3BAVA

Crystal structure of l26a/d28n mutant of human acidic fibroblast growth factor
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
141
structure length
141
Chain Sequence
HHHHFNLPPGNYKKPKLLYCSNGGHFLRIAPNGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A logical OR redundancy within the Asx-Pro-Asx-Gly type I beta-turn motif.
pubmed doi rcsb
molecule keywords Heparin-binding growth factor 1
molecule tags Hormone
source organism Homo sapiens
total genus 39
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3bavA00
3RMXA 2BEAA 4LO2C 1V6WA 4EKXB 1JTCA 4IHZA 3UJ0A 2VUAA 7I1BA 1HWPB 1PC8B 2HWMA 1QXMA 5EG6C 1AXMA 1AF9A 2WRYA 5DSSB 2IHOA 4TLPA 4ZKTB 3H6RB 1S0CA 1YBIA 1IJTA 4AN7B 1GGPB 4XKIA 5BXTA 2AAIB 3D7WB 3CAHA 3R4UA 4I1EA 1XG6A 3CA5A 3UDAA 1JT3A 3RSJA 3BB2A 1FGAA 1BFFA 4J2XA 1HWNB 3N7LA 2DREA 2Q9XA 2NP0A 3BTAA 3S8JA 3HOMA 1F31A 1SR4A 4QC4A 3O3QA 3N7JA 3VUOA 3CRIA 4ZFWB 4QBVA 2R9KB 3AJ6A 3WO2A 1HCDA 3CA0A 4QD2C 3K1XA 1ISVA 1YYNA 4IZXA 2L5XA 4GP0A 1HWOB 2DRYA 4HJJA 3BAQA 3O4CA 4A7KA 4I37A 1DFCA 1JY0A 3AH2A 3BAGA 4GOVA 4X3AA 2NZ9A 4LO0C 3AZWA 2BFHA 3PUBA 4J2SA 1BASA 1HCEA 1VCLA 3H6SE 4I6IA 2P23A 4GAIA 4ZGRB 2GO2A 1V6VA 3RTIB 4DEPA 3CRGA 3FJ9A 4IZEA 1D0HA 4EFRA 4KEKA 4OWLA 5DVHA 2DS0A 1ILR1 1IHKA 1SR4C 3I2AA 1RMLA 3ZXDA 1S0BA 2Z48A 1II4A 4P0LA 4OEFA 1ISXA 3N7MA 4Z8SB 3N0KA 3NBEA 1XHBA 2Y9FA 3FJAA 3IIRA 4ISRA 3FGMA 3VEQA 3O5WB 4EFPA 5BQUC 1Q1UA 2I1BA 1OQLB 4G6JA 1AVWB 5DUYA 1BLAA 1WD4A 2BEBA 1J0SA 4JKQA 2FFVA 1G9DA 2XOAA 4G1RA 3C9ZA 2ET2A 3I2XA 2RSTA 4KEJA 4R6UB 1FN0A 2FFUA 5GAQA 1FMZA 4AN6A 3HMYA 1JQZA 1ISYA 4KC3A 4X38A 5BXPA 1MC9A 1ISZA 1S0EA 3FJ8A 1FQ9A 3HBWA 1JT7A 4USOA 3S8KA 4I4YA 1EYLA 3NJ5A 3FUOA 5E24E 4OUJA 5D61A 1T9FA 3IM6A 3FJFA 2D1ZA 2K4AB 4KBBA 2UUSA 4I8MA 4FGFA 3O49A 2VXRA 1Q04A 4J23B 9ILBA 1W3FA 3OJMA 4LO7C 4J2KA 1I1EA 3NBNA 4LO3A 1WD3A 4PC4A 2ZR1B 2D44A 5EHAA 2HWAA 4QD2B 3AKGA 2Y9XE 4X39A 1T4QA 2D20A 2K8RA 3O4BA 2FGFA 3T8SA 1TOOA 3OJ2A 1TTUA 1G9AA 2AQZA 3A23A 3H6RA 4ISQA 5F90A 3ZC9A 4Q9PA 1FWUA 4I4RA 2K43A 2MIBA 2KLLA 1DZCA 4JRAA 3AKFA 3NBDA 4A7YA 2ERMA 1IRPA 4XFUA 1N4KA 3JRRA 5BP5A 3P6JA 4F34A 2E4MA 4ZFUB 3WO3A 3PHZA 21BIA 3BRFA 1TWMA 3FJJA 3UD9A 2YUGA 4II0A 1ISWA 1Q03A 3A07A 2VXTI 4USPA 1PZZA 4LO3C 3VT0A 3A22A 3BAHA 3CA1A 2VU9A 4D0ZA 3FFZA 1PWAA 3FJEA 3P53A 4I4PA 4DENA 3EF2A 4EEEB 2ESUA 4Z9WB 3F62B 1AVXB 2VSEA 1HKNA 4I0YA 4I2SA 4ZBVB 3IM7A 4G9NA 1DZDA 3UD7A 1V6UA 2NTDA 1WBAA 1ABRB 4IQPA 5F8YA 5FZUA 3BAOA 5F8SA 4HR6C 3FJKA 4IY9A 4A7ZA 1JLYA 3BA7A 4ENDA 2QYIB 3FJDA 4IYBA 2MC2A 1PUMB 1AFCA 4ZLBB 2D22A 1FWVA 5F8WA 4OWKA 3W9TA 3BA4A 3OJVA 3ZC8A 3R4SA 3RTJB 4G9MA 4I96A 4F83A 1W3GA 2MLLB 4LO1A 3V0AB 1UPSA 1TIEA 1JT4A 3O4OA 3BADA 3LTQA 5D63A 3CRHA 4Q91A 3VT1A 4ZA3B 1G9CA 1RZOB 4J2YA 2VLCA 4JKXB 3CU1B 1AVUA 4OEEA 3WMVA 31BIA 1G9BA 3V0BB 1TWEA 2HW9A 3WO4A 1DIWA 1FV3A 4LO7B 1E0OA 4JQ0A 4QKSA 4LO2A 2VSAA 2P39A 3IM5A 3JUTA 3TC2A 3MPPG 4HA2A 5FZYA 2AXMA 5DZUA 1FV2A 3VSZA 3QR5A 2Y9WC 1IT0A 5EC5A 1DLLA 2D7RA 3FJCA 1YTOA 1CE7B 4QBCA 4ZFYB 1XYFA 4L4HA 4LO1C 8I1BA 1K5UA 2GZBA 1G82A 1V6XA 3WINA 1M16A 1S0FA 3OBRA 5FNWA 1Z4SA 3RMYA 2D23A 3AH1A 1BLDA 1WBCA 2NM1A 4XFSA 2Y9GA 1TFMB 3BX1C 3I29B 3FJHA 4GAFA 3FUQA 3A21A 2Z49A 4G6MA 4I4XA 3VSFA 5FNXA 5G00A 3UD8A 4I4UA 1EPWA 3VWCA 4I4OA 3VT2A 1BARA 3BAUA 4Q9GA 3BRDA 1DQGA 2HZ9A 1QQKA 4OWJA 2F8XC 4QKRA 3KMVA 4LO0A 1YXWA 1NZKA 2KH2A 1MD6A 4ZOTA 1IILA 1S0DA 1ONKB 3FJIA 3WA1A 4X37A 3AH4A 4L4IA 1BA7A 4H04A 3WINC 1S0GA 3CA6A 5BXSA 4EB2B 1W3AA 3BA5A 1PUUB 3BAVA 2FO1A 5BOWA 4H9WA 1EV2A 2KKIA 2D7IA 4LO8B 2RQ9A 1R8OA 4OW4A 1TP0A 3PMEA 2F2FA 3HN1A 3PG0A 1BFBA 3B9UA 2KI6B 3AKHA 4FVVA 5D62A 3UJ4A 5JLVA 1JLXA 5BQUA 1ITBA 1HIBA 1DFQA 1L2HA 1RY7A 4QO3A 3NBCA 3CQAA 4DCKC 5BP5C 2E4MC 1QQLA 4I4QA 1NUNA 2KI4A 41BIA 3N7KA 1IRAX 2X2SA 3H6QA 3LLPA 3O44A 4D8HA 4EFQA 4I3NA 