3BAWA

Human pancreatic alpha-amylase complexed with azide
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Alternative catalytic anions differentially modulate human alpha-amylase activity and specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Pancreatic alpha-amylase
total genus 178
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bawA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bawA01
4PBGA 5E0FA 4QLJA 2YDRA 3S5ZA 4D6EA 4L4PA 3WD2A 2FH8A 3WF2A 5A6AA 3F5LA 2OSWA 2VZTA 4UFJA 3ZM8A 5M3WA 1V3JA 1JYXA 1MW1A 4YHGA 1W3HA 2NT0A 3WFZA 3ARQA 3VSTA 2G3MA 1GUVA 3D5HA 3VD4A 3DX0A 4MJ2A 3T2QA 2D3NA 3PBGA 1HJQA 3DECA 3D51A 2PB1A 1V3LA 3MSGA 3AIVA 2JF6A 4MAVA 3BUIA 4W86A 1BG4A 2NSXA 3GNRA 1XSJA 3DYMA 3WNNA 2YA0A 5ABGA 4ZEPA 1R7OA 2F7RA 4TOQA 3VO0A 3VMPA 5CJ5A 3K8KA 2PWEA 1KWGA 2WLZA 3ARPA 1DP0A 3N1AA 1GJWA 1J12A 2WYSA 5AY7A 5A8PA 5CLTA 4OUEA 4WIWA 1UZ1A 2FGLA 4PUEA 4BQ2A 4PMYA 3WFLA 3GZAA 4CN4A 4W8AA 2VRQA 3MMWA 4Z2GA 3AMLA 3WH5A 4WK9A 1C92A 1Q6DA 4HPHA 1YHTA 4CU6A 3VIGA 1XSKA 4AYSA 3D50A 3S2CA 1W1TA 2F1BA 2WVUA 1JDAA 4ZXOA 4W8BA 5JBEA 4W88A 3IK2A 1GCYA 3T09A 4FNQA 2X0YA 1JFXA 3BAXA 5CGTA 1CXLA 4UQDA 1PPIA 3WY3A 2WBGA 2F8QA 3ZR6A 3WDIA 2YL9A 3OB8A 1CGVA 1E55A 4PMVA 5FIPA 1EOMA 1NOFA 2ZXBA 3ARYA 4UZSA 3A3HA 5ABEA 4W93A 1BG9A 3EDDA 4GPNA 2BV9A 1WO2A 1JYWA 3WDRA 4BQ3A 2F61A 1CECA 1PBGA 3PZOA 3BH4A 1V3HA 3QR3A 4EANA 2A3EA 1QI0A 4BQ5A 5DF0A 4PMXA 1VFMA 2WXDM 2E3ZA 2X0HA 1J0ZA 1TA3A 7TAAA 4PCTA 1KCKA 4KMQA 3SCWA 4D6DA 2Y8KA 1OBAA 1Q6GA 7A3HA 2VO5A 4TTUA 3CZLA 1OSEA 3WMSA 2WAGA 3CC1A 1BLIA 1VFFA 1HP5A 1YQ2A 1ISVA 1ITXA 5A95A 4AMCA 1R47A 5CXPA 2EO7A 4AEFA 1UKOA 1XHGA 2E8YA 1KB3A 3EJSA 1FP8A 3VIHA 4M82A 2WWDA 4UOQA 4TVUA 3BVVA 4KRTA 3WDHA 2D2OA 3A47A 1ZJBA 1TVNA 1US3A 3AMDA 1HVQA 2YL8A 2WVSA 3CZEA 1BYDA 1K9DA 2GVYA 4PTMA 3UR8A 1QHZA 3VVGA 2D23A 4UFHA 1GOWA 2D3LA 2X2IA 4CGTA 5A2BA 3M6DA 1UG6A 4OJYA 2C7FA 4GINA 1EGZA 3AHTA 1CTNA 2QV4A 3WY2A 4XX6A 3GXNA 3HG5A 5E09A 1M01A 3D4YA 2Y4SA 3UERA 2VR4A 5GNZA 1MW2A 4J3TA 4QFUA 1C8YA 1GQJA 2PWDA 4W5UA 3WELA 1RP8A 3WF1A 2WLYA 5I6SA 3NSXA 3VDCA 1UKPA 4CVWA 1UR1A 3NSNA 1FFQA 4HPGA 3HG4A 5I77A 3AJ7A 2CBJA 3SCTA 5EFFA 3L4XA 1UA3A 2OYLA 1JGIA 4TXEA 2J25A 4U2ZA 1XYFA 1VB9A 1B31A 4H8VA 3MSDA 3CHCA 3M46A 4PTVA 2WZEA 3L4VA 3AXIA 4M81A 3AIQA 4IM4A 3ARWA 1HXJA 4FK9A 5EFDA 3WIJA 2ZUMA 8CGTA 1R8LA 4RL3A 1UWTA 2CHNA 3AZTA 1R87A 3TTOA 1PAMA 1UD5A 2VR5A 4JCLA 5HPOA 2B31A 4B16A 4QAWA 1UR2A 4P7OA 1UYQA 2XYLA 1H3GA 4CVUA 1OIFA 1ISZA 4IPNB 1DWHM 5BCAA 3WL1A 1B3WA 4Y7EA 1BYAA 3EMCA 1UKSA 1P6WA 1Q6FA 3BAKA 2DSVA 4HOZA 2CEQA 5CPQA 2W61A 3W28A 1CNVA 1QI2A 3AQUA 2G3IA 1MQQA 1T0OA 5C70A 2WMKA 2RGLA 4JHZA 4RE2A 3AI0A 1WB0A 3VIFA 1O6IA 3VKKA 3VGHA 1CXEA 2WPGA 2X05A 1MWOA 4UQ9A 5A6MA 5IHRA 3H54A 4M1RA 5I2UA 1TFVA 3OZOA 2YA2A 1EHNA 1CGWA 1H09A 1NH6A 5D9NA 3G6LA 5D8ZA 1FP9A 4GZEA 1DEDA 3EDFA 2VCCA 2DEPA 5C8BB 4MB1A 1HN1A 1PZ3A 4PSRA 1J0JA 3W37A 3A22A 4L4OA 3PZTA 1VJSA 1WPCA 1ZBKA 3SCSA 3WDJA 3BLPX 3WY1A 4IPLA 1KQZA 3AFBA 3S6TA 4F66A 1DTUA 2ZX8A 3LPOA 1KBKA 3VIKA 2O9RA 3AS0A 3SCUA 3BUBA 2ZUNA 4JIEA 1XD0A 3T0DA 4X0VA 4GO8A 2VRKA 3G6MA 2WMFA 3NCOA 1H49A 4QP0A 4WSJA 1EQCA 3OBAA 4X9YA 4MNMA 2ZOXA 3SCNA 1JIBA 2J8GA 3POHA 1Y7VA 1U2YA 2ZXAA 4XUYA 2XM1A 2AOSA 1FHDA 1QHPA 2O92A 1HX0A 1CGXA 3CZSA 5ECUA 4WF7A 2CBIA 3RMEA 4MDOA 5HPCA 1H0GA 2CHOA 4LYPA 2ZXDA 4MPKA 2WM0A 1J0IA 5BRQA 1V6YA 1V0MA 2VI0A 2CCRA 5KEZA 1KTCA 4DM2A 1UD2A 1UD8A 2G3NA 3GBEA 4NF7A 1PX3A 2EJ1A 2VOTA 5HNNA 1LLOA 2G41A 4D1IA 1UD3A 1BFNA 1E0WA 3LRMA 2G4FA 1CLXA 4JL1A 1V0KA 4OBSA 4AIUA 3BXWA 1E0XA 4FNPA 1V3IA 3MKKA 2PWGA 3HG3A 4V27A 2YA1A 1E1FA 2Y8VA 3A4XA 3FAXA 3CMGA 1JYVA 4Q7NA 3QHOA 1MVYA 3AYRA 4DO5A 2GDVA 3VX0A 4JFUA 5ABFB 1WZAA 4ATLA 4PRWA 2CIPA 1NWUA 3OGRA 2ZX5A 3T08A 1B3VA 4JFWA 5IDIA 3K4DA 4HZ6A 2WSKA 2XFFA 1MFUA 1VAHA 2EPLX 4GZIA 1XH0A 1ISYA 1TE1A 3EJRA 1E3XA 1WZMA 4C7FA 2BY2A 2XFRA 3H55A 4PMOA 4ZXLA 1KXHA 4ACZA 5JUVA 2WVVA 1TQVA 1VFOA 4UNIA 2E40A 2QHAA 1JZ8A 1DWGM 3TTYA 3NSMA 2ZUWA 2QPUA 5TD4A 5LYRA 5BROA 2DSUA 3HMCA 2PBOA 1IZJA 1CDGA 3N9KA 1CXFA 1KFWA 1MQPA 3WQWA 2QPSA 1EQPA 3ARTA 3AYSA 4S3KA 3ALFA 2UY4A 1G5AA 1AQMA 3GTNA 2WHLA 1UOKA 1E4MM 3VTRA 1UR0A 3L4TA 3WH9A 2JALA 1TUXA 1HKKA 3WD3A 1LJYA 2BY0A 4P7RA 2WMJA 1AQHA 1HKJA 4DO6A 1A3HA 4GI8A 3PZVA 1HTYA 3ZSSA 4X0NA 2ZWZA 1B1YA 4AZ5A 1F4HA 1W9UA 3HJEA 4LYRA 4P7QA 5DO8A 2DH2A 1W2VA 2GDUA 5FCZA 3DHPA 3QHMA 3ZT7A 1JG9A 4NXKA 3W4RA 3UG3A 1OT2A 4UR9A 2CXGA 1ISWA 5E70A 3L4WA 4J3XA 2DSWA 3CMJA 2Y5EA 2CKSA 4W5ZA 2DSKA 3A23A 3LXAA 1W3JA 4DUVA 2VVSA 1ZJAA 3CHFA 3I3EA 3KE0A 2JFEX 1KR1A 1CGYA 3DHUA 4UQAA 2DT0A 1WNOA 2J62A 3H53A 1NM9A 1BHGA 3WF0A 5LA0A 1DWIM 5BWFA 2VZUA 1V6WA 3VD7A 1R46A 1JDDA 2D0HA 4P7NA 3VIOA 4CD5A 3UG4A 3AIEA 3BVUA 1ECEA 3ALGA 2WBKA 1FA2A 4CN1A 1R85A 1M04A 4GO9A 4Z2JA 1XGZA 3UG5A 3ZOAA 1BVNP 3TONA 3SUSA 4W89A 3BCFA 2TAAA 1LL7A 1BYCA 5E1QA 1KQYA 2PF0A 1ZL1A 3NJ3A 2YBTA 2CBUA 4PSPA 5AYBA 3VNZA 3VSVA 1EXPA 3LPFA 5HBFA 2V3DA 2X2YA 4E8DA 1HXKA 4AWEA 3QOMA 3WD1A 2J47A 2VX5A 2EPMX 3EBVA 1B3XA 3CO4A 