3BAWA

Human pancreatic alpha-amylase complexed with azide
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Alternative catalytic anions differentially modulate human alpha-amylase activity and specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 178
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bawA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bawA01
5JBDA 3PZVA 4JFTA 1QW9A 3J7HA 3O6AA 2WSPA 3WSUA 3BUIA 1JI1A 1XYZA 2WMIB 3GTNA 4N0RA 2ZXQA 5I77A 3ZMRA 3AZSA 3CLWA 4U3AA 2D2OA 3UCQA 3AXIA 2AMGA 3L2LA 5AYBA 3DX1A 1E5NA 1W91A 3GYCA 1PAMA 3N13A 4DWSA 3WF2A 3WH6A 1PX4A 2OYLA 1M04A 2CKSA 1X1NA 4QCFA 3WFZA 1CXFA 2WZIA 5JIPA 3LXCA 1BSIA 4BCEA 3DX0A 3SURA 2VX7A 2NW0A 3WD3A 1TQTA 2F2HA 5I79A 1UHVA 3BUQA 4ZFMA 4DM1A 4MB3A 4NF7A 2YKKA 2VR4A 1TMQA 1JZ6A 5D9PA 1HN1A 5A6KA 4CU6A 1EDQA 3EDFA 1QI3A 2W92A 3WY1A 3JUGA 4Z2KA 2QPSA 4MADA 3F5JA 1CGWA 3AISA 2OSXA 1QWNA 1H49A 1F4AA 1NWRA 1T0OA 3IAPA 2VRKA 1LWJA 4WKHA 3LPPA 1W1TA 4NRSA 1G9HA 1JF6A 1K9FA 3WEMA 1V6UA 3CH9A 2WCAA 2J7EA 4AD5A 4E8DA 1E3XA 1KBKA 1QHOA 1QHZA 3PZQA 5EBAA 4JL2A 2UY4A 1UKTA 3UR7A 2WMIA 4J3XA 2IXUA 3HN3A 3A47A 1V08A 2UY5A 2FH8A 1KCKA 3WY3A 3M7SA 1HJSA 1J10A 1HKJA 3T0BA 1JZ2A 3M6DA 1E6QM 2DDXA 3BAWA 4MJ2A 3A4XA 1S46A 1DHKA 1E0VA 1PIGA 3BCFA 1H1NA 3K8KA 2CBJA 1ZL1A 2GDVA 2X05A 2EPLX 3AQUA 1GJWA 1KXTA 3W0KA 3VIIA 3WQ5A 1MFUA 4WIWA 1TQSA 1QI2A 5I2UA 1FH9A 1R33A 1XSIA 1WZLA 1X6LA 1ZJBA 1BAGA 2AOSA 3CHEA 3LXBA 4RE4A 1WB0A 5A8OA 3CZSA 1NWTA 2UY2A 4IISA 1EH9A 4HMCA 4BQ4A 3II1A 1AVAA 2W91A 2YDRA 4Q7NA 3WQ8A 2E9MA 2DT3A 4C7GA 1K6AA 1CXIA 2MANA 2WMKA 4OOZA 5KEZA 1H11A 1JFXA 5EFFA 4UOZA 1CXHA 4W8BA 1F4HA 5A95A 1E6PA 4TX6A 3VDAA 3MSDA 1UZ4A 3WNOA 1UKPA 3AROA 1KTBA 3B9EA 4AD3A 1JXKA 5HDRA 3VD7A 3BMVA 3WDQA 2J47A 5JBEA 1FH7A 1ECEA 3WQ4A 2DT0A 1V0KA 3MV11 3E1F1 2OSWA 1VJZA 3TONA 4AEFA 2RGLA 2XIIA 5EFDA 1NOWA 3VKKA 2EQDA 2ZUSA 2YFOA 4GI6A 2VURA 2YL6A 1JXJA 2Z1SA 3D4ZA 1J0KA 1KXQA 4AD2A 5BXRA 4KWUA 3WF0A 3K1DA 1JAEA 4J3UA 4DUVA 1CTNA 2D3NA 6CGTA 2OWWA 5A8NA 4JHZA 1KQZA 2RGMA 3NDYA 1CLXA 3UERA 3SCQA 1VAHA 1XH0A 3EMZA 1GOMA 4IPNB 2G3NA 2ZUNA 4JHOA 3NCOA 2AAAA 2W63A 1LL7A 3U57A 3AHTA 2D73A 3WMCA 5A6MA 2D22A 5ABEA 4P8VA 5GNZA 1K9DA 3VDHA 4KH2A 4BF7A 1PZ2A 1ODUA 1DEDA 5A2CA 3QHMA 4HPGA 4GIAA 1E40A 1KGXA 3CO4A 5HXMA 4AW7A 4GZIA 4GQQA 3CGTA 1E71M 2IUZA 4MAZA 1JZ7A 4Y7EA 3AOFA 1OIMA 2BHUA 4M24A 1MQPA 2E8ZA 1WP6A 2VR5A 3WEZA 1KB3A 3CZGA 3SCTA 2FHBA 4GI9A 1H09A 1JNEA 3UETA 3FY1A 1KXHA 2D20A 4H8UA 4AYGA 1JFHA 1C7SA 2BY1A 2XSAA 3B9AA 1ITCA 3EJRA 2WCSA 4W89A 2EJ1A 2CHOA 3L4XA 1G01A 3RDKA 3CUGA 5CJ5A 1PBGA 3DECA 5I3DA 3AS0A 3MO4A 5ECUA 1HJWA 4RE3A 3W28A 5GNXA 2G8ZA 1C8XA 4HP5A 4CU7A 2BY2A 3WDIA 4FNQA 1ZBCA 3WH8A 3MV01 1E9LA 1VFMA 3EJPA 3WNMA 1UD8A 3DYPA 2F1BA 4WK9A 2DIEA 1Q6FA 4E4PA 1TQWA 4PTMA 1KBBA 4N42A 1TR1A 2XWEA 3ARTA 1DWAM 4JKLA 1UH4A 2VCBA 4TTUA 4Z2HA 2CXGA 4ATLA 4D6FA 1K9TA 1UH3A 2D0FA 1I1WA 1AQ0A 3VINA 3ARZA 4LX4A 4LYPA 2GJXB 1V0NA 3A24A 3WELA 3T2PA 3AZRA 3RIKA 1G5AA 5FKYA 3K4DA 2YOCA 3PZUA 3OLGA 2BV9A 1GHSA 5BROA 3W6LA 2E9BA 3W81A 2VI0A 1ZBKA 3A23A 1JIBA 1QNRA 4PEEA 1Q6CA 2PB1A 1W1PA 3B9DA 1VF8A 3ALFA 1J12A 4E8CA 1KGWA 1O7DC 1LWHA 4P7LA 1E56A 3AIBA 1I75A 3CUJA 4ACYA 3VIOA 4UFMA 2W5FA 1Q4NX 3H54A 1MW0A 2B31A 3UEQA 1DWFM 3N12A 3W27A 2XVPA 3WF4A 3K8MA 4BZYA 1LL6A 5I23A 3PN8A 3A3HA 5A2BA 2QHAA 1BHGA 3FNDA 2A3EA 2G3JA 4QLLA 1IZJA 5TD4A 4QLKA 1JGIA 3OA5A 1MW3A 2D0HA 4Z2GA 2FYVA 1CNVA 2XN2A 1Z32X 1TE1A 4D6HA 3TTYA 3FHAA 3WDHA 4A3HA 1WDRA 3D52A 3TTSA 3AIRA 4P8UA 3L4VA 4PCSA 2GJXA 4U3CA 3S5YA 1E6RA 1QBAA 2WSKA 3WDRA 3CMGA 1GQKA 2QPUA 3D50A 3CZKA 2QMJA 5LA2A 3PTKA 1NQ6A 3WUFA 4DWSD 4H04A 3FW6A 5HPOA 2WHKA 5E6YA 4D6IA 3IANA 4AC1X 1MXDA 1GOOA 1OGBA 1J11A 4UQDA 3EJQA 4W84A 4A4AA 3I3DA 1EOMA 2WMHA 3ZIZA 5IFPA 1TVNA 