2YYAA 1H8HG 2P4KA 4I55F 4RQEA 1WR2A 1EZJA 5KKNB 1VP7A 4IRDA 1AP6A 1DF4A 3OM3B 4XZ3B 2ZDIA 2UU9B 3T1YH 3PVXA 2GV9A 1I7FA 4GKJO 1Q3EA 1ZX3A 4DR7H 1VQ8V 4MVZA 3VQWA 3KALA 4KFMA 4GC7A 1JVMA 2R82A 3UT5A 3KCYA 2R8KA 4CH3A 2ASJA 4O2BF 4OGQB 5CB4A 4B3MB 4O4HF 3AG2C 1WB8A 3G6BA 4D7SA 4DRXA 1SCUB 3KAKA 3E22A 4WHXA 4RB3C 1SESA 5BY1A 1PK8A 4WD3A 2WE6A 5KFUA 5EWGA 3BG5A 4DR2H 4JV5H 4DUYO 4MV4A 5ITZA 3N2KA 3JZFA 2W0FC 2ADPA 4I5SA 4HNVA 2M05A 1PM9A 3BAAA 4Z2WA 5F2VO 2JRIA 4PDLA 3RYCA 1OCZB 4DAAA 5KHKA 3D36A 2FPIB 4UCTA 3ABKB 5DMXA 1WJZA 3VPDA 3ZMTA 1VQPV 4LNUB 4W4LA 3OMAB 5EIBD 1WPXA 2ARHA 4IWXA 3ZX6A 3RGBA 4B3SH 4DW0A 4FM1A 3HKEB 4DV0H 4LF7O 4JI8O 4LF8B 5KFOA 4FGRA 3PN1A 1EKFA 1IBKO 4B3RH 4TV8B 2F4VO 4JI4H 3MWEA 2ZE8A 1V4YA 4FIPC 3FKSG 2W9CB 4J9YB 3H0GG 2X0LA 3N8DA 2BOBC 1LUVA 3IJ4A 1K33A 1PV0A 5C1PA 2LQTA 4FE2A 4MV6A 2J9GA 5IJ0A 2FYUH 2R70A 3JRXA 2UUBH 1BNCA 5CB4B 2XIGA 2CK3G 5AG2A 1HNXB 3V4SA 4YIOA 1UFIA 5CM0A 3UZOA 4DRXB 1Y6XA 4XDKA 1RK6A 1Q81W 4K0KO 4RB0A 2XC9A 2V4DA 2YXYA 1JFFB 2PGGA 2BSKB 1WPBA 2GTAA 4ZI7A 3T99A 5BWWA 2R92G 1OZ0A 1RJRA 1BXRA 3STZC 4X62H 3WG7C 2W6NA 1V9PA 3STLC 5IYBG 2V59A 2Y0IA 3RYCB 4LCUC 4LFCO 4BBRG 1UPGA 3NBYB 4CKCA 3X2QC 2AHYA 4JI1O 4DV4H 4QIWA 4O3SA 3L4JA 5IYBO 3CHXA 4IYHA 3GTLA 1M93A 2LW7A 2ATKC 2DLNA 2YRWA 1V51A 2W0XA 1YTFD 4BY1G 2QKAA 1NTZH 4WBNF 2WSSG 2EIJC 2AGAA 2RDIA 4ECSA 4JYAH 1JA8A 3ETJA 5C3EG 4MSWC 3DC5A 4AHCA 1W59A 1H38A 4JUZA 2EILB 3BVOA 3LQSA 3K9AA 5IP7G 4PDRA 3K04A 4J9ZB 3CPWU 2PYLA 4PJ0Z 3CRQA 4AYBE 5BXZA 1GM9A 5EIBC 1A0GA 2Q4PA 4LH6A 4GKKB 2UXBB 2W71A 4FBTA 3LNMB 4IYIA 5IJ0B 4QWCA 1FFTB 1GM7A 1FJGH 4LF9O 2CTQA 5KFWA 4FLXA 5LOVA 5KT3A 4IR1A 2Q8VA 3DSQA 5GONF 2DIKA 1FFXA 3LUTB 1TVKB 4WCEV 5KFSA 3OSPA 3SPHA 4FFOA 4J9KA 4GX2A 1GN2A 3PO3G 4X66H 3OTFA 4ZI7B 4JI7B 3W1GA 4ED8A 1SF9A 1GAXA 2QDOA 2BTOA 3HOWG 4C5BA 1JOYA 3JAWB 3OE7G 2UXCB 3ABLC 4JAUA 4YHHH 3RYHA 1NVPB 5KA6A 1OWTA 2WA4A 4JI5B 2JS3A 1QHTA 4LMYA 2JDIG 1I50A 4U3FH 5LGUA 2YS8A 1S10A 4CBCA 2X6AA 3CJHB 4ASUG 4A2AA 1SQPH 4YJ2A 1N34O 2NVYA 4RB1A 4O81A 3MR6A 3K9SA 2IJJA 4ZKIA 3RW0A 1WH2A 1KKCA 1IBLO 5KFPA 3OTOH 4J9LA 2R7MA 2A79B 1EKVA 3R66A 1OCCC 4MVQA 2PI4A 5DN6G 2VOBA 2JEXA 3P30A 1VQ5V 3ETQA 3CMAV 1KYOF 2W7PA 4L8JA 1KT8A 2WLJA 4PBCA 4IHJA 4JI0B 5DISC 4LC1A 2WLMA 4U7NA 1N0JA 4F4WA 4YY3H 5EYPA 1TUBA 2XAJA 1JJOA 2Q5ZA 4RUAA 3V6JA 1KC7A 4LF5O 2WPDG 1PP9H 2HIXA 4RCNA 3B09A 4RAIA 4HNUA 3QZ8A 2PYJA 3PW0A 1JXLA 2MK3A 4PDVA 1K7DA 1SS3A 3H9VA 2OLSA 1BT8A 4DV6B 1IXMA 4MVUA 3H1HH 5L3FA 4X1KA 4PZ7A 2O03A 3RV4A 1THZA 4R6ZA 4UXNA 3FDSA 3ZMUA 2OTJV 2UUAH 4BW5A 2JA5G 3RYHB 4DV1B 3VMMA 3OMIB 4DV2H 2Y4UA 2XASA 1VEWA 2W7OA 3J80N 1Q90D 1WP7A 4PD4F 5CA1B 4X20B 2JEUA 3W1BA 2PY5A 4QW9A 3E86A 4JAVA 5DQHA 2IW5A 2E5LO 5C5JA 4DL5A 4YJ2B 2R9RB 2ZR3A 1SETA 4DUZO 2UU9H 1K92A 2LGQA 3T1YO 3ZMZA 5C8YF 2FP4B 1JX4A 2QM7A 4DR7O 4FVMA 1GSOA 1WN7A 4J9PA 2ZD9A 3MWDA 4DR5O 5LMUB 3GWOA 1R3LC 5T14A 2QWNB 3FB6C 2W6IG 1ZSPA 2HDKA 5LYJA 2ZCEA 3RVZA 4O4LF 4BXXG 3OHAA 2E2HA 5JCOC 1N8RW 1TUBB 4TV9A 4FS2A 2R8HA 4Y8VB 4R50A 3GTQA 4XDJA 3T5LA 4WFEA 3W7WA 1CKMA 4QSHA 1GO3E 1KJIA 1R3JC 1ZHSA 3EFFK 1J5EB 2ZINA 3KHGA 1RSOB 2YS6A 1JCHA 4O4JB 2RQ6A 1G4YB 1LUWA 1Q43A 3ASNB 3H1JH 4NXNB 3JZIA 4I4TF 3RGXA 1D5AA 1FXKC 2VUMG 4M0JA 1UC8A 5LMNB 3WWIA 2PVPA 4O7TA 3JD2A 2HGWA 3FKIG 1CXZB 4B3SO 1Y67A 3KCXA 4LF8H 1GKFA 2JGDA 4B3RO 3RR5A 2R9IA 4JI4O 3FB7C 2AHZA 1SQXH 3WU2Z 5IWAH 4L87A 1KEEA 2IJKA 1CE8A 2HR3A 1TWCA 1Z2PX 3CEIA 2J6SA 1BJTA 3VOTA 2IH3C 2ZE6A 2QJ1A 3KHLA 4X65B 3VA7A 3HKBA 4RAZA 4AQYB 2W6ZA 3EPIA 2FLNA 2COJA 4PWQA 1AN7A 2CAZC 1HNXH 3K3PA 1YHQV 1Q86W 2ADQB 4ZBMA 1YSCA 5H6RA 2UXDH 1P49A 2A1HA 2HHFA 3GJXB 3CS5A 4DR1B 2AZ2A 3TK1A 3A8TA 2Z02A 1GO3F 4KXRA 4TV9B 4O7YA 3LSQA 1V55C 3UQ8A 3ABLB 4LF4B 5FNVA 3T9AA 1TWHA 5LXTF 2DYRC 4EYHB 4F4YA 4DL3A 3L4KA 1VF6C 4ED2A 1G2WA 3IGAC 3ZS8C 2H3OA 1Y1VA 4HR7A 1NKDA 1I94B 1YDXA 4FBUA 5L3GA 4O7SA 1E4FT 5FJ8G 3MAQA 2RN9A 1B3QA 2YC0A 1OHHG 3IFXA 3GTOA 3I12A 2CDYA 1XMQB 5C1OA 1H2NA 2QR4A 3EPGA 5KS8A 1FKAO 3OUZA 4JTCB 5IYZB 1KUQA 1GGOA 1L8DA 1JR9A 3LSUA 1OCCB 1IOVA 4RU9A 1WB7A 2LJ2A 1R9TA 5J2TF 1JQ0A 4OX9H 4LFAH 1X59A 4DV7O 3JD3A 3OGCC 4GKKH 1YTFB 1ET0A 3I5DA 2UXBH 4NR1A 2Q7DA 3WO1A 4NLGA 3C3SA 3HKBB 3SYAA 1VQOV 4I9WA 4CHIA 1S9FA 5I5WA 2L35A 2ITDC 3T7AA 4CMFA 2C2EA 2CH7B 5KG2A 4JI2B 1EHIA 2V58A 1K8AW 1NTKH 2UXXA 2L6LA 1Q82W 1E79G 2YW2A 3B8NA 2YZMA 4ED1A 4GX5A 3BPZA 4BIUA 1G8MA 2LP7A 5I5SA 5BWTA 1MSDA 4G2KA 1DV2A 1K1SA 4N21A 3G71V 1NTMH 2XT9A 1AI4A 4PV1B 5FNVB 3GWKC 1PNKA 2HKOA 3N2GB 2UXCH 3QO8A 2R7ZG 5JVDA 1K97A 2W6JG 4O4IA 3WFVA 1QQCA 3E35A 2R72A 1C3OA 1P4RA 4JI5H 5KT5A 4DL7A 3TEKA 3AG1C 2YZGA 5GTIZ 1FXHA 4NTYA 4R8CA 1M0TA 1KB9F 1COWG 4DV3H 2GLTA 2CUGA 1XDCA 2ATLA 2V7QG 4I50A 2ZR2A 4RAYA 2HJWA 1L0LH 4J10A 4BY7G 2Q2UA 1BHBA 3MHSC 3OT7A 4HQ6A 1GM8A 3K57A 1N0NA 2ETNA 3SPCA 3RAXA 2B63G 5IJ9B 5LP6A 4LFBO 3JATB 5KFFA 2D3OW 3H4BA 5I5YA 2FMLA 2P90A 3SNOA 2VR1A 3CC2V 2OT5A 1KJQA 2C2RA 2ODMA 1AR5A 3K06A 4YY3O 4H0LB 1C30A 4PA3A 4JF3A 4FLWA 2AGPA 5CB4F 1S97A 1PX2A 5JJEB 4EEYA 1QLNA 2PMZA 2C28A 4JGSA 1AI5A 3IN5A 4DV6H 4MVMA 1FXKB 5HFMA 2GTSA 3O65A 4JI3B 3TIIA 3VPCA 2ZKOA 4O3PA 1Y14B 1Y66A 5JVDB 2R7NA 2VUGA 4JPRA 5DG8A 4O4IB 4JI6B 4DV1H 5DLGA 1JJ2U 2UUAO 3K5NA 1F4NA 4Q0YA 3CRMA 3ZHRA 5I47A 2F43G 2DYSC 4ZOLA 5FPOA 1I08A 1GSAA 2P6JA 4QIWE 3I55V 1SA0A 4I50B 2LO1A 1MZEA 3U11A 2QTOA 4EKWA 4WFBV 4Q6GA 3CRAA 4MTFA 3JALA 5CA0A 4C5AA 4LF6H 2JA6G 1G6UA 5H9CA 4M9UA 1B6RA 5D5PA 1UJWB 2FLPA 4U3JA 3T9FA 3SYQA 2Y69C 5LP6B 4P30A 3E8FA 5JWPA 3N6RA 2BCCH 2JJ2G 2DWCA 5BYBA 5L1KA 3S3WA 2ALZA 2RF4A 3RYFA 4DK1A 2CGOA 4OPHA 5IT9N 1GN6A 4Q20A 1PNMA 4H44B 1RJPA 1V55B 1VS0A 3GIPA 2YI8A 4UV9A 1HNWB 1FD9A 2I8CA 2HJDA 2DYRB 3SGIA 4NXMB 1IXBA 3ZIAG 4DR6O 1J5EH 5BZBA 3HOXG 4MV1A 1IYEA 3AYHB 4NXNH 4ZI7F 3G6YA 1TGOA 3OMNB 3GV5B 2WLLB 4E4EA 3CRRA 3ZRVA 3WNZA 4Q44A 4EQ5A 4YQWA 5H80A 3E8BA 3IG0A 4QIWF 2GHYA 5FPRA 1M5IA 2OCHA 4RUFA 5BR8O 1SA0B 5DAAA 1R3KC 3GTKA 4D7TA 2XHBA 4DV5H 1IYDA 1SC5B 4FFKA 1GK9A 3DTGA 2QKSA 2AZ0A 4DR4B 4X65H 4Q43A 2AU0A 2JIZG 4LNUA 5EBWC 2ILMA 3BABA 1RM1C 3CCLV 1N33O 4AQYH 2YEVB 4A93G 3ABMC 4X1IB 3AG7A 1SZXA 1K73W 4JYYA 2B1GA 1W93A 4CH4A 3ICXA 2JEFA 1NH2D 1Z2NX 4QPJA 3GIDA 1SQVH 4X64B 3QFFA 4TV8A 2VQFB 1JKJB 2EBOA 1N36B 2GPWA 2W9CA 1S5LZ 2YDEA 3RFRA 2UXDO 5DGHA 2UUCO 