3BABA

Structural basis for the inhibition of bacterial nad+ dependent dna ligase
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
312
structure length
312
Chain Sequence
LTLTAATTRAQELRKQLNQYSHEYYVKDQPSVEDYVYDRLYKELVDIETEFPDLITPDSPTQRVGGKVLSGFEKAPHDIPMYSLNDGFSKEDIFAFDERVRKAIGKPVAYCCELKIDGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTVADFGPMKAKTQFEALEELSAIGFRTNPERQLCQSIDEVWAYIEEYHEKRSTLPYEIDGIVIKVNEFALQDELGFTVKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA ligase
publication title Structural Basis for the Inhibition of Bacterial NAD+ Dependent DNA Ligase
rcsb
source organism Enterococcus faecalis
molecule tags Ligase
total genus 99
structure length 312
sequence length 312
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3babA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 3babA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3babA02
5BR8B 1HNXB 2E5LB 4X64B 4JI8B 2UU9B 3KYHC 4UCRA 4KHPB 3GDEA 4DV6B 5FPOA 2UXCB 4LH6A 3JSNA 2OWOA 4PZ7A 2VUGA 4B3TB 1IBKB 4UCUA 4UCOA 1I94B 4DV0B 4CC5A 4JI0B 5LMNB 1CKNB 2HHHB 1XNQB 1VS0A 4UCTA 5D1OB 5LMUB 2HVSA 3UQ8A 3TY8A 4X62B 2HIVA 3S24A 4DR6B 3T1YB 4NXNB 1HNZB 3TY5A 3NC0B 4TOIA 1CKMA 1HNWB 1S68A 4YHHB 3W5OA 4JI1B 3QWUA 3BA9A 4JI6B 4DR4B 3TY9A 4YY3B 2UUAB 3W1GA 3VNNA 2VQFB 4GKKB 4LFBB 1N33B 3NBYB 1XDNA 3JSLA 4LFCB 4DR7B 3GB8B 2ZM6B 4JI2B 4NXMB 5D1PA 4DR1B 1IBMB 4B3RB 4DV4B 4JYAB 1IBLB 3BABA 4JI4B 1XNRB 4CC6A 4LF5B 3RTXA 1XMOB 3NBZB 3BA8A 4DV2B 3W1BA 4EFEA 4PZ8A 1CKNA 1N34B 4JI3B 3OTOB 4GLXA 4LF6B 4LF7B 4OX9B 1N32B 1DGSA 3SGIA 2F4VB 2UXDB 4EEQA 2VQEB 1P8LA 3T1HB 4DR5B 1B04A 2UUBB 4DUYB 4DR2B 4JI5B 1CKOA 4E6NA 4DV7B 4DRFA 4EFBA 3L2PA 1ZAUA 2HVQA 2Q2UA 2UXBB 1X9NA 4AQYB 1XMQB 4X65B 4DUZB 2Q2TA 1V9PA 4UCSA 4LF9B 1J5EB 4PZ6A 4LH7A 4B3SB 1XK5A 1N36B 4EQ5A 4B3MB 3RR5A 5FPRA 4K0KB 5DISC 2HVRA 1TAEA 4DV5B 4LFAB 5D1OA 4UFZA 4JI7B 2CFMA 5IWAB 4DV1B 1FVIA 4DV3B 4DR3B 4JV5B 1FJGB 1A0IA 4UCVA 4GKJB 4LF8B 2HIXA 1HR0B 3BAAA 3GJXB 1TA8A 2UUCB 4LF4B 1P16A 4X66B 3PN1A
chains in the Genus database with same CATH superfamily
5JJNB 4BY1G 3JASA 2DN9A 1RM1B 1A9XA 3M9OB 5DECA 3AG3C 2DLNA 4UCRA 5KFVA 1HR0O 4FBUA 5BPHA 1JFFB 4B3MH 2DW4A 1SZTA 3RYCA 3ABMC 5EYPB 1K1SA 3AK1A 3Q4HB 1P4RA 4D6TH 4DV5H 2AGQA 1S0NA 2HGWA 3P3NA 4MTDA 4PDLA 4ZKIA 5DQGA 1PL0A 3DC5A 4O3NA 2JRIA 4FLVA 5LOVB 1MZBA 2YS6A 4A3CG 4WBNB 3WWJA 5A9GA 2W9CB 3T5KA 4NXNB 4LCUC 2EILC 3ZMUA 4LP8A 3L70H 4IHJF 3HKDA 3V6HA 1J95A 1YF2A 1Q90D 2IU0A 3H0GA 3G6EV 5FLMG 3SDLA 1M56C 2CTRA 3N27A 5LP6F 4LFBB 1PX2A 2QWQB 2ASLA 3R5FA 1SETA 4XDKA 1Y6XA 3GTQA 1K7DA 2HHHH 1ZLZA 1S0OA 1HDJA 4ZI7B 2ZT9B 2VWKA 3SYPA 3KHRA 2FLPA 3ZN1A 2R84A 3EPGA 1IBMB 1IURA 2QWOB 4ZHQB 1K4DC 3C3TA 4CH4A 4IIJB 1S5JA 1Y76A 2VPSA 1I7LA 5C93A 4O7RA 3NR7A 3CSWA 5GW7A 4MTFA 3N2GA 5D5QA 4IR1A 3K5HA 3RWRD 3R23A 4DL3A 4UXNA 2RDCA 1M9NA 2LFRA 3CRMA 2XD4A 1SQFA 3R66A 5KA5A 5KFNA 2LJ2A 5LYJA 4DUYB 5E79Z 3BVOA 1KEEA 1OZ0A 2PN1A 2LW1A 2IM9A 4YJ3B 4I50F 1HNZH 5CBFA 2EIYA 5CA1A 3K0DA 4GUNA 2UUBO 4O4IA 4Q4CA 4H44B 5KFHA 1L2ZA 5L3DA 5LL6Y 4Q8FA 2RMKB 5EZYB 1GN4A 1N48A 2C2DA 2CNUA 2FB9A 3RYFA 1K97A 1P49A 4GC7A 3RB6A 3T1HH 3CX5F 1M93A 5EDWA 1XMOO 1FPOA 2ZJTA 5KFWA 5IJ9B 2FKXA 2WLLA 1JOYA 2RCVA 1K3EA 1CPYA 2WLHA 2E5LB 2V58A 5BR8B 4X64B 4F4LA 5IY5C 1IDSA 4JAAA 1N36H 3K5NA 4H13B 3ABKB 2RDIA 4LH6A 4LF4O 2FPGB 2VUGA 2O57A 1Y1VG 5EBLC 1NH2B 3LSUA 5JH7F 3CQZA 2MW2B 1WB8A 4LWSA 4DV0B 1HNXO 2I80A 4FVMA 2J6SA 4MTOA 4O3SA 3N8DA 4KHPO 1AILA 5LA6F 2W8LA 4IHJB 1B33N 3TY8A 4QIWF 3QG5A 2AU0A 3EFFK 1FS0G 2W9BA 2QB5A 1SQVH 5LP6B 5C3EG 3F5TA 4MV3A 3UYYA 4JI1B 4EYIB 3B40A 3E83A 1KP3A 4GLWA 4MT8A 2ZXWB 1IZ3A 1K73W 5DQHA 2XAQA 4XYLB 3JYCA 2OTJV 1CQJB 1I1MA 4JAVA 5LGNA 2CTQA 4UB8Z 2LGWA 1G4YB 3ASNC 5KFBA 2JA7A 1VEWA 5FLXW 4PI0A 2V5AA 1W93A 1K1QA 2Y0PA 1W2BU 3G6XA 5LMUH 3GB8B 5DG9A 4MVRA 3ZMVA 4CKEA 4X62H 3E35A 4O7YA 4WD3A 4DR1B 3RJ0A 4K6NA 2EILB 4LFCO 4MV6A 4MV4A 3K9AA 4QE9A 3DF7A 4J9YB 4JI8H 4QIWE 3GTLA 1N34B 4JI3B 4ASUG 3U11A 1M56B 4PA3A 2W6MA 2YC0A 3WO0A 5BWUA 1Y4MA 3WNZA 4I50B 4JI6O 1VQ7V 1NVPB 1CP9A 1CE8A 1VQ8V 3ETHA 2DPIA 4R50A 5KFQA 1VF6A 5K1PA 5KHIA 5BZBA 3OUFA 4HR7A 2RJZA 1O75A 5JUMA 1RJRA 1AVMA 3CHXA 2BQ3A 1IVSA 4J42A 4Q0YA 2CW8A 3G8DA 2GQRA 3ZCCA 3MWDA 4LFAB 2PBZA 4FLWA 4BAYA 4AYBA 2W6PA 2R72A 4MAMA 1FJGB 4NZMA 1PNKA 4B3MO 1VQ9V 2QTOA 1THZA 3SPHA 5CA0F 1T3NA 4DV5O 4O7VA 1XL6A 1M0TA 5CB4F 4UV8A 4FFBA 4HNVA 2EIKB 2YU9A 1Q43A 4G2KA 3AG1C 4F6EA 1BMFG 5JH7B 4OGQB 2YZNA 3B77A 3BFRA 3VQVA 3B2EE 1JIHA 3HB3B 2HG5C 5LA6B 2BTQA 3ORRA 4A3EG 5IE9A 3RYHB 2DE0X 4FFPA 5D1OB 3GIDA 4HBNA 2DZDA 2XCPA 3GV5B 4DL4A 3G4SV 2JEGA 4CKCA 3DAAA 3VOUA 2EJ2A 5L3BA 1JDEA 3VOTA 5IDJA 3B8NA 2HLDG 5J2UF 3TY5A 1OJHA 4TOIA 2HHHO 1N4CA 1SS3A 1JX4A 5KFDA 3MR6A 1AROP 4LF9H 4MVMA 3TGUH 3K0GA 4R8UB 4FFKA 3PW2A 3PVXA 1GO3E 3RN4A 1SQXH 1LNQA 1YHQV 1P7BA 3MDSA 2CNVA 3VPCA 2PYLA 4HQ6A 1JKJB 2HGXA 2WE6A 4FFMA 2Q0AA 3E8HA 2KSDA 3SE7A 3IAYA 4FM1A 2F66C 3H9VA 1JLLB 4NXMB 5D1PA 3T1YH 2KQXA 5B3SB 4O4HA 2B5UA 1WH2A 5EIBD 3EYYA 2PF4E 1OCOB 3ABLB 3STZC 1HNWH 1H2NA 3P3PA 3MHSC 5KFPA 1XMOB 1V55C 4EFEA 4C7UA 2QKAA 2COJA 2R93A 4TVIA 4DV6H 4U6PA 4O7NA 2R7LA 4QWEA 1HNZO 2XAGA 3BY6A 3L74H 2P0AA 4U7OA 2QK4A 4JZGA 5IT9N 3ASNB 1EUCB 2ZINA 5KX5A 5HV6A 4KL1A 2HKOA 3MFIA 3LULA 2BSKB 4B3RH 1ZHQA 4H33A 2P90A 4BBSG 5JJEB 3BACA 2Z5UA 3WWIA 2EIJB 1WLEA 3K5OA 5I60A 2F23A 1QLNA 5CA0B 3M4IA 4LF7H 2F1MA 4CH3A 5CB4B 1NJIW 3KHGA 4FJCC 3H01A 4NZOA 3FYEB 1V54C 2H3OA 2D2CB 2M05A 2DWDC 5L3CA 1FFTB 3P30A 3TXQA 5LGTA 3KKYA 3TQ1A 4RB2C 4PBCA 3CD6V 4DL6A 2R8IA 4J9NA 1KJ8A 4LNUA 1BT8A 5JJJB 4PA9A 4X66B 3PW5A 5JCOC 1J5EH 4R8CA 5I5UA 3RYIA 2Y0SE 2M6YA 4DRXA 1GKFA 1QR9A 2R92G 1HWYA 3JSNA 2JA6A 4OXSA 4AQYO 1TWHA 5KFLA 4BIZA 2R7KA 4WFHA 5IWAH 5J2UB 5B66Z 1QLEC 2HEPA 1EYZA 3SPIA 4UCTA 5DAAA 2FYUH 3LNNA 1VQKV 3RV4A 5KUKA 2QDOA 3FFQA 3CCVV 4CS2A 3BQ2A 1SZXA 2XTAA 2FJZA 4JI6B 3ASOC 3M9MB 3N6XA 3T2MA 1B6SA 3I56V 4E4TA 2ADQB 3VPBA 4QPJA 1EN4A 1I94H 2Q4PA 4JI0H 2Q9LA 4JI8O 3CCQV 2ASJA 2UVVA 3CMAV 3GQCA 2W71A 4PDMA 1RPOA 3G6VA 2Q67A 3VPDA 4DQNA 3SJQC 3HOUG 3BEHA 3U55A 3CVZA 4TV8F 1OCRB 2F93B 1IBLB 3OGIB 1EZ1A 1IXMA 4DW1A 1R3JC 3RTXA 4A3BG 1DF4A 2GUZB 2Y0IA 3BA8A 3MHHC 5IJ0A 4RB3C 4YY3H 5KT4A 3OW2U 4TV9F 4AILC 2N04A 4GKKH 1AUVA 1WN7A 1NVPD 4YHHO 4EB6B 3W7WA 2ZQMA 2YWVA 3CB2A 4DR7H 4O86A 2QYZA 3A0RA 1YITV 3JZFA 3KALA 4HNAB 4JI2H 2HVQA 2QEXV 4I0XB 2VUMG 1N33O 2IBZH 3SYQA 1TGOA 2IH3C 4IYHA 2WPDG 2R9AA 2JEIA 1DIKA 4UVBA 4PZ6A 2DPJA 1X59A 3MFHA 5I47A 4DV2H 1SA0B 4N23A 2QR4A 3KHHA 4Z2WA 1ZTEA 5JQGA 2ZIMA 5IYBO 4NYEA 1XOUA 3OTOH 5KAIZ 3BQ0A 3LMLA 4LF6H 2HG8A 3HOYG 4MW8A 1N32H 2MCTA 3JARA 2UXDH 2BCCH 2Q5ZA 2R70A 3TIGA 1RK6A 4GKJB 2EINC 2NU9B 1F23A 1XHXA 4X1KA 3BAAA 5DMXA 4IRKA 1XUQA 4G27B 4DUZH 2YZLA 4TWKA 3UZBA 4TQFA 4KP4A 4A3FG 1FFXA 3KXYT 2ASDA 4ZBMA 1OHHG 3GDEA 2CNQA 2QA4V 4FE2A 3JATB 2NVXA 5BMVA 3VMMA 3HKEA 1V4YA 4JYCA 2AXTZ 1FD9A 1GLVA 3QZ8A 4RB1A 3HBLA 4LF9O 1ZL8B 2JGUA 3CWBH 2EX3A 3RAQA 4JAUA 1V54B 3DTGA 4JI5H 1KUTA 5L3EA 4Q44A 2FMLA 1JDBB 2ZR2A 2WLJA 2PVPA 2GPWA 4J41A 1HNZB 3EVKA 2H8PC 2RF4A 4DV1H 3GILA 2YXHA 4PWQA 3SNOA 2FK3A 4R6ZA 1AR4A 4IR9A 4X1YA 3TY9A 3GTOA 2AHYA 4J9MA 2Q7EA 2AZ2A 1YTFD 2UXCH 4QPKA 3OR6C 4B3TH 3U9SA 5KT5A 2OT5A 1HNWO 3H20A 1WSCA 1IYDA 2BTOA 1I7NA 2YI8A 4FS2A 2YUAA 4ED8A 4TV8B 2BOBC 5DGIA 1R6TA 4DV6O 5IYDO 1YI2V 3QTCA 1FXKA 5KAFZ 4RAYA 1TWGA 4J9LA 4RUCA 4YP3A 2V4DA 5K2MA 1F7YA 4TV9B 3OMIB 2ITDC 1PK8A 2WLIB 5L3GA 3AYHB 5EIBC 1JCHA 3ZRSA 3I4MG 5KUMA 1VQNV 5C1PA 4TQRA 1XILA 1ZWIC 3HKDB 4DR6O 3KZIZ 3MJFA 1IOWA 2YICA 5KS8A 2VQEB 5L1IA 1JR9A 3K5MA 4DR4O 1VP7A 1DK1A 3ML0A 4DV7B 2DWEC 5I5YA 3L72H 2HHFA 4LF7O 4O4JA 2CAZC 3ZJZA 4AQYB 1VF6C 3DSQA 4MTGA 4FPPA 4O2BA 3FYIB 4EBCA 4CKBA 1DV2A 3KREA 4LH7A 1Q6UA 4YB8B 3L75H 5FL7G 3A8TA 4WFGA 3WFVA 3OUSA 1NU1H 2Y69C 3N2GB 1KD1W 2Z04A 3L9DA 5H6RA 4DV3B 1J5EO 4RCNA 4BBRG 3IC9A 