4U5KA 1QW9A 2CBVA 2EBNA 1UH4A 4F9DA 2QMKA 3WMBA 3TOPA 1LQ0A 2GK1B 1EHAA 3BLKA 1PZ2A 2W63A 2BXYA 4EE9A 2VL4A 1CZ1A 2CESA 2YFOA 3VSUA 3ZSTA 4MB5A 2WKLA 3AROA 3CUJA 4UOJA 2IXVA 4HA4A 4HZ8A 3WQVA 5A6BA 3SUVA 5IFTA 4ZFMA 3RM9A 4D71A 3VX1A 4HU8A 4AD2A 1GOIA 1WDPA 1B9ZA 3WEMA 2JIWA 1JZ2A 2QMJA 3UEQA 1E4LA 1NP0A 3MUAA 3PTKA 2QLYA 3O6AA 4JL2A 3W6MA 2F7OA 4GIAA 2D22A 5A8QA 1J18A 1XYZA 3LPGA 4BS0A 4KH2A 3J7HA 4DWSA 2VNCA 1HJUA 5FL1A 4CCCA 3N17A 3EDJA 2GJPA 1E6XM 2J7FA 5GNXA 1J9YA 1JZ6A 4JCMA 4V28A 1CENA 1HT6A 6TAAA 1L8NA 1KXQA 4WSKA 1GZJA 3I3BA 3CGTA 2D20A 2CITA 4P8VA 2V3EA 3N12A 1XC6A 3M07A 3W0KA 1EA9C 1WP6A 1NQ6A 1D7FA 3WMCA 2ZX7A 5BXPA 1UD6A 2BNJA 1E5NA 3D4ZA 1OM0A 1FH7A 5GNYA 3AMKA 3OLGA 1NARA 1C3FA 1HJVA 1M03A 3FHQA 2GJXA 4XV0A 4FLOA 4OOUA 1UWUA 1BSIA 1HIZA 2WZIA 4W84A 4C7GA 3DYPA 1JF6A 1U33A 1FH8A 4LQ1A 3ZJ8A 1E4IA 1WDQA 3PZUA 2PWFA 1AMYA 3VNYA 2AMGA 2ZUSA 2YJQA 3FNDA 5IXEA 3VGEA 4AIEA 4BQ4A 2WK2A 1L0PA 4GQRA 2WMGA 4D6FA 3VGFA 2GFTA 1V02E 3W26A 3BGAA 1CGTA 4TUFA 2YLAA 5FL0A 2ZE0A 4D1JA 5D9PA 4AD0A 4PCSA 5GQBA 2VZVA 3AS3A 1KR0A 3MMDA 3GNPA 1E73M 3CUIA 3APGA 2DIEA 4Z2IA 2XM2A 1UH2A 3ARXA 1DWJM 2OSXA 1UR8A 4MDPA 3VGBA 4U2YA 4JZ5A 1EDGA 3O9NA 1JAEA 1E5JA 1J11A 2X1IA 8A3HA 3CTTA 3W6LA 3LX9A 1CWYA 3BAIA 3N15A 3BSGA 3W38A 2UY3A 3MANA 1QWNA 1TZ7A 3BVXA 4B9ZA 1FFRA 4ATDA 4HMEA 2J7DA 1KGUA 4P8WA 3II1A 1QNPA 3WEOA 5KZ6A 4RE3A 1K9EA 4MADA 1IZKA 1ITCA 1E71M 3ZR5A 1RD6A 5LA2A 2ZX6A 1GHSA 1VF8A 3WF4A 4DO4A 2W67A 3L2LA 6CGTA 5A3HA 4OGZA 4JHOA 3BMVA 1QX1A 1OGBA 4OBRA 3B9EA 3VDBA 1BGAA 2W66A 1E72M 3VIIA 4MB3A 1BGGA 1E6RA 4TVDA 2E0PA 1GOQA 3SUTA 4B3LA 4CN6A 4U5IA 1ODZA 2VX4A 3VIPA 3CZKA 1FH9A 1TG7A 1V6XA 2E9MA 4DUWA 4TVCA 3L4ZA 4HU0A 3AIUA 3A6OA 2DPEA 4MNJA 3WNLA 4N0RA 5I79A 1TA3B 1G0CA 2WMIB 1J0HA 1V03A 2XPKA 4P8UA 1V0LA 3GXDA 3FY1A 2WCAA 3UR7A 4WKAA 3AIWA 4CUCA 1E43A 5A8MA 3BCDA 1X6NA 2A3HA 1H2JA 3KZSA 3MUZ1 1ZBCA 1E1EA 1UQYA 1PIGA 2F7PA 2XVKA 4PMQA 4AMXA 1R34A 1JZ7A 3ARSA 3GXTA 1JNEA 4MNKA 2XJ7A 2ZUUA 3DDGA 2WCSA 1Q6CA 1QNSA 2WHKA 4PUDA 1W91A 3VMOA 4FNTA 3S5YA 4HZ7A 1XSIA 3PN8A 4E2OA 3OA5A 4JFTA 5D9MA 3FAWA 1B3YA 3A5VA 3RM4A 1E6ZA 1VEPA 1XH2A 1E6NA 4D6IA 2VURA 3CZJA 2BHZA 3SCVA 3W24A 3WUEA 4JKKA 3EJUA 3THDA 2WHJA 3IAQA 3GXFA 3LRKA 4DUXA 2NW0A 3KWXA 3VD3A 5I5RA 1JAKA 1UR4A 2EADA 2J75A 4W7WA 1WZKA 2XGBA 2ZX9A 2V3GA 4CU7A 2XHYA 1B90A 3DYOA 5DEZA 3MI6A 1BQCA 2J7GA 2W62A 4YN5A 3WNOA 4WLCA 1DWFM 3ZQ9A 2VRJA 1OIMA 4LXFA 2ZIDA 3VILA 3U5UA 4NZFA 3MV01 3NUKA 5IFPA 5HDRA 3PZ9A 1H0IA 1N82A 2VQUA 3WDQA 4JAWA 5DFAA 3WH6A 3DC0A 1UHVA 4H8UA 4PN2A 3WQ6A 3AHXA 2X8RA 3WUFA 3TTQA 1HP4A 4B3KA 2V3FA 4U31A 2WC3A 3FHAA 3EMZA 3ZJKA 2W91A 3AMCA 3CZNA 1GHRA 1G94A 1QVBA 1PIFA 1RPKA 4MB4A 2RGMA 2ZUTA 1HF6A 1BF2A 2YOCA 2VX6A 1J0KA 3PZGA 3KL0A 2VT0A 1LWHA 1GQKA 4AY1A 4W87A 1TQSA 2F2HA 1KGXA 5BYWA 3LMYA 5E0CA 1VRXA 1BTCA 9CGTA 2E9BA 2CERA 1SR0A 2EABA 1OD0A 1KTBA 2OLHA 2W92A 3LPPA 5CG0A 3WQ8A 1WE5A 1UWRA 3AS1A 3THCA 1W9DM 1CLVA 1WAWA 4XZWA 2J7CA 3FW6A 4TX8A 4D6GA 1H11A 4HMCA 1EO7A 1US2A 1OB0A 1UKQA 3BAJA 4GKLA 1GORA 1E70M 3OIHA 4AD5A 4QCEA 1GVYA 4F9JA 3BUPA 3CH9A 2Q8XA 5DT5A 1FOBA 4M29A 2XVGA 3VD9A 3GXMA 2YDQA 3AIBA 5JIWA 3VIJA 2BHUA 3WNKA 5CPTA 3MV11 1H41A 3VD5A 4GI6A 2BVTA 2J79A 1QWUA 2WVTA 3JUGA 4BCEA 2XN2A 1I1WA 4FNRA 2EQDA 2FYVA 5A6BD 4M56A 1OGGA 2Z1KA 4PMNA 4KWUA 4LX4A 4H04A 2VCAA 3CPUA 4IISA 2DDXA 1GNXA 1WDRA 4CD6A 4NSBA 5A8NA 5JBFA 1JZ3A 3HG2A 2GSJA 2D73A 1JD7A 1GVIA 3MU7A 4D6CA 3AS2A 1IT0A 2XIBA 3K8LA 1H1NA 1B2YA 1CXHA 2WMHA 3UETA 4UFMA 3TA9A 4F79A 2XSBA 1J10A 4MNLA 1JFHA 1B30A 2PC8A 5E6ZA 1C8XA 2X09A 2X2HA 3L4UA 1V3KA 5E9AA 4NI3A 4HMDA 3RDKA 2VZOA 5I0DA 2XUCA 1PEZA 1VENA 1E3ZA 1W32A 3EJTA 4DWSC 3TP4A 3VUPA 4H7VA 2W4XA 1W9XA 2GJXB 4AZCA 1K6AA 4UFKA 1UASA 2CYGA 3CUGA 1XCWA 2GUYA 2ALWA 2XWDA 3WD0A 2ESCA 4KRUA 3A24A 4Z2HA 1UWQA 1VBRA 4PYSA 3VDAA 4V2XA 5D8WA 3HN3A 3U7BA 2OYMA 3RJXA 4UTFA 4UQBA 1VEOA 4NRRA 3WN6A 2XVNA 1GONA 5A6JA 3KL5A 4FLSA 4AZIA 5CPSA 1E6PA 1Q4NX 2YDSA 3O2LA 3WDPP 1TQWA 4E4PA 2HISA 4DM1A 4LYQA 4ZE4A 1LF1A 1BPLB 2GK1A 1U30A 1GQLA 4GQQA 2XIIA 1OD8A 4NX0A 4AD3A 1MXGA 3AZSA 3AZRA 1JI2A 4A3HA 1ZU8A 1C8QA 2XWEA 4W8LA 1OINA 4BZYA 1F4AA 2EEXA 4UFIA 1A47A 3VMNA 2ZXQA 1I75A 3GH4A 3HZ3A 2YL5A 1V6UA 3BMWA 4MJ4A 4U3AA 1QNOA 1DHKA 3GDBA 5M5DA 1HVXA 2EAEA 2J74A 2O9TA 2DT2A 2WC7A 4XZBA 3BUDA 3LRLA 3WBAA 3POCA 4JKMA 1MQRA 2YBUA 4W85A 3IJ8A 2WVVB 3W29A 5A6KA 4W7VA 1UKTA 2JEPA 3FN9A 4ZENA 2OYKA 3F4VA 2D0FA 3WUGA 2XFYA 1PX4A 2VX7A 1QNQA 2IXUA 4TTGA 4YHEA 2EACA 1C93A 3GH7A 1BVZA 2FH6A 3VINA 1QBBA 3K46A 1K9TA 1C90A 3WL0A 2Y24A 2FE0A 1OT1A 3QOKA 1TCMA 1NWTA 2O9PA 4GZJA 1BYBA 2BHYA 3EJQA 1VIWA 2CKRA 4NZJA 4AZBA 1M7XA 3QHNA 3W53A 4CKQA 4TX6A 3WQ5A 4D6HA 3IGUA 3IAPA 1TR1A 4DWSB 4UCFA 1X6LA 4OOZA 3B9DA 4HP5A 3E1F1 4QCFA 4AZCB 4JKLA 4AC1X 5A69A 1V6VA 1MW3A 1J01A 3U7VA 2DGAA 4NXSA 1EIBA 3ARVA 1R75A 3A21A 2J7HA 4OIFA 4AMWA 1ZB5A 2E4TA 4C7DA 2WNWA 1XCXA 2IUZA 1AVAA 3BLBA 4IUGA 3CBWA 3NDZA 3ZO9A 3ZT6A 4J28A 3CUHA 3T0AA 5A94A 2XN0A 4J3UA 2HVMA 1GW1A 2F1AA 1HJXA 3VU2A 1JF5A 3ZT5A 