3BAWA

Human pancreatic alpha-amylase complexed with azide
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Alternative catalytic anions differentially modulate human alpha-amylase activity and specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Pancreatic alpha-amylase
total genus 178
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bawA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bawA01
3ZJ7A 5A8QA 1B3YA 1UQYA 4X0NA 4NZFA 4B9YA 3FAWA 1FH7A 2CERA 2QV4A 2VMFA 4AD5A 1V08A 5A8OA 3RM8A 1QX1A 4LGXA 1EXPA 3MUAA 1Q6GA 4MB5A 1OGSA 1F4AA 1JDDA 3CUHA 1R85A 1ZBKA 4JHZA 1LL6A 1LQ0A 1FP8A 3VD7A 3A4WA 2UY3A 3WD2A 3SIMA 1HNYA 3VGEA 1VRXA 4WKHA 5FCZA 3IJ9A 2FHBA 1LL4A 3GYCA 4PEEA 4HPGA 2XM2A 2FH8A 2DGAA 2WK2A 3AMDA 1BGAA 1JZ8A 3SEPA 5DF0A 1TE1A 5A6AA 3SCTA 2VZSA 1Z32X 1UG6A 4UQ9A 3W81A 1DWHM 1C3FA 3QOKA 1P6WA 4GQRA 4W84A 2BY1A 3VKKA 2YOCA 4NRRA 4P7LA 3WBEA 3M07A 1X6LA 5JBDA 1OWQA 1K9TA 4TX6A 3PZIA 3A23A 1B3XA 3HZ3A 1DEDA 2CETA 3WMBA 1H0IA 1M53A 1VEPA 3POHA 3TTYA 3HU7A 3CHCA 5C70A 3MUIA 3AS1A 2OW6A 3BVUA 2YL8A 4PMQA 4J3XA 4TVUA 1V3MA 2WHMA 2WKLA 3BAKA 1OBAA 3WDJA 1ODUA 3AXXA 3NSXA 3VTRA 3L2MA 1LL7A 4TXEA 1HX0A 3VOCA 1J18A 3AJ7A 1VENA 4MDPA 2Y2WA 3N04A 1C7TA 2G3MA 4W7VA 3WDRA 2Z1KA 2GK1A 1IZJA 4FNUA 3K4DA 1E70M 3MANA 4KH2A 3W26A 1QNOA 4P8XA 1WE5A 2GSJA 3PBGA 4V28A 1WZLA 3W28A 3CZJA 2OYKA 3RDKA 2QPSA 4DWSD 1HJWA 3MV11 1JFHA 3MMUA 1BYBA 2CNCA 3AMLA 3RO8A 1GJWA 2PI6A 5HBFA 1Q6EA 2EAEA 1WAWA 5ECUA 1JYXA 1QW9A 1UH4A 4GZIA 4AZCB 2X8RA 1NOWA 1BG4A 1UWSA 5JBEA 2IGTA 3AISA 1GQIA 1XRVA 3WL0A 1CGXA 1W9DM 1GVYA 1QHOA 5TD4A 2OYMA 4J7RA 2JALA 2VZTA 1J11A 3NJ3A 3K8LA 1NP0A 2TAAA 1HJXA 3CZGA 5EFDA 1TZ7A 2V5CA 5DMYA 3VIIA 4XUYA 1OB0A 3VGBA 2X05A 4ZENA 1HJUA 3SUVA 1JG9A 4YPJA 4MPKA 2WPGA 2XUCA 1PX4A 1HKMA 1H3GA 1JXJA 1C93A 2XVLA 1JYNA 3BAIA 1JZ3A 4P7RA 5D8WA 2FHFA 2O9TA 3GXMA 1UYQA 4H8UA 1EH9A 1E6PA 3BC9A 4M8UA 2VL4A 3GBEA 3WDHA 3RJYA 3OZPA 4B15A 3DX3A 2XYLA 2OSYA 3G6LA 3EMCA 1V3IA 3PZUA 3WY3A 3IJ7A 2YDRA 3O2LA 1J12A 1JD7A 4WK9A 3AHVA 3AS0A 4HZ8A 1E6RA 3ARXA 4QLJA 2G4FA 4J27A 1RH9A 4WSJA 1XD1A 3NUKA 3OIHA 3UR7A 3W25A 4CD7A 1S46A 3N12A 1ITCA 3OLDA 5KEZA 4GXPA 4E8CA 2ZICA 2WLYA 4F8XA 3VD3A 4AZ6A 1JZ2A 4UR9A 3LPFA 2WWCA 7A3HA 1E0VA 1HL9A 4PYSA 3LRKA 4CU6A 1OCQA 4JKLA 1VFMA 1MQPA 4H2CA 2VCCA 1J0HA 4UQAA 2OWWA 4UFIA 4DUXA 3OLEA 2VJXA 2DT1A 2UY5A 1UZ1A 3DYPA 2EJ1A 2VX6A 5A6JA 2FYVA 3DHPA 1CGVA 5IHRA 3VINA 2YBUA 4XX6A 4HOWA 4U33A 1U30A 5A6LA 3GDBA 3BVVA 3WD4A 2O92A 2VC9A 3GZAA 5CJ5A 4PMVA 3ARPA 2YBTA 1JDCA 5IDIA 3ARWA 2J7EA 3BXWA 7TAAA 4DWSB 3AIEA 2DPEA 3AS3A 1Q6DA 3EDDA 5A2AA 5CGMA 1JNDA 3AZSA 5I0DA 4HMDA 1V6WA 1E1EA 4M29A 3POCA 3BMVA 5D9PA 1OT1A 3U7VA 3PTKA 1RD6A 1JAKA 1EQCA 4U5IA 2WCGA 1PZ2A 3KZSA 4JAWA 1W9UA 3D52A 1AQ0A 4UFMA 4UFKA 3W29A 1J0IA 1F4HA 4CKQA 1BVZA 3DC0A 4DO5A 2WCAA 2D3NA 1N82A 2J77A 3AMCA 4OOUA 4UOZA 1JFXA 1GOQA 3FN9A 3VPLA 4D71A 3FHQA 2A3CA 2XWEA 2DH3A 2E8ZA 3NDZA 6TAAA 3VMNA 4CUCA 1EQPA 1DHKA 3L2LA 4TX8A 1HXKA 1UOKA 1E4NA 1GW1A 2V3GA 4JIEA 3GNPA 4JFVA 2JF7A 5CQ1A 2YDSA 3TONA 4CN4A 3H53A 1E55A 1NP2A 2WVTA 4KRUA 4E4PA 5IFTA 1KXQA 3WUEA 2ZXBA 1TQUA 1E71M 1YQ2A 1E73M 5AYIA 5AC4A 1G01A 1UR8A 1WO2A 1QVBA 1J9YA 1UD6A 4Z2HA 2ZUUA 2D0GA 1CENA 1WZMA 1G94A 2GJXB 2W66A 4FNQA 3WL1A 1B30A 1UD8A 1XV8A 3T2QA 2YA2A 3ZOAA 1BF2A 1K9FA 3UR8A 2O9RA 1UKTA 5HXMA 4PTVA 3LPOA 1R75A 3EDJA 5HPOA 1QI0A 4R27A 3SCSA 5BRPA 4JL2A 1OD0A 3EYPA 5D9NA 1UR4A 4GI8A 1WDSA 3WUGA 4H8VA 1UR2A 3CHFA 4H41A 2DH2A 5EB8A 2WNWA 3MMWA 4WLCA 2YA0A 3VGGA 2XIIA 1EDTA 4M1RA 1E72M 5BXTA 1CXEA 3BLPX 3CC1A 1FP9A 4XZWA 5BROA 3PHAA 4L4PA 3WF4A 3ZSSA 5JUVA 3WD1A 3GM8A 4OOZA 4MDOA 1W1PA 2EPLX 3VD9A 1ODZA 2CEQA 3AYRA 3S2CA 5ABGA 2XVGA 1BPLB 3A22A 1CGTA 1VEMA 1LWJA 1WZKA 2J75A 7CGTA 2XJ7A 3DHUA 4FNTA 1TMQA 1W9BM 4CN6A 2ZWYA 3K8MA 2F7RA 3MSGA 4AEFA 1JYVA 2E9MA 1GQKA 3VDBA 4FLOA 1CYGA 3VVGA 3SCPA 4EK7A 3EJTA 3IJ8A 2J62A 3B9EA 1OINA 2VCBA 1WP6A 4ATLA 4MNLA 1LF1A 1WKYA 2VVSA 3T09A 1W1YA 2VQUA 3B9DA 3GXNA 2ZIDA 2RGLA 1KFWA 3N17A 1GNXA 2VO5A 4NZCA 3WMCA 2C0HA 4DWSA 1XSJA 3VSTA 5BYWA 1GUVA 3EJUA 4M81A 2BS9A 1ECEA 4AD2A 4AZCA 1OSEA 5HPCA 1JYWA 3W6LA 5FD0A 3VIFA 4FNPA 1H1NA 3FXYA 1W9VA 2WXDM 1R8LA 4HMEA 3A4AA 1EOMA 2J7BA 3HMCA 4PBGA 5C71A 1US3A 4ZXLA 4F9JA 3CZEA 3EMQA 3WNPA 2MANA 3LRLA 1QWNA 1W3KA 1VJSA 1R86A 2ZX8A 4IPLA 4U31A 3NSMA 1UH2A 2A3BA 2ZX7A 3GXTA 5CLTA 1WNOA 1HXJA 3TTQA 3PZGA 1KB3A 4AIEA 2XN1A 1KXVA 5F7UA 3GH4A 3WF1A 1MXDA 2NT0A 4U5KA 5LA0A 1D7FA 4P8WA 4E2OA 4Z2KA 5JIWA 1I75A 1PPIA 2VZOA 4OUEA 5A8NA 1DWIM 3SCWA 2WMKA 3A6OA 5AC5A 4IPNB 3DX2A 4NSBA 2WKGA 5FOOA 4B3KA 1M01A 1UH3A 2FHCA 1RP9A 3VO0A 3WY4A 4B9ZA 1AQHA 3BUQA 3MO4A 3A4XA 1BGGA 5LYRA 1FHDA 1ZJBA 3ARZA 4MTVA 1CNVA 2WZIA 1B1YA 2GVYA 2DT3A 4IUGA 4N42A 2Y8VA 3VIOA 2YIHA 1TG7A 1E6QM 4X9YA 1H11A 2PBOA 1UR0A 2HISA 4D6CA 4HOXA 1MYRA 1XGZA 4PMOA 3LPGA 3CLWA 2EPMX 3UEQA 2EO7A 4D6JA 2WHJA 2JEPA 3E1F1 4W87A 2XN0A 1NM9A 1CXLA 3W4RA 4B16A 2EABA 1KR0A 5ABFB 2J7FA 1ZS2A 1ISVA 1SR0A 1OIMA 1R46A 4KWUA 1XCXA 2QPUA 2IUZA 3F5KA 1E6ZA 4U2ZA 