2AGPA 1UPGA 2NU7B 3CMEV 4H0LB 4HZ3A 2W6OA 1A0IA 4A3JG 2QJ1A 4LF8B 2R87A 4RZQA 4APMA 2IH1C 2OTLV 4UVCA 5FR9A 4E4EA 2UUCB 3FB7C 3OHAA 4F6RA 5IWAO 3JAWB 3W7SA 3OR7C 5DQIA 3SI8A 4JI8B 4GX2A 3VA7A 4I5SA 3AG7A 2Q7HA 2OWOA 3NGDA 4K0KH 1WA8A 4RNOA 2J9GA 4UCOA 1Y1VA 5B1AC 1U96A 1JJOA 1S76D 3A2FA 1MA1A 4ZOLA 1I3QA 3RYFB 1Q3EA 2EULA 5KMGA 4QNHB 2XGQA 4MTEA 2EJRA 4HN2A 1I94O 3ZEDA 5BWRA 1I2KA 2FL4A 2DYSC 2W0XA 4JI0O 3BQ1A 2K9PA 1RFYA 4YHHB 2WLLB 1S68A 1SQQH 2ITCC 3F7YC 1VQ5V 2WB1A 2UU9H 3T5JA 1TUBA 3PO2G 2GTSA 2YS7A 2C35B 2R8JA 3N2KA 2JVDA 2PI4A 3W1GA 2FK1A 3BG5A 2V1DA 2W6IG 1N33B 5KFKA 3K3WA 1E4EB 1VQMV 2PUSA 1IX9A 4CZZA 3PW7A 4YY3O 2EJ0A 2QKCA 4LWSB 2QM7A 5KFCA 2EJ7A 4KXRA 5K1XA 4WFAV 4GKKO 2ZKOA 2LFSA 3PW0A 2IMWP 4JYAB 1MZEA 4DR7O 3T4ZA 2VOBA 3VQYA 3PW4A 1I50A 3CJHA 4JV2A 1ZSPA 2CDYA 1KJIA 4JI2O 5BWXA 3IFXA 1M1KW 2UUAH 2LW7A 1PP9H 4I9QA 2VQFH 4OX9B 2VA3A 5LMNH 5KT7A 2W6JG 1QVGU 4ECQA 3HOZG 4EFBA 3OTOO 3ABTA 2ZM6H 4LF6O 3M99B 2WA4A 3ZRXA 2EIMC 1N32O 1XMQB 2UXDO 3HXLA 4JI4H 3UO2A 1XNRH 4JTDB 4LF9B 2A7WA 4HAMA 3T1CA 3ZHQA 5J9PC 1I6UA 1AR5A 5FPRA 2VR1A 2XIGA 4DUZO 1H2LA 4BIUA 4WCEV 3GTJA 4JI7B 2AW9A 2COGA 2F4VH 4O2AF 4J9SA 5C8YA 3N44B 1K5SA 1T5EA 3HT5A 2E75B 3PZPA 4A3IG 1AI6A 3JAKB 1TWAA 5FLXN 5BY1A 4ED7A 4RNMA 1BQZA 1BZKA 1H2SB 1MSWD 2JIZG 3AW8A 5I5TA 4NTYA 3MR5A 3SYOA 2ZDIA 4WHXA 1WAZA 2XAJA 2UVRA 3UT5B 4JI5O 4I7ZB 4B3SH 4DO2A 4DV6B 2QGNA 1MOFA 4IGGA 2EJ3A 2GDSA 4FFLA 3OD4A 1IBKB 4DV1O 3WB0A 1BHAA 2Y69B 2VPQA 2R85A 5KFSA 2E3CA 5JVLA 2FK2A 4ME6A 2UXCO 1OCCC 4B3TO 3BRCA 1M90W 4DR6B 1OWTA 5EWFA 5IYZA 4I4TA 3SPGA 3HKCA 1XL4A 4TQDA 5FNVA 3OSNA 1VBHA 3W5OA 4FFNA 3Q8PB 3WG7B 3BA9A 4RUFA 1WJZA 1PM9A 4DR4B 3GWKC 1T36A 1WP8A 4NVPA 4TM5A 3JALB 1KJ9A 1RP3B 2JJ2G 1G8MA 3OE7G 3L4JA 2YYAA 1P7GA 3FDSA 2BTQB 5CM0A 3ZX6A 3TW7A 4Q45A 2ABJA 3F7VC 2I87A 3WB2A 1JA8A 1XDCA 4DV4B 1JFFA 1KP2A 2G38A 5B5EZ 5DGAA 1XNQO 5EYPA 4LF5B 2C2EA 1GAXA 3DGEA 3JD3A 3AG3B 2GLTA 4XX0B 3GIJA 3GIKA 4BY7G 4LBEC 5LOVA 2GHYA 3ABMB 1BCCH 3KTMA 1QVFU 4WBNA 1X4TA 4MV8A 2OIGA 1VIBA 3EXAA 4FM2A 2NU6B 5JVDF 2R86A 4GT1A 1SRYA 5KG7A 3O65A 1GTOA 4X65B 1MSDA 3HKZA 4PELA 3KAKA 4UB6Z 4O2AB 2Z3YA 4F4WA 2IBKA 2YDEA 1LR1A 1CXZB 4YIPA 3CP1A 4ZI7A 5H2FZ 4MV1A 4XBFA 4QWAA 4DR3B 4J0MA 3HR0A 4DR5H 4W4LA 4ZHQA 3TJTA 4IIJA 2NUAB 1AB3A 4K0KO 2XGPA 2HIXA 3A0BZ 3HOWG 4MS2A 1XHZA 1HR0B 1SCUB 2X0LA 3JCZA 4KFMA 1G2WA 1WR2A 3IGAC 3CCJV 3PN1A 3X2QC 2JDIG 1K92A 3ZMSA 3W7TA 3H0GG 1EBOA 3L73H 1VQ6V 4DR2O 4DYLA 1RJPA 2YIDA 1KMIZ 1OCZC 2B63G 3H1LH 1TUEB 1WPXA 4LMYA 4F50A 2MK3A 1BHBA 1GM9A 1SFOA 4CHIA 4P2ZA 2UXBO 2OCHA 2PGGA 5KG4A 1YZBA 3S3XA 1UC9A 1Q7YW 3K08A 1NT2B 3R5HA 3RT3C 2C2AA 5EC2C 1MG1A 2JK5C 4W4KA 1D2DA 2HVSA 4EBDA 4GX5A 3CRRA 1XEQA 3WU2Z 5BWVA 5HNEA 3LDDA 2CUGA 2R9RB 5KG6A 1GO3F 4PA7A 1VARA 2AZ0A 3HB9A 2QWPB 3GIPA 3MWEA 3FMAA 1M57C 4LNUB 1TVKA 1N8RW 5J2TA 5B1BC 4Z1MG 5F9NA 3R5XA 2HGSA 1P84F 3RYIB 4RWUA 2GBOA 5H80A 3GTGA 3WB1A 1QR8A 4QE7A 3LNMB 1Q86W 4NTXA 1L0LH 1BXRA 4JV5H 4ECRA 2VQFO 1Q6IA 1OCCB 3K79A 3G67A 5I5VA 3RGXA 3OMNB 4Q6GA 2ZNJA 4EG0A 4NXNH 3FAVA 4O7SA 2FPIB 3R9RA 1SYXB 1Y14B 3T9FA 1FXKC 4GZRB 5LMNO 2FLNA 2RGRA 3CXCU 2ZM6O 3P32A 5IY5B 3N40P 1S97A 2X6BA 1KTAA 4LFBH 5JVDB 1Z2GA 1XNRO 3V4ZA 3RBDA 4IHJA 3ZRVA 4PDVA 1WRVA 2HDKA 4BWSC 3CC7V 1NTKH 1YTFB 3HOXG 2Z02A 4JGSA 5KFUA 2UUBB 4JI5B 1CKOA 3FX7A 4MA5A 3F5WC 5LP6A 4J10A 5KHJA 5KG2A 1S10A 4TSFG 3C90A 1IBMH 3TXSA 4D7TA 2YI9A 1A3GA 5KFOA 1QQCA 4X20B 3TINA 4RAZA 4N21A 2Y4UA 1L0NH 1YJNV 1Y1WG 5LHIA 2P4VA 3LDEA 3RR5A 1KQSU 1US6A 2W8KA 3V6JA 4XDLA 2VS0A 4B3SO 2R7MA 2CQYA 4DUYH 2JA5G 2LO1A 2ZIOA 4NZNA 3NUAA 1BL8A 1IOVA 3MR3A 4DL7A 4LF4B 2JGDB 2CH7B 1HNXB 4J9RA 3K9SA 2RQ6A 3T1HO 3PR5B 1R6NA 4AI8A 2KG7B 2YZGA 4KHPB 2UVUA 2GPSA 1H2KA 1SQGA 2VA2A 4I50A 2QF7A 1YIJV 4UCUA 2JA7G 3D8CA 4O4JF 4CS3A 4CBCA 3G8CA 1EKFA 1EZJA 1XNQB 2NN4A 5L1LA 5KG5A 1N36O 3OM3B 4EKWA 1O9GA 3JARB 3VBBA 3G6YA 3KHLA 3NC0B 3O9OA 1CKMA 3ZS8C 4CE5A 5BR8H 2CK3G 1OBDA 4J80A 4X64H 4HYKA 1S5HC 5KFMA 4A3DG 4WF9V 4ICGA 5F2VO 1EUDB 4O4LF 5KFYA 1OCZB 4A3MG 1Q6HA 1VQ4V 3BPZA 3GTMA 3CCRV 2QWNB 4JASA 1W96A 2FP4B 4X8AA 3NBYB 3C3SA 5HFLA 1H2GA 3S3WA 3I55V 4LSXA 4DV0H 3GTPA 1HP8A 4LFCB 3CYOA 3T7AA 2V4QA 3L4KA 1A0GA 2Q8VA 1EZVH 3FKIG 3MWMA 5JH7A 1LUVA 1PL4A 2BOCC 5IYCG 4P9PA 4JPRA 5JQWA 1JPXA 4RNNA 3BABA 2XT9A 1SEIA 2A06H 2A9HA 3ETJA 5CR5A 2YCHA 1RK5A 3H1HH 1BGWA 1G6UA 3E2EA 4JI1H 1NR7A 5LMUO 3AG1B 3CCEV 4G3IA 3NBZB 2R7ZG 4ZOLF 3B8MA 5B1BB 2IJHA 4X62O 1VKZA 2GV9A 4QW9A 1K33A 2VQDA 1QBZA 3TCUA 3T9AA 3CSXA 3TETA 1M6VA 3UZOA 4FGRA 2YIBA 2XHBA 1TWFA 3E8BA 2V7QG 1DV1A 2UXNA 3AG4C 1M7JA 2XCAA 2AGOA 4DR2B 4LR3A 5KFZA 1Y66A 2PZSA 2DAAA 2L6LA 1GN6A 4DR1H 5H5NA 2UXBB 4QJFB 4H37A 2OCCC 4R8UA 3RGBA 4Q43A 4FU0A 3G6BA 4BIOA 1FXKB 4FZ1A 4DR5O 3G80A 5HBRB 4GCZA 4D7SA 5BYBA 2CZGA 3I5DA 2F43G 1DLBA 5KG1A 4B3MB 5CAEB 2VWJA 1N34H 4JI3H 5IT9W 1TAEA 4ECZA 4DV5B 4I9WA 2N05A 1UNNC 1D5NA 1O9HA 2RN9A 1T94A 2ODTX 2CW7A 2ZE7A 3B09A 1Y74B 5D8DA 1KECA 3RB0A 3T5LA 2R8KA 3APOA 2FPPB 5IP7G 3WWHA 4I55A 3GJXB 4J7ZA 1E1RG 4A5UB 1SC5B 1AI5A 2C2RA 2YZMA 1PPJH 2AGAA 3G71V 1NTMH 2Y48A 5KKNB 1R9TA 4O4JB 1G1XB 2WB1E 3KYHC 2ZDIC 3BJYA 3KCYA 1V55B 2CE4A 3J80N 2FE3A 2IW5A 3FB8C 5ITZB 4A3LG 2ZGIA 4LFAH 2JS5A 3ZHTA 5KFTA 4J9OA 3AK3A 5LMNB 1CKNB 2HHHB 3OUUA 1VS0A 2BSKA 1NKDA 1FJGH 3IG0A 5EC1C 3CXHF 4O4LB 3PJSK 3EHBB 1ORQC 4A2AA 4JV5O 4F6RB 5C8YF 1YDXA 2FLLA 2R93G 3LSSA 1L1FA 5JWPA 3SYCA 5LYJF 2DWCA 2E74B 3ETEA 4DK1A 4A3GG 4NXNO 4ED2A 1Q8IA 1R3KC 2ZDQA 1QNMA 3QF7A 3ZRWB 4PA4A 2COIA 4X88A 2YW2A 5CA1F 2X0SA 5E1AC 4O4IF 3DXRB 1MMMA 3PR4A 3LQSA 1JQ0A 4ZOLB 5KFAA 2L35A 2XAFA 2F95B 2QE7G 4U3JA 4PZ8A 5E25A 5J2UA 2IJJA 1IBMO 5HFMA 3T1YO 3ETDA 3JASB 5H6QA 5I5XA 2HJWA 3Q8QB 5IYZF 3PFFA 3N2KB 5LXTA 3GV8B 3J81N 2ZE6A 3T1HB 3RYCB 3V6KA 1B04A 3RVYA 5F9LA 3N41B 1L8DA 4O3QA 1QLEB 3L2PA 3SJCC 3FB6C 3J7AU 4XDJA 4NXMH 4M7EA 5H9CA 3U0ZA 2A79B 4MVZA 4DUYO 4TUYA 1NBMG 2X6AA 1XMOH 1N36B 3ZMZA 1M5IA 3ASOB 5KFXA 5BWWA 1S5LZ 2HP8A 3E22A 1W0JG 4B3RO 3LWBA 2CFMA 5A2QW 1OV9A 4RZRA 4ABMA 2ZE8A 4TT3G 3AG4B 4DL5A 2HFEC 4MVSA 2QKSA 3QVNA 4O81A 1WP7A 2IJKA 3CCUV 4FM0A 3UCSC 4YBZB 2OCCB 5K3WA 1GSOA 3CPWU 1RSOA 4K8ZA 2OH2A 1Y76B 2QM4A 3AEIA 2A0LA 2WAQA 4PZ7A 4G28B 4CH6A 3LSQA 2W6QA 5BR8O 2DYRC 3RAXA 4HNAA 4X64O 1KU9A 1F4MA 4FLYA 4I0XA 5LMUB 2J6UA 4IAJA 5EBMC 1N0JA 3SPCA 4YR3A 2V4RA 5C8YB 4X62B 2HIVA 5EBWC 5LYJB 4YJ2A 4JXUA 5LL6b 5L3FA 4ZQIA 4X66H 1I08A 1GSAA 4Q8EA 3CEBA 1KUQA 2BE3A 5KT2A 4RO2A 4IWXA 3N42B 3E8GA 1RYRA 1DAAA 5CA1B 1WB7A 1Z2NX 4F4YA 4O4IB 5L1KA 2NVYA 3Q1KA 4QSHA 4QWDA 2YEVA 1PNLA 2XOKG 3STLC 2B9ZA 2HJDA 4ECXA 4X1IA 3M8AA 3OEEG 2BQUA 3HKBA 2EINB 2JEFA 2WAMA 1AJNA 5DG8A 5KFFA 3ORQA 2X7RB 4O7ZA 2WTFA 5IYZB 3HKZE 4JI6H 2YL2A 3ABKC 2GQSA 3JRWA 1VMGA 4CH5A 4DR1O 4GX0A 1ZL8A 1Z5VA 4NR1A 1PD3A 1SERA 1XREA 1DGSA 3UO3A 5LGUA 1I5XA 4FFOA 4EGJA 2GSMB 1BNCA 3RV3A 2O03A 1KKCA 5J2TF 1N34O 4JI3O 4ECSA 3VQXA 2P6JA 2JEUA 4O82A 1UC8A 5LP6C 4BR6A 3OGCC 2W7OA 1BE3H 4X9QA 2YXYA 4PD4F 2R8HA 3B4SA 4A3KG 1IBLH 2ILMA 4U7NA 4O7LA 3T9DA 4GX1A 4O83A 2DQ3A 2ZXWC 5DGHA 1TWCA 5B1NA 4M0JA 2W9BB 4K8XA 2Z0AA 1YJWV 1JX9A 2VRZA 1N0NA 3N43B 4RU9A 2C22A 4TV8A 1JVMA 4CMDA 1I0HA 3QQMA 3GWOA 4K35A 5GONA 4J11A 2P06A 3D3IA 4AYBE 2JS3A 3JD4A 3JD2A 4JV5B 2JA8G 4DV2O 1Q81W 2ZE5A 3RBEA 4TV9A 1OBGA 5KFIA 4LFAO 2WLIA 3ZHSA 1TA8A 4EGQA 1WCMG 3SPJA 2C28A 4BXXG 1B6RA 4WFBV 1MNGA 1FJGO 2HVJC 2B63A 3T9EA 2IJIA 3RW0A 5L1JA 2YSUB 4CC5A 4FLUA 5KHGA 4O4HF 4QWBA 3KCXA 3H3VH 4L1KA 4F4XA 2WWWA 3RGZA 1AJPA 4C5BA 4GKJH 3T1YB 2C00A 3BCCH 2B1IA 1HNWB 3OAAG 3H4DA 3MD0A 2HJFC 3U9TA 1URFA 1NI8A 5KX5F 3NXSA 1NR1A 4UVAA 3JAMW 1K83A 3QZ7A 1S3JA 5KA6A 2WDTA 5T14A 3TIIA 3K59A 3U10A 4BW9A 2DYRB 3JSLA 2IU3A 1I7FA 1AP5A 3T99A 3JAWA 5CBGA 2W7PA 3MR2A 4O7TA 2P4KA 2EIKC 1R3IC 2ATLA 2W6ZA 2JEXA 3H1IH 4B3RB 5KFJA 3BHPA 4QWCA 1COWG 4IL6Z 4IRCA 2ODMA 1DF5A 3E8FA 1S72V 1Q82W 2DJVA 4QW8A 