2DT1A 1KXTA 3K8MA 1JDCA 2WC4A 3PTMA 2WHMA 5I3DA 2J77A 4ATWA 1ISXA 3DX2A 4P7LA 1W2PA 4AZGA 2XG9A 5D9OA 2WW5A 2VMFA 2WZHA 5F7UA 5I78A 2XVPA 4XB3A 2YLLA 5HOSA 1EO5A 1CBGA 1GJUA 1PJ9A 5I24A 3SURA 1JZ4A 2A3AA 1HKIA 2Z1SA 1DWAM 3WQ4A 4J27A 1E0VA 4ML4A 4AIOA 4J7RA 4K68A 4Q22A 1MW0A 2VVNA 1H5VA 3PHAA 1LL6A 3ARUA 3MO4A 4RE4A 1W1YA 4D72A 2XTKA 2ZUVA 1B3ZA 1KXVA 5CZKA 3BSHA 2FHFA 4EK7A 2DIJA 1K9FA 3VGDA 1S46A 3AOFA 2E9LA 2EPKX 3CZGA 3B9AA 3VDHA 3A4WA 5I23A 4AZ7A 2V5CA 5EMYA 1UZ4A 3DX3A 3CUFA 1TMQA 2EPOA 1TQTA 1NWSA 1NOWA 1D2KA 3BC9A 4W7UA 4E8CA 1CPUA 1JXKA 2F7QA 3VM7A 3WH8A 4A3YA 1V3MA 3ZIZA 3KEHA 4HOXA 4FLQA 2CNCA 3EDEA 3LXBA 1ZBWA 3TTSA 4B15A 1G9HA 1PS3A 1HL8A 1JD9A 4PTWA 4JFVA 2YKKA 3PZMA 5BXTA 3QGVA 3RIKA 2A3BA 4PMRA 3VPLA 3SUUA 2CETA 4UZUA 3SIMA 3EJPA 4M8UA 3L4YA 4FLRA 1UQZA 1GOKA 3AXHA 1RP9A 3BUQA 1E6SM 4R27A 1ODUA 1CEOA 2F18A 3N11A 1J0YA 5C71A 1QI5A 4GXPA 1W1VA 4QLLA 1QW8A 4URIA 4GI9A 1NWRA 1UUQA 5D4YA 1QBAA 3WBEA 5BXRA 5E6YA 3W81A 3WNPA 4CU8A 3WF3A 1KBBA 1W1PA 2O9OA 2W5FA 3SCQA 1O7AA 2JIEA 2YFNA 1OCQA 4HA3A 4PEEA 3VOCA 1LL4A 4P8XA 4AXNA 4QLKA 2D1ZA 5A1AA 1QI3A 5FKYA 1VFUA 2J7BA 3GH5A 3MMUA 1SMAA 4KGJA 1R86A 2BS9A 1HJWA 3N04A 4HA1A 3MUIA 5CSUA 2BFGA 1EH9A 4H2CA 2OW7A 4BF7A 2WANA 2JE8A 3EYPA 5JBDA 4WJXA 2G8ZA 3B8SA 4EKJA 1E40A 1G1YA 3L2MA 3WENA 3T2OA 3U57A 3MUY1 4AZ6A 2J4GA 1UH3A 3PZIA 3CZ8A 2ZICA 2EXOA 2UWFA 6A3HA 2J8FA 1HNYA 4UQEA 1C91A 4AD1A 1RH9A 3BAWA 1V08A 5A2AA 1QOXA 3OGVA 3GXIA 5FOOA 2FDMA 1R33A 3DX4A 3CIVA 5A8OA 1TQUA 3VIMA 1XD1A 2OWCA 3I3DA 5ABFA 2GJRA 3EMQA 1KGWA 3KLKA 1QHOA 2UY5A 4M80A 1W3LA 3CHEA 1E6QM 1E15A 3MS8A 4H41A 1QI4A 4MAZA 3OZPA 5EB8A 5M03A 3AMGA 3GM8A 1E4NA 2BXZA 2DH3A 3F5KA 3WNMA 1JYNA 5GPRA 1W3KA 3AIRA 4NRSA 1H4PA 2FHBA 2XSAA 4N42A 4OKDA 4PTXA 1NP2A 2J78A 2XVLA 3KLLA 2DQXA 2VUYA 2BVDA 2BY3A 3GYCA 1WDSA 2VZSA 4Z2KA 1IV8A 1CGUA 1C7TA 3M7SA 3ZJ6A 1XV8A 3RCNA 3VM5A 3AXXA 4JFSA 4HTYA 1FHLA 2V38A 3WD4A 4QDMA 4D6JA 1JXJA 1M53A 1R7AA 3D52A 3AISA 5AC4A 1Z32X 5A6LA 2FHCA 3RM8A 3TV8A 1GQIA 2D0GA 3BVTA 1E9LA 5AC5A 4B9YA 4AW7A 4CD7A 4FNSA 4CCEA 2NT1A 2Y2WA 4CD8A 3FXYA 3W25A 2G3JA 2J7EA 4HOWA 3GNOA 2YL6A 4MTVA 1UA7A 4PMZA 3SCRA 2YIHA 1TVPA 3CLWA 2C0HA 4Z2LA 4UOZA 2MANA 1G01A 5DMYA 2PBGA 5HXMA 4YPJA 1XH1A 2WMIA 3WUBA 1ZS2A 2X2JA 1LG2A 4FF5A 2VQTA 2IGTA 1PX8A 4BA0A 3WY4A 5CLWA 2BY1A 2C8NA 2VTFA 4R5EA 5CSYA 1JNDA 2WKGA 3ZMRA 3W82A 4UFLA 3CHDA 1W9BM 1HWWA 1D3CA 3KL3A 1E56A 1WCGA 3ARZA 3SCOA 3NYDA 3T0BA 4FNUA 3PZQA 4CCDA 4H8HA 1EOKA 3SCPA 3U5YA 3N13A 3OGSA 4OZOA 4WKHA 4A4AA 3BVWA 3LXCA 4AYGA 4ZE5A 5BRPA 1V02A 2OSYA 2WWCA 3WKZA 5CGMA 5IHSA 5FD0A 1CIUA 3EDKA 3K4AA 5JIPA 2EPNA 2PWHA 2PI6A 1OWQA 3AHVA 4NZCA 4DWSD 1GOMA 1UD4A 1XRVA 3IJ9A 3D3AA 1SMDA 4AISA 3RILA 3NDYA 1HKMA 3WEZA 3IJ7A 1SYTA 2UY2A 1KCLA 5A2CA 5CQ1A 3W27A 2WSPA 3ARRA 1QPKA 3GBDA 4WKFA 2JF7A 1VEMA 2ZWYA 1JI1A 1GPFA 1UWIA 3GXPA 4AEEA 1LG1A 3RPMA 3UCQA 2WB5A 3A4AA 4PMDA 3PZNA 4ACZB 1UWSA 5LA1A 1JZ5A 1LWJA 4ACYA 3WSUA 1CXKA 1SZNA 2FGZA 4PMUA 4U33A 2WCGA 4FMVA 1HJSA 1OGSA 3SUWA 1MXDA 1VJZA 1AQ0A 1EDQA 1ESWA 2OWWA 1UR9A 4EAMA 3OLDA 4UQCA 1CYGA 2OWXA 3RO8A 4CD4A 3K1DA 1O7DC 1C7SA 1MYRA 3WH7A 2D24A 2AAAA 4LPCA 1MFVA 3AICA 2VCBA 2OW6A 1W9PA 4AD4A 1W9VA 3PTQA 1HL9A 3ZJ7A 3AHYA 3ECQA 3DDFA 4J3SA 1EDTA 3DX1A 5M17A 5DT7A 4J3VA 3IANA 2DT3A 2XGIA 1SFSA 2QF8A 1CXIA 3AHZA 1WZLA 3SEPA 4KGLA 1BAGA 4J3WA 2DSZA 1NOUA 1I1XA 1VBUA 1JL8A 1WKYA 5ABHA 2JEQA 3BAYA 5BXSA 2XN1A 2BVYA 4U3CA 5EBAA 1V0NA 3UESA 1QNRA 1KWKA 3CV5A 3RJYA 4LGXA 2CPUA 4F8XA 1GOOA 3N18A 4M24A 2VC9A 5A6SA 3VGGA 7CGTA 3OG2A 4AZHA 3NIYA 4S3JA 3HU7A 1B0IA 1ZBVA 2V5DA 1Q6EA 5AYIA 2E8ZA 1X1NA 3OLIA 3OLEA 2A3CA 3F5JA 3T2PA 2VJXA
chains in the Genus database with same CATH superfamily
3F12B 3E7JA 2GGHA 1YAZA 4U6XA 1DIOA 1VERA 5F7EL 1MAKA 4I88A 2YS4A 1AFVL 5CGYC 4IIGA 3GSVA 1SFJA 4D6EA 3S5ZA 4HCLA 1LO4H 2AJ3B 2JTYA 4M8QB 2VQ4A 4OW6A 2R15A 5A6AA 1QKZH 3BE7A 1KIRA 4L1SA 2VZTA 1MCOH 3N4FA 4ORGB 4UFJA 4XZIA 5M3WA 1V3JA 1K8IB 2VGBA 3WFZA 1I7TA 1MHCB 1HSBB 2I07A 1QFWI 2VISB 3FN0L 2GSHA 1J87A 2Y5QA 3HI5L 1BVNT 1BP3B 1N7ML 3VSTA 4GRMB 1GUVA 3FEMA 1OAZL 3BE1H 5DRIA 2KL6A 3DX0A 2BIOA 4MJ2A 4X8JA 4Y88A 3OPZL 4KDVA 2ZADA 3AYTA 3SDAB 5EHFA 3OO2A 1PY9A 2HA1A 4IG2B 2CNZA 2VKXA 1EAQA 3VXSB 2RMNA 5DJ2A 1PKNA 4AYDC 4BV1A 5C2GA 3D51A 1Q6RA 3DFYA 4HJJH 1IM9D 1IC4H 4LLYA 3LHYA 1RL1A 3K4WA 4LCQA 4ALDA 3JWNE 1IC7L 1G7MA 2A1YA 3AIVA 1U8LB 4LEOA 4W9FC 1BECA 3BUIA 1YPZB 2VLLB 4BWUA 4NWTH 3C6SB 4OI8A 3TYZA 2QR0B 4QRBA 1XAUA 4G2AA 4XX1G 1XSJA 3GSVB 4KI5C 2Q76A 4MD0A 1WGVA 3EFFA 5DMKB 5I6MA 5ABGA 1JVKA 3NJVA 1XLKA 4ES4A 1A4KA 3OMIB 4Z7AA 2Y1ZA 3JV5A 1OZMA 1W6WA 3UZXA 3FRPG 4HLJA 2NVCA 3P14A 3UJEA 3YPIA 4NDMA 4QRPD 3IGFA 5DK3A 3T0ED 3WOVA 1J8VA 3FUMA 1PTDA 5ICZB 5CCHE 1LM1A 4GKZB 1KWGA 1KELH 2APXA 1J93A 2WYSA 3HC4H 3GLEA 4JZJB 4KAQH 1CFMA 2BM3A 4DETA 4OFKA 2MUCA 4B5NA 4ERAA 5A8PA 1BCIA 1OWRM 4WIWA 1P2CB 5JOFB 1UZ1A 2EGZA 1HIMH 4JREC 2CZVA 3UZZA 1JTOA 2MOQA 4I8YA 2FBOJ 3KWVA 2EJAA 4PMYA 1CLOL 3BXNB 4KZ0A 4DCQB 4ELKA 5AFAA 3GZAA 3NURA 3RGVD 4CN4A 3MTRA 