3QYDA 4IONA 1A8DA 3OBTA 2RG9B 5HPZA 3WMUA 1JT5A 2WBCA 3P6IA 3Q7YA 4JPZA 3OGFA 4OEGA 3AZVA 1K5VA 3ZXGA 4I4VA 4YOLA 1IOBA 5BXRA 3BRGC 4JP0A 3AKIA 3MALA 1XZZA 2M49A 1EVTA 2NVHA 2F2FC 2LIEA 4QALA 2X2TA 3SNVA 3V0AA 1Z2VA 4WBCA 3AJ5A 4I4SA 3HALA 1P63A 1SZ6B 3F1RA 2AFGA 2IWTB 4JAWA 5FZZA 4CJMA 1I1BA 2QN4A 3OGGA 3HSMA 3O4AA 4KEIA 6I1BA 3V79C 3CA4A 4GP3A 3Q7WA 4I7IA 2Q3NB 5B2HA 1KNMA 4I1BA 3V0BA 2ZQNA 1AVAC 2J3PA 1RG8A 2DRZA 1HWMB 1DQOA 3Q7XA 4P6AA 3FJBA 3ZX7A 4P0JA 4D0TA 3E8LC 5BVPI 3O4DA 1M2TB 4P0KA 2D43A 2FDBM 3IAGC 3ILAA 4IY8A 1BFCA 1Z0HA 5I1BA 3POKA 1FMMS 1BFGA 1CVSA 2D24A 2NYYA 2ZQOA 5JMCA 1R8NA 2LIQA 1S0LA 4XFTA 4GOYA 3CA3A 1YF8B 1DJSB
chains in the Genus database with same CATH superfamily
3RMXA 2BEAA 4LO2C 1V6WA 4EKXB 1JTCA 4IHZA 3UJ0A 2VUAA 7I1BA 1HWPB 1PC8B 2HWMA 1QXMA 5EG6C 1AXMA 1AF9A 2WRYA 5DSSB 2IHOA 4TLPA 4ZKTB 3H6RB 1S0CA 1YBIA 1IJTA 4AN7B 1GGPB 4XKIA 5BXTA 2AAIB 3D7WB 3CAHA 3R4UA 4I1EA 1XG6A 3CA5A 3UDAA 1JT3A 3RSJA 3BB2A 1FGAA 1BFFA 4J2XA 1HWNB 3N7LA 2DREA 2Q9XA 2NP0A 3BTAA 3S8JA 3HOMA 1F31A 1SR4A 4QC4A 3O3QA 3N7JA 3VUOA 3CRIA 4ZFWB 4QBVA 2R9KB 3AJ6A 3WO2A 1HCDA 3CA0A 4QD2C 3K1XA 1ISVA 1YYNA 4IZXA 2L5XA 4GP0A 1HWOB 2DRYA 4HJJA 3BAQA 3O4CA 4A7KA 4I37A 1DFCA 1JY0A 3AH2A 3BAGA 4GOVA 4X3AA 2NZ9A 4LO0C 3AZWA 2BFHA 3PUBA 4J2SA 1BASA 1HCEA 1VCLA 3H6SE 4I6IA 2P23A 4GAIA 4ZGRB 2GO2A 1V6VA 3RTIB 4DEPA 3CRGA 3FJ9A 4IZEA 1D0HA 4EFRA 4KEKA 4OWLA 5DVHA 2DS0A 1ILR1 1IHKA 1SR4C 3I2AA 1RMLA 3ZXDA 1S0BA 2Z48A 1II4A 4P0LA 4OEFA 1ISXA 3N7MA 4Z8SB 3N0KA 3NBEA 1XHBA 2Y9FA 3FJAA 3IIRA 4ISRA 3FGMA 3VEQA 3O5WB 4EFPA 5BQUC 1Q1UA 2I1BA 1OQLB 4G6JA 1AVWB 5DUYA 1BLAA 1WD4A 2BEBA 1J0SA 4JKQA 2FFVA 1G9DA 2XOAA 4MZFB 4G1RA 3C9ZA 2ET2A 3I2XA 2RSTA 4KEJA 4R6UB 1FN0A 2FFUA 5GAQA 1FMZA 4AN6A 3HMYA 1JQZA 1ISYA 4KC3A 4X38A 5BXPA 1MC9A 1ISZA 1S0EA 3FJ8A 1FQ9A 3HBWA 1JT7A 2NS2A 4USOA 3S8KA 4I4YA 1EYLA 3NJ5A 3FUOA 5E24E 4OUJA 5D61A 1T9FA 3IM6A 3FJFA 2D1ZA 2K4AB 4KBBA 2UUSA 4I8MA 4FGFA 3O49A 2VXRA 1Q04A 4J23B 9ILBA 1W3FA 3OJMA 4LO7C 4J2KA 1I1EA 3NBNA 4LO3A 1WD3A 4PC4A 2ZR1B 2D44A 5EHAA 2HWAA 4QD2B 3AKGA 2Y9XE 4X39A 1T4QA 2D20A 2K8RA 3O4BA 2FGFA 3T8SA 1TOOA 3OJ2A 1TTUA 1G9AA 2AQZA 3A23A 3H6RA 4ISQA 5F90A 3ZC9A 4Q9PA 1FWUA 4I4RA 2K43A 2MIBA 2KLLA 1DZCA 4JRAA 3AKFA 3NBDA 4A7YA 2ERMA 1IRPA 4XFUA 1N4KA 3JRRA 5BP5A 3P6JA 4F34A 2E4MA 4ZFUB 4H75A 3WO3A 3PHZA 21BIA 3BRFA 1TWMA 3FJJA 3UD9A 2YUGA 4II0A 1ISWA 1Q03A 3A07A 2VXTI 4USPA 1PZZA 4LO3C 3VT0A 3A22A 3BAHA 3CA1A 2VU9A 4D0ZA 3FFZA 1PWAA 3FJEA 3P53A 4I4PA 4DENA 3EF2A 4EEEB 2ESUA 4Z9WB 3F62B 1AVXB 2VSEA 1HKNA 4I0YA 4I2SA 4ZBVB 3IM7A 4G9NA 1DZDA 3UD7A 1V6UA 2NTDA 1WBAA 1ABRB 4IQPA 5F8YA 5FZUA 3BAOA 5F8SA 4HR6C 3FJKA 4IY9A 4A7ZA 1JLYA 3BA7A 4ENDA 2QYIB 3FJDA 4MZGB 4IYBA 2MC2A 1PUMB 1AFCA 4ZLBB 2D22A 1FWVA 5F8WA 4OWKA 3W9TA 3BA4A 3OJVA 3ZC8A 3R4SA 3RTJB 4G9MA 4I96A 4F83A 1W3GA 2MLLB 4LO1A 3V0AB 1UPSA 1TIEA 1JT4A 3O4OA 3BADA 3LTQA 5D63A 3CRHA 4Q91A 3VT1A 4ZA3B 1G9CA 1RZOB 4J2YA 2VLCA 4JKXB 3CU1B 1AVUA 4OEEA 3WMVA 31BIA 1G9BA 3V0BB 1TWEA 2HW9A 3WO4A 1DIWA 1FV3A 4LO7B 1E0OA 4JQ0A 4QKSA 4LO2A 2VSAA 2P39A 3IM5A 3JUTA 3TC2A 3MPPG 4HA2A 5FZYA 2AXMA 5DZUA 1FV2A 3VSZA 3QR5A 2Y9WC 1IT0A 5EC5A 1DLLA 2D7RA 3FJCA 1YTOA 1CE7B 4QBCA 4ZFYB 1XYFA 4L4HA 4LO1C 8I1BA 1K5UA 2GZBA 1G82A 1V6XA 3WINA 1M16A 1S0FA 3OBRA 5FNWA 1Z4SA 3RMYA 2D23A 3AH1A 1BLDA 1WBCA 2NM1A 4XFSA 2Y9GA 1TFMB 3BX1C 3I29B 3FJHA 4GAFA 3FUQA 3A21A 2Z49A 4G6MA 4I4XA 3VSFA 5FNXA 5G00A 3UD8A 4I4UA 1EPWA 3VWCA 4I4OA 3VT2A 1BARA 3BAUA 4Q9GA 3BRDA 1DQGA 2HZ9A 1QQKA 4OWJA 2F8XC 4QKRA 3KMVA 4LO0A 1YXWA 1NZKA 2KH2A 1MD6A 4ZOTA 1IILA 1S0DA 1ONKB 3FJIA 3WA1A 4X37A 3AH4A 4L4IA 1BA7A 4H04A 3WINC 1S0GA 3CA6A 5BXSA 4EB2B 4UY4A 1W3AA 3BA5A 1PUUB 3BAVA 2FO1A 5BOWA 4H9WA 1EV2A 2KKIA 2D7IA 4LO8B 2RQ9A 1R8OA 4OW4A 1TP0A 3PMEA 2F2FA 3HN1A 3PG0A 1BFBA 3B9UA 2KI6B 