1C7SA 2D20A 3AXIA 3ZO9A 1E1FA 4OJYA 3GNOA 4AD0A 2CITA 3D51A 4QLKA 1ZBVA 3CH9A 2VR4A 3K4AA 3MS8A 2XSBA 2DEPA 4WKFA 3ZR6A 1R47A 1V6VA 4WKAA 3WF3A 4JFTA 1R7OA 2NW0A 4AEEA 2D73A 1KWKA 4A3HA 1E3ZA 4JFWA 3I3EA 3A47A 2OYLA 2V3EA 1UKPA 5D9MA 1W1TA 1E5NA 4EAMA 4UZSA 2WMJA 5A6MA 1DTUA 1GQJA 1TVNA 4PMZA 1M03A 2E8YA 1KBBA 1LJYA 3OGVA 1V0LA 1B3ZA 2WCSA 2JIWA 1EGZA 2G3NA 3UG4A 2WC7A 2JF6A 3VILA 5FL1A 1I1XA 2GUYA 1W9PA 3O9NA 1CWYA 1WPCA 2WHKA 4U3AA 4D6HA 1XYFA 5IFPA 1XH0A 1JZ6A 3KL5A 3CV5A 3D3AA 3VX0A 3AICA 1BHGA 4WF7A 2DSUA 4BQ2A 4OIFA 5JIPA 1OD8A 1K6AA 1XYZA 2WYSA 3BMWA 4W89A 1VFFA 4J3TA 1J0JA 5CZKA 1BLIA 3SCNA 4CVUA 1JZ7A 4CD6A 1L0PA 4PCTA 4ZFMA 2OW7A 5IHSA 3OGSA 4U3CA 5A6KA 4W8AA 1J0KA 3ARUA 1PIFA 2W62A 2VQTA 3T0BA 2VRQA 3TP4A 1NOUA 1U33A 5LA1A 5GQBA 3OBAA 1HWWA 4Z2GA 2YFOA 4PTXA 1FH8A 2PBGA 3RMEA 1O7AA 3KL3A 4PTWA 3BVWA 2GDVA 1QI5A 3WH5A 4LYPA 1W9XA 1I1WA 4ACZA 1E15A 5IXEA 1KTBA 1LLOA 1V6YA 2EADA 3SCQA 2E3ZA 2GDUA 1KBKA 4HZ7A 3WQ5A 1PEZA 5DO8A 1OM0A 4BQ3A 3N15A 5BXRA 3VSUA 1LWHA 1B31A 2VZUA 1O6IA 2VTFA 4NXKA 5BXPA 2X2IA 4ZE4A 2ZOXA 1G0CA 2OWXA 1E3XA 3CUFA 4HOZA 3WN6A 1GQLA 1BYCA 3M46A 4UQEA 4HA3A 3T2PA 1BYAA 2BFGA 5I2UA 4LXFA 1HKJA 3H54A 4A4AA 2V3DA 1E4LA 2UY2A 4W7WA 3F5LA 1CIUA 1H49A 5A8PA 2X2YA 2XM1A 3SUWA 3WSUA 4HP5A 5DFAA 4JCLA 4D72A 1EO5A 3I3DA 2PC8A 3SUSA 3GH7A 3N13A 3AS2A 4LYRA 2PWGA 3FY1A 3LXBA 4HZ6A 1QBBA 2CHNA 5FKYA 3LMYA 1B90A 4UCFA 1MVYA 1EOKA 2A3HA 4AZ5A 1SMDA 2WVVB 3ZSTA 2VRJA 1Q4NX 4NI3A 2CBIA 1ZU8A 3THDA 2BY2A 2WMHA 3LXCA 3K46A 2CKRA 2X0YA 3VNZA 2ZX6A 3RJXA 1QNSA 1C92A 2WZHA 2XPKA 1DP0A 1V0MA 3ZIZA 1R33A 1GOWA 3TOPA 1JD9A 2BVDA 2EPKX 2DSKA 1GOIA 3HN3A 5I24A 4PMXA 2WSPA 3W82A 1BTCA 3OG2A 3AXHA 3S5ZA 1TCMA 1HN1A 2CBJA 3AMGA 5M17A 3VDCA 3HG4A 4PCSA 3WD3A 2CHOA 2ALWA 2W5FA 2F2HA 3DX0A 2JFEX 1PIGA 3BH4A 2CPUA 1R7AA 4W7UA 3PZVA 2DSWA 4CD5A 3SCUA 3WD0A 1GZJA 1V6XA 1XSIA 3F5JA 3EMZA 1TA3A 3CZSA 1KQYA 5GNZA 2ZX5A 1C8XA 4D6DA 3A24A 3UG5A 1CBGA 3U57A 1ZJAA 3PZOA 4C7FA 3O6AA 2C7FA 1QNQA 3WH9A 2Y4SA 2VOTA 5LA2A 2WC3A 4EKJA 3I3BA 3TTOA 1M7XA 1QNPA 1UWQA 4CCEA 3APGA 5M03A 1JGIA 4AC1X 5HNNA 1V3JA 4MNKA 4BF7A 1D3CA 2Y8KA 2E40A 4ATDA 1LG2A 1V03A 4AD3A 4PN2A 3T08A 4QP0A 3BCDA 3D4ZA 1G5AA 4GIAA 3LRMA 3UESA 3BUDA 3UG3A 4XV0A 1H41A 5DEZA 4D6EA 1JXKA 4GINA 2Y24A 1B9ZA 2CYGA 2W91A 2E4TA 4GO9A 4AIOA 1B2YA 8A3HA 1YHTA 1RPKA 5FIPA 3WNMA 4PMYA 2YJQA 4GI9A 3WFZA 2NT1A 1UWUA 3KE0A 1HT6A 5CPSA 1GHSA 2WMIA 4UFHA 3AMKA 4PMUA 1W3LA 4GQQA 1HP5A 1UA7A 2W63A 5A69A 3VIKA 1UKQA 4ZEPA 1C91A 4JL1A 3U5UA 4UZUA 3VGDA 1UR9A 3WELA 1UZ4A 1E43A 2E0PA 1CTNA 2CXGA 3QHMA 3WKZA 2UY4A 1FA2A 1MW0A 4HA1A 5E6ZA 1W3HA 4V27A 4TTUA 3SUUA 1GORA 2XGIA 1J0YA 1UKSA 5HOSA 4PRWA 3HG2A 4FK9A 1G1YA 1KQZA 5D9OA 2J74A 3PTMA 3VDHA 4UOJA 1JNEA 3DDGA 1GOMA 1VEOA 4IISA 4AISA 5A6BD 3CPUA 2EBNA 2WLZA 1TQSA 1NH6A 5E09A 1SZNA 3WNLA 3G6MA 4KGJA 4IM4A 3IGUA 3VD5A 4D6IA 1AVAA 1KCKA 1IZKA 5I6SA 1UR1A 4F66A 1UUQA 1HJSA 1CLXA 3FNDA 3L4VA 3WNNA 2Z1SA 3L4UA 4W86A 3NSNA 2CKSA 3AIVA 1MW2A 4AZHA 4M24A 1L8NA 3M7SA 4TVDA 3VM5A 4D1IA 2X2HA 1CEOA 1PX8A 3AIWA 1C8YA 2Q8XA 2YKKA 3PZ9A 1E0XA 2XFRA 2OWCA 3WEOA 2PWDA 3N11A 4C7DA 1A47A 3VGFA 2FH6A 4Q22A 2J8FA 1KXHA 3MMDA 1R87A 3BUIA 1HKIA 2XFFA 2VX5A 1KXTA 1AMYA 3RILA 2ESCA 1MWOA 3CZLA 4CGTA 1EIBA 2FDMA 1ZBWA 4AWEA 1J0ZA 5AYBA 3ECQA 4W93A 1KTCA 4UNIA 1TFVA 1OT2A 1UA3A 1W2PA 1HF6A 2PWEA 3BAYA 5CSUA 1GONA 1HJQA 5EFFA 1PAMA 1B3WA 9CGTA 4HU0A 2F7QA 1UKOA 3WDPP 4GKLA 4R5EA 4MAZA 3WBAA 3BLBA 5FL0A 1Q6FA 5A8MA 3RM9A 3WQ6A 1CGYA 5ABHA 4AZBA 4Q7NA 1CLVA 1SYTA 3EJSA 1C8QA 4AZIA 4Z2LA 4NX0A 2XGBA 3AI0A 1HJVA 2IXVA 5GPRA 1ZL1A 1E6XM 3TTSA 1QHZA 4P8VA 3ARSA 4QLLA 2CCRA 1UD2A 2VI0A 3KLLA 1A3HA 1X6NA 1PJ9A 4PUDA 1W2VA 1JZ5A 1V0KA 1E9LA 5CPQA 3VD4A 4CCCA 3NDYA 3GXPA 3CMJA 5I78A 1E0WA 4P7NA 2E9BA 3RIKA 4OKDA 2J8GA 3W24A 4AW7A 2QLYA 1E5JA 2QF8A 4HA4A 4JKMA 5GNXA 3MSDA 4NRSA 2DT0A 2J4GA 4FNSA 4ML4A 1EA9C 5C8BB 5A3HA 4DM1A 3IANA 3MI6A 3A5VA 4QCEA 5BCAA 4DO6A 1NWRA 6A3HA 3QGVA 2XWDA 3QHNA 3OZOA 4JFSA 4ATWA 4OZOA 1NWTA 1B3VA 3ARVA 3NCOA 1QW8A 5CG0A 2J79A 5ABEA 1E4IA 2X2JA 2J25A 4CVWA 2PB1A 3W6MA 1SFSA 3WFLA 3DDFA 3VM7A 2WMFA 3WF0A 2BHZA 1CZ1A 4P8UA 3ZMRA 4DUVA 1ESWA 2F18A 1TR1A 4XZBA 1JL8A 2W92A 3WQ8A 4ACYA 1BG9A 4W5UA 2WC4A 3AHZA 1VAHA 5A2BA 5JBFA 3AZTA 2BXZA 2NSXA 3SUTA 1JI1A 1XH2A 2OSXA 3AIRA 1ISWA 3DYMA 4DWSC 3NIYA 3S6TA 3K8KA 3MUZ1 2VZVA 3B9AA 2WAGA 3W0KA 4TTGA 1DWGM 1H4PA 4K68A 2XIBA 4Y7EA 4UQBA 2XVKA 2VURA 1HP4A 2VR5A 1HVXA 1UD3A 3IAPA 5EMYA 4AXNA 3CIVA 1OGGA 5BRQA 1EDGA 1CXHA 1EDQA 3DYOA 3PTQA 4UFLA 1XHGA 3KLKA 2IXUA 1M04A 4JCMA 5CPTA 3OA5A 3W38A 3II1A 1C90A 2FE0A 3IAQA 3CBWA 2WW5A 4KGLA 2VCAA 2VNCA 3DX4A 1VB9A 5CXPA 4ZXOA 4ZE5A 1QI2A 1CECA 3W37A 4HPHA 1Y7VA 4P7QA 3VIJA 2W61A 2QHAA 1WDQA 2WWDA 3CHDA 2EEXA 4AIUA 3BGAA 3WNKA 1CXIA 1EO7A 4LPCA 3BVTA 1TQWA 1DWJM 3W53A 4AZGA 3GXDA 1VBUA 1GCYA 1NWSA 2WVVA 1UASA 4BA0A 4U2YA 3PZTA 3QR3A 3VMPA 5CLWA 4NZJA 3CMGA 1EHAA 1KGWA 5M5DA 3BVXA 3ZQ9A 3OLGA 3F4VA 3GH5A 3AYSA 4WJXA 4DUWA 1ISXA 3J7HA 4P7OA 4PMNA 4QFUA 1BVNP 2J7CA 1XSKA 4BQ5A 