3BAWA

Human pancreatic alpha-amylase complexed with azide
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
496
structure length
496
Chain Sequence
b'EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Alternative catalytic anions differentially modulate human alpha-amylase activity and specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 178
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bawA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bawA01
3ALGA 1W32A 4NXKA 2VVSA 1HJWA 4Z2IA 4D6EA 1PJ9A 1CXHA 2CKSA 2DT1A 4J3WA 3CZJA 3ARSA 4NSBA 2NSXA 1CENA 1FOBA 4UFLA 1J10A 4BZYA 1KXHA 3QOKA 3W4RA 2J25A 1E6QM 4FNQA 4QLLA 4L4PA 1ISWA 1C7TA 3CZEA 3O2LA 3SUVA 4F9JA 3SUWA 1LL7A 3WF0A 2J79A 1WB0A 2BXZA 4KGLA 2XVNA 5HNNA 5IHSA 1WDSA 3W26A 1QNPA 1M7XA 4UOZA 5GNZA 3AQUA 4MNMA 4OJYA 2DT0A 1JXJA 3VIHA 3D52A 2Z1SA 4W5UA 2X2YA 3ECQA 3NYDA 2WPGA 1KCLA 4CN6A 2XVGA 3CUIA 3VX0A 3GNPA 2OSXA 2D20A 4GPNA 1LL6A 4J3TA 3B9DA 2FHBA 1R85A 3W37A 5LA0A 3D3AA 3ZO9A 3MANA 1XH0A 5E1QA 1MW3A 1NOUA 2IXVA 3GNOA 4PMYA 3E1F1 4HA1A 5IHRA 3WNNA 4UCFA 2FHFA 2WVUA 3VM7A 3DX4A 4YPJA 3WY4A 3HMCA 1QWNA 1B2YA 5D8ZA 2D73A 3SIMA 3WF1A 1I75A 2W67A 3VIFA 5I24A 1SFSA 1KB3A 2W92A 4A3HA 5JIPA 1BG9A 4R5EA 4PSPA 3CO4A 2PC8A 3RIKA 1E0WA 3ARQA 3N15A 1WDPA 1HNYA 3UETA 4EE9A 2WLYA 4WK9A 2CNCA 1QNQA 4MDOA 1TMQA 3WDJA 5DO8A 1BGGA 1JFXA 4Z2KA 3LMYA 2BXYA 4JL2A 2IUZA 3VD9A 5E0FA 5CG0A 4J28A 4UFKA 1UKSA 3OA5A 1ISVA 3FAXA 1QI5A 5BRQA 1HJSA 1VBUA 2YKKA 1M53A 1J0ZA 1R7AA 3DX0A 4JFVA 1MW1A 4AISA 1EHNA 1JXKA 4CD8A 3PZGA 5A94A 3K8KA 3QGVA 1NQ6A 1BYDA 1K9FA 1C8YA 2BVDA 2HVMA 5ECUA 3A4WA 1HJUA 1CECA 3CUHA 3WF3A 3FHAA 1OT2A 1AQMA 2FGLA 2RGLA 3RM9A 3OBAA 3MMDA 3PZTA 3BVXA 4W7WA 2Y2WA 1W1VA 3RDKA 2JIEA 3WH8A 5TD4A 2O92A 5BROA 1ZB5A 1W1TA 3M7SA 4J7RA 3MUZ1 3EDKA 1ITXA 2DSZA 3M6DA 4PTVA 4TVCA 1AQ0A 5FOOA 1EO7A 1UD6A 2QMKA 4HZ8A 2VI0A 4TX8A 2WMFA 2XVKA 2FH6A 2W4XA 1WO2A 3EDEA 3WNLA 2VC9A 4K68A 4U5IA 3AZTA 1OB0A 2XHYA 5ABGA 1UWRA 1J9YA 4AD0A 1HP5A 1BYCA 3EDJA 2EPNA 1H49A 1G0CA 1GJWA 4M8UA 3VOCA 5E0CA 2EABA 1PEZA 2BY2A 3CH9A 3OIHA 1R86A 1JYNA 1HL9A 3VKKA 3W28A 1JYWA 1XHGA 3CLWA 3ZSSA 9CGTA 2VRQA 5CQ1A 3VGEA 3S5ZA 4M29A 3VTRA 4P8VA 2WVVA 2XN1A 3WY1A 2GDVA 4AIOA 4MJ2A 1XYZA 3NSXA 4NRSA 1TR1A 1DWFM 3TTQA 1UQYA 5FL0A 3ZSTA 2GJPA 3I3BA 5A2CA 1VEMA 4PUDA 3AJ7A 4PMOA 1JZ3A 2J74A 1JZ5A 1KFWA 1E6XM 4LYPA 1ZU8A 4AZCA 1R47A 4D6DA 1BGAA 3MUAA 1X1NA 2XGBA 2ZX8A 1GQIA 1TQTA 1J11A 1E3ZA 3KLLA 4M82A 4DUVA 1B3YA 3OLDA 1LLOA 2OSYA 4UFMA 1D7FA 4JCLA 5LA2A 3TV8A 3RCNA 1EQPA 1CGVA 2DH2A 4BS0A 3A24A 4UQDA 5CGMA 3BGAA 2WCSA 4FMVA 2XM1A 3M46A 1UYQA 4ACYA 2JF6A 1ESWA 2GK1A 3NUKA 3VNYA 1KGUA 1CDGA 1XSKA 3SUUA 1KBBA 1QW9A 3AMLA 3AFBA 1H0IA 5D9OA 2FHCA 3DX3A 1HVXA 3S6TA 3GM8A 4P7LA 1GVIA 1NWUA 3NDZA 5GPRA 1YQ2A 3WF2A 4J3VA 4OBRA 1BSIA 1UR1A 1GHRA 4QP0A 5A8PA 4MDPA 4JFTA 3JUGA 1MXDA 5IDIA 3A3HA 2ZUVA 2BY3A 2OWWA 1NARA 4YN5A 4D6CA 3UEQA 4MAVA 4OUEA 4P8WA 1FHLA 2ZUTA 2QLYA 1NH6A 1IT0A 3ZR5A 4DWSD 4GZEA 2NW0A 4Q7NA 3GDBA 4PTMA 2CPUA 1NP2A 3ZOAA 5KZ6A 5I5RA 1TVPA 1JZ8A 1FHDA 3BCFA 2X2IA 1E5JA 3I3EA 3VGHA 3SCUA 1ZBCA 3RM4A 3F4VA 1KGWA 2VX7A 1QI4A 4PCTA 2W61A 4GXPA 1XH2A 1E4LA 4GO8A 3LPFA 3BC9A 3U5UA 2O9OA 1MYRA 1ZJAA 3T08A 1US3A 1BHGA 1UZ4A 4JKLA 3GXDA 1VFFA 4ZEPA 1E6SM 2YOCA 4RL3A 4W89A 1E6PA 4OGZA 4UZUA 2VZUA 1Q6FA 3VM5A 3S2CA 4X0NA 3AIEA 3AIBA 4B9YA 3AMCA 4AXNA 2QV4A 2DSUA 1VENA 3W24A 3WH7A 5CLTA 2WWDA 1JNEA 3SCWA 5C71A 4J3UA 5AYIA 1HJXA 1F4HA 1UR2A 4UQBA 4IM4A 5FIPA 1DWHM 1HWWA 1PX4A 3AYRA 2AMGA 1BQCA 3ZIZA 2YL8A 1C7SA 1BYAA 3HN3A 4TTUA 1UA3A 2J77A 2EAEA 3VDBA 5A6BA 4PMRA 3H53A 1H11A 1C93A 3WEZA 1LQ0A 2NT0A 2OYMA 2C0HA 4Z2GA 5CLWA 2J7CA 1UOKA 2G4FA 4E2OA 1ZL1A 5CJ5A 3L4YA 2PBGA 4FNRA 5AC5A 2WMIA 2OW6A 3W25A 3QHNA 2IGTA 3LPGA 1OD8A 3WN6A 5HBFA 1KCKA 4QAWA 1UR4A 2VZSA 3BVUA 5FL1A 3AXIA 4OZOA 4BQ3A 3T0AA 2UY2A 1VBRA 3D4YA 2BHUA 1G1YA 2VMFA 2ZX7A 1FH9A 4A4AA 4H8VA 1B3XA 2DEPA 2PWEA 4BA0A 4NRRA 2WKLA 4UR9A 1X6LA 4X0VA 1UUQA 2G8ZA 4IPNB 1JAKA 2YL9A 1B3ZA 1KWGA 4AD4A 1FP9A 3VU2A 1W3KA 1SMDA 2UY3A 3CZGA 4MNKA 3BAWA 4P7OA 3CUJA 4MADA 1NOFA 1CXIA 4GO9A 3AI0A 3HG3A 2XIBA 1QI3A 1M01A 2E3ZA 3T09A 2GDUA 5DT5A 4CVUA 3EMZA 2WVTA 2CBIA 5HXMA 4DO5A 5A6MA 3GNRA 3PZMA 4V28A 3WQ8A 2VQTA 3GXMA 4FLQA 4WLCA 1MVYA 3RILA 3VSVA 1HVQA 4B3KA 1UH2A 5GNYA 2XG9A 4JCMA 4R27A 2ZICA 4AZIA 3MV11 1PX8A 4PTXA 2XSBA 1UD5A 4RE2A 1RD6A 1EDQA 1CXLA 2WK2A 1PAMA 2XFFA 2F18A 4P7QA 2YDQA 5A6JA 2EACA 1W2PA 3NCOA 3VIMA 1UASA 4M24A 3EYPA 1TQWA 2CERA 2VRKA 3GXPA 3VSTA 4ZE5A 3VIJA 3SUTA 2BHZA 4KH2A 3L4ZA 3GBEA 4EK7A 4WSJA 1UR8A 1E56A 3AXHA 1JF6A 1JDDA 1C8XA 3CPUA 1L8NA 2C8NA 4A3YA 1A3HA 2B31A 4HZ6A 5HPOA 5E6ZA 3WY3A 3T0BA 3LPPA 2NT1A 3T2OA 4B9ZA 1VB9A 3CZNA 3VGFA 4GI6A 4TVUA 4AMXA 2F8QA 1R34A 2FDMA 2WHJA 3BAXA 4W87A 4RE3A 5A69A 3WD2A 1H3GA 2YL6A 1FFQA 3PZIA 1SZNA 1HJVA 2XGIA 1B0IA 3ARWA 1UWUA 1Z32X 4B3LA 1E3XA 4W93A 1RP8A 1SYTA 1E0XA 1JGIA 2BNJA 1JG9A 5BRPA 1XSJA 1DWJM 4L4OA 3FAWA 2QHAA 1J18A 5A2BA 4HTYA 4GKLA 3N04A 3VDHA 1VJSA 4JAWA 2OWXA 2XN2A 4Y7EA 4N42A 2DT2A 