3AKHA 4FVVA 5D62A 3UJ4A 5JLVA 1JLXA 5BQUA 1ITBA 1HIBA 1DFQA 1L2HA 1RY7A 4QO3A 3NBCA 3CQAA 4DCKC 5BP5C 2E4MC 1QQLA 4I4QA 1NUNA 2KI4A 41BIA 3N7KA 1IRAX 2X2SA 3H6QA 3LLPA 3O44A 4D8HA 4EFQA 4I3NA 3QYDA 4IONA 1A8DA 3OBTA 2RG9B 5HPZA 3WMUA 1JT5A 2WBCA 3P6IA 3Q7YA 4JPZA 3OGFA 4OEGA 3AZVA 1K5VA 3ZXGA 4I4VA 4YOLA 1IOBA 5BXRA 3BRGC 4JP0A 3AKIA 3MALA 1XZZA 2M49A 1EVTA 2NVHA 2F2FC 2LIEA 4QALA 2X2TA 3SNVA 3V0AA 1Z2VA 4WBCA 3AJ5A 4I4SA 3HALA 1P63A 1SZ6B 3F1RA 2AFGA 2IWTB 4JAWA 5FZZA 4CJMA 1I1BA 2QN4A 3OGGA 3HSMA 3O4AA 4KEIA 6I1BA 3V79C 3CA4A 4GP3A 3Q7WA 4I7IA 2Q3NB 5B2HA 1KNMA 4I1BA 3V0BA 2ZQNA 1AVAC 2J3PA 1RG8A 2DRZA 1HWMB 1DQOA 3Q7XA 4P6AA 3FJBA 3ZX7A 4P0JA 4D0TA 3E8LC 4MZHA 5BVPI 3O4DA 1M2TB 4P0KA 2D43A 2FDBM 3IAGC 3ILAA 4IY8A 1BFCA 1Z0HA 5I1BA 3POKA 1FMMS 1BFGA 1CVSA 2D24A 2NYYA 2ZQOA 5JMCA 1R8NA 2LIQA 1S0LA 4XFTA 4GOYA 3CA3A 1YF8B 1DJSB
chains in the Genus database with same CATH topology
3RMXA 2BEAA 4LO2C 1V6WA 4EKXB 1JTCA 4IHZA 3UJ0A 2VUAA 7I1BA 1HWPB 1PC8B 2HWMA 1QXMA 5EG6C 1AXMA 1AF9A 2WRYA 5DSSB 2IHOA 4TLPA 4ZKTB 3H6RB 1S0CA 1YBIA 1IJTA 4AN7B 1GGPB 4XKIA 5BXTA 2AAIB 3D7WB 3CAHA 3R4UA 4I1EA 1XG6A 3CA5A 3UDAA 1JT3A 3RSJA 3BB2A 1FGAA 1BFFA 4J2XA 1HWNB 3N7LA 2DREA 2Q9XA 2NP0A 3BTAA 3S8JA 3HOMA 1F31A 1SR4A 4QC4A 3O3QA 3N7JA 3VUOA 3CRIA 4ZFWB 4QBVA 2R9KB 3AJ6A 3WO2A 1HCDA 3CA0A 4QD2C 3K1XA 1ISVA 1YYNA 4IZXA 2L5XA 4GP0A 1HWOB 2DRYA 4HJJA 3BAQA 3O4CA 4A7KA 4I37A 1DFCA 1JY0A 3AH2A 3BAGA 4GOVA 4X3AA 2NZ9A 4LO0C 3AZWA 2BFHA 3PUBA 4J2SA 1BASA 1HCEA 1VCLA 3H6SE 4I6IA 2P23A 4GAIA 4ZGRB 2GO2A 1V6VA 3RTIB 4DEPA 3CRGA 3FJ9A 4IZEA 1D0HA 4EFRA 4KEKA 4OWLA 5DVHA 2DS0A 1ILR1 1IHKA 1SR4C 3I2AA 1RMLA 3ZXDA 1S0BA 2Z48A 1II4A 4P0LA 4OEFA 1ISXA 3N7MA 4Z8SB 3N0KA 3NBEA 1XHBA 2Y9FA 3FJAA 3IIRA 4ISRA 3FGMA 3VEQA 3O5WB 4EFPA 5BQUC 1Q1UA 2I1BA 1OQLB 4G6JA 1AVWB 5DUYA 1BLAA 1WD4A 2BEBA 1J0SA 4JKQA 2FFVA 1G9DA 2XOAA 4MZFB 4G1RA 3C9ZA 2ET2A 3I2XA 2RSTA 4KEJA 4R6UB 1FN0A 2FFUA 5GAQA 1FMZA 4AN6A 3HMYA 1JQZA 1ISYA 4KC3A 4X38A 5BXPA 1MC9A 1ISZA 1S0EA 3FJ8A 1FQ9A 3HBWA 1JT7A 2NS2A 4USOA 3S8KA 4I4YA 1EYLA 3NJ5A 3FUOA 5E24E 4OUJA 5D61A 1T9FA 3IM6A 3FJFA 2D1ZA 2K4AB 4KBBA 2UUSA 4I8MA 4FGFA 3O49A 2VXRA 1Q04A 4J23B 9ILBA 1W3FA 3OJMA 4LO7C 4J2KA 1I1EA 3NBNA 4LO3A 1WD3A 4PC4A 2ZR1B 2D44A 5EHAA 2HWAA 4QD2B 3AKGA 2Y9XE 4X39A 1T4QA 2D20A 2K8RA 3O4BA 2FGFA 3T8SA 1TOOA 3OJ2A 1TTUA 1G9AA 2AQZA 3A23A 3H6RA 4ISQA 5F90A 3ZC9A 4Q9PA 1FWUA 4I4RA 2K43A 2MIBA 2KLLA 1DZCA 4JRAA 3AKFA 3NBDA 4A7YA 2ERMA 1IRPA 4XFUA 1N4KA 3JRRA 5BP5A 3P6JA 4F34A 2E4MA 4ZFUB 4H75A 3WO3A 3PHZA 21BIA 3BRFA 1TWMA 3FJJA 3UD9A 2YUGA 4II0A 1ISWA 1Q03A 3A07A 2VXTI 4USPA 1PZZA 4LO3C 3VT0A 3A22A 3BAHA 3CA1A 2VU9A 4D0ZA 3FFZA 1PWAA 3FJEA 3P53A 4I4PA 4DENA 3EF2A 4EEEB 2ESUA 4Z9WB 3F62B 1AVXB 2VSEA 1HKNA 4I0YA 4I2SA 4ZBVB 3IM7A 4G9NA 1DZDA 3UD7A 1V6UA 2NTDA 1WBAA 1ABRB 4IQPA 5F8YA 5FZUA 3BAOA 5F8SA 4HR6C 3FJKA 4IY9A 4A7ZA 1JLYA 3BA7A 4ENDA 2QYIB 3FJDA 4MZGB 4IYBA 2MC2A 1PUMB 1AFCA 4ZLBB 2D22A 1FWVA 5F8WA 4OWKA 3W9TA 3BA4A 3OJVA 3ZC8A 3R4SA 3RTJB 4G9MA 4I96A 4F83A 1W3GA 2MLLB 4LO1A 3V0AB 1UPSA 1TIEA 1JT4A 3O4OA 3BADA 3LTQA 5D63A 3CRHA 4Q91A 3VT1A 4ZA3B 1G9CA 1RZOB 4J2YA 2VLCA 4JKXB 3CU1B 1AVUA 4OEEA 3WMVA 31BIA 1G9BA 3V0BB 1TWEA 2HW9A 3WO4A 1DIWA 1FV3A 4LO7B 1E0OA 4JQ0A 4QKSA 4LO2A 2VSAA 2P39A 3IM5A 3JUTA 3TC2A 3MPPG 4HA2A 5FZYA 2AXMA 5DZUA 1FV2A 3VSZA 3QR5A 2Y9WC 1IT0A 5EC5A 1DLLA 2D7RA 3FJCA 1YTOA 1CE7B 4QBCA 4ZFYB 1XYFA 4L4HA 4LO1C 8I1BA 1K5UA 2GZBA 1G82A 1V6XA 3WINA 1M16A 1S0FA 3OBRA 5FNWA 1Z4SA 3RMYA 2D23A 3AH1A 1BLDA 1WBCA 2NM1A 4XFSA 2Y9GA 1TFMB 3BX1C 3I29B 3FJHA 4GAFA 3FUQA 3A21A 2Z49A 4G6MA 4I4XA 3VSFA 5FNXA 5G00A 3UD8A 4I4UA 1EPWA 3VWCA 4I4OA 3VT2A 1BARA 3BAUA 4Q9GA 3BRDA 1DQGA 2HZ9A 1QQKA 4OWJA 2F8XC 4QKRA 3KMVA 4LO0A 1YXWA 1NZKA 2KH2A 1MD6A 4ZOTA 1IILA 1S0DA 1ONKB 3FJIA 3WA1A 4X37A 