4D1JA 1WB0A 1FHLA 2AAAA 3ZR5A 2B31A 1V6UA 3AFBA 3WY2A 3PN8A 3HG3A 3VU2A 4EE9A 2F61A 4GPNA 1IV8A 1UWTA 1BSIA 1IT0A 3A21A 1JI2A 5KZ6A 2VUYA 2PWFA 4J3SA 5D8ZA 3CZNA 3SCVA 2D24A 1ISZA 3CZ8A 4NF7A 3SCRA 5BWFA 2FGZA 2EPOA 3BUBA 2XFYA 1XCWA 1QPKA 2VRKA 2XHYA 2YFNA 3QOMA 1U2YA 2DIEA 1TQVA 3VGHA 1CPUA 5A6SA 2FGLA 3AOFA 4L4OA 3VIMA 2VX4A 2UWFA 1QWUA 4AYGA 3VNYA 2E9LA 3WY1A 2J47A 4MNJA 1VBRA 1VJZA 2JE8A 2F1BA 1H5VA 3WNOA 2ZXAA 2YA1A 3VIHA 1KCLA 4KMQA 2GJPA 1JAEA 2W67A 1TUXA 2YL9A 2A3AA 3WEMA 3CHEA 3CTTA 2YLLA 4CU8A 2GFTA 2WM0A 2AOSA 1PS3A 2CIPA 3EJPA 2V5DA 1B0IA 1BAGA 2WZEA 3WUBA 5E1QA 5I3DA 4MB1A 1UQZA 2BY3A 3ZT5A 1KWGA 4FNRA 4RL3A 1NARA 3LX9A 2C8NA 3MV01 1JZ4A 4ACZB 1K9EA 2J7HA 3FHAA 4AY1A 2PWHA 3GTNA 4FLRA 4EANA 1JIBA 4JKKA 3D5HA 3TA9A 2CBVA 1QI4A 1LG1A 3WIJA 4URIA 4W8BA 3DECA 3L4XA 2DT2A 4WSKA 2O9OA 2X1IA 3EDEA 4OGZA 2GJXA 3HG5A 3VIGA 1JF5A 1E6NA 3BAJA 2EPNA 3EJQA 4UTFA 4C7GA 3KL0A 3MKKA 5A6BA 2HVMA 4CD4A 3BSGA 4AD1A 1KGUA 1UHVA 3L4YA 1PZ3A 4J3VA 4WIWA 2A3EA 2BHUA 4AZ7A 2EQDA 2OSWA 3WDQA 3MUY1 3ALGA 4QCFA 4TVCA 1ZB5A 2D2OA 3UERA 3DX1A 2ZUNA 3AQUA 1UWIA 4X0VA 1G9HA 3U7BA 2GJRA 4Z2JA 2XVNA 2WVUA 1CGWA 3BLKA 3VX1A 1V02E 2F7OA 4MJ2A 1DWFM 4BQ4A 5M3WA 2ZXDA 3GBDA 1R34A 5A2CA 2CESA 2G3IA 4YN5A 2RGMA 1V0NA 3KWXA 1J10A 1QBAA 4LX4A 3EDKA 4FMVA 1WDPA 2BVTA 3LXAA 4FLSA 4JHOA 1DWAM 1QOXA 2D23A 1GJUA 2CBUA 3CO4A 3GNRA 1QI3A 1MQRA 1T0OA 1KGXA 1XC6A 2DSZA 1O7DC 1V3KA 1PBGA 1ITXA 2XSAA 1BQCA 3PZQA 1UWRA 1WDRA 4YHEA 3NYDA 1BFNA 3M6DA 3ARRA 3AIBA 3L4TA 1XH1A 1HTYA 4M80A 1CDGA 1JF6A 2G41A 4W88A 5A94A 1WZAA 4N0RA 1K9DA 4BZYA 5E9AA 3BUPA 5BXSA 4OBRA 3WQ4A 4DO4A 3AIQA 3BSHA 4D6FA 5A1AA 2BVYA 1W1VA 2QMKA 2PF0A 3AHXA 1TVPA 5DT7A 5A95A 2W4XA 1VF8A 3N9KA 2D1ZA 4B3LA 1AQMA 2G8ZA 5E70A 3ARQA 1E56A 4CU7A 3HJEA 5CGTA 3U5YA 3ZJKA 5I5RA 1FFRA 4D6GA 3WF2A 1TQTA 4HTYA 5I77A 3EJRA 3THCA 2QMJA 2BXYA 5I79A 1MW1A 3GXIA 4RE3A 3SCOA 1E4MM 2XG9A 3S5YA 1HL8A 4BS0A 5HDRA 2WVSA 2F7PA 3WDIA 1GOOA 2VVNA 4CN1A 3L4ZA 2EXOA 4Z2IA 4J3UA 2YL6A 3W27A 4UQCA 2D22A 4PSRA 1HVQA 1FFQA 1W3JA 3FAXA 1KR1A 3OLIA 1VFOA 3L4WA 1V3HA 2VT0A 3ZJ8A 4GO8A 3T2OA 3OB8A 1EHNA 3ARYA 5AY7A 4AMCA 2EACA 2BHYA 2WMIB 2WB5A 1GPFA 1MXGA 1Q6CA 5DT5A 3ZM8A 2XN2A 1JDAA 4M56A 4H8HA 2D0FA 3BCFA 1OGBA 1X1NA 4S3KA 4TUFA 4F9DA 2ZUMA 3CZKA 2BV9A 4S3JA 2J78A 3B8SA 3VSVA 3ZT6A 1E6SM 2ZWZA 2WBKA 4MB3A 1NOFA 3AIUA 3IK2A 3WENA 1UD4A 4XB3A 4GZEA 3CUIA 2BY0A 1WCGA 1FH9A 4CD8A 1OIFA 3CUGA 1MFUA 4DM2A 4BCEA 3CUJA 1QNRA 1HKKA 4GZJA 4AMWA 2VX7A 4OBSA 3PZMA 1NWUA 2Y5EA 4W8LA 2X09A 1UD5A 3MU7A 4AD4A 1W91A 2O9PA 3RM4A 3WQWA 1VIWA 4MNMA 4M82A 2X0HA 4YHGA 2XVPA 4MAVA 4CCDA 2XTKA 2J7DA 5E0CA 1CXKA 4F79A 4AMXA 3UETA 1US2A 3WH6A 2AMGA 3EBVA 3FW6A 3WQVA 3TV8A 3VUPA 4V2XA 4UOQA 8CGTA 4J3WA 4PUEA 1MFVA 1H09A 2WSKA 3JUGA 4A3YA 3GXFA 1MQQA 2ZUSA 4PMDA 5I23A 2J7GA 3WEZA 2D3LA 4AYSA 2DDXA 3T0AA 3PZNA 4W85A 4HU8A 3BAXA 4J28A 4LQ1A 4JFUA 2F8QA 4JZ5A 1ISYA 1NQ6A 2V38A 3VMOA 2ZXQA 2YL5A 3D4YA 2D0HA 3WH7A 1J01A 4W5ZA 3AROA 3AHTA 5EBAA 4KRTA 1FOBA 4H04A 5D4YA 2ZE0A 3K1DA 4QAWA 3QHOA 5CSYA 4MJ4A 3UCQA 3CGTA 3EDFA 5ABFA 1CXFA 4MB4A 4MADA 1CGUA 1H0GA 2GK1B 3RPMA 4RE4A 2DSVA 2WANA 1D2KA 2ZUTA 1QHPA 2V3FA 4FLQA 3WH8A 6CGTA 5E6YA 3WUFA 3AHYA 1BYDA 1H2JA 3T0DA 1XD0A 3OGRA 4FF5A 2ZUVA 4NXSA 1MW3A 2BNJA 5E0FA 2JIEA 2F1AA 3KEHA 1GHRA 4E8DA 3WMSA 2ZX9A 1E40A 1GVIA 3ZJ6A 2DIJA 2YLAA 2OLHA 3A3HA 4UFJA 4LYQA 4HMCA 4H7VA 3D50A 3BAWA 3ZT7A 2YDQA 4PSPA 4GI6A 1V3LA 3N1AA 2G3JA 3H55A 5GNYA 4QDMA 3AZRA 2JEQA 1GOKA 3RCNA 4UQDA 3SURA 1RP8A 2ZUWA 1V02A 4PTMA 3N18A 1HIZA 3LPPA 2WBGA 4RE2A 1VFUA 1PX3A 2WMGA 3VIPA 1ZBCA 4TOQA 3ARTA 1W32A 2DQXA 3VDAA 4PMRA 3ALFA 1SMAA 2WHLA 1TA3B
chains in the Genus database with same CATH superfamily
3ZJ7A 5A8QA 3ZLQC 2XN9A 3IDMA 4XI5D 1ZANH 4ALAC 1HCFX 2I7GA 5ICXB 2ZE3A 4LCVA 4A3QA 2PETA 1J05A 1TTFA 5DJ8B 1CDHA 2R0ZH 1Q0YH 1QX1A 3ZRCC 2VR7A 3WJJA 1SN2A 3MUAA 1F4AA 3CUHA 3NO5A 1K4DB 1KIUA 1BRLA 1R85A 5MEOA 4JHZA 4P2CG 1H7XA 2FQFA 4U6VH 2C1GA 3T3ME 4DP0X 3RL2A 2X4RB 4JTEA 1FYTA 1MHHA 5CIPA 2ICEB 3FOLB 2H8PA 5EC2A 4P9HC 3UGEA 3CN3A 2OMXA 2Q7YA 4WKHA 5JW5A 2P5WE 2CLMA 2GJNA 2I07B 1GZQB 4ORMA 4PRHA 4Q6IB 1TZZA 4PEEA 4UTHA 3TU9A 5I1CL 2F54A 3QFJA 3QIBD 4HT1L 1D9EA 4HPGA 4J3ZA 1OHZA 1FVCB 3F7QA 2CJUL 1U8IB 4N0CC 4GEIA 3R79A 5ERWA 3IF1B 4C4KO 2OQJB 4IMAA 1JNLL 4YSRA 5DC4B 3G1RA 3WJYA 3SEPA 5JYMA 4DHGA 4P3DB 2PU1A 2XIQA 4XAPA 5GIRB 5H8UA 3VGAB 3LD5A 2VC2L 4AYDC 1TJIH 1KIPA 2QADB 2EVIA 3D39B 4QRUB 1F2XK 2PP1A 2I25N 3IIXA 4W84A 4QRRB 4F0SA 1ZALA 4XTDA 3P4OA 3M44A 3EWZA 2AQSA 2LFEA 4CQDA 2PDCA 1CT5A 1IM9A 2E7HA 4TX6A 4N90E 3PZIA 3G9AB 5MF5A 3V0AC 3DUHA 4EDWH 4X6CB 3CFJA 3HZ3A 2WLJA 3M0IA 4AH2A 4HIQA 4AVNA 4YHNA 4AGNA 1Q0XL 1J5TA 5KYYA 2H6UA 1I1CA 2DWSA 1INDH 1I3GH 1EFXA 4XGZA 2GY7B 3O6CA 4US5D 4AB4A 4NBZB 3RZCB 3CUPA 3POHA 3VI4A 3ZYZA 3O2VL 3NZ1A 5DS2A 1CLKA 3T42A 4MMZB 2XISA 1U95A 2ARJA 3FFDA 5E8OB 3B0PA 4X6DA 2V5RA 4N2IA 4S3FA 5LNSA 3HU7A 3DIVA 2A83B 1LMKA 4QI3A 3U2SB 4F7EA 1DVJA 1G4TA 1Q45A 2YZ5A 4YSOA 2PCQA 3MUIA 2CO6A 3DRTA 1SEBB 5IBLC 3QI9C 