1H41A 3MSDA 1UR0A 1DHKA 2D3NA 3W53A 5A2AA 1QNSA 3WH5A 2QF8A 4FLSA 3D50A 1GOMA 5DT7A 4V2XA 3WIJA 3N17A 1QNOA 4JZ5A 1VIWA 2VOTA 1NP0A 2OLHA 1DEDA 3NDYA 3T0DA 5I23A 2YLAA 1J0KA 1E4MM 1RH9A 4D6FA 3TOPA 4HMCA 4MNJA 3AISA 3VX1A 2XPKA 2YFNA 2XYLA 1JYXA 1G9HA 3HJEA 3WQ5A 1QW8A 2ZXDA 1FH8A 2AOSA 2J7HA 4S3JA 3MU7A 1G94A 1EO5A 4WSKA 2WHMA 3EBVA 3UESA 5E6YA 4AD1A 1C3FA 2D2OA 2FH8A 2JF7A 4FNUA 2WAGA 3T2QA 3FHQA 4HZ7A 3GXFA 1H5VA 4F66A 3KLKA 2EPLX 1V02E 3ZMRA 3ARYA 1HJQA 3NIYA 4WF7A 1ISZA 4GI9A 3UCQA 5D9PA 1E55A 1CLXA 2PWHA 1GQJA 2XTKA 4BQ2A 3PZNA 2D3LA 3AXXA 4PYSA 4F8XA 1E6RA 2JE8A 3B8SA 4FNSA 2ZX6A 1KXTA 4ML4A 2ZXBA 1UH4A 2EPKX 4AEFA 1V08A 2BV9A 2CBJA 3PZQA 3ARZA 1H09A 2VCAA 1QPKA 3WEMA 4E4PA 1KGXA 4MB3A 5JIWA 1QVBA 1H0GA 1OSEA 3GXNA 2JIWA 4AMWA 2EXOA 4BQ4A 3U7VA 1UZ1A 1TA3B 2J7DA 1V03A 1I1XA 1WNOA 2JFEX 3CZKA 4QCFA 2CHNA 4HA3A 2E8ZA 3DECA 2BY1A 1JZ4A 4W88A 4FF5A 4FK9A 2WC7A 5FKYA 3LX9A 1ECEA 4OOZA 1N82A 3AHXA 1CGUA 5CPTA 3W6MA 1GJUA 1J12A 4UQEA 1QHOA 2DSVA 3FN9A 4DWSB 1VEOA 3KE0A 2VTFA 4C7FA 4DM1A 3UG5A 1LF1A 2F2HA 1UD3A 4UZSA 2PF0A 5AYBA 4OBSA 3ARPA 1K9DA 4EAMA 4PMUA 1EXPA 1L0PA 1MQPA 1K6AA 1DP0A 3IK2A 3WNOA 2DSKA 4GQRA 1OM0A 4ZFMA 2ZUSA 1HKKA 3HU7A 4U5KA 2G3NA 2GJXB 4ZXOA 2Y4SA 1QBAA 2WCGA 3CC1A 3IAQA 3AS1A 1DWAM 4XX6A 3VGGA 3AIVA 1LL4A 4JFWA 3ARVA 5E09A 4HPHA 2F1AA 1XSIA 2BVYA 1VRXA 4UOJA 3WBEA 3VO0A 1C91A 1CXFA 3AHYA 4FLRA 1KR1A 2EEXA 1DWGM 3BLKA 4XB3A 2WBGA 3VUPA 3WQ6A 3QR3A 3QHMA 4CU8A 1QI2A 3UERA 4Z2LA 3K8LA 3ZT5A 3VIOA 4B15A 2CYGA 4KRTA 1PZ2A 1CIUA 4CCEA 3WUEA 3THCA 5I3DA 2EADA 4NZFA 3SCVA 2DDXA 2WMHA 4Z2JA 3A21A 4M80A 1XH1A 5BXPA 3FY1A 4U31A 5EFDA 1LJYA 3WH9A 3WY2A 5A3HA 1W9BM 3PTQA 3NSMA 2CCRA 4JIEA 1EH9A 3KL3A 1E9LA 3CZSA 5A1AA 2MANA 1U33A 5BXSA 1UHVA 4F9DA 5ABFB 3BAJA 3A4AA 1TFVA 1HXJA 3VDCA 4ATLA 5E9AA 2GSJA 3OZPA 4LGXA 5JBEA 4AD5A 5A8NA 5A8QA 4AZGA 3N18A 4DUWA 4MB5A 4UQCA 2VT0A 4UOQA 3AMDA 5A8OA 3T2PA 5D8WA 1GPFA 1OCQA 3EJRA 2FYVA 3HG2A 4D6GA 1R46A 5DFAA 4JL1A 1UWTA 2XVPA 1ITCA 4AZ6A 1GW1A 3PZOA 2WXDM 1XCWA 4TOQA 1GONA 1V3MA 3K8MA 5D9MA 1V6UA 2TAAA 1UQZA 5A6BD 2WSPA 3VIIA 1PIGA 1CNVA 1PBGA 2YFOA 2ZX9A 3O9NA 3RJXA 1C8QA 1B9ZA 4CCDA 4AZ7A 3CZ8A 1E71M 1JF5A 3OLGA 4JKKA 4BF7A 1WPCA 3W0KA 1D3CA 4D1IA 1UD2A 4CKQA 5AY7A 3UR7A 2WSKA 2OW7A 1VFMA 2E9LA 3EDDA 3K1DA 2JALA 5KEZA 2WMKA 2YBUA 5C8BB 4AZBA 2WM0A 3WUGA 5EFFA 5ABHA 3ZJ6A 4QLKA 2X2JA 1ZBWA 1H2JA 4D1JA 2V38A 2VZTA 1MQQA 2Y24A 1EHAA 4XV0A 4TVDA 1HL8A 3BUIA 5EB8A 7A3HA 1C92A 4PMDA 1V02A 4EKJA 1AVAA 2A3CA 1BLIA 3SCPA 1JD9A 2VJXA 3IAPA 1WE5A 1BF2A 1US2A 3SEPA 3MS8A 1J01A 3HG5A 1TA3A 2CIPA 1WZAA 4CD5A 1GOWA 1PZ3A 3OZOA 4H8UA 1HIZA 4UQ9A 1O6IA 4KWUA 4DWSC 1XRVA 2CESA 5EMYA 3GH4A 3N9KA 5I77A 2XFRA 1J0IA 5DMYA 3ZT7A 1OT1A 1PS3A 2W91A 4U2ZA 4AYGA 4NF7A 5CGTA 4H2CA 3ALFA 3L4XA 1ZS2A 3WQ4A 5HOSA 1PPIA 2E9BA 2X05A 2PWFA 3MO4A 1ODUA 1ODZA 2DIJA 2BFGA 1E40A 3KZSA 1EDGA 3CIVA 3DC0A 2BVTA 2XM2A 2UY5A 1BTCA 2A3AA 3TP4A 4ACZB 3WL1A 5ABEA 4C7GA 2DQXA 4AD2A 1AMYA 2W5FA 2YL5A 1O7AA 3WBAA 4LX4A 4MB4A 4EANA 1E43A 1NWSA 4QDMA 2GJXA 3RO8A 4M56A 1GOOA 1S46A 3N1AA 2XWEA 1GHSA 3SCTA 4U33A 1GORA 3ZJKA 1V3LA 1TCMA 1K9EA 3DX2A 4MAZA 3VINA 3ZQ9A 3BLBA 3DYOA 1R75A 3WUBA 5LA1A 1BVNP 5GQBA 1MW0A 4IISA 2F61A 4W8BA 2A3HA 2XJ7A 4HOWA 2J62A 2J7BA 4CD7A 1QHPA 3GH7A 3SCNA 3VMPA 3CMJA 5BYWA 1UR9A 2V3EA 2F7OA 4GIAA 3VMNA 5FD0A 2VX6A 3LXBA 2CEQA 3TTSA 3BSHA 8CGTA 1W1PA 1SMAA 2PWDA 1E1FA 1EA9C 1HXKA 2J78A 4JHOA 3RPMA 1NM9A 1BFNA 2G3IA 4ZE4A 3EDFA 1C90A 2PB1A 1E6NA 2D22A 3N12A 2W66A 4JHZA 1CGWA 1XGZA 1XD0A 3TONA 1UKOA 2XIIA 1EOMA 2W62A 1JD7A 4CN4A 2YJQA 1TZ7A 1OGSA 1GQKA 1TE1A 3MMWA 1B3WA 2DSWA 3UG3A 3WENA 3EMCA 3AS3A 3WMBA 5ABFA 5A6LA 2F7RA 4HMEA 3A6OA 2X09A 5A6AA 1UD8A 3AMGA 1JIBA 1W9UA 3CHDA 3PZUA 4P7NA 3GYCA 1W3JA 1Q6CA 1OGGA 3AHZA 1UWIA 1JZ2A 1HTYA 1E4NA 2YLLA 3VIGA 2V3FA 5IFPA 2GFTA 3D4ZA 2WZIA 1J0JA 4MNLA 2YA0A 1WZKA 1ZJBA 3MMUA 4V27A 2CITA 5A6KA 4AC1X 1PX3A 3CV5A 4PN2A 2VRJA 3BUBA 3BUDA 3BAYA 2G41A 1G01A 4PUEA 1V3HA 2Z1KA 1E0VA 3NJ3A 1JDAA 1QOXA 2O9RA 1V3JA 4MB1A 4AWEA 1EIBA 4F79A 1G5AA 1LG2A 3L4WA 2YA1A 5FCZA 4XUYA 3D51A 3H55A 2QMJA 1CZ1A 4AIUA 2J8GA 4CD6A 1KR0A 3U57A 5JBDA 2D0GA 1EDTA 4PRWA 2X0YA 3NSNA 2JEQA 4LPCA 3BAKA 4U3CA 3N11A 4AZCB 2ZIDA 3N13A 2D0FA 2VURA 1BG4A 3EJTA 4TTGA 2GUYA 1BPLB 4OKDA 5GNXA 1HX0A 4M81A 5BWFA 3J7HA 4S3KA 5C70A 2WBKA 3W38A 2O9PA 2WWCA 2F7QA 1Q6GA 2ZUWA 3BLPX 2J4GA 3UR8A 1XC6A 4NXSA 4MPKA 4D6JA 1V0MA 3EJUA 1NWTA 1JI1A 1MWOA 3QHOA 1GOIA 1B3VA 4PTWA 1DWIM 1WZMA 2GK1B 5I78A 3TA9A 1WCGA 1R33A 4RE4A 2F7PA 3BSGA 4J3SA 2VX4A 3FXYA 3L2MA 1JAEA 4PMZA 1UG6A 1UKTA 2F1BA 1GOQA 1XV8A 2G3MA 1DTUA 1FA2A 1VFOA 3L4UA 3B9EA 3BMVA 1PIFA 1QBBA 1VF8A 4W7VA 1KQZA 5AC4A 2V5DA 1KTCA 1M04A 3SCRA 1R87A 1E70M 5JUVA 2AAAA 3AROA 3BMWA 1E72M 3PHAA 3SURA 3MV01 2E0PA 4NX0A 3WMCA 3CUGA 5CSUA 1VAHA 1JNDA 1W9VA 4PMVA 4J27A 3PZ9A 3LXAA 1V0KA 4HU8A 3PTMA 2WHLA 1CLVA 5A6SA 2DT3A 1EOKA 4BCEA 3WD4A 2ZWZA 2HISA 3DYMA 3CHCA 4NI3A 1E15A 1V6WA 2GVYA 2CBUA 4ACZA 4N0RA 1OBAA 6CGTA 4AIEA 4HMDA 4KMQA 3ZJ8A 4ATWA 4H7VA 3AZSA 2BY0A 2YDRA 