3SOBH 4YIWA 3C6LC 3QZLA 1BEXA 3P54A 1F41A 4E0RA 5HA7A 2HTMA 4EX4A 4HPHA 3GU2A 1UWYA 3R2GA 4D8AA 3ATAA 1JV5B 2Y8UA 3CN1A 3EZ8A 1KC5L 4FYSA 4IDJH 4GMTH 4AYSA 5KVFL 3H70A 2R1WA 4I0KA 3DGGA 4N9DA 3Q2WA 2XPYA 3MJ8B 2ICEB 3UTSE 1L9QA 1V4YA 4OT1L 3QDJA 2F1BA 4NCC2 1YDOA 2O30A 4PTUA 3JT0A 3LZLA 2NUPB 5E9DE 3HPSA 4NOFA 5EUOB 3D87B 3IK2A 3L3HA 4JFPA 2ITDB 3QNXA 3QUYD 4Q4EA 4YLQT 3BMXA 3T09A 4N9EA 3BGFB 4FNQA 1U42A 3AB0B 4O2CA 1G9NC 3EFDH 4FABL 3WFBL 2EDFA 5CFHA 3C0SA 3K1KC 1WAAE 5EC2B 2WBGA 2J66A 4ICNA 3VFNA 2RHEA 4ELMF 2PPAA 1DQVA 4RDBA 3PPHA 3B1TA 4XMPL 3BXNA 1KTDA 1AR2A 4UIKL 2HN7A 5KTEL 3S42A 1MCCA 1FYTB 1NOFA 3DVFA 3IF1A 4RRPG 4WHYG 4UZSA 1BYNA 1YNPA 4K71B 5ABEA 3P2BA 5ETUA 1CI5A 4HKBB 4POZD 4JNMA 1DQKA 2LQRA 3RPIB 4GAJL 4LKCB 4PULA 2ODHA 3KCPB 1TJIL 2HKHL 3IVKB 3H2PA 4WUKH 3K2UH 3OVGA 4ZFFA 3O2DA 1LQBC 2VP8A 3S4TA 4G1KA 1E6OL 2IG2H 2IIJA 2ESVB 5I02A 1ZTXL 1NLDH 2Y1AA 1CECA 1M1SA 1IKFL 3QYMA 2J8HA 5DD3H 4P9HH 5EMJA 4UBDC 1L0YA 3N9SA 2EYRA 2BFVH 5DQJB 1BF6A 3OTRA 1R17A 5IG7A 1ZIBA 4PH8A 1FYTD 2Y7QA 1JCTA 3URQA 4MKVA 4GBXD 3UBXI 4K8GA 3FQYA 3N6YA 5EUKB 2GHZA 2OJZL 2E5EA 2X6BA 1W72B 1TMLA 3NQVA 4N8VA 7A3HA 5D7JC 1UZ8A 1AQKL 1R19A 4JFDA 3QB7C 2UX7A 4HAFA 5I19H 1HKVA 4Z0SA 2AZUA 3N0PB 2CK0H 1FE8H 3RL1B 4WKZA 3PBYA 4YHOH 1UM4L 1V5JA 3C61A 1FYTA 3EIFA 3H7RA 2XUWA 4PLJD 4PS8A 4WR3A 1YQ2A 1V7ML 3O9WB 4JM4L 4FQIH 4JQ2A 1X5ZA 3UDWC 3T9WA 3VFUA 1DIEA 5C97A 5AHNA 5CXPA 4P3CH 3ASWA 3GVGA 2VN3A 5A6IA 1I4FA 1VPOH 3QISA 1LP6A 1U22A 1ZLDA 1I7RB 3AB0C 1IE4A 1J86A 1SMOA 5J0BA 4X6DA 3ARFD 1O60A 4UOQA 2MWCA 4LL9A 1NU5A 3RKDC 1BAFL 2ISVA 4EZKA 2A83A 2LLGA 3GMOB 4LFYA 1BJ1J 5I73C 3BV7A 2CNYA 5K1VA 4EIVA 2X44D 1JPDX 3UZVA 3U2SB 5TIMA 3AABA 3KHQA 1T83A 2DW5A 1TENA 1UC6A 1HINL 5FF2A 4TSBL 4I5XA 1QNZL 3PIQB 3H3PL 3TN3A 1ACCA 1T5XA 3CZEA 3VVGA 4FC3E 4HBQA 1BYDA 2BIHA 3UR8A 1QHZA 1WDWA 4LS2A 3PRZA 3VXNB 1R4XA 3KVQA 1MOEA 2D3LA 2X2IA 5A2BA 2C0AA 3BZFB 4AX7A 4C6FA 4IBTA 4LFHD 2CLKA 4OJYA 3B9KA 4ZUWA 4DKFL 3KOYA 3L9BA 1TPXC 2G4EA 4PB0H 4IQDA 3BWZA 2NR6D 3CC5A 2K45A 1DJXA 3AHTA 3IJHB 3W9DA 2OR9L 3WY2A 1FGVH 3E8UH 3GXNA 4DVBA 2G60L 5ID1B 4XCNB 1M01A 1TYGA 1X6UA 2XWJB 2ZZ4A 3OR7B 3BP6B 4A2SA 3D4YA 5CUSH 5D1XA 3U9WA 5J11C 2P10A 2FGWH 4BF7A 2VR4A 1KXTB 1MW2A 3DIFB 3W2DH 4J3TA 4G80B 3GK0A 2MRYA 1SY6A 4KQNA 1KENL 3OG4B 1H3XA 2YR3A 2QCNA 3F1QA 3O1NA 2PWDA 2IPJA 3F2LA 3AXLB 3ZQXA 3RX3A 1I7UB 1GHFL 4MNQD 3C86A 1DQJB 5BPPA 4LPUA 2AQOA 2QGCA 3WO4B 1UKPA 3NSNA 1FFQA 3CBJB 1JEZA 1DO6A 2QTEA 2ZQKA 4MA8L 2COQA 4HWEH 5TQLA 1RJLA 4MQ7A 5MEPA 5EOQH 5T3XE 1BWLA 2OYLA 1R9ZA 4PODA 3QDGB 2AI0L 3S37H 3SSZA 4YSOA 1ZAJA 3ABQA 3TA6A 3VXSD 5BV7B 1TYRA 4M1BA 5CBAA 2FFCA 1VB9A 4ACPA 4H8VA 3MSDA 2YAMA 3F4DA 4U4MA 5I03A 4RE0A 3BT2H 1A5NC 3CHCA 3LKOB 5IDZA 1R5VA 3L4VA 2ZCLH 3HZMA 3NFSH 1JPFA 4GQ9H 4B5UA 3ARWA 4WV1A 2FKPA 3A3XA 2ZUMA 3M45A 2B7NA 4MFDA 1P53A 1E0VA 3QEHA 4UXDA 1R87A 2PGEA 5FM5O 1NAMB 3CH1B 2YBRB 4JPVH 1RJQA 1UD5A 2VM9A 4FI8A 5FYKD 3S96B 3ZTEA 1XIDA 3WBWA 3IDYB 3VYPA 3ULUE 8XIMA 5CBIA 4GE8A 4OIIH 4W4OA 1YNLL 1DPMA 5KJ7E 3QO1A 2XYLA 1H3GA 4B3VA 4GUGA 1XTLA 5IVZB 3HNTH 2EIBA 2C34A 4G6JH 4NIYE 1YPFA 1KG0A 1F8TL 4AT6A 4M7LH 2J27A 5DFTA 1JMXA 3WL1A 1KLFB 2FJFB 3IMSA 3NO5A 2E56A 4X6FB 1J1OH 4JTEA 3RLHA 1XS2A 2WLKA 3NIFE 5KUKA 4Z95L 1Q6FA 2HLEB 3BAKA 1RZ7H 4OZHB 2C15A 1T04A 4NO5A 3L3DA 5JMRA 3O4LB 3CUZA 2EUVA 5K5YA 1IJNA 4WVXA 4K7PY 4PJAB 1V7NH 4BD4A 2W61A 6TIMA 1OC6A 5DJDA 3O3BB 4H25A 3W28A 4K8RH 3NWRA 3NZ8A 2IVFC 3GLAA 4KRPB 3TBSA 2GBAA 3W5MA 2W65B 2G3IA 1MQQA 4K3JH 3VWKC 1EFXD 1L9TA 4PJXF 3QLLA 3DV6B 4UR8A 4ZYKA 1OCNA 3TNMA 2AGKA 1ULVA 4QNWA 4RE2A 1O6IA 2W88A 3OPZH 3PXJA 1CXEA 2X05A 3ZGIA 1DDHB 1QHQA 1MWOA 5KZMA 2EVJA 2BSRB 4IQEA 1A4BA 3NZQA 5I2UA 5CP3H 2RFXB 1KGCD 2VIRA 4H0GA 3MRJB 4D0CB 2I5YH 4UTTA 1BQKA 1P7KA 2PDUA 1FV1A 4YLCA 2VM3A 2DW6A 1ADQL 3WLMA 1L4IA 1N18A 5E00B 4ABVA 5I30L 3KPOB 4I85A 3QMRA 1MUMA 2DFAA 4PTDA 5D8ZA 1ETA1 2FT7A 3IU3A 1R24A 1DBML 4PY7B 1PYWA 2WXQA 1N64L 1SHXA 1DEDA 3NGBC 3UTTD 4E9RA 12E8H 1UXSA 3O6ML 3QRGL 4Z7VB 1HDMB 3CQQA 1RULH 2AXGB 5F6HI 1F18A 3GC3A 4MB1A 1XG3A 2MCPL 2CXEA 5HWMA 2OMAA 2J1WA 5CJMA 3STCA 4W9JC 5T9CE 5MKGB 2UVFA 2NR6A 5FYKE 3V75A 1H63A 1XGTA 4LUIA 2PKDA 4KTEL 1VJSA 3H0TA 3ECVA 4JRYB 4U6TA 4D7PA 1O9VA 2QNEA 3SCSA 3FNKA 3R1GL 3WDJA 3WY1A 3SKMA 2ROYA 4ZFGH 3AFBA 3KVJA 1U8KA 1BVKB 1X4ZA 2ZYRA 4HLZG 4BJLA 3PDOA 5GRWA 4NI8A 2VLRE 2ZX8A 3K72B 1ZWIA 3HKFA 3QJRB 1NIEA 1KBKA 2C4FU 4GFXA 1H8LA 2C1OB 5DS1A 3FUDA 3PGFL 3KZPA 4IMGA 1IGCL 3VIKA 1NUFA 1FL5A 3QUXD 2ISDA 5JR1L 2VYOA 4KQ3H 5CBBA 4CMMA 1K6QH 2BSCA 1B5TA 1TE6A 2CLMA 3N06B 4OFIA 2W0KA 4JIEA 3G6MA 4UTUA 5E9DA 2W5PA 2WMFA 3NCOA 3HHRB 1LLWA 1ZHNB 2UYLB 1F58H 2VDOL 3KJ4C 3PPSA 1NOLA 4I7VA 3UTSA 3IMUA 1T41A 1FCUA 1F05A 1RUQL 4XCYB 4H8WC 3K1GA 2OT1A 2ZNWA 2J8GA 4HIXH 3RURA 4F7CA 2W0UA 4L4TA 1I2OA 3Q2CA 5ACLA 4OV5A 5AFDA 1BM3L 3DROB 3NIDE 4IU2B 4RAUB 1CD1B 2XM1A 2D2JA 5L0QB 2AOSA 3DFSA 3MZ2A 2JCCA 4KJPC 2IGFH 3B5HA 3PGCB 4PJ8A 1UZHA 4QR6A 2G9KA 4YXGA 5KSBB 1CGXA 3OKKA 1FWBC 1IKNA 3G04A 4WF7A 3LMJL 