1XNQO 5L3BA 2Z3YA 5HV6A 3PZPA 5B1OA 5LOVF 1VARA 2Q73A 2W6PA 4LF4H 5KFIA 3B2EE 2JA7A 1V54C 2XAFA 3MR3A 1HNZH 1L2ZA 3HOYG 5L9XA 1NQTA 1CEZA 3SI8A 2YIBA 2HP8A 3CCUV 1R3IC 2EIKC 2ZXWB 1JFFA 1OV9A 2BSKA 2N05A 3E8HA 4GX0A 3TW6A 1Q7YW 5B3SB 3THOA 3AEIA 3J80W 2ZIMA 2H8PC 1KBHA 1B6SA 1Z2OX 3G8CA 3MHHC 5FLXN 4NYKA 5KT4A 1N32O 2QWRB 5KFBA 3EVKA 2OIGA 1AJQA 1GN3A 2QE7G 3L72H 2RGRA 3AG3B 3H20A 3M8AA 4FMTA 5B1BC 4OX9O 3M9OB 2CFMA 1K4CC 2KG7B 4QE9A 3T1HO 4LFAO 4YJ2F 4FFMA 4FLTA 5TISZ 2EINC 3K5HA 1W0KG 3MFIA 3K0DA 3TW7A 1Z2GA 4BAYA 3F5WC 5CAEB 1FYJA 2FJZA 1YVWA 4CE5A 1I3QA 2JEIA 3UFXB 1EUDB 1N4CA 4C7UA 2XNDG 1DTOA 1H8EG 4PA6A 5KFQA 1XNRB 2VRZA 4DR3O 3ASOC 2EIMB 2HHHB 3FAVB 4X8AA 4IHJF 3ZHTA 5FR9A 2XGQA 4MVOA 4KHPH 2R87A 4F6EA 4WFFA 1EFRG 2QWQB 2F1MA 1XUQA 2GQSA 1KD1W 3TY9A 4YAJB 2ZM6H 4DXWA 1TA8A 2W9AA 2VQEO 2DYSB 1S68A 1AJPA 1TVKA 4MW8A 2GBOA 2WAMA 4DV3O 3R65A 1IURA 3G67A 1OCRC 1AUVA 2FL4A 1I2KA 4MAMA 3K3VA 1AJNA 5KG4A 3R23A 3F7VC 1ULZA 2ODTX 4YAKB 3JAWA 1OBDA 3ETEA 3U9SA 4MV8A 3PJSK 2ZT9B 2Y69B 3CC4V 4RO2A 3HBLA 5KHGA 3WB2A 4MTEA 3W5OA 1K83A 2I87A 4FPPA 1AR4A 4U7OA 2UUCB 3CJHA 5L1IA 3T9CA 1CKOA 5KG3A 3OEHG 3T5HA 1L1FA 1I2LA 1VQNV 2YS7A 4GKJB 1HR0O 3WWHA 1N56A 5IY5C 2HIVA 4XBFA 1WA8B 5LYJF 4YJ3A 1YJ9V 4O2AB 4PA7A 5KFEA 1WCMA 2COIA 3Q1KA 2R8JA 4J42A 1I1KA 5KX5F 2AQ4A 4IIJA 1MSWD 2E75B 4DUYB 3AG4C 4MV9A 4JI6H 3EXAA 2CNVA 2HVQA 5KHIA 3W7TA 4FFLA 1K5SA 3VQYA 2EZOA 4O7LA 1ZUQA 1QVGU 3RIZA 2P0AA 4QWEA 4ZIBA 1K1QA 2HLDG 2IM9A 2XUMA 4BIZA 5B66Z 2IMWP 1NR1A 5BPHA 2V9WA 2C2DA 2WLNA 2PBZA 1XHXA 2G38A 4O3QA 1KC8W 4JASA 4FM9A 3D3IA 4O82A 5BMVF 2BR0A 4I55A 1RM1B 3GB7C 3APOA 5IP9G 2UVUA 4PELA 2P06A 2CTRA 2DABA 4MTOA 4LF7B 4JI8B 3KREA 3CD6V 1IBKB 1PD3A 3CEBA 1TWGA 2EJ7A 2BTQA 2F4VB 2RNBA 1CQJB 4DR3B 4EYIB 2LFSA 3K58A 5JVLA 5CA1A 5D1PA 4X20A 5CN0A 4IRKA 5B1AC 5L1LA 4RUEA 1JDEA 1O9HA 5H6QA 3HOZG 1HNWH 1VQLV 4NXMH 4LSXA 1I7NA 4EGJA 4DIMA 1AI6A 1EKPA 3G4SV 4YJ3B 4IL6Z 1F7YA 4X1YB 1PNLA 5KFLA 2QB5A 4QWBA 1YZBA 1AUXA 3AG2B 4DLKA 4MT8A 3AK2A 1DF5A 3SJBC 4YP3A 4K0KB 1D2DA 5LL6b 1KMIZ 4IIJB 5I5TA 3SDLA 1S0OA 4GLXA 2RMKB 2E3CA 2FLLA 2NR5A 3UKMA
chains in the Genus database with same CATH topology
3ZS8C 2KSWA 1I94B 4X66B 4GYCB 4LFCB 1E4FT 3MAQA 4B08A 3F8NA 1RSOA 4JI1B 4I7HA 4O4JA 4ZHQB 1XMQB 4FM2A 4YHHB 2R9AA 5BR8B 1IBMH 4I55B 4DR4H 4CS2A 2Q7GA 5IYZB 5IWAB 3HKDA 1L8DA 4FLYA 5J2TA 2BTQB 1N33B 4OX9H 4X64H 4LFAH 2VQFH 1N36H 5EZYA 4GKKH 2UXBH 3UT5B 5LA6B 4UCVA 3HKBB 3WB0A 4O4HB 3HKCB 3OTOB 3VQVA 3E22B 4FLZA 4K8XA 5FD5A 2UXDB 4KL1A 2VWJA 4JI2B 1XNQB 4K8ZA 2WYOA 5ITZB 3N2KB 3N44B 2Q0AA 4LF9B 3RTXA 2RJZA 4TUYA 3BPZA 4B3MH 4ETSA 2JS5A 4EFBA 2JVDA 4X1YA 5KMGA 5FNVB 3N2GB 2UXCH 5LXTB 5JVDA 3CSXA 4ZOLB 1XI1A 4HBNA 4O4IA 2OYQA 1QQCA 4BWAA 4AILC 2YXLA 2WDTA 2R72A 4JI3H 3DF7A 4JI5H 1XMOH 4UCOA 4UCSA 1M0TA 1FKAH 4DV3H 3JALB 5CA0B 1IBMB 2YCHA 3N41B 4R7RA 4I50A 1XHZA 4RAYA 2JGUA 3KYHC 4CH5A 1N32B 3U0ZA 4CC5A 4U3JB 3TY5A 3HKEA 4DV2B 2Q2UA 4DV7H 1B04A 4OX9B 1M0WA 3HKDB 3K57A 3T1HB 3RYFB 4LFAB 2MCTA 4B3TH 1N34B 4I9QA 1T5EA 1H2SB 1WNSA 5IJ9B 1IBLB 5LP6A 5IYZA 5EZYB 3JATB 1XNRH 2HHHH 5IT9W 2UU9B 3T1YH 2ZIOA 2GV9A 1I7FA 1Q3EA 4DR7H 4FFBA 5GONA 3VQWA 3KALA 4DK0A 1E4GT 3UT5A 4CH3A 4FLWA 4B3MB 4O2BA 5CB4A 5D1OA 1S03G 4O4HA 3JAKA 3HKCA 5JJEB 4D7SA 4DRXA 3KAKA 3E22A 3QG5A 4RB3C 4TUYB 1P8LA 3S24A 4LF5B 3ZEDA 2WE6A 4DR2H 4JV5H 4DV6H 3JSNA 5ITZA 3N2KA 3HXLA 4TQFA 4JI3B 5KMGB 5JH7A 2VQEB 5JVDB 3BAAA 2VUGA 4O4IB 4JI6B 2Q2TA 4DV1H 2FE3A 3RYCA 3K5NA 4DV3B 5K1XA 4Q0YA 5KHKA 3RF2A 3N2GA 4UCTA 4ZOLA 3K5LA 5FPOA 4WBNB 3TY8A 1SA0A 4LNUB 4I50B 5EIBD 1A0IA 3U11A 3RGBA 4B3SH 4FM1A 4Q6GA 3HKEB 4DV0H 3JSLA 3JALA 4BWSC 5CA0A 4LF8B 4LF6H 4LFBH 3M7MX 3PN1A 4B3RH 1G6UA 4CS4A 2E5LB 4TV8B 2HVSA 4JI4H 4DUZB 1O75A 1SEIA 5D5PA 1ZHQA 4GKJH 4U3JA 3T1YB 4IAJA 5LP6B 4PDBA 4DR7B 2RGVA 3RYFA 4DK1A 5LOVB 4DR5B 1HR0B 4FFBB 5GONB 1FFXB 5IJ9A 5IJ0A 1XDNA 3JATA 1VS0A 2R70A 2UUBH 2HGSA 2HEPA 2YI8A 1HNWB 4DUYH 4NXMB 4O2BB 3SGIA 5CB4B 5D1OB 1HNXB 3JAKB 2XIGA 1JMKC 5JCOA 4DRXB 1J5EH 1KU9A 4RB0A 2V4DA 4NXNH 1JFFB 2PGGA 1WPBA 1SKVA 4A2BA 4ZI7A 3QWUA 1TGOA 5JH7B 4X62H 3VNNA 1V9PA 2VWKA 4JI7H 3RYCB 4EQ5A 5D5QA 4CH6A 5FLXW 3NBYB 3IG0A 1X4TA 2F95B 4DV4H 5FPRA 4DRFA 1M5IA 4B3SB 4LF7H 1MZBA 3L4JA 4JI8H 3MWMA 3CHXA 1M93A 1SA0B 3BRCA 4LF6B 1IBKH 4D7TA 2XHBA 2F4VH 4B3RB 4DV5H 3NC0B 4JI4B 4FLUA 4MV7A 4WBNA 1VF7A 4DR4B 2ZJTA 4X65H 4JYAH 4LNUA 3BABA 4AQYH 3K59A 4AHCA 3KAJA 4X1IB 2Q7HA 4CH4A 1CKNB 3ICXA 4IHJB 1Z2NX 2PYLA 4X64B 3BA9A 5EYPB 2YI9A 4TV8A 2VQFB 5EIBC 1I6UA 1N36B 4GKKB 4LH6A 5KX5A 2UXBB 2P5OA 3RFRA 5IJ0B 2ZNJA 3M4IA 4DR6H 1FJGH 4K0KH 1DGSA 4FLXA 5LOVA 4LF4H 4JI0H 3B2EE 3DSQA 1FFXA 1TVKB 4X1KB 3LMLA 1HNZH 1L2ZA 1ZAUA 1XQ8A 4X66H 2PZSA 3OTFA 4ZI7B 4JI7B 3W1GA 2ZNIA 5BMVA 2YIBA 2BTOA 4JI1H 1SYXB 3JAWB 2UXCB 3CB2A 4YHHH 1JFFA 3IAYA 5BR8H 3K5MA 3RYHA 4M7EA 3THOA 3J80W 2ZIMA 1NT2B 1Z2OX 3N43B 4JI5B 1Z5VA 5J2UA 1XMOB 4DV5B 1QHTA 4LMYA 4F6RA 4EFEA 4A2AA 2RGRA 1N33H 1GYFA 3H20A 4MTDA 2CFMA 3NBZB 4YJ2A 4RB1A 4FLTA 5JQGA 1WH2A 4FM0A 3BHPA 4DV7B 3OTOH 3VQXA 5LP6C 4PHZA 4B3TB 2F66C 4CC6A 5LYJB 2OWOA 2UUCH 2VOBA 1XNQH 4O4LB 4EB6A 3JAMW 3ETQA 3SJAC 4LF9H 2KKWA 4L8JA 5KX5B 1XNRB 4X1IA 2HHHB 5LMUH 1CKNA 2Q7EA 4E6NA 4IHJA 4JI0B 1M4UA 3BA8A 3K5OA 5DISC 1P16A 4UCRA 4YY3H 5EYPA 4KHPH 1TUBA 3JARA 1JJOA 3RYIA 3U10A 1X9NA 1S5JA 1HNZB 4PI0A 2HIXA 4I4TB 2F1MA 5K1PA 2PYJA 3TY9A 2ZM6H 1TA8A 4DR2B 4JV5B 1S68A 4DV6B 2VPSA 1TVKA 5BMVB 2F93B 4X1KA 4PZ7A 2O03A 2YIAA 1N32H 2UUAH 4PZ8A 3K3VA 3RYHB 4DV1B 5EOYA 4DV2H 3RJ0A 5LMNH 3KXYT 5J2UB 3T1HH 2PUSA 3C0FB 3JAWA 1N34H 4F6RB 3J7AK 5CA1B 4X20B 5KHGA 4HNAA 3W1BA 2PY5A 1IBLH 3WB2A 4MTEA 3W5OA 5JJJB 4EEQA 4LR3A 4YJ2B 2UU9H 5JQGB 4DV0B 1O9GA 2UUCB 5C8YA 4LFBB 3GB8B 1TAEA 2CW7A 1CKOA 4FVMA 1WN7A 4DR3H 2EX3A 1HW7A 5LMUB 4NVPA 4GKJB 3RWRD 4EB6B 5JJNB 2P22C 2HIVA 1Q5OA 2YIBD 4YY3B 4YJ3A 5LYJA 4KHPB 2ZCEA 3JASA 4O2AB 4LSAA 4LF5H 4O4LA 4LH7A 5JCOC 4FLVA 1TUBB 3JARB 1BGWA 3RYIB 4TV9A 2PTMA 2UUBB 2VQEH 2ZM6B 4IIJA 1YEWA 4DUYB 3FMAA 4MV9A 4PZ6A 4DR1H 4JI6H 1CKMA 2HVQA 5KHJA 5KHIA 5FD6A 4CS3A 1ZHSA 3N42B 3VQYA 1J5EB 3J81W 2ZINA 3L2PA 2CW8A 4J0MA 1XK5A 4O4JB 1SQFA 2RQ6A 2W57A 1Q43A 5A2QW 3RIZA 4NXNB 3N40P 2UUAB 4I4TA 4ZIBA 1D5AA 3SJCC 2QM4A 2IM9A 3RGXA 3A2FA 5LMNB 1I94H 4X62B 1XHXA 4ZHQA 3CVZA 4LFCH 5KHHA 