1H4PA 4XZWA 1TQVA 1GZJA 2G3JA 2WKGA 1CXEA 4PEEA 1ZBKA 3VMOA 3WFZA 1HKIA 5EBAA 5DF0A 3DYPA 4KRUA 2VR5A 4BQ5A 3WD0A 4WKAA 2EPOA 1CXKA 1V3KA 3RMEA 2Y8VA 1YHTA 1TG7A 4CGTA 5BXTA 1TQSA 1CTNA 1TQUA 4P7RA 1P6WA 2UWFA 2ALWA 1TVNA 4TX6A 2WCAA 5CPSA 4UQAA 2ZXQA 3AHTA 3K4AA 3WF4A 2JEPA 4OOUA 3MSGA 2DIEA 2EO7A 2EBNA 1WAWA 4LYRA 1EQCA 3GBDA 1KQYA 3TTOA 1O7DC 3WNPA 1HT6A 2WVSA 3K46A 3CHFA 4GQQA 2XSAA 3DHUA 2WZHA 4FNPA 4CU7A 3BH4A 3VD5A 1B30A 5IFTA 1NWRA 1D2KA 1V6XA 3W29A 2UY4A 3CZLA 3WH6A 1R8LA 2QPUA 4HP5A 1HKJA 4AZ5A 3LPOA 1J0HA 8A3HA 4D6IA 3WDIA 1V0LA 3GH5A 1OGBA 2X1IA 2EPMX 3AZRA 4TUFA 1R7OA 1CYGA 3LRKA 5A95A 3AIRA 3OGVA 4W85A 3IJ7A 2WLZA 3PN8A 4H8HA 3A23A 2WMIB 3WL0A 3L4TA 2WANA 4FLOA 2DPEA 4CN1A 4GI8A 1ISYA 3G6MA 2WC4A 3EMQA 1CGTA 2XUCA 3IJ9A 4JKMA 2E40A 3VPLA 1BAGA 3MUIA 1RPKA 1XCXA 1LWJA 4Q22A 2WYSA 1B31A 2ZUMA 1QNRA 3IGUA 5F7UA 3PBGA 2ZE0A 1B1YA 1OD0A 2X8RA 4UFHA 3AHVA 3EJPA 3CMGA 3WDQA 4W86A 3WSUA 3VGBA 5M17A 2E9MA 3F5KA 4JFUA 4FNTA 1UA7A 1JI2A 1UKPA 4P8XA 4PSRA 4WIWA 4NZCA 7TAAA 4AEEA 4HOZA 3EJSA 5IXEA 3HZ3A 3GXTA 3U7BA 4AYSA 4TXEA 1TUXA 4OIFA 1KBKA 4IPLA 3KL0A 3SUSA 3WNKA 3VIPA 4PMQA 4CUCA 1W2VA 3LXCA 3WEOA 1V3IA 1QI0A 1W9PA 4D72A 2ESCA 4HA4A 3A4XA 4PMXA 1MQRA 4GZJA 3AIQA 1BYBA 1JL8A 2VO5A 5BCAA 3ARXA 1FFRA 2D0HA 1U2YA 3AIWA 1OINA 3BUPA 2PWGA 3ZR6A 3PZVA 1B90A 2A3BA 1E5NA 2VZVA 3AS2A 3RJYA 3BXWA 3DHPA 1LG1A 3W82A 2J75A 1UWSA 2WB5A 2A3EA 2WNWA 4U3AA 5HPCA 1JZ6A 3GTNA 1K9TA 1MW2A 2X2HA 3F5LA 4UNIA 5M5DA 3WKZA 2OYKA 3AS0A 4MJ4A 1F4AA 4U2YA 1IZKA 1LWHA 2E8YA 3CTTA 3QOMA 2ZUUA 3VILA 3LRLA 4NZJA 1WP6A 1IZJA 1W9XA 1I1WA 2Q8XA 3G6LA 1X6NA 1JFHA 3VD4A 3H54A 2BS9A 3VD3A 4AZHA 3KL5A 5JBFA 1W1YA 1T0OA 1IV8A 4D71A 5A8MA 4C7DA 2CBVA 1AQHA 6TAAA 1M03A 1VEPA 2ZXAA 2WZEA 6A3HA 4AMCA 4X9YA 3OGSA 3WDPP 2VX5A 2V3DA 1ZBVA 5DEZA 4AW7A 3AICA 5CPQA 1QHZA 2EQDA 1BVZA 3M07A 4XZBA 4W8AA 4DO6A 2WC3A 3CHEA 3SCOA 4QCEA 1JZ7A 4DM2A 1E1EA 2DGAA 2Y5EA 3BCDA 3WDHA 2RGMA 1QWUA 3A47A 5I2UA 4PMNA 3OLEA 3IANA 4IUGA 2VUYA 1U30A 4W8LA 3WQVA 2J7FA 1E6ZA 3AOFA 3K4DA 1E4IA 5CZKA 3BUQA 3GZAA 2VR4A 3ARRA 3FW6A 3F5JA 2E4TA 3I3DA 4ZENA 2DH3A 3WD1A 4AY1A 2WHKA 2D1ZA 3OG2A 1MFVA 2XVLA 3ARUA 3MKKA 1GNXA 4LQ1A 2QPSA 3VGDA 4PCSA 4ATDA 1W3HA 3MUY1 4LXFA 5BXRA 2FGZA 3VVGA 1GUVA 3A5VA 1HF6A 4HU0A 4CD4A 1CPUA 1JYVA 3O6AA 1GQLA 4B16A 3CBWA 4HOXA 3A22A 1FP8A 1UKQA 3POCA 1KWKA 4H04A 3EJQA 3VIKA 1WKYA 4DUXA 4JFSA 3BAIA 5LYRA 2VCBA 4UFIA 4PBGA 4DWSA 4YHGA 5E70A 3HG4A 1FH7A 1WDQA 1RP9A 3PTKA 4H41A 4CCCA 3ZT6A 1V6VA 2XFYA 4MTVA 3BVWA 2YBTA 4CU6A 2VL4A 3KEHA 4WKFA 5I0DA 3WUFA 1HKMA 3DX1A 3VDAA 2PI6A 1VFUA 2XN0A 3W27A 2VNCA 3LRMA 1QX1A 2FE0A 3WMSA 3WD3A 3IJ8A 3BVTA 2BHYA 1XD1A 2WMGA 2ZOXA 4E8DA 2CXGA 1CGYA 1KTBA 2J47A 1XYFA 1VJZA 4HPGA 1UH3A 3L4VA 3POHA 5I79A 5CSYA 4CVWA 2X0HA 4URIA 1H1NA 3AMKA 3ZJ7A 2IXUA 3MI6A 1NOWA 1Q6EA 4Z2HA 1ISXA 3D5HA 4W5ZA 5D9NA 3DDGA 1JDCA 4P8UA 1GVYA 2CKRA 1SR0A 3BVVA 4UTFA 1KXVA 3B9AA 2GJRA 2YIHA 2CHOA 2OYLA 3VSUA 2D24A 4WKHA 3VD7A 2YA2A 3WDRA 4E8CA 2PBOA 2YDSA 5CXPA 1UWQA 2V3GA 3KWXA 3WFLA 2J7EA 1A47A 1GCYA 1W91A 1CEOA 5M3WA 3U5YA 2VQUA 2EJ1A 3WELA 4DO4A 4M1RA 2ZX5A 1HP4A 3OGRA 2VZOA 1V6YA 3DDFA 1WDRA 3FNDA 1EGZA 3W81A 3TTYA 2CETA 2VVNA 4ZXLA 1GOKA 1E73M 1Y7VA 1Q4NX 1CBGA 3AIUA 4KGJA 5D4YA 4WJXA 1W9DM 1UD4A 3OLIA 2J8FA 4LYQA 4W7UA 3APGA 3ARTA 5I6SA 1OIFA 2OWCA 1OWQA 2XWDA 3CGTA 4W84A 3L2LA 1V0NA 1J0YA 2D23A 4UFJA 4QFUA 3S5YA 2J7GA 2WMJA 4YHEA 3II1A 4J3XA 3SCSA 3WQWA 3WNMA 2W63A 3SCQA 4GINA 1MFUA 3UG4A 3AYSA 2VCCA 2WW5A 1OIMA 4QLJA 5M03A 2Y8KA 1Q6DA 2WVVB 3W6LA 1CWYA 1KXQA 5HDRA 3CUFA 1HN1A 4GZIA 3ZM8A 4D6HA 1CGXA 4AD3A 1W3LA 2OSWA 3OB8A 3VNZA 2ZWYA 7CGTA 2V5CA 2ZUNA 1MXGA 2C7FA 3RM8A 3GXIA 1WZLA 3THDA 2O9TA
chains in the Genus database with same CATH superfamily
2RTTA 4M1DH 3OP2A 4P9HL 5AZUA 3PJNA 3RCMA 2CJUL 4F91B 3UYCA 1K6QH 1KXHA 3N1MC 1NSJA 1TVLA 3U4EA 4NKMA 4PRIA 4Y9EA 5IM51 3SUWA 4RAVA 5IQ9B 2J79A 4KGLA 5HNNA 5JQIB 2HVKB 3KM2A 3AQUA 2ZPKL 3NZUA 3PWPB 3TVMD 5EORL 1B54A 5C09D 4CN6A 1VACB 3W0WB 2AEQH 1RIUH 1NOUA 4JPVL 4KK8C 4UCFA 1XIMA 2WTOA 4DKEL 3G0XA 1H7OA 3RGVA 3RIKA 4NZUL 5IUCA 1W1A1 1JVKA 4G1MA 2WLYA 3CLFL 4PWIA 5MKGA 5CIPH 1XDMA 1XBVA 3GBML 4YHLH 2ZYRA 4BDVA 2EKSA 1CX9A 5I74B 2OR2A 2YRZA 1A5SA 1XIHA 1VCVA 4GUIA 1R3IH 1J0ZA 5FUOH 1IEAB 3LEXA 3NZRA 4IZGA 4K6AA 5AOIA 1SM3L 1BYDA 1QFWI 4Q4RA 5FEBA 2WUBH 3D0VA 2HVMA 4NKIL 3OKNA 4O5LH 3BP6B 3NOIA 3IXAA 1AR1C 3LSOB 3PZTA 5FHBL 3VE0A 3TBYA 2IFFL 2IMMA 5GGSB 1D6VL 4WU5B 7FABH 4PJFA 4RX4A 3MUZ1 1ITXA 1NSNL 4RNFA 3EKZA 2INZA 4JY8A 5ECJE 3I6RA 1IL1A 2FL5A 4LSQL 1JUKA 2OXGB 4F2BA 3WCYA 4FFZL 1HP5A 2QUUA 2IPUK 4YS4A 2YARA 3G5XA 4N20A 1EL3A 4R96B 1F58L 4G6ML 2HJLA 3N5AA 1RSYA 5GGTA 5FSDC 4IFKA 4AIOA 3HGOA 4ADJA 1OK8A 1TETH 1E51A 2Q0ZX 3AACA 1A5FL 2ZCKL 3G1FA 5FGRA 2VKZG 1GPOL 5IB4B 4S1DC 2XGBA 5CAYB 3B97A 3F7YB 3R0UA 4EXBA 2JLPA 2QGEA 3EBIA 3MAWA 4JCLA 4PPTA 3UAFA 3IN0A 2OG9A 2QDWA 5J9PA 3I9GH 4GLRH 1GS8A 4A8RA 5F0MB 3PUGA 2Z4TA 3AFBA 1F3DJ 1R4XA 1AG1O 1U92A 2EZ0C 4P7LA 1JV5B 1YQ2A 3ZVHB 5C9UA 3ZUCA 5HVFB 1S7QA 4OBRA 