5M03A 2OWCA 3U5YA 3PZOA 1IZKA 4UQBA 3L4TA 1IT0A 3ZJ7A 3KE0A 1WZAA 4HA4A 4AZ7A 4ZEPA 1E1EA 2D23A 3GNRA 5AYIA 2VRQA 4AMCA 3W53A 3AIEA 2XFYA 3F4VA 2JF6A 1M03A 2HVMA 2GVYA 2O9PA 2WC4A 1HVXA 3OB8A 2DT1A 4ATDA 3VVGA 2GSJA 4J7RA 3G6MA 1QI4A 3CC1A 2EPKX 2FDMA 1D7FA 3RM8A 4ZE5A 1E73M 1A3HA 1E4LA 4F9JA 3N1AA 1U30A 2XPKA 2FGZA 3SUVA 4CD5A 4W86A 2WK2A 2BY3A 3VD4A 3MU7A 1UR1A 2W62A 2WXDM 1LG1A 5A6BA 1HX0A 2ZX7A 3IAQA 3LMYA 4UQCA 1IV8A 1HP4A 3GXMA 3T0AA 2WZHA 2IXVA 1PS3A 2ZUTA 1UA3A 1C7TA 2ALWA 2O9OA 1EDTA 3VOCA 5BWFA 3CUIA 1UKOA 3SCRA 1UWSA 2XM2A 5FIPA 2VX5A 5C70A 3VX1A 1XYFA 5AY7A 2XFFA 4J28A 4EE9A 1CGTA 2OW7A 1H41A 4HMEA 4TXEA 3BLPX 1UD4A 2UY3A 2VT0A 1U2YA 4P7QA 2DPEA 3OLIA 3MMWA 2OW6A 2UWFA 2VO5A 4JZ5A 4UZSA 2QF8A 5CQ1A 2J8GA 1UH2A 1MWOA 4UFKA 4JFSA 4AZCB 4B15A 2WHLA 1CYGA 4M29A 2BS9A 2ZXAA 4UR9A 3KLKA 1GOQA 4UOQA 1PZ3A 1LQ0A 1QX1A 1HP5A 3CIVA 3T09A 3RM9A 1L0PA 1DWIM 1C8QA 4H8VA 3MMDA 3S2CA 2PWDA 4UNIA 2G3IA 3VGFA 2X8RA 3MUIA 3KLLA 2JEQA 4AIEA 3EJTA 2WWDA 2Y24A 2YA2A 1RH9A 1W2VA 3W29A 1JG9A 4D6DA 4D6GA 3GXIA 4HOXA 1E6ZA 3SCUA 3SIMA 4W8LA 1NH6A 4H7VA 3VNYA 3VIKA 1O7AA 5DF0A 3W82A 4EANA 1B3YA 1FOBA 3VX0A 8CGTA 5HBFA 2WHJA 1CGVA 3GXNA 3ZT5A 4X0NA 1QI0A 2X2YA 1VRXA 3HG3A 3ZR6A 2X0YA 3DDGA 2NT0A 2WC7A 1N82A 2EPMX 3BAKA 1B0IA 1JZ3A 1CENA 3VD3A 2CESA 4ZENA 1JYXA 1QOXA 4YHGA 1R87A 2BVDA 2D0GA 3BVVA 5M3WA 3WF1A 2BHYA 4U5IA 3U7VA 2DSZA 1BLIA 2JALA 2X0HA 4AZCA 3KWXA 4JCMA 1JD7A 1V6VA 3O9NA 5A6JA 1RPKA 1XCWA 1GOWA 3WUBA 5D8WA 3CMJA 1G0CA 1BFNA 5A2AA 1V3KA 4J3SA 1B3ZA 2J25A 1H4PA 3KL5A 3WQ6A 2CEQA 4CUCA 2J4GA 1HKMA 3GNPA 1VEMA 4Z2IA 2ZIDA 5CPTA 3RMEA 1PX3A 2O9TA 4LYRA 3GH5A 4IUGA 3GZAA 5HOSA 1D3CA 3L4UA 5CLTA 4EK7A 4FNSA 2J7HA 3BXWA 2E0PA 4DUWA 1EO7A 4BQ2A 3GBDA 3AJ7A 2GJPA 1BYDA 4AZIA 2WKLA 3ARQA 4FMVA 4QCEA 4AWEA 3WIJA 1UQZA 1ZB5A 4AD4A 3FAWA 2Q8XA 3MANA 4M81A 1W9PA 3IJ7A 3TTQA 2O92A 1E4IA 1JDAA 1EIBA 5A8PA 4PCTA 1J9YA 1XD0A 3W26A 4E2OA 4HMDA 4FNRA 3CZNA 1R86A 1R8LA 3QHNA 3QR3A 3T2OA 2XJ7A 1OD8A 2F7RA 1GQIA 4PMZA 3BSGA 1B1YA 3EBVA 3GXDA 3U5UA 4XX6A 2XFRA 3OLEA 2A3AA 1EDGA 1HVQA 4U33A 2A3HA 4PMUA 2CHNA 3NDZA 2IGTA 3D3AA 1J18A 1V0MA 5IHSA 3A21A 3AIUA 2YA1A 1WDSA 3AS2A 3BVWA 1J0IA 3ARVA 3GBEA 5CPQA 4PUDA 3BGAA 5DT7A 4AIUA 4W93A 2ZXBA 2F18A 4J3WA 1B3XA 2WMGA 2V3DA 4Z2LA 5D9OA 4U31A 3IJ8A 3GH4A 4MDPA 1BGGA 1H2JA 3WQWA 4W5ZA 1EXPA 1B2YA 1W9XA 3HJEA 1NARA 5ABFB 3VIMA 2XVKA 4JFWA 2ZWZA 5M5DA 2OLHA 5JUVA 5FCZA 5BYWA 3EDDA 3VIPA 2FHFA 4Q22A 2CIPA 2VQTA 4V27A 1C91A 1GHRA 1ODZA 1PPIA 3WDPP 4QAWA 5A8QA 2ZUMA 1SZNA 1MW2A 1R75A 2BY0A 2V3EA 4R27A 3VM5A 2XGBA 4S3KA 4TOQA 4P7NA 1GQLA 4LGXA 3W6MA 3GXPA 3PZ9A 4FNUA 3PZIA 1UG6A 4PMOA 5A1AA 3DYMA 2ZICA 3WD2A 1CPUA 3N18A 1WZKA 1JAKA 2DSUA 4AMWA 1R47A 1ZJAA 2CKRA 2CETA 1LF1A 1VFFA 2YL9A 5D4YA 2Y8KA 4IPLA 5DO8A 3S5ZA 1ZU8A 2HISA 4KRUA 3RCNA 1VENA 5CG0A 1EQPA 1TA3B 3PBGA 2GJRA 1CWYA 2WBKA 3K8LA 1E4NA 4CVUA 4GZEA 3WEOA 2WHMA 2YL5A 1E6SM 4FLSA 1XH2A 5M17A 1BG9A 2Y5EA 3AMCA 3BVXA 3M46A 3AMDA 4GKLA 5A94A 5ABFA 1V6WA 5CZKA 1JZ8A 4CN1A 4V2XA 4U5KA 3AYSA 1D2KA 1VB9A 4DO6A 7A3HA 4MTVA 1X6NA 1H3GA 1CGUA 4MDOA 1C8YA 1A47A 4UTFA 3AHYA 3WENA 4NX0A 2ZX6A 1TQUA 5LYRA 3TA9A 1XSKA 4RE2A 2G3MA 3VILA 1EGZA 2CBVA 4OGZA 4W8AA 3BAIA 2WVUA 3MS8A 1MVYA 4UFJA 5D8ZA 4TVUA 4NXSA 5ABHA 1QBBA 5FD0A 5JBFA 5AC4A 1GUVA 1GOIA 4EKJA 7TAAA 3K4AA 5GNYA 4J3TA 4D1JA 3SCSA 4NZCA 1GPFA 3DHPA 1C92A 4FNPA 3AS1A 2ZE0A 1ZBWA 5D9NA 1ISZA 3AHXA 1FP8A 4MB5A 1MQQA 3S6TA 3LRMA 3WBEA 4PMRA 3T08A 3WBAA 1UR0A 5IXEA 3NJ3A 2EXOA 4M56A 4S3JA 1ISXA 3GDBA 2WCGA 1WNOA 4OOUA 1UR8A 1TA3A 1HJXA 4QP0A 2YIHA 3W25A 5E1QA 2FGLA 5A3HA 1MXGA 1OGSA 3L4WA 1SFSA 1Q6EA 1B3WA 1VFOA 5BRQA 1KCLA 3WH5A 1NOFA 4BQ5A 5A6BD 3N04A 5CSUA 3TP4A 3TTOA 2E9LA 2DH2A 1UWUA 3EJSA 1WAWA 1CGXA 1R7AA 1WDPA 4PYSA 3A6OA 1XH1A 4CCDA 2WC3A 2QMKA 