4FFBB 3T9CA 2UVWA 1GH6A 4L8JA 3CCMV 4NXMO 1ZQ7A 1TVKB 1U97A 5J2TB 4GLXA 1YSCA 4LF7B 3K3VA 5DM6V 2PMZA 4BW5A 4EEQA 5B1AB 5TISZ 3AX6A 3TQTA 4E6NA 4U3FH 5EWEA 4O7WA 3T5HA 2R9IA 2DQ0A 2NLJC 3SYAA 2Q68A 1AP6A 5CN0A 1E1QG 1CEZA 4WFEA 5GTHZ 4ECYA 2DYSB 2ALZA 1GM8A 3FAVB 1J5EB 1E4EA 4OPAA 3Q4HA 4IWYA 4B7KA 2EZOA 4IT5A 4XYMB 4MW3A 1Y1WA 1VQLV 4A2BA 1F51A 4MVUA 4ED3A 4RUEA 4UFZA 3GIMA 3PO3G 2E2IA 5IWAB 2J6TA 4FK5C 2VQEH 2W9CA 1NS1A 1W0KG 2NR5A 4JTCB 1KC7A 1KT8A 4UCVA 2JA5A 4DV7H 3TW6A 4EYHB 5B3SC 4JF3A 4OPHA 1Z2PX 1V51A 1OCOC 3ABLC 1VF5B 1QHTA 3QNEA 3ETGA 3GIIA 4AQYH 4WFFA 1QCEA 2ATKC 4YR0A 1A32A 5DLGA 4O3OA 4O4HB 2W6NA 1WPBA 3I4NG 4RQFA 4X66O 4LC1A 5I5WA 1ZETA 1I94B 1Z2OX 2A3QA 3D36A 4ETSA 4JI0B 4MTXA 1BQ0A 4DV3H 3H1KH 1EKPA 1SQBH 2LGQA 3UQ8A 4B08A 4O3PA 4LF8H 1SF9A 1GGOA 3EPIA 4ED6A 3ZBHA 3FD9A 1BJTA 2UUCH 5KX5B 1ULZA 2KKWA 4JTAB 2EIMB 1UJWB 2EIJC 3GTKA 1N56A 2EBOA 3RVZA 3RUPA 4YY3B 4E2LA 1FKAH 4I55F 4GKKB 1YVWA 4ED0A 2R92A 3JAKA 2GTAA 5C44G 3JZIA 3T9BA 1E4FT 2LQTA 2XASA 3H1JH 2UU9O 4DR7B 4YJ3A 3LUTB 2DIKA 4JI2B 4BWAA 4ZIBA 3FKIA 3UT5A 2PYJA 2I8CA 2ZDHA 5JQGF 2V9WA 1M0WA 5IP9G 2NU8B 2FMAA 4YHHH 4CC6A 5EZYA 1Z5WA 2D3OW 5LHGA 2SCUB 3OUZA 4DV2B 3OHBA 2R7ZA 3ETQA 5KG3A 4PA6A 5BPFA 1E4GT 3OTOB 3GVMA 1PKXA 3W7XA 1N33H 1IBLO 4LF6B 4YR2A 1N32B 5DG7A 2QTSA 4DRXB 2UXDB 5IJ9A 3CCLV 2R8GA 5EWGA 3THOA 2B1GA 2ZNIA 3HPLC 1EN5A 2UUAO 3AK2A 4JZ2A 5GTIZ 3TEKA 1AR1B 3JCUZ 2E76B 4FLZA 5C1OA 2Q2UA 1S0MA 4CS4A 1X9NA 5KT6A 5BMVF 4DUZB 4U7CA 4FBTA 4JYAH 5CE8A 3JALA 5DN6G 3CEIA 3IJ4A 4J9PA 1D5AA 3WO1A 4JV0A 2PI5A 4FFRA 3CS5A 4IYIA 2ZD9A 4DK0A 4OX9H 4JI4O 2P22C 2XC9A 2UXXA 2ARHA 1R6KA 4JYYA 3JD0A 5LBQA 3DTUB 4ECWA 3KG2A 2H94A 4P9OA 4J7KA 1OCRC 1R3LC 3T54A 3K5IA 2VUMA 1XMQH 4DV1B 2F4VO 4YQWA 4FLTA 4F4ZA 5LXTF 1EN6A 4UUJC 4GKJO 2XNDG 5FPOA 4MA0A 2UXCB 2Q7DA 1B06A 4O84A 4YIOA 4B3TB 1CS0A 2KSWA 1JMKC 3UFXB 5IJ0B 1PV0A 1AI7A 2YXLA 4EBEA 4JI7H 2ADPA 5IYBG 1AJQA 3CC4V 3DC6A 4TUYF 1FXVA 4LSAA 2DABA 5KHHA 3M7MX 2RGVA 2OYQA 5CBHA 4O2AA 4I55B 1GN3A 1EKVA 4HNTA 3QWUA 1RJQA 4DL2A 2WLMA 4PI2A 1KBLA 1IYEA 4TQSA 4FM9A 1GN2A 1IBKH 4C5CA 5EOYA 2FTKA 1KBHA 2KB1A 2YIAA 3D3QA 1IXBA 1NTZH 3K57A 5JQGB 5BWTA 4O2BF 4Q4DA 4R7RA 4O3RA 1K4CC 2DMXA 2P7TC 1R1BA 1S9FA 2JEJA 3ZN0A 1EM1A 4NTWA 2R7NA 3N6RA 4DR6H 3CRQA 5DGBA 5FJ8G 1NZ6A 1ET0A 3RIZA 3M9NB 1S03G 2N74A 2OIEA 2E5LH 1JJ2U 4X1KB 3X2QB 1S0VA 4GYCB 3CC2V 4CMFA 3ZIAG 4DR4H 2W0FC 3OT7A 1YEWA 1AUXA 3Q8RB 3LDCA 1FFXB 3ICXA 3SR2C 2W9AA 2Q69A 4YJ2F 5L9XA 4J7JA 3OTFA 5BMVB 3HKEB 2K1EA 1Y67A 3U0GA 2Y4TA 2RNBA 4ECTA 4DRFA 3ZHVA 1YCIA 1GYFA 4ECVA 3JD1A 5DLFA 2CGOA 5IYDG 4DV4H 1FYJA 3K06A 2VQEO 2R82A 3Q8SB 4FLXA 5LA6A 4LF5H 1NH2D 2Q73A 4DV7O 1WNSA 4QIWA 2P5OA 1M57B 2M7WA 4C5AA 2WAQE 3RYHA 1ZX3A 4K0KB 5DISC 2HVRA 5FD6A 4U3JB 4A93G 5D1OA 4X1YB 4RB0A 2Y4RA 1KB9F 3GLKA 1GRJA 3GV7B 3IN5A 5LXTB 4R7CA 2WSSG 3JZ6A 3RB3A 4P30A 1ENVA 4PJ0Z 4DV3O 4DIMA 4X65H 4FIPC 1A48A 4PHZA 2UU9B 5JVDA 4Y8VB 3QO5A 3FB5C 4LF8O 2XUMA 2HVKC 2Q7GA 2Q6AA 2UUCO 5LHHA 4TUYB 2PY5A 3W7UA 4FZ0A 3F8NA 3RF2A 2CKZB 4DR3H 1QU7A 3E22B 3ZMTA 4PDRA 1FKAO 4X20A 3S24A 1KKDA 5D5PA 2IP4A 1HR0H 2QM8A 1K34A 1M4UA 4UUGA 1H8EG 2OLSA 3H4BA 3DTFA 5GONF 2HHFB 2NNUA 3MAQA 3GIQA 1I2LA 1FXHA 2UUAB 5KHKA 4O2BB 1RSOB 4HYOA 2VQFB 4MVQA 2ETNA 4KUMA 3QFFA 4K3AA 1B6QA 4X89A 2YRXA 4AHCA 2JGDA 2QSAA 5A2QN 2BR0A 5C5JA 2CH7A 3AG2C 2ZM6B 2WLNA 3IC7A 3CRAA 1K5QA 2KG7A 3CCSV 1R73A 3JRXA 4QGPA 4JI4B 1XNRB 1VAJA 4YJ2B 4FMTA 1RPRA 3W1BA 2CTWA 2ZR3A 2X5RA 3CE2A 5CA0A 3C0FB 4MV9A 5CB4A 2BQRA 4JYAO 1KJJA 4ED1A 3SGIA 2F4VB 5C4XG 2YRWA 1JXLA 3OEHG 1WA8B 3RBZA 2WYOA 2YEVB 4JYBA 4Q20A 1KC8W 3J7AK 4IRDA 1DTOA 3Q2OA 1ZAUA 3ZHUA 3GB7C 4LFBO 1MABG 5BXZA 4OX9O 4X1IB 4YAKB 3OSPA 1ZHSA 3HKBB 2Q2TA 1V9PA 1RM1C 5KMGB 1GK9A 2DOSA 4YXWG 2E2HA 4B3SB 1B3QA 1XK5A 1K9MW 3CRCA 1EFRG 1H38A 1H8HG 3R65A 3I12A 1I1LA 5AG2A 1XMQO 4J9QA 1TUBB 4MSWC 1VF7A 2YIBD 4I4TF 1FVIA 2P67A 5FNVF 2UUBH 5KG0A 3SJBC 3E86A 1BS3A 5FD5A 2IA6A 1K8AW 4J9ZB 3LP8A 1LUWA 4JI7O 1P16A 1WCMA 3UKMA 5CA3A 1CQIB 4RUAA 1I1KA 5KFGA 2PTMA 1AI4A 3OFNG 4FS1A 2WA3A 2HR3A 1YJ9V 2JJ1G 2JA6G 4JUZA 3CJHB 3K04A 4IZOA 3HO8A 4L87A 4NB5A 4PV1B 4RQEA 5B1OA 5IYCO 2RDJA 3D36C 4ECUA 1NQTA 4QJFA 3K3PA 5GONB 4PDBA 1F4NA 1IBKO 1BGYH 3KAJA 1Q5OA 4LF4H 2GUZA 3RFCA 1VQPV 1BSMA 3E89A 3FKSG 4MV7A 5LOVF 1HNXH 3J80W 3OMAB 4WBNF 2Y0SA 4KHPH 4B7EA 2XAHA 1Y74A 4EB6A 2ZDGA 3VNNA 4GC6A 3VQWA 3TK1A 2PMZE 2E5LO 3ABUA 1XDNA 4NKGB 3RFRA 1XBLA 3K5LA 4C2MA 4DLKA 1XNQH 1PNMA 2A1HA 4DW0A 3A0HZ 1KYOF 3APQA 4RAIA 1E79G 2Q0OC 5DEDA 5EK0A 1FAFA 3E5NA 4DV0O 2W70A 2R6FA 4Z1VA 4EEYA 1S77D 4ZI7F 3HOVG 3ZHRA 1SA0A 2V59A 4YAJB 1SQPH 4UV9A 5ITZA 1AN7A 4ZHQF 1CKNA 4IIJF 5KFRA 1GMGA 2WLKA 4DV4O 3QO7A 2X6CA 2EZPA 2ZCEA 4M9UA 4LF5O 5KT3A 4JI1O 5KLVH 1P8LA 4LFCH 4NYKA 4O4LA 4DR5B 1VBGA 1W59A 1I5YA 1EHIA 2W57A 3K03A 1HW7A 3SJAC 2CGNA 4MVOA 4JV1A 3AG2B 3QO8A 5KFEA 3L71H 5I5SA 1XQ8A 3WG7C 1GSHA 4J9KA 2XCLA 4UCSA 2LP7A 3JATA 4DXWA 1SESA 4I4TB 3K58A 2QWRB 3HKCB 4EQ5A 1C3OA 3ZRWA 5FNVB 5BYAA 4YJ3F 1RYSA 4NLGA 1XI1A 1VQOV 3J81W 1H2MA 1ZUQA 2CTPA 4HNUA 4DAAA 3UM7A 1UFIA 4X65O 2AQ4A 2FB5A 3DXRA 3JAMN 2YS8A 3T4DA 1YXBA 3U54A 3RB4A 3H40A 4I7HA 5EZYF 1GM7A 4DR2H 1SKVA 3V4SA 1MZFA 2FKLA 1C30A 1ROPA 1KJQA 2AHZA 5JCOA 5CMUA 2UXBH 4XZ3B 4DR3O
chains in the Genus database with same CATH topology
5JJNB 1HNXB 2RQ6A 3JASA 4TQFA 1FFXA 3KXYT 4O4HB 4UCRA 4KHPB 3GDEA 1JFFB 4B3MH 3JATB 1SQGA 1WPBA 4I50A 3RYCA 5BMVA 5EYPB 3HKEA 4UCUA 4DV5H 1I94B 1Z2OX 4CS3A 4ETSA 4MTDA 4JI0B 4DV3H 4RB1A 2JGUA 1XNQB 2EX3A 4FLVA 5LOVB 4JI5H 1O9GA 3JARB 3UQ8A 4B08A 1MZBA 4LF8H 4WBNB 4NXNB 1BJTA 1HNZB 2UUCH 5KX5B 3NC0B 2KKWA 1CKMA 3ZS8C 4DV1H 5BR8H 3HKDA 4X64H 4X1YA 3TY9A 4YY3B 2Q7EA 1FKAH 2UXCH 3BPZA 4GKKB 4LFBB 4B3TH 3JAKA 3NBYB 3H20A 4DV0H 4LSXA 2BTOA 2YI8A 4LFCB 1E4FT 2HHHH 4TV8B 4DR7B 4ZI7B 2VWKA 4YJ3A 3L4KA 3QTCA 4JI2B 5JH7A 3MWMA 4BWAA 4ZIBA 1IBMB 4RAYA 3UT5A 2PYJA 4ZHQB 4CH4A 4IIJB 1S5JA 2V4DA 4TV9B 3BABA 1M0WA 1SEIA 2VPSA 2YCHA 4YHHH 4CC6A 5EZYA 1Z5WA 1G6UA 1BGWA 4JI1H 3NBZB 4DV2B 5EIBC 3N2GA 5D5QA 3ETQA 1E4GT 2GV9A 3HKDB 3RWRD 3OTOB 3CSXA 1N33H 4LF6B 1SQFA 2YIBA 2XHBA 1N32B 4DRXB 2UXDB 5IJ9A 2VQEB 3THOA 5LYJA 4DUYB 3K5MA 4DR2B 4LR3A 2ZNIA 4DV7B 2PZSA 4FLZA 4DR1H 4O4JA 2Q2UA 2CAZC 2IM9A 4CS4A 2UXBB 4YJ3B 4AQYB 1X9NA 3DSQA 4DUZB 1HNZH 4JYAH 3RGBA 5CA1A 3JALA 4O2BA 4O4IA 1D5AA 4LH7A 4D7SA 1L2ZA 4B3MB 5EZYB 2VWJA 1N34H 4JI3H 5IT9W 1TAEA 4DV5B 3N2GB 4DK0A 1O9HA 3RYFA 4OX9H 2P22C 1P49A 4DV3B 2CW7A 3T1HH 1M93A 2ZJTA 1A0IA 2QJ1A 5IJ9B 4LF8B 4I55A 4RZQA 4APMA 3GJXB 2UUCB 4F6RA 3JAWB 1XMQH 4DV1B 2E5LB 5BR8B 4FLTA 4O4JB 4X64B 4JI8B 3KYHC 5FPOA 3K5NA 1N36H 2UXCB 4LH6A 2Q7HA 2OWOA 4K0KH 2VUGA 4B3TB 2FE3A 2KSWA 5ITZB 1JMKC 4UCOA 4LFAH 2JS5A 5IJ0B 4DV0B 2YXLA 1JJOA 4JI7H 4FVMA 3A2FA 5LMNB 1CKNB 2HHHB 1VS0A 4ZOLA 3RYFB 1Q3EA 1FJGH 3IG0A 4IHJB 3TY8A 4LSAA 5KMGA 3QG5A 4MTEA 4O4LB 5KHHA 3M7MX 3ZEDA 2OYQA 2RGVA 4O2AA 5LP6B 4I55B 1S68A 4YHHB 4A2AA 4JI1B 3QWUA 4F6RB 2UU9H 1TUBA 4PI2A 4DK1A 3N2KA 2JVDA 3W1GA 1Q8IA 4FM9A 1N33B 1IBKH 5EOYA 2YIAA 3QF7A 2PUSA 3K57A 5JQGB 5FLXW 4PI0A 4R7RA 5LMUH 3GB8B 5K1XA 4X62H 4DR6H 4ZOLB 4DR1B 3RJ0A 4JYAB 3RIZA 1S03G 2VOBA 2E5LH 3VQYA 4X1KB 2F95B 3DF7A 4GYCB 4U3JA 4JI8H 4DR4H 1YEWA 4PZ8A 2UUAH 5J2UA 1N34B 4JI3B 4I9QA 2VQFH 3JASB 3U11A 1FFXB 3ICXA 3SR2C 4OX9B 3N2KB 5LXTA 3T1HB 4I50B 3RYCB 5LMNH 1B04A 3OTFA 5BMVB 3HKEB 3N41B 1L8DA 4DRFA 4EFBA 3L2PA 3SJCC 2ZM6H 5K1PA 4NXMH 1GYFA 5KHIA 4M7EA 3U0ZA 2RJZA 1XMQB 4DV4H 1O75A 3HXLA 4JI4H 1XNRH 4FLXA 4LF9B 5LA6A 4TUYA 3CHXA 4LF5H 1XMOH 1WNSA 4Q0YA 1N36B 2P5OA 2CW8A 1M5IA 1I6UA 5FPRA 3RYHA 4K0KB 5DISC 2HVRA 5FD6A 2XIGA 3E22A 4U3JB 4LFAB 5D1OA 4X1YB 4JI7B 2CFMA 5A2QW 4FLWA 2F4VH 4RB0A 5C8YA 3N44B 1T5EA 2R72A 1FJGB 3JAKB 5LXTB 1M0TA 1H2SB 4FFBA 4FM0A 4X65H 1Q43A 4PHZA 5JH7B 1RSOA 4K8ZA 3UT5B 5JVDA 2UU9B 4B3SH 3VQVA 3B2EE 4DV6B 2QM4A 2Q7GA 4PZ7A 5LA6B 