3U0PA 3IU3A 3DFQA 5D1XE 1IB5A 1K4DA 4NWUH 5LIKX 2ADJA 3TJEH 2A73B 4O0KA 3HUJB 4OCWL 4WJG3 5DD0H 5DMMA 3UGVA 4XD3A 4I9MA 1RIHH 4RNHA 4GRWE 2OP4H 1JF1B 1BEXA 2NMSA 3T7VA 4QYAA 3ZUNC 2CFFA 1ICTA 3L7FA 2E86A 1DE4A 3DSNB 4A6YA 1F3EA 3SCUA 4MLJA 1MEWA 1AXTH 4L1BA 3FQNA 4ZO7A 1UOWA 3TZNA 3CDYA 2X89D 1IWAA 3V0IA 1E9ZB 1NWPA 5E6SB 3S2LA 3NCJL 1DDHB 4NHCH 2XPGA 4YTSA 3VVWA 4ODWA 1T04B 5ESQB 1EFXD 4PTUB 3S2CA 4M7LH 4LCCB 3H21A 1S9XB 1G9EA 4GC4A 3LH9A 4PJIF 2YW3A 4KUZL 1A22B 2VC2B 3G04B 1KEGH 3IJYA 3PXLA 2VC5A 5FM8A 1Z3GH 3FB7A 2FWLB 4HS3B 7ENLA 2Q2LA 1CLYH 4JREC 1S2EA 3GMPA 2C4XA 5CLWA 2F38A 3LH2L 1LVEA 4PJDE 3L12A 2AJVL 5F93C 1R6VA 3MUUA 5MI0C 3UTTE 1DUZA 4FFTA 3LPGA 2BSED 3WN6A 5C54A 2V0AA 4MXQD 2VC2L 1I7UA 2VEGA 2CHDA 3O3DA 3RFZB 2EPHA 1NFIB 4LY8A 1QUNA 1Y07A 1HKFA 2DEPA 2H2SC 3JTSB 1AS8A 1DCEA 1J8HB 2XG5A 3KVMA 3QRGH 4IPNB 2YL9A 1X7QA 1B3ZA 2QULA 3ZRSA 3PQYD 1QSVA 1RZQA 2XBDA 4GKOA 2ZCGA 1OYBA 5E8PB 4FADA 4IFOA 1WAUA 3XISA 1BYNA 2R0KH 1I1YB 2FDBP 1R3QA 1B0RA 1M05A 3TCLA 3OMNB 3QIBD 3IXTB 2R4SL 3IRPX 4IIGA 1N7ML 3W01A 5J6GA 3VNMA 4YQXH 3ZE1B 3FB6A 1WCBB 1YYML 3Q8BA 3VSTA 3H3PH 1BZ7B 3B9NA 3MLRH 2XICA 1T3FB 1E56A 3L5LA 1TCRA 4Y9CA 3PP7A 2VLKA 5A69A 2ILLA 4LOEA 5GGRY 4JO4H 2WIMA 3ARWA 2Y7DA 4KY2A 4Z3JA 5LGJB 3P4NA 5EU4B 4NNXB 4X6CF 4L5FE 2QHAA 3W3OA 1PD1A 4GP4B 1LHZA 5DYOB 2RBLA 2M2DA 3UJ2A 3RGVD 4F8OA 1DPMA 3P4OA 1CBJA 1ROCA 5C1MB 1GOMA 1OGAD 1N6QL 1P48A 3WIJA 4JN6A 2H3NB 2AGKA 2VOTA 5B1JC 5IQLA 2GK0B 1EPVA 4GG6B 1C9DA 1E2VA 1TPB1 5J3HD 1I1AA 3SYQA 2NQJA 5EYWA 4AV0A 2YFNA 2KERA 2F5BL 3WQ5A 2GVLA 3NJLA 5IJBC 1QSZA 3TJHC 1KM1A 4TOYH 1SN0A 3T2QA 4GC3A 5JQ6L 2CR6A 4I5UA 4YGVB 1E5BA 2XZAL 2LFGA 1JPST 2FLBT 3FO1B 3INUL 4NDMB 2EDMA 4RX4D 3SYPA 1CLOL 3C6LC 1O95A 1P5VA 3RYSA 3EBGA 1I8JA 1UWYA 4JNYA 4TNFA 5FYKU 2JNZA 3K74B 1KKRA 2R23A 4DP9X 3AU6A 4A7SA 4MZ3A 5JMOC 3W1UA 4ANKA 2GQ8A 2DLHA 2APFA 4TQTA 2A9AA 5TQ0L 4PJ7E 5DXYA 2JB5H 1F4YH 3IVSA 4M6QA 1EGJA 2CNYA 3DECA 5MERA 1BVLB 1RJPA 2BY1A 2DLEA 2BSSA 3TGXA 2ENSA 2OI9B 2PDNA 3QIUC 1NDGA 1J5TA 1C1EH 1W8EA 4K71C 2F74A 3ABMB 2DMBA 4K94L 4IH3A 1IEVA 3LVEA 5EIQA 4XP4H 3UC2A 5I1CL 1L7IL 4RH4A 4FX6M 1ID2A 3SDDB 3L3GA 1I45A 2PO6C 2Q76B 5DK0B 3HE7C 2XTJB 1OGPA 1A3WA 1HKLL 4ZXOA 1QBAA 4IRZH 3AS1A 2O55A 2CLVA 3QUZA 2XYCA 4CEUC 3U6WA 4GQZA 2DY3A 4UT9A 1P6FA 5KVEL 3DGCR 3OPZH 5GGVY 4Z7NE 2WQUA 2RH0A 2ENYA 3QR3A 2NY0B 4CL7A 2CALA 2MQGA 2ADFL 4QHLB 1CIUA 2LLEA 5HDLA 1GS7A 4QHMB 3Q13A 4HWNA 1A6ZA 1BD2E 5BW7C 1FZJA 3LV3A 1LJYA 3UJSA 3WH9A 3DMMA 1W9BM 4WWKB 3FT9A 2CHZA 3FCPA 2MANA 3KG5A 1MQ8A 3D07A 1T1XA 2AK1H 3KRZA 5A7EA 4L9ZA 1T0NA 4JJ5A 1RAMA 1PNCA 3RITA 4ATLA 2NLYA 1HCFX 4XG1A 3HS9A 1XCTB 1V05A 3QKEA 4M48H 4S3CA 2I9EA 1I85C 1A7NH 3VFWA 4BA8A 5A8OA 3T2PA 1HNFA 1N68A 1UM5L 4I9JA 5EOCH 2PDFA 3HGRA 4JL1A 1UWTA 1GW1A 1YDNA 4XZ9A 1SLUA 1AD9A 1R3JB 2I5IA 4YJ5A 2WSPA 4OUUA 1TO4A 2YFOA 3LZFH 4ZPTA 3MQIA 3P54A 4JKKA 1IGCL 4EVZA 1WPCA 5KSAA 1D3CA 2JJWA 3LI1A 3MCYA 1ZT4B 2HP4A 3PUUA 4X6BA 5D2WA 2YBUA 4B0MB 2WMPA 3V16A 1OK4A 1EXHA 2R2EB 3B9KC 2DQJL 1YEKH 5EB8A 3UJTH 2OZ8A 3TNBA 2OZ4H 3UO1L 1A9EA 2DQFA 3JV4B 3HG5A 4GKSB 1BOGA 3BGJA 4DK5A 2KC0A 5DD3H 4OGQC 5F9AC 4D8OA 1MG2C 1I1FB 5EMYA 3GH4A 4AQAB 1NAKL 3E2HB 1Z66A 3G5YB 1YNLH 1BXBA 4XB7A 2BP0A 2EAWA 4C47A 1A50A 4J2PA 5ABEA 1RAKA 3OG6B 4O02L 2HH0H 4KETA 2P8PA 1SY6A 5IMOA 3AUJA 1BXCA 3WMPA 3PL6A 2PRMA 4ZTOH 4HJJH 1K9EA 1IGIL 5F4SA 4HPOH 2Q3OA 1FLRL 2B59A 1QO2A 2PGFA 1WDDA 3QO0A 5HGDA 2VLKD 3NH7H 1A0DA 2I07B 2F7OA 3QZNA 2PDBA 1W1PA 3T4YA 3MLXH 1BM3H 3N9GL 1SJCA 2JKAA 3ABRA 1FJ1B 1ZLSH 2Y6TE 3KR3H 3PHOA 2FSDA 3B8VA 3OZMA 2X30A 3S7GA 1ENUA 3NVTA 3TO4A 5CC3A 3ZVVA 3J8F7 2OX1A 5AALA 2XIIA 1PZCA 4D9LL 4AWUA 5DO2C 5T3XE 3T8LA 3MMWA 3ZDYE 3WENA 3QJTB 3MV8A 2HLAB 2HMID 3K6NA 1DJSA 1KJMB 3KMDA 2X09A 2P44B 4GW1B 5I6MA 1I1AD 4FG0A 4DPRA 4BK5C 3ETBJ 4I7VA 4PMFA 1ZJBA 5JIHA 3AM8A 2JKWA 1UJQA 3VZXA 1UZGA 1G01A 4QY8A 1MIEL 5DC4B 4HT1L 1IC7L 3CFDB 3TE9A 2QMJA 1FDLL 2KLTA 4RRPA 4AIUA 4O51A 4FRWA 4KEUA 5JBDA 4YOKA 1KBGH 3D30A 4LIQE 3V8OA 3L6FA 3QUML 4NZ8A 2ZIDA 1JPGB 1Q3NA 4IPIA 4ELKB 3V1PA 4KEMA 3VUSA 1BG4A 1WEJH 4TTGA 5GNXA 5GJTL 4HZAA 2H90A 3F4DA 5GSVA 3QJZA 2I14A 4M6NH 5MHSE 2J4GA 1FIGL 3EJUA 4JR9L 3MJYA 1FKXA 4O2EB 5GJSL 1EZSA 2VE6B 1UG6A 2F1BA 4A2HA 2C18A 3BMVA 3UZWA 2G9HB 4YXHH 3EJZD 3PC0A 3SCRA 1Z9SA 1HSAB 5E5MB 3SURA 3B7TA 1LYQA 3WAKA 3I6KB 3VKBA 3GLAA 3FKRA 4EI6B 1BMZA 5JXAH 4Z7UF 3MJ8B 2D7MA 3S0PA 1CYXA 1A1OA 3DYMA 3WKQA 4GBXC 3F4CA 5IMMB 4PP2B 5HWNA 6XIMA 3SQBA 5DQDL 3MPGA 7PTDA 3W7QA 2HSAA 2MUCA 5ABAA 4M5TA 1AFVH 5EUOA 1IM9A 1CDCA 4MVAA 1WLHA 3FT3A 2CCWA 1CICB 3QUZD 2EPOA 4H0LC 1C8PA 4R97B 4Z7OE 4GUFA 2NZ9D 4KCVA 1AZZC 1ZXKA 3F62A 3RPKA 3LS5H 2UWFA 2G60L 1F41A 4NC1C 3TN5A 4MLRA 1E28A 1KLFA 4MDIB 4LYRA 2HT4D 1SXBA 1DXIA 1RHFA 2W60B 4I87A 3TTOA 5GS1A 2WVSA 1L6WA 4GQQA 5LNGA 3S47A 3EOAB 3VD5A 2ZTJA 3CT7A 2UY4A 1JQVA 2IKGA 4JPIA 5FYKE 4FNLL 3DMMD 1T7VA 3UXAA 3QBUA 3TYAA 3OGVA 2QPXA 1SYVB 5M1TA 1DLHA 4TUKH 2W95A 2DPEA 1ZEAH 1CBVH 3ATZA 4OU1A 1ISYA 4WX2A 2Z91A 4IMKA 3GF8A 1EAPB 1XQ4A 