3AH4A 4L4IA 1BA7A 4H04A 3WINC 1S0GA 3CA6A 5BXSA 4EB2B 4UY4A 1W3AA 3BA5A 1PUUB 3BAVA 2FO1A 5BOWA 4H9WA 1EV2A 2KKIA 2D7IA 4LO8B 2RQ9A 1R8OA 4OW4A 1TP0A 3PMEA 2F2FA 3HN1A 3PG0A 1BFBA 3B9UA 2KI6B 3AKHA 4FVVA 5D62A 3UJ4A 5JLVA 1JLXA 5BQUA 1ITBA 1HIBA 1DFQA 1L2HA 1RY7A 4QO3A 3NBCA 3CQAA 4DCKC 5BP5C 2E4MC 1QQLA 4I4QA 1NUNA 2KI4A 41BIA 3N7KA 1IRAX 2X2SA 3H6QA 3LLPA 3O44A 4D8HA 4EFQA 4I3NA 3QYDA 4IONA 1A8DA 3OBTA 2RG9B 5HPZA 3WMUA 1JT5A 2WBCA 3P6IA 3Q7YA 4JPZA 3OGFA 4OEGA 3AZVA 1K5VA 3ZXGA 4I4VA 4YOLA 1IOBA 5BXRA 3BRGC 4JP0A 3AKIA 3MALA 1XZZA 2M49A 1EVTA 2NVHA 2F2FC 2LIEA 4QALA 2X2TA 3SNVA 3V0AA 1Z2VA 4WBCA 3AJ5A 4I4SA 3HALA 1P63A 1SZ6B 3F1RA 2AFGA 2IWTB 4JAWA 5FZZA 4CJMA 1I1BA 2QN4A 3OGGA 3HSMA 3O4AA 4KEIA 6I1BA 3V79C 3CA4A 4GP3A 3Q7WA 4I7IA 2Q3NB 5B2HA 1KNMA 4I1BA 3V0BA 2ZQNA 1AVAC 2J3PA 1RG8A 2DRZA 1HWMB 1DQOA 3Q7XA 4P6AA 3FJBA 3ZX7A 4P0JA 4D0TA 3E8LC 4MZHA 5BVPI 3O4DA 1M2TB 4P0KA 2D43A 2FDBM 3IAGC 3ILAA 4IY8A 1BFCA 1Z0HA 5I1BA 3POKA 1FMMS 1BFGA 1CVSA 2D24A 2NYYA 2ZQOA 5JMCA 1R8NA 2LIQA 1S0LA 4XFTA 4GOYA 3CA3A 1YF8B 1DJSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RMX A;  2BEA A;  4LO2 C;  1V6W A;  4EKX B;  1JTC A;  4IHZ A;  3UJ0 A;  2VUA A;  7I1B A;  1HWP B;  1PC8 B;  2HWM A;  1QXM A;  5EG6 C;  1AXM A;  1AF9 A;  2WRY A;  5DSS B;  2IHO A;  4TLP A;  4ZKT B;  3H6R B;  1S0C A;  1YBI A;  1IJT A;  4AN7 B;  1GGP B;  4XKI A;  5BXT A;  2AAI B;  3D7W B;  3CAH A;  3R4U A;  4I1E A;  1XG6 A;  3CA5 A;  3UDA A;  1JT3 A;  3RSJ A;  3BB2 A;  1FGA A;  1BFF A;  4J2X A;  1HWN B;  3N7L A;  2DRE A;  2Q9X A;  2NP0 A;  3BTA A;  3S8J A;  3HOM A;  1F31 A;  1SR4 A;  4QC4 A;  3O3Q A;  3N7J A;  3VUO A;  3CRI A;  4ZFW B;  4QBV A;  2R9K B;  3AJ6 A;  3WO2 A;  1HCD A;  3CA0 A;  4QD2 C;  3K1X A;  1ISV A;  1YYN A;  4IZX A;  2L5X A;  4GP0 A;  1HWO B;  2DRY A;  4HJJ A;  3BAQ A;  3O4C A;  4A7K A;  4I37 A;  1DFC A;  1JY0 A;  3AH2 A;  3BAG A;  4GOV A;  4X3A A;  2NZ9 A;  4LO0 C;  3AZW A;  2BFH A;  3PUB A;  4J2S A;  1BAS A;  1HCE A;  1VCL A;  3H6S E;  4I6I A;  2P23 A;  4GAI A;  4ZGR B;  2GO2 A;  1V6V A;  3RTI B;  4DEP A;  3CRG A;  3FJ9 A;  4IZE A;  1D0H A;  4EFR A;  4KEK A;  4OWL A;  5DVH A;  2DS0 A;  1ILR 1;  1IHK A;  1SR4 C;  3I2A A;  1RML A;  3ZXD A;  1S0B A;  2Z48 A;  1II4 A;  4P0L A;  4OEF A;  1ISX A;  3N7M A;  4Z8S B;  3N0K A;  3NBE A;  1XHB A;  2Y9F A;  3FJA A;  3IIR A;  4ISR A;  3FGM A;  3VEQ A;  3O5W B;  4EFP A;  5BQU C;  1Q1U A;  2I1B A;  1OQL B;  4G6J A;  1AVW B;  5DUY A;  1BLA A;  1WD4 A;  2BEB A;  1J0S A;  4JKQ A;  2FFV A;  1G9D A;  2XOA A;  4G1R A;  3C9Z A;  2ET2 A;  3I2X A;  2RST A;  4KEJ A;  4R6U B;  1FN0 A;  2FFU A;  5GAQ A;  1FMZ A;  4AN6 A;  3HMY A;  1JQZ A;  1ISY A;  4KC3 A;  4X38 A;  5BXP A;  1MC9 A;  1ISZ A;  1S0E A;  3FJ8 A;  1FQ9 A;  3HBW A;  1JT7 A;  4USO A;  3S8K A;  4I4Y A;  1EYL A;  3NJ5 A;  3FUO A;  5E24 E;  4OUJ A;  5D61 A;  1T9F A;  3IM6 A;  3FJF A;  2D1Z A;  2K4A B;  4KBB A;  2UUS A;  4I8M A;  4FGF A;  3O49 A;  2VXR A;  1Q04 A;  4J23 B;  9ILB A;  1W3F A;  3OJM A;  4LO7 C;  4J2K A;  1I1E A;  3NBN A;  4LO3 A;  1WD3 A;  4PC4 A;  2ZR1 B;  2D44 A;  5EHA A;  2HWA A;  4QD2 B;  3AKG A;  2Y9X E;  4X39 A;  1T4Q A;  2D20 A;  2K8R A;  3O4B A;  2FGF A;  3T8S A;  1TOO A;  3OJ2 A;  1TTU A;  1G9A A;  2AQZ A;  3A23 A;  3H6R A;  4ISQ A;  5F90 A;  3ZC9 A;  4Q9P A;  1FWU A;  4I4R A;  2K43 A;  2MIB A;  2KLL A;  1DZC A;  4JRA A;  3AKF A;  3NBD A;  4A7Y A;  2ERM A;  1IRP A;  4XFU A;  1N4K A;  3JRR A;  5BP5 A;  3P6J A;  4F34 A;  2E4M A;  4ZFU B;  3WO3 A;  3PHZ A;  21BI A;  3BRF A;  1TWM A;  3FJJ A;  3UD9 A;  2YUG A;  4II0 A;  1ISW A;  1Q03 A;  3A07 A;  2VXT I;  4USP A;  1PZZ A;  4LO3 C;  3VT0 A;  3A22 A;  3BAH A;  3CA1 A;  2VU9 A;  4D0Z A;  3FFZ A;  1PWA A;  3FJE A;  3P53 A;  4I4P A;  4DEN A;  3EF2 A;  4EEE B;  2ESU A;  4Z9W