1T2QH 4YBQD 4XC3H 3H2OA 1A22B 4PMQA 3QEGH 4X6EB 4TVUA 3SDDB 3NQCA 3TVMD 4O11A 3C56A 4A05A 4BFAA 1DV7A 1R2RA 3PUUA 1OPGL 1OBAA 2EXYD 5AZ2H 2PTDA 3VOHA 3KP1A 3S96B 4IJ3B 2PZ0A 5DJ2B 3BZGA 4GUOA 1MLCA 3WUWG 1YC7A 1IR1A 5F44A 3NSXA 2HA1A 1AGEB 2PDXA 4DJED 2PP7A 4FQLH 4JRYE 3ZK0A 4DWSC 2XY1A 1YPZA 3KOWA 1ZIBA 1B2WL 2COQA 4F57L 3U0PB 1YPIA 4FQXA 4FSAA 4JPGA 1KBPA 1HX0A 3O8AA 3HOGA 6FABH 4IMEA 4Z3HA 2XRAL 5DANA 2OT1A 3WLOA 1K7EA 5ITFA 1ZPTA 1T96A 1M65A 2G3MA 8FABA 1XLMA 2P0OA 4EXAA 1F4YH 2HKAA 4XZNX 2ICWB 4FG4A 2Z1KA 3NA9H 4NN7B 2GK1A 3OIXA 1B3JA 3EX1A 3N34A 3ABGA 3L3KB 5JVLA 5I9QC 1E70M 4KH2A 5DU7A 5L8LB 4MMWA 2VC6A 4P8XA 1JWSA 4AAJA 4M7KL 2GSJA 3PBGA 1CLYH 3ZTNH 4X7SL 5JH1A 3VXQB 3FQNA 4EDXA 1HSBA 3QSRA 3MBXL 3THML 3UBXA 1RPUA 3O9WC 4P4KB 3WHXA 1WZLA 3O11A 1QU4A 4JUTA 4K8RC 1LP6A 3ULUD 2GUOB 3CZJA 2JXMB 3RDKA 3V5CA 4FXRA 2CHRA 3BWUC 3PF3A 4EAEA 3U0PA 4DJFC 4GRLD 2RA1A 4YN5A 4YHKL 5FYLL 3MV11 4Y4KD 1JFHA 4KNQA 2PDYA 4Z7WB 3LN3A 3MMUA 8FABB 2GSHA 2PPAA 3U4BH 3AMLA 1NBVL 1ZRQA 1PCSA 3RWCA 2Z6IA 1WAWA 1JYXA 3EWWA 5ELIA 1DZ0A 3GY1A 4GZIA 2X8RA 4QKTA 3ORWA 3D85B 4DOHE 2RAGA 2OR9L 4O5LL 4M5ZH 1BG4A 5GJSH 2NVAA 4UM9D 2NLJA 2UVEA 3O6FB 4NNBA 1GQIA 3DURB 2WIMA 3N29A 1CGXA 3F01A 5F70A 3NIGB 2NY3B 3P6LA 3RAJL 3G3DA 5DJAB 2GIXA 2Z64C 2FYYB 4UM8B 4C58B 2OX1A 2C7UA 3KBHE 2VZTA 4J7RA 5D7IF 4B5UA 1J11A 3N4EA 4K4KA 4U1MB 1VKXA 1UJPA 3AO0A 4M4RA 1NP0A 2DMBA 4QYOA 1TZ7A 2V5CA 3MLUH 2BS71 4CRPA 4C65A 3CFDA 1J8HE 4ZENA 3VTMA 2ZKHH 1Z5LA 1AGEA 1IAOA 2IGFL 3C6CA 3H9SE 3MJ7B 1UZDA 2MUCA 3V7AE 2YC1A 5I66B 2WPGA 3GIZH 3M88A 4Z08A 1DVFD 5JZ7C 1OZQA 1JE6A 3H9SD 1UWAA 2VDKB 3GWJA 5F9WC 4D6DA 4R7OA 1JXJA 3EJZD 1NGQH 3FSWA 3LKNA 3MC0A 2DZTA 2OKOA 5D37A 1OANA 5DHVH 3TQVA 3VAEA 1G5GA 2OMZA 2N4IA 3LZQA 5F7DA 4L5FE 2VC2B 2BOFX 2FEEI 2FHFA 1DFBH 1VFAA 1WBXA 1E4JA 1GPOL 2J7LA 3LV3A 3Q1EA 4M6AA 1OYBA 2XXFA 4YXLL 3GXMA 5AOIA 3QIUD 4IBLT 4JFPB 2XPGB 4OFYD 1R30A 2ICES 5DRWA 3HS8A 3TNMA 2VISB 3G04A 4PPTA 2Y25A 3HNSH 4P5KB 3MJ9H 4M8UA 3A3YB 4Y8AA 4O1AA 1C5DB 2VL4A 3L9RA 4K2UL 2QGHA 2GQ8A 1H7WA 4G6FB 2VDIA 3TKFA 3WDHA 1MZZA 1WICA 3SKMB 4H1LH 3DSNA 3KH4A 4QM1A 5I66A 5I82A 2PYEE 3W7DA 3BYTA 3MRRB 2XYLA 2OSYA 3W1RA 4YTTA 5D2VA 2LABA 4J4PD 1CE6B 1OYCA 1V3IA 3VABA 4O1BA 5F72S 3HRZB 4JANB 3MFFA 3O6KH 4PRAB 2VDQL 1E5UI 2WO5A 2YCIX 1M7UA 4QTIL 3V0WL 4HGKC 3UBPC 1RMFL 1JD7A 2L7JA 1K5NB 4K71B 3AS0A 2WOBA 3NNTA 4OVUA 4HZ8A 1IKNC 1E6RA 4N2LA 2JKAA 2ENPA 3L7FB 4QJ4B 1JCJA 1XLBA 3EYUH 2XIJA 4BCZA 1E9OA 3BKJL 3QDGA 2OL3B 1XD1A 1H8SA 5IVOA 2Q7NA 3S4SA 3W25A 4ZDHA 1A9EB 3OZKA 3PNWA 2ZKMX 3NQDA 2P3EA 3MBEC 1KY7A 4CGUB 5E9DD 5K1VA 3I50L 4P04A 1Q65A 2X5PA 3EXRA 4OCRL 1GYWA 2Y6SD 4X61A 3O6FC 1CFNB 1NCBH 2JH2A 4FQCH 4J12A 4XNYH 1BVOA 4I88A 2CMRH 4K2SA 4UR9A 2BW5A 3BN3B 3MP3A 1JK9B 3NIGF 1TJ2A 3KDMA 3X12A 2WWCA 1YUHB 2GK2A 1ONQA 2AXGA 4DIAA 5C0QA 6TIMA 2Q76B 1Z5LB 4KK9C 1FZJB 5IBTH 3LRKA 3WOVA 1M1BA 2P3ZA 4NJKA 3GI8L 4Y16A 4LCUB 2CXKA 4JKLA 1XL6A 4X2UA 4AYMC 5KYNA 1N59B 4GQGA 4JDTL 3RURA 3BHBB 1RZ8A 4H2CA 1MCQA 4JHVA 2Z27A 3TA6A 4OFDA 4HS3A 2OWWA 5C0CB 5EZOH 1LYQA 4O51B 2PP0A 3QTPA 4HZLA 3OLEA 4U1KB 3FTZA 2EIBA 2VJXA 2DT1A 2VDMH 2QSVA 3JZ7A 1F86A 2I5QA 5ICYB 1YNQA 3DYPA 1OF6A 2AJSL 5IQLA 5A6JA 5D7KE 4LSSL 4A7VA 1SY6A 5J4MA 1O5KA 1NEUA 4XZMX 4AWSA 5HJGA 4BWUA 1CGVA 4A22A 1QSEA 3MRQB 4KK6C 3ABQA 3VINA 2E6JA 1PJWA 4NLHA 4DJDC 1NEYA 2ZQ0A 3ULVE 4YFLF 1A14H 2Y36L 3BK0A 3MLSH 3SAZA 3QO0B 4XMKH 2P10A 2C16A 1KRMA 3GMPA 3GDBA 3WMPA 3WD4A 3CWGA 2WOQA 1YBQB 2VC9A 2Q3OA 2CZEA 5KW9L 4PMVA 3Q2DA 1WIUA 4Z8FL 3ARWA 1RJLA 1SLVA 5I8OL 3H2AA 2DM7A 5F4XA 2CZ5A 4FHAA 4YS4A 2OGYA 1RY8A 8XIMA 4ZFOB 4N0UB 1HYRC 2CUAA 1Q6DA 4LEXH 3S48A 3U7WL 3EDDA 3Q37A 1ZSDB 4GSRA 4I3RL 1TENA 2NNAA 5A2AA 4L61A 2CR6A 2L0DA 2E7BA 2EP6A 2MJWA 1IGIH 2ZOUA 3FN0L 5DZLA 4ZO7A 3TNNA 4OF6A 5I0DA 3T05A 3WF4A 3SJVE 4YSPA 3O3AA 5C08B 1B4TA 4G8EA 5C2XA 1AXSA 1DCEA 2W9DH 2UWEE 4YPGB 4C6OA 4PRIA 3BG9A 4MRBA 1RD6A 3X2QB 3KWTA 5DHVB 3RWJB 3LHYA 4W70A 1SVDA 3VKKA 2Y5JA 4G8GA 4YVPA 4WFHD 4OQ1A 4XCCL 1W9UA 1AQ0A 3RO6A 4UFKA 4UR8A 5KS9A 3VNDA 4GQZA 3GS6A 2OCJA 1VLXA 3MGTB 3DC0A 5T1KA 1IQDB 1TWZA 1IC7L 1OZTG 2GCYA 3LB6D 4DO5A 1KB5L 4X5PA 2WCAA 3VPLA 3HBZA 3AMCA 2BXVA 4PVBA 4IOTA 5H2BA 2HKHL 3EAUA 4EI6A 4HUWB 2EZ0C 3ABLB 2UY7A 3PWLA 5C07B 3RTQD 1DBBH 3TA3B 5I73C 2A3CA 1FJ1A 3LEVL 4LLQB 3RI5K 4ZFQA 2ZSWB 4ZOCA 5J06A 3BMXA 3OAYK 6TAAA 1GGUA 3L3DB 4UM9A 5EU5B 4P59H 1P7TB 2JKXA 3RDTA 1E30A 2MQ3A 2RHGA 5C0BD 1XDMA 1Y18B 1PDZA 4KKBD 2WMPA 5DFVD 1ICPA 1GW1A 2V3GA 2G60H 1HOCB 1OOWA 5TQ2L 1UEYA 3WH9A 3KJ4B 1HWGB 4Q2ZB 1SLWA 3US0A 3GUWA 5FACA 3Q3GA 3MRHB 1HILA 3JZEA 4OCYH 2VWEE 4EUPB 4E68A 1LDPL 1I9RH 4G9DB 2Z3FA 2X6AA 4NIKB 4YBLC 4YLBA 5TDPB 1U3NA 4S2BA 2VCOA 5IFTA 1K6QL 3QXAA 4N8CH 4TNWF 2R24A 3WUEA 3BI9X 5I1KH 3MV9B 4GXUN 4MVBD 9XIMA 2A77H 2P0IA 5I1CH 1BFSA 1SXBA 2EIZB 5DSCB 4YBLB 7PAZA 5MERB 3LA4A 4J9JA 2YMTA 3P9WB 1PZCA 3GVGA 4S39A 1IE5A 1KCXA 1MWAA 5HYJB 3QDME 1E4XL 4P8QA 2FR4B 1J9YA 2CLLA 3D2UA 1F6FB 3PLYA 2D7QA 1G9MC 3HZKA 4TF4A 3EFOB 5C0ND 5MEQB 1PVHA 