3SEPA 3ZSTA 3ALGA 2EABA 4ZXOA 1UD6A 3LXAA 1AQMA 1JDCA 3KL0A 4TTGA 4P8XA 3QHOA 1B90A 4FLOA 2WVVB 3H53A 3ZJ6A 1O6IA 2D24A 3RO8A 3WN6A 3VDCA 1GZJA 4W88A 1BPLB 4A3YA 3NUKA 4YPJA 4KGLA 2D1ZA 4V28A 2XN1A 3VMOA 1H5VA 1FP9A 1W3JA 5CLWA 1WO2A 3BLBA 1CBGA 2VJXA 5I5RA 1UWTA 4QDMA 4W87A 2DIJA 1CXLA 1W9UA 1XCXA 5D9MA 3VPLA 2JEPA 5GPRA 4DO4A 2VQUA 4W7WA 4TVDA 4AD0A 1GVYA 2Y2WA 1JI2A 4D6EA 2V5CA 3PHAA 3WNNA 4ML4A 3MI6A 2YFNA 3A4AA 3SUTA 2ZX5A 1SMDA 1GW1A 3PZMA 4HA3A 3ARRA 2PF0A 3ZT6A 1UD3A 4GQRA 3VM7A 1ITXA 1W2PA 1OWQA 3AYRA 3UESA 4UOJA 2WM0A 1ZBVA 4PRWA 4NI3A 1MYRA 4DWSC 4PN2A 1J0ZA 2W67A 4PTWA 1OIFA 2OWXA 1OCQA 3SCNA 4HZ6A 3WD1A 4OUEA 4P8WA 1R85A 3CTTA 2JF7A 3CBWA 2E4TA 1TFVA 5KZ6A 2WVSA 3LRKA 4GZJA 1KGUA 5A6LA 2G41A 3WD4A 3UG5A 2XSBA 3ECQA 3BAYA 1VFUA 4PBGA 5DMYA 3D4YA 4PSPA 1XSJA 2YJQA 3VD9A 3HG5A 4XZBA 2V3GA 1B9ZA 3ZOAA 5DT5A 3MKKA 1E6NA 1KWGA 4WKFA 3VGHA 4QFUA 1JYNA 2J77A 1KQYA 1DP0A 2OYKA 1C93A 2ZUVA 4CCCA 2J7FA 1EHNA 1W1YA 2YDQA 1UKQA 2BNJA 1OM0A 3UG3A 2ESCA 3SUWA 3ZSSA 1TZ7A 1LL4A 3WH7A 3WF3A 3NYDA 4GINA 1JD9A 1HXJA 1UD2A 4URIA 2VX4A 5LA1A 3M07A 4WKAA 1HIZA 4AMXA 3NSNA 4DUXA 1VJSA 2F7PA 4KRTA 3WMBA 3GH7A 3AICA 1TG7A 3OIHA 1B30A 4PUEA 3AFBA 3D5HA 4ZXLA 2G4FA 5BXTA 1XGZA 1H0GA 1XD1A 2CBIA 3EDKA 4UQEA 4MAVA 3PTQA 5A6SA 2ZWYA 5I24A 5CPSA 3DYOA 2QLYA 1UYQA 3LPOA 4WSKA 2WBGA 3W38A 1OBAA 1PJ9A 1UWQA 1OSEA 4HU8A 1P6WA 2VUYA 3POHA 5FOOA 1ISYA 4JFUA 3CV5A 1CXEA 1HWWA 5ABGA 4KGJA 2E40A 1NP0A 4M80A 1BVNP 2BVTA 1HL9A 3MUY1 5C71A 1R7OA 2EACA 3MSGA 1H0IA 1BGAA 4PSRA 4D6CA 2Y8VA 1QI5A 2F7QA 2YBUA 3NSXA 4D1IA 1US2A 2CERA 5I0DA 1E72M 3PZGA 1CLVA 4EAMA 2A3BA 1E4MM 4UCFA 2E3ZA 1E0WA 3AXXA 2VOTA 2X2JA 3ZJ8A 2J7CA 1HNYA 3ARYA 3THDA 2ZXDA 2YA0A 2PBOA 2F8QA 2XHYA 3MUAA 3OZOA 1EA9C 5BRPA 4WF7A 3EMQA 4M8UA 5LA0A 2JIEA 9CGTA 3W37A 3K46A 1RD6A 3POCA 4B16A 3VGGA 2V38A 2XVNA 2VCCA 4JFVA 3LRLA 3AMGA 3WDJA 1HJUA 2WLYA 3BUDA 3AMLA 1OT2A 3AIVA 5BCAA 3BUBA 1BQCA 2E8YA 3RILA 1QVBA 5A6AA 1FFQA 1DWHM 3HU7A 3T0DA 1HXKA 1UUQA 4JL1A 3RJXA 4RL3A 2CPUA 1GONA 3ARXA 2C0HA 5IDIA 2DSKA 2DT2A 3ZQ9A 1WCGA 3VSVA 4AZ6A 3IGUA 4CD4A 4UQ9A 5DEZA 3OBAA 5E0FA 2XGIA 4BQ3A 1JDDA 1V03A 1JL8A 2FE0A 1QNSA 3WUEA 4PMDA 2WWCA 3GNOA 5E0CA 1KWKA 2BXZA 1E15A 2JFEX 1EO5A 1V6YA 1DWGM 1V0LA 2VC9A 4W5UA 1WE5A 1E1FA 3DC0A 3HMCA 3ZM8A 3WUGA 5C8BB 5FL1A 3AIQA 2BFGA 1MQRA 4TUFA 2PBGA 4QLJA 3VMNA 1RP9A 4OBSA 4AYSA 2BVYA 4CD6A 2CBUA 4GO9A 1KR0A 1XRVA 1V3LA 2GDUA 1GORA 2X2IA 1GOKA 1V3JA 3WL1A 2VNCA 3DX4A 4OKDA 2ZX8A 3FHQA 1V3HA 1WZMA 1HKIA 4R5EA 1JZ4A 1PIFA 3OZPA 1BVZA 2XVLA 1MFVA 3DDFA 3QOKA 1BF2A 3U7BA 3HZ3A 4M1RA 3L4YA 4ATWA 3EMCA 2EPOA 4PMNA 4BA0A 2DSVA 4JIEA 4AEEA 1GCYA 3VIGA 3VIJA 1C3FA 2C8NA 2GUYA 3CHDA 3VD5A 2YLLA 4Z2JA 3SUSA 2PWEA 1J0JA 1KFWA 1ZS2A 4D71A 2WZEA 4XB3A 3N11A 2WYSA 4D6JA 3B8SA 2X09A 3CPUA 3T2QA 1W32A 1JYVA 4UQAA 3I3EA 1W9VA 2DQXA 1KR1A 4F66A 2J74A 1GNXA 4PMVA 4UFHA 4W7UA 4XUYA 2PWFA 2BHZA 1WKYA 2XWDA 1VIWA 4C7DA 4HOZA 4WJXA 4PTVA 3L4ZA 3SCPA 5FL0A 1TVPA 4ZE4A 3ARSA 1LG2A 1UOKA 1PX8A 4AZBA 4CU8A 2WNWA 4P7RA 5CSYA 3A22A 1Q6DA 1CGYA 2V3FA 1G1YA 4W7VA 1I1XA 3VTRA 3BVTA 1QWUA 1M53A 1OINA 3OG2A 3BSHA 2CYGA 4HPHA 3WMSA 4NXKA 4CN4A 2OSYA 4NSBA 2CCRA 1ISVA 2XVGA 1J0YA 1FH8A 3F5KA 4P7OA 2FHCA 3BVUA 3VIHA 3BUPA 1R34A 4FLRA 1J0HA 1SMAA 3G6LA 1B31A 1R46A 1CDGA 4JKMA 5CGTA 2O9RA 4AXNA 1W3KA 2F1AA 3BCDA 1GJUA 2F61A 5GQBA 2OYMA 3VU2A 2X1IA 1CECA 3DX2A 4HA1A 4MNKA 2Y4SA 5CGMA 2J8FA 5BXSA 1CXKA 4CN6A 1KTCA 2QV4A 3SCOA 3NSMA 1SR0A 4NRRA 4OZOA 3WD0A 1V6XA 3F5LA 2DSWA 4LYQA 3ZJKA 3SUUA 3WH9A 1VEPA 2VZTA 3KEHA 3WFLA 3VSTA 3ARPA 4XZWA 2EBNA 2C7FA 4L4PA 3ARUA 1CEOA 2XTKA 3H55A 1GVIA 3IJ9A 4F79A 2TAAA 4H8HA 3QOMA 1EOKA 1HJVA 3CHFA 3APGA 3WL0A 3OGSA 5CXPA 4KMQA 4AISA 2GK1B 1BTCA 1NWUA 4FLQA 4OBRA 1GQJA 4BS0A 4F8XA 1QHPA 4F9DA 4DO5A 4H2CA 