B;  3F62 B;  1AVX B;  2VSE A;  1HKN A;  4I0Y A;  4I2S A;  4ZBV B;  3IM7 A;  4G9N A;  1DZD A;  3UD7 A;  1V6U A;  2NTD A;  1WBA A;  1ABR B;  4IQP A;  5F8Y A;  5FZU A;  3BAO A;  5F8S A;  4HR6 C;  3FJK A;  4IY9 A;  4A7Z A;  1JLY A;  3BA7 A;  4END A;  2QYI B;  3FJD A;  4IYB A;  2MC2 A;  1PUM B;  1AFC A;  4ZLB B;  2D22 A;  1FWV A;  5F8W A;  4OWK A;  3W9T A;  3BA4 A;  3OJV A;  3ZC8 A;  3R4S A;  3RTJ B;  4G9M A;  4I96 A;  4F83 A;  1W3G A;  2MLL B;  4LO1 A;  3V0A B;  1UPS A;  1TIE A;  1JT4 A;  3O4O A;  3BAD A;  3LTQ A;  5D63 A;  3CRH A;  4Q91 A;  3VT1 A;  4ZA3 B;  1G9C A;  1RZO B;  4J2Y A;  2VLC A;  4JKX B;  3CU1 B;  1AVU A;  4OEE A;  3WMV A;  31BI A;  1G9B A;  3V0B B;  1TWE A;  2HW9 A;  3WO4 A;  1DIW A;  1FV3 A;  4LO7 B;  1E0O A;  4JQ0 A;  4QKS A;  4LO2 A;  2VSA A;  2P39 A;  3IM5 A;  3JUT A;  3TC2 A;  3MPP G;  4HA2 A;  5FZY A;  2AXM A;  5DZU A;  1FV2 A;  3VSZ A;  3QR5 A;  2Y9W C;  1IT0 A;  5EC5 A;  1DLL A;  2D7R A;  3FJC A;  1YTO A;  1CE7 B;  4QBC A;  4ZFY B;  1XYF A;  4L4H A;  4LO1 C;  8I1B A;  1K5U A;  2GZB A;  1G82 A;  1V6X A;  3WIN A;  1M16 A;  1S0F A;  3OBR A;  5FNW A;  1Z4S A;  3RMY A;  2D23 A;  3AH1 A;  1BLD A;  1WBC A;  2NM1 A;  4XFS A;  2Y9G A;  1TFM B;  3BX1 C;  3I29 B;  3FJH A;  4GAF A;  3FUQ A;  3A21 A;  2Z49 A;  4G6M A;  4I4X A;  3VSF A;  5FNX A;  5G00 A;  3UD8 A;  4I4U A;  1EPW A;  3VWC A;  4I4O A;  3VT2 A;  1BAR A;  3BAU A;  4Q9G A;  3BRD A;  1DQG A;  2HZ9 A;  1QQK A;  4OWJ A;  2F8X C;  4QKR A;  3KMV A;  4LO0 A;  1YXW A;  1NZK A;  2KH2 A;  1MD6 A;  4ZOT A;  1IIL A;  1S0D A;  1ONK B;  3FJI A;  3WA1 A;  4X37 A;  3AH4 A;  4L4I A;  1BA7 A;  4H04 A;  3WIN C;  1S0G A;  3CA6 A;  5BXS A;  4EB2 B;  1W3A A;  3BA5 A;  1PUU B;  3BAV A;  2FO1 A;  5BOW A;  4H9W A;  1EV2 A;  2KKI A;  2D7I A;  4LO8 B;  2RQ9 A;  1R8O A;  4OW4 A;  1TP0 A;  3PME A;  2F2F A;  3HN1 A;  3PG0 A;  1BFB A;  3B9U A;  2KI6 B;  3AKH A;  4FVV A;  5D62 A;  3UJ4 A;  5JLV A;  1JLX A;  5BQU A;  1ITB A;  1HIB A;  1DFQ A;  1L2H A;  1RY7 A;  4QO3 A;  3NBC A;  3CQA A;  4DCK C;  5BP5 C;  2E4M C;  1QQL A;  4I4Q A;  1NUN A;  2KI4 A;  41BI A;  3N7K A;  1IRA X;  2X2S A;  3H6Q A;  3LLP A;  3O44 A;  4D8H A;  4EFQ A;  4I3N A;  3QYD A;  4ION A;  1A8D A;  3OBT A;  2RG9 B;  5HPZ A;  3WMU A;  1JT5 A;  2WBC A;  3P6I A;  3Q7Y A;  4JPZ A;  3OGF A;  4OEG A;  3AZV A;  1K5V A;  3ZXG A;  4I4V A;  4YOL A;  1IOB A;  5BXR A;  3BRG C;  4JP0 A;  3AKI A;  3MAL A;  1XZZ A;  2M49 A;  1EVT A;  2NVH A;  2F2F C;  2LIE A;  4QAL A;  2X2T A;  3SNV A;  3V0A A;  1Z2V A;  4WBC A;  3AJ5 A;  4I4S A;  3HAL A;  1P63 A;  1SZ6 B;  3F1R A;  2AFG A;  2IWT B;  4JAW A;  5FZZ A;  4CJM A;  1I1B A;  2QN4 A;  3OGG A;  3HSM A;  3O4A A;  4KEI A;  6I1B A;  3V79 C;  3CA4 A;  4GP3 A;  3Q7W A;  4I7I A;  2Q3N B;  5B2H A;  1KNM A;  4I1B A;  3V0B A;  2ZQN A;  1AVA C;  2J3P A;  1RG8 A;  2DRZ A;  1HWM B;  1DQO A;  3Q7X A;  4P6A A;  3FJB A;  3ZX7 A;  4P0J A;  4D0T A;  3E8L C;  5BVP I;  3O4D A;  1M2T B;  4P0K A;  2D43 A;  2FDB M;  3IAG C;  3ILA A;  4IY8 A;  1BFC A;  1Z0H A;  5I1B A;  3POK A;  1FMM S;  1BFG A;  1CVS A;  2D24 A;  2NYY A;  2ZQO A;  5JMC A;  1R8N A;  2LIQ A;  1S0L A;  4XFT A;  4GOY A;  3CA3 A;  1YF8 B;  1DJS B; 
#chains in the Genus database with same CATH topology