2GBTA 2R2HB 4XNXL 1CENA 4IP5A 3TH3T 3AG1B 5DS8B 1G94A 3BQUA 3CBJB 5AYZA 4ODBD 4FXKB 2APWA 2Y7LA 4Y4HB 3MT1A 3WL1A 1ED3B 4NKOA 4S0TD 4FC3E 1B30A 5BV7C 2RTTA 1QLFB 2OMWA 1OCZB 2WO2B 1XLDA 4C6QA 2RGSA 2VXUL 4FCAA 5H4ZA 1IT9H 1KLUB 1FWIC 5D9SB 5CPNA 2HFFA 2YA2A 5E23A 4NERA 4ZQKA 5C9ZA 2PRHA 1K9FA 2VDRB 3U36A 1ADDA 3RU8X 3IFPB 3DG7A 2IH8A 2O9RA 1UKTA 3T2NH 1HIML 3R4RA 4PTVA 4HBKA 5IHHA 3EF4A 5AOZA 1T03H 4KKQA 4HC1L 3OVPA 4R27A 1S9WA 4DQWA 1VA9A 4OECA 1K7FA 3O2VH 4QRQB 3G1SA 5D9NA 1GKEA 2D7NA 1T89A 3B9KD 3U6RB 4IUOA 1KEGL 5BUGA 1TYGA 1CFSA 4H8VA 2R7EB 3DPBB 4UB0L 2DH2A 1CBVL 2WNWA 4HUVA 4U6HA 3PWLB 5F3BB 1PHQA 4JGJA 4Y16C 5DS8A 3SGDI 3OKLA 3B2XA 3MMWA 1LP9A 5D96B 4WLCA 4PFHA 2R1XA 4TQPA 3VGGA 2XIIA 2V2WA 2RH0A 4YSSA 4JTRA 3MCG1 5FB8B 3NQ2A 3CC1A 3BLPX 1THAA 4JFFB 1I8MA 3OP2A 3M6YA 4UTWA 3KDOA 1JK8A 4LUSA 4L4PA 2W60B 1A3WA 1URIA 2DYPA 4I8DA 1JCKA 4YHIB 2BNQB 3IU4L 5MEND 4XBGA 4BGLA 4UM9B 3FS9A 3AM8A 3LRSA 1POJA 3NSYA 2FTPA 5LGYA 3TWCH 4MDOA 2YSTA 2EXWC 4XPHH 4F91B 3OM3B 4DP8X 5DR5H 3HAEH 5I0VA 1AC6A 3UWUA 5M1TA 4NOFA 5AVTB 2A3LA 2CEQA 5EUKB 4AC2A 1KCUL 3V4PL 3MRHA 3FKRA 2X1PA 1G0XA 2W8CA 4CL7A 5JMRA 3KW8A 2GEQA 2CFFA 3GG1A 3A22A 4OD2B 3TVMC 4EQ2A 1A25A 2XKNB 3D0LB 3P5YA 1RFDH 1TZAA 1WD9A 4MJ6B 5DGRA 5GJTH 2X38A 5KANG 3REWA 1MHHB 5JW4N 1EBHA 1VP5A 2Y0FA 2OJZL 5HQLA 1F1DA 1ZXKA 2QDEA 2EXYC 3C8FA 5E6ID 3B04A 4D2JA 4B3EA 3HW7A 2H0EA 3NCBB 5CZTA 1BJMA 3UIZA 1A5UA 1S38A 3E2VA 3IJYB 3KPPB 4XPTL 5DI8B 5DEGB 1M9WA 1TMQA 5HI4C 1W9BM 4XISA 5KVFE 5IR1A 2AEWA 3EGXA 1D5BA 3CTLA 4DP5X 1IGWA 2F7RA 3LRSB 3T65A 2FFCA 1FO0H 3BDYL 1CB4A 4DK5A 2E9MA 4JX6A 1CTOA 5FGCE 3LS5L 5DLLA 3EX2A 5BU9A 1YJDC 4RAUB 1E9ZB 2EDKA 1AS7A 1YHPA 2OCFD 2ZCHH 1BECA 2PF6A 4HCRH 3VDBA 2QDWA 3RVWC 5DY2A 1EJ7L 1KNWA 2EICA 1Q7MA 4R53A 3EJTA 4EK7A 2ZAIA 2OJPA 5LIWX 5EC1A 3EYOA 1URZA 2G9KA 3DX5A 1ZEAL 5F1NA 4Z7AA 1KV5A 3QV8A 3BWAA 3WEXB 2P8LB 4HEMA 5GGTA 4RISL 2IFGA 1OINA 2VCBA 4HAGA 2BCMA 1BXVA 2E27L 5DQ9B 4E5XG 3K6SB 2TPSA 2OKMA 4MUPA 1DANT 1HSAB 2Z7WA 1H3WM 5IESL 2IBGA 3ELAT 2JCWA 3LCYA 5DJ8A 2FB2A 1TV8A 1PSKL 4JS7A 5C0BB 2JK2A 2FWOA 2VQUA 3RJDA 4LVBA 1W16A 1RHCA 3D47A 3GXNA 3CX5J 3OKLB 4GVHA 1PCXA 4I8YA 2Y7OA 4JD4A 3HNVH 2RGLA 3GNXA 3BW9A 3LKOB 1XMEB 3PQYE 4UQ2B 5I16B 1BZEA 1GNXA 2OVLA 5F1SA 5IVZA 5KBLA 3WMCA 3HG1D 1KC5L 3AVEA 4UTKA 1XYLA 1S2VA 2XFXA 5CZVL 3PJWA 5EMMA 1BXXA 3FRUB 3JTSA 1G7HA 3U2SA 2NX5A 1CICC 1OC7A 1XQKA 3D9AH 5D55A 3S5LB 3CH1A 3N25A 4CQBA 4M81A 1A5FH 1MEXL 2BS9A 1Q90A 3C2AL 3VVVA 2R39A 5FW8A 2G3XA 4QHRA 4LSVL 2GFBA 4RX4A 3FFCE 5FYJH 1G7MA 1E8ZA 3SQSA 4MJIB 4AZCA 5EH1A 2QR6A 1CLOH 2R2BA 5KVGH 4DKFL 3W6LA 3KPLA 5TIMA 4FHKA 1OC5A 5GIRA 2QCMA 2ZBTA 3ECBB 3Q5YA 1XS2A 4ZS6D 1CD1A 4UTIA 4OZIA 1TZGL 3HE6D 4OD2A 1V05A 2X4UB 1NFKA 2ISFA 4FNPA 4QXGH 1IM3D 1W9VA 3IEAA 2OX5A 1ITBB 2GBVA 3RMJA 3V6ZA 2ZVIA 4D9QE 1DVQA 5LHFA 1OAQH 2OMYA 3LGDA 3NP3A 1QFWL 1PD0A 1W3KA 4UBDD 2NUWA 3S2MA 2FTYA 3UZZA 1TLMA 3RFZC 4HIXL 3D3VA 5GSVB 3CZFB 1E6OL 3N2TA 2ZX7A 4WW1B 2VKZG 1A5BA 1AGFB 3VI4B 5KVFL 1OXYA 4EXPX 2AK1L 5DTFB 2I69A 1QEXA 1Q2SA 3W2NA 1F1GA 3X1GA 1D5IL 4CC4C 5GJMA 2DQTL 2A3TA 2EH8H 4X7EC 1DLHB 2X53A 3FDWA 3MODH 5CLTA 5B1KA 4OCWH 2FWSA 5CBIA 1USQA 1HXJA 2K0RA 1KB3A 3D69B 3RVVC 4AIEA 3PR2A 1R3HA 2DW6A 1XCTB 5EORH 5FLUA 4X4YA 4D0CA 1ZLWK 1V51A 4HYWA 2ATMA 4Q4MA 4PJXF 1EEYB 1H9DA 4I4WB 2GJ6B 4U5KA 2VLLB 5LA0A 2VE6B 4E2OA 2IALA 2VZOA 5A8NA 1HZHH 3K6FA 2BP0B 3SCWA 4TNVF 4YL9A 2B59B 4YVVA 2V9TA 4MCMA 3REQA 4B3KA 4MYXA 5G5DB 3JTBA 1Q6LA 3OMZA 2XWBA 4MTMA 3VW3L 1Z44A 3CNYA 4JY6B 3MUCA 2YAMA 3KWUA 1K5WA 1XIJA 4B9ZA 2PLCA 1AQHA 5AAWA 3NSJA 2V2DA 1ACZA 5HI3C 4JPIB 2ZG2A 2FSEA 4F2MB 3CWOX 3BW9B 2WQSA 2BOBA 1ZCRA 1T20A 3ARZA 4MTVA 3W6YA 2WNGA 5F7WC 3CHOA 5KYXB 1K03A 4ODXA 3VFWB 2P5PA 4APXA 4M51A 1WTGT 1IX2A 4HJ1A 1B1YA 4MZIA 3KGTA 1T1ZB 2P42B 2KYIA 2A9BA 1B5TA 3L5LA 4MCYB 4PJ8A 5ICXA 3VIOA 1F4WL 4X0KA 5IJVB 3OVQA 4L8BA 3R4DA 5ANHA 3V0GA 4BM7A 4D7PA 1H11A 4PCKA 2HISA 4X6BA 3IRZA 2G9HA 1MYRA 4RNRB 4TQ8A 4XPGH 5D04C 2BNRE 3ZDWA 4N0UE 3U25A 3VA2C 2VDML 2BZNA 3CLWA 1XG3A 2EPMX 3UEQA 3MV7A 3QUYA 4XXWC 3TA3D 2RDTA 4XCNB 2EDBA 2RFGA 3NZGA 1NLBH 2O30A 2PWVA 4AXKA 3M5ZA 4Q8NA 5E6IB 5ISZB 2FD6L 3QQDA 1EJRC 2JEPA 4KFZC 1KJ2B 4WGHA 4X63A 1F42A 3UJIL 3WG7B 4BFEA 2RD0A 5F3BA 5ENLA 1BYPA 3W4RA 1VFBB 2Y36H 4B16A 1FCQA 4N8VA 2IF7A 3AC0A 3HVNA 3D46A 4NYYA 1NOLA 1OSPL 3ESVF 4I3SL 1R5IB 3HMJG 3AT0A 3H70A 4HT1H 1U42A 3IJSA 3SE9H 1ISVA 3O3DB 2OJ1A 3LEXA 2W0FA 1AQ8A 4KWUA 2B77A 1H3PL 4OLYH 2XN9D 1R4XA 3CFQA 4E0RA 5I8OH 2AGKA 2QPUA 2VC7A 3TBVA 3ERPA 3F5KA 7REQB 1FNSH 5A2IH 4EE2A 2D20A 2VR3A 3O81A 3BWZA 3P84A 1KW1A 5DRZB 1RZFL 1E5YA 1U8CA 1AH1A 4LEXL 3GNOA 4FX7A 2KZ1B 4Q4PA 1IIKA 3CT7A 3DURA 4I3RH 4QLKA 1UUMA 3PFQA 3FN0H 3MLZL 3CH9A 1REIA 5G55A 4HEME 4JY5L 4MNGA 4NC2B 4AJWA 1LQSR 1BVWA 2XSBA 1DBJL 1AJ0A 4TR9A 3WSQH 1JPFB 1J1XH 5FYKE 4HUXA 4N6FA 3GNNA 3RDJA 3C6LA 1FAIL 1ZT7B 3NJNA 4WKAA 3F7JA 3H24A 4JFTA 1SLUA 4QYOB 3RWDA 2Q3ZA 1IB5A 2BP3A 5I75C 4H9YA 2OMBA 5EN3A 3URQA 1KPRA 1WEJH 2VUNA 2CR0A 3S47A 3WLQA 1NDGB 