3O0FA 4GY4A 4GSRA 1OL0A 1JRCA 1F6AA 1VKXB 4ZI8A 3VRIB 5CEZE 2YPLA 1ZHKA 1SQ2N 3RTLA 1OB1A 3F5KA 4N2AA 4EPSA 4KRNA 1ZTXH 5GJPA 4XCCH 1E4JA 1YUHB 4F7MA 4LCWB 4OLUL 4PRPE 4IBZA 3DFOA 1TJIH 2I5YL 1G7UA 1A2YA 2ZOUA 4QR6A 5KSAD 3AIQA 1IAIH 5CD5D 1RJCA 3QCVL 2GTWA 3HAEB 3Q3GB 4RW5A 2AEIT 3N40F 3IRZA 3SW6A 4JRYA 5I1GL 3FK3A 3BEVA 1F4AA 3CTTA 4Q9RH 4IOFD 1W9XA 4EZMA 2Q8XA 1H50A 3DKJA 2X7VA 1OTSC 3GHUA 5DCEA 2H45A 5HINA 1RK0A 3ABZA 4LLQA 1NFAA 4X9YA 4FALA 1U1JA 1IKFL 1Q94B 3AICA 1TEGA 2E1WA 1ZDSA 1SXCA 4RZCA 3VH8G 1OSPH 3L08A 3STLA 1Q66A 5DJXB 4U4IA 2A7NA 3V6FB 4ORIA 1YJDL 4H6EA 3W00A 5D1XB 3IBEA 2FVKA 1I0DA 5CZKA 4EOWH 4M7JL 3PL6D 1GZ1A 4AY1A 3MKKA 3T1FB 3CPLB 2X4OB 4UV4L 5KG9A 4CC0A 4OZFB 2PAJA 4GRWB 4KKAD 1XWYA 3VVGA 4PD4J 3RY5A 1HF6A 3EFOB 2CMRL 2MCAA 3B7YA 4YDVA 1ZLVH 3HFFA 4HOXA 3VOFA 3B8DA 4H04A 4HQQL 3BAIA 1ODAA 2CO7A 1H8OA 3U9IA 2Y2YA 5CJXA 4LCYB 4WAFA 4J8QA 3TO4D 3BVWA 4MQXD 2YBTA 2ESVE 4S1RL 3A9IA 2BP8B 4LUSA 3WJWA 4ZD3L 1IQWH 1T80A 1AP2B 1XBXA 2XETA 2E9WA 2MWCA 2EIBA 5I1EH 2AQOA 2J47A 2CGZA 2J8UF 1XYFA 3R10A 3MV8D 1I9JL 2RKXA 5FA3A 5DHYA 3BX7C 4ALAC 3E7JA 4L8DB 4NKDB 2H1XA 2XH2A 4P8UA 3WJZA 1YN7A 1CL7L 5F7WC 4Z1YA 3O7UA 3DV4B 4JFEA 1ZANH 4PVBA 1WYIA 3NQCA 1DJHA 3WG7B 3UTTB 2QGDA 4Z5RA 4NBYB 1YE6A 4HFUL 2VUKA 4KVPA 2YUXA 4NCC1 4YVXA 4J3ZA 2IG2L 3FQ4A 1OO2A 4PJGF 4E9LA 3IJEA 4RE0A 3GO1H 3G1SA 3I6TA 4OCMC 2PLMA 3G0UA 1P4IL 3N4EA 2D31A 4XN7A 4X3ZA 1VA9A 4A66A 1GIGH 3QMSA 4YAQB 3GC4A 1G7LB 3LTPA 4Q4KA 3MNZA 1PUDA 4OM1L 1ZHBA 1OIMA 3M64A 1BIIA 5CJOH 2GBAA 2WVVB 4UDTB 3GSQB 3ZMEA 4JTJA 2YXMA 5TK4A 3PFRA 3WKYA 4DXXA 5FO9A 5L4IA 4QIUA 1S2WA 3VNLA 2FYYA 4OUIA 5A16B 1W5PA 3EYFB 4NJAH 1W32A 3N85H 4NXKA 3N1GC 2ADYA 3HS8A 4KEVA 3DURB 3L3OB 1RQEA 4BZYA 4BFBD 4YVPA 3SSGA 1NCDL 3WEAA 3V5HA 1KC5L 4LSVL 3UBXI 5D70H 4A55A 2AJXH 3A13A 2DQCL 3T1WA 2XIQA 3DFSA 2K45A 4BFIB 2DIBA 3ASNB 3MTWA 1MHCA 2YKLL 4JFHE 4XZIA 4HJSA 2DEWX 2APTA 2HVNA 5JO5A 3OU8A 4X0KB 5D7SL 4DEUA 3DSFL 4KFPA 1OTUD 5DURB 1I75A 4PGJA 2H9AA 4LLAA 2OA9A 2W67A 3P61A 3QVQA 2EIZB 3QJVB 3ARQA 1CE1L 4BEIA 2HT3C 4WK9A 4XOEA 2CRYA 1F4XL 3FT2A 3N1FC 3WKML 4L5FL 1ZSXA 2PCYA 3SECA 1Q0YL 5CG0A 3C2SA 2YPLD 1HQRA 5AYZA 4JFVA 3LENA 1MW1A 4X4XA 1VGEH 5IBXC 3RUGF 3M1BB 1IFRA 4YEFA 2PLCA 5I9QB 2H26B 1TTPA 1NKRA 4BY3A 3FHAA 2FGLA 1EP1A 3OBAA 4L64A 2VWEE 4IHCA 3KHOA 4AY7A 2O92A 1MAJA 4Y2DA 4P9HC 4HKBA 4M7LT 3SY0A 3KBSA 5A7BA 4BZ2L 3HB3B 5D2NE 1QYGH 4ZR8A 4JPKL 4ETQB 4XNXH 2W4XA 1WO2A 1M7IA 2DAVA 5FM5M 3N2OA 4PJ7B 2R91A 4P9MH 4MXWL 3H24A 4ZMWA 3A4FA 2EABA 1PEZA 1KB5A 3L66A 1EBAA 2Z24A 1BQ5A 3UOAB 1FVCA 3LGGA 3EHBB 5KW9L 4JD4A 3RY4A 1QFWM 3FOLA 7XIMA 3W1TA 2VDPB 2NXYB 1U8PA 2XA3A 3AT0A 4XMLL 2XH4A 4KK9D 1ZU8A 5H4YA 3RWCB 2GIMA 4ZQKB 1RFDH 4K7FA 5JH1A 3HUJE 3HHRB 5EULV 2C3WA 4R84A 1K3ZA 2PDXA 2Y7LA 1KFGA 2YD7A 1QSEB 4UXDA 2YBGA 4WENB 2WN3A 3VXQB 3UXIA 2A4CA 3CK0H 4D9QE 3IEAA 4WR3A 4WEUD 3ZQWA 3D9AH 3G5VB 1OPGH 3NDZA 4B4FA 5B7ZA 2VDPL 3JBG7 5L6YH 5CWSB 1XT5A 4AV4A 3PFQA 2F8IA 3WFEH 1QMUA 4U1LA 4WFHD 1D2OA 4ZUUB 1RUQH 4JHMA 1MCSA 1BFOB 1B0WA 2NPLX 3G08A 3BKJL 4NQSA 4DZAA 2C9PA 4P46D 3PVFA 4N6QA 3STEA 4FQXB 5I5RA 1TELA 2VERA 1PNDA 3MHFA 5I74C 1X9QA 3RB7A 4F20A 1MYRA 1ZJAA 3TZVB 3A3YB 4LOUC 1E6SM 3CFCH 1Q6FA 3WL9B 4JAMA 4WI8A 5HY9B 2GBTA 4YE4H 3P14A 4DP5X 3UACA 3U2SB 3CH1A 4W9JC 2WXNA 2WV8A 1XR9B 3UR5A 3NRFA 4C6MA 5D1QA 5HHQB 4NYYA 5B8CB 2PETA 2AGJH 2AS5M 3PWNA 1IGFL 2IQTA 3V55A 3IVKB 5F7NC 2NNCA 4GIRA 3TAKA 1WAAF 1P4LB 5CAHA 2PDQA 3QEGL 3QHNA 4NM8L 2WXMA 1KCKA 2GYIA 3HMXA 3AAMA 3S96B 3WO4B 2WQRA 1WD8A 4JG5A 4ZMVA 3QJFA 4PBVC 2Y36L 2J6EA 3O16A 2HCVA 1TXKA 4WRHA 3AUOA 3MLYL 1S1RA 2W1NA 3ZE1E 3V0HA 1UUQA 3P40A 4F7CB 3G5ZB 3BE1H 2UY3A 4NKQB 2F6UA 5DJ0B 4XBEH 4ZGYA 4LJ3A 2NTFA 1M9HA 2I57A 4R7NA 3D69B 3L45A 1E4XL 2VD9A 4V28A 3C5ZB 5E00B 2CM5A 1Q9LB 3S37L 2DQUL 4PWHA 2X6AA 4RQQA 3N44F 3ASOB 1IAOA 2NY7L 4LVOB 1NEZA 3QLLA 1SQ7A 1FZOA 2YXWA 3RE0A 4LSSL 2JWYA 4R2GD 1TWSA 5I1LA 3EFDH 4AF0A 1ORSB 3FUEA 3RPTA 5E2TH 2PCEA 2BLEA 1GQNA 2ATPB 3NSCA 1ONWA 3PPFA 4ERSH 4H8NA 2VHLA 1KLZA 3T0BA 1OY3B 1B4LA 2FDMA 3I7SA 4GI6A 4C1NB 2ODHA 3BQVA 3GIVB 2YL6A 3I6GB 4QRQB 3IDJB 4GG6E 2JI2A 5DD6B 4B3LA 2ADGB 2YMOA 3N06B 4NUGH 1OM3H 1GTFA 4WY7L 1OLLA 5BV7B 3OVUB 1YEGH 2J13A 5A2BA 3O05A 2RUSA 3IJHB 4Z7WA 2GEQA 2OWXA 1R2SA 1UZDA 4DQAA 4GZ7A 1A14L 4ZO8A 2ZKYA 4N9BA 2DQMA 4LCCC 3U83A 2WSDA 3QZAA 4XP1H 4QG8A 2BMKB 4MNJA 4E9QA 1NPJA 1QPQA 3I6SA 3KYOA 1Q1JL 2FX8H 2R0ZL 5T3XL 5LKNA 1MLCB 5BV7L 3FSOA 2EP6A 4MDJA 4MWAE 4JZJC 3QH2A 1R2RA 5A6IA 3TT1L 3CX5K 3CVHH 5DRNA 4G3YH 4AQ1B 5T5FA 3K7UA 2VUNA 4POZD 4JHVA 3EJYC 3PAYA 1HIMH 1HEHC 4X7FC 3STCA 3O4LE 4KPHL 4HSCX 3RG6A 3AXLA 4Y2DD 4A29A 5IJKC 4BQ2A 1KN2L 2AL2B 5I0YA 4ZS7L 4PYSA 2WKOF 4F8XA 1KPVB 3B04A 3ZL4H 1MWAB 4ML4A 1ORQA 3PZQA 4LIQL 2HFEA 1MOEA 1MRDH 2ICWJ 4UDUB 5EFIB 1JP5A 2F54E 4QTHB 4E6MA 5HYJB 3WKPA 1XX9C 1KRCC 2V4LA 2J7DA 4GXVH 3LS4H 3QTGA 1JZHA 3TVMA 2E8ZA 2Y9RT 5C09A 1B3OA 3B43A 1MWAL 2OODA 4WUKL 3LDBC 1PWMA 4AUJA 4PJXA 3MJ7A 4QRRD 2V8MA 3THQA 4I0PA 3M17B 1C5BL 2EXWC 3F4NA 1K9DA 2A6LA 4HOMA 