2VZUA 3WQVA 1NM9A 3ARWA 3UG4A 1L8NA 4TX8A 5JIWA 3MUZ1 3OGRA 3AMKA 1YQ2A 3WY2A 1Y7VA 4CCEA 3SCVA 3DX3A 6TAAA 2DGAA 2WPGA 3AIWA 1DTUA 3OGVA 4CD7A 3QGVA 4XV0A 1QNPA 4CD8A 4GO8A 3VO0A 1VBRA 1E70M 3HG4A 3PZTA 2WMFA 4YN5A 3EDJA 1CIUA 3VNZA 3EDEA 3N15A 1BYBA 3ZR5A 1OD0A 1ESWA 1UWRA 1Q6GA 5EB8A 2WANA 1V02A 5IHRA 3CUHA 4JAWA 4JCLA 4AD1A 4B3LA 1E3ZA 4PMYA 5HNNA 3CHCA 1QNQA 1V02E 3UR8A 2WKGA 4AIOA 4CKQA 3L2MA 3BC9A 1WPCA 3RJYA 1UWIA 2X2HA 2JIWA 4FNTA 1E43A 3VGDA 4HOWA 1FHLA 2J75A 5I78A 3WKZA 2YL8A 2GFTA 4D72A 1V3MA 2J62A 3LPGA 2PWHA 1B3VA 4LQ1A 2NSXA 2GK1A 1TUXA 4B9YA 4ACZB 5E9AA 3W4RA 2J79A 2V5DA 2WAGA 4OJYA 4K68A 4MNJA 2FH6A 4MNMA 3HG2A 3VDBA 1JZ5A 4AZHA 4WSJA 4GI8A 3KZSA 4X9YA 1NWSA 2XUCA 3BLKA 1G94A 3W24A 4U2ZA 3AXHA 2J7DA 2VX6A 1W3LA 3LX9A 4M82A 3D51A 2VZSA 3TOPA 4HZ8A 3AZTA 4MB1A 1V3IA 1UD5A 3ZO9A 3VUPA 4OIFA 2WW5A 2VTFA 3CZ8A 2VRJA 4DM2A 4HZ7A 5DFAA 3ZT7A 1FHDA 1EQCA 3BAXA 1OB0A 4HTYA 2WLZA 3RM4A 2A3CA 1HT6A 2J78A 3OLDA 3EYPA 3CUFA 1JNDA 3CZLA 1W9DM 3THCA 7CGTA 2EAEA 1UKSA 1VEOA 2NT1A 3BH4A 1HF6A 2PI6A 2XYLA 3I3BA 4U2YA 2EADA 1BYCA 2DH3A 1BG4A 1U33A 3BAJA 2J7GA 8A3HA 2Z1KA 3CZJA 4MJ4A 1M7XA 3GXTA 1JYWA 1QW8A 3SCWA 5E6ZA 3PTMA 1E55A 1WDQA 2VVSA 4LPCA 2VVNA 2VZVA 1K9EA 4B9ZA 4PMQA 2W4XA 4JKKA 2DEPA 1YHTA 1ISWA 1VBUA 4WLCA 3N17A 4W85A 4ACZA 2BXYA 3AHZA 2XM1A 5I6SA 3WY4A 3VGEA 1HTYA 2XIBA 3CZEA 1C90A 1US3A 3WNPA 3VMPA 3FXYA 1FFRA 2WVVA 1NP2A 1XHGA 4MPKA 2J7BA 4AZ5A 1JF5A 1NOUA 1E6XM 1UR9A 1LJYA 5F7UA 1M01A 5BXPA 2F7OA 1UR2A 2VZOA 1UASA 3KL3A 1W3HA 3GM8A 1TQVA 5A8MA 1UA7A 3VGBA 3AHVA 2VCAA 1AQHA 2VL4A 1W1VA 3O2LA 1J01A 3RPMA 1BYAA 1XC6A 2EEXA 2YLAA 1HL8A 2WMJA 3A5VA 2XN0A 5IFTA 2JE8A 1MW1A 5A69A 1E0XA 2WB5A 3FN9A 3IK2A 2CNCA 2ZOXA 4LXFA 4TVCA 3VSUA 1DWJM 1UQYA 1HKKA 3DHUA 2PC8A 2VMFA 3GXFA 5E09A 4FK9A 4PTXA 2WVTA 1OGGA 1OT1A 4MNLA 4UZUA 3A4WA 3TV8A 4PMXA 4UFIA 3LPFA 1AMYA 1CZ1A 4CGTA 1EHAA 1UR4A 3WNKA 3NIYA 4AY1A 3BMWA 4J27A 5EMYA 2YBTA 4DWSB 2D3LA 4L4OA 2XG9A 3VIFA 4CVWA 4B3KA 2CITA 2ZX9A 3MMUA 3EJUA 1XV8A 5E70A 3FAXA 3AI0A 4YHEA 5AC5A 1SYTA 1KXVA 5HPCA 2ZUWA 4UFLA 2W66A 1PEZA 4NZFA 2W61A 4J3VA 3N9KA 4GXPA 4H41A 2ZUUA 1HJQA 3WNLA 1FA2A 1W9BM 1QNOA 1QPKA 4HU0A 2PWGA 4MB4A 1TCMA 1LLOA 3PZNA 4C7FA 4NZJA 2YDSA 1RP8A 4X0VA 4FF5A 2EO7A 4GPNA 4AZGA 2EPNA 1UZ1A 4IM4A 6A3HA 1E5JA 3AS3A
chains in the Genus database with same CATH superfamily
5KMYA 2E7LA 2CLIA 2PGFA 4J6IA 4U3SB 3RE0A 4ONVA 1AHWB 4Y6GA 4WFFE 4U3AA 3QEUA 3Q9QA 1A6VL 1S8DB 2RACA 3WH6A 3KCLA 4UINH 2Z93A 3PP3H 2C1OA 1MHEB 2GK0B 4L8SC 4XTRD 4I85A 2YKKA 5IVXB 3WO3B 1LM1A 3WLTA 2B1OA 2R91A 3KBJA 1QI3A 5G4WA 4M8QB 4I5BB 3JYBA 1IAOB 3QG7L 1BVNT 3TBYB 3NQ2A 5DO2C 2IPTH 4XISA 3FTGB 5CCKL 4YSUA 3H26A 2QCLA 1JGDB 4QXGH 3OXSB 2C4XA 3CFDB 1WG3A 1L7TL 1Y0LB 2PW2A 4JPKL 4UMSA 4Y19A 3ZTNL 3P2TA 4ZMWA 3HN3A 4JHAL 4QXTB 1JK9A 1JQXA 3QG6B 1G7MA 4Y19E 2O7SA 1TTUA 1WGVA 4HGWB 4ENEC 1L2UA 4GIPD 1DANU 3BCFA 4U0QB 1ZANH 35C8H 1ZL1A 2X4UA 5JA8B 2W65B 3FO1A 1FWCC 2W0KA 4EI5C 1DDHA 1MFUA 3IDMA 4I8DA 4LIQE 3WX7A 2XA8L 1X5LA 3SKUD 4PCFA 4WFGE 2X4SA 1ZJBA 2I5GA 1VLXA 4GIOA 3V0FA 3ULVL 4AGNA 1NIFA 4Q7NA 3BP7B 5KS9F 4OOZA 5J11C 3E8UL 3DETC 3TBCA 4GUFA 4G9FA 4JY6B 3TM6A 1NJ9A 1UZ4A 4G9FE 4YC2B 5KSUB 1QG3A 4DIAA 3JZ7A 1NJJA 4FZ8L 1NLDL 3FCGA 1U8LA 2Y06H 1WA1X 1I7TB 2VEKA 4H4NA 4PB3A 4G1EB 4ONOA 2N7SA 5C0CD 1N5YH 1IVTA 2OWWA 3RU8L 4H9VA 5SV3A 1X5GA 1XC4A 5D38A 2R1LA 2R0KL 3LG3A 3UERA 1R3KB 3BKYL 1M65A 3U4BH 5KITA 2NQZA 3GKWL 2J9ZA 1U93B 3K6SB 1OB1A 2DQGL 2BOGX 4BF7A 1DEDA 1WD8A 1LBMA 4HWZA 4AW7A 1H7NA 1V10A 1BGXH 2C9QA 5CIPA 1KB3A 3SCTA 1QCWA 1TKWB 1MFDL 4LZKA 3T4YA 4TSAL 4DYJA 2HFEB 3U9WA 4U28A 3C09B 4W89A 1H3WM 2EJ1A 3RDKA 1PBGA 2MQCA 3W28A 4LCCC 4W9HC 3GSXB 4IFKA 5FDWA 2QKIB 5BS0E 1A7OL 3TN4A 5E9DD 4WK9A 4N42A 3T65B 4TTUA 4Z2HA 3QXVA 4WK0B 