2WOYA 4NQTA 3FJTA 2IQ9H 2D9QB 3CK5A 1Y07A 1IGTA 4X6CA 5HYQB 3ANVA 2NQZA 2YEZB 2Z8WC 4NWUH 4XVUC 3US1A 2G2NA 2OYLA 1UKPA 3DGRA 5EF0A 5D9MA 2P46B 5F7YC 1W1TA 3P3RA 3FTYA 2GBUA 2LV4A 3OTTA 5HYSG 1ZHBB 1Q9KA 4ELMB 1NJ9B 1PZBA 1PS9A 1S5TA 2XGZA 4F8NA 4GZ7A 3HE6C 3LV3B 1NCAL 1LTXA 1RVFL 4TVPD 1GQJA 4F7CB 4R2GB 1QG3A 3OKYA 3QQNA 1UACL 2N7BA 2NZ1A 3OVGA 4LAOA 4RK8A 4FFWD 2Q86B 1OPGH 3GSNL 1KB5B 1V7NL 3FQ2A 1TX2A 3R0DA 5KSAB 2XWJB 3TXZA 4UR7A 1KT2B 2XBZA 1LJYA 5A3ID 1P5VB 2WCSA 2PLTA 3LMJH 3MNZA 1JN6B 3ZGIA 3L9BA 2VN5A 3UG4A 2JIWA 1IEAB 3HQ1A 4QF1A 4Z76B 4E9SA 5EBUA 4FQXB 3HQOA 4R5VA 5KZCD 4XVDA 4JAMB 4FR6A 3QNXA 2NY5H 5G1YA 5H1WA 1I1XA 3EXTA 3CHPA 1S5NA 2I5YH 5TE4L 4Y9AA 2GJ6D 2XRAH 4WHTA 2ZCLH 3C6EA 1UGKA 3L3GA 2PD5A 2YAEA 3G5ZA 1MFDL 4M62L 1FG2A 1G9NC 1XH0A 3NJXA 5ECJE 2KPWA 3KL5A 3D33A 3CV5A 2PTZA 1XGUA 3U9UB 2OL3A 2YPLB 3W70A 3H6OA 3VYLA 1A7OL 5F8QC 5FYJE 4MZ8A 3UJJL 1PBYA 3OEXA 4AM0B 3SPIA 2GDQA 1UXLA 4PJFA 4XAFA 4K8RL 5JIPA 3BH8B 3MV9E 3ZTNL 1OD8A 3L81A 1MCJA 3ET9F 1XYZA 3QZOA 2CJ3A 3ESUF 3FB6A 3KVKA 4J3TA 4OR1A 5ETUB 1DVYA 2OG9A 2A83A 2F58H 4YUEL 1JZ7A 1CO1A 4HSAC 4C56D 1AZ1A 3LUTA 3NOYA 1WC7A 3WIIH 1YEYA 1YDPA 1L0PA 2IFFL 5K9QI 1J1PH 4ZBJA 3AWFA 2NPLX 2FVKA 1XGQA 3FMGL 1DIEA 1KV3A 2FLBT 2WUCH 2FMNA 4Z7WA 1H3VA 3IFNL 2JB5L 1E51A 2OW7A 3RJQB 4TVSa 5CFHA 1GQNA 3VWKA 1J4EA 1EZSA 2IH9A 3JBG7 3K0WA 4GXUM 5EZJB 3GTFA 3U4BL 3SCMA 4JZOB 3WMQA 2EE6A 1HIMH 1MIMH 2D2GA 3I6TA 4PRIB 5C97A 1T5XB 3MUGB 1ES0A 4HC1H 4QJ5B 1N4XH 4B97A 2V2CA 2HT3C 1NOUA 4IBZA 3OSKA 2AJXL 3FQUB 4YDZA 3OBAA 1IIHA 4LANA 4M5ZL 4AFYA 1HWWA 2QVFB 2AV1B 2NV9A 3QAZC 5GJSL 2R91A 2WXFA 1XIDA 3UWEA 5FJTA 1C16B 4OZGB 1Q0EA 5A7BA 3BLEA 4QWWC 3RMEA 1YTDA 4AT6B 1O7AA 4PUKA 4P9HL 2BWGA 1OGAA 3HMXH 4A8LA 3ALPA 4XNMB 1AZVA 1WC7B 3BVWA 3A6CL 2GDVA 3BE1H 5E2WL 4EN2A 3Q58A 4LYPA 3WH5A 1YECL 1IGJA 5IXEA 3DG6A 5FFLA 1QQDA 4F0MA 3MLVH 1IT7A 1KBKA 3TROA 4JFDE 1WJ3A 1PEZA 3BUYA 3LN5B 4ZPTB 3WQ5A 1O6TA 4RAHA 4UTAH 2AQRA 4LDLB 4NCC2 1QSZA 4NZTL 4YDLC 5J6SA 1HSBB 3QUXC 4NY2A 3IDYC 2I1OA 1A65A 4PBDA 1G9ML 4HFWB 2ADJB 4ZSUA 5D7JA 1O5PA 2EDEA 1SZEA 1A0DA 1JRBA 4RDBA 4H1LA 1XL9A 3CUZA 4Z0BH 3RWGB 1NFGA 5FGBC 4HK3J 1R38A 4LVFA 3TNNB 5BXPA 4I18A 4P2OA 2QQLH 3MA7A 1JZEA 4K94L 4YZFE 2CBTA 3FHEA 2XETA 3NPSB 3QXVA 2H26B 5T1DL 3L2NA 1NSJA 2V82A 4DLFA 2H3DA 3HA0A 2ZC1A 1XLEA 1FGNH 3UXAA 1EPFA 1RHHA 3B8DA 2D7TL 4WEVX 3RYMA 4JE0A 4EZMA 1YTEA 4HDIA 2QF7A 3ARDC 5D70L 1A4JA 1TKWB 5C08A 4B9JA 3SYQA 2XA3A 1KM3A 4HA3A 4Y5YC 1YY9D 4L5FH 3GFXA 2WXKA 3VFPA 4KQ4H 4LUJA 4IIZA 3EOTH 5DFWH 1QJWA 2V3DA 2VDOB 3LN9A 4K2UH 4N6RA 3P67A 1WIOA 2CHXA 3D08A 3IVSA 1O95A 2XXCB 5A8PA 4GS7B 2X2YA 2YJLA 2ZCHL 5ETUA 2ZZ7A 4HCRL 3QLDA 3AY4C 3WSUA 3MRKA 4JCLA 2AITA 4X98B 2PC8A 3RWGA 3V4BA 5FYJU 3GH7A 4LYRA 1CT8A 2E9GA 2PWGA 3FYEB 3P0VL 3LXBA 4HZ6A 4FXGB 2VDQH 3SCMB 3F12A 3HZMB 4IJTA 4QTIH 3ITXA 1O7VA 3V0WH 5FKYA 3AAMA 3E49A 3E6HA 4M3HA 4IM8A 2F9BT 3CL8A 3T7VA 3RVTC 4AZ5A 3ULUF 1D5MB 1S5IL 2WBJA 4JHWL 5EMUA 3VACA 1HW6A 1MXSA 5ESAA 4XCFL 1XGRA 3BGFC 1Q4NX 4MS6A 5C0AA 3P60A 1ZU8A 2BY2A 2WMHA 3LXCA 4EI0A 2NY6B 3Q48A 1OZMA 4ORGA 4LSQH 5JA9A 3CIAA 4HU4A 2HH0H 4KVNH 5EU6E 1QCWA 1SXCA 4ZAKC 2Z7YA 3WE1A 1C92A 2WZHA 3RHWF 1MCPL 3NPSC 4KTGA 4S10A 2XPKA 3ZIZA 2M8XA 4UDTA 1R33A 2GPZA 4Y7MA 1GC1L 1W0MA 5J11B 2EPKX 3GNML 3AUOA 3SPJA 4EIVA 1H0DB 4LQFL 1FZJA 1J5DA 3NGJA 2QW5A 2R83A 4H88L 1QFUL 1JK8B 2EYSA 5B8CA 3G04B 5I24A 3X12B 5INDA 3HJ0A 2QQKL 3DXAD 3B7YA 2EIZA 3OG2A 2WBXA 3AABA 1TCMA 4XCEA 5C0DA 2CBJA 2YB1A 3MNMA 3VDCA 1XBZA 3AAZB 2BX7A 3EGJA 4RNIA 1FGVH 2L04A 5CPLA 3C2OA 3KVJA 4P46C 4GX9A 4FMFA 5K93A 4PCSA 3ARBA 4W4QA 4MAYB 2Y8UA 1PIIA 1JULA 2J3SA 4FXKA 4NO2A 4ADTA 4B9IA 5LVEA 2VXSH 4OF3A 3P8IA 2W5FA 1U3YA 1E0OB 2F2HA 3FUHA 5MEQA 5FLVA 3EKLA 3RUGB 1S8DB 3T1FA 3DX0A 1BKHA 4G70B 2WLNA 1FIGH 4D94A 1EBPA 1PIGA 2DKMA 3MRIA 5FOJA 3LZRA 1QSEB 3NA8A 4W7UA 4RQQA 3U36B 3RVUC 1E4WL 5K59F 1IEIA 1MH5B 1E6JH 2VN4A 2XYBA 3HMWH 2BGNE 3EEGA 4L80A 5D9SA 3GR7A 3CVHB 4CD5A 1XSIA 1ILSA 5KTEL 2DIKA 3P73B 2F53B 4ZS6C 2DQCH 2YN3A 4K3JH 2CCWA 2HRPL 4MJZA 2J6EH 1YN6B 1D5IH 3TR2A 1CFSB 5IB2A 2PABA 1C8XA 2Z2AA 3OAYH 1X3DA 3PSWA 4BYHA 4GVIA 4HWBL 2O6EA 4DK3A 1VBHA 5ALBL 4X5WA 5EIVA 3SKNB 3V5KA 1CDBA 2F6KA 3HLAB 4PG9A 3ITTA 4Z1CA 1ZJAA 4XPAH 4A3UA 1QEWB 4KROD 1M6UA 1OFDA 4N8UA 5D2YA 4MJ5A 4QRSA 4NQEB 1G4PA 3O6AA 1JOIA 1JDEA 2MCG1 5IY5B 1XIWD 2Y4SA 3EIFA 3KR3L 3OG4B 3PY9A 4OZGF 2CHZA 1PZDA 4A8RA 1RZGA 5F7HA 1FQ9C 1G7PB 1JXDA 4FCHA 1BVLB 2VABA 5FKPB 1FWSA 2A2IA 4C6DA 5D4QA 4G7YH 1KN4L 1YMHA 3LERA 1QNPA 3G08B 1S7TB 4NHUA 2QS8A 4WW2A 5AW0B 2ZYHA 4CCEA 4OZFH 4QNWA 3UC0H 4W9EC 4MNGE 2QUNA 4XK2A 4PN2A 2EPHA 1GGCH 4GHRA 4HS8L 3GMQB 1F8IA 5HNNA 4ROQA 4FJYA 2HSIA 2FWOB 2Y8KA 3OKNA 4ATDA 4UDTB 1BLNA 3VXUB 1K8CA 1IC7H 4AD3A 4U1IB 3C4UA 5DD5L 4XO4A 1ZLSL 4NQED 1N3NB 4JEGB 1OX4B 3MR9B 3T08A 1A6AB 4EI6B 3RAOA 2XDFA 2HDJA 1JPSH 4WFFE 4MD4B 3QORA 4WUKH 4ADSA 3W76A 2ZSWA 3UESA 3LEVH 3A6BL 3UG3A 4Q56A 4K3EH 5KJ4A 3DROB 1H41A 1P48A 1P4UA 3K4WA 5DEZA 4XV0A 1E4XI 4D6EA 5KSAC 2E77A 4AQ8C 5CEWA 