4M6VA 2ZP0T 1EAPA 2WZPD 1ES0A 2Z35B 3D25B 5HPCA 2OXHA 4KK5D 1H7XA 3UADA 3NQFA 3BGGA 1JCKA 4LYPA 1ZT1B 4IGBB 1NANH 2FB4H 3OKOA 3SJVA 4QE4A 2FLIA 5BRQA 2GQ8A 4Q58C 3HRZC 1E4XL 2DLGA 2G5BB 1H3PH 3UH8A 3P0XA 4UMBA 4L37B 4NVTA 5D2WA 1UD2A 2WQXA 1MLCA 1A4CA 3H22A 4H6QA 4FQXD 2I60H 5F1NB 4DK6A 1THAA 1LDPH 1QBMH 1IVLA 1DZBA 1BF5A 1NL0L 4DGVL 3QUYC 1S9WA 1NY1A 4WD0A 4JUSA 5ESVB 4WFGE 3QJZA 3FSZA 4OJCA 4NHVA 3H9HB 1SBBA 1U8PB 4NQEA 1ZSXA 2PGRA 3VD2A 1TWZA 2VDIA 5BMXA 5IF0B 4AVOA 4H8QA 1E0XA 1Y6KR 1A25A 2KBGA 2YD7A 3PGCA 4FNPA 5DD1H 5D7HA 3HG3A 4R26L 2YA1A 4ZXBB 4MVBD 1E1FA 2PLKA 2Y8VA 3S1WA 2QHRL 1JYVA 4JG5A 3C2YA 4XGZA 1IWAA 1CICA 2OMUB 3AYRA 4JJ5A 1L9MA 2NY3D 4OM1L 2GT9A 3QRBA 2GDVA 1G7MB 4DZ5A 4JFUA 3TNMB 3ANVA 4PRWA 3WK1A 2UXVA 2WGNB 1FYTE 3MRMB 1E1CB 4Y2DA 1CB4A 1NBYB 3MVTA 3OMNB 3QMSA 2EG8A 1YEHL 4ONVA 5CLZA 1EEZB 4DYJA 3T08A 3VXQA 1B3VA 3T8LA 4QYAA 1NGPL 3FB7B 4BHUI 1VP5A 2KAUC 2VGIA 4YTUA 1JHKH 2ZZ2A 3DBXA 3ESPA 2WSKA 1HHJB 1EEYA 1BWVA 3MCYA 2CW6A 2EPLX 4GZIA 1XH0A 3HI1A 5I76B 2A74C 4OF3A 2ZYIA 2IPWA 2Y6SC 4JPGA 4OZHE 2J20A 5IMOA 1T5WA 2EIMB 2ICEC 2YPKB 3EOTH 3EJRA 4QHLB 3UXAA 2VE6A 5DEGB 2ED6A 1BZDA 3CVDA 3H56A 4GG6E 1UXSB 1OTSC 4EI5C 4XB8A 4Q56A 4ERSL 1D5MB 4IGBC 1H1ZA 3LG3A 4PMOA 2ICSA 3W2NA 4LVNC 3QJOA 4WWID 1TNNA 1H1YA 1ZDSA 5FB8B 2E1DA 3NPXA 1N9PA 3KAOA 4XXCC 4IXHA 1MFDH 3BGMA 3H2EA 4LF2A 2DJUA 1XG4A 1IAKB 3EEZA 3NSMA 4IIEA 3L0KA 2FGWL 1E5UI 3GSWA 1QR1B 2EICA 4ZFOB 3LNDA 1JWUB 1FNAA 1GGCH 4OCRH 3TPUA 3JVFC 4U05A 2XZCL 5TD4A 1FDLL 3TU6A 2WYIA 1AUSL 2BC4A 1VFBA 4LGSB 1R9XA 2DSUA 3B04A 3MMWA 3EO1B 1CXFA 2OJ1A 2CUIA 4ABUA 4D9PA 4EO5A 4PB0L 4QXGH 3ARTA 3B4NA 4IJCA 3AWFA 1DQXA 1AQMA 3KLAA 1F45A 4Q33A 1FGVL 3GTNA 3Q8BA 4U1HB 4W81A 1FWNA 4BK9A 5DRNA 3E6HA 1W1B1 4F7PA 1O0VA 1QRND 3G9AB 5I15H 3ITVA 2AI0H 4NNXB 3S37L 1E4MM 4Q4SA 4I9TA 4N28A 2F54A 4U1JB 3A9BA 1KENH 3FONB 3QC0A 2NUPA 1R3WA 1TUXA 3E2RA 4GXMA 3W9ZA 1A7PH 1PZBA 4M5YH 4YSRA 5I1IH 2L5HA 4LV4A 3O11B 3EXLA 2W07A 3GBLA 3PWVA 2WMJA 4P7RA 1RHHB 4GQGA 1EAOA 4N2FA 1GW9A 2QKIC 3S0PA 1MJUH 1AQHA 4DO6A 1A3HA 1XQKA 2UZ9A 5L88H 5EC2A 2NVDA 1QG3A 4ZFQA 3QJXA 3LNHA 3ZS4A 3N6QA 3M0JA 3NZUA 1MFNA 3LV3A 5BMWA 4L64A 4X0NA 3H21A 1LE9A 2B0MA 4PN6A 1NEZG 2R29H 3HE6B 5F2MA 3SJVD 5FF6A 2HN7B 2X2UA 3VKAA 3ROOA 4DJED 3HPLA 4B5WA 4A3UA 4GKOA 2XI9A 4IU3B 5EG6C 5T1MA 1SHWA 3PWPA 1F4HA 3R06A 5DLLA 5FWRA 1W9UA 4RKAA 1RQEA 2DH2A 1YY9D 5I8KL 5ES4B 3UFYA 5DFWH 2I9EA 1OYBA 4JKWA 2EDDA 1U4EA 4PJCB 3IV3A 4RGNC 2PDNA 2CXGA 2DD8L 1BOGA 2IMMA 2XN9D 3Q2VA 4LB8A 3PNZA 4MWAB 4NHCH 3ZKSD 4J39A 4L37A 2J21A 3DOSA 1ZT7B 5C08B 5ADOL 4J2XA 3QFEA 3LA4A 4EOWL 3RJDA 8RUCA 5G1TA 1E0UA 2O5ZL 3DX9A 3GBNH 1DQIA 1QSEB 32C2B 4RR4A 4QXUH 1ETJA 4JVUA 2M8XA 3PFUA 4L8DA 4JY5L 2CLEA 3FFDB 1F8TH 4PJIF 5IFJB 4I6VA 1MZZA 1XFPA 5HJ3A 4BKTC 3EA3A 3WJMA 3CHFA 2Z25A 3MA7B 4A7TA 5KW9L 2JFEX 4QM1A 1X3DA 3QI9A 1Z5LA 5DZVA 4ZW6A 4QS5A 1CGYA 2PR4H 4MSWB 2DT0A 3UZ5A 4YYFA 3R8RA 4ZMYA 3VFOA 3IIPA 1WA1X 3M5ZA 3K6DA 4QTGA 3C5SB 1NM9A 3A3WA 3AG2B 3WU1A 4XZMX 2W3ZA 2WLMA 3N4EA 4M3HA 4J4KA 4X7SH 5BXPA 3S36L 1CJYA 3LUTA 1IC5H 4INFA 3LLDA 3NL3A 4QRQB 3TQVA 2QZRA 3VD7A 3G5XB 4WUIA 3H2AA 2A6JB 4P2YA 2HNEA 1JDDA 4YWIA 3MUHL 4R7LA 4YGAB 5KANI 3FSWA 2D0HA 4HXAL 1E1CA 3GMQB 1T8XA 3H2OA 1AKPA 1MCPL 3F7VA 3K6OA 3U0WL 1MCFA 2BNRE 5F1KC 3UG4A 1B0RB 3MACL 2HE8A 4CD5A 3ALGA 1XH3B 2WBKA 5I1JH 3GTFA 2C4XA 4CN1A 2DPKA 3S6DA 4GAJH 1SJDA 3A9IA 1QNVA 1CICC 4RFOH 5I17B 4YBQC 1GKPA 1A7OL 1D5BA 4NNBA 1EF3A 3UZVB 1N2RB 3GDCA 3BCFA 1MHCA 2N0MA 2YOAA 2DYRB 4FG0A 3GDRA 2BOFX 4JNZA 2N01B 3TGXA 2INZA 3NCYS 2UXFA 1ASPA 1T5XB 4P9HL 4RAVA 1SVZA 1VPQA 2PF0A 5E8PA 1XT5A 3U9IA 1EFQA 1QAWA 1GVFA 5HNUA 3SCRA 2FT6A 5I30H 1YXDA 1RZQA 1YEFH 2PC4A 5H94A 1F74A 1RR2A 2X2YA 5LO7A 2FRGP 3GSMA 4E8DA 2Y2TA 4NKQB 2XYBA 1XIWA 3MLZH 1U3YA 4M7JL 4P57A 4K94L 5DJ2B 1VHPA 4XCNA 1L6SA 2DZEA 2OQJA 3CCHA 5E8DH 3ZE1F 2QDDA 4QGYA 1LT8A 3KHDA 5IB3A 2HJFB 3WQOA 1CR9H 3BPOB 2CRMA 3QK0A 4TQEL 3EGXB 3QW4B 4AWTA 3PUUA 3VFWB 4TQTA 3JWDH 4WRHA 2QAPA 1LQ0A 2GUOA 3GIVA 1Y6NR 1EHAA 2GK1B 4C1NB 1HEZA 2OMTA 3BLKA 3G6JE 4X6CE 2W63A 2WO2B 4WW2A 2JF1A 4OD2B 2Z2UA 4IP5A 1NICA 1OQOA 2CJ3A 3LKQA 5IHUH 1EKOA 1W5MA 4NZ3A 4HHGA 1CG9B 4G8IA 1CZ1A 3HQPA 4NJKA 1MH5A 1SW0A 2AXHA 5C0AE 1S9YA 4F2MA 3W86A 2CESA 1NCJA 4GG6B 1X5AA 1FIEA 1MEXH 3VH8A 4C83B 2OCCB 1VYPX 3SJ3A 2WKLA 2FIKA 4IOIA 3QIBD 1TT6A 5GZOD 5LDSA 1GYMA 1IIHA 4X2RA 2DVXA 3MQTA 3ROLB 4LASH 2EKSB 1OAJA 5MERA 4IKNA 4PJ7F 3IPBA 1KM1A 2BOLA 3MRNA 4MZ2A 2QFRA 2OBGA 3VNJA 3ZXWA 4YEEA 4BFBD 4CBZA 3MXWL 3NPUA 4B4HA 5FM8A 1F3DH 5D9SA 5F97E 4HU8A 4EPBC 4PLNC 2HH0H 4NM4H 3DJZA 3ULVE 4C58B 3BEVB 3ARBD 2ZWNA 2R91A 1WDPA 2ZG3A 3G1VA 3CQPA 4JY4A 4TLKA 3Q6FB 1A6ZB 3WUWG 2FTAA 4LGRB 3UEQA 3JVGC 4F8NA 1GW0A 2HFTA 3S4SB 3TZVD 3MUAA 3CV1A 4Z7OB 3AU6A 4PB9L 1GYUA 1F4XL 2C16A 5E8EA 1RZMA 2XFWA 3ZLQC 2PYFB 3FRUA 4XODA 2AEQH 2R0KL 4QRPE 1R9FA 2P0IA 3V6FA 5CJNA 4X9SA 2X9YA 3X17A 2WWMD 2JLLA 4X6DF 4XNZC 2F7OA 1TTJA 1YW1A 1HI6A 3LCHA 4WNSA 3QDJB 2XSXA 5EC1A 4E9VA 1S9XB 1GKRA 3FH8A 1HL5A 4O2CB 