4TUYB 2PY5A 4CH6A 2BTQA 1IBKB 3WB0A 3F8NA 3RF2A 3RYHB 4HNAA 1KU9A 4DR3H 4FLYA 3E22B 2E3CA 5D1OB 5LMUB 4HBNA 4X20A 4IAJA 5C8YB 4X62B 2HIVA 3BRCA 5D5PA 4DR6B 3S24A 1HR0H 5IYZA 4I4TA 1M4UA 5LYJB 4YJ2A 3HKCA 5LL6b 3TY5A 4TQDA 4TOIA 5FNVA 4X66H 3W5OA 3BA9A 3MAQA 4LF9H 4DR4B 2UUAB 3N42B 4NVPA 5KHKA 5CA1B 3JALB 4O2BB 1Z2NX 2VQFB 4O4IB 2PYLA 3L4JA 2WE6A 2Q0AA 4AHCA 2BTQB 4X1IA 3IAYA 4FM1A 3HKBA 2F66C 2ZM6B 4NXMB 5D1PA 3T1YH 3WB2A 4O4HA 4DV4B 1WH2A 5EIBD 4JI4B 1XNRB 1JFFA 3EYYA 1HNWH 4YJ2B 5IYZB 5EYPA 4LF5B 4JI6H 1XMOB 3W1BA 4EFEA 5CA0A 3C0FB 4CH5A 4DV6H 4MV9A 1Z5VA 5CB4A 5LOVA 1DGSA 3SGIA 2F4VB 4WBNA 1X4TA 2ZINA 5KX5A 2WYOA 2O03A 4FM2A 4KL1A 3VQXA 3J7AK 1ZAUA 5LP6C 4X1IB 4B3RH 1ZHSA 4X65B 1ZHQA 3HKBB 2Q2TA 1IBLH 1V9PA 5KMGB 5JJEB 3KAKA 4B3SB 1XK5A 4O2AB 4K8XA 3N43B 3K5OA 4TV8A 4ZI7A 1TUBB 5CA0B 3M4IA 1VF7A 2YIBD 4LF7H 1FVIA 2F1MA 4CH3A 5GONA 4DR3B 5CB4B 4J0MA 4JV5B 4DR5H 4ZHQA 2UUBH 4IIJA 3SJBC 4TV9A 5FD5A 2HIXA 4RB2C 1XHZA 1HR0B 1TA8A 4LNUA 1P16A 5JJJB 4X66B 3PN1A 5JCOC 2PTMA 1J5EH 3RYIA 1KMIZ 4DRXA 4LMYA 3JSNA 2PGGA 4CC5A 4FLUA 5IWAH 5KHGA 5J2UB 1NT2B 2HEPA 4UCTA 2HVSA 3LNNA 5GONB 3RGZA 4GKJH 4PDBA 3T1YB 3KAJA 1Q5OA 4LF4H 3FFQA 4CS2A 1HNWB 4MV7A 1HNXH 3J80W 3FMAA 4LNUB 1TVKA 4JI6B 5J2TA 4KHPH 3N6XA 3JAMW 4EB6A 3VNNA 2HGSA 3RYIB 2WDTA 3VQWA 1I94H 3K59A 3U10A 3WB1A 1XDNA 4BW9A 3RFRA 4JI0H 3K5LA 3JSLA 1I7FA 1XNQH 3JAWA 4JV5H 3RGXA 4Q6GA 2ZNJA 4NXNH 4B3RB 3CVZA 3BHPA 1SYXB 2F93B 1IBLB 1SA0A 3RTXA 5ITZA 2RGRA 1AN7A 3BA8A 4FFBB 5IJ0A 4RB3C 4L8JA 4YY3H 1CKNA 3N40P 1TVKB 4AILC 5J2TB 4GKKH 4GLXA 1WN7A 5JVDB 4LFBH 4LF7B 3K3VA 4IHJA 2ZCEA 4BWSC 4EB6B 4EEQA 1P8LA 4LFCH 4O4LA 3CB2A 4DR5B 2UUBB 4DR7H 4E6NA 4JI5B 1CKOA 2W57A 1HW7A 3SJAC 5LP6A 5KHJA 3KALA 4HNAB 4JI2H 2HVQA 1IBMH 4D7TA 2YI9A 1TGOA 1XQ8A 1QQCA 4X20B 4RAZA 2R9AA 4UCSA 3JATA 1J5EB 4PZ6A 4I4TB 3K58A 3HKCB 4DV2H 1SA0B 4EQ5A 5FNVB 5JQGA 3RR5A 1XI1A 4A2BA 2ZIMA 3J81W 3OTOH 3LMLA 4LF6H 4UFZA 5IWAB 1N32H 2MCTA 3JARA 2UXDH 2VQEH 2R70A 4I7HA 4DUYH 4DR2H 1SKVA 4UCVA 4GKJB 2ZIOA 4DV7H 1XHXA 4X1KA 1Z2PX 3BAAA 4LF4B 5JCOA 2UXBH 4AQYH 1QHTA 4DUZH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 B;  1HNX B;  2E5L B;  4X64 B;  4JI8 B;  2UU9 B;  3KYH C;  4UCR A;  4KHP B;  3GDE A;  4DV6 B;  5FPO A;  2UXC B;  4LH6 A;  3JSN A;  2OWO A;  4PZ7 A;  2VUG A;  4B3T B;  1IBK B;  4UCU A;  4UCO A;  1I94 B;  4DV0 B;  4CC5 A;  4JI0 B;  5LMN B;  1CKN B;  2HHH B;  1XNQ B;  1VS0 A;  4UCT A;  5D1O B;  5LMU B;  2HVS A;  3UQ8 A;  3TY8 A;  4X62 B;  2HIV A;  3S24 A;  4DR6 B;  3T1Y B;  4NXN B;  1HNZ B;  3TY5 A;  3NC0 B;  4TOI A;  1CKM A;  1HNW B;  1S68 A;  4YHH B;  3W5O A;  4JI1 B;  3QWU A;  3BA9 A;  4JI6 B;  4DR4 B;  3TY9 A;  4YY3 B;  2UUA B;  3W1G A;  3VNN A;  2VQF B;  4GKK B;  4LFB B;  1N33 B;  3NBY B;  1XDN A;  3JSL A;  4LFC B;  4DR7 B;  3GB8 B;  2ZM6 B;  4JI2 B;  4NXM B;  5D1P A;  4DR1 B;  1IBM B;  4B3R B;  4DV4 B;  4JYA B;  1IBL B;  3BAB A;  4JI4 B;  1XNR B;  4CC6 A;  4LF5 B;  3RTX A;  1XMO B;  3NBZ B;  3BA8 A;  4DV2 B;  3W1B A;  4EFE A;  4PZ8 A;  1CKN A;  1N34 B;  4JI3 B;  3OTO B;  4GLX A;  4LF6 B;  4LF7 B;  4OX9 B;  1N32 B;  1DGS A;  3SGI A;  2F4V B;  2UXD B;  4EEQ A;  2VQE B;  1P8L A;  3T1H B;  4DR5 B;  1B04 A;  2UUB B;  4DUY B;  4DR2 B;  4JI5 B;  1CKO A;  4E6N A;  4DV7 B;  4DRF A;  4EFB A;  3L2P A;  1ZAU A;  2HVQ A;  2Q2U A;  2UXB B;  1X9N A;  4AQY B;  1XMQ B;  4X65 B;  4DUZ B;  2Q2T A;  1V9P A;  4UCS A;  4LF9 B;  1J5E B;  4PZ6 A;  4LH7 A;  4B3S B;  1XK5 A;  1N36 B;  4EQ5 A;  4B3M B;  3RR5 A;  5FPR A;  4K0K B;  5DIS C;  2HVR A;  1TAE A;  4DV5 B;  4LFA B;  5D1O A;  4UFZ A;  4JI7 B;  2CFM A;  5IWA B;  4DV1 B;  1FVI A;  4DV3 B;  4DR3 B;  4JV5 B;  1FJG B;  1A0I A;  4UCV A;  4GKJ B;  4LF8 B;  2HIX A;  1HR0 B;  3BAA A;  3GJX B;  1TA8 A;  2UUC B;  4LF4 B;  1P16 A;  4X66 B;  3PN1 A; 
#chains in the Genus database with same CATH topology
 5JJN B;  4BY1 G;  3JAS A;  2DN9 A;  1RM1 B;  1A9X A;  3M9O B;  5DEC A;  3AG3 C;  2DLN A;  4UCR A;  5KFV A;  1HR0 O;  4FBU A;  5BPH A;  1JFF B;  4B3M H;  2DW4 A;  1SZT A;  3RYC A;  3ABM C;  5EYP B;  1K1S A;  3AK1 A;  3Q4H B;  1P4R A;  4D6T H;  4DV5 H;  2AGQ A;  1S0N A;  2HGW A;  3P3N A;  4MTD A;  4PDL A;  4ZKI A;  5DQG A;  1PL0 A;  3DC5 A;  4O3N A;  2JRI A;  4FLV A;  5LOV B;  1MZB A;  2YS6 A;  4A3C G;  4WBN B;  3WWJ A;  5A9G A;  2W9C B;  3T5K A;  4NXN B;  4LCU C;  2EIL C;  3ZMU A;  4LP8 A;  3L70 H;  4IHJ F;  3HKD A;  3V6H A;  1J95 A;  1YF2 A;  1Q90 D;  2IU0 A;  3H0G A;  3G6E V;  5FLM G;  3SDL A;  1M56 C;  2CTR A;  3N27 A;  5LP6 F;  4LFB B;  1PX2 A;  2QWQ B;  2ASL A;  3R5F A;  1SET A;  4XDK A;  1Y6X A;  3GTQ A;  1K7D A;  2HHH H;  1ZLZ A;  1S0O A;  1HDJ A;  4ZI7 B;  2ZT9 B;  2VWK A;  3SYP A;  3KHR A;  2FLP A;  3ZN1 A;  2R84 A;  3EPG A;  1IBM B;  1IUR A;  2QWO B;  4ZHQ B;  1K4D C;  3C3T A;  4CH4 A;  4IIJ B;  1S5J A;  1Y76 A;  2VPS A;  1I7L A;  5C93 A;  4O7R A;  3NR7 A;  3CSW A;  5GW7 A;  4MTF A;  3N2G A;  5D5Q A;  4IR1 A;  3K5H A;  3RWR D;  3R23 A;  4DL3 A;  4UXN A;  2RDC A;  1M9N A;  2LFR A;  3CRM A;  2XD4 A;  1SQF A;  3R66 A;  5KA5 A;  5KFN A;  2LJ2 A;  5LYJ A;  4DUY B;  5E79 Z;  3BVO A;  1KEE A;  1OZ0 A;  2PN1 A;  2LW1 A;  2IM9 A;  4YJ3 B;  4I50 F;  1HNZ H;  5CBF A;  2EIY A;  5CA1 A;  3K0D A;  4GUN A;  2UUB O;  4O4I A;  4Q4C A;  4H44 B;  5KFH A;  1L2Z A;  5L3D A;  5LL6 Y;  4Q8F A;  2RMK B;  5EZY B;  1GN4 A;  1N48 A;  2C2D A;  2CNU A;  2FB9 A;  3RYF A;  1K97 A;  1P49 A;  4GC7 A;  3RB6 A;  3T1H H;  3CX5 F;  1M93 A;  5EDW A;  1XMO O;  1FPO A;  2ZJT A;  5KFW A;  5IJ9 B;  2FKX A;  2WLL A;  1JOY A;  2RCV A;  1K3E A;  1CPY A;  2WLH A;  2E5L B;  2V58 A;  5BR8 B;  4X64 B;  4F4L A;  5IY5 C;  1IDS A;  4JAA A;  1N36 H;  3K5N A;  4H13 B;  3ABK B;  2RDI A;  4LH6 A;  4LF4 O;  2FPG B;  2VUG A;  2O57 A;  1Y1V G;  5EBL C;  1NH2 B;  3LSU A;  5JH7 F;  3CQZ A;  2MW2 B;  1WB8 A;  4LWS A;  4DV0 B;  1HNX O;  2I80 A;  4FVM A;  2J6S A;  4MTO A;  4O3S A;  3N8D A;  4KHP O;  1AIL A;  5LA6 F;  2W8L A;  4IHJ B;  1B33 N;  3TY8 A;  4QIW F;  3QG5 A;  2AU0 A;  3EFF K;  1FS0 G;  2W9B A;  2QB5 A;  1SQV H;  5LP6 B;  5C3E G;  3F5T A;  4MV3 A;  3UYY A;  4JI1 B;  4EYI B;  3B40 A;  3E83 A;  1KP3 A;  4GLW A;  4MT8 A;  2ZXW B;  1IZ3 A;  1K73 W;  5DQH A;  2XAQ A;  4XYL B;  3JYC A;  2OTJ V;  1CQJ B;  1I1M A;  4JAV A;  5LGN A;  2CTQ A;  4UB8 Z;  2LGW A;  1G4Y B;  3ASN C;  5KFB A;  2JA7 A;  1VEW A;  5FLX W;  4PI0 A;  2V5A A;  1W93 A;  1K1Q A;  2Y0P A;  1W2B U;  3G6X A;  5LMU H;  3GB8 B;  5DG9 A;  4MVR A;  3ZMV A;  4CKE A;  4X62 H;  3E35 A;  4O7Y A;  4WD3 A;  4DR1 B;  3RJ0 A;  4K6N A;  2EIL B;  4LFC O;  4MV6 A;  4MV4 A;  3K9A A;  4QE9 A;  3DF7 A;  4J9Y B;  4JI8 H;  4QIW E;  3GTL A;  1N34 B;  4JI3 B;  4ASU G;  3U11 A;  1M56 B;  4PA3 A;  2W6M A;  2YC0 A;  3WO0 A;  5BWU A;  1Y4M A;  3WNZ A;  4I50 B;  4JI6 O;  1VQ7 V;  1NVP B;  1CP9 A;  1CE8 A;  1VQ8 V;  3ETH A;  2DPI A;  4R50 A;  5KFQ A;  1VF6 A;  5K1P A;  5KHI A;  5BZB A;  3OUF A;  4HR7 A;  2RJZ A;  1O75 A;  5JUM A;  1RJR A;  1AVM A;  3CHX A;  2BQ3 A;  1IVS A;  4J42 A;  4Q0Y A;  2CW8 A;  3G8D A;  2GQR A;  3ZCC A;  3MWD A;  4LFA B;  2PBZ A;  4FLW A;  4BAY A;  4AYB A;  2W6P A;  2R72 A;  4MAM A;  1FJG B;  4NZM A;  1PNK A;  4B3M O;  1VQ9 V;  2QTO A;  1THZ A;  3SPH A;  5CA0 F;  1T3N A;  4DV5 O;  4O7V A;  1XL6 A;  1M0T A;  5CB4 F;  4UV8 A;  4FFB A;  4HNV A;  2EIK B;  2YU9 A;  1Q43 A;  4G2K A;  3AG1 C;  4F6E A;  1BMF G;  5JH7 B;  4OGQ B;  2YZN A;  3B77 A;  3BFR A;  3VQV A;  3B2E E;  1JIH A;  3HB3 B;  2HG5 C;  5LA6 B;  2BTQ A;  3ORR A;  4A3E G;  5IE9 A;  3RYH B;  2DE0 X;  4FFP A;  5D1O B;  3GID A;  4HBN A;  2DZD A;  2XCP A;  3GV5 B;  4DL4 A;  3G4S V;  2JEG A;  4CKC A;  3DAA A;  3VOU A;  2EJ2 A;  5L3B A;  1JDE A;  3VOT A;  5IDJ A;  3B8N A;  2HLD G;  5J2U F;  3TY5 A;  1OJH A;  4TOI A;  2HHH O;  1N4C A;  1SS3 A;  1JX4 A;  5KFD