4FM9A 5J2TB 4LF8H 4I55A 4RZQA 4APMA 2E5LH 3EYYA 1XMQH 4DV4B 4DUZH 3RR5A 4LF7B 3N6XA 3QF7A 4JI8B 4HNAB 1IBKB 5IWAH 2BTQA 2F4VB 1Q8IA 4RB2C 1Z5WA 4DR3B 1Z2PX 4DR5H 3K58A 1BJTA 4UCUA 1HR0H 5CA1A 5D1PA 2QJ1A 4X20A 5LA6A 5C8YB 4X65B 3HKBA 4JYAB 3GDEA 4TQDA 4RAZA 1SQGA 4AQYB 1O9HA 1HNWH 3FFQA 1AN7A 2CAZC 4NXMH 4LSXA 1HNXH 3SR2C 3LNNA 4PI2A 4YJ3B 3RGZA 3JASB 4X1YB 2UXDH 1P49A 3WB1A 3GJXB 4JI2H 4DR1B 1FVIA 3SJBC 4DR6B 1FJGB 4K0KB 4TV9B 5LL6b 1KMIZ 4IIJB 4O2AA 3UQ8A 4GLXA 5FNVA 4LF4B 4BW9A 2E3CA 4TOIA 5LXTA 3QTCA 4UFZA 3L4KA 2HVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I94 B;  4X64 B;  3BA9 A;  1P8L A;  3S24 A;  2VQF B;  4LF5 B;  4X66 B;  3W1B A;  1N36 B;  4LFC B;  4LH6 A;  4GKK B;  2UXB B;  4EEQ A;  3JSN A;  3W5O A;  4JI1 B;  4JI3 B;  4DV0 B;  1XMQ B;  4YHH B;  2VQE B;  5BR8 B;  2UUC B;  4LFB B;  3GB8 B;  1TAE A;  1DGS A;  3BAA A;  1CKO A;  2VUG A;  4JI6 B;  2Q2T A;  4DV3 B;  5IWA B;  5LMU B;  4GKJ B;  4UCT A;  2HIV A;  4YY3 B;  5FPO A;  1N33 B;  3TY8 A;  4KHP B;  1ZAU A;  4JI7 B;  1A0I A;  3W1G A;  4LH7 A;  4UCV A;  2UXC B;  3JSL A;  2UUB B;  3OTO B;  4LF8 B;  2ZM6 B;  3PN1 A;  4DUY B;  4PZ6 A;  2E5L B;  1CKM A;  2HVS A;  2UXD B;  2HVQ A;  4DUZ B;  4JI2 B;  4JI5 B;  1XNQ B;  1XMO B;  1J5E B;  4DV5 B;  4LF9 B;  3T1Y B;  3L2P A;  3RTX A;  4EFE A;  1XK5 A;  4DR7 B;  4NXN B;  2UUA B;  4DR5 B;  2CFM A;  3NBZ B;  1HR0 B;  5LMN B;  4EFB A;  4X62 B;  1XDN A;  1VS0 A;  4DV7 B;  1HNW B;  4B3T B;  3SGI A;  4CC6 A;  4NXM B;  5D1O B;  1HNX B;  2OWO A;  4DV4 B;  3RR5 A;  4LF7 B;  4JI8 B;  4UCO A;  4UCS A;  1IBK B;  1XNR B;  1IBM B;  2HHH B;  2F4V B;  1CKN A;  4E6N A;  4DR3 B;  4JI0 B;  3BA8 A;  3QWU A;  5DIS C;  3KYH C;  4UCU A;  1P16 A;  1N32 B;  4UCR A;  5D1P A;  4CC5 A;  3GDE A;  4X65 B;  4JYA B;  3TY5 A;  3VNN A;  4DV2 B;  1V9P A;  4AQY B;  1X9N A;  2Q2U A;  1HNZ B;  4EQ5 A;  1B04 A;  4OX9 B;  2HIX A;  4LFA B;  3T1H B;  1N34 B;  3NBY B;  5FPR A;  3TY9 A;  4DRF A;  1TA8 A;  4B3S B;  1IBL B;  4DR2 B;  4JV5 B;  1S68 A;  4DV6 B;  4LF6 B;  3GJX B;  4DR1 B;  2UU9 B;  4B3R B;  1FVI A;  4PZ7 A;  3NC0 B;  4JI4 B;  4DR6 B;  1FJG B;  4K0K B;  4DR4 B;  4PZ8 A;  3UQ8 A;  4DV1 B;  4GLX A;  4LF4 B;  3BAB A;  4TOI A;  4B3M B;  4UFZ A;  5D1O A;  2HVR A;  1CKN B; 
#chains in the Genus database with same CATH topology
 1IDS A;  3UCS C;  4J9M A;  3W7X A;  3J81 N;  4UUJ C;  1OCO C;  2Y0P A;  4LFC B;  2KSD A;  3QO5 A;  3CCS V;  1BS3 A;  4B08 A;  3F8N A;  3L73 H;  1QVF U;  1RSO A;  2NN4 A;  4JI1 B;  3T4D A;  4O4J A;  1XMO O;  4DV5 O;  5I60 A;  1IBM H;  2UXN A;  3FD9 A;  4I55 B;  3H1L H;  4JZG A;  4DR4 H;  1I0H A;  4CS2 A;  1KP2 A;  2Q7G A;  1VQM V;  3MJF A;  4JXU A;  1GRJ A;  4Q8F A;  3I56 V;  4L1K A;  1IX9 A;  1AR1 B;  4TQR A;  2MW2 B;  1DK1 A;  2BTQ B;  4N23 A;  3ETG A;  3BY6 A;  4X64 H;  2Y4R A;  2V4R A;  2VQF H;  1QCE A;  1N36 H;  5EZY A;  2IP4 A;  4B3T O;  4QGP A;  1S76 D;  2IH1 C;  1XL6 A;  4NTW A;  4O4H B;  4C5C A;  3HKC B;  5KLV H;  2QYZ A;  4J80 A;  1A9X A;  3UZB A;  5LGN A;  4ED0 A;  4K8X A;  5FD5 A;  4ECV A;  4KL1 A;  3A0R A;  1DIK A;  3N44 B;  1NH2 B;  2FKX A;  4ECQ A;  2Q0A A;  4LF9 B;  2X6C A;  5KFK A;  2WLI B;  3GTJ A;  1KJJ A;  4TUY A;  5JQW A;  4B3M H;  1HNZ O;  3L74 H;  2PMZ E;  4EFB A;  1FAF A;  3H3V H;  2JVD A;  5K2M A;  4O3O A;  3SPI A;  3AK1 A;  1K34 A;  4ECU A;  3CSX A;  1Q6H A;  4DR2 O;  1XI1 A;  2OYQ A;  4JV5 O;  2R86 A;  4O4I F;  5I5X A;  1HWY A;  1VQ7 V;  2YXL A;  2AXT Z;  4J9S A;  2WLH A;  3WG7 B;  2B5U A;  4UCS A;  4K3A A;  4FU0 A;  2J6T A;  5KAI Z;  3HKZ A;  3KZI Z;  3X2Q B;  4R7R A;  4R8U B;  4I50 F;  2HG8 A;  4J9N A;  3U0Z A;  4CC5 A;  3G80 A;  4KP4 A;  2Q68 A;  3TY5 A;  3ORQ A;  4X88 A;  1A48 A;  2Y0S A;  3L9D A;  1B6Q A;  1M0W A;  3BAC A;  3RN4 A;  4HN2 A;  1N34 B;  3DTF A;  2EIJ B;  3CCR V;  2DJV A;  3C90 A;  1H2S B;  4DV0 O;  1I1M A;  1IBL B;  5LP6 F;  5C44 G;  5IYZ A;  2NU8 B;  5EZY B;  4LP8 A;  1R6K A;  2NU9 B;  1XNR H;  2DAA A;  1VIB A;  4X9Q A;  2GUZ B;  2HHH H;  3ZRX A;  1Y1W A;  3UM7 A;  5IT9 W;  3T4Z A;  4FFB A;  5GON A;  5I5U A;  1HP8 A;  5KUK A;  1I7L A;  4Z1V A;  1K3E A;  3LDC A;  4QE7 A;  4DK0 A;  4KHP O;  1E4G T;  3AG4 B;  1PL4 A;  2V1D A;  3P3N A;  5LA6 F;  1I5Y A;  3MDS A;  4IZO A;  1S03 G;  4WF9 V;  3NXS A;  4BIO A;  1US6 A;  4TUY B;  4ABM A;  2UUB O;  4LF5 B;  1P8L A;  4TM5 A;  5IYC G;  2CH7 A;  3CSW A;  5H2F Z;  3T2M A;  4TQF A;  3T9D A;  1AP5 A;  5DM6 V;  3NGD A;  4MTG A;  1JDB B;  1D5N A;  5JH7 A;  1F4M A;  1MAB G;  1BMF G;  2GDS A;  5IYC O;  4MA0 A;  3BQ2 A;  3Q8P B;  2R7K A;  3KG2 A;  5EWE A;  2EJ0 A;  2Z04 A;  1CQI B;  5K1X A;  3QNE A;  3QVN A;  3N2G A;  1IVS A;  4X62 O;  4ZOL F;  1CP9 A;  4WBN B;  2LGW A;  2GQR A;  3TY8 A;  5FL7 G;  1URF A;  1YJN V;  1A0I A;  3NR7 A;  2SCU B;  1UNN C;  4DL4 A;  4DV4 O;  1JX9 A;  3PFF A;  1YF2 A;  5KFZ A;  3JSL A;  3NUA A;  5CA0 F;  4BWS C;  5B1A B;  3CRC A;  1TWA A;  3M7M X;  3H1K H;  4CS4 A;  2E5L B;  1G1X B;  5DGA A;  4DUZ B;  1O75 A;  1SEI A;  1H2L A;  5J9P C;  1DAA A;  1ZHQ A;  4K6N A;  4GKJ H;  3T1Y B;  2K1E A;  2YID A;  5BPF A;  1WLE A;  4Q45 A;  4IAJ A;  4PDB A;  4JYA O;  4DR7 B;  2QA4 V;  1T36 A;  1S0V A;  2CNQ A;  4XDL A;  4DR5 B;  4A3E G;  1BHA A;  3H4D A;  1QBZ A;  3ZHQ A;  4FFB B;  5GON B;  5IJ9 A;  2DQ0 A;  1XDN A;  4GC6 A;  1ENV A;  3JAT A;  4UVB A;  4G3I A;  2HGS A;  4ECY A;  1BCC H;  3CME V;  4DUY H;  1FS0 G;  3CX5 F;  1JMK C;  5JCO A;  4HNT A;  3DTU B;  3K03 A;  1FJG O;  1KU9 A;  4R7C A;  1OCO B;  4GX1 A;  5EDW A;  1M57 C;  2PF4 E;  5DLF A;  4A2B A;  4NZM A;  3CCM V;  4XX0 B;  3QWU A;  4P9P A;  5C93 A;  5JH7 B;  2CZG A;  4O7V A;  2BQU A;  2PI5 A;  2BE3 A;  2WB1 A;  2VWK A;  4JI7 H;  5DQI A;  1FXK A;  4X66 O;  3CCE V;  5FLX W;  3CXC U;  3L71 H;  4IT5 A;  1X4T A;  2F95 B;  2W6O A;  3G6X A;  4ED3 A;  4DRF A;  3MD0 A;  3G8D A;  2FB9 A;  3W7S A;  3F7Y C;  4B3S B;  4LF7 H;  2WTF A;  1M9N A;  4JI8 H;  4YHH O;  3R9R A;  3BRC A;  1UC9 A;  1RJQ A;  1R1B A;  1IBK H;  2F4V H;  1WP8 A;  2IU3 A;  4I0X A;  4B3R B;  4JI4 B;  2VQD A;  1XOU A;  4MV7 A;  4J7K A;  3AW8 A;  4WFA V;  3DGE A;  3K59 A;  2ABJ A;  4A3C G;  2Q7H A;  4A3M G;  1CKN B;  4RNN A;  4H37 A;  1YIJ V;  2R84 A;  2N04 A;  3R5X A;  1P7B A;  3BA9 A;  4TV8 F;  3OTO