3QI9B 2I57A 2NUYA 4PY7B 1BBDL 2W91A 4PD4J 4LP4A 1XTMA 2OFQA 4XVSH 1G7MB 1R3JA 3E8VA 5E4AA 5I19L 5KSBF 4XN7A 5HHMD 1V55B 4ABUA 2RJHA 3QKZA 1NMBL 2BZCA 5C9JA 5I6OA 1XIHA 5AB2A 1CLCA 3BKMH 1YHTA 3BDKA 3QZPA 1RPKA 4N0UA 4NO2B 3U0TA 2JKEA 4PMYA 4E9QA 1B4LA 2DZXA 3DFQA 4GI9A 3MLTA 3VXTA 3WFZA 3NFUA 4C56E 3ABZA 1BVKA 4B3VA 4HC1A 1UWFA 3N1FC 3RTQA 3IDIB 4JM4L 5HVWA 2NXIA 4U28A 1ENUA 5DLCA 4LOEA 2BIQA 1OABA 3ATAA 3AREA 1R9ZA 2WMIA 1VADB 2X1UA 1JJKA 4K36A 2ON3A 4OD1H 4P46D 2YXVA 3GKWL 1W3LA 2IPKB 4ISVA 3BQUC 1S9YA 5DHEA 5I1IH 1WFNA 1JV5A 2NW2B 2OTUA 2K6ZA 4JM2D 2QKIA 4XNBA 2NY6D 3NIFB 1AGDB 4JEJA 5I3JA 3WHE0 4U4IA 1FNSL 4JL1A 1A6WH 1LE5B 1YY8B 2WLLA 5EBMB 2DQDH 2YGQA 3PNRB 4FQ2L 5C9JB 4TULH 3U5UA 3V18A 1GGIL 1MNUH 3WELA 5FO8A 1E43A 1HQ4B 3RGVC 1KBJA 3MNWB 5AW9B 4NJJA 1NKRA 4Y5VA 5BMXA 1AE6H 1JGLH 3DGDA 5EBLA 2TODA 3QHMA 3WKZA 4PQXA 3IGHX 2E3VA 4AL8H 3ARFC 1OTSC 1FA2A 4BWWA 2VXUH 2HFFB 5E6ZA 4DT2A 1K77A 3MYZA 1WD8A 3SUUA 1UM4L 3JTTB 2XGIA 1U3ZA 4Z7UF 2QGYA 4PUMA 5HOSA 3N6HA 3EB3A 1LO5A 4DTGL 4HYRA 3KYNB 3HG2A 3A4JA 3L1OL 4Q9BA 4QIUA 4HISA 2J74A 3PTMA 1IQWL 1YVLA 5ACZB 5IGXH 4DVBA 2BOEX 5EGRA 3DIFB 1QBLH 1VEOA 4TVPE 3DBNA 1KFEA 2NR6C 5CR8A 5TPWH 2GL5A 4K23L 4YBQC 3MR9A 2BWIA 4JMXA 1DZBA 2EBNA 3MKCA 4Z7UE 4LF3A 3S6OA 5E1AA 3TN6A 3OWEA 4PRDA 1U3JA 3SGDH 4EPEC 1BZ9B 2GW5A 4WEMB 5E9DB 3TZVB 4UV7H 2AL2B 3DOHA 1FKXA 2FZBA 3LNHA 3QUZA 3QJXA 3E6FB 3G6MA 5C6PB 3E8UL 3I6RA 1JWMB 1LP9B 3G6JB 3VD5A 3BWSA 5LWYH 2JBMA 1EC7A 3G5VA 4IM4A 1IZKA 3NPWA 3UZVB 2HQAA 4HVXA 1XB6A 4HPYL 2P48B 3UWZA 2APXA 4JFFA 4TRPL 1HJSA 4ODUA 1CLXA 1UUQA 1N0XH 2NUTA 1J5OL 3HGOA 3RRAA 1NELA 2YXWA 3EOLA 3IU3B 3W2DH 3MVTA 4AF0B 1DN0A 4CADB 2Y6ZA 3NIDB 4DGIH 1Z8AA 4EIGB 2NQLA 2GVEA 2ICWJ 5DD1H 3HI1B 1NC2A 1BMZA 2F8VA 5DTFA 4TVDA 5H8PA 3O7UA 4R5XA 2HBXA 2R8SH 4BK4A 5AZEH 4GXFA 1JNLH 3FRPB 4I5BA 5DMJB 1QBML 4XN1A 3G77A 4FI6A 5DUBB 2OEKA 3D39A 3MRPA 4LNVA 4KZDL 3CASA 1C5BL 2QYGA 4I4WA 5FF3A 5TH2B 1L2QA 1P1XA 4W9FC 1CC3A 4WV1B 3IEBA 2I27N 3IDMB 1AYRA 4C7DA 4Q9CA 1OM3H 1KFCA 4G8FB 1S3RA 2NUTB 2FX9L 2G0KA 3NPZB 4GIYA 4PEKA 2WWKO 3UD6A 4AGPA 3IIVA 4R3SA 2VEGA 3KVQA 1R87A 4AK1A 3ZLGA 3CUPB 3ULVH 1HKIA 1UB6B 1F3DH 4NPKA 1TTUA 2FNWA 1FNEA 2CNZA 5L4IA 3T65B 2F8XC 4YSEA 2R1XB 1J1PL 3TAKA 2F2KA 3RX4A 2V5KA 1RZJH 3CZLA 4QLRA 5CIPB 3ZY7A 2YRBA 5F9DC 4X80H 5G2NA 1PTGA 4NSKA 4GRWE 4P2OD 3ZL2A 2RCSL 5CS7A 1F9CA 2VMJA 1LO5B 2ZF9A 3HE6A 5D2NC 4UNIA 1MWAL 1YYMH 4HQQH 3KCJA 1U8MA 1IE7C 1TFVA 4Q4SA 1OT2A 1SOSA 5CZXD 4FTVE 2E27H 4B2DA 1GSKA 1HF6A 3QORC 1DQJB 2H2PD 1L0XA 2PWEA 1G7JA 1RI8A 4FFVC 4G7VH 4NEHB 5CSUA 2NZIA 5EFFA 5CSRA 3RWDB 4I3GA 2QTEA 4U4BA 9CGTA 4HU0A 2EECA 4NVTA 4OFCA 3SRHA 5B3JF 5D7LB 3KXFA 4BQ9A 4PP2B 4HPJA 4R5EA 1KGIA 3QUYC 4MAZA 3F04A 3BLBA 4HK7A 3WBAA 2A6JB 4HIHA 1AQDA 4P9HH 3U9WA 3I6SA 1Q6FA 3MBEA 3JT2A 4Q9RH 3WQ6A 3VB8A 1XLIA 3T4YB 3Q43A 1EAPB 4XNUH 4AZBA 2VYOA 3NQAA 4W9TA 3BSZL 4YSCA 2LT9A 4FAAB 3ZS4A 3QUZB 5ANME 2XFXB 5HHVH 2AW2A 4Z2LA 5T1JA 1FYTE 3NVTA 4L7ZA 3KPTA 1O6VA 1XYAA 3GC5A 4KFOA 4X4XB 4DJFD 1C1EH 4GP5B 1MJ8L 1HJVA 2W0FB 2VDNB 5GPRA 1KSRA 1KYAA 4LL1A 1SW7A 4QXTA 3TTSA 3DOIA 1UA6L 1CFTA 3I6LD 4IGBC 1FWXA 2Y6TE 4DHLA 4G6JL 1Z89A 1VPXA 2CCRA 3QBTB 1UD2A 2GFBB 5LBVA 1MY5A 1OTTC 1A3HA 1PJ9A 4M7KH 4L8DA 2WINA 3BZJA 1DUZB 5INCB 4PUDA 3SQBA 2LGNA 4FXJA 2Q8AL 1K8IA 1FP5A 1E9LA 1GYUA 2BSDA 2YGYA 3BZ4B 2OMTA 5CJNA 4CCCA 4OUUB 1DXIA 1JPFA 5LB1A 4PRBA 3FT2A 4L4TA 3SOBL 4O8RA 1K3IA 1TLKA 1FGNL 3ITVA 4KIRA 3ZLFA 4BZ1L 1PFOA 1E0WA 4WU5A 2ICEA 4LLYA 2QXWA 5HUPA 3UJ2A 2J8GA 4E3TA 4OZ4A 4W4OC 1UVQA 2Q2LA 3GE7A 2NQCA 4Q14A 2UY6B 4WKZB 2WB7A 2BM3A 2Y72A 2LQRA 4JKMA 3P62A 3WKML 2ZONA 4DJDA 3O3BA 3MSDA 4FI7A 4IQDA 3CBKB 3APFA 3FUKA 1L9PA 3V16A 5E1HB 5D6DC 3HZVB 4FNSA 2Y7NA 1YW1A 2J4GA 3PJXA 3LKSB 1PLBA 2CWXA 4ICWA 3VXPB 1FWGC 4CLMA 3FJ4A 4OZHA 1SOKA 4O5LH 2Q71A 4BHUI 4ZFGH 5I28A 1R3WA 3NM1A 3PM6A 5GGVH 1IGMH 3NSCA 1U22A 1NWRA 2ZRWA 3QGVA 2W79A 4Q32A 2DMCA 3ZL1A 1R3KB 5ITFB 1KV8A 2P53A 1CR9H 3VWJB 3QHNA 4PMFA 1VD6A 3OZOA 1MAJA 3BFOA 5E8EA 2GHWB 1FLTX 4PLOB 3EW3B 4PJXA 1WWAX 4GRLA 4PI0A 2FLIA 2YWZA 4RR4A 1VDGA 4AK2A 1NWTA 4GBUA 4RZ4A 1B3VA 3ARVA 3NCOA 2H7WA 4M00A 4Q6IC 5CBAB 1P9MA 3FFCD 3KOXA 1BEXA 1KPVB 2ZKYA 3GKAA 1E90A 2HJLB 4E4FA 2A6JA 4HIHB 4MCZA 1OF8A 3GDKA 3W1MA 2CZVA 2ZKHL 3WCZA 1KLFB 4UTAA 1RXOB 2CLPA 2VZ3A 2J25A 3QM3A 4W68A 4QHKI 4IRJB 3LZFH 2ZRVA 3TVMB 1T20B 1EPXA 3T07A 3U83A 4KWWA 3ZMRA 3OG6B 4FXSA 1TZ8A 1GC1H 4FGMA 4ZO9A 5LBGA 2WQPA 1R19A 4KY1H 2YARA 2KAUC 3AITA 2I9TA 1R3IL 3WQ8A 1A3LH 3STLB 3NYKA 2X2GA 4UCGA 2H9AA 1BG9A 1DFXA 4TNFA 3VYNA 1X7QA 3CSPA 4OWGA 2PNDA 3E6EA 2CM6A 4Q6IA 1Y0LA 4HIBA 1BXCA 2BXZA 2NSXA 3EWUA 2OSXA 3K2MC 5JXED 3QPKA 3NIFE 3QEUB 3N0PB 4A63A 3MCNA 3ASWA 4G72B 2OQLA 3FA5A 3NIYA 4Z42C 3K8KA 4Q6JA 2CO4A 3MUZ1 4JG1H 1KG0B 2WXPA 2ADJA 2X9WA 4XVJH 4D0CB 5EEXA 1E9PB 2G9HB 3LNGA 4OKVA 1NFDA 2HPTA 3TQ0A 4A2RA 4Y7EA 4UQBA 1GA2A 1XF3A 4I9TA 4QXIA 1VR6A 5CMAB 1RVGA 2VURA 5CSGA 1XCQA 3JV4A 3MVIA 1E4WH 2XNAA 3GB7B 4QRUA 3IAPA 4HK0B 2DLTA 3V4VL 3WN5C 4POUB 3CIVA 2H9AB 