A;  3MR6 A;  1ARO P;  4LF9 H;  4MVM A;  3TGU H;  3K0G A;  4R8U B;  4FFK A;  3PW2 A;  3PVX A;  1GO3 E;  3RN4 A;  1SQX H;  1LNQ A;  1YHQ V;  1P7B A;  3MDS A;  2CNV A;  3VPC A;  2PYL A;  4HQ6 A;  1JKJ B;  2HGX A;  2WE6 A;  4FFM A;  2Q0A A;  3E8H A;  2KSD A;  3SE7 A;  3IAY A;  4FM1 A;  2F66 C;  3H9V A;  1JLL B;  4NXM B;  5D1P A;  3T1Y H;  2KQX A;  5B3S B;  4O4H A;  2B5U A;  1WH2 A;  5EIB D;  3EYY A;  2PF4 E;  1OCO B;  3ABL B;  3STZ C;  1HNW H;  1H2N A;  3P3P A;  3MHS C;  5KFP A;  1XMO B;  1V55 C;  4EFE A;  4C7U A;  2QKA A;  2COJ A;  2R93 A;  4TVI A;  4DV6 H;  4U6P A;  4O7N A;  2R7L A;  4QWE A;  1HNZ O;  2XAG A;  3BY6 A;  3L74 H;  2P0A A;  4U7O A;  2QK4 A;  4JZG A;  5IT9 N;  3ASN B;  1EUC B;  2ZIN A;  5KX5 A;  5HV6 A;  4KL1 A;  2HKO A;  3MFI A;  3LUL A;  2BSK B;  4B3R H;  1ZHQ A;  4H33 A;  2P90 A;  4BBS G;  5JJE B;  3BAC A;  2Z5U A;  3WWI A;  2EIJ B;  1WLE A;  3K5O A;  5I60 A;  2F23 A;  1QLN A;  5CA0 B;  3M4I A;  4LF7 H;  2F1M A;  4CH3 A;  5CB4 B;  1NJI W;  3KHG A;  4FJC C;  3H01 A;  4NZO A;  3FYE B;  1V54 C;  2H3O A;  2D2C B;  2M05 A;  2DWD C;  5L3C A;  1FFT B;  3P30 A;  3TXQ A;  5LGT A;  3KKY A;  3TQ1 A;  4RB2 C;  4PBC A;  3CD6 V;  4DL6 A;  2R8I A;  4J9N A;  1KJ8 A;  4LNU A;  1BT8 A;  5JJJ B;  4PA9 A;  4X66 B;  3PW5 A;  5JCO C;  1J5E H;  4R8C A;  5I5U A;  3RYI A;  2Y0S E;  2M6Y A;  4DRX A;  1GKF A;  1QR9 A;  2R92 G;  1HWY A;  3JSN A;  2JA6 A;  4OXS A;  4AQY O;  1TWH A;  5KFL A;  4BIZ A;  2R7K A;  4WFH A;  5IWA H;  5J2U B;  5B66 Z;  1QLE C;  2HEP A;  1EYZ A;  3SPI A;  4UCT A;  5DAA A;  2FYU H;  3LNN A;  1VQK V;  3RV4 A;  5KUK A;  2QDO A;  3FFQ A;  3CCV V;  4CS2 A;  3BQ2 A;  1SZX A;  2XTA A;  2FJZ A;  4JI6 B;  3ASO C;  3M9M B;  3N6X A;  3T2M A;  1B6S A;  3I56 V;  4E4T A;  2ADQ B;  3VPB A;  4QPJ A;  1EN4 A;  1I94 H;  2Q4P A;  4JI0 H;  2Q9L A;  4JI8 O;  3CCQ V;  2ASJ A;  2UVV A;  3CMA V;  3GQC A;  2W71 A;  4PDM A;  1RPO A;  3G6V A;  2Q67 A;  3VPD A;  4DQN A;  3SJQ C;  3HOU G;  3BEH A;  3U55 A;  3CVZ A;  4TV8 F;  1OCR B;  2F93 B;  1IBL B;  3OGI B;  1EZ1 A;  1IXM A;  4DW1 A;  1R3J C;  3RTX A;  4A3B G;  1DF4 A;  2GUZ B;  2Y0I A;  3BA8 A;  3MHH C;  5IJ0 A;  4RB3 C;  4YY3 H;  5KT4 A;  3OW2 U;  4TV9 F;  4AIL C;  2N04 A;  4GKK H;  1AUV A;  1WN7 A;  1NVP D;  4YHH O;  4EB6 B;  3W7W A;  2ZQM A;  2YWV A;  3CB2 A;  4DR7 H;  4O86 A;  2QYZ A;  3A0R A;  1YIT V;  3JZF A;  3KAL A;  4HNA B;  4JI2 H;  2HVQ A;  2QEX V;  4I0X B;  2VUM G;  1N33 O;  2IBZ H;  3SYQ A;  1TGO A;  2IH3 C;  4IYH A;  2WPD G;  2R9A A;  2JEI A;  1DIK A;  4UVB A;  4PZ6 A;  2DPJ A;  1X59 A;  3MFH A;  5I47 A;  4DV2 H;  1SA0 B;  4N23 A;  2QR4 A;  3KHH A;  4Z2W A;  1ZTE A;  5JQG A;  2ZIM A;  5IYB O;  4NYE A;  1XOU A;  3OTO H;  5KAI Z;  3BQ0 A;  3LML A;  4LF6 H;  2HG8 A;  3HOY G;  4MW8 A;  1N32 H;  2MCT A;  3JAR A;  2UXD H;  2BCC H;  2Q5Z A;  2R70 A;  3TIG A;  1RK6 A;  4GKJ B;  2EIN C;  2NU9 B;  1F23 A;  1XHX A;  4X1K A;  3BAA A;  5DMX A;  4IRK A;  1XUQ A;  4G27 B;  4DUZ H;  2YZL A;  4TWK A;  3UZB A;  4TQF A;  4KP4 A;  4A3F G;  1FFX A;  3KXY T;  2ASD A;  4ZBM A;  1OHH G;  3GDE A;  2CNQ A;  2QA4 V;  4FE2 A;  3JAT B;  2NVX A;  5BMV A;  3VMM A;  3HKE A;  1V4Y A;  4JYC A;  2AXT Z;  1FD9 A;  1GLV A;  3QZ8 A;  4RB1 A;  3HBL A;  4LF9 O;  1ZL8 B;  2JGU A;  3CWB H;  2EX3 A;  3RAQ A;  4JAU A;  1V54 B;  3DTG A;  4JI5 H;  1KUT A;  5L3E A;  4Q44 A;  2FML A;  1JDB B;  2ZR2 A;  2WLJ A;  2PVP A;  2GPW A;  4J41 A;  1HNZ B;  3EVK A;  2H8P C;  2RF4 A;  4DV1 H;  3GIL A;  2YXH A;  4PWQ A;  3SNO A;  2FK3 A;  4R6Z A;  1AR4 A;  4IR9 A;  4X1Y A;  3TY9 A;  3GTO A;  2AHY A;  4J9M A;  2Q7E A;  2AZ2 A;  1YTF D;  2UXC H;  4QPK A;  3OR6 C;  4B3T H;  3U9S A;  5KT5 A;  2OT5 A;  1HNW O;  3H20 A;  1WSC A;  1IYD A;  2BTO A;  1I7N A;  2YI8 A;  4FS2 A;  2YUA A;  4ED8 A;  4TV8 B;  2BOB C;  5DGI A;  1R6T A;  4DV6 O;  5IYD O;  1YI2 V;  3QTC A;  1FXK A;  5KAF Z;  4RAY A;  1TWG A;  4J9L A;  4RUC A;  4YP3 A;  2V4D A;  5K2M A;  1F7Y A;  4TV9 B;  3OMI B;  2ITD C;  1PK8 A;  2WLI B;  5L3G A;  3AYH B;  5EIB C;  1JCH A;  3ZRS A;  3I4M G;  5KUM A;  1VQN V;  5C1P A;  4TQR A;  1XIL A;  1ZWI C;  3HKD B;  4DR6 O;  3KZI Z;  3MJF A;  1IOW A;  2YIC A;  5KS8 A;  2VQE B;  5L1I A;  1JR9 A;  3K5M A;  4DR4 O;  1VP7 A;  1DK1 A;  3ML0 A;  4DV7 B;  2DWE C;  5I5Y A;  3L72 H;  2HHF A;  4LF7 O;  4O4J A;  2CAZ C;  3ZJZ A;  4AQY B;  1VF6 C;  3DSQ A;  4MTG A;  4FPP A;  4O2B A;  3FYI B;  4EBC A;  4CKB A;  1DV2 A;  3KRE A;  4LH7 A;  1Q6U A;  4YB8 B;  3L75 H;  5FL7 G;  3A8T A;  4WFG A;  3WFV A;  3OUS A;  1NU1 H;  2Y69 C;  3N2G B;  1KD1 W;  2Z04 A;  3L9D A;  5H6R A;  4DV3 B;  1J5E O;  4RCN A;  4BBR G;  3IC9 A;  2AGP A;  1UPG A;  2NU7 B;  3CME V;  4H0L B;  4HZ3 A;  2W6O A;  1A0I A;  4A3J G;  2QJ1 A;  4LF8 B;  2R87 A;  4RZQ A;  4APM A;  2IH1 C;  2OTL V;  4UVC A;  5FR9 A;  4E4E A;  2UUC B;  3FB7 C;  3OHA A;  4F6R A;  5IWA O;  3JAW B;  3W7S A;  3OR7 C;  5DQI A;  3SI8 A;  4JI8 B;  4GX2 A;  3VA7 A;  4I5S A;  3AG7 A;  2Q7H A;  2OWO A;  3NGD A;  4K0K H;  1WA8 A;  4RNO A;  2J9G A;  4UCO A;  1Y1V A;  5B1A C;  1U96 A;  1JJO A;  1S76 D;  3A2F A;  1MA1 A;  4ZOL A;  1I3Q A;  3RYF B;  1Q3E A;  2EUL A;  5KMG A;  4QNH B;  2XGQ A;  4MTE A;  2EJR A;  4HN2 A;  1I94 O;  3ZED A;  5BWR A;  1I2K A;  2FL4 A;  2DYS C;  2W0X A;  4JI0 O;  3BQ1 A;  2K9P A;  1RFY A;  4YHH B;  2WLL B;  1S68 A;  1SQQ H;  2ITC C;  3F7Y C;  1VQ5 V;  2WB1 A;  2UU9 H;  3T5J A;  1TUB A;  3PO2 G;  2GTS A;  2YS7 A;  2C35 B;  2R8J A;  3N2K A;  2JVD A;  2PI4 A;  3W1G A;  2FK1 A;  3BG5 A;  2V1D A;  2W6I G;  1N33 B;  5KFK A;  3K3W A;  1E4E B;  1VQM V;  2PUS A;  1IX9 A;  4CZZ A;  3PW7 A;  4YY3 O;  2EJ0 A;  2QKC A;  4LWS B;  2QM7 A;  5KFC A;  2EJ7 A;  4KXR A;  5K1X A;  4WFA V;  4GKK O;  2ZKO A;  2LFS A;  3PW0 A;  2IMW P;  4JYA B;  1MZE A;  4DR7 O;  3T4Z A;  2VOB A;  3VQY A;  3PW4 A;  1I50 A;  3CJH A;  4JV2 A;  1ZSP A;  2CDY A;  1KJI A;  4JI2 O;  5BWX A;  3IFX A;  1M1K W;  2UUA H;  2LW7 A;  1PP9 H;  4I9Q A;  2VQF H;  4OX9 B;  2VA3 A;  5LMN H;  5KT7 A;  2W6J G;  1QVG U;  4ECQ A;  3HOZ G;  4EFB A;  3OTO O;  3ABT A;  2ZM6 H;  4LF6 O;  3M99 B;  2WA4 A;  3ZRX A;  2EIM C;  1N32 O;  1XMQ B;  2UXD O;  3HXL A;  4JI4 H;  3UO2 A;  1XNR H;  4JTD B;  4LF9 B;  2A7W A;  4HAM A;  3T1C A;  3ZHQ A;  5J9P C;  1I6U A;  1AR5 A;  5FPR A;  2VR1 A;  2XIG A;  4DUZ O;  1H2L A;  4BIU A;  4WCE V;  3GTJ A;  4JI7 B;  2AW9 A;  2COG A;  2F4V H;  4O2A F;  4J9S A;  5C8Y A;  3N44 B;  1K5S A;  1T5E A;  3HT5 A;  2E75 B;  3PZP A;  4A3I G;  1AI6 A;  3JAK B;  1TWA A;  5FLX N;  5BY1 A;  4ED7 A;  4RNM A;  1BQZ A;  1BZK A;  1H2S B;  1MSW D;  2JIZ G;  3AW8 A;  5I5T A;  4NTY A;  3MR5 A;  3SYO A;  2ZDI A;  4WHX A;  1WAZ A;  2XAJ A;  2UVR A;  3UT5 B;  4JI5 O;  4I7Z B;  4B3S H;  4DO2 A;  4DV6 B;  2QGN A;  1MOF A;  4IGG A;  2EJ3 A;  2GDS A;  4FFL A;  3OD4 A;  1IBK B;  4DV1 O;  3WB0 A;  1BHA A;  2Y69 B;  2VPQ A;  2R85 A;  5KFS A;  2E3C A;  5JVL A;  2FK2 A;  4ME6 A;  2UXC O;  1OCC C;  4B3T O;  3BRC A;  1M90 W;  4DR6 B;  1OWT A;  5EWF A;  5IYZ A;  4I4T A;  3SPG A;  3HKC A;  1XL4 A;  4TQD A;  5FNV A;  3OSN A;  1VBH A;  3W5O A;  4FFN A;  3Q8P B;  3WG7 B;  3BA9 A;  4RUF A;  1WJZ A;  1PM9 A;  4DR4 B;  3GWK C;  1T36 A;  1WP8 A;  4NVP A;  4TM5 A;  3JAL B;  1KJ9 A;  1RP3 B;  2JJ2 G;  1G8M A;  3OE7 G;  3L4J A;  2YYA A;  1P7G A;  3FDS A;  2BTQ B;  5CM0 A;  3ZX6 A;  3TW7 A;  4Q45 A;  2ABJ A;  3F7V C;  2I87 A;  3WB2 A;  1JA8 A;  1XDC A;  4DV4 B;  1JFF A;  1KP2 A;  2G38 A;  5B5E Z;  5DGA A;  1XNQ O;  5EYP A;  4LF5 B;  2C2E A;  1GAX A;  3DGE A;  3JD3 A;  3AG3 B;  2GLT A;  4XX0 B;  3GIJ A;  3GIK A;  4BY7 G;  4LBE C;  5LOV A;  2GHY A;  3ABM B;  1BCC H;  3KTM A;  1QVF U;  4WBN A;  1X4T A;  4MV8 A;  2OIG A;  1VIB A;  3EXA A;  4FM2 A;  2NU6 B;  5JVD F;  2R86 A;  4GT1 A;  1SRY A;  5KG7 A;  3O65 A;  1GTO A;  4X65 B;  1MSD