O;  1I6U A;  3VOU A;  1BL8 A;  2P5O A;  4E2L A;  3V6H A;  2ZNJ A;  2IU0 A;  4F4L A;  4K0K H;  1KQS U;  2C22 A;  3BQ1 A;  1DGS A;  3ORR A;  2E2I A;  3M9M B;  4JI0 H;  4O3R A;  5KFT A;  3KHR A;  1HDJ A;  3LML A;  4A3I G;  3GTG A;  1RYR A;  1ZAU A;  1XQ8 A;  1AI7 A;  2PZS A;  1RFY A;  2RCV A;  1VF6 A;  2WAQ A;  4WFH A;  1OCZ C;  3U9T A;  4JI1 H;  2A06 H;  3L75 H;  3CB2 A;  5CBF A;  1ZWI C;  5KFG A;  3ABK C;  2R7Z A;  5KFA A;  1IBM O;  1NT2 B;  2WLL A;  3RAQ A;  1Z5V A;  3HB3 B;  5J2U A;  3L70 H;  2A7W A;  4BBS G;  2XAG A;  4PDM A;  4EFE A;  5E79 Z;  1WRV A;  1DV1 A;  5BWU A;  4DV2 O;  2GPS A;  3OR7 C;  5KG7 A;  4I0X B;  3ZJZ A;  1VKZ A;  4MTD A;  1S77 D;  3RUP A;  2OH2 A;  4O7Z A;  1S5H C;  5JQG A;  4DV7 B;  2LFR A;  4DO2 A;  3APQ A;  1BE3 H;  2F66 C;  4CC6 A;  3GV8 B;  1SFO A;  3H1I H;  2OWO A;  2ZDI C;  2UU9 O;  4O4L B;  5LHH A;  4EB6 A;  2CNU A;  4ECT A;  4ECZ A;  4LF9 H;  3OUU A;  3PW2 A;  2KKW A;  2ZE5 A;  3OD4 A;  2YEV A;  3D3Q A;  3GIL A;  3JD0 A;  4X1I A;  4DL2 A;  5LMU H;  5KA5 A;  2Q7E A;  4E6N A;  3K5O A;  4B3M O;  1NVP D;  2RDJ A;  3K79 A;  4UB8 Z;  4UCR A;  3JAR A;  3RYI A;  3U10 A;  1X9N A;  1S5J A;  3WO0 A;  4I4T B;  3O9O A;  5K1P A;  4JV2 A;  4RZR A;  5KT6 A;  1F23 A;  2YZN A;  2BQR A;  4YB8 B;  5CBH A;  1PL0 A;  4W4K A;  4TT3 G;  3A0H Z;  4NTX A;  2ASD A;  4LWS A;  2F93 B;  1EM1 A;  2DWD C;  4G28 B;  5CBG A;  3D36 C;  4JV0 A;  5EBL C;  2FPG B;  1H2M A;  3OR6 C;  3M99 B;  3TJT A;  3G6E V;  2Q6A A;  2YZL A;  3RJ0 A;  3LSS A;  5LMN H;  3KXY T;  5J2U B;  3Q8S B;  2XCL A;  2XAH A;  3C0F B;  1N34 H;  3J7A K;  1SRY A;  1NU1 H;  1IBL H;  4LF8 O;  4Q4C A;  5D8D A;  4EEQ A;  2OIE A;  4QWD A;  1XEQ A;  5JQG B;  2EIL C;  2JA7 G;  3T5K A;  1O9G A;  4LFB B;  1SZT A;  2JA6 A;  1W0J G;  2ZE7 A;  5IWA O;  4FJC C;  2Z0A A;  2KG7 A;  2HGX A;  1HW7 A;  5F9N A;  4NVP A;  3JD1 A;  3RWR D;  4EB6 B;  2C2A A;  4TQS A;  2W6Q A;  1ROP A;  3JAM N;  1Q5O A;  3DAA A;  3UO3 A;  4YY3 B;  4YJ3 F;  1DLB A;  3JAS A;  4LSA A;  1NI8 A;  2XCA A;  4LF5 H;  2XOK G;  1VQ9 V;  2R85 A;  2XAQ A;  3CCJ V;  4LH7 A;  1HNX O;  1Q6U A;  2UVR A;  2DQ3 A;  3ETH A;  3AK3 A;  3JAR B;  3D8C A;  1BGW A;  3RYI B;  1SER A;  4UVA A;  2CTP A;  4IIJ F;  3SYO A;  3FAV A;  4DR1 H;  3T1C A;  4PZ6 A;  2Y48 A;  3CYO A;  4EBC A;  3CE2 A;  1QR9 A;  2QM8 A;  4IGG A;  3MR2 A;  4CS3 A;  3N42 B;  2FK1 A;  3J81 W;  5E1A C;  2CW8 A;  4J0M A;  5EC2 C;  3OAA G;  3E5N A;  1SQF A;  2W57 A;  2UUA B;  4LWS B;  3SJC C;  2QM4 A;  2EJ3 A;  3CC7 V;  1S0M A;  2E76 B;  1Y76 B;  3BCC H;  1I94 H;  3AG1 B;  2F23 A;  4FZ0 A;  5HFL A;  4GLW A;  4DL6 A;  2A3Q A;  4ZHQ A;  2E74 B;  1YXB A;  2HFE C;  3CVZ A;  4J7J A;  4O3N A;  4JYC A;  4EBD A;  5J2T B;  3QZ7 A;  1U97 A;  4TVI A;  1TUE B;  4Z1M G;  4RZQ A;  4F50 A;  1VQ6 V;  3JYC A;  4APM A;  2WLK A;  2E5L H;  1AB3 A;  1XMQ H;  4DUZ H;  3P3P A;  3N6X A;  3FX7 A;  1I5X A;  5KFH A;  2GSM B;  4DW1 A;  4I7Z B;  4EGQ A;  2NNU A;  2XCP A;  1GSH A;  4UUG A;  4RB2 C;  4NYE A;  1Z5W A;  2R93 A;  2EIY A;  4DR5 H;  1GH6 A;  3W7U A;  1T3N A;  5CA1 F;  3GDE A;  4HZ3 A;  5CA3 A;  2B1I A;  1SQG A;  3HB9 A;  4GKK O;  3FFQ A;  5KAF Z;  1GMG A;  2Q67 A;  2UXB O;  3K08 A;  2A9H A;  5KFN A;  3SR2 C;  3LWB A;  5DG9 A;  4ECW A;  3LNN A;  4O83 A;  4PI2 A;  4UVC A;  2D2C B;  3JAS B;  2CQY A;  4ECX A;  2NU6 B;  3WB1 A;  4MTX A;  4JI2 H;  1Y4M A;  3P32 A;  3JRW A;  4A3D G;  4J7Z A;  4DR6 B;  4H33 A;  1WA8 A;  2X7R B;  2FPP B;  2V4Q A;  4O2A A;  5B5E Z;  2OTL V;  1S0N A;  4TOI A;  3PO2 G;  3QTC A;  4JI7 O;  4J9Q A;  4UFZ A;  4IR9 A;  1BGY H;  4J11 A;  2YUA A;  2HVR A;  2EJ2 A;  4JTD B;  2VA3 A;  2UXC O;  1F51 A;  4GYC B;  5A2Q N;  3QQM A;  4O7R A;  2DWE C;  2DPI A;  1AIL A;  2W6M A;  5DGI A;  1EUC B;  3TGU H;  4CKB A;  1H2G A;  4I7H A;  1JPX A;  2HVJ C;  4O4J F;  4JI5 O;  3KTM A;  4ZHQ B;  5I5V A;  3HKZ E;  1A32 A;  2R9A A;  5BR8 B;  4RNM A;  5C4X G;  3Q8R B;  3MR5 A;  1MMM A;  4HAM A;  3UO2 A;  5IWA B;  3T54 A;  3GIM A;  2Y0S E;  4YXW G;  1WCM G;  1P84 F;  1N33 B;  3ZCC A;  5KG1 A;  5EZY F;  3UT5 B;  2JEG A;  4GCZ A;  3QO7 A;  4UCV A;  2P67 A;  2EJR A;  1GLV A;  2CKZ B;  3TQT A;  3E22 B;  3HOV G;  1BZK A;  4FLZ A;  4K35 A;  2W8K A;  3ZHV A;  2VWJ A;  2UXD B;  3LP8 A;  4YR3 A;  2YWV A;  4B7K A;  5LBQ A;  1XNQ B;  1J95 A;  3N2K B;  3ETD A;  4JI0 O;  5ITZ B;  2RJZ A;  1E4E A;  4FFP A;  4ICG A;  2XGP A;  4TUY F;  2X5R A;  2C35 B;  5L1J A;  1QR8 A;  2R8I A;  3H0G A;  3RB4 A;  1AVM A;  2UVV A;  3OFN G;  4X1Y A;  4IRC A;  5KMG A;  3TIN A;  2QWP B;  4CKE A;  2YSU B;  1Y74 A;  3GVM A;  4HBN A;  3ASN C;  4DV6 O;  4B7E A;  5B1N A;  4BWA A;  4JI3 H;  4TV9 F;  1R6N A;  2QK4 A;  3DF7 A;  5KFR A;  4JAA A;  1M6V A;  4UCO A;  2QSA A;  1FKA H;  4DV1 O;  2COG A;  1R6T A;  2YCH A;  2NVX A;  2X0S A;  5IE9 A;  2JGU A;  5L3C A;  3KYH C;  1QLE C;  4CH5 A;  1N32 B;  1K5Q A;  3Q4H A;  2R92 A;  4DV7 H;  1B04 A;  4OX9 B;  2HJF C;  4LFA B;  3T1H B;  5DED A;  5KT2 A;  4UV8 A;  1MA1 A;  3MFH A;  3V6K A;  1PKX A;  2IJH A;  1T5E A;  1WNS A;  4LF6 O;  5IYZ F;  3ABM B;  1M1K W;  5KG6 A;  4RUC A;  3KHH A;  1QU7 A;  3TCU A;  2ZIO A;  1JLL B;  5LMU O;  3TXQ A;  2P4V A;  5BWR A;  1R73 A;  2RDC A;  5DGB A;  4QJF A;  3H01 A;  3SPJ A;  3T9B A;  4O2B A;  5D1O A;  5L3D A;  3JAK A;  4O4H A;  3HKC A;  4MVR A;  3ZN1 A;  1M90 W;  2R6F A;  1E4E B;  1B33 N;  3QG5 A;  1ORQ C;  5KFY A;  1KUT A;  3S24 A;  3SE7 A;  1V54 B;  3ZED A;  4YR0 A;  1ZQ7 A;  5BYA A;  5JUM A;  2AGQ A;  3JSN A;  4MV3 A;  3HXL A;  3TET A;  3SJQ C;  2H94 A;  5KMG B;  2WLI A;  1J5E O;  4C2M A;  5JH7 F;  2VQE B;  2X6B A;  1Y74 B;  1RPR A;  2Q2T A;  5L3E A;  4NXN O;  2FE3 A;  3FB8 C;  3KKY A;  3OW2 U;  4DV3 B;  3K5I A;  2EIK B;  2WB1 E;  3RF2 A;  5FNV F;  5LMN O;  4RWU A;  4CMD A;  3IC9 A;  2DOS A;  3PW4 A;  3K5L A;  1NBM G;  2ITC C;  2CE4 A;  2ZDG A;  3G6V A;  3FYE B;  3OEE G;  1KKD A;  5E25 A;  3CXH F;  1KTA A;  2IA6 A;  3BEH A;  4EBE A;  3Q4H B;  4LFB H;  5B1B B;  4R8U A;  3E2E A;  1EN5 A;  2HVS A;  2VA2 A;  2EIN B;  2YL2 A;  5KFV A;  2DE0 X;  1ZLZ A;  4X65 O;  1VBG A;  2R8G A;  5K3W A;  3T9E A;  1VAJ A;  2LW1 A;  1M56 C;  4UB6 Z;  4AQY O;  1KBL A;  2RGV A;  5LOV B;  3PR5 B;  3I4M G;  1TWF A;  3GTP A;  1GTO A;  2DW4 A;  