2O6CA 3UTSE 1INEL 3DYOA 4OBTA 4UFLA 5H8MA 1RMFH 1MFNA 3QCTH 4PJGF 1GOFA 3KLKA 1ADQA 2W38A 5IOPB 5CUSH 4S1QH 5C07E 4GNJA 4F7MB 5CPTA 1JZDC 2PPEA 4B5SA 4GMSH 3MRGA 2ARJB 3FFDB 4UT9A 1C90A 4LLVB 2FE0A 3IAQA 3QJFA 1IIGA 3LTYA 1QXLA 2FSEB 2R69A 3MJ6A 4F2MA 1SZFA 1ILUA 2E59A 3CBWA 4Y7OC 2AV1A 3EOBA 2P5EB 1NKGA 1RK0A 3DETD 5F1KC 3KLHC 1XAKA 3W2UA 3DX4A 4MD5A 4ZXOA 1P53A 2NZ9C 4ZE5A 3IXAA 4JZJC 2WWNA 2E9JA 2ZUYA 3W37A 1WBXB 4UQIM 2FQDA 5D93B 1R3KA 5FHAL 3JYBA 3WN5B 5C3LD 5L4MA 2QHAA 2W61A 1FWFC 1X7FA 3CHDA 4YDVB 5I6LA 4LPCA 3RXZA 3RIFK 3X1FA 4O53A 1KN4H 1I9CB 2UWEA 1M3IA 4PJXB 4XAZA 3APMA 1T66D 5B8CC 4EANA 3W53A 1A3QA 2BP5M 3BWWA 1ZDSA 4DN4H 1T22A 2CM5A 4R9XA 1ECQA 2ADIB 2BLEA 1NWSA 5ESAB 5C0AB 4BA0A 2QVHA 4DUOA 2XZ7A 4DJDD 3QR3A 1ZS8A 4BFJA 3VMPA 1T21A 2OMVB 1IMHC 2YEZA 2C6QA 2JGQA 2YD3A 2OT0A 2PR4H 1EHAA 1KGWA 2YQ3A 1OK0A 5GZNC 4JPQA 1NDGA 2ED7A 4NQEE 2XKSA 5JORB 1KFBA 3I6GB 2NLJB 2R0ZL 2WV8A 3QQDB 3AYSA 4WJXA 4DUWA 3T78A 4Y9BA 4PJEA 5LGJB 1ISXA 2OMAA 5EPDA 3AY4A 4UM8A 4Y5XA 5SWSE 3GMOB 5I1JH 2I9TB 3ZDYE 1QOPA 2HSAA 4LPXA 1F3JB 4GNKB 1NCAH 5FEXA 1RVFH 3BOVA 3QUGA 5E8DH 3BZFA 4BFIB 1AD9A 1UACH 1FHLA 4PUWA 1ZE3C 1AD0B 1A0QH 1H19A 4P2RA 4YHYB 4HJTA 4XVSL 4XXCA 2IH1A 5I19H 4XO5A 1ZV9A 1LOQA 5CGQA 3OW1A 5T9CE 1CFQB 1WF5A 4L3EA 2E09A 3QEHA 4KVCH 4JS3A 1OAKH 4GLRH 2MNJB 1ZS8B 1XX9C 2KZKA 3FQNB 3LMJL 4EDXB 4DEPC 4NQCD 3G8RA 2V4LA 4QYAA 2PLKA 3B0XA 3R8GA 1IV8A 2WNKA 5IK3B 3TYBA 2BVUA 4OH2A 3UTPE 1P5VA 1IT0A 2KT6A 1LO2H 1NFIA 2YZ8A 3MRKB 3MXVH 1PLGH 1IJ9A 4OF5A 5B39G 5SWZD 4H7CA 1I2PA 4GG9A 3TYFB 1NEPA 2GSGB 4NUWA 1BG1A 3MJYA 5BV7H 1D7KA 5D8ZA 2X4NA 3RWCB 4K7PX 2H0JA 5AOMA 1LK3H 4OD1L 3WJMA 4UMBA 5BVJB 1LOLA 2NQ5A 5C0EA 1A4MA 4YE4H 1CMOA 2DWDA 3RRXA 3BUBA 3D85A 3IJHB 3R19A 4HCHA 4INFA 3SJVD 1NM4A 3P82A 2FUQA 4G7QB 3PAYA 4HWEH 1WBZB 1Z6KA 2YFNA 4FQ2H 4FXTA 1MFEH 4ZS7L 3KBWA 3OG3A 4XPBL 4FG0A 3S5SA 1CZ8H 2H45A 1OFAA 1T7VA 1NF7A 3BZ5A 1NIDA 3U2IA 3CHQA 3GVWA 4X5WB 2AAMA 2YBRA 3WIIL 3NZPA 5FJRA 4PWGA 4GKSA 1NFIB 2N59A 1KCSL 4C6BA 5CAHA 2NY3C 4JFYB 2VX4A 4NJAL 1I3RB 3VNYA 4ENZA 3WLTA 2J47A 1A7PL 3UU0A 4YFEA 2UXGA 2F1BA 3SYPA 4F20A 1T21B 1NCOA 3ZE0E 4AKPA 5D32A 3VIHA 3SD2A 4GH3A 1EZLA 2OLSA 4WWKC 4AYEC 2W67A 5L8KB 1TUXA 4Y9OA 1W2KT 4QNPE 3LHAA 1FCVA 3F4CA 3I6LE 5EA0L 1QSFE 3T3PF 4IFRA 3ZTDC 3CAWA 1PS3A 2YC1B 3DH7A 5EU7C 4RETB 1KEML 1YEEH 1QNVA 1YDNA 3V0VB 3M64A 1G7UA 5LLIC 2O4MA 4UT6H 3MO1A 2AVFA 4QOKA 3PUGA 2I9LB 5FYKH 4OCYL 1NMAH 4R97C 4LCQA 1KGJA 4RL3A 2VKWA 1NARA 3QA3A 5B3NA 1AA1B 3NAAH 5KMYA 2K70A 3G3LA 1K9EA 2J7HA 3ATEA 3VXMD 1YAZA 3A67L 4J40A 4FLRA 3T1GA 1EANA 5D7LD 2V33A 4HUUB 4UTAL 1TPDA 4L6OA 3SFKA 1JIBA 4JKKA 4DGIL 4NRYA 3AQZA 1SJBA 3D5HA 3TA9A 1P6FA 3V5OA 3VTAA 5HNUA 2H0PA 4QHMA 4PA8A 1QI4A 1LM8V 1U0QA 2WXMA 1GZHC 3D2UB 4MGXA 1LG1A 2XIOA 3BSMA 4URIA 1FV1B 3ISYA 4H1LG 1U93A 4HYTB 5F96L 3L4XA 4MAUH 5KAQG 3EA1A 1FBAA 2O9OA 2CGRH 3QQXA 4OGZA 1OCWH 1T2JA 5E6IC 2IXQB 4Z0BL 3HG5A 4XKYA 1HL5A 2I85A 4ZSOA 3VFRA 2PDWA 3S34H 1C5BH 3BAJA 1BVLA 2VABB 5FKPA 2LR4A 5K1NA 3G6DL 1S7UB 4AE0A 2EPNA 4KPLA 1RUQH 3TH6A 5FDWA 4UTFA 3FH8A 1BOGB 1RULH 4LRNH 1A50A 3PB2A 1XI3A 2WN3A 3UNTA 4CD4A 2WIIA 3BSGA 3V2AR 1IAMA 4KK8C 5MHSD 1A9EA 3CU7A 3PNWB 4MA8L 3WZ0E 2QCCA 5D1ZI 3Q8FA 1XMWA 1A6UL 4QR7A 3SY0B 3AW5A 3NDOA 4JTJA 4HSNA 1NBVH 2N01B 2XZQL 5B1JA 3WK0A 3B43A 3MWAA 5E5MB 5EDXA 3B0VC 4UQ3B 5GGUA 2A74A 3TOYA 1XBDA 1A5KC 1U93B 2OSWA 3WQDA 3RDTC 4PRID 3WGUB 4EUPA 4ZMLA 2DOCA 3MV8E 4MY1A 1S5MA 5BROA 2WWDA 2WY3B 4XKYB 1ZB5A 3UERA 1CBVH 2WWKT 3ABOA 5EMKA 3W88A 3DX1A 5AVVB 3L16A 3F8UB 1F41A 1AZNA 1LO3L 1QYGL 4PJGB 2VDOL 1G9HA 3MRJB 4R4BB 3KPSD 3LRHA 3AQUA 3CAQA 2IBZY 5FDWB 3MSYA 2DIBA 2VLKB 2EIMB 3BP7A 5DSCA 3VX1A 1FZKB 3SZKC 3QHFH 4YDNA 4ZUSA 5EIQA 1QOKA 1UPPA 4GK8A 3WJXA 1JUFA 3H9SB 5DVMA 1TZHB 1R5YA 2Q10A 2FATH 3VFCA 2ZXDA 1BZ7B 2G75B 3B2PA 4DNLA 5D4JA 5BV7B 3L0GA 1MY7A 3GBDA 1AYOA 2VDRL 4JE4B 2HEJA 3GSMA 5CWSB 4US6A 1D9KA 3DIFA 4DLMA 2DDQL 4P0DA 4ORGB 4EN3C 2HX7A 1I8LC 5I2IA 4Q9RL 1PZ0A 4I85A 2AXJA 3ALXA 4PMEA 1DQVA 1L6ZA 1LWRA 3WD5L 3RBSA 2J5LC 1NWOA 2E5EA 1I1AC 2R29A 4IMLA 4Z7NE 5IIEB 1ZGLM 3DGGA 1J10A 2E5CA 3GAKA 4LCWD 1KNOA 3BX7C 4BA8A 3PFRA 3XINA 1AZCA 2AL2A 4FLSA 2VXTH 4TOYH 3IMVA 1UZ6F 2IAND 1PXGA 1DJHA 4E41D 1WQVT 1YBQA 4JHOA 1K8DA 4LU5L 2QQKH 4YXLH 4KMTH 1XXXA 4PRPD 1V7YA 4G6JH 3GZQA 1U6AH 2DW5A 4IHOA 4PFEA 5C0CE 5MI0C 4XPTH 2BVOA 3N3EA 1I9IL 4MNQA 4F7TB 1BF5A 2PYEB 1N8FA 4QHLB 4XCEB 3CO4A 1YPZE 4NZUH 4I5UA 4WXZA 1QTPA 1ZMYA 2ZAGA 4JRYA 1A6TA 3MRCB 1V77A 3MNVA 3INPA 1WDAA 2DM4A 3B3BA 1MQRA 4AQEB 3L1EA 1M56B 2AXHA 4OB5L 4KAQH 5GGTH 3I74A 1TQJA 2HZGA 3NL6A 4PGJA 3CVDA 3RVXD 1HI6B 2X0SA 2Z2UA 4AJYV 1PBGA 4G1MA 1PYWA 3II2A 4PY8I 4XXWA 4BZ1H 5I07A 1B88A 1HH9B 1O5RA 1WDRA 1B6UA 3F85A 1BFNA 1Z9AA 2FZ3B 3EKGA 1WQ5A 2CW6A 3O16A 5KVDL 2CBOA 3SBQA 4NT6B 4Y1SA 2OZ8A 3WYRA 3ANYA 1HSAA 1F90H 1BWVA 2D4FA 2B2XH 4KI5F 4YPGA 2A7RA 3AIBA 4GYKA 4BH8B 2H6RA 2B7DT 4XP9H 2E9IA 1ZE3H 5LXVA 4M80A 3LYEA 2G41A 3NRQA 5IQMA 3TBSB 4HLJA 4ETQA 1CI3M 4QE4A 1U8LB 3R06B 2YQBA 3HRPA