A;  3HKZ A;  4PEL A;  3KAK A;  4UB6 Z;  4O2A B;  2Z3Y A;  4F4W A;  2IBK A;  2YDE A;  1LR1 A;  1CXZ B;  4YIP A;  3CP1 A;  4ZI7 A;  5H2F Z;  4MV1 A;  4XBF A;  4QWA A;  4DR3 B;  4J0M A;  3HR0 A;  4DR5 H;  4W4L A;  4ZHQ A;  3TJT A;  4IIJ A;  2NUA B;  1AB3 A;  4K0K O;  2XGP A;  2HIX A;  3A0B Z;  3HOW G;  4MS2 A;  1XHZ A;  1HR0 B;  1SCU B;  2X0L A;  3JCZ A;  4KFM A;  1G2W A;  1WR2 A;  3IGA C;  3CCJ V;  3PN1 A;  3X2Q C;  2JDI G;  1K92 A;  3ZMS A;  3W7T A;  3H0G G;  1EBO A;  3L73 H;  1VQ6 V;  4DR2 O;  4DYL A;  1RJP A;  2YID A;  1KMI Z;  1OCZ C;  2B63 G;  3H1L H;  1TUE B;  1WPX A;  4LMY A;  4F50 A;  2MK3 A;  1BHB A;  1GM9 A;  1SFO A;  4CHI A;  4P2Z A;  2UXB O;  2OCH A;  2PGG A;  5KG4 A;  1YZB A;  3S3X A;  1UC9 A;  1Q7Y W;  3K08 A;  1NT2 B;  3R5H A;  3RT3 C;  2C2A A;  5EC2 C;  1MG1 A;  2JK5 C;  4W4K A;  1D2D A;  2HVS A;  4EBD A;  4GX5 A;  3CRR A;  1XEQ A;  3WU2 Z;  5BWV A;  5HNE A;  3LDD A;  2CUG A;  2R9R B;  5KG6 A;  1GO3 F;  4PA7 A;  1VAR A;  2AZ0 A;  3HB9 A;  2QWP B;  3GIP A;  3MWE A;  3FMA A;  1M57 C;  4LNU B;  1TVK A;  1N8R W;  5J2T A;  5B1B C;  4Z1M G;  5F9N A;  3R5X A;  2HGS A;  1P84 F;  3RYI B;  4RWU A;  2GBO A;  5H80 A;  3GTG A;  3WB1 A;  1QR8 A;  4QE7 A;  3LNM B;  1Q86 W;  4NTX A;  1L0L H;  1BXR A;  4JV5 H;  4ECR A;  2VQF O;  1Q6I A;  1OCC B;  3K79 A;  3G67 A;  5I5V A;  3RGX A;  3OMN B;  4Q6G A;  2ZNJ A;  4EG0 A;  4NXN H;  3FAV A;  4O7S A;  2FPI B;  3R9R A;  1SYX B;  1Y14 B;  3T9F A;  1FXK C;  4GZR B;  5LMN O;  2FLN A;  2RGR A;  3CXC U;  2ZM6 O;  3P32 A;  5IY5 B;  3N40 P;  1S97 A;  2X6B A;  1KTA A;  4LFB H;  5JVD B;  1Z2G A;  1XNR O;  3V4Z A;  3RBD A;  4IHJ A;  3ZRV A;  4PDV A;  1WRV A;  2HDK A;  4BWS C;  3CC7 V;  1NTK H;  1YTF B;  3HOX G;  2Z02 A;  4JGS A;  5KFU A;  2UUB B;  4JI5 B;  1CKO A;  3FX7 A;  4MA5 A;  3F5W C;  5LP6 A;  4J10 A;  5KHJ A;  5KG2 A;  1S10 A;  4TSF G;  3C90 A;  1IBM H;  3TXS A;  4D7T A;  2YI9 A;  1A3G A;  5KFO A;  1QQC A;  4X20 B;  3TIN A;  4RAZ A;  4N21 A;  2Y4U A;  1L0N H;  1YJN V;  1Y1W G;  5LHI A;  2P4V A;  3LDE A;  3RR5 A;  1KQS U;  1US6 A;  2W8K A;  3V6J A;  4XDL A;  2VS0 A;  4B3S O;  2R7M A;  2CQY A;  4DUY H;  2JA5 G;  2LO1 A;  2ZIO A;  4NZN A;  3NUA A;  1BL8 A;  1IOV A;  3MR3 A;  4DL7 A;  4LF4 B;  2JGD B;  2CH7 B;  1HNX B;  4J9R A;  3K9S A;  2RQ6 A;  3T1H O;  3PR5 B;  1R6N A;  4AI8 A;  2KG7 B;  2YZG A;  4KHP B;  2UVU A;  2GPS A;  1H2K A;  1SQG A;  2VA2 A;  4I50 A;  2QF7 A;  1YIJ V;  4UCU A;  2JA7 G;  3D8C A;  4O4J F;  4CS3 A;  4CBC A;  3G8C A;  1EKF A;  1EZJ A;  1XNQ B;  2NN4 A;  5L1L A;  5KG5 A;  1N36 O;  3OM3 B;  4EKW A;  1O9G A;  3JAR B;  3VBB A;  3G6Y A;  3KHL A;  3NC0 B;  3O9O A;  1CKM A;  3ZS8 C;  4CE5 A;  5BR8 H;  2CK3 G;  1OBD A;  4J80 A;  4X64 H;  4HYK A;  1S5H C;  5KFM A;  4A3D G;  4WF9 V;  4ICG A;  5F2V O;  1EUD B;  4O4L F;  5KFY A;  1OCZ B;  4A3M G;  1Q6H A;  1VQ4 V;  3BPZ A;  3GTM A;  3CCR V;  2QWN B;  4JAS A;  1W96 A;  2FP4 B;  4X8A A;  3NBY B;  3C3S A;  5HFL A;  1H2G A;  3S3W A;  3I55 V;  4LSX A;  4DV0 H;  3GTP A;  1HP8 A;  4LFC B;  3CYO A;  3T7A A;  2V4Q A;  3L4K A;  1A0G A;  2Q8V A;  1EZV H;  3FKI G;  3MWM A;  5JH7 A;  1LUV A;  1PL4 A;  2BOC C;  5IYC G;  4P9P A;  4JPR A;  5JQW A;  1JPX A;  4RNN A;  3BAB A;  2XT9 A;  1SEI A;  2A06 H;  2A9H A;  3ETJ A;  5CR5 A;  2YCH A;  1RK5 A;  3H1H H;  1BGW A;  1G6U A;  3E2E A;  4JI1 H;  1NR7 A;  5LMU O;  3AG1 B;  3CCE V;  4G3I A;  3NBZ B;  2R7Z G;  4ZOL F;  3B8M A;  5B1B B;  2IJH A;  4X62 O;  1VKZ A;  2GV9 A;  4QW9 A;  1K33 A;  2VQD A;  1QBZ A;  3TCU A;  3T9A A;  3CSX A;  3TET A;  1M6V A;  3UZO A;  4FGR A;  2YIB A;  2XHB A;  1TWF A;  3E8B A;  2V7Q G;  1DV1 A;  2UXN A;  3AG4 C;  1M7J A;  2XCA A;  2AGO A;  4DR2 B;  4LR3 A;  5KFZ A;  1Y66 A;  2PZS A;  2DAA A;  2L6L A;  1GN6 A;  4DR1 H;  5H5N A;  2UXB B;  4QJF B;  4H37 A;  2OCC C;  4R8U A;  3RGB A;  4Q43 A;  4FU0 A;  3G6B A;  4BIO A;  1FXK B;  4FZ1 A;  4DR5 O;  3G80 A;  5HBR B;  4GCZ A;  4D7S A;  5BYB A;  2CZG A;  3I5D A;  2F43 G;  1DLB A;  5KG1 A;  4B3M B;  5CAE B;  2VWJ A;  1N34 H;  4JI3 H;  5IT9 W;  1TAE A;  4ECZ A;  4DV5 B;  4I9W A;  2N05 A;  1UNN C;  1D5N A;  1O9H A;  2RN9 A;  1T94 A;  2ODT X;  2CW7 A;  2ZE7 A;  3B09 A;  1Y74 B;  5D8D A;  1KEC A;  3RB0 A;  3T5L A;  2R8K A;  3APO A;  2FPP B;  5IP7 G;  3WWH A;  4I55 A;  3GJX B;  4J7Z A;  1E1R G;  4A5U B;  1SC5 B;  1AI5 A;  2C2R A;  2YZM A;  1PPJ H;  2AGA A;  3G71 V;  1NTM H;  2Y48 A;  5KKN B;  1R9T A;  4O4J B;  1G1X B;  2WB1 E;  3KYH C;  2ZDI C;  3BJY A;  3KCY A;  1V55 B;  2CE4 A;  3J80 N;  2FE3 A;  2IW5 A;  3FB8 C;  5ITZ B;  4A3L G;  2ZGI A;  4LFA H;  2JS5 A;  3ZHT A;  5KFT A;  4J9O A;  3AK3 A;  5LMN B;  1CKN B;  2HHH B;  3OUU A;  1VS0 A;  2BSK A;  1NKD A;  1FJG H;  3IG0 A;  5EC1 C;  3CXH F;  4O4L B;  3PJS K;  3EHB B;  1ORQ C;  4A2A A;  4JV5 O;  4F6R B;  5C8Y F;  1YDX A;  2FLL A;  2R93 G;  3LSS A;  1L1F A;  5JWP A;  3SYC A;  5LYJ F;  2DWC A;  2E74 B;  3ETE A;  4DK1 A;  4A3G G;  4NXN O;  4ED2 A;  1Q8I A;  1R3K C;  2ZDQ A;  1QNM A;  3QF7 A;  3ZRW B;  4PA4 A;  2COI A;  4X88 A;  2YW2 A;  5CA1 F;  2X0S A;  5E1A C;  4O4I F;  3DXR B;  1MMM A;  3PR4 A;  3LQS A;  1JQ0 A;  4ZOL B;  5KFA A;  2L35 A;  2XAF A;  2F95 B;  2QE7 G;  4U3J A;  4PZ8 A;  5E25 A;  5J2U A;  2IJJ A;  1IBM O;  5HFM A;  3T1Y O;  3ETD A;  3JAS B;  5H6Q A;  5I5X A;  2HJW A;  3Q8Q B;  5IYZ F;  3PFF A;  3N2K B;  5LXT A;  3GV8 B;  3J81 N;  2ZE6 A;  3T1H B;  3RYC B;  3V6K A;  1B04 A;  3RVY A;  5F9L A;  3N41 B;  1L8D A;  4O3Q A;  1QLE B;  3L2P A;  3SJC C;  3FB6 C;  3J7A U;  4XDJ A;  4NXM H;  4M7E A;  5H9C A;  3U0Z A;  2A79 B;  4MVZ A;  4DUY O;  4TUY A;  1NBM G;  2X6A A;  1XMO H;  1N36 B;  3ZMZ A;  1M5I A;  3ASO B;  5KFX A;  5BWW A;  1S5L Z;  2HP8 A;  3E22 A;  1W0J G;  4B3R O;  3LWB A;  2CFM A;  5A2Q W;  1OV9 A;  4RZR A;  4ABM A;  2ZE8 A;  4TT3 G;  3AG4 B;  4DL5 A;  2HFE C;  4MVS A;  2QKS A;  3QVN A;  4O81 A;  1WP7 A;  2IJK A;  3CCU V;  4FM0 A;  3UCS C;  4YBZ B;  2OCC B;  5K3W A;  1GSO A;  3CPW U;  1RSO A;  4K8Z A;  2OH2 A;  1Y76 B;  2QM4 A;  3AEI A;  2A0L A;  2WAQ A;  4PZ7 A;  4G28 B;  4CH6 A;  3LSQ A;  2W6Q A;  5BR8 O;  2DYR C;  3RAX A;  4HNA A;  4X64 O;  1KU9 A;  1F4M A;  4FLY A;  4I0X A;  5LMU B;  2J6U A;  4IAJ A;  5EBM C;  1N0J A;  3SPC A;  4YR3 A;  2V4R A;  5C8Y B;  4X62 B;  2HIV A;  5EBW C;  5LYJ B;  4YJ2 A;  4JXU A;  5LL6 b;  5L3F A;  4ZQI A;  4X66 H;  1I08 A;  1GSA A;  4Q8E A;  3CEB A;  1KUQ A;  2BE3 A;  5KT2 A;  4RO2 A;  4IWX A;  3N42 B;  3E8G A;  1RYR A;  1DAA A;  5CA1 B;  1WB7 A;  1Z2N X;  4F4Y A;  4O4I B;  5L1K A;  2NVY A;  3Q1K A;  4QSH A;  4QWD A;  2YEV A;  1PNL A;  2XOK G;  3STL C;  2B9Z A;  2HJD A;  4ECX A;  4X1I A;  3M8A A;  3OEE G;  2BQU A;  3HKB A;  2EIN B;  2JEF A;  2WAM A;  1AJN A;  5DG8 A;  5KFF A;  3ORQ A;  2X7R B;  4O7Z A;  2WTF A;  5IYZ B;  3HKZ E;  4JI6 H;  2YL2 A;  3ABK C;  2GQS A;  3JRW A;  1VMG A;  4CH5 A;  4DR1 O;  4GX0 A;  1ZL8 A;  1Z5V A;  4NR1 A;  1PD3 A;  1SER A;  1XRE A;  1DGS A;  3UO3 A;  5LGU A;  1I5X A;  4FFO A;  4EGJ A;  2GSM B;  1BNC A;  3RV3 A;  2O03 A;  1KKC A;  5J2T F;  1N34 O;  4JI3 O;  4ECS A;  3VQX A;  2P6J A;  2JEU A;  4O82 A;  1UC8 A;  5LP6 C;  4BR6 A;  3OGC C;  2W7O A;  1BE3 H;  4X9Q A;  2YXY A;  4PD4 F;  2R8H A;  3B4S A;  4A3K G;  1IBL H;  2ILM A;  4U7N A;  4O7L A;  3T9D A;  4GX1 A;  4O83 A;  2DQ3 A;  2ZXW C;  5DGH A;  1TWC A;  5B1N A;  4M0J A;  2W9B B;  4K8X A;  2Z0A A;  1YJW V;  1JX9 A;  2VRZ A;  1N0N A;  3N43 B;  4RU9 A;  2C22 A;  4TV8 A;  1JVM A;  4CMD A;  1I0H A;  3QQM A;  3GWO A;  4K35 A;  5GON A;  4J11 A;  2P06 A;  3D3I A;  4AYB E;  2JS3 A;  3JD4 A;  3JD2 A;  4JV5 B;  2JA8 G;  4DV2 O;  1Q81 W;  2ZE5 A;  3RBE A;  4TV9 A;  1OBG A;  5KFI A;  4LFA O;  2WLI A;  3ZHS A;  1TA8 A;  4EGQ A;  1WCM G;  3SPJ A;  2C28 A;  4BXX G;  1B6R A;  4WFB V;  1MNG A;  1FJG O;  2HVJ C;  2B63 