4ISVA 4KHTH 5HI5D 2GWNA 3STGA 1T89A 1X7IA 3RVVC 1RJPA 3I6GA 3CO8A 4BS0A 4DP4X 1MHEB 5AKSA 1R3TA 5DD0L 3SBPA 5DY2A 3Q8FA 5HUOA 2J2ZB 1X9RA 3JTTA 3U82B 4DWSA 2RR3A 3OB0K 5D32A 1E4WL 3TWYA 3TEUA 3QUXC 2AABL 3VFNB 1I82A 3O9WC 9XIAA 2YK1H 4GFSA 2AQSA 4AY8A 2E27H 4A2FA 2ISFA 4PGDB 4HKBA 5AYUH 1JGVL 2H9AA 1MFEH 1XBDA 2QSVA 1OSPL 3DO3A 1EYWA 4BF5A 2BHFA 3L1OH 1SYSA 4JKPH 5AHLA 2QZ5A 1P0NA 3BV4A 4B9PA 2WUBH 4Q0XL 3IUHA 4QWWC 3A64A 4RZKA 1XIMA 2Q6ZA 1JZ6A 4FHBD 2BVOA 4NQCA 1QOPA 3LSOA 4EVNA 4V28A 2EDNA 1HT6A 6TAAA 3VABA 3I3BA 2PCXA 3SIKA 1GZJA 3CGTA 5SX5H 2CITA 3OHXC 4WI0A 1Q8MA 2KMWA 4Q4OA 4BQBA 3KCOA 3DHFA 3MA9L 4YHYB 4F9LA 3GR8A 5I16A 2QZQA 3W0KA 4MDIB 2OODA 1M7PA 1WP6A 1I45A 2QFPA 4C6BA 5C09A 4L3EA 4PV9B 5K1JA 2OKTA 2K7PA 2ZX7A 1KXVC 2WLIB 1JPTL 2CR6A 4HK0A 1E5NA 2Z92B 2CO3A 1OM0A 3MMTA 1T7ZA 4JIIX 3FO9B 3HIZA 3OG6B 2CLZB 3QULA 3HBZA 4X9GA 3EOAB 3D30A 3NQAA 4XV0A 2CBPA 3GNXA 3SN4A 2HXTA 2WMPB 4GQPH 1YUHA 2OTWB 4YC2C 3MOQA 4OOUA 1AGBA 2WZIA 1SYSB 1ZVHA 4JEQA 4LVEA 2ZKHL 4W84A 3DYPA 4HZMA 1NIUA 4C7GA 2HFFA 1JF6A 3MREB 3SKMB 2OU4A 5GGRY 3EGXA 1FH8A 2GJ6D 1WDQA 4RNHA 1M6OA 2DWDB 3O0KA 2PWFA 3BGFC 2MMXA 1IXOA 2FQEA 3MRHB 2ZUSA 5F7HA 5JZ7D 3JUYA 1PIIA 2YJQA 1N0XH 1IGYA 3WKMH 2DUXA 3FNDA 1WAEA 4PJ7B 2ZC8A 3R4DA 5D1QB 4G5AA 3QIBB 5EO1B 3BQVA 3VXSA 3OG3A 2B7PA 1L0PA 4GQRA 2JV6A 5E9DB 3TBVA 2WMGA 2X4TB 4FJ6A 5T33H 2QQ6A 4KJYA 3VOIA 3PJTA 1JNLH 3TJHD 4AYFB 2R0ZL 3BGAA 5FXCH 3W26A 5LGHL 1TPWA 5IMLA 1Z9LA 3E49A 2X12A 2H3NA 3V5KB 1IGJB 5FL0A 5KVDE 1F3XA 4XNYL 4AG4H 3ZDZF 2VR7A 2H0PA 4E41D 1YYCA 3AT0A 5KG9A 3QNFA 2GAZB 1I1AB 2W80C 2ZOUA 35C8H 4KXCA 5IBUG 4NNPH 5LBGA 4AZUA 3L7FA 3TSBA 2F5AH 5DRZB 5GQBA 1LO0L 3W9DB 4HFWB 1P1XA 3NVDA 2NY0D 1A7PL 2H1PH 4M5YL 4NG3A 4R9OA 1TR7A 1IQWL 4WFHE 2EDJA 1E27B 4POUB 3APGA 3MRQB 4DRSA 3ITXA 4Z2IA 5ABAA 2VDOB 4YUEL 1UQSB 3MV8D 5CP3A 4G80A 4M9PA 1UWGL 1S6NA 4AKQA 4GUJA 4MOZA 1KY6A 1MHPH 3BVDB 4G8EB 3VOHA 3OR7A 2YYTA 1YDPB 1H5BC 2W60B 3VGBA 4MDPA 1NKOA 4XRCA 5J12C 1OCWL 4LBAA 3SI9A 4OQ1A 3H85A 1J5DA 4PRHE 3VI4A 3LKSA 3CAWA 5F44A 4KKZA 3L5MA 4IMKA 1JAEA 8A3HA 3RRXA 2B7OA 3BFWA 3H8NA 3INUH 4NN7C 2KZHA 1KBVA 1CWYA 2QCDA 1IGJA 1W5OA 5AHFA 5D1ZA 1TEFA 3BAIA 4UDTA 3V4VA 2W0PA 4YX2H 3HE6D 2GTQA 2X4QB 3ULVL 3ME3A 3N15A 1K5NB 1WV7T 4MUZA 3NJNA 4YFEA 2AQQA 4IJRA 1S5NA 2W94A 2JJSC 1MF2H 3LZPA 2IDCA 4OJFL 3UJJL 5EMMA 3A3YB 3ARFA 3N29A 5TBOA 1V6TA 4B9ZA 3K2MC 3PFRA 2VH5H 1PAZA 2HVKB 4HMEA 3RNQA 1BKHA 2J7DA 3B0VC 3G5YA 1KGUA 4OAWB 1XKYA 2MHAB 3II1A 1T4WA 3WEOA 4A7GF 2VXTH 3QEQA 4XMWA 3GAYA 1HEJC 5DD6A 2IV8A 1QOKA 5G4EA 5H8DA 4KXAA 4D3CH 2G75A 3HPJA 4JFPB 3B2VL 4NCC1 4IF2A 4QDPA 2ZZ6A 3TEWA 4BSVB 4L4LA 1KG0B 1NDGB 3G6AA 1FORH 4MQXC 5GJSH 4YHMH 3L2LA 4KVNH 5A3HA 2Q9OA 2VSKB 4P46D 4CJ0A 4OCYL 1KRBC 4H19A 4XX5A 3BMVA 1PKLA 1JPST 1AC6A 5D2TA 1T2XA 3AUJA 1WSST 3RWJA 4UT9H 3EADA 1KXQE 2ZCKH 5T3ZL 3BW9A 4WNJA 3ZL2A 5I1LA 5IMOB 1QQDB 1PG7L 1E72M 2JJTA 4MB3A 4ZMWA 4ZUUA 1E6RA 1CL7H 2YD9A 4YLBA 4UT6L 1OARL 3MRLA 4GEIA 2I9UA 3NZHH 5E2UH 4H26A 4ODSL 4G1MB 4MJJA 1ODZA 4S1RH 2J6EH 5FACA 1BV8A 2R2HB 1BJMA 3LH8A 3VXUA 2D7TL 3ZDYF 1M7JA 1AOHA 3KS0J 1IEBA 2OMZB 1WBHA 3KRBA 2ZCHL 1T7VA 5CEZH 3QEQB 1IT9H 4FKEA 2E9MA 4UU9A 4HC1H 4YR6A 2WWNA 3LLFA 4P5MB 3E3HA 2MOVA 3D46A 3AIUA 4MNJA 3N9GL 3IDMA 4NKDA 1A6VH 2DICA 4ADSA 4LKCA 3WNLA 4N0RA 4FDWA 3TCLA 3OJ2C 4IKLA 3VXRE 1TA3B 1XGDA 3V0TA 4J6IA 1P0EA 3QYQA 1RH8A 2Z3FA 3MCG1 1OCBA 4IRZH 4PLJC 4Y8EA 2C3VB 2J1XA 5E99L 5A6SA 4Y2OB 1BD2E 3W39A 3DH7A 4JFYA 1WHOA 2HFEA 1M2VB 4HJJL 5HDBE 5L4MA 1UEYA 3TF4A 4XUGA 3D4CA 3GXDA 1PZDA 2HTLC 4BH7B 2C3ZA 2JXMA 1FCCA 3UR7A 3HS0C 5D7JD 5EF3A 1K5WA 2VHLA 5C7ZA 2DMGA 3S2JA 3AIWA 2VLJD 5IQ7L 5KTLA 2VM4A 3BCDA 4DPPA 5FO7A 3RIFK 2OL3L 3PBUA 1G7IA 5DD5H 3EGDB 3Q3GB 1H2JA 1UXLA 4Z7WB 5HQMA 3KZSA 1YX1A 4P4RB 2G37A 1LK3H 2BCKA 5FGSA 3BRGC 1RZGA 1MVUB 5AVHA 3TW9A 2F7PA 1MZRA 1SDDA 4M62L 4DEFA 3PDOB 5I3JA 1JDFA 1JZ7A 4FO4A 1W0WA 3KPPA 1LBMA 2UWEF 1NF0A 1N6QH 2WCSA 1E6JH 3KS0H 3HR6A 3TH3T 5BU9A 5ENWB 2ZXGA 4XO9A 2H8ZA 3TBYB 2WHKA 3GAKA 3O05A 4NPYA 4PUDA 1C1EL 1J88A 1G0YR 1XGTB 1QLFB 3GFUA 4FNTA 2WSYA 3PWPB 1P5UC 3S5YA 1XSIA 2XG4A 2Z4QA 4RLIA 3OA5A 5IM7B 3ARDA 3ECWA 5H2BA 4KVPA 1PLCA 5JIQA 4MWAC 3FTWA 4M1DL 4PJCA 5LAXA 1MJ7H 4XCFH 5LKNA 1A7QH 2X53A 3MXWH 4JFQB 3TO4D 3KVMA 4F7CB 1D5ZA 2NX5A 2OZ4L 3P9MA 3B8YA 4IGBD 1OTSD 3N43F 3HB3C 3KWWA 5IEHB 3NO3A 3T0EA 5D7KE 3CZJA 3ME0B 3RAJH 4AM0A 1NSNH 3SCVA 3W24A 3A6BH 3KPMA 2R23A 2ZZ1A 2Y6SD 2Q8ZA 3THDA 2OV0A 2ETWA 1E6OH 2IG2L 1DBKL 3K91A 3BKCH 5LXXA 3DO7A 3IEBA 1EEUA 5HJ3B 4AGMA 4EPDC 1VBGA 4H88H 5EWIL 3ANUA 3GE7A 1ZT1A 1AZNA 2PRHA 5I5RA 2WJ5A 4TV3A 2EADA 4YMZA 5DHVB 5K69A 3G04B 3LCIA 3IPEA 4W7WA 4E42A 5HHNB 1Q13A 1P6AB 4G6ML 2XGBA 2ZX9A 3ZZ1A 2K9FB 5K9OA 5AVNA 1YMYA 1CLYL 2PYEB 3BPNC 5JPNC 4Q8TA 4YK4C 3W1TA 1A0QL 2QQNH 3N40P 5DEZA 2P8CA 3MI6A 4C56B 4BDVB 4YN5A 3P73B 1FO0A 5J6GB 1RK1B 4NUGL 3O2WL 2XV0A 4LSSH 4F15C 3DRTB 5LWYH 4N5EC 3BZDA 5E1HB 1HFUA 1E28A 3C5JB 1I3RA 3QFGA 4N8CL 4C4KT 3ARED 5KS9A 1AQ8A 1EB3A 3IDXH 1OIMA 4UIOA 1E8ZA 4G56A 3QR2A 