2B0SH 1SUHA 4Z7OB 2Y8UA 4LCVA 4LVEA 3TLQA 3SDCA 2X44D 1BQGA 2YWZA 1TTRA 2Q3XA 3FS9A 4KKXA 2EKCA 4C6PA 4WGKA 3W83A 1QU4A 5EO9B 2HPOA 1HZHH 1MCPH 4R8WH 4ZTPH 3IRDA 2Q02A 4ENEC 4TSBH 2NY3D 1MI3A 4YLQT 1T66D 3UNTA 2UZXA 4HWBL 3GR8A 2WMHA 1WFNA 1Q90A 1XH1A 2E67A 1YN6A 2P47B 4FFYH 4FC3E 1ID5I 3L81A 1RPXA 1H1ZA 3P11L 3IMVA 4WFFE 3EYUH 3HFTA 2OB3A 3QORA 3APDA 5FYKL 3AYTA 3TIDA 4U6VH 3QQ3B 4DQOL 4OIAA 3QDAA 1L6ZA 4LGXA 4HHMA 5JBEA 4AD5A 1YEJH 1M1BA 2IS7A 5KTEH 4CVZB 4H4NA 2FUTA 5C0QA 4PRPB 4X4ZA 3UJIL 4HQVA 5BRZB 3KDNA 4JK0D 5HVWA 3QKZA 2XQ0A 3FUNA 5D1QD 2J5WA 3P3TA 5CEZL 4PS8A 2Q6ZA 1PIGA 1G7HA 2PTTA 1C8QA 1F2QA 2NLJB 3X1FA 5EKYA 1R6WA 3OLGA 6REQB 3DK0A 1F45A 2OO6A 4LU5L 3VKAA 1UD2A 4GX9A 4CKQA 1SXSA 2Q86B 1A3ZA 3SO5A 3KPOA 5KEZA 4DK6A 4GMTL 4KPLA 4JFYA 5IM7B 4LUTA 2ZA3A 2FZDA 1Q72H 1RUPL 4C56E 4R85A 4HUUA 2C3VA 2VQ1A 5KYUA 1AVAA 3QJAA 1EMTL 4LS1A 3R0NA 5KINA 3RDTB 4OB5L 1WF5A 2VITB 2VFDA 2E4FA 5KS9B 3GVWA 4JTDA 1TUFA 2XFRA 4Y9BA 4Q6IC 3VI4B 1IX2A 1MCOH 2XTJC 3C6SB 4AY0A 1Z9PA 1BPVA 4NO2A 5D9SB 5SX5H 4F8NA 2AVFA 3L0NA 1BTCA 4H13C 2UY7B 4ZFOB 4AD2A 3VNIA 1W6WA 4EANA 1E43A 4BFOA 1GVFA 3RU8H 4BHUA 1H0DA 1XGQB 4M56A 4RSYA 5FJUA 4MAZA 4FQQA 1SO4A 2H5UA 2ADAA 2NY0C 3S46A 5I8KH 1EFXA 4LBSA 2J62A 3MLWH 4YSUA 4HK5A 1D5IH 1WBXA 1UR9A 3B3IA 1W6LA 3KPPB 4ZFOL 1CYWA 1EA9C 2C1HA 2W79A 3HVNA 2O1AA 4OJAA 2PA6A 3P30H 3R18A 3RN6A 4NQDA 3B4NA 4OTXH 2ZWNA 1QEWA 3X1GA 2W62A 4CN4A 3VK5A 1TZ7A 1YEEH 4YHPA 1ZVHA 3SZ8A 2BSEA 3WMBA 5ABFA 5ALCH 3QW4B 2WLKA 4YVUA 4ORZC 1OAKL 1LUCA 4LLVA 4XP5L 2AW2A 1ZA6A 3CXHJ 1E4NA 3T55A 3O2WL 4AYMC 4I2XA 5A6KA 5HHPA 5JHLL 3ILDA 2FSEB 1EWHA 1NA8A 1V3JA 5D38A 3L4WA 4CSTA 4EDXA 1EJ6A 3TFKD 4LASL 3LXUX 2D0GA 3NSNA 4UT7H 5AD0A 3BV7A 4W9IC 1W72A 2VXTL 1LORA 3HC4H 1LP9E 4R83A 2Z7UA 4MMYA 1G0DA 4BFRA 2FWUA 4WO4B 2IQ0A 4YWGL 2QCDB 1NPUA 3QIBA 3P0WA 4H2AA 3HPAA 1NJ9B 4WV1C 3TN0A 2DWXA 1NCHA 5C0IB 2J1ZA 1U8NB 3MROA 3BSGA 4B5WA 1ED3A 4HIIA 3WG6A 5BU9A 4G5DA 2PTVA 3MKVA 4QJ3B 3B9EA 5GSRB 4XVJL 5I1IH 3QUYB 5ES4B 3GDRA 3UZQA 2V5DA 1LO2L 1XXXA 4O11A 2ARJA 4EXPX 4IMFA 2AMXA 2E0PA 5D8JH 1YDYA 4ADIA 4KDTC 2VFIA 1VPQA 1XH3A 2DZPA 2IKIA 5JOPD 4I0PD 2HT2C 4QHKI 3J2PA 5JU6A 1DJIA 4N0RA 1O94A 5K69A 5HSFA 4KXAA 5HUOA 4ONGL 3KHJA 2I7SA 2G3JA 1GAFL 3SDCD 1CXEA 3K2GA 1OGAA 5E8NA 3DYPA 4UAHA 3CZFB 4MQ7B 2J88L 1LRQA 2IAMB 3UMTA 1CE6B 3RY6C 3P0YL 4Q58C 1AG0A 2GPZA 2P8MA 3FV9A 4JFOB 2QS8A 3HBQA 1NFDA 1VCFA 3ISIX 1OAUL 2OLSA 4QJ5B 1OAQL 3UFIA 3KPMA 4H20L 3GBDA 4P2YA 1A4KA 1HT6A 2NYYD 5IB1A 4OVUA 1NU5A 1ZWIB 1KMGA 2ZKMX 1RBLA 2NVCA 3IJLA 4EF9A 4N0FB 4YHOH 3LKPB 3MRNB 3RIFK 3S2MA 4Y9FA 1KYUA 4LVDA 1PS9A 3FFDB 4LCWE 3VFUB 5T1KB 1KC7A 1K8DA 1AJ0A 4HWEH 3QORD 1KTJA 2V30A 3V6OE 1HZLA 3SYAA 5C0ND 1B1YA 1OD0A 3QNYA 1MHPH 1NANI 4BQ8A 4UILL 4PSRA 1KNOA 1LMKA 1VHCA 4RZ6A 5ISZB 5D2NB 4KTEL 2ZOKA 2FNBA 4HA4A 1THCA 4H6QA 2PMZA 3MOAL 3NEXA 1UJ3C 3EWUA 1L9PA 1E5NA 4D8PA 3IU4H 2A85A 5HPCA 1DV7A 2RMNA 3X3FL 2CLRA 3QXAB 3EH2A 1J8VA 2N1KA 2VGGA 1U83A 3R1ZA 3BWAA 4LPXA 4H5SB 4E0CA 5T1DH 3TIEB 2PDYA 1T0OA 3OMAB 5I2IA 3VG0H 5AHMA 5HMSA 1O5XA 3NN8A 4U0RC 3KRUA 4Y9GA 1JZ7A 3KWWA 4GCAA 2CRZA 2JJSC 5EBGA 3IRSA 1XRTA 5C0BB 5LKYA 2YCEA 4ZSOB 4I7UA 1TZGH 1KCBA 3WD1A 4LVHB 1JVNA 1A3LL 2SFPA 3B8TA 5H4ZA 1AQKL 2QPSA 3WLLA 1H61A 4N5ED 2I5QA 2HVJA 1P84J 3UTPE 1N59A 2XKNA 4B16A 2NRDA 3ONCA 1NGWB 4RK8A 2Y23A 3LYRA 3WTVA 5ID1B 4ZZKA 5JR1L 3RXZA 3Q1SL 3S1WA 3FYEB 4NQDD 1UFGA 5T3ZE 1XBDA 3STZB 2CSPA 4JTKA 1L9RA 1O7SA 1J93A 4ODXB 1MFAH 4WKFA 3FU6A 3EXTA 2PI6A 4LBAA 3W27A 3LVTA 2VW4A 1CFTB 1QBLH 1WQ5A 3SGDH 3UBGA 3OJGA 5IBLC 1IFGA 4XVSL 3CXDH 1Y8BA 3N6JA 4JY6B 5SX4H 1MH5B 3UO8B 1Q5MA 4AG0A 3L5XL 5FO2A 1MUCA 3L9EA 2CLEA 2H47C 3BT2L 1KDIA 3S3CB 5ENLA 1FH5L 4NC2B 1CLKA 4XAWH 2CHOA 2K6WA 5LGYA 1OY0A 1S7XA 3NTCH 4GJTB 1F8TL 1NOAA 3DXAB 2PBOA 2YDSA 2WXFA 5CXPA 3KWXA 4QRAA 3BYTA 2I1OA 3BWZA 2WTPA 3SGEI 1WYJA 3BPLC 1ELSA 1EZWA 3M45A 1B88A 3FNDA 3L1OL 5ICUA 4DZ5A 2CETA 1GOKA 1HXMB 1E73M 3AB0B 4E9YA 3ATFA 1P1MA 1IWPA 4NLHA 3TN0D 3MY9A 4TSAL 1RUMH 2C1PB 2AEPL 5K9OA 3KP1A 4JFPA 5E0KA 4A3RA 3II1A 4QI3A 4FE9A 4AT6B 2XZ9A 1VFTA 2E47A 2DWEB 1RKRA 4FL4B 1XL9A 3B8WA 5CHNB 2Q7YA 3ARBB 3N43F 3N9RA 2OSWA 3RM8A 3GXIA 1I9IL 5D1XC 4BXVA 3W22A 4E0RB 1MXSA 3UCDA 2B2XH 3LD5A 3BW4A 1WBYA 3QNFA 4A7GF 2OMYB 3W2DH 3NXLA 1X5FA 1KIPA 2HTKD 1E6QM 3OKMB 3BV4A 5D5MA 1G67A 3S1UA 4K5PA 5IHSA 3CDFA 2NY4B 1CG9B 5ACZA 5CG7A 4XCNB 5EGRA 3EGSB 3LNGA 4MJJA 5IFHH 2UXFA 3UYIA 2VDMB 3NYDA 3KBPA 1MJJB 3OR6A 4EUPA 2W65B 4H9XA 3LCFA 4GO6B 2CA4A 1R5YA 1H5BB 1LOLA 3C8HA 5IHRA 1MEIA 3VM7A 1JRBA 3NURA 1UP0A 4XO8A 4QXTA 5DHMC 3OJMB 3AG2B 3NEVA 2W07B 1EBHA 4DOHE 3UETA 1NGXB 2IADB 3OKEB 3RKDC 4IXHA 3N6YA 4MWAB 1CLZH 5H2BB 4IJTA 3H9HA 1TTFA 4JDZA 3QJQB 2RFXB 3S5OA 1KYAA 1GGBL 3LNDA 3MNDA 4GMEA 1HJSA 1LLWA 5D96C 2ZAIA 4F27A 1RMFL 4Z9KB 1JUBA 5BOJA 4MKSA 1RZ7L 3O4LB 3DHFA 4LSRH 1C8YA 4S11A 3V5DA 3NO3A 3VA6A 1KRAC 2WP3O 3R19A 5JXEC 3W75A 4M4PA 2R1XB 1DFBH 2X1SA 1NGYA 3OIXA 4PI2A 1POKA 1EJ7L 3ZL2A 3WJLC 3M7OA 2JELH 1T2QL 4V2BA 3QGKC 2VL5A 2F54B 2PXYD 2VC9A 