 3RMX A;  2BEA A;  4LO2 C;  1V6W A;  4EKX B;  1JTC A;  4IHZ A;  3UJ0 A;  2VUA A;  7I1B A;  1HWP B;  1PC8 B;  2HWM A;  1QXM A;  5EG6 C;  1AXM A;  1AF9 A;  2WRY A;  5DSS B;  2IHO A;  4TLP A;  4ZKT B;  3H6R B;  1S0C A;  1YBI A;  1IJT A;  4AN7 B;  1GGP B;  4XKI A;  5BXT A;  2AAI B;  3D7W B;  3CAH A;  3R4U A;  4I1E A;  1XG6 A;  3CA5 A;  3UDA A;  1JT3 A;  3RSJ A;  3BB2 A;  1FGA A;  1BFF A;  4J2X A;  1HWN B;  3N7L A;  2DRE A;  2Q9X A;  2NP0 A;  3BTA A;  3S8J A;  3HOM A;  1F31 A;  1SR4 A;  4QC4 A;  3O3Q A;  3N7J A;  3VUO A;  3CRI A;  4ZFW B;  4QBV A;  2R9K B;  3AJ6 A;  3WO2 A;  1HCD A;  3CA0 A;  4QD2 C;  3K1X A;  1ISV A;  1YYN A;  4IZX A;  2L5X A;  4GP0 A;  1HWO B;  2DRY A;  4HJJ A;  3BAQ A;  3O4C A;  4A7K A;  4I37 A;  1DFC A;  1JY0 A;  3AH2 A;  3BAG A;  4GOV A;  4X3A A;  2NZ9 A;  4LO0 C;  3AZW A;  2BFH A;  3PUB A;  4J2S A;  1BAS A;  1HCE A;  1VCL A;  3H6S E;  4I6I A;  2P23 A;  4GAI A;  4ZGR B;  2GO2 A;  1V6V A;  3RTI B;  4DEP A;  3CRG A;  3FJ9 A;  4IZE A;  1D0H A;  4EFR A;  4KEK A;  4OWL A;  5DVH A;  2DS0 A;  1ILR 1;  1IHK A;  1SR4 C;  3I2A A;  1RML A;  3ZXD A;  1S0B A;  2Z48 A;  1II4 A;  4P0L A;  4OEF A;  1ISX A;  3N7M A;  4Z8S B;  3N0K A;  3NBE A;  1XHB A;  2Y9F A;  3FJA A;  3IIR A;  4ISR A;  3FGM A;  3VEQ A;  3O5W B;  4EFP A;  5BQU C;  1Q1U A;  2I1B A;  1OQL B;  4G6J A;  1AVW B;  5DUY A;  1BLA A;  1WD4 A;  2BEB A;  1J0S A;  4JKQ A;  2FFV A;  1G9D A;  2XOA A;  4MZF B;  4G1R A;  3C9Z A;  2ET2 A;  3I2X A;  2RST A;  4KEJ A;  4R6U B;  1FN0 A;  2FFU A;  5GAQ A;  1FMZ A;  4AN6 A;  3HMY A;  1JQZ A;  1ISY A;  4KC3 A;  4X38 A;  5BXP A;  1MC9 A;  1ISZ A;  1S0E A;  3FJ8 A;  1FQ9 A;  3HBW A;  1JT7 A;  2NS2 A;  4USO A;  3S8K A;  4I4Y A;  1EYL A;  3NJ5 A;  3FUO A;  5E24 E;  4OUJ A;  5D61 A;  1T9F A;  3IM6 A;  3FJF A;  2D1Z A;  2K4A B;  4KBB A;  2UUS A;  4I8M A;  4FGF A;  3O49 A;  2VXR A;  1Q04 A;  4J23 B;  9ILB A;  1W3F A;  3OJM A;  4LO7 C;  4J2K A;  1I1E A;  3NBN A;  4LO3 A;  1WD3 A;  4PC4 A;  2ZR1 B;  2D44 A;  5EHA A;  2HWA A;  4QD2 B;  3AKG A;  2Y9X E;  4X39 A;  1T4Q A;  2D20 A;  2K8R A;  3O4B A;  2FGF A;  3T8S A;  1TOO A;  3OJ2 A;  1TTU A;  1G9A A;  2AQZ A;  3A23 A;  3H6R A;  4ISQ A;  5F90 A;  3ZC9 A;  4Q9P A;  1FWU A;  4I4R A;  2K43 A;  2MIB A;  2KLL A;  1DZC A;  4JRA A;  3AKF A;  3NBD A;  4A7Y A;  2ERM A;  1IRP A;  4XFU A;  1N4K A;  3JRR A;  5BP5 A;  3P6J A;  4F34 A;  2E4M A;  4ZFU B;  4H75 A;  3WO3 A;  3PHZ A;  21BI A;  3BRF A;  1TWM A;  3FJJ A;  3UD9 A;  2YUG A;  4II0 A;  1ISW A;  1Q03 A;  3A07 A;  2VXT I;  4USP A;  1PZZ A;  4LO3 C;  3VT0 A;  3A22 A;  3BAH A;  3CA1 A;  2VU9 A;  4D0Z A;  3FFZ A;  1PWA A;  3FJE A;  3P53 A;  4I4P A;  4DEN A;  3EF2 A;  4EEE B;  2ESU A;  4Z9W B;  3F62 B;  1AVX B;  2VSE A;  1HKN A;  4I0Y A;  4I2S A;  4ZBV B;  3IM7 A;  4G9N A;  1DZD A;  3UD7 A;  1V6U A;  2NTD A;  1WBA A;  1ABR B;  4IQP A;  5F8Y A;  5FZU A;  3BAO A;  5F8S A;  4HR6 C;  3FJK A;  4IY9 A;  4A7Z A;  1JLY A;  3BA7 A;  4END A;  2QYI B;  3FJD A;  4MZG B;  4IYB A;  2MC2 A;  1PUM B;  1AFC A;  4ZLB B;  2D22 A;  1FWV A;  5F8W A;  4OWK A;  3W9T A;  3BA4 A;  3OJV A;  3ZC8 A;  3R4S A;  3RTJ B;  4G9M A;  4I96 A;  4F83 A;  1W3G A;  2MLL B;  4LO1 A;  3V0A B;  1UPS A;  1TIE A;  1JT4 A;  3O4O A;  3BAD A;  3LTQ A;  5D63 A;  3CRH A;  4Q91 A;  3VT1 A;  4ZA3 B;  1G9C A;  1RZO B;  4J2Y A;  2VLC A;  4JKX B;  3CU1 B;  1AVU A;  4OEE A;  3WMV A;  31BI A;  1G9B A;  3V0B B;  1TWE A;  2HW9 A;  3WO4 A;  1DIW A;  1FV3 A;  4LO7 B;  1E0O A;  4JQ0 A;  4QKS A;  4LO2 A;  2VSA A;  2P39 A;  3IM5 A;  3JUT A;  3TC2 A;  3MPP G;  4HA2 A;  5FZY A;  2AXM A;  5DZU A;  1FV2 A;  3VSZ A;  3QR5 A;  2Y9W C;  1IT0 A;  5EC5 A;  1DLL A;  2D7R A;  3FJC A;  1YTO A;  1CE7 B;  4QBC A;  4ZFY B;  1XYF A;  4L4H A;  4LO1 C;  8I1B A;  1K5U A;  2GZB A;  1G82 A;  1V6X A;  3WIN A;  1M16 A;  1S0F A;  3OBR A;  5FNW A;  1Z4S A;  3RMY A;  2D23 A;  3AH1 A;  1BLD A;  1WBC A;  2NM1 A;  4XFS A;  2Y9G A;  1TFM B;  3BX1 C;  3I29 B;  3FJH A;  4GAF A;  3FUQ A;  3A21 A;  2Z49 A;  4G6M A;  4I4X A;  3VSF A;  5FNX A;  5G00 A;  3UD8 A;  4I4U A;  1EPW A;  3VWC A;  4I4O A;  3VT2 A;  1BAR A;  3BAU A;  4Q9G A;  3BRD A;  1DQG A;  2HZ9 A;  1QQK A;  4OWJ A;  2F8X C;  4QKR A;  3KMV A;  4LO0 A;  1YXW A;  1NZK A;  2KH2 A;  1MD6 A;  4ZOT A;  1IIL A;  1S0D A;  1ONK B;  3FJI A;  3WA1 A;  4X37 A;  3AH4 A;  4L4I A;  1BA7 A;  4H04 A;  