1HR0 B;  3ZN0 A;  1FFX B;  1RPO A;  4QJF B;  3ASO B;  2GUZ A;  2HEP A;  4D6T H;  1EYZ A;  3RV3 A;  4O2B B;  5D1O B;  3JAK B;  4J41 A;  3OGI B;  3SPG A;  2W9B A;  4DR1 O;  2JK5 C;  2C00 A;  1GN4 A;  2DN9 A;  4CZZ A;  5LL6 Y;  1NS1 A;  1BQZ A;  1FPO A;  2BOC C;  4LF4 O;  3JCZ A;  3BQ0 A;  1SKV A;  3RBE A;  3OSN A;  1CPY A;  5EWF A;  2O57 A;  4O7W A;  4ECR A;  3M9N B;  2A0L A;  3B77 A;  3UYY A;  1I94 O;  3VNN A;  2QWO B;  2WAQ E;  3ABU A;  2ZDH A;  3LDE A;  2QKC A;  5D5Q A;  4CH6 A;  1OCR B;  1YCI A;  1Y1W G;  3ZRS A;  5JVD F;  1XMQ O;  1U96 A;  1MZB A;  2KQX A;  2AGO A;  3MWM A;  2QF7 A;  3JCU Z;  4LF6 B;  1LR1 A;  2DZD A;  4PA4 A;  4FZ1 A;  3NC0 B;  4A3J G;  5KFD A;  4FLU A;  4WBN A;  1EN6 A;  1VF7 A;  4A5U B;  3K3W A;  3HT5 A;  2NLJ C;  2ZJT A;  3PW7 A;  4JYB A;  3IC7 A;  3RB0 A;  1VBH A;  3KAJ A;  2JJ1 G;  2V5A A;  3ZRW A;  2FK3 A;  2JA5 A;  1RYS A;  4IHJ B;  4OXS A;  2JEJ A;  1B06 A;  2YI9 A;  5EYP B;  1RK5 A;  5KX5 A;  3U0G A;  4U6P A;  4OPA A;  1JIH A;  4DYL A;  4P9O A;  5IY5 B;  2K9P A;  4JI2 O;  4DR6 H;  3M4I A;  2EUL A;  3LDD A;  5EK0 A;  2W9B B;  2PN1 A;  5LHI A;  1YIT V;  2ZDQ A;  4X1K B;  3CP1 A;  1Y1V G;  4ME6 A;  3HPL C;  3R5F A;  3ZMS A;  4ED6 A;  2ZNI A;  5BMV A;  4J9R A;  3GLK A;  1I1L A;  1EN4 A;  1SYX B;  1QLE B;  2ZM6 O;  1IZ3 A;  1M7J A;  1WAZ A;  3IAY A;  1S3J A;  5BR8 H;  3K5M A;  4M7E A;  1KJ8 A;  1W96 A;  3TQ1 A;  2HVK C;  3N43 B;  4A3K G;  5J2U F;  3GIK A;  1XMO B;  4DV5 B;  4NZN A;  4F6R A;  1H2K A;  1MOF A;  3LUL A;  3F5T A;  1N33 H;  1GYF A;  3A0B Z;  5FLM G;  3NBZ B;  1MNG A;  5DEC A;  2VUM A;  5JQG F;  4YBZ B;  4O7N A;  4FM0 A;  3OUF A;  3BHP A;  5LGT A;  5EBM C;  1QNM A;  5LP6 C;  3VQX A;  4PHZ A;  3U54 A;  3ZRW B;  4AI8 A;  5LYJ B;  4B3T B;  4NB5 A;  3RBZ A;  3FKI A;  4AYB A;  5KT7 A;  5KG0 A;  4PA9 A;  3B8M A;  2UUC H;  1XNQ H;  3JAM W;  3SJA C;  2M7W A;  5BWX A;  3GQC A;  2OCC C;  5LHG A;  4IWY A;  4EG0 A;  1MG1 A;  5KX5 B;  4U7C A;  1CKN A;  1M4U A;  2M6Y A;  3BA8 A;  3GIJ A;  1P16 A;  1FXV A;  1YJW V;  2YXH A;  3ABT A;  1OJH A;  1HNZ B;  4Q8E A;  4PI0 A;  1EZV H;  3E89 A;  3SYC A;  2Q69 A;  3GTM A;  5KFX A;  4J9O A;  4JI3 O;  3CQZ A;  3FYI B;  1VQ4 V;  4DR2 B;  4JV5 B;  3TXS A;  2VPS A;  4ED7 A;  5KFC A;  4JI6 O;  5BMV B;  2XD4 A;  2YIA A;  2JGD B;  2YIC A;  4ZQI A;  1N32 H;  1A3G A;  4PZ8 A;  5CE8 A;  5EOY A;  3R5H A;  3T1H H;  2PUS A;  3S3X A;  4A3B G;  4F6R B;  2Z5U A;  4A3G G;  1ZET A;  3E83 A;  4HNA A;  1M56 B;  5JJJ B;  4O84 A;  3VPB A;  4LR3 A;  4DV0 B;  5CR5 A;  3GIQ A;  5C8Y A;  3GB8 B;  1TAE A;  1EBO A;  2CW7 A;  2QTS A;  4FS1 A;  4H13 B;  2IBK A;  4DR3 H;  2EX3 A;  4F4X A;  3AX6 A;  2Q9L A;  3RB6 A;  4NKG B;  2HHF B;  5IYD G;  4YR2 A;  3H40 A;  3BFR A;  5JJN B;  2P22 C;  2YIB D;  2VPQ A;  5A9G A;  3RFC A;  1ZTE A;  3V4Z A;  4KHP B;  3ZHS A;  3HO8 A;  4JV1 A;  1EZ1 A;  1HNW O;  5IYD O;  4NXM O;  3WWJ A;  4O4L A;  2P7T C;  2HG5 C;  4FLV A;  3RVY A;  1YI2 V;  1XL4 A;  2PTM A;  2UUB B;  2VQE H;  2ZM6 B;  1YEW A;  3I4N G;  1OBG A;  3FMA A;  3ZHU A;  3PR4 A;  3ZBH A;  1MZF A;  1KJ9 A;  5KHJ A;  5FD6 A;  4FFR A;  5DG7 A;  3L2P A;  4A3L G;  2FKL A;  1XK5 A;  4XYM B;  2JA8 G;  5A2Q W;  2ZXW C;  1VQK V;  3N40 P;  2YRX A;  1XRE A;  4I4T A;  4JZ2 A;  3CWB H;  3A2F A;  5B3S C;  3Q8Q B;  4X62 B;  3C3T A;  3TIG A;  4ZHQ F;  2KB1 A;  4LFC H;  5KHH A;  4RQF A;  3K0G A;  2J6U A;  3EYY A;  3AG3 C;  3FB5 C;  4DV4 B;  2FTK A;  1T94 A;  3QF7 A;  3B40 A;  3VBB A;  3J7A U;  4HNA B;  4QPK A;  3JZ6 A;  3DXR A;  2QGN A;  4DR4 O;  1Q8I A;  5IDJ A;  1VMG A;  2IBZ H;  4YIP A;  1BQ0 A;  5BWV A;  3PW5 A;  3HOU G;  2VS0 A;  4MVS A;  4UCU A;  1HR0 H;  2NUA B;  1CS0 A;  5C8Y B;  3BJY A;  5LA6 A;  4JYA B;  4TQD A;  3CCQ V;  4X64 O;  4MS2 A;  3GV7 B;  2VQF O;  1N36 O;  2YU9 A;  1W2B U;  3RB3 A;  4HYO A;  2EIM C;  3CCV V;  4F4Z A;  1BSM A;  3JD4 A;  1P7G A;  1ARO P;  3HR0 A;  1K9M W;  2FB5 A;  3RGZ A;  4GZR B;  5KFJ A;  2QEX V;  2W70 A;  2B63 A;  1SQB H;  1FVI A;  2B9Z A;  2CGN A;  2IJI A;  1FJG B;  1NJI W;  4TWK A;  3ML0 A;  2W8L A;  3ZMV A;  4A3F G;  4O2A F;  1KEC A;  2DMX A;  2CTW A;  4P2Z A;  5H5N A;  4QNH B;  4BW9 A;  3Q2O A;  5LXT A;  4FFN A;  5HNE A;  1E1Q G;  2KSW A;  5DQG A;  1IOW A;  4JTA B;  2NU7 B;  4E4T A;  2Q0O C;  4G27 B;  4X66 B;  3RT3 C;  5KUM A;  3E8G A;  2FK2 A;  4QWA A;  4GT1 A;  2AW9 A;  1LNQ A;  1ZL8 A;  4XYL B;  5F9L A;  4FM2 A;  4YHH B;  2ZQM A;  1KP3 A;  4KUM A;  1E1R G;  1Y76 A;  3HKD A;  4FLY A;  2BQ3 A;  1S72 V;  1NR7 A;  5GTH Z;  4X89 A;  5J2T A;  2EZP A;  3DXR B;  3U55 A;  5KFM A;  2OCC B;  4FK5 C;  2UVW A;  3B4S A;  4NZO A;  4LBE C;  2XTA A;  4TSF G;  1XIL A;  5LA6 B;  5KG5 A;  3WB0 A;  1PPJ H;  2ZGI A;  2I80 A;  4QW8 A;  3OTO B;  1SQQ H;  3VQV A;  2ASL A;  2Y4T A;  3T5J A;  1XNR O;  3SYP A;  2HHH O;  2WYO A;  4K8Z A;  1N48 A;  3DC6 A;  2N74 A;  4MW3 A;  4O86 A;  3RTX A;  1VF5 B;  1L0N H;  2WWW A;  1K4D C;  3OHB A;  2R7L A;  4ETS A;  3OUS A;  2JS5 A;  2DPJ A;  4MA5 A;  4GUN A;  1M57 B;  5LXT B;  4ZOL B;  3GII A;  4AIL C;  2WDT A;  5HBR B;  4RNO A;  1NZ6 A;  1WSC A;  1XMO H;  2R93 G;  3EHB B;  4BR6 A;  3JAL B;  1Q6I A;  5CA0 B;  1IBM B;  3N41 B;  5CMU A;  5GW7 A;  1ZL8 B;  1XHZ A;  4HYK A;  3N27 A;  3RBD A;  4Q4D A;  1RP3 B;  5EC1 C;  4U3J B;  4WFG A;  3HKE A;  4DV2 B;  2FMA A;  1XBL A;  4DQN A;  3HKD B;  2WA3 A;  2MCT A;  3RYF B;  4B3T H;  4I9Q A;  2YYA A;  1H8H G;  2P4K A;  4I55 F;  4RQE A;  1WR2 A;  1EZJ A;  5KKN B;  1VP7 A;  4IRD A;  1AP6 A;  1DF4 A;  3OM3 B;  4XZ3 B;  2ZDI A;  2UU9 B;  3T1Y H;  3PVX A;  2GV9 A;  1I7F A;  4GKJ O;  1Q3E A;  1ZX3 A;  4DR7 H;  1VQ8 V;  4MVZ A;  3VQW A;  3KAL A;  4KFM A;  4GC7 A;  1JVM A;  2R82 A;  3UT5 A;  3KCY A;  2R8K A;  4CH3 A;  2ASJ A;  4O2B F;  4OGQ B;  5CB4 A;  4B3M B;  4O4H F;  3AG2 C;  1WB8 A;  3G6B A;  4D7S A;  4DRX A;  1SCU B;  3KAK A;  3E22 A;  4WHX A;  4RB3 C;  1SES A;  5BY1 A;  1PK8 A;  4WD3 A;  2WE6 A;  5KFU A;  5EWG A;  3BG5 A;  4DR2 H;  4JV5 H;  4DUY O;  4MV4 A;  5ITZ A;  3N2K A;  3JZF A;  2W0F C;  2ADP A;  4I5S A;  4HNV A;  2M05 A;  1PM9 A;  3BAA A;  4Z2W A;  5F2V O;  2JRI A;  4PDL A;  3RYC A;  1OCZ B;  4DAA A;  5KHK A;  3D36 A;  2FPI B;  4UCT A;  3ABK B;  5DMX A;  1WJZ A;  3VPD A;  3ZMT A;  1VQP V;  