2CPCA 4KVPA 4XN8A 5L0QB 1CFVH 3TO4C 4AENB 4ZTOL 3L5XH 1G5AA 2ZCHH 3LH2L 5EOCH 3IXAB 3OLGA 3TN0D 5BW7A 1SBBA 3N1QC 5IHHA 5F8RC 2J2ZA 2WXIA 3QDGA 2YC1A 3HAEB 1O5XA 3RWIB 3TA3D 3LDVA 4KDWA 5CLXA 4UFMA 3QIUC 1K4GA 3VDGA 1KYOK 4DELA 3DVFA 1GGIL 1EEXA 4CQAA 1EBAA 5CZXC 2QHAA 4HN8A 4OLEA 3RX9A 1UWAA 3SD2A 4YAQB 4JS7A 3OX8B 1S2TA 1OF0A 4GW1B 2WAQA 3NIDB 4TSCH 2X4QB 4GBXD 1CFNB 5EC2B 4AL8C 4LOVA 3SCMC 4MPQA 1Q1JL 2J9XA 5D70H 1ZLSL 3QTPA 5MI0B 3N2XA 2HJLB 1IEAB 1IT9H 4KKLD 4QJ3B 1FLTX 2HE8A 1W72H 3PBYA 3ATFA 5ESQA 2CM5A 4UQDA 3FZUD 1CFBA 3U9IA 2K6ZA 2W38A 1VF5C 1J5DA 2AK4B 4JTDA 3TBTA 5BV7B 2FSDA 4NVTA 1A3RH 1E1EA 1XINA 3T8XA 4DBDA 2RQEA 5LLIC 2NX9A 4PJIA 2YJLA 4AMCA 3HC4L 4PP1C 2HVMA 5MENB 1HVXA 3OB8A 4PJIE 1GY1A 2UX6A 1QI4A 3CC1A 5I1JH 4LDEB 1AKPA 2NUTB 4O57A 2E7DA 1D5ZB 1Q13A 1E73M 4IOIA 4PJ9B 1XR8B 1A1NA 2FGZA 4CD5A 4YHIA 4WRLA 4PV9A 1UR1A 5AENA 4PWGA 3DPBB 1TV8A 4X6DA 3QEQD 1RHFA 2HJPA 4WKZB 4X6DE 3L17A 2VX5A 2VSDA 2Z34A 4J28A 2OW7A 4GRWH 3STLB 4JUSA 1U2YA 3T04D 2DLIA 3RMJA 5JW4M 3M5YA 2VDKH 5IB3B 5SWZB 2Z24A 2PTZA 2D4DA 2ZXAA 3U6WA 4KDTA 1MLBB 2CJTA 3HS0C 5IVNA 43CAB 1IEXA 1RU9H 4R96B 4NG3A 1RUMH 1WUNT 2HKHL 1XF4B 4PHZA 2FBRA 4J1UA 4QM1A 2VR8A 1YLBB 4GP4B 4FP8H 3UJIL 3UGVA 3HQPA 2EG7A 3MUIA 1RHCA 2JIXA 1DUZA 4K71C 1MFAL 3OJDA 3VQ1C 1E6ZA 2G95A 4W8LA 4FMKA 2GSGA 1L9QA 5K9CA 3LB6D 1NGQH 1GW6A 2OO6A 1XWVA 4ZS7L 1VRXA 2YPKB 5F0LB 4XTRC 3FV9A 1IKFH 1LNUB 4MFHA 3RFZC 1YG9A 3MFGB 4UMCA 2JKEA 4GOSA 4Y4FC 4AZCA 1VACB 1EC8A 2W59A 4RK8A 1VPOH 4M7LT 2AV7A 2ACUA 3OMAB 4IDJH 5I75C 4ACPA 3IGXA 3FQNB 3SGZA 3GZAA 3HUJB 4F0LA 5F2GA 2J7HA 2C1HA 4OLXH 2J13A 3SDXF 4DOHE 3V5HA 1GK8A 1AFSA 3OG4B 4JX4A 5BNXD 5AC7A 2A7PA 1XD0A 2OMNA 5I3IA 4Y1AD 3ELQA 1L5GA 3B9VA 5I18H 2QXWA 3HG1A 1EZLA 4MA1C 1KDIA 1W17A 3TWYA 3UZJA 4YQXL 3HG1E 4Y5YB 1LO4L 4Q6IB 2X3BA 3WFBL 1JZJA 5D7SL 4U33A 2A3HA 3OVGA 2DWEA 2ZQKA 1ADOA 4CC4C 2CWNA 1J0IA 4NYUA 3HI6H 1HI6A 1HIML 3BD3A 4RNFA 3AITA 3NO1A 2OOFA 1NMBL 3OG3A 4ADSA 3UXAA 3B1UA 1B2YA 1YTKA 2R29H 1VQTA 3OVQA 4GRLB 3MREA 4X7TA 4AVHA 4D9LL 1JBJA 3PGCB 3ATAA 4BSWB 4ZZ9A 1WAPA 5DJZA 3LZRA 4HJIA 2LABA 3QUYB 1JK8A 3G0SA 3AU2A 3X14A 5GGQL 3Q4DA 3EX6A 1H0DB 2C6QA 2YXGA 5HGHA 1S7VA 4JW3A 1HH6A 2IAMC 4JR5A 3V7MA 4Q4RA 1GT8A 3NOYA 1MCDA 5HULA 4IGBA 1TPXC 5LGJA 4LNYA 4IPLA 2LAGB 2IWEA 3B8YA 2HLAB 5CG0A 3U82B 2PPCA 1YEKH 1NBYA 2E5CA 1L3WA 2VDRH 4MD5A 5DJCB 1AYOA 2AJVH 1J5SA 3CB3A 1A66A 2GKIA 4UOW1 3RGVB 4BQBA 4RZCB 3RB5A 1C9SA 4MTVA 1A5UA 4P5RA 1M1XB 2B5IC 3GR8A 4XCCL 2A83A 4D8PB 3F1QA 2CBVA 2GBUA 2VGIA 4N87A 1K8DA 4TVUA 2EGZA 1OPGH 5JBFA 1T2QH 5AC4A 3ZTJG 3HTLX 3ECVA 2WNQA 5C0BD 3WL9B 1XBVA 1OHZA 2R2EA 2I16A 4I5XA 1N6QL 3AADB 3L5MA 3MJGX 4MB5A 3LN9A 2PU1A 5CLZA 5I1GH 4QP0A 2CUHA 3W25A 1OAZL 4IHCA 2OMXA 4S1SL 2V2WA 1SFSA 2EC8A 1NOFA 3UCDA 4BQ5A 2YQ2A 3GJFK 3TP4A 4PUMA 5GGTL 4LEXH 3V7AE 1LP9A 3TA3C 2ZCKL 2WQAA 1LP9E 5FYKD 1B90A 3H53A 4OZFH 1U3ZA 4W88A 4WY0F 3E38A 4ZRGA 5IHLB 5CLWA 4J3BA 5JMRA 2G30A 1I0DA 1KLGB 2XIDA 4H25A 3NA4A 1NFDB 4AD0A 2V5CA 1ZHLA 4U4MA 4MSWB 1EAPB 1NDGA 1HHGB 3GAKA 3UESA 4KKLC 3H2MA 1MYRA 4YX2L 2DQMA 4ZOCA 3QJHA 5K9OB 3SCNA 3FZUC 4N8VB 3JV6B 3JU2A 5L2KB 4HIXH 4X7SH 3FO2B 1UXWB 2C3VB 1IC4H 4RAVB 3D4YA 5F21B 3VD9A 3S5LB 3K6IA 5LAPA 1MPAH 4XHQA 3DSFL 3WLKX 4U6HB 1NBQA 3QUKA 1MRFH 1UZDA 3UA3A 3JTSA 3FB5A 3SUWA 4JPQA 1I2RA 3WF3A 1I8LA 3AFLA 1QFUH 2PF8A 3S35H 2VX4A 1JVKA 1VJSA 4TSBL 4AEIL 5K7JA 5IHBA 4I9WD 1OSZB 5CILH 4P2QD 1A4LA 3ZUCA 2DUXA 1F6FB 4WFHD 3OIHA 4KVNL 4HSCX 3IFLH 3KR3H 2E7FA 3DX7A 1OZQA 1EANA 3FFSA 1OBAA 1TTAA 1FNHA 4FQ1L 3W74A 2PDLA 1URLA 2WSYA 1GJPA 1UACL 5C71A 2EACA 3TJHC 4D0CB 4JANB 1KN2L 2Y1VA 4MKMA 2FTAA 5I30L 4FHBD 1G43A 3P14A 5ADPH 4JDZA 3CQQA 1YLVA 2OLAA 1HNYA 4GKTA 4NC1C 3P9LA 1HXYA 5DJYA 4JQAA 3EMQA 3FDWA 2Z9TA 1IGTB 1OZMA 1QR4A 