3D48R 2ZKHH 4GKZA 3AZTA 4X5XA 2WB7A 3WUWG 1XGYL 3EGXA 4HG4K 1BYCA 3RJQB 5EC2A 3MBXL 3LEYH 4H40A 2VEKA 1QSEE 5IFAH 3W28A 3U48A 3ZSSA 3EOBB 3X17A 3FT4B 2VRQA 3UPCA 2ITDA 2XN1A 4DPBX 2Q2EB 2NNAA 3WY1A 3CL8A 1G6RB 4OQTL 1C9WA 2HKFL 5HMFA 2WBJC 1L0XA 2GVJA 4PBWD 4IKJA 2CGYA 3V0WH 1KBVA 2NW2B 4XNBA 3N40P 3KUMA 3TV8A 5C9WA 2DQDL 3H8NA 4KDVA 3GO2A 4R7WA 2WXGA 1B6UA 6ENLA 4PUBH 3MC5A 4TV5A 5CD3A 2Q6WB 5HBBA 4KZEL 1UYQA 3SBQA 2Z64C 5EZOH 1G6RL 1NWUA 4MG4A 4EN3C 4QRNA 3BKYL 1UT9A 1C5CH 4ZUWA 4J3VA 4KRZA 2LQRA 3B7RL 4UQ2A 4JB9L 3P3SA 2HVBA 4HHLA 3VI3B 3M8OH 4UV7L 5IMKB 3N4FA 1PLCA 3CV2A 2XH7A 3NDYE 4ZUSB 2QCCA 1A6AA 4YHIA 2CPUA 1JCNA 4LARH 3E6FA 2FNWA 1ZBCA 1PKQB 1U4EA 3R7QA 3NJGA 2NUPA 1XF5B 3BO8B 3H3BC 3L3DB 1I7RA 2V6HA 1S7RA 5EG6C 3FFSA 1GYAA 1EEYB 2A1WH 2GW5A 4YO0A 5CKSA 2IMNA 2A7PA 2A6IA 3QAZB 1CDHA 4JKLA 4WJ5B 5IR1B 1DO6A 1UOLA 5DQJB 4OGZA 3UGUA 2GFBA 1LL1A 4KAQL 2TSYA 3N25A 2FWOB 4PJBA 4GYJA 4FDWA 2YPKB 3AGWA 4PC8A 5FJPA 2HX8A 4DW2H 1IXOA 4J12A 3GSOA 4Q8MA 2VEMA 1B5TA 2CRIA 4JQ1A 2AMGA 2G3FA 3ZIZA 2YL8A 1UA3A 2PN5A 4JDVB 2EAEA 4X98A 1S7TB 3ULAB 5G5DB 3JV6B 3S36L 5K9QG 2JH2A 2YD6A 3NJJA 4C56B 3JVGC 5EH1A 2A7BA 3T07A 3CPGA 4GAYA 1T22B 3RNKB 5C3TA 4MY9A 4PGEA 3W86A 1RJLA 1WOAA 4R6UA 4IPPA 2DQIL 5JW5A 1EC9A 4AOFA 4BQ3A 2CIIA 3D4YA 3MLTB 3KNBA 3WK3A 3F85A 3PGDA 2Z4QA 4BA0A 3ZE0F 4O1DA 4XO9A 3UXDA 4AVJA 5JOEA 2CLHA 5F1IB 3H4GA 3CZGA 4Z3TA 2ZDSA 2YGOA 4Y8FA 2XIBA 3MV7A 2X6VA 2HLFD 4XO3A 1ROWA 2EDTA 5KVDE 2CLPA 2WVTA 5HXMA 3OX8B 3QZEA 4IQLA 1AXSA 4N85A 1CFNB 3WIHL 2XDFA 2R51A 2UUDK 7REQB 1GHFL 4I9WE 3EOUA 5CP3A 2JXMB 4AZIA 4G7VH 4L6OA 3B2VH 3ETBF 2NUYA 4IMDA 5J1AB 3SDXA 1G1KA 2DM2A 4HFWB 1W2PA 1S7SA 1DQTA 2GGEA 1FNEB 4ZE5A 4ZZ9A 1OLZA 5EN3A 1A5CA 3VIJA 5SWZD 3LZOA 4EK7A 2VH5L 3GTHA 3QQ4B 1CK0L 5HPOA 3KYNA 2ZVRA 2EDJA 4Q4SA 1AD0A 4B9ZA 2WHJA 1R34A 3MRRA 4FQXC 4UAOB 4XVTH 5DD5H 2EEFA 4PGCA 2XRAH 2BNJA 3WJSA 5DFTA 5ESVA 2QR0B 1E9QB 1WFJA 2WGNB 4DGVH 4QKXB 3D25A 4C6FA 2ZXGA 1QLEB 1U8HB 1W31A 1MCWM 2I26N 1QNSA 2CZEA 4P5KA 2YO3A 1P7QA 4XAPA 5AVTB 3EPMA 4G1EB 1PVNA 5JQHC 1DBJH 1W5MA 1UFUA 5B8CC 1QW8A 1JCYA 4FXJA 4HKZB 1FCCA 4KOCA 5KOMC 4QOKE 1V6TA 5I00A 4DBDA 3NPZB 1LP9B 1RUAH 3IFOA 1QLEL 4LLDB 1ME9A 3IIOA 1RLCL 3ARYA 5HYJE 1VADB 2A9NH 1YRRA 2PYED 3G1AA 5I6KA 3KOZA 3NIYA 4BD4A 4OGXL 5E4OA 4ZOCA 2K6ZA 4OLYH 3QXUA 3W2MA 5GZNA 2B1HH 4IJ3C 3P0VL 3FQWA 3GMNB 1XZ0A 4B3EA 1SVDA 3TCTA 1F4WH 3CVDA 3F5WA 2BZDA 1WZ1H 5I1AB 3NFNA 2YXFA 4LAZA 5I5MA 4ZW7A 5KN5B 3WEMA 1E9OB 2A4ZA 1PY0A 4O8AA 2YSTA 1FTXA 4WTZG 3WBWA 4F57L 2VISB 3C5ZC 3CVBA 4JTLA 4H83A 3F58H 4NUMA 4PWJA 3HNVL 3VOHA 3DFNA 2H41A 3DO7B 3LQAH 4D0BA 1YZZA 4AC4A 5D33A 4QAIA 4LHUG 1VHPA 1QPOA 3WAJA 2F2HA 3E2SA 3LLFA 4BFNA 3TL5A 2WJFA 3OHXC 4HHWA 1EXPA 4MTMA 4XIMA 3NAAH 4FEIA 3WUZA 1CDJA 2HEJA 2A6JA 4AENA 4L8CA 3U6XS 5IGXH 4RGMC 3FN3A 3C2OA 5I7GA 3AREA 5GZOC 5CLZA 4JFWA 5LNDA 1BXAA 3OEXA 4E68A 3B5GA 3D85A 1NELA 2LAGB 1C91A 4P2AA 4IYKA 4Z76B 5DVPA 4S0HA 1D5ZB 1AW1A 3UP8A 3LZPA 2DLFL 3QHMA 3L7EA 1A6TA 2W0PA 2OTWB 1PTAA 4BKTC 3K71A 1B0GA 5B1BB 3THCA 1EZVY 3NVDA 3RIAF 2R0LL 3U4BL 3FFCA 5BRZE 3ARDB 4Y4FC 3QJOA 4IX0A 4ZFGH 1H6FA 3FLUA 5A3HA 3SKMB 2H1LM 2CCRA 4JIEA 2HJFB 3OKDB 4IIQC 1UA6L 3TWCL 2FJFA 3C60B 5IQNA 4F9DA 1ZPLA 5JHDE 4MX7A 4M5PA 1Q8MA 3SPGA 5L8JB 4ZAKC 3N6QA 2NZLA 3UAEA 3JUZA 5DFAA 1VLWA 1S78C 4AZ6A 4UTHA 4KQ4L 3GFZA 1X7SA 4I0KA 3NZHH 3IS1X 1GONA 2E7DA 3K8MA 2X0WA 3DTXB 4JIIX 2DYPB 3S34L 1F7BA 3P62A 5J04A 2BRRH 1YO4A 2DZTA 2RCSL 3SBWA 4D7PA 5KS9E 2IPUG 2W9EH 1AK5A 3UTQB 3MRJA 5BPPA 3VI4E 4JM0A 3AY4C 2VZTA 4X99A 5C2BH 2CDFB 1PVHA 3LUTA 4IG2A 2B4CL 2MJWA 7A3HA 1LTDA 3IWPA 4Q0XH 3LYEA 1H15B 5IW6B 2EG7A 2X4QA 5DHEA 1FWCC 3SCPA 1UWFA 4X7EC 4V33A 1WWBX 2X38A 3IAPA 4FCHA 3QO1B 1OFPA 5AFDA 4NZTL 1E50A 3VXTA 1ME7A 3N9KA 3VWJA 3MV7D 2ID5A 3KM8A 3MOBH 5JZ7D 1K72A 3ZTCC 2Y6ZA 4P5MB 2VDNB 5ETUA 1XIWC 2O61A 3WQ4A 4X4KA 5FKAA 4P46A 2CXEA 3B0XA 4NJHA 1KPRB 2A3AA 5BOOA 5I6NA 3ML9A 5EEZA 1NWSA 3P0GB 1GORA 3K5XA 1GVEA 4MD5A 4APQC 4WOQA 3IDXH 5KUKA 2E9IA 1IXQA 2OMBA 5EUKA 1R75A 1BVNP 1REIA 1S5TA 4ZFFB 1QNVA 5G1MA 4IISA 1OV8A 1ZV2A 4K1WA 1O7VA 2O5YH 3QRLA 3COOA 3FO0L 3IF1A 3OZKA 2LR4A 5E2JA 3NFPA 4RV8A 2PD9A 5BMFH 1MAKA 1NM9A 2QVHA 5DJAB 2PB1A 4C6KA 2PDMA 3U7WL 3GMQA 4P23A 4PW3A 4Y19E 4TMBA 4PB9L 5I07A 1XLHA 3Q37A 4HXBH 1P7QD 4N4QA 3DX7A 2DBLL 3FB5A 5T3ZL 3X11B 3M6YA 4PG2C 5BU6A 3LKQB 1E67A 1TJGL 4BJHA 3MLVH 3B8YA 4QYOB 2W5PA 3GU9A 1J0JA 4HNCA 3WS3A 5D6CB 4GNVA 4XZUB 4AX6A 4FERA 1E0VA 1QPPA 4HGKC 1QOXA 3CN1A 1AHWC 4UB0H 1XC4A 2P7TB 4NY2A 1M7DB 2ZG2A 4O2FA 2IANA 4S1SL 4OKVB 3QSKB 4JO3H 2KZKA 2N1TE 5GZND 4Z95H 2ICEA 3U7YL 4NSKA 3G1VA 2BOCB 3DUHA 2WWCA 4DVRL 1V0MA 1NWTA 1AGCB 1B3VA 4WDIB 4YR6B 3EXJA 1FE8H 3RVWD 1R33A 2Q8AH 1SYSB 4AYBA 4QUOA 4IRSC 1OTTD 3D3VE 2BCKB 1DTUA 4E2VA 4OD3H 1FV1B 5C0AB 3M1OA 4Q8VA 1PZ5B 5KVMC 1A3XA 3BOLA 5K5YA 1N0XL 4LF3B 2NUXA 1E70M 1PCXA 4YXLH 4WFEE 3D0LA 1YLBB 5DZPA 3RGTA 3GMLA 2GT9B 5GRJH 1VAHA 3QT2A 1OAZL 3FCUB 3PZ9A 1LDSA 1FAIH 3GBNL 3QYCA 2QCLA 2CBUA 1BF5A 2BP5M 4OH2A 4PV9B 4HMDA 1OX5A 