4LNU B;  4W4L A;  3OMA B;  5EIB D;  1WPX A;  2ARH A;  4IWX A;  3ZX6 A;  3RGB A;  4B3S H;  4DW0 A;  4FM1 A;  3HKE B;  4DV0 H;  4LF7 O;  4JI8 O;  4LF8 B;  5KFO A;  4FGR A;  3PN1 A;  1EKF A;  1IBK O;  4B3R H;  4TV8 B;  2F4V O;  4JI4 H;  3MWE A;  2ZE8 A;  1V4Y A;  4FIP C;  3FKS G;  2W9C B;  4J9Y B;  3H0G G;  2X0L A;  3N8D A;  2BOB C;  1LUV A;  3IJ4 A;  1K33 A;  1PV0 A;  5C1P A;  2LQT A;  4FE2 A;  4MV6 A;  2J9G A;  5IJ0 A;  2FYU H;  2R70 A;  3JRX A;  2UUB H;  1BNC A;  5CB4 B;  2XIG A;  2CK3 G;  5AG2 A;  1HNX B;  3V4S A;  4YIO A;  1UFI A;  5CM0 A;  3UZO A;  4DRX B;  1Y6X A;  4XDK A;  1RK6 A;  1Q81 W;  4K0K O;  4RB0 A;  2XC9 A;  2V4D A;  2YXY A;  1JFF B;  2PGG A;  2BSK B;  1WPB A;  2GTA A;  4ZI7 A;  3T99 A;  5BWW A;  2R92 G;  1OZ0 A;  1RJR A;  1BXR A;  3STZ C;  4X62 H;  3WG7 C;  2W6N A;  1V9P A;  3STL C;  5IYB G;  2V59 A;  2Y0I A;  3RYC B;  4LCU C;  4LFC O;  4BBR G;  1UPG A;  3NBY B;  4CKC A;  3X2Q C;  2AHY A;  4JI1 O;  4DV4 H;  4QIW A;  4O3S A;  3L4J A;  5IYB O;  3CHX A;  4IYH A;  3GTL A;  1M93 A;  2LW7 A;  2ATK C;  2DLN A;  2YRW A;  1V51 A;  2W0X A;  1YTF D;  4BY1 G;  2QKA A;  1NTZ H;  4WBN F;  2WSS G;  2EIJ C;  2AGA A;  2RDI A;  4ECS A;  4JYA H;  1JA8 A;  3ETJ A;  5C3E G;  4MSW C;  3DC5 A;  4AHC A;  1W59 A;  1H38 A;  4JUZ A;  2EIL B;  3BVO A;  3LQS A;  3K9A A;  5IP7 G;  4PDR A;  3K04 A;  4J9Z B;  3CPW U;  2PYL A;  4PJ0 Z;  3CRQ A;  4AYB E;  5BXZ A;  1GM9 A;  5EIB C;  1A0G A;  2Q4P A;  4LH6 A;  4GKK B;  2UXB B;  2W71 A;  4FBT A;  3LNM B;  4IYI A;  5IJ0 B;  4QWC A;  1FFT B;  1GM7 A;  1FJG H;  4LF9 O;  2CTQ A;  5KFW A;  4FLX A;  5LOV A;  5KT3 A;  4IR1 A;  2Q8V A;  3DSQ A;  5GON F;  2DIK A;  1FFX A;  3LUT B;  1TVK B;  4WCE V;  5KFS A;  3OSP A;  3SPH A;  4FFO A;  4J9K A;  4GX2 A;  1GN2 A;  3PO3 G;  4X66 H;  3OTF A;  4ZI7 B;  4JI7 B;  3W1G A;  4ED8 A;  1SF9 A;  1GAX A;  2QDO A;  2BTO A;  3HOW G;  4C5B A;  1JOY A;  3JAW B;  3OE7 G;  2UXC B;  3ABL C;  4JAU A;  4YHH H;  3RYH A;  1NVP B;  5KA6 A;  1OWT A;  2WA4 A;  4JI5 B;  2JS3 A;  1QHT A;  4LMY A;  2JDI G;  1I50 A;  4U3F H;  5LGU A;  2YS8 A;  1S10 A;  4CBC A;  2X6A A;  3CJH B;  4ASU G;  4A2A A;  1SQP H;  4YJ2 A;  1N34 O;  2NVY A;  4RB1 A;  4O81 A;  3MR6 A;  3K9S A;  2IJJ A;  4ZKI A;  3RW0 A;  1WH2 A;  1KKC A;  1IBL O;  5KFP A;  3OTO H;  4J9L A;  2R7M A;  2A79 B;  1EKV A;  3R66 A;  1OCC C;  4MVQ A;  2PI4 A;  5DN6 G;  2VOB A;  2JEX A;  3P30 A;  1VQ5 V;  3ETQ A;  3CMA V;  1KYO F;  2W7P A;  4L8J A;  1KT8 A;  2WLJ A;  4PBC A;  4IHJ A;  4JI0 B;  5DIS C;  4LC1 A;  2WLM A;  4U7N A;  1N0J A;  4F4W A;  4YY3 H;  5EYP A;  1TUB A;  2XAJ A;  1JJO A;  2Q5Z A;  4RUA A;  3V6J A;  1KC7 A;  4LF5 O;  2WPD G;  1PP9 H;  2HIX A;  4RCN A;  3B09 A;  4RAI A;  4HNU A;  3QZ8 A;  2PYJ A;  3PW0 A;  1JXL A;  2MK3 A;  4PDV A;  1K7D A;  1SS3 A;  3H9V A;  2OLS A;  1BT8 A;  4DV6 B;  1IXM A;  4MVU A;  3H1H H;  5L3F A;  4X1K A;  4PZ7 A;  2O03 A;  3RV4 A;  1THZ A;  4R6Z A;  4UXN A;  3FDS A;  3ZMU A;  2OTJ V;  2UUA H;  4BW5 A;  2JA5 G;  3RYH B;  4DV1 B;  3VMM A;  3OMI B;  4DV2 H;  2Y4U A;  2XAS A;  1VEW A;  2W7O A;  3J80 N;  1Q90 D;  1WP7 A;  4PD4 F;  5CA1 B;  4X20 B;  2JEU A;  3W1B A;  2PY5 A;  4QW9 A;  3E86 A;  4JAV A;  5DQH A;  2IW5 A;  2E5L O;  5C5J A;  4DL5 A;  4YJ2 B;  2R9R B;  2ZR3 A;  1SET A;  4DUZ O;  2UU9 H;  1K92 A;  2LGQ A;  3T1Y O;  3ZMZ A;  5C8Y F;  2FP4 B;  1JX4 A;  2QM7 A;  4DR7 O;  4FVM A;  1GSO A;  1WN7 A;  4J9P A;  2ZD9 A;  3MWD A;  4DR5 O;  5LMU B;  3GWO A;  1R3L C;  5T14 A;  2QWN B;  3FB6 C;  2W6I G;  1ZSP A;  2HDK A;  5LYJ A;  2ZCE A;  3RVZ A;  4O4L F;  4BXX G;  3OHA A;  2E2H A;  5JCO C;  1N8R W;  1TUB B;  4TV9 A;  4FS2 A;  2R8H A;  4Y8V B;  4R50 A;  3GTQ A;  4XDJ A;  3T5L A;  4WFE A;  3W7W A;  1CKM A;  4QSH A;  1GO3 E;  1KJI A;  1R3J C;  1ZHS A;  3EFF K;  1J5E B;  2ZIN A;  3KHG A;  1RSO B;  2YS6 A;  1JCH A;  4O4J B;  2RQ6 A;  1G4Y B;  1LUW A;  1Q43 A;  3ASN B;  3H1J H;  4NXN B;  3JZI A;  4I4T F;  3RGX A;  1D5A A;  1FXK C;  2VUM G;  4M0J A;  1UC8 A;  5LMN B;  3WWI A;  2PVP A;  4O7T A;  3JD2 A;  2HGW A;  3FKI G;  1CXZ B;  4B3S O;  1Y67 A;  3KCX A;  4LF8 H;  1GKF A;  2JGD A;  4B3R O;  3RR5 A;  2R9I A;  4JI4 O;  3FB7 C;  2AHZ A;  1SQX H;  3WU2 Z;  5IWA H;  4L87 A;  1KEE A;  2IJK A;  1CE8 A;  2HR3 A;  1TWC A;  1Z2P X;  3CEI A;  2J6S A;  1BJT A;  3VOT A;  2IH3 C;  2ZE6 A;  2QJ1 A;  3KHL A;  4X65 B;  3VA7 A;  3HKB A;  4RAZ A;  4AQY B;  2W6Z A;  3EPI A;  2FLN A;  2COJ A;  4PWQ A;  1AN7 A;  2CAZ C;  1HNX H;  3K3P A;  1YHQ V;  1Q86 W;  2ADQ B;  4ZBM A;  1YSC A;  5H6R A;  2UXD H;  1P49 A;  2A1H A;  2HHF A;  3GJX B;  3CS5 A;  4DR1 B;  2AZ2 A;  3TK1 A;  3A8T A;  2Z02 A;  1GO3 F;  4KXR A;  4TV9 B;  4O7Y A;  3LSQ A;  1V55 C;  3UQ8 A;  3ABL B;  4LF4 B;  5FNV A;  3T9A A;  1TWH A;  5LXT F;  2DYR C;  4EYH B;  4F4Y A;  4DL3 A;  3L4K A;  1VF6 C;  4ED2 A;  1G2W A;  3IGA C;  3ZS8 C;  2H3O A;  1Y1V A;  4HR7 A;  1NKD A;  1I94 B;  1YDX A;  4FBU A;  5L3G A;  4O7S A;  1E4F T;  5FJ8 G;  3MAQ A;  2RN9 A;  1B3Q A;  2YC0 A;  1OHH G;  3IFX A;  3GTO A;  3I12 A;  2CDY A;  1XMQ B;  5C1O A;  1H2N A;  2QR4 A;  3EPG A;  5KS8 A;  1FKA O;  3OUZ A;  4JTC B;  5IYZ B;  1KUQ A;  1GGO A;  1L8D A;  1JR9 A;  3LSU A;  1OCC B;  1IOV A;  4RU9 A;  1WB7 A;  2LJ2 A;  1R9T A;  5J2T F;  1JQ0 A;  4OX9 H;  4LFA H;  1X59 A;  4DV7 O;  3JD3 A;  3OGC C;  4GKK H;  1YTF B;  1ET0 A;  3I5D A;  2UXB H;  4NR1 A;  2Q7D A;  3WO1 A;  4NLG A;  3C3S A;  3HKB B;  3SYA A;  1VQO V;  4I9W A;  4CHI A;  1S9F A;  5I5W A;  2L35 A;  2ITD C;  3T7A A;  4CMF A;  2C2E A;  2CH7 B;  5KG2 A;  4JI2 B;  1EHI A;  2V58 A;  1K8A W;  1NTK H;  2UXX A;  2L6L A;  1Q82 W;  1E79 G;  2YW2 A;  3B8N A;  2YZM A;  4ED1 A;  4GX5 A;  3BPZ A;  4BIU A;  1G8M A;  2LP7 A;  5I5S A;  5BWT A;  1MSD A;  4G2K A;  1DV2 A;  1K1S A;  4N21 A;  3G71 V;  1NTM H;  2XT9 A;  1AI4 A;  4PV1 B;  5FNV B;  3GWK C;  1PNK A;  2HKO A;  3N2G B;  2UXC H;  3QO8 A;  2R7Z G;  5JVD A;  1K97 A;  2W6J G;  4O4I A;  3WFV A;  1QQC A;  3E35 A;  2R72 A;  1C3O A;  1P4R A;  4JI5 H;  5KT5 A;  4DL7 A;  3TEK A;  3AG1 C;  2YZG A;  5GTI Z;  1FXH A;  4NTY A;  4R8C A;  1M0T A;  1KB9 F;  1COW G;  4DV3 H;  2GLT A;  2CUG A;  1XDC A;  2ATL A;  2V7Q G;  4I50 A;  2ZR2 A;  4RAY A;  2HJW A;  1L0L H;  4J10 A;  4BY7 G;  2Q2U A;  