1TVHA 1Z9NA 1NBCA 2VDNB 4KO6A 4X7CC 4KX9A 5DQ9B 3QCUH 5KYWB 3BJFA 2B2XH 1EP2A 1AZBA 3CFKB 1XLFA 3MV01 1VRSA 1SBSL 3TVMA 1XYAA 5EN2A 1PQZB 5IFPA 3LTYA 4HUUB 1XI3A 3HEIB 3JSSA 1JCLA 2IANB 3DENA 4NHCL 4GAFB 1OM9A 2VQUA 1N82A 2J6WA 3ZVHB 3WMQA 2PD5A 4C91A 5HNRA 3D47A 5DZNA 3CSBA 3HAEH 5E08H 1EC9A 1XIWD 1JPTH 2BMKA 3RI5K 4QXWA 3HNTL 3TTQA 2QVKA 4B3KA 1FG2A 4FULA 2V3FA 4L4VE 2XQYK 1VCBC 4KI5D 4EIGB 4PVLA 4ZPVB 4Z78B 1DANU 3HI1B 1HWGB 2EO9A 1G94A 1NMBH 5ICXB 2Z1WA 1RPKA 2BWQA 5AAMA 2RGMA 2MCAA 5TQ2L 3M5YA 1TYEB 3EFOA 4JJHA 5LGKA 3V6OA 4JY6A 3KL0A 3PZGA 4R7JA 1DVYA 1D5MA 4QRSA 2I1OA 4E5TA 3V4VL 3PBMA 5JXEC 1A5LC 4MFEA 4PJDB 4ZMZA 2Z8RA 5D71L 3V5OA 1YEWA 4Z3TA 4P46A 4W87A 1FP5A 5LNRA 5BYWA 3MNDA 3LMYA 1TQBC 1VR6A 3U9UA 5J11B 1BTCA 3AU1B 2E9BA 2CERA 2AK1L 4K39A 5LVEA 2EABA 1HSAA 3FOMB 1OD0A 2JKIS 2OLHA 4V1XA 2OFJA 1D5XB 1QO5A 4HPNA 1KN2H 4NLAA 2Y0FA 4B2DD 3EYQC 5CR1A 3S37X 4GOSA 1KLGA 5EEXA 4HMNA 1WE5A 1DDHA 3AS1A 3B1UA 4X60A 4GJTB 1O94A 3C60A 1SUJA 2WINA 3QUXB 4AEIL 3N2OA 3D39B 3N50A 1YSOA 4XNAA 1CD8A 2GEEA 5DQDH 2FX9L 1J5OL 1XINA 4F0MA 2GB2A 1IGFH 1Q9LA 5K9KA 1WAWA 3OKMB 5HVHC 4NFBA 4KZEH 2J7CA 3FW6A 2YXGA 4FFZL 1H11A 3GVWA 2DQDL 1E51A 3MDWA 1S78D 4L8SA 1AR1B 3B7TA 3DURB 3NFNA 1US2A 3BAJA 1CW2A 1L6YA 3L48A 5I8OH 3ULVD 1A1NB 4F9JA 3BUPA 3CH9A 1M5WA 4UM8B 4LLAA 1MIML 3DWTA 2MTAA 2W07B 3U46A 1RQBA 3SY0A 4LBEB 4RMRA 3V4PL 3TEXA 1RUAH 2YGVA 1A6AA 4L1LA 1S7VA 3AIBA 2QLVB 3FO0L 3GRIA 4GHRA 1SRDA 2FECI 3MV11 5J9PA 5DS2A 3VNIA 4A2HA 3TS8A 4Y5YC 3DMMD 3VE9A 5J5RA 2P5WA 3JUGA 4NX5A 4F3HA 1P5UA 3CB8A 3PWVB 4JOMA 4BCEA 4FNRA 3KBMA 1PVNA 4RWYL 4TUKL 3FONA 3A67H 3W1XA 2H3XC 3AGWA 5LXVA 4PMNA 4R6UA 3URBA 4HD5A 3BFOA 5J13B 4H04A 2H32B 3ELFA 3CPUA 4IISA 2XXMB 3RGTA 5DTFB 1J48A 1C12B 1OGPA 5A8NA 1H19A 4DEPB 5DJ8A 1ZGLA 1A8JH 5F3HA 3T4YA 4LARH 2D73A 5L6UA 1S5IL 5HHXH 3R4IA 3AT8A 1BFVH 4E9SA 3AS2A 3M88A 3OMZA 3OVRA 5FWQA 1M3IA 1EFXB 1MJJB 4N0CD 1XF2B 4NAFB 5GJPA 3TH6A 4BDVA 3QNYA 4WFGD 4HGKC 4UNUA 3F2DA 4GG8A 4KRPD 3SY0B 5INCB 4DXKA 3K8LA 2NNAA 1H1NA 1B2YA 1CXHA 3OX8B 3CLFH 2R59A 2V7HA 4XMKH 2WLHA 3U7YL 3QQ3A 3NG5A 1J10A 1Z5LB 2E76C 3O45B 4PY8I 5CLXA 3W70A 4X99A 3UGVA 3IMVA 4OF0A 5HDOA 4JHWH 1T0PB 1B30A 1P1MA 4Y9MA 1NGWB 3STEA 2EEBA 5MF5A 1P7TB 5E9AA 5XINA 4HMDA 1O9ZA 4GRWF 3WJLC 3RL2A 2GJLA 1P1VA 4IMDA 1DVQA 2ZCKL 1FIGH 3BIKB 1E3ZA 5B7EA 5JNYB 1W32A 3S5SA 3WG6A 3VTTA 1D6EA 3VUPA 4DN1A 2XZAL 1GOGA 5IV2A 3QEGH 2BK8A 1MCWW 2FLMA 3VSQA 4HK7A 2A9BA 1HZHH 5DZ9A 1JUEA 4WUUE 2ZQ0A 3WHXB 4RSVA 5AG8A 1UWAA 3ZRSA 2NWSA 3W2MA 1AO7D 1JHTA 1FFPB 2NY1C 3B43A 3K13A 2ICWJ 2A1WH 4BH8A 4JQ1A 4OFCA 1K4DB 2WYHA 4N2KA 4BRJA 4YBLB 1EAPB 3SGJC 4HS6B 3VXRA 4MASA 2HT2D 5MP6L 2XWDA 4F9PA 1OLZA 3G08B 1TUFA 3A24A 4TUUA 5MHSE 4OF7A 4Y8DC 8FABB 4QJ1A 1FZJB 1HNFA 3HN5A 4XAKD 3OF6A 2R1XA 5AVUB 2FNWA 1MRCL 5FF7A 5BS0D 2NNXA 2YC1A 3VDAA 1EZVX 4JG1H 1NGWA 4FXRA 4GK8A 4NQDE 5B39A 1MLCB 2N1KA 4L9DA 5CP7B 1DVFB 4PJXE 4R26H 4U1LB 1HKLL 1WDDA 2HSAA 4A6YB 3G8EA 3UA4A 3ZFHA 4UNVA 4M5TA 2GT9B 4UQBA 2P42B 1U8JA 4ZMNA 1JRBA 1VFAA 4FLSA 2WIMA 1ACZA 3QA3B 5CPSA 1SXCA 5CJOH 3SDYH 3KW7A 5EDSA 1RV6X 4L61A 4PB5A 4WO4B 5E5UB 1OTUC 4NKIH 2Y72A 2ZE3A 4AXKA 4DP0X 4HGWB 4LLUB 3LHPL 2ZOLB 1B0GB 3KW3A 4J40A 1AGCA 1BPLB 4JVWA 4WK0B 1HTIA 1U30A 3GIVB 1O9WA 4MMYB 1GQLA 4M62H 2GK1A 1DXIA 5A5WA 4GQQA 2NNCA 1H0DB 1YCSA 2CKNA 1DBMH 2X0WA 1OD8A 3DGGB 4NX0A 4U1GC 2X1TA 5I6PA 4EKXA 3T7VA 2HJFA 4KQ0A 2BTMA 5K9CA 4URTB 2LLLA 4DKFH 4EDXA 2MOGA 4NQED 1W3IA 5A16B 3RG1C 2ERJB 4O02A 4YDNA 3NCYP 4IK6A 1Z7AA 1F4AA 2AQVA 3C8NA 1XMWA 5HHOA 4UFIA 4ZQCA 1U8QB 3IN0A 5F0LB 2ZRXA 2HG5A 4FQXA 5FB8A 1I75A 2EEAA 4RGNB 3KBVA 3B2PA 1BRLA 4FZ8L 2C1HA 1ZAHA 2PW1A 4KTDH 2YL5A 3M0MA 4PTNA 5HVWA 3UD6A 1C8VA 4E2VA 1S9YB 2D9QB 3EBGA 1GWJA 4L8SC 2AEPH 4N85A 4EACA 3GDBA 1YMHB 1FVPA 3OQEA 2EAEA 2O9TA 3GSWB 1QR1A 4MHHG 3NESA 4NLHA 2XIMA 2R27A 4QHLA 4K3EH 4P5RA 3HMXA 3LNGA 3FO2A 1QK0A 1NGXA 4JKMA 2BIMA 4G43B 2WBJB 2YBUA 5DBTA 1GYVA 3KCPA 3W11C 3KOXA 5A6KA 3UPAA 1JQXA 1ADWA 4ZENA 2ZTBA 5DDHA 2EKSA 1W2KT 2REQB 3DC8A 2L0DA 4YFLF 4U6YB 5HJGA 1GS6X 2CHWA 1E90A 1X7FA 5AW1B 4TTGA 4OZFB 3RZCC 1YQVH 4QF1A 3VFPB 1C93A 1XLHA 4MYWB 1BVZA 2FH6A 2CJSA 3O9WD 1OD9A 3VINA 4K3HA 4ANXA 4S0HA 5MI0C 2PDQA 4I3SL 1PLBA 5DBUA 5H6HA 1CO1A 3PV6A 4GXVH 3UJTL 2PUQT 3W57A 4AJYV 5CN3A 1DN0A 2DWYA 3AG3B 4EBQH 1NWTA 2BHYA 4N24A 2IOMA 3AUVA 5BS0A 2EINB 5C9XA 1BYOA 2Z91B 5L88L 3K2KA 2Y1HA 1S7RB 3KBNA 4HUWA 3QQ0A 4CILA 5ID0A 5E93A 1HOCA 2P49B 1RIHH 4FQQA 4UV4L 1J1PH 3KPSD 3IDGB 5C92A 4GXUM 1B9BA 3A4EA 6PAZA 4AZBA 3BO8A 3GU9A 3EGSB 2R29L 5D2LA 5AAWA 2P47B 3VKKA 5C0EA 4UBDD 1D5IL 2FWLB 2CU0A 1L9NA 4UNLA 1R0MA 1QK2A 1RJZB 3I6KB 3C08L 3O3EA 1TR1A 1AL8A 5IV2B 4H5SB 4NAEA 4OFYA 3CBRA 4YMPA 5FGCE 2ESVD 1L9WA 2A3LA 3LOTA 4J5NA 5J8LA 4A35A 1QZ1A 2P8MA 4QCFA 1RCYA 1R9YA 1X9QA 4X4ZA 1EXUA 1J01A 2BS71 5CR8A 4NXSA 4TU1A 2JBMA 3W71A 3TZNA 3KPLA 2N59A 3GSUB 3TJ4A 3SZ6A 5DHDA 3ZK0A 3TU9A 5LKYA 3R06B 4EI6A 1AS7A 2J7HA 2VH5L 3IDMB 2P76A 2EIDA 4CEUC 1ZLPA 2VEGA 1S9VA 3ZTNH 3SDDD 1VIZA 2APTA 2IAAC 