A;  3T9E A;  2IJI A;  3RW0 A;  5L1J A;  2YSU B;  4CC5 A;  4FLU A;  5KHG A;  4O4H F;  4QWB A;  3KCX A;  3H3V H;  4L1K A;  4F4X A;  2WWW A;  3RGZ A;  1AJP A;  4C5B A;  4GKJ H;  3T1Y B;  2C00 A;  3BCC H;  2B1I A;  1HNW B;  3OAA G;  3H4D A;  3MD0 A;  2HJF C;  3U9T A;  1URF A;  1NI8 A;  5KX5 F;  3NXS A;  1NR1 A;  4UVA A;  3JAM W;  1K83 A;  3QZ7 A;  1S3J A;  5KA6 A;  2WDT A;  5T14 A;  3TII A;  3K59 A;  3U10 A;  4BW9 A;  2DYR B;  3JSL A;  2IU3 A;  1I7F A;  1AP5 A;  3T99 A;  3JAW A;  5CBG A;  2W7P A;  3MR2 A;  4O7T A;  2P4K A;  2EIK C;  1R3I C;  2ATL A;  2W6Z A;  2JEX A;  3H1I H;  4B3R B;  5KFJ A;  3BHP A;  4QWC A;  1COW G;  4IL6 Z;  4IRC A;  2ODM A;  1DF5 A;  3E8F A;  1S72 V;  1Q82 W;  2DJV A;  4QW8 A;  4FFB B;  3T9C A;  2UVW A;  1GH6 A;  4L8J A;  3CCM V;  4NXM O;  1ZQ7 A;  1TVK B;  1U97 A;  5J2T B;  4GLX A;  1YSC A;  4LF7 B;  3K3V A;  5DM6 V;  2PMZ A;  4BW5 A;  4EEQ A;  5B1A B;  5TIS Z;  3AX6 A;  3TQT A;  4E6N A;  4U3F H;  5EWE A;  4O7W A;  3T5H A;  2R9I A;  2DQ0 A;  2NLJ C;  3SYA A;  2Q68 A;  1AP6 A;  5CN0 A;  1E1Q G;  1CEZ A;  4WFE A;  5GTH Z;  4ECY A;  2DYS B;  2ALZ A;  1GM8 A;  3FAV B;  1J5E B;  1E4E A;  4OPA A;  3Q4H A;  4IWY A;  4B7K A;  2EZO A;  4IT5 A;  4XYM B;  4MW3 A;  1Y1W A;  1VQL V;  4A2B A;  1F51 A;  4MVU A;  4ED3 A;  4RUE A;  4UFZ A;  3GIM A;  3PO3 G;  2E2I A;  5IWA B;  2J6T A;  4FK5 C;  2VQE H;  2W9C A;  1NS1 A;  1W0K G;  2NR5 A;  4JTC B;  1KC7 A;  1KT8 A;  4UCV A;  2JA5 A;  4DV7 H;  3TW6 A;  4EYH B;  5B3S C;  4JF3 A;  4OPH A;  1Z2P X;  1V51 A;  1OCO C;  3ABL C;  1VF5 B;  1QHT A;  3QNE A;  3ETG A;  3GII A;  4AQY H;  4WFF A;  1QCE A;  2ATK C;  4YR0 A;  1A32 A;  5DLG A;  4O3O A;  4O4H B;  2W6N A;  1WPB A;  3I4N G;  4RQF A;  4X66 O;  4LC1 A;  5I5W A;  1ZET A;  1I94 B;  1Z2O X;  2A3Q A;  3D36 A;  4ETS A;  4JI0 B;  4MTX A;  1BQ0 A;  4DV3 H;  3H1K H;  1EKP A;  1SQB H;  2LGQ A;  3UQ8 A;  4B08 A;  4O3P A;  4LF8 H;  1SF9 A;  1GGO A;  3EPI A;  4ED6 A;  3ZBH A;  3FD9 A;  1BJT A;  2UUC H;  5KX5 B;  1ULZ A;  2KKW A;  4JTA B;  2EIM B;  1UJW B;  2EIJ C;  3GTK A;  1N56 A;  2EBO A;  3RVZ A;  3RUP A;  4YY3 B;  4E2L A;  1FKA H;  4I55 F;  4GKK B;  1YVW A;  4ED0 A;  2R92 A;  3JAK A;  2GTA A;  5C44 G;  3JZI A;  3T9B A;  1E4F T;  2LQT A;  2XAS A;  3H1J H;  2UU9 O;  4DR7 B;  4YJ3 A;  3LUT B;  2DIK A;  4JI2 B;  4BWA A;  4ZIB A;  3FKI A;  3UT5 A;  2PYJ A;  2I8C A;  2ZDH A;  5JQG F;  2V9W A;  1M0W A;  5IP9 G;  2NU8 B;  2FMA A;  4YHH H;  4CC6 A;  5EZY A;  1Z5W A;  2D3O W;  5LHG A;  2SCU B;  3OUZ A;  4DV2 B;  3OHB A;  2R7Z A;  3ETQ A;  5KG3 A;  4PA6 A;  5BPF A;  1E4G T;  3OTO B;  3GVM A;  1PKX A;  3W7X A;  1N33 H;  1IBL O;  4LF6 B;  4YR2 A;  1N32 B;  5DG7 A;  2QTS A;  4DRX B;  2UXD B;  5IJ9 A;  3CCL V;  2R8G A;  5EWG A;  3THO A;  2B1G A;  2ZNI A;  3HPL C;  1EN5 A;  2UUA O;  3AK2 A;  4JZ2 A;  5GTI Z;  3TEK A;  1AR1 B;  3JCU Z;  2E76 B;  4FLZ A;  5C1O A;  2Q2U A;  1S0M A;  4CS4 A;  1X9N A;  5KT6 A;  5BMV F;  4DUZ B;  4U7C A;  4FBT A;  4JYA H;  5CE8 A;  3JAL A;  5DN6 G;  3CEI A;  3IJ4 A;  4J9P A;  1D5A A;  3WO1 A;  4JV0 A;  2PI5 A;  4FFR A;  3CS5 A;  4IYI A;  2ZD9 A;  4DK0 A;  4OX9 H;  4JI4 O;  2P22 C;  2XC9 A;  2UXX A;  2ARH A;  1R6K A;  4JYY A;  3JD0 A;  5LBQ A;  3DTU B;  4ECW A;  3KG2 A;  2H94 A;  4P9O A;  4J7K A;  1OCR C;  1R3L C;  3T54 A;  3K5I A;  2VUM A;  1XMQ H;  4DV1 B;  2F4V O;  4YQW A;  4FLT A;  4F4Z A;  5LXT F;  1EN6 A;  4UUJ C;  4GKJ O;  2XND G;  5FPO A;  4MA0 A;  2UXC B;  2Q7D A;  1B06 A;  4O84 A;  4YIO A;  4B3T B;  1CS0 A;  2KSW A;  1JMK C;  3UFX B;  5IJ0 B;  1PV0 A;  1AI7 A;  2YXL A;  4EBE A;  4JI7 H;  2ADP A;  5IYB G;  1AJQ A;  3CC4 V;  3DC6 A;  4TUY F;  1FXV A;  4LSA A;  2DAB A;  5KHH A;  3M7M X;  2RGV A;  2OYQ A;  5CBH A;  4O2A A;  4I55 B;  1GN3 A;  1EKV A;  4HNT A;  3QWU A;  1RJQ A;  4DL2 A;  2WLM A;  4PI2 A;  1KBL A;  1IYE A;  4TQS A;  4FM9 A;  1GN2 A;  1IBK H;  4C5C A;  5EOY A;  2FTK A;  1KBH A;  2KB1 A;  2YIA A;  3D3Q A;  1IXB A;  1NTZ H;  3K57 A;  5JQG B;  5BWT A;  4O2B F;  4Q4D A;  4R7R A;  4O3R A;  1K4C C;  2DMX A;  2P7T C;  1R1B A;  1S9F A;  2JEJ A;  3ZN0 A;  1EM1 A;  4NTW A;  2R7N A;  3N6R A;  4DR6 H;  3CRQ A;  5DGB A;  5FJ8 G;  1NZ6 A;  1ET0 A;  3RIZ A;  3M9N B;  1S03 G;  2N74 A;  2OIE A;  2E5L H;  1JJ2 U;  4X1K B;  3X2Q B;  1S0V A;  4GYC B;  3CC2 V;  4CMF A;  3ZIA G;  4DR4 H;  2W0F C;  3OT7 A;  1YEW A;  1AUX A;  3Q8R B;  3LDC A;  1FFX B;  3ICX A;  3SR2 C;  2W9A A;  2Q69 A;  4YJ2 F;  5L9X A;  4J7J A;  3OTF A;  5BMV B;  3HKE B;  2K1E A;  1Y67 A;  3U0G A;  2Y4T A;  2RNB A;  4ECT A;  4DRF A;  3ZHV A;  1YCI A;  1GYF A;  4ECV A;  3JD1 A;  5DLF A;  2CGO A;  5IYD G;  4DV4 H;  1FYJ A;  3K06 A;  2VQE O;  2R82 A;  3Q8S B;  4FLX A;  5LA6 A;  4LF5 H;  1NH2 D;  2Q73 A;  4DV7 O;  1WNS A;  4QIW A;  2P5O A;  1M57 B;  2M7W A;  4C5A A;  2WAQ E;  3RYH A;  1ZX3 A;  4K0K B;  5DIS C;  2HVR A;  5FD6 A;  4U3J B;  4A93 G;  5D1O A;  4X1Y B;  4RB0 A;  2Y4R A;  1KB9 F;  3GLK A;  1GRJ A;  3GV7 B;  3IN5 A;  5LXT B;  4R7C A;  2WSS G;  3JZ6 A;  3RB3 A;  4P30 A;  1ENV A;  4PJ0 Z;  4DV3 O;  4DIM A;  4X65 H;  4FIP C;  1A48 A;  4PHZ A;  2UU9 B;  5JVD A;  4Y8V B;  3QO5 A;  3FB5 C;  4LF8 O;  2XUM A;  2HVK C;  2Q7G A;  2Q6A A;  2UUC O;  5LHH A;  4TUY B;  2PY5 A;  3W7U A;  4FZ0 A;  3F8N A;  3RF2 A;  2CKZ B;  4DR3 H;  1QU7 A;  3E22 B;  3ZMT A;  4PDR A;  1FKA O;  4X20 A;  3S24 A;  1KKD A;  5D5P A;  2IP4 A;  1HR0 H;  2QM8 A;  1K34 A;  1M4U A;  4UUG A;  1H8E G;  2OLS A;  3H4B A;  3DTF A;  5GON F;  2HHF B;  2NNU A;  3MAQ A;  3GIQ A;  1I2L A;  1FXH A;  2UUA B;  5KHK A;  4O2B B;  1RSO B;  4HYO A;  2VQF B;  4MVQ A;  2ETN A;  4KUM A;  3QFF A;  4K3A A;  1B6Q A;  4X89 A;  2YRX A;  4AHC A;  2JGD A;  2QSA A;  5A2Q N;  2BR0 A;  5C5J A;  2CH7 A;  3AG2 C;  2ZM6 B;  2WLN A;  3IC7 A;  3CRA A;  1K5Q A;  2KG7 A;  3CCS V;  1R73 A;  3JRX A;  4QGP A;  4JI4 B;  1XNR B;  1VAJ A;  4YJ2 B;  4FMT A;  1RPR A;  3W1B A;  2CTW A;  2ZR3 A;  2X5R A;  3CE2 A;  5CA0 A;  3C0F B;  4MV9 A;  5CB4 A;  2BQR A;  4JYA O;  1KJJ A;  4ED1 A;  3SGI A;  2F4V B;  5C4X G;  2YRW A;  1JXL A;  3OEH G;  1WA8 B;  3RBZ A;  2WYO A;  2YEV B;  4JYB A;  4Q20 A;  1KC8 W;  3J7A K;  4IRD A;  1DTO A;  3Q2O A;  1ZAU A;  3ZHU A;  3GB7 C;  4LFB O;  1MAB G;  5BXZ A;  4OX9 O;  4X1I B;  4YAK B;  3OSP A;  1ZHS A;  3HKB B;  2Q2T A;  1V9P A;  1RM1 C;  5KMG B;  1GK9 A;  2DOS A;  4YXW G;  2E2H A;  4B3S B;  1B3Q A;  1XK5 A;  1K9M W;  3CRC A;  1EFR G;  1H38 A;  1H8H G;  3R65 A;  3I12 A;  1I1L A;  5AG2 A;  1XMQ O;  4J9Q A;  1TUB B;  4MSW C;  1VF7 A;  2YIB D;  4I4T F;  1FVI A;  2P67 A;  5FNV F;  2UUB H;  5KG0 A;  3SJB C;  3E86 A;  1BS3 A;  5FD5 A;  2IA6 A;  1K8A W;  4J9Z B;  3LP8 A;  1LUW A;  4JI7 O;  1P16 A;  1WCM A;  3UKM A;  5CA3 A;  1CQI B;  4RUA A;  1I1K A;  5KFG A;  2PTM A;  1AI4 A;  3OFN G;  4FS1 A;  2WA3 A;  2HR3 A;  1YJ9 V;  2JJ1 G;  2JA6 G;  4JUZ A;  3CJH B;  3K04 A;  4IZO A;  3HO8 A;  4L87 A;  4NB5 A;  4PV1 B;  4RQE A;  5B1O A;  5IYC O;  2RDJ A;  3D36 C;  4ECU A;  1NQT A;  4QJF A;  3K3P A;  5GON B;  4PDB A;  1F4N A;  1IBK O;  1BGY H;  3KAJ A;  1Q5O A;  4LF4 H;  2GUZ A;  3RFC A;  1VQP V;  1BSM A;  3E89 A;  3FKS G;  4MV7 A;  5LOV F;  1HNX H;  3J80 W;  3OMA B;  4WBN F;  2Y0S A;  4KHP H;  4B7E A;  2XAH A;  1Y74 A;  4EB6 A;  2ZDG A;  3VNN A;  4GC6 A;  3VQW A;  3TK1 A;  2PMZ E;  2E5L O;  3ABU A;  1XDN A;  4NKG B;  3RFR A;  1XBL A;  3K5L A;  4C2M A;  4DLK A;  1XNQ H;  1PNM A;  2A1H A;  4DW0 A;  3A0H Z;  1KYO F;  3APQ A;  4RAI A;  1E79 G;  2Q0O C;  5DED A;  5EK0 A;  1FAF A;  3E5N A;  4DV0 O;  2W70 A;  2R6F A;  4Z1V A;  4EEY A;  1S77 D;  4ZI7 F;  3HOV G;  3ZHR A;  1SA0 A;  2V59 A;  4YAJ B;  1SQP H;  4UV9 A;  5ITZ A;  1AN7 A;  4ZHQ F;  1CKN A;  4IIJ F;  5KFR A;  1GMG A;  2WLK A;  4DV4 O;  3QO7 A;  2X6C A;  2EZP A;  2ZCE A;  4M9U A;  4LF5 O;  5KT3 A;  4JI1 O;  5KLV H;  1P8L A;  4LFC H;  4NYK A;  4O4L A;  4DR5 B;  1VBG A;  1W59 A;  1I5Y A;  1EHI A;  2W57 A;  3K03 A;  1HW7 A;  3SJA C;  2CGN A;  4MVO A;  4JV1 A;  3AG2 B;  3QO8 A;  5KFE A;  3L71 H;  5I5S A;  1XQ8 A;  3WG7 C;  1GSH A;  4J9K A;  2XCL A;  4UCS A;  2LP7 A;  3JAT A;  4DXW A;  1SES A;  4I4T B;  3K58 A;  2QWR B;  3HKC B;  4EQ5 A;  1C3O A;  3ZRW A;  5FNV B;  5BYA A;  4YJ3 F;  1RYS A;  4NLG A;  1XI1 A;  1VQO V;  3J81 W;  1H2M A;  1ZUQ A;  2CTP A;  4HNU A;  4DAA A;  3UM7 A;  1UFI A;  4X65 O;  2AQ4 A;  2FB5 A;  3DXR A;  3JAM N;  2YS8 A;  3T4D A;  1YXB A;  3U54 A;  3RB4 A;  3H40 A;  4I7H A;  5EZY F;  1GM7 A;  4DR2 H;  1SKV A;  3V4S A;  1MZF A;  2FKL A;  1C30 A;  1ROP A;  1KJQ A;  2AHZ A;  5JCO A;  5CMU A;  2UXB H;  4XZ3 B;  4DR3 O; 