1BHB A;  3MHS C;  3OT7 A;  4HQ6 A;  1GM8 A;  3K57 A;  1N0N A;  2ETN A;  3SPC A;  3RAX A;  2B63 G;  5IJ9 B;  5LP6 A;  4LFB O;  3JAT B;  5KFF A;  2D3O W;  3H4B A;  5I5Y A;  2FML A;  2P90 A;  3SNO A;  2VR1 A;  3CC2 V;  2OT5 A;  1KJQ A;  2C2R A;  2ODM A;  1AR5 A;  3K06 A;  4YY3 O;  4H0L B;  1C30 A;  4PA3 A;  4JF3 A;  4FLW A;  2AGP A;  5CB4 F;  1S97 A;  1PX2 A;  5JJE B;  4EEY A;  1QLN A;  2PMZ A;  2C28 A;  4JGS A;  1AI5 A;  3IN5 A;  4DV6 H;  4MVM A;  1FXK B;  5HFM A;  2GTS A;  3O65 A;  4JI3 B;  3TII A;  3VPC A;  2ZKO A;  4O3P A;  1Y14 B;  1Y66 A;  5JVD B;  2R7N A;  2VUG A;  4JPR A;  5DG8 A;  4O4I B;  4JI6 B;  4DV1 H;  5DLG A;  1JJ2 U;  2UUA O;  3K5N A;  1F4N A;  4Q0Y A;  3CRM A;  3ZHR A;  5I47 A;  2F43 G;  2DYS C;  4ZOL A;  5FPO A;  1I08 A;  1GSA A;  2P6J A;  4QIW E;  3I55 V;  1SA0 A;  4I50 B;  2LO1 A;  1MZE A;  3U11 A;  2QTO A;  4EKW A;  4WFB V;  4Q6G A;  3CRA A;  4MTF A;  3JAL A;  5CA0 A;  4C5A A;  4LF6 H;  2JA6 G;  1G6U A;  5H9C A;  4M9U A;  1B6R A;  5D5P A;  1UJW B;  2FLP A;  4U3J A;  3T9F A;  3SYQ A;  2Y69 C;  5LP6 B;  4P30 A;  3E8F A;  5JWP A;  3N6R A;  2BCC H;  2JJ2 G;  2DWC A;  5BYB A;  5L1K A;  3S3W A;  2ALZ A;  2RF4 A;  3RYF A;  4DK1 A;  2CGO A;  4OPH A;  5IT9 N;  1GN6 A;  4Q20 A;  1PNM A;  4H44 B;  1RJP A;  1V55 B;  1VS0 A;  3GIP A;  2YI8 A;  4UV9 A;  1HNW B;  1FD9 A;  2I8C A;  2HJD A;  2DYR B;  3SGI A;  4NXM B;  1IXB A;  3ZIA G;  4DR6 O;  1J5E H;  5BZB A;  3HOX G;  4MV1 A;  1IYE A;  3AYH B;  4NXN H;  4ZI7 F;  3G6Y A;  1TGO A;  3OMN B;  3GV5 B;  2WLL B;  4E4E A;  3CRR A;  3ZRV A;  3WNZ A;  4Q44 A;  4EQ5 A;  4YQW A;  5H80 A;  3E8B A;  3IG0 A;  4QIW F;  2GHY A;  5FPR A;  1M5I A;  2OCH A;  4RUF A;  5BR8 O;  1SA0 B;  5DAA A;  1R3K C;  3GTK A;  4D7T A;  2XHB A;  4DV5 H;  1IYD A;  1SC5 B;  4FFK A;  1GK9 A;  3DTG A;  2QKS A;  2AZ0 A;  4DR4 B;  4X65 H;  4Q43 A;  2AU0 A;  2JIZ G;  4LNU A;  5EBW C;  2ILM A;  3BAB A;  1RM1 C;  3CCL V;  1N33 O;  4AQY H;  2YEV B;  4A93 G;  3ABM C;  4X1I B;  3AG7 A;  1SZX A;  1K73 W;  4JYY A;  2B1G A;  1W93 A;  4CH4 A;  3ICX A;  2JEF A;  1NH2 D;  1Z2N X;  4QPJ A;  3GID A;  1SQV H;  4X64 B;  3QFF A;  4TV8 A;  2VQF B;  1JKJ B;  2EBO A;  1N36 B;  2GPW A;  2W9C A;  1S5L Z;  2YDE A;  3RFR A;  2UXD O;  5DGH A;  2UUC O;  1XNQ O;  5L3B A;  2Z3Y A;  5HV6 A;  3PZP A;  5B1O A;  5LOV F;  1VAR A;  2Q73 A;  2W6P A;  4LF4 H;  5KFI A;  3B2E E;  2JA7 A;  1V54 C;  2XAF A;  3MR3 A;  1HNZ H;  1L2Z A;  3HOY G;  5L9X A;  1NQT A;  1CEZ A;  3SI8 A;  2YIB A;  2HP8 A;  3CCU V;  1R3I C;  2EIK C;  2ZXW B;  1JFF A;  1OV9 A;  2BSK A;  2N05 A;  3E8H A;  4GX0 A;  3TW6 A;  1Q7Y W;  5B3S B;  3THO A;  3AEI A;  3J80 W;  2ZIM A;  2H8P C;  1KBH A;  1B6S A;  1Z2O X;  3G8C A;  3MHH C;  5FLX N;  4NYK A;  5KT4 A;  1N32 O;  2QWR B;  5KFB A;  3EVK A;  2OIG A;  1AJQ A;  1GN3 A;  2QE7 G;  3L72 H;  2RGR A;  3AG3 B;  3H20 A;  3M8A A;  4FMT A;  5B1B C;  4OX9 O;  3M9O B;  2CFM A;  1K4C C;  2KG7 B;  4QE9 A;  3T1H O;  4LFA O;  4YJ2 F;  4FFM A;  4FLT A;  5TIS Z;  2EIN C;  3K5H A;  1W0K G;  3MFI A;  3K0D A;  3TW7 A;  1Z2G A;  4BAY A;  3F5W C;  5CAE B;  1FYJ A;  2FJZ A;  1YVW A;  4CE5 A;  1I3Q A;  2JEI A;  3UFX B;  1EUD B;  1N4C A;  4C7U A;  2XND G;  1DTO A;  1H8E G;  4PA6 A;  5KFQ A;  1XNR B;  2VRZ A;  4DR3 O;  3ASO C;  2EIM B;  2HHH B;  3FAV B;  4X8A A;  4IHJ F;  3ZHT A;  5FR9 A;  2XGQ A;  4MVO A;  4KHP H;  2R87 A;  4F6E A;  4WFF A;  1EFR G;  2QWQ B;  2F1M A;  1XUQ A;  2GQS A;  1KD1 W;  3TY9 A;  4YAJ B;  2ZM6 H;  4DXW A;  1TA8 A;  2W9A A;  2VQE O;  2DYS B;  1S68 A;  1AJP A;  1TVK A;  4MW8 A;  2GBO A;  2WAM A;  4DV3 O;  3R65 A;  1IUR A;  3G67 A;  1OCR C;  1AUV A;  2FL4 A;  1I2K A;  4MAM A;  3K3V A;  1AJN A;  5KG4 A;  3R23 A;  3F7V C;  1ULZ A;  2ODT X;  4YAK B;  3JAW A;  1OBD A;  3ETE A;  3U9S A;  4MV8 A;  3PJS K;  2ZT9 B;  2Y69 B;  3CC4 V;  4RO2 A;  3HBL A;  5KHG A;  3WB2 A;  4MTE A;  3W5O A;  1K83 A;  2I87 A;  4FPP A;  1AR4 A;  4U7O A;  2UUC B;  3CJH A;  5L1I A;  3T9C A;  1CKO A;  5KG3 A;  3OEH G;  3T5H A;  1L1F A;  1I2L A;  1VQN V;  2YS7 A;  4GKJ B;  1HR0 O;  3WWH A;  1N56 A;  5IY5 C;  2HIV A;  4XBF A;  1WA8 B;  5LYJ F;  4YJ3 A;  1YJ9 V;  4O2A B;  4PA7 A;  5KFE A;  1WCM A;  2COI A;  3Q1K A;  2R8J A;  4J42 A;  1I1K A;  5KX5 F;  2AQ4 A;  4IIJ A;  1MSW D;  2E75 B;  4DUY B;  3AG4 C;  4MV9 A;  4JI6 H;  3EXA A;  2CNV A;  2HVQ A;  5KHI A;  3W7T A;  4FFL A;  1K5S A;  3VQY A;  2EZO A;  4O7L A;  1ZUQ A;  1QVG U;  3RIZ A;  2P0A A;  4QWE A;  4ZIB A;  1K1Q A;  2HLD G;  2IM9 A;  2XUM A;  4BIZ A;  5B66 Z;  2IMW P;  1NR1 A;  5BPH A;  2V9W A;  2C2D A;  2WLN A;  2PBZ A;  1XHX A;  2G38 A;  4O3Q A;  1KC8 W;  4JAS A;  4FM9 A;  3D3I A;  4O82 A;  5BMV F;  2BR0 A;  4I55 A;  1RM1 B;  3GB7 C;  3APO A;  5IP9 G;  2UVU A;  4PEL A;  2P06 A;  2CTR A;  2DAB A;  4MTO A;  4LF7 B;  4JI8 B;  3KRE A;  3CD6 V;  1IBK B;  1PD3 A;  3CEB A;  1TWG A;  2EJ7 A;  2BTQ A;  2F4V B;  2RNB A;  1CQJ B;  4DR3 B;  4EYI B;  2LFS A;  3K58 A;  5JVL A;  5CA1 A;  5D1P A;  4X20 A;  5CN0 A;  4IRK A;  5B1A C;  5L1L A;  4RUE A;  1JDE A;  1O9H A;  5H6Q A;  3HOZ G;  1HNW H;  1VQL V;  4NXM H;  4LSX A;  1I7N A;  4EGJ A;  4DIM A;  1AI6 A;  1EKP A;  3G4S V;  4YJ3 B;  4IL6 Z;  1F7Y A;  4X1Y B;  1PNL A;  5KFL A;  2QB5 A;  4QWB A;  1YZB A;  1AUX A;  3AG2 B;  4DLK A;  4MT8 A;  3AK2 A;  1DF5 A;  3SJB C;  4YP3 A;  4K0K B;  1D2D A;  5LL6 b;  1KMI Z;  4IIJ B;  5I5T A;  3SDL A;  1S0O A;  4GLX A;  2RMK B;  2E3C A;  2FLL A;  2NR5 A;  3UKM A; 
#chains in the Genus database with same CATH homology