3WIN C;  1S0G A;  3CA6 A;  5BXS A;  4EB2 B;  4UY4 A;  1W3A A;  3BA5 A;  1PUU B;  3BAV A;  2FO1 A;  5BOW A;  4H9W A;  1EV2 A;  2KKI A;  2D7I A;  4LO8 B;  2RQ9 A;  1R8O A;  4OW4 A;  1TP0 A;  3PME A;  2F2F A;  3HN1 A;  3PG0 A;  1BFB A;  3B9U A;  2KI6 B;  3AKH A;  4FVV A;  5D62 A;  3UJ4 A;  5JLV A;  1JLX A;  5BQU A;  1ITB A;  1HIB A;  1DFQ A;  1L2H A;  1RY7 A;  4QO3 A;  3NBC A;  3CQA A;  4DCK C;  5BP5 C;  2E4M C;  1QQL A;  4I4Q A;  1NUN A;  2KI4 A;  41BI A;  3N7K A;  1IRA X;  2X2S A;  3H6Q A;  3LLP A;  3O44 A;  4D8H A;  4EFQ A;  4I3N A;  3QYD A;  4ION A;  1A8D A;  3OBT A;  2RG9 B;  5HPZ A;  3WMU A;  1JT5 A;  2WBC A;  3P6I A;  3Q7Y A;  4JPZ A;  3OGF A;  4OEG A;  3AZV A;  1K5V A;  3ZXG A;  4I4V A;  4YOL A;  1IOB A;  5BXR A;  3BRG C;  4JP0 A;  3AKI A;  3MAL A;  1XZZ A;  2M49 A;  1EVT A;  2NVH A;  2F2F C;  2LIE A;  4QAL A;  2X2T A;  3SNV A;  3V0A A;  1Z2V A;  4WBC A;  3AJ5 A;  4I4S A;  3HAL A;  1P63 A;  1SZ6 B;  3F1R A;  2AFG A;  2IWT B;  4JAW A;  5FZZ A;  4CJM A;  1I1B A;  2QN4 A;  3OGG A;  3HSM A;  3O4A A;  4KEI A;  6I1B A;  3V79 C;  3CA4 A;  4GP3 A;  3Q7W A;  4I7I A;  2Q3N B;  5B2H A;  1KNM A;  4I1B A;  3V0B A;  2ZQN A;  1AVA C;  2J3P A;  1RG8 A;  2DRZ A;  1HWM B;  1DQO A;  3Q7X A;  4P6A A;  3FJB A;  3ZX7 A;  4P0J A;  4D0T A;  3E8L C;  4MZH A;  5BVP I;  3O4D A;  1M2T B;  4P0K A;  2D43 A;  2FDB M;  3IAG C;  3ILA A;  4IY8 A;  1BFC A;  1Z0H A;  5I1B A;  3POK A;  1FMM S;  1BFG A;  1CVS A;  2D24 A;  2NYY A;  2ZQO A;  5JMC A;  1R8N A;  2LIQ A;  1S0L A;  4XFT A;  4GOY A;  3CA3 A;  1YF8 B;  1DJS B; 
#chains in the Genus database with same CATH homology
 3RMX A;  2BEA A;  4LO2 C;  1V6W A;  4EKX B;  1JTC A;  4IHZ A;  3UJ0 A;  2VUA A;  7I1B A;  1HWP B;  1PC8 B;  2HWM A;  1QXM A;  5EG6 C;  1AXM A;  1AF9 A;  2WRY A;  5DSS B;  2IHO A;  4TLP A;  4ZKT B;  3H6R B;  1S0C A;  1YBI A;  1IJT A;  4AN7 B;  1GGP B;  4XKI A;  5BXT A;  2AAI B;  3D7W B;  3CAH A;  3R4U A;  4I1E A;  1XG6 A;  3CA5 A;  3UDA A;  1JT3 A;  3RSJ A;  3BB2 A;  1FGA A;  1BFF A;  4J2X A;  1HWN B;  3N7L A;  2DRE A;  2Q9X A;  2NP0 A;  3BTA A;  3S8J A;  3HOM A;  1F31 A;  1SR4 A;  4QC4 A;  3O3Q A;  3N7J A;  3VUO A;  3CRI A;  4ZFW B;  4QBV A;  2R9K B;  3AJ6 A;  3WO2 A;  1HCD A;  3CA0 A;  4QD2 C;  3K1X A;  1ISV A;  1YYN A;  4IZX A;  2L5X A;  4GP0 A;  1HWO B;  2DRY A;  4HJJ A;  3BAQ A;  3O4C A;  4A7K A;  4I37 A;  1DFC A;  1JY0 A;  3AH2 A;  3BAG A;  4GOV A;  4X3A A;  2NZ9 A;  4LO0 C;  3AZW A;  2BFH A;  3PUB A;  4J2S A;  1BAS A;  1HCE A;  1VCL A;  3H6S E;  4I6I A;  2P23 A;  4GAI A;  4ZGR B;  2GO2 A;  1V6V A;  3RTI B;  4DEP A;  3CRG A;  3FJ9 A;  4IZE A;  1D0H A;  4EFR A;  4KEK A;  4OWL A;  5DVH A;  2DS0 A;  1ILR 1;  1IHK A;  1SR4 C;  3I2A A;  1RML A;  3ZXD A;  1S0B A;  2Z48 A;  1II4 A;  4P0L A;  4OEF A;  1ISX A;  3N7M A;  4Z8S B;  3N0K A;  3NBE A;  1XHB A;  2Y9F A;  3FJA A;  3IIR A;  4ISR A;  3FGM A;  3VEQ A;  3O5W B;  4EFP A;  5BQU C;  1Q1U A;  2I1B A;  1OQL B;  4G6J A;  1AVW B;  5DUY A;  1BLA A;  1WD4 A;  2BEB A;  1J0S A;  4JKQ A;  2FFV A;  1G9D A;  2XOA A;  4MZF B;  4G1R A;  3C9Z A;  2ET2 A;  3I2X A;  2RST A;  4KEJ A;  4R6U B;  1FN0 A;  2FFU A;  5GAQ A;  1FMZ A;  4AN6 A;  3HMY A;  1JQZ A;  1ISY A;  4KC3 A;  4X38 A;  5BXP A;  1MC9 A;  1ISZ A;  1S0E A;  3FJ8 A;  1FQ9 A;  3HBW A;  1JT7 A;  2NS2 A;  4USO A;  3S8K A;  4I4Y A;  1EYL A;  3NJ5 A;  3FUO A;  5E24 E;  4OUJ A;  5D61 A;  1T9F A;  3IM6 A;  3FJF A;  2D1Z A;  2K4A B;  4KBB A;  2UUS A;  4I8M A;  4FGF A;  3O49 A;  2VXR A;  1Q04 A;  4J23 B;  9ILB A;  1W3F A;  3OJM A;  4LO7 C;  4J2K A;  1I1E A;  3NBN A;  4LO3 A;  1WD3 A;  4PC4 A;  2ZR1 B;  2D44 A;  5EHA A;  2HWA A;  4QD2 B;  3AKG A;  2Y9X E;  4X39 A;  1T4Q A;  2D20 A;  2K8R A;  3O4B A;  2FGF A;  3T8S A;  1TOO A;  3OJ2 A;  1TTU A;  1G9A A;  2AQZ A;  3A23 A;  3H6R A;  