#chains in the Genus database with same CATH homology
 5JJN B;  1HNX B;  2RQ6 A;  3JAS A;  4TQF A;  1FFX A;  3KXY T;  4O4H B;  4UCR A;  4KHP B;  3GDE A;  1JFF B;  4B3M H;  3JAT B;  1SQG A;  1WPB A;  4I50 A;  3RYC A;  5BMV A;  5EYP B;  3HKE A;  4UCU A;  4DV5 H;  1I94 B;  1Z2O X;  4CS3 A;  4ETS A;  4MTD A;  4JI0 B;  4DV3 H;  4RB1 A;  2JGU A;  1XNQ B;  2EX3 A;  4FLV A;  5LOV B;  4JI5 H;  1O9G A;  3JAR B;  3UQ8 A;  4B08 A;  1MZB A;  4LF8 H;  4WBN B;  4NXN B;  1BJT A;  1HNZ B;  2UUC H;  5KX5 B;  3NC0 B;  2KKW A;  1CKM A;  3ZS8 C;  4DV1 H;  5BR8 H;  3HKD A;  4X64 H;  4X1Y A;  3TY9 A;  4YY3 B;  2Q7E A;  1FKA H;  2UXC H;  3BPZ A;  4GKK B;  4LFB B;  4B3T H;  3JAK A;  3NBY B;  3H20 A;  4DV0 H;  4LSX A;  2BTO A;  2YI8 A;  4LFC B;  1E4F T;  2HHH H;  4TV8 B;  4DR7 B;  4ZI7 B;  2VWK A;  4YJ3 A;  3L4K A;  3QTC A;  4JI2 B;  5JH7 A;  3MWM A;  4BWA A;  4ZIB A;  1IBM B;  4RAY A;  3UT5 A;  2PYJ A;  4ZHQ B;  4CH4 A;  4IIJ B;  1S5J A;  2V4D A;  4TV9 B;  3BAB A;  1M0W A;  1SEI A;  2VPS A;  2YCH A;  4YHH H;  4CC6 A;  5EZY A;  1Z5W A;  1G6U A;  1BGW A;  4JI1 H;  3NBZ B;  4DV2 B;  5EIB C;  3N2G A;  5D5Q A;  3ETQ A;  1E4G T;  2GV9 A;  3HKD B;  3RWR D;  3OTO B;  3CSX A;  1N33 H;  4LF6 B;  1SQF A;  2YIB A;  2XHB A;  1N32 B;  4DRX B;  2UXD B;  5IJ9 A;  2VQE B;  3THO A;  5LYJ A;  4DUY B;  3K5M A;  4DR2 B;  4LR3 A;  2ZNI A;  4DV7 B;  2PZS A;  4FLZ A;  4DR1 H;  4O4J A;  2Q2U A;  2CAZ C;  2IM9 A;  4CS4 A;  2UXB B;  4YJ3 B;  4AQY B;  1X9N A;  3DSQ A;  4DUZ B;  1HNZ H;  4JYA H;  3RGB A;  5CA1 A;  3JAL A;  4O2B A;  4O4I A;  1D5A A;  4LH7 A;  4D7S A;  1L2Z A;  4B3M B;  5EZY B;  2VWJ A;  1N34 H;  4JI3 H;  5IT9 W;  1TAE A;  4DV5 B;  3N2G B;  4DK0 A;  1O9H A;  3RYF A;  4OX9 H;  2P22 C;  1P49 A;  4DV3 B;  2CW7 A;  3T1H H;  1M93 A;  2ZJT A;  1A0I A;  2QJ1 A;  5IJ9 B;  4LF8 B;  4I55 A;  4RZQ A;  4APM A;  3GJX B;  2UUC B;  4F6R A;  3JAW B;  1XMQ H;  4DV1 B;  2E5L B;  5BR8 B;  4FLT A;  4O4J B;  4X64 B;  4JI8 B;  3KYH C;  5FPO A;  3K5N A;  1N36 H;  2UXC B;  4LH6 A;  2Q7H A;  2OWO A;  4K0K H;  2VUG A;  4B3T B;  2FE3 A;  2KSW A;  5ITZ B;  1JMK C;  4UCO A;  4LFA H;  2JS5 A;  5IJ0 B;  4DV0 B;  2YXL A;  1JJO A;  4JI7 H;  4FVM A;  3A2F A;  5LMN B;  1CKN B;  2HHH B;  1VS0 A;  4ZOL A;  3RYF B;  1Q3E A;  1FJG H;  3IG0 A;  4IHJ B;  3TY8 A;  4LSA A;  5KMG A;  3QG5 A;  4MTE A;  4O4L B;  5KHH A;  3M7M X;  3ZED A;  2OYQ A;  2RGV A;  4O2A A;  5LP6 B;  4I55 B;  1S68 A;  4YHH B;  4A2A A;  4JI1 B;  3QWU A;  4F6R B;  2UU9 H;  1TUB A;  4PI2 A;  4DK1 A;  3N2K A;  2JVD A;  3W1G A;  1Q8I A;  4FM9 A;  1N33 B;  1IBK H;  5EOY A;  2YIA A;  3QF7 A;  2PUS A;  3K57 A;  5JQG B;  5FLX W;  4PI0 A;  4R7R A;  5LMU H;  3GB8 B;  5K1X A;  4X62 H;  4DR6 H;  4ZOL B;  4DR1 B;  3RJ0 A;  4JYA B;  3RIZ A;  1S03 G;  2VOB A;  2E5L H;  3VQY A;  4X1K B;  2F95 B;  3DF7 A;  4GYC B;  4U3J A;  4JI8 H;  4DR4 H;  1YEW A;  4PZ8 A;  2UUA H;  5J2U A;  1N34 B;  4JI3 B;  4I9Q A;  2VQF H;  3JAS B;  3U11 A;  1FFX B;  3ICX A;  3SR2 C;  4OX9 B;  3N2K B;  5LXT A;  3T1H B;  4I50 B;  3RYC B;  5LMN H;  1B04 A;  3OTF A;  5BMV B;  3HKE B;  3N41 B;  1L8D A;  4DRF A;  4EFB A;  3L2P A;  3SJC C;  2ZM6 H;  5K1P A;  4NXM H;  1GYF A;  5KHI A;  4M7E A;  3U0Z A;  2RJZ A;  1XMQ B;  4DV4 H;  1O75 A;  3HXL A;  4JI4 H;  1XNR H;  4FLX A;  4LF9 B;  5LA6 A;  4TUY A;  3CHX A;  4LF5 H;  1XMO H;  1WNS A;  4Q0Y A;  1N36 B;  2P5O A;  2CW8 A;  1M5I A;  1I6U A;  5FPR A;  3RYH A;  4K0K B;  5DIS C;  2HVR A;  5FD6 A;  2XIG A;  3E22 A;  4U3J B;  4LFA B;  5D1O A;  4X1Y B;  4JI7 B;  2CFM A;  5A2Q W;  4FLW A;  2F4V H;  4RB0 A;  5C8Y A;  3N44 B;  1T5E A;  2R72 A;  1FJG B;  3JAK B;  5LXT B;  1M0T A;  1H2S B;  4FFB A;  4FM0 A;  4X65 H;  1Q43 A;  4PHZ A;  5JH7 B;  1RSO A;  4K8Z A;  3UT5 B;  5JVD A;  2UU9 B;  4B3S H;  3VQV A;  3B2E E;  4DV6 B;  2QM4 A;  2Q7G A;  4PZ7 A;  5LA6 B;  4TUY B;  2PY5 A;  4CH6 A;  2BTQ A;  1IBK B;  3WB0 A;  3F8N A;  3RF2 A;  3RYH B;  4HNA A;  1KU9 A;  4DR3 H;  4FLY A;  3E22 B;  2E3C A;  5D1O B;  5LMU B;  4HBN A;  4X20 A;  4IAJ A;  5C8Y B;  4X62 B;  2HIV A;  3BRC A;  5D5P A;  4DR6 B;  3S24 A;  1HR0 H;  5IYZ A;  4I4T A;  1M4U A;  5LYJ B;  4YJ2 A;  3HKC A;  5LL6 b;  3TY5 A;  4TQD A;  4TOI A;  5FNV A;  4X66 H;  3W5O A;  3BA9 A;  3MAQ A;  4LF9 H;  4DR4 B;  2UUA B;  3N42 B;  4NVP A;  5KHK A;  5CA1 B;  3JAL B;  4O2B B;  1Z2N X;  2VQF B;  4O4I B;  2PYL A;  3L4J A;  2WE6 A;  2Q0A A;  4AHC A;  2BTQ B;  4X1I A;  3IAY A;  4FM1 A;  3HKB A;  2F66 C;  2ZM6 B;  4NXM B;  5D1P A;  3T1Y H;  3WB2 A;  4O4H A;  4DV4 B;  1WH2 A;  5EIB D;  4JI4 B;  1XNR B;  1JFF A;  3EYY A;  1HNW H;  4YJ2 B;  5IYZ B;  5EYP A;  4LF5 B;  4JI6 H;  1XMO B;  3W1B A;  4EFE A;  5CA0 A;  3C0F B;  4CH5 A;  4DV6 H;  4MV9 A;  1Z5V A;  5CB4 A;  5LOV A;  1DGS A;  3SGI A;  2F4V B;  4WBN A;  1X4T A;  2ZIN A;  5KX5 A;  2WYO A;  2O03 A;  4FM2 A;  4KL1 A;  3VQX A;  3J7A K;  1ZAU A;  5LP6 C;  4X1I B;  4B3R H;  1ZHS A;  4X65 B;  1ZHQ A;  3HKB B;  2Q2T A;  1IBL H;  1V9P A;  5KMG B;  5JJE B;  3KAK A;  4B3S B;  1XK5 A;  4O2A B;  4K8X A;  3N43 B;  3K5O A;  4TV8 A;  4ZI7 A;  1TUB B;  5CA0 B;  3M4I A;  1VF7 A;  2YIB D;  4LF7 H;  1FVI A;  2F1M A;  4CH3 A;  5GON A;  4DR3 B;  5CB4 B;  4J0M A;  4JV5 B;  4DR5 H;  4ZHQ A;  2UUB H;  4IIJ A;  3SJB C;  4TV9 A;  5FD5 A;  2HIX A;  4RB2 C;  1XHZ A;  1HR0 B;  1TA8 A;  4LNU A;  1P16 A;  5JJJ B;  4X66 B;  3PN1 A;  5JCO C;  2PTM A;  1J5E H;  3RYI A;  1KMI Z;  4DRX A;  4LMY A;  3JSN A;  2PGG A;  4CC5 A;  4FLU A;  5IWA H;  5KHG A;  5J2U B;  1NT2 B;  2HEP A;  4UCT A;  2HVS A;  3LNN A;  5GON B;  3RGZ A;  4GKJ H;  4PDB A;  3T1Y B;  3KAJ A;  1Q5O A;  4LF4 H;  3FFQ A;  4CS2 A;  1HNW B;  4MV7 A;  1HNX H;  3J80 W;  3FMA A;  4LNU B;  1TVK A;  4JI6 B;  5J2T A;  4KHP H;  3N6X A;  3JAM W;  4EB6 A;  3VNN A;  2HGS A;  3RYI B;  2WDT A;  3VQW A;  1I94 H;  3K59 A;  3U10 A;  3WB1 A;  1XDN A;  4BW9 A;  3RFR A;  4JI0 H;  3K5L A;  3JSL A;  1I7F A;  1XNQ H;  3JAW A;  4JV5 H;  3RGX A;  4Q6G A;  2ZNJ A;  4NXN H;  4B3R B;  3CVZ A;  3BHP A;  1SYX B;  2F93 B;  1IBL B;  1SA0 A;  3RTX A;  5ITZ A;  2RGR A;  1AN7 A;  3BA8 A;  4FFB B;  5IJ0 A;  4RB3 C;  4L8J A;  4YY3 H;  1CKN A;  3N40 P;  1TVK B;  4AIL C;  5J2T B;  4GKK H;  4GLX A;  1WN7 A;  5JVD B;  4LFB H;  4LF7 B;  3K3V A;  4IHJ A;  2ZCE A;  4BWS C;  4EB6 B;  4EEQ A;  1P8L A;  4LFC H;  4O4L A;  3CB2 A;  4DR5 B;  2UUB B;  4DR7 H;  4E6N A;  4JI5 B;  1CKO A;  2W57 A;  1HW7 A;  3SJA C;  5LP6 A;  5KHJ A;  3KAL A;  4HNA B;  4JI2 H;  2HVQ A;  1IBM H;  4D7T A;  2YI9 A;  1TGO A;  1XQ8 A;  1QQC A;  4X20 B;  4RAZ A;  2R9A A;  4UCS A;  3JAT A;  1J5E B;  4PZ6 A;  4I4T B;  3K58 A;  3HKC B;  4DV2 H;  1SA0 B;  4EQ5 A;  5FNV B;  5JQG A;  3RR5 A;  1XI1 A;  4A2B A;  2ZIM A;  3J81 W;  3OTO H;  3LML A;  4LF6 H;  4UFZ A;  5IWA B;  1N32 H;  2MCT A;  3JAR A;  2UXD H;  2VQE H;  2R70 A;  4I7H A;  4DUY H;  4DR2 H;  1SKV A;  4UCV A;  4GKJ B;  2ZIO A;  4DV7 H;  1XHX A;  4X1K A;  1Z2P X;  3BAA A;  4LF4 B;  5JCO A;  2UXB H;  4AQY H;  1QHT A;  4DUZ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...