 3ZS8 C;  2KSW A;  1I94 B;  4X66 B;  4GYC B;  4LFC B;  1E4F T;  3MAQ A;  4B08 A;  3F8N A;  1RSO A;  4JI1 B;  4I7H A;  4O4J A;  4ZHQ B;  1XMQ B;  4FM2 A;  4YHH B;  2R9A A;  5BR8 B;  1IBM H;  4I55 B;  4DR4 H;  4CS2 A;  2Q7G A;  5IYZ B;  5IWA B;  3HKD A;  1L8D A;  4FLY A;  5J2T A;  2BTQ B;  1N33 B;  4OX9 H;  4X64 H;  4LFA H;  2VQF H;  1N36 H;  5EZY A;  4GKK H;  2UXB H;  3UT5 B;  5LA6 B;  4UCV A;  3HKB B;  3WB0 A;  4O4H B;  3HKC B;  3OTO B;  3VQV A;  3E22 B;  4FLZ A;  4K8X A;  5FD5 A;  2UXD B;  4KL1 A;  2VWJ A;  4JI2 B;  1XNQ B;  4K8Z A;  2WYO A;  5ITZ B;  3N2K B;  3N44 B;  2Q0A A;  4LF9 B;  3RTX A;  2RJZ A;  4TUY A;  3BPZ A;  4B3M H;  4ETS A;  2JS5 A;  4EFB A;  2JVD A;  4X1Y A;  5KMG A;  5FNV B;  3N2G B;  2UXC H;  5LXT B;  5JVD A;  3CSX A;  4ZOL B;  1XI1 A;  4HBN A;  4O4I A;  2OYQ A;  1QQC A;  4BWA A;  4AIL C;  2YXL A;  2WDT A;  2R72 A;  4JI3 H;  3DF7 A;  4JI5 H;  1XMO H;  4UCO A;  4UCS A;  1M0T A;  1FKA H;  4DV3 H;  3JAL B;  5CA0 B;  1IBM B;  2YCH A;  3N41 B;  4R7R A;  4I50 A;  1XHZ A;  4RAY A;  2JGU A;  3KYH C;  4CH5 A;  1N32 B;  3U0Z A;  4CC5 A;  4U3J B;  3TY5 A;  3HKE A;  4DV2 B;  2Q2U A;  4DV7 H;  1B04 A;  4OX9 B;  1M0W A;  3HKD B;  3K57 A;  3T1H B;  3RYF B;  4LFA B;  2MCT A;  4B3T H;  1N34 B;  4I9Q A;  1T5E A;  1H2S B;  1WNS A;  5IJ9 B;  1IBL B;  5LP6 A;  5IYZ A;  5EZY B;  3JAT B;  1XNR H;  2HHH H;  5IT9 W;  2UU9 B;  3T1Y H;  2ZIO A;  2GV9 A;  1I7F A;  1Q3E A;  4DR7 H;  4FFB A;  5GON A;  3VQW A;  3KAL A;  4DK0 A;  1E4G T;  3UT5 A;  4CH3 A;  4FLW A;  4B3M B;  4O2B A;  5CB4 A;  5D1O A;  1S03 G;  4O4H A;  3JAK A;  3HKC A;  5JJE B;  4D7S A;  4DRX A;  3KAK A;  3E22 A;  3QG5 A;  4RB3 C;  4TUY B;  1P8L A;  3S24 A;  4LF5 B;  3ZED A;  2WE6 A;  4DR2 H;  4JV5 H;  4DV6 H;  3JSN A;  5ITZ A;  3N2K A;  3HXL A;  4TQF A;  4JI3 B;  5KMG B;  5JH7 A;  2VQE B;  5JVD B;  3BAA A;  2VUG A;  4O4I B;  4JI6 B;  2Q2T A;  4DV1 H;  2FE3 A;  3RYC A;  3K5N A;  4DV3 B;  5K1X A;  4Q0Y A;  5KHK A;  3RF2 A;  3N2G A;  4UCT A;  4ZOL A;  3K5L A;  5FPO A;  4WBN B;  3TY8 A;  1SA0 A;  4LNU B;  4I50 B;  5EIB D;  1A0I A;  3U11 A;  3RGB A;  4B3S H;  4FM1 A;  4Q6G A;  3HKE B;  4DV0 H;  3JSL A;  3JAL A;  4BWS C;  5CA0 A;  4LF8 B;  4LF6 H;  4LFB H;  3M7M X;  3PN1 A;  4B3R H;  1G6U A;  4CS4 A;  2E5L B;  4TV8 B;  2HVS A;  4JI4 H;  4DUZ B;  1O75 A;  1SEI A;  5D5P A;  1ZHQ A;  4GKJ H;  4U3J A;  3T1Y B;  4IAJ A;  5LP6 B;  4PDB A;  4DR7 B;  2RGV A;  3RYF A;  4DK1 A;  5LOV B;  4DR5 B;  1HR0 B;  4FFB B;  5GON B;  1FFX B;  5IJ9 A;  5IJ0 A;  1XDN A;  3JAT A;  1VS0 A;  2R70 A;  2UUB H;  2HGS A;  2HEP A;  2YI8 A;  1HNW B;  4DUY H;  4NXM B;  4O2B B;  3SGI A;  5CB4 B;  5D1O B;  1HNX B;  3JAK B;  2XIG A;  1JMK C;  5JCO A;  4DRX B;  1J5E H;  1KU9 A;  4RB0 A;  2V4D A;  4NXN H;  1JFF B;  2PGG A;  1WPB A;  1SKV A;  4A2B A;  4ZI7 A;  3QWU A;  1TGO A;  5JH7 B;  4X62 H;  3VNN A;  1V9P A;  2VWK A;  4JI7 H;  3RYC B;  4EQ5 A;  5D5Q A;  4CH6 A;  5FLX W;  3NBY B;  3IG0 A;  1X4T A;  2F95 B;  4DV4 H;  5FPR A;  4DRF A;  1M5I A;  4B3S B;  4LF7 H;  1MZB A;  3L4J A;  4JI8 H;  3MWM A;  3CHX A;  1M93 A;  1SA0 B;  3BRC A;  4LF6 B;  1IBK H;  4D7T A;  2XHB A;  2F4V H;  4B3R B;  4DV5 H;  3NC0 B;  4JI4 B;  4FLU A;  4MV7 A;  4WBN A;  1VF7 A;  4DR4 B;  2ZJT A;  4X65 H;  4JYA H;  4LNU A;  3BAB A;  4AQY H;  3K59 A;  4AHC A;  3KAJ A;  4X1I B;  2Q7H A;  4CH4 A;  1CKN B;  3ICX A;  4IHJ B;  1Z2N X;  2PYL A;  4X64 B;  3BA9 A;  5EYP B;  2YI9 A;  4TV8 A;  2VQF B;  5EIB C;  1I6U A;  1N36 B;  4GKK B;  4LH6 A;  5KX5 A;  2UXB B;  2P5O A;  3RFR A;  5IJ0 B;  2ZNJ A;  3M4I A;  4DR6 H;  1FJG H;  4K0K H;  1DGS A;  4FLX A;  5LOV A;  4LF4 H;  4JI0 H;  3B2E E;  3DSQ A;  1FFX A;  1TVK B;  4X1K B;  3LML A;  1HNZ H;  1L2Z A;  1ZAU A;  1XQ8 A;  4X66 H;  2PZS A;  3OTF A;  4ZI7 B;  4JI7 B;  3W1G A;  2ZNI A;  5BMV A;  2YIB A;  2BTO A;  4JI1 H;  1SYX B;  3JAW B;  2UXC B;  3CB2 A;  4YHH H;  1JFF A;  3IAY A;  5BR8 H;  3K5M A;  3RYH A;  4M7E A;  3THO A;  3J80 W;  2ZIM A;  1NT2 B;  1Z2O X;  3N43 B;  4JI5 B;  1Z5V A;  5J2U A;  1XMO B;  4DV5 B;  1QHT A;  4LMY A;  4F6R A;  4EFE A;  4A2A A;  2RGR A;  1N33 H;  1GYF A;  3H20 A;  4MTD A;  2CFM A;  3NBZ B;  4YJ2 A;  4RB1 A;  4FLT A;  5JQG A;  1WH2 A;  4FM0 A;  3BHP A;  4DV7 B;  3OTO H;  3VQX A;  5LP6 C;  4PHZ A;  4B3T B;  2F66 C;  4CC6 A;  5LYJ B;  2OWO A;  2UUC H;  2VOB A;  1XNQ H;  4O4L B;  4EB6 A;  3JAM W;  3ETQ A;  3SJA C;  4LF9 H;  2KKW A;  4L8J A;  5KX5 B;  1XNR B;  4X1I A;  2HHH B;  5LMU H;  1CKN A;  2Q7E A;  4E6N A;  4IHJ A;  4JI0 B;  1M4U A;  3BA8 A;  3K5O A;  5DIS C;  1P16 A;  4UCR A;  4YY3 H;  5EYP A;  4KHP H;  1TUB A;  3JAR A;  1JJO A;  3RYI A;  3U10 A;  1X9N A;  1S5J A;  1HNZ B;  4PI0 A;  2HIX A;  4I4T B;  2F1M A;  5K1P A;  2PYJ A;  3TY9 A;  2ZM6 H;  1TA8 A;  4DR2 B;  4JV5 B;  1S68 A;  4DV6 B;  2VPS A;  1TVK A;  5BMV B;  2F93 B;  4X1K A;  4PZ7 A;  2O03 A;  2YIA A;  1N32 H;  2UUA H;  4PZ8 A;  3K3V A;  3RYH B;  4DV1 B;  5EOY A;  4DV2 H;  3RJ0 A;  5LMN H;  3KXY T;  5J2U B;  3T1H H;  2PUS A;  3C0F B;  3JAW A;  1N34 H;  4F6R B;  3J7A K;  5CA1 B;  4X20 B;  5KHG A;  4HNA A;  3W1B A;  2PY5 A;  1IBL H;  3WB2 A;  4MTE A;  3W5O A;  5JJJ B;  4EEQ A;  4LR3 A;  4YJ2 B;  2UU9 H;  5JQG B;  4DV0 B;  1O9G A;  2UUC B;  5C8Y A;  4LFB B;  3GB8 B;  1TAE A;  2CW7 A;  1CKO A;  4FVM A;  1WN7 A;  4DR3 H;  2EX3 A;  1HW7 A;  5LMU B;  4NVP A;  4GKJ B;  3RWR D;  4EB6 B;  5JJN B;  2P22 C;  2HIV A;  1Q5O A;  2YIB D;  4YY3 B;  4YJ3 A;  5LYJ A;  4KHP B;  2ZCE A;  3JAS A;  4O2A B;  4LSA A;  4LF5 H;  4O4L A;  4LH7 A;  5JCO C;  4FLV A;  1TUB B;  3JAR B;  1BGW A;  3RYI B;  4TV9 A;  2PTM A;  2UUB B;  2VQE H;  2ZM6 B;  4IIJ A;  1YEW A;  4DUY B;  3FMA A;  4MV9 A;  4PZ6 A;  4DR1 H;  4JI6 H;  1CKM A;  2HVQ A;  5KHJ A;  5KHI A;  5FD6 A;  4CS3 A;  1ZHS A;  3N42 B;  3VQY A;  1J5E B;  3J81 W;  2ZIN A;  3L2P A;  2CW8 A;  4J0M A;  1XK5 A;  4O4J B;  1SQF A;  2RQ6 A;  2W57 A;  1Q43 A;  5A2Q W;  3RIZ A;  4NXN B;  3N40 P;  2UUA B;  4I4T A;  4ZIB A;  1D5A A;  3SJC C;  2QM4 A;  2IM9 A;  3RGX A;  3A2F A;  5LMN B;  1I94 H;  4X62 B;  1XHX A;  4ZHQ A;  3CVZ A;  4LFC H;  5KHH A;  4FM9 A;  5J2T B;  4LF8 H;  4I55 A;  4RZQ A;  4APM A;  2E5L H;  3EYY A;  1XMQ H;  4DV4 B;  4DUZ H;  3RR5 A;  4LF7 B;  3N6X A;  3QF7 A;  4JI8 B;  4HNA B;  1IBK B;  5IWA H;  2BTQ A;  2F4V B;  1Q8I A;  4RB2 C;  1Z5W A;  4DR3 B;  1Z2P X;  4DR5 H;  3K58 A;  1BJT A;  4UCU A;  1HR0 H;  5CA1 A;  5D1P A;  2QJ1 A;  4X20 A;  5LA6 A;  5C8Y B;  4X65 B;  3HKB A;  4JYA B;  3GDE A;  4TQD A;  4RAZ A;  1SQG A;  4AQY B;  1O9H A;  1HNW H;  3FFQ A;  1AN7 A;  2CAZ C;  4NXM H;  4LSX A;  1HNX H;  3SR2 C;  3LNN A;  4PI2 A;  4YJ3 B;  3RGZ A;  3JAS B;  4X1Y B;  2UXD H;  1P49 A;  3WB1 A;  3GJX B;  4JI2 H;  4DR1 B;  1FVI A;  3SJB C;  4DR6 B;  1FJG B;  4K0K B;  4TV9 B;  5LL6 b;  1KMI Z;  4IIJ B;  4O2A A;  3UQ8 A;  4GLX A;  5FNV A;  4LF4 B;  4BW9 A;  2E3C A;  4TOI A;  5LXT A;  3QTC A;  4UFZ A;  3L4K A;  2HVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...