4ISQ A;  5F90 A;  3ZC9 A;  4Q9P A;  1FWU A;  4I4R A;  2K43 A;  2MIB A;  2KLL A;  1DZC A;  4JRA A;  3AKF A;  3NBD A;  4A7Y A;  2ERM A;  1IRP A;  4XFU A;  1N4K A;  3JRR A;  5BP5 A;  3P6J A;  4F34 A;  2E4M A;  4ZFU B;  4H75 A;  3WO3 A;  3PHZ A;  21BI A;  3BRF A;  1TWM A;  3FJJ A;  3UD9 A;  2YUG A;  4II0 A;  1ISW A;  1Q03 A;  3A07 A;  2VXT I;  4USP A;  1PZZ A;  4LO3 C;  3VT0 A;  3A22 A;  3BAH A;  3CA1 A;  2VU9 A;  4D0Z A;  3FFZ A;  1PWA A;  3FJE A;  3P53 A;  4I4P A;  4DEN A;  3EF2 A;  4EEE B;  2ESU A;  4Z9W B;  3F62 B;  1AVX B;  2VSE A;  1HKN A;  4I0Y A;  4I2S A;  4ZBV B;  3IM7 A;  4G9N A;  1DZD A;  3UD7 A;  1V6U A;  2NTD A;  1WBA A;  1ABR B;  4IQP A;  5F8Y A;  5FZU A;  3BAO A;  5F8S A;  4HR6 C;  3FJK A;  4IY9 A;  4A7Z A;  1JLY A;  3BA7 A;  4END A;  2QYI B;  3FJD A;  4MZG B;  4IYB A;  2MC2 A;  1PUM B;  1AFC A;  4ZLB B;  2D22 A;  1FWV A;  5F8W A;  4OWK A;  3W9T A;  3BA4 A;  3OJV A;  3ZC8 A;  3R4S A;  3RTJ B;  4G9M A;  4I96 A;  4F83 A;  1W3G A;  2MLL B;  4LO1 A;  3V0A B;  1UPS A;  1TIE A;  1JT4 A;  3O4O A;  3BAD A;  3LTQ A;  5D63 A;  3CRH A;  4Q91 A;  3VT1 A;  4ZA3 B;  1G9C A;  1RZO B;  4J2Y A;  2VLC A;  4JKX B;  3CU1 B;  1AVU A;  4OEE A;  3WMV A;  31BI A;  1G9B A;  3V0B B;  1TWE A;  2HW9 A;  3WO4 A;  1DIW A;  1FV3 A;  4LO7 B;  1E0O A;  4JQ0 A;  4QKS A;  4LO2 A;  2VSA A;  2P39 A;  3IM5 A;  3JUT A;  3TC2 A;  3MPP G;  4HA2 A;  5FZY A;  2AXM A;  5DZU A;  1FV2 A;  3VSZ A;  3QR5 A;  2Y9W C;  1IT0 A;  5EC5 A;  1DLL A;  2D7R A;  3FJC A;  1YTO A;  1CE7 B;  4QBC A;  4ZFY B;  1XYF A;  4L4H A;  4LO1 C;  8I1B A;  1K5U A;  2GZB A;  1G82 A;  1V6X A;  3WIN A;  1M16 A;  1S0F A;  3OBR A;  5FNW A;  1Z4S A;  3RMY A;  2D23 A;  3AH1 A;  1BLD A;  1WBC A;  2NM1 A;  4XFS A;  2Y9G A;  1TFM B;  3BX1 C;  3I29 B;  3FJH A;  4GAF A;  3FUQ A;  3A21 A;  2Z49 A;  4G6M A;  4I4X A;  3VSF A;  5FNX A;  5G00 A;  3UD8 A;  4I4U A;  1EPW A;  3VWC A;  4I4O A;  3VT2 A;  1BAR A;  3BAU A;  4Q9G A;  3BRD A;  1DQG A;  2HZ9 A;  1QQK A;  4OWJ A;  2F8X C;  4QKR A;  3KMV A;  4LO0 A;  1YXW A;  1NZK A;  2KH2 A;  1MD6 A;  4ZOT A;  1IIL A;  1S0D A;  1ONK B;  3FJI A;  3WA1 A;  4X37 A;  3AH4 A;  4L4I A;  1BA7 A;  4H04 A;  3WIN C;  1S0G A;  3CA6 A;  5BXS A;  4EB2 B;  4UY4 A;  1W3A A;  3BA5 A;  1PUU B;  3BAV A;  2FO1 A;  5BOW A;  4H9W A;  1EV2 A;  2KKI A;  2D7I A;  4LO8 B;  2RQ9 A;  1R8O A;  4OW4 A;  1TP0 A;  3PME A;  2F2F A;  3HN1 A;  3PG0 A;  1BFB A;  3B9U A;  2KI6 B;  3AKH A;  4FVV A;  5D62 A;  3UJ4 A;  5JLV A;  1JLX A;  5BQU A;  1ITB A;  1HIB A;  1DFQ A;  1L2H A;  1RY7 A;  4QO3 A;  3NBC A;  3CQA A;  4DCK C;  5BP5 C;  2E4M C;  1QQL A;  4I4Q A;  1NUN A;  2KI4 A;  41BI A;  3N7K A;  1IRA X;  2X2S A;  3H6Q A;  3LLP A;  3O44 A;  4D8H A;  4EFQ A;  4I3N A;  3QYD A;  4ION A;  1A8D A;  3OBT A;  2RG9 B;  5HPZ A;  3WMU A;  1JT5 A;  2WBC A;  3P6I A;  3Q7Y A;  4JPZ A;  3OGF A;  4OEG A;  3AZV A;  1K5V A;  3ZXG A;  4I4V A;  4YOL A;  1IOB A;  5BXR A;  3BRG C;  4JP0 A;  3AKI A;  3MAL A;  1XZZ A;  2M49 A;  1EVT A;  2NVH A;  2F2F C;  2LIE A;  4QAL A;  2X2T A;  3SNV A;  3V0A A;  1Z2V A;  4WBC A;  3AJ5 A;  4I4S A;  3HAL A;  1P63 A;  1SZ6 B;  3F1R A;  2AFG A;  2IWT B;  4JAW A;  5FZZ A;  4CJM A;  1I1B A;  2QN4 A;  3OGG A;  3HSM A;  3O4A A;  4KEI A;  6I1B A;  3V79 C;  3CA4 A;  4GP3 A;  3Q7W A;  4I7I A;  2Q3N B;  5B2H A;  1KNM A;  4I1B A;  3V0B A;  2ZQN A;  1AVA C;  2J3P A;  1RG8 A;  2DRZ A;  1HWM B;  1DQO A;  3Q7X A;  4P6A A;  3FJB A;  3ZX7 A;  4P0J A;  4D0T A;  3E8L C;  4MZH A;  5BVP I;  3O4D A;  1M2T B;  4P0K A;  2D43 A;  2FDB M;  3IAG C;  3ILA A;  4IY8 A;  1BFC A;  1Z0H A;  5I1B A;  3POK A;  1FMM S;  1BFG A;  1CVS A;  2D24 A;  2NYY A;  2ZQO A;  5JMC A;  1R8N A;  2LIQ A;  1S0L A;  4XFT A;  4GOY A;  3CA3 A;  1YF8 B;  1DJS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...