2EE2A 2WXRA 3GDCA 1DIKA 2N01B 1HE7A 2QDVA 3LB6C 1HJUA 2O61B 4DGWC 1UZGA 3BUDA 4JFFE 1A6VH 3IDNB 4H9TA 3AIVA 1FWDC 2E56A 1RMFL 2NY5L 3SY8A 1A1MB 2JKRM 3SPJA 3ARXA 3SY6A 1DZ0A 3HPLB 1EERB 3O3EB 1KV5A 3SO7A 4HBQA 4ZO7A 2EAWA 2E75C 3GNOA 1E4KA 1EO5A 4W5UA 1WE5A 3STZB 3ZM8A 3QG7H 4ZB2A 4GXMA 3DO7B 4FXLA 4GVHA 4RH4A 3BE1L 1NCUA 4AYSA 3AUVA 1P1ZB 1M1BA 4J8RA 1MDRA 2FD6L 5FWRA 1L7TH 1NMCB 3FHQA 3V9EA 1E5ZA 4JPKH 3O81A 3C61A 3ZTNH 1ALDA 2G3XA 2QDGA 3HZ3A 5G4MA 2YHGA 2Y7QA 4LCWD 1Q9LA 3L4YA 4UQIM 3ZDYB 4IRJA 1U2CA 4QSHA 1EEYB 2F8OA 3ZXAC 5C2XA 4L8BB 3CV2A 4RGOL 5BZDA 5I09A 1ETA1 4Y5VB 3QF0A 1H9VA 2WZEA 4DP9X 1ZNNA 2XA8H 1X7QA 1YNTB 2UYLA 3PP3K 4UQAA 3S36X 2YXXA 4UTHA 3S46A 3MVIA 1YIXA 5T9CE 4P5MB 3ULVH 4JJOA 3E8UH 4PS4L 2FTYA 4E68A 1E7UA 5E51A 3MNWA 3B56A 3T4AC 2ZVIA 3HGOA 5CJQH 2A6DA 1MI3A 3AREA 4FZ8H 4PFEA 1NLDH 5JIDA 5AEAA 1FH8A 2FHCA 5FO8A 2GW5A 4O00A 4S1DD 1CFQB 5E8EA 3GMRA 4J9JA 2X1IA 3FRPA 2IH3A 3QPEA 4BK9A 5CGMA 3RI5K 1R4XA 3V6BR 1W8GA 1MMFA 3N6QA 3NSMA 4BXVA 4NRRA 3X3FL 5EULV 2DU2A 3FQTB 4E5TA 3KTXA 2WZ5A 3BKYH 4FG0A 5DMKA 2ZC1A 4XZWA 5DUBB 5KZMA 4U1SB 3WIHL 3GKWH 3VRLF 1DLHB 4LB4A 2DQGH 1QVOA 2VFEA 3GVRA 3LSOA 3TDFA 3ZE0E 4E41B 4OZIA 1W54A 5E4AA 2DJSA 3UG4A 1P7HL 4C59B 4OZIE 1YQ2A 4AH7A 4TNFA 1MFDH 3PANA 2DGAA 4TSAH 2NW3B 2YQ3A 3FQUA 3QGVA 5IEHB 2NVDA 4QSFA 4MDIB 1DJIA 2H32A 1KV3A 2OCJA 3ENEA 2PPDA 4WDIA 4XBPA 2J21A 2XWBA 4LJ3A 1QNQA 3WHE0 4CKQA 2BSTA 2JIWA 4JN2B 1FHLA 2DW6A 5DQJB 1JCLA 1M2OA 4ZTOH 4I6KA 1W5OA 1NTDA 1YYLL 3S2LA 1H8OA 1CDJA 1AI1L 4ODUB 2YKLL 1CFSB 3VDBA 1S1PA 4GW4A 4WSJA 4Y16B 2Z0UA 4M82A 3LX9A 5DUJA 3K2GA 4YS4A 4BDVA 4NOFA 4J2XA 2F7IA 2Z31D 4DP8X 4DP2X 2JI3A 3LKQA 1GGIH 3HHSB 2VDOB 1TQBC 5KSAB 3MNDA 2J78A 1W9DM 5DUPL 1F3XA 4IHOB 1KCSL 3BH4A 3R43A 3O2DA 2DH3A 3H7LA 4WEBL 2QELA 2Z1KA 4PGDB 4MJJA 3W9EB 4NENB 1M7XA 3DOSA 1QW8A 4B5XA 1Q1JH 3L3KB 2Z8VC 3SKNB 3TO4B 1KNOA 1ZLSH 2VVSA 3NIGB 3ECWA 4DF9A 3BRFA 5FYJE 3CJJA 4N6QA 4LMQI 2EIEA 5E9NA 3IACA 1JXDA 4L1XA 4LUSB 4ZQCA 1H7WA 3NFNA 2W9EL 3CDZB 1NOUA 2O4EA 3IU4L 1UR2A 1BJ1H 4N6FA 1ZHAA 1ZGLA 2WNGA 1G5GA 3QW3A 4RWYL 2GABA 2VCAA 4Q8NA 5IVZB 2F8XC 3KOWA 4LDLB 3HC4H 4IQJA 4FXKC 5IQOA 3B3IA 4A6GA 1CS6A 3SCMB 3IK2A 2ZOXA 2FB4L 3B2VH 4Z7NE 1IU1A 4DN4L 4M8RA 4M7ZC 4CGTA 2SEBB 1Q0XL 2YBTA 3TL5A 4IRSD 4JRLA 3UTTB 2QDWA 5MHBA 2TRYA 2PGRA 3AI0A 3DI3B 4GH3A 4ECLA 4PJBF 2NXYD 3MCG1 3MRHA 5ID0A 4Z78A 1J5CA 3OA3A 4KT2A 3UYRL 4BKLB 5JHDD 2EPNA 5JIQA 5D6DA 6A3HA 2Y70A 1E5JA 5EUOF 5F4WA 2HKHH 1IJNA 3J7HA 1H60A 4Z7VB 5REQB 1MCSA 5LIWX 4MF4A 3UJIH 3AZSA 1VZIA 2CHZA 2HLFD 4LFHG 1UJ3B 1FDZA 5DJXA 4HH9B 2GTQA 4A66A 1MFAH 3MV9D 3L3IA 4GISA 3F6JA 1C16A 3ZZ1A 3CIQA 4HCHA 2VX7A 1AY1L 5DWPA 4CADA 3W75A 4FB7A 1HFBA 4ZS7H 5E4IA 5JIIA 3BKML 1IUZA 4GG6B 4JQ4A 2ZUYA 4HFWA 2VR4A 5H35A 5KZEA 2EKJA 4Q8WA 4YHYC 2PEVA 2QPFA 2QPSA 1WSST 3ZKXC 1Q90A 2ENPA 1R3WA 1XGUB 1C1EL 2DOCA 4KFNA 3ULVF 2L8AA 3RKPA 2GT9B 4K38A 2WCAA 1XPGA 3EYVB 2V5BA 4B9PA 5AOLA 1BXVA 3DGDA 2IMMA 1CICB 1YAIA 2CXKA 1BEXA 3RL1B 5HYQB 4V1DD 2H9GA 4JGJA 5LGYA 1R3YA 3M44A 5B8CB 2HJFB 3TIMA 1X9LA 4KKBD 1TOXA 5JLZA 4GLEA 1UXSA 3EFOB 1ZANL 35C8L 2VDPL 2CKBA 2X05A 3KWSA 1G87A 3UTZA 3W0KA 4NJAH 4H13C 2WWNA 1OYAA 4YSAA 8FABB 2D3JA 3HR5A 4Y4FB 2K4WA 2QKSA 2OZNA 4JFOA 4YQXH 4HCFA 1LO4H 2V4LA 4YDJA 3B3DA 5D7SH 2XQYA 4ZX4A 1PTDA 4FYSA 3S6CA 4AT6B 1U8HB 1XR2A 4ZQKB 2EIZA 5FIEA 5I75B 3W7JA 4W8BA 3SSGA 3VI4F 5A95A 3MV8A 1E6PA 4PWHA 3ILDA 1R3LA 1NMBH 4F8PA 3AROA 3Q6GH 3MV8E 5EO1A 5RUBA 3IJDA 4GYPA 1ZPLA 1X8FA 3M16A 4D9LH 4S1DC 3VKKA 4RJEA 1JPIA 3OKLA 1XIWC 5I8OH 3ZTJH 3M17A 1GZ1A 3NQGA 4JO5A 3K1DA 1XP3A 4BHUI 5BOFA 4GUOA 3HC0B 2D3NA 4GS7B 3QKEA 3U4FA 5ESVB 5H1WA 1JERA 1Y6NR 2OMZB 3QPKA 3G5YB 5GGQH 4NERA 4NQCE 3GUFA 2X0VA 4TTDD 5CWSA 3SQBA 3WK3A 1KPRA 2BNRA 5T3XE 3PVFA 3FJTA 3SBPA 