2BSCA 4C83B 3AZSA 4ZB5A 4RDBA 4FIQA 2WKGA 3MTRA 4CMMB 3RPIB 4CVXB 5HPMA 4QHUA 5BOPA 5CKGA 3ARED 3WNJA 4FS9A 1L7TH 3D85D 3WLWC 1HYRC 1AJ7L 1KFLA 5ECGA 2PPCA 2MOGA 4UBDD 4GYPA 3FJTA 2F5AL 3Q2DA 2VJ0A 3T3PB 4DOHB 2XSAA 4Z0JA 2R29H 3BH4A 1B30A 4O54A 2OSLA 1R8LA 3UWVA 3FFCD 4B9PA 1DUYB 3E0LA 3H2OA 3VFCA 2B39A 4L1GA 1OGBA 3UXKA 3UY7A 2Z26A 5ISZE 1QO3B 2AJYL 4KKLD 2ENJA 3SE3C 1FWRA 3CNKA 1Y18B 1BQHB 2X4PB 1LWJA 3QG6B 3FHEA 2G5RA 4ORGB 1BIHA 3MCG1 3VFGH 5LCVA 2VXQL 3PY9A 3UZEC 3S8HA 4ADUA 4JFUA 3R8HA 3MRFB 4G9FE 4WIWA 3Q48A 4P57A 3L1GA 4K3DL 3RL2A 3L54A 5INDB 3S9YA 3KL0A 4U3SB 4H88H 5I8OH 5IIEB 3WSQH 3PNZA 2Y7SA 1F5WA 3MYJB 3PAJA 4JGMA 3BQUA 4QRRA 5B1CA 3ZR6A 4EZLA 3TCEA 4L9LA 2CLZB 2AEOA 1LQSR 4UUJA 1J05A 3W5MA 3TV3H 5GISL 3V4PB 2VFGA 2ACRA 4H0GA 5C0BE 4MKMA 1PW3A 3D39D 4ZSOE 1JFHA 3FSWA 2UZYB 4DUOA 2CBVA 3TYFA 4BFFA 1AQHA 4KMTH 3VWJD 2OEJA 3PQYB 5T33H 1MUJB 4TNVF 4O2CA 2XQBH 3WFAA 3L5AA 4FXGB 3SKNA 5DELA 1A66A 2WC3A 3QEQE 3S88H 4X7DC 3QLDA 3V4PL 3RX4A 1K7XA 4UTAA 1A21A 5FWRA 3A47A 3Q5TA 3OLEA 4HHGA 1U30A 3SE6A 3ID7A 1H51A 2K7PA 2R82A 2V5KA 4M3KB 3E12A 3JWNE 2ZONA 3U4EB 3WJJA 4RCAA 3BDXA 4PRIB 1TV7A 5LUMA 4XBPB 3K80A 1EYEA 4AH7A 3SZKC 4UYQA 4XXCA 4HU4A 4NC0B 4DJFC 1JYVA 1T20A 2JB6B 2OLAA 1RURH 2P5WE 5CPLA 3EJQA 1T5AA 5LHDA 3UZVA 1TNNA 1CTMA 3L5HA 4QRBA 1V7NH 4J3OD 2IPTL 3WTWA 2ZRVA 4LHQB 1NDZA 1PLBA 4JX6A 4KVNL 4YEEA 4MASA 4HWZA 4E5XA 4P23D 4CU6A 1GG0A 4AQ8A 2VL4A 3LNHA 3DXAE 3ULVH 1HKMA 1YC7A 3NXFA 5HHVL 5C0RH 3WMSA 4G1MB 1AZUA 3AXKA 4C5YA 5MKGB 1UH3A 1S2AA 4UTWC 4YYCA 2XWBA 4XMKL 4URIA 3S1XA 1KXTB 2EKSB 4I3SH 2O56A 4KROD 3ZLGA 2D2CC 3H7BA 5HUPA 1A9BB 3LQMA 2CKBH 4NKOB 5D2NC 4UTFA 3PTDA 3LEXB 3OB0K 1UXWA 4U7SA 5DS2A 4KFOA 2PPDA 2CGRH 1A7OH 3BURA 1C16A 2V3GA 5BVJB 5F0PB 1EVTC 3S5LG 3MUGA 3OKNB 5I0ZA 2C9AA 1UCWA 2D4DA 2VQUA 3RK8A 2IAND 2TRYA 4DKFL 3IXAB 3LV6A 3PJUA 1O6SA 3DDFA 3HE6A 3VE0B 3W81A 3IVUA 3TTYA 3GU1A 3V18A 1CBGA 2J8FA 4CA4A 2OS7A 3ZLQC 1ZLEA 1S7WB 3G7TA 2ALRA 1XL6A 4GAGH 4HD9A 2NCMA 2WMJA 2HWZL 4PR5A 2J2ZB 1XG3A 4Q4MA 2AK4A 2O7QA 2ENPA 2Z2AA 1FO0H 3VXRD 1DANU 5EU6A 2Y8KA 2HJLB 4P4KB 4IFKB 5K9DA 2MCPL 3MI2A 1S5IH 2FVNA 4AK1A 3IJSA 2ZUNA 2RGSA 1WZLA 4DP8X 3ALGA 1XINA 3GLCA 3SR7A 1VCAA 1L3WA 1TPH1 3MRLA 4JGJA 1KSRA 4O57A 3KS0H 4HXAL 3CZJA 4GAAA 2AXFA 1FC1A 3UF9A 1KM0A 1IBGH 3W4RA 4YXKH 2A77H 5KVDL 1WWWX 2MNJB 1U95B 4HJ0C 4XPTL 3ULUH 4PUMA 4EE2A 1U92B 2BXZA 5H35A 4IMGA 1RZFL 3U0PB 2RHEA 3IU3B 4OJYA 1JXJA 1K4DB 3QXBA 1HJBC 1SDYA 2ADJB 2X2YA 3BLOA 1HINL 3EBAA 4K3GA 5CZ0A 2X4UA 3B9DA 1SJVA 5LHFA 4NB7A 4L8SA 4LBEA 5FR3A 3LH8A 4PMYA 3FTSA 4HA0A 2VR9A 4GCXA 1DE4B 4A6YB 4LUYA 3P3BA 2XINA 2DY2A 2JKXA 1ZK9A 3RFZC 3FQNB 4XN2A 4GG8B 4MDOA 3WDJA 4HJIA 4IXXA 1HHGA 1HDMB 4IBVA 4KX7A 4ODWB 3K13A 4NPKA 2DPKA 4QOKB 3MMEA 4I8DA 3DEQA 1VBUA 2YKKA 3SPCA 3OKLA 1DIOA 2YB4A 3BP4A 5FXCH 5DZOA 2OO0A 2Z6JA 4WEBL 2QVTA 3IJYB 3II3A 3OVPA 4DGIH 1L9SA 4JQXA 5F2FA 5E9DA 2Q10A 4GNJA 1RHHA 1AJ2A 2UBPC 1REQA 3FB7B 4OLZL 3MMDA 2V5YA 2Y2WA 3GMPB 4NNYB 2NR6C 1X39A 4GAJH 1ZB5A 4D8ZA 1PSKH 3SDAB 3O2VH 2FX7L 2DSZA 3BQUD 1AQ0A 2X6BA 3QI9D 1FFPB 1H3TA 4B53A 2JI3A 4WHYH 5EN2A 3KBMA 1Q38A 4K68A 1I7UB 1UWRA 1J9YA 3V0UA 4IJBA 3JV5A 2C6QA 5DDHB 3CLWA 1DIDA 4UM8A 3PBMA 2XG5B 4H9ZA 4AG4L 5C8JA 1X7QB 3TTQA 1LK3L 5E8OB 3P2TA 1JGEA 1URIA 1IM3A 4PMOA 5EU3B 5IRPA 3NYZA 4QT5A 3KTSA 4AZCA 5CF3A 2YGYA 2QEJA 3TSMA 4J6RH 2VIRB 4K3EH 4S3AA 3QEUB 2DF3A 3QZWB 3VI3E 3LN4B 1B0RB 1M05B 3MDWA 2VDLH 5EBMB 1YEDA 4FMVA 4PB0L 2R24A 2PS2A 1TWWA 3RWIA 3Q58A 4CMHB 5K3VA 4JDBA 4PUKA 2IO5A 1GVIA 2HKAA 1HAWA 2R83A 1PKQE 5AAWC 1BTMA 1YBQA 1HL5A 4MDPA 1D5RA 4L9YA 1EZ2A 3UWWA 2PE4A 2VLKB 3QYMA 4OUEA 3C2AH 4K3JH 2WINA 3ZR5A 3P4NB 4HPNA 2F58H 1KF9B 3SD5A 1YPXA 1AG6A 4LGPB 1QI4A 5JHDB 4GXPA 4K94C 3ZKXB 4E2BA 1EEXA 1QBML 4QRUA 4G6AC 4NN5B 2Q20A 4L37B 3F6JA 3LRHA 5DD1L 1MSPA 2TSAA 4X0NA 4B9CA 1AQFA 4L0YA 4BH7B 3H3KA 2VKXA 2QV4A 2FIKA 3FGCB 2IGLA 5G2IA 3M0IA 4Q6XA 2ICWI 2OI9C 3SCWA 1F4HA 2YLHA 2ANUA 2NQ9A 1I1RA 4W9LC 3VNDA 2OQLA 1Y1UA 3SDDC 1PFCA 2NT0A 2WQVA 4L3CA 3HE6D 1GJIA 2G4FA 2QQKL 3HRZA 2GSEA 3WQOA 4QBXA 1XUUA 3PS7A 2EE3A 4YHKH 1P5VB 2IDSA 3I75B 5E2VH 5HBFA 4QAWA 2JQZA 1WXYA 4J1UA 1JN6A 1KTDA 2B1AL 5KVGE 2R23B 1CO1A 1O7DE 5TE7L 3OMIB 1OF2A 4A38A 1RUKL 1GOGA 4GAFB 2BK8A 2PWEA 4NP7A 1EA0A 2B7QA 2AK4D 3UYPA 4UR9A 1DL7H 4P3DA 4D9RE 5EU6D 4V15A 1I3GH 3MRBA 2FQGA 4AGOA 1EF2A 3LTSA 1AGBA 3AW5A 2D9QB 4F7PA 3AFLA 1VYSX 3MXVL 1T1WB 5DJ2A 3GAYA 1NQBA 4XN8A 1SJHA 1PQZA 4M4RA 2YCLA 2ZZ2A 4XVUD 1XF4A 2MTAA 3QS3A 3GNRA 2HTLC 3QC0A 3VSVA 4WWKC 4YHNA 3TOYA 4U4BA 1FHVA 2XYBA 3GSXB 3VXMA 2G97A 4K36A 2Z00A 5FA4B 4JYDA 2YC1A 1R5VA 4KK6D 1TQWA 1TEYA 1ZD6A 5DK3A 4XPBH 3T2NL 1QPNA 1J9QA 2XVBA 3SUTA 2DORA 4GVIA 1PZAA 4U4MA 2BSTA 2CLVB 3MRCB 3QUZB 2OBGA 5T5NF 2F8QA 3BAXA 4DJDC 2R39A 3DX5A 2L7JA 3TMQA 5I06A 1IZCA 3FJNA 3FVDA 3KBJA 1UATA 2EECA 3R06A 1Z32X 3KP0A 1GTNA 1MREL 4Y19B 4YZFF 5BRPA 5DVKA 3TA3A 1J18A 2Q3RA 4KJWD 3QAZC 2W27A 4Y7EA 3VFLA 4N42A 4XNMB 1A6ZB 1ADQL 4MZ2A 1H41A 3LV3B 3DMMB 4FLSA 4MS8D 2QVKA 1WITA 5AB2A 4TLTA 5EMLA