4PV8B 3SOTA 4HETA 1EJ8A 1ZP4A 1G1CA 2WNWA 1XWVA 2OP4H 4KDTC 3U1SL 5PCYA 4WI0B 2DMKA 4IHBA 2IUZA 3W2UA 4I77H 3B2VH 3BLBA 3ML9A 3LTSA 3ISRA 1COBA 2DBLH 3ZO9A 4PJ8C 3NG3A 3W1QA 4GRWH 5A8GA 3DX9B 1AIZA 2FR4B 4R4BA 3NQCA 3FB5B 1MKFA 4L3EB 4OFYD 3ZL4L 1BZEA 1SEQH 3HGSA 5CZJA 1F00I 4J3BA 3T0AA 3P93A 4KU1A 4W9GC 4WTZG 1HJXA 2G0LA 4DI8A 3VU2A 4URKA 2XPGA 2OCZA 2CKBB 5EU6A 3S4SG 3P9WB 3VE0A 1RZJC 3APDA 4CVXA 1XH3A 3PTMA 4I7WA 3UO8B 2V33A 3LIZL 2LAAA 3MLVL 4OM0H 4IIDA 5I3DA 3U25A 2J77A 5K4ZA 1XCQB 2WY3B 2ZWKA 1N26A 1Z5YD 4NRXA 5EORH 2XTSA 3RU8H 4JYEA 2E7BA 1WS7A 5D9OA 2BNRB 4DQOL 2WW5A 4QO1A 3GD1C 3PWPE 3QAZB 5GS0C 1EJOH 2HFFB 4HUXA 3S7GA 4X4ME 1K02A 2CR3A 1AKJB 2Z2BA 4XB3A 5C2CA 1AZRA 2ZOKA 1EO5A 1U8QA 2A2QT 4G7QB 1T22A 3VWJC 5KYXA 4EPEC 1PJ9A 4HK6A 1KB9K 5CG7A 1MUWA 2AJSL 2X40A 4J8RB 2OK0L 3SQSA 3OKDA 3KHOA 4W9KC 4YCPA 3CLEH 3FYOA 4DWDA 1I9JH 4U3HA 5F9OH 3T0EB 4DZBA 3TKFA 1OX4B 1RAKA 2Z1SA 3MRDA 5E2VH 3RUGA 5E8NB 1OP5H 1FKXA 3K6NA 3HFTA 2W9EL 1KULA 4UYPA 2A9CA 2J55A 4YBQD 1G9MH 1MELA 2K1MA 2YZ8A 4XPBH 3RVXC 1OK4A 5J5EA 2B5IB 5ICZA 4KROB 5HYJD 3EYSL 1TMHA 1LL6A 4P99A 4UYQA 3MO4A 4Y90A 4OLYL 4Q6XA 2PDGA 2XTKA 2BO0A 1MWAA 4LARL 4BFFA 1B3ZA 3UA3A 1WWBX 2KUTA 1S2EA 3BSHA 2I16A 1JP5A 1RZ8B 3TLRA 2CGRH 4X9FA 2DIJA 4RWHA 1MREH 3ALWA 1K9FA 3GHBH 5EZOL 1A7NH 5C8JB 1S46A 5FR3A 4MZIA 5JIMA 5FO9A 5F7FA 4HZAA 4IRSB 1MUJB 4Z7QF 4F9PC 2NX1A 2VD9A 2K6ZA 2ICEA 2E9LA 2EPKX 3AOFA 1R3IH 4N8VG 4WY0F 5DY3A 2OM5A 3CZGA 1U8HB 2DIAA 1XIBA 2BXVA 1Q6OA 2EE6A 3EPNA 3LERA 5EMYA 4BE5A 1UZ4A 3M1ZA 3MLSL 1K5NA 2DQTL 2DWXA 4IQJA 1NFDE 1YDPA 2A38A 1TQTA 3L3HB 2ITDA 3QNXB 1NOWA 4DQWA 4W9HC 4WW2B 3BC9A 4W7UA 2F8OA 1TZGH 4W9ZA 3E0GA 2X1OA 2CBOA 4DGIL 1T96A 2F7QA 2PWVA 1ZSHA 4F5CA 2FSDA 2QR6A 1QFWL 1I2RA 1PD1A 2JH2A 5EZPA 4GG6A 2AMUA 4L0PB 3ARGA 5E4IA 3TN6A 3ZIZA 3KEHA 3QDMA 1IZCA 2QVNA 2RFGA 4EJ1C 3GGWA 1KTLB 3PR2A 1KPRB 3P9LA 4KMLB 5F96H 5SWQA 1MWAB 5FDYA 4G11A 5DJYB 1ZLUK 5LQBL 3LM3A 2WN2A 3EDEA 1X5XA 3LXBA 3KWUA 3PAOA 1LXMA 5K33A 4I9MA 1NDMB 5FYKL 3VTAA 3TTSA 1FL6A 1WTLA 3P30L 2HAZA 4MCYB 1CBJA 3BKCL 3X11B 3WLHA 3TA3C 4UCGA 4B15A 4P2OA 3WFHA 2IO5A 4Z2GA 1HQ4A 5AB9A 1PS3A 3NM3A 1F4XH 4UDUB 2GUBA 3FT4B 3CEPA 3QGVA 2FO1A 1NUDA 4ZODA 3W00A 4UTWA 1CYWA 2V2HA 1PG7X 5CBJA 2BBFA 3IGAA 4V1DB 3VE7A 4P05A 4ZUUB 3NIGF 4PJFB 1UQZA 3EWUA 3BH8B 1GOKA 1S1PA 4KCWA 3T07A 1RP9A 4NI6A 3TA3D 3HPZA 4QMEA 3CN2A 3GO1H 3R13A 4KO9A 1NFGA 5T8GA 1A1MB 3UBXG 2L3BA 1A50A 1CEOA 4H1LH 3QUZA 3GSNA 2GIMA 4G7YH 5DJ0B 5KANG 3UEZA 1A5FL 3SPGA 3B8VA 4A66A 4YHYC 3RYMA 4OZIE 4JQ4A 2E5CA 3V2AR 3SDAC 3AITA 3HG1D 5FGCB 4ZOAA 3CM4A 4H2HA 3WDQA 2DZPA 3EOTL 3FN3A 4GI9A 3IDNB 2Z34A 1NWRA 3ZDXF 1C16B 3QGKC 1O5RA 1I1AC 3C8FA 1RI8A 4PJDF 5D7LA 4GRWB 3OZLA 3HUJE 2EDLA 3T42A 3WBEA 4Y1AD 3H8AA 3BSZH 3LIUA 1ZZMA 4NJJA 4C1LA 4Z8FH 2J73A 4PP1C 4W70A 1FWXA 2D7OA 3LKPA 2E25A 5A2KH 3NPVA 2AVGA 2EAWA 3VNLA 2JIEA 1B57A 1JCYA 3WUWA 4HA3A 4HJGA 4PEEA 3VOCA 2Z6IA 4P8XA 4PGEB 2Z00A 1ZENA 4AXNA 2D1ZA 4NQCB 4CQ8A 2WXJA 3FRPA 3WTXA 4XCYA 2ZVRA 3FF7A 1AFSA 2XH7A 4GRLA 5J89A 5FKYA 2J7BA 1X9UA 2VDPB 3AAZA 4HIHA 3P4MB 1MQKH 4KGJA 1KFLA 3QC5X 2KX9A 25C8L 2Y5SA 4CQDA 2P53A 1F7BA 1U5HA 1KACB 1VJIA 3VFTB 3RVXD 1MJ8H 2EXWC 2I25N 3CC5B 5CSUA 1JUKA 4GFTB 4IQLA 2V8ZA 2E46A 2Q86A 3RFZA 2JE8A 2WSDA 3CUPB 4G5ZH 5JIIA 5JO5B 2OLSA 5B8CC 3B06A 3KYOB 5KSAB 4XBGB 3BFQG 4PFHA 1E40A 4OV5B 2IMRA 4NP4H 3ZRCC 4EI5B 1WXYA 1L9RA 5GIRB 1HK6A 1MJUL 1IC4L 2P5EE 3IJHA 3INOA 3U57A 1SN0A 2P8PA 3PL6D 4I1RA 1JRHI 1YTEA 2WQ8A 3ZTJG 4MA8H 4FQ2H 1LK2A 3VK5A 4ZUTB 4X7DC 4KK9D 2HWZL 3MMEA 2A3TA 4CQAA 4PIBA 4PJ7E 2F7IA 1ZLWH 1YNKH 2FYYB 5H4YA 2WO5A 5CILH 2GYSA 3F4WA 4R7OA 4AD1A 4TSAH 3HCVB 4GY1A 5DMIH 1N3NA 2Y3NA 5AB2A 2HWGA 1NPJA 2WQWA 5A2AA 5AZ0A 3FOLA 3L13A 1NCTA 5LIXX 4JX4A 3MJ7A 5TH2B 5HWNA 1JFQL 4WK4B 4Z23A 2PXYA 2IQ9L 3DX4A 1HE7A 4P04A 2EDKA 1OOAA 3CIVA 1ML0A 1IQWH 4FABH 2ZRUA 4I9JA 3VIMA 3O4LE 4O2EB 1OFDA 1ZUAX 4M4PA 3MNWA 1KTLA 4PLOB 3FZUD 1HZLA 4JN2B 1J5CA 4JCWA 4G82A 3EMQA 3WBXA 2PA6A 5GGVH 3DO7B 1QHOA 1MHPL 2VD8A 2BZCA 4AU0A 2QSTA 1J8KA 4M80A 4LVHB 4PJ9B 1JPIA 3GHPA 4ES8A 1XDMA 2OAAA 2QYGA 2ZRWA 3ECBB 2KI6A 4XVTH 5JMOC 5IVZA 1NMCB 2ZOOA 3BD3A 3V7AE 2X42A 3PB0A 1E27A 2E6JA 4AGNA 3RX9A 3JWNG 4GNKB 4I7ZC 5EOCJ 4HQQL 2XISA 1QI4A 5M03A 2LGNA 3M44A 2YBRA 4KFOA 2GW5A 3GM8A 5CWSB 4YN3A 3VYNA 1E4NA 3ANYA 3I68A 3KP1A 4GSQA 3WNMA 1NFBA 1WVZA 5FYLE 1YDNA 1F13A 1U3HA 4IRSC 5GPRA 4BGLA 4LCUB 3ZE2E 2QCMA 3MRFB 2GI7A 4YHOL 1RBLA 1W3KA 3AIRA 5ENLA 1XX1A 3VKDA 4DEPC 3FOLB 2FHBA 4Y4HC 1H4PA 2B81A 2BCMA 3PHSA 3S34L 1XF0A 2XSAA 4N42A 4UTJA 4JD4A 3O4OC 2BRRH 4G70B 4HV8B 3PP4L 4R5XA 5FUOH 3ZDXE 4QGTA 3KLLA 3SGEH 2X6VA 1OGAE 2OJZH 4B9KC 4TNWF 5F7LB 2Q3AA 2Y70A 3S88L 3O6FB 2BVPB 3GM0A 1I3GH 2O5XL 3WKML 4KO5A 4XZLX 1F8MA 5REQA 2CGYA 2DL9A 2OZTA 3MDUA 1W8OA 2I32A 4BSVA 3RCNA 3VM5A 2EE9A 4ZPTA 1LO3H 2P5ED 3ZN6A 1FHLA 2EC8A 1ROCA 2J5LC 3TO4A 5JIKA 3I9PA 5FLVA 2VZ1A 1TV4A 1VHNA 3GS6A 3D52A 4QLWA 4XPTH 1RY8A 4QDWA 3RWEB 1UXWA 1IM3A 5EPMA 4MY8A 4CKVX 1F3JA 2V7NA 1N5YL 5BVPH 2Z28A 2TSBA