1JVNA 2BNRE 4IW4C 3RAJL 4ANWA 4X8GA 4K3DL 1JNHA 3NJMA 4ENLA 4D7PA 2VR5A 3UY8A 4RLIA 3QW9A 2ADJA 3KBNA 3RX7A 3QPZA 5KAQG 4XCCH 1JVOA 3SE3C 3CHVA 3CUGA 1IKNC 1XGTB 1S9YA 2WZTA 2IAMB 3WDIA 5FYLL 1XBRA 5DC0A 1VFMA 1UD8A 2F1BA 2Y3NA 1WFIA 1N6QH 4X5RA 7XIMA 2FVNA 4XXCA 3S0CA 4ZMGA 2PLKA 4LX4A 5AVXB 4RFEA 3RIKA 1DJYA 1OAZH 3K4DA 4S1SH 5B7FA 3V0IA 1UMYA 3S4SB 3W01A 2BZNA 3B2UD 5D2LB 3QXDA 5GGTH 1RCYA 4G71B 4ZUVB 4FXRA 3IJHB 4KRZA 2E7HA 2ZCKH 3KNBA 3S3CB 3CUJA 4ACYA 2Y25A 1SXZA 3QAZB 4LVHC 5C08A 2HMID 4W9EC 3UEQA 1IWPA 2Z31C 2XVPA 4EACA 5IJCC 4AUJA 3WIFA 1F2JA 5C08E 3JRKA 2J4WL 3H3KA 5F7NC 4GD0A 3SDCB 2AXGB 2WD0A 4KCWA 4N0UA 4BA8A 3MA8A 2V7NB 4PJ5B 5M95B 4U1GB 1NGXA 4LS2A 1D5MA 3L5WB 5D70L 4IKNA 4TQPA 1YN6B 5D7LA 5B38A 3IE4A 3WDRA 1XJBA 1W8SA 1T8XA 5D7LE 3P80A 4YX2H 3BVDB 3R5EA 4QRRA 3G3DA 2HXUA 4AWTA 5E6YA 4ATTA 1OGBA 4NKDA 4QRRE 3TH6A 1BIIA 3MRQA 3IEAA 4C6EA 1KRBC 1E8XA 4O19A 3D39D 1NFGA 2H6RA 4NKOA 2SFPA 3H2OA 5L88L 3CLFL 5LNGA 3JVGA 3NTCH 2XH7A 1PO9A 1FH5L 4QQUA 2VRQA 3BW3A 2JF6A 3SPHA 3VFMA 2APXA 5I1JL 3DSFH 5JNYB 3MHFA 2ZZUT 3S2MA 1MI5B 4F9JA 3N1AA 2LFEA 3FTUA 3TBSA 5AHEA 1KM3A 2WXDM 4TSBH 2PZ0A 1OWWA 4IRSC 2NY6D 3D9AH 4JM2F 4IGNA 2FFIA 4ISVA 1LYQA 4KVNH 2YQBA 5HHOA 4XX1E 3PP4L 2NXYC 2ZNWA 1KFAL 1A8JH 4PVBA 5GS1C 5HHOE 5BMFL 4FS9A 2A99A 4M51A 3GUTA 4UFKA 4B15A 3E2VA 2EINB 5T9BG 2YPVA 2JI1A 3KLKA 2PW1A 1SRDA 4Z3GA 4N90E 5I30H 4DP1X 1KLYA 1L0PA 1AL7A 5D7KD 4WWKB 3KLLA 2Y24A 2H6UA 4EN2A 2FWUA 1V8EA 4XWOD 1DSYA 2B8OT 2OX1A 4TUOB 1NH6A 3EYFA 3VGAC 5HTSA 5DF0A 1O4UA 5M1TA 3GSVB 1DQDL 1ECQA 1RMFH 2NY5H 4RFOL 1JZ3A 9PCYA 4FZIA 3GLAA 3O16A 4HJUA 4POZD 2OL3A 5EUKA 3MFFB 1IBZA 4JCMA 4PGCA 3RDTB 2FJGA 4QIUA 3BQ6A 1W1A1 2WWMC 3OF6D 5TDNB 3ZE2B 2P47B 4IDJL 2ZIDA 1PX3A 3N29A 3K6OA 4FR6A 1CBVL 1F8MA 3CQIA 2ACRA 3QQ1A 1T21B 3BE1H 3I6EA 1P0NA 4ERSL 4OLXL 2WKLA 5FA4A 4M7LH 2OR8A 1OQFA 2FD6H 1OK6A 1JPFA 3TYUA 3VXRD 1EXGA 3MWCA 3SBQA 3IF1A 4DP0X 1GJIA 3G08A 1P1VA 1XCTB 5INDA 4ORMA 5XIMA 3NA9L 8XIAA 1EDGA 2J8HA 1M3IA 4RMTA 3D3AA 1JR1A 2PYED 2W07B 1ZXQA 1M6JA 1VRDA 3OODA 1S7RA 2CO7A 2CLKA 3RNKA 1XM3A 1BX2B 2TMDA 2DQ6A 4QYAA 1NBCA 3LKNB 2P7TA 4PS4H 5EO9B 2UZXA 2YSSA 4J12A 4LP4A 4KRPC 1UOWA 2P80A 3ARFA 4WI2A 2DQEL 3BTNA 4OTKA 2CIPA 3RQ3A 3WDPP 3HEIB 2E9GA 1R75A 4LVGA 3RNDA 1GQLA 3GGWA 2X4TB 1BWVA 5T8IA 1BZ7A 2INEA 4QOKA 2DUZA 2ZICA 3BCJA 2PTVA 5C7HA 4TTDC 1U8CB 1WZKA 3T40A 2CNYA 4QOKE 2VC2B 2VM3A 3X3FH 4IP4A 1U41A 3S5ZA 5L6UA 4FI4A 1RVKA 2VRAA 2WBKA 3K8LA 1ZT1B 2ZKYA 4CVUA 3WIHH 5EC1B 2PDQA 3PFUA 3RR4A 2AJVL 3B2DC 3IDJB 4JVUA 3L7EA 5ABFA 1V6WA 2Y0FA 1D2KA 3P8IA 1E8YA 3FQXB 4H0LC 4N5ED 4PWKA 1CT8A 1C8YA 2ZX6A 3KGRA 1WTGT 1MWAH 2G3MA 4QF1B 3SB0A 1WCQA 3ZR4A 3IRSA 5D8ZA 2J72A 1ZS8A 3KPLB 1OPGL 5TQLA 2O5XL 2G75A 4HYTB 2G37A 3EB2A 1GPFA 2XXGA 1MRDH 1ZBWA 1SJAA 1PZAA 4GVFA 1AJ0A 1G7LB 1J6OA 3KVPA 5I0WA 4ONFL 1O66A 5FI8A 4ZMOA 3T08A 5CZ0A 2KMWA 3VNDA 1U3JA 1I8MB 2MQ0A 4OV5A 4KRLB 3QQ9D 1XFCA 1VFOA 1QWHA 3GFXA 4H9XA 1LROA 2PDIA 3B2UC 2DYPD 1MDLA 4EOWL 1CGXA 4C56D 2YK1L 1AQFA 4ESKA 1XH1A 4M1DL 4YSTA 1S4IA 2X7LA 3TJXA 3DX8B 3ALXA 3KP1A 3SBWC 3UG8A 4EDWL 2NV9A 2HMIC 2YKLH 4ADGA 3QC6X 4A7UA 1NC2B 4XAFA 4YVXA 4N1EA 5DS2A 4YPJA 4UNVA 1JGUL 1W3JA 2WXJA 3NESA 4NO3B 3GU1A 4PGEA 3IGAB 1YEYA 3UOAB 1XLBA 3W9DA 3SE4A 5H37G 4W7WA 4ZFOB 1E4XL 3MBXL 1M5WA 1UZ6E 1KRMA 4IMKA 3T3PB 1KCSH 1OGTA 4NP4L 3SQOL 4WW2C 2H90A 4W1TA 2XRAH 3BP5B 4WEBH 3C8KA 4YK4C 3NZQA 1J0ZA 1KO0A 3FU3A 2BW5A 2WTRA 2WO3B 3OKMA 3FFCA 3ILQC 4NHVA 5KZ6A 4IOSD 1MUJB 3BPLB 5A6LA 3TBWB 2HRGA 3FFCE 2W9EH 4RMSA 3T8MA 1VADB 3RNQA 3IU4H 1XH3A 3UC2A 4RISL 3IJEB 4MD4B 2YOAA 3VCNA 1MHHB 4RWYH 1KWGA 5C9ZA 3VFUA 1U5HA 3GE7A 1P84K 4IJBA 5E8NA 2ZXEB 4ZTPL 1TEYA 1TZ7A 3WH7A 3KAAA 2ZAHA 1P48A 1ZSXA 1U5JA 3Q5YA 3S35L 3FVDA 2F7PA 4F3HA 4KRTA 1Q0YL 3GRGA 5IEKB 2FB4H 3BH8A 1RZMA 3G7TA 1XL6A 4DN4H 1U8IA 1RI8A 5KG9A 4US6A 2WXKA 1Q0XH 4NJ9L 2Y5QA 4LCYB 1UWQA 3NO5A 3QXUA 3W76A 1GG0A 2VUYA 2LT9A 5EN2B 2R8WA 3P62A 5ABGA 1HL9A 4ERAA 3U9UB 1R5IA 2QT3A 2B7PA 3FA4A 4C6FA 1L9NA 5LAXA 2F7QA 3QWQB 4NLAA 1DBML 3QZWG 2V5SA 3B7RL 3UYRH 4JQ1A 2H7WA 3GMNB 1ZRQA 1EA9C 4BWWA 3DGCR 4L18A 4I0KA 4NQDE 3FXGA 2AI0L 4XWOC 2BX5A 3BZ4B 1AQDA 4Y5XC 1I2NA 4XP6L 4L29A 2C16A 3KM8A 1Z9OA 4HGKC 4WDWA 5L7XH 3B0PA 1XAUA 4UWQB 5JXEA 4BF9A 4MXVF 1OP5H 4TL4A 4LLMA 1XX1A 4L3AA 2JJSC 1AY1H 3BPCB 2P8PA 5E99L 2WO5A 3ID7A 3IGUA 2QGEA 3BKMH 5MF5A 2HVKB 1V8HA 5IB5A 3L0KA 1YEJL 1QSEA 5DFVC 2RALA 3FN0L 1C1EH 1KZQA 2AERT 1BWLA 3O41B 3SGDH 2BP8B 1J05B 3PDDA 1QSEE 3O8AA 4XNQA 3N40F 1GORA 3NFPB 4BQ8A 3HBZA 1UXLA 3PPHA 5IWLA 4I5UA 3HFMH 4N2DA 1P7QD 3DDFA 3MLYH 1BF2A 2FKPA 3TVMD 4FABL 2QHLA 2HKAA 5GRXG 5FJRA 1QBLH 4OGYL 2H26B 4NT0A 4AEEA 2CLHA 3LAFA 1XR9A 3VIJA 2VDPH 4R9OA 4Z7UA 4AWSA 2EZ0C 3JQOB 3DGGB 1AZZC 2H3NB 2IOIA 4Z7UE 5JMUA 4LPUA 3H4GA 2X4NB 4QRNA 2MCPL 4XRCA 4ALAL 3T2QA 4OD2A 2FX9L 3LKOA 1F1AA 4XUYA 4P57B 3S88L 3WJJA 3I7SA 2VEIA 1Z9SB 3DMMB 1T40A 3PSWA 3EGDA 1QRNA 3S97C 4CU8A 3O4LD 1O9ZA 1QFWL 3FL7A 1QRNE 3WLHA 4GC4A 3MRIA 2R51A 3RUGA 2P0IA 1JCNA 4XTIA 4O8AA 2YZ1A 5CJQL 4H6KA 1YBQB 1FP5A 3RUGE 4TN9A 4GLRH 1EJSC 3WU1A 2HS6A 1CLOL 1INEL 4NPKA 2V68A 2DJ4A 5IW1B 4MNKA 1L6XA 1SDYA 5I3KA 4D0DA 3QEHA 2OBGA 2BZCA 1KG0B 5JW3L 2ZRYA 3WAKA 5TH2A 3V0VB 2HQAA 4JTKA 4Z7OF 2EXWD 5HJDA 4LSRL 3WFLA 3OPUA 5I1KL 4C1KA 3GC3A 5KVDE 4MASA 3VNKA 2ZZ3A 1EK3A 5LGKA 3PJSA 1JRCA 2HPOA 4GNJA 4AMAA 2GK1B 4XO8A 3CMOH 2X5PA 2QJGA 1D9KD 3RAJH 4OCWH 1AO7D 1PV8A 4K3DH 2G2NA 4LVOC 4XMKL 2H3XC 1UPMB 1MEXL 5KZCB 1XIWB 4M0XA 1FVCA 1E2WA 1ECZA 1DTUA 3QQ4B 3S1XA 2X88A 4XV0A 4HAFA 3C6LB 3FBKA 3AM8C 4KZCA 3VRJA 2P43B 3PZTA 4XXWA 2Q87A 5BS0A 3EDJA 3ABMB 3QRHA 1RJZA 5FYLH 1BYBA 4HK6A 1IGML 4PJFA 4HUXA 4ANXA 2ID5A 3MYOA 3CHCA 3QQ9C 4PJFE 3L21A 3L2MA 4Y7OC 4EZKA 3TF7C 4N85A 2P88A 4HEPG 1TWDA 1M7DB 1GSMA 4ABVA 1XGEA 3W7PA 1FN4A 3MV7D 3WKZA 4HK0B 3OBKA 2FIRT 2LE9A 4XX5A 3V4PB 3VA8A 4NO5A 1QLFB 3GT6A 3KX6A 3MRNB 5MEPA 2HAZA 4FC3E 3EB3A 1HSBA 2APFA 3W24A 2VX6A 2IFFH 4JDEA 5MEQB 1DJQA 1HCFX 1GGOA 2WW5A 2V5TA 3LZLA 3ZT7A 3VFTA 4HIEB 4QHUA 3GIYA 2J4WH 3OLDA 2KHAA 5EDXA 3VC5A 7CGTA 4U2YA 1ES0A 1ORQA 2RH9A 3DBNA 4MJ4A 1FCBA 2EDQA 2DS4A 3VKJA 4JFXA 4X63A 3EGXB 1RQBA 2VFHA 3U8GA 5INCB 1EXUA 3UAJC 1W56A 1P7BA 4RAHA 2EDEA 4HKJB 5DD5L 3X1GA 2IS7A 4KO9A 3I84A 5TE4L 2BCKA 1UOLA 1EFXA 3FQRB 3U3HA 1O9WA 4MCZA 4LVHB 1KJ2L 1E3FA 5L88H 3CLFH 1O7SA 3IVKA 4F7EB 4GJ1A 2PDWA 4HIQA 4PRIE 5DJAB 3O2LA 1FH5H 1H5BC 4LLWA 3EOEA 1EGMA 3EJCA 3MRJB 2WB5A 3ITLA 1TRIA 2NX3A 1HQRB 3MHGA 2EDLA 3B2VL 3MY9A 1HKKA 1KCBA 3KW7A 4UZUA 2ZC8A 1XL4A 5CEZD 2OPCA 3EH3B 1SSGA 2W9LA 4MY1A 4P2RD 5EMYA 2GQAA 4L4OA 1KJMB 3QGKC 4KUCD 4DX3A 4TV6A 2DWYA 1UWEL 2BP3A 1P5UA 2R1YB 1JJKA 4PTUB 2W66A 3PP4H 2CO3A 1KFAH 5DN1A 3RL2B 5BMFH 3FOLA 2ITCB 4RZKA 3ROLB 4JDTH 2YDSA 2EO7A 1N9PA 2K6WA 4L9LC 4IQEA 3VVWA 1L6WA 3DIFB 4KK6D 1N8OE 1A80A 1XDJA 3SYOA 2FNWA 5T3ZE 5BZAA 3KVLA 5FLUA 2WMIB 1QASA 1KYAA 3ZMRA 2BIPA 3FBQA 1U8KB 4L4VB 3IDIB 4MUZA 4FXSA 3KRSA 3SY0B 4N6RB 1KT2B 4R9HA 4GYJA 3LXCA 2KPWA 1AQKL 1Q9WA 3OQ8A 4RXGA 1TQTA 4XWUA 1DQDH 2J8UB 4PV8B 1JUBA 1H6EA 4RFOH 5DGRA 2LVCA 2QUVA 1J7VR 1EDQA 3O8XB 1EJWC 3BANA 2Q1EA 3F5JA 4A39A 3UFYA 9XIAA 4LLDB 3TW6A 5I0YA 4PRDA 3LDBB 1ONQB 1VLWA 3ESUF 2VL5B 3LRSA 1G9HA 4AZ8B 4YDKL 3JWOL 3QMTA 4G9DA 4GW5B 4HHHA 1JCTA 3FSZA 2IC2A 4KXZI 2UY4A 1CBVH 4UV7L 4ZMQA 3FULA 1KGYE 3QRLA 4ERSH 1NQKA 3TVMC 1FF5A 1K8IA 4BWTA 1IEIA 4EN3A 4PW9A 3GB7A 2VISB 3P4LA 1E2VA 1BBJB 3JWNG 4TO8A 3WJMB 1X5ZA 2I26N 4NJAL 1GYVA 1DQXA 1KYUA 2DWXA 3NA9H 1RERA 2VIRA 2E7BA 1ZA3A 2PP7A 4MQ7A 4WHBA 3HFFA 3PFQA 1RAMA 2Y5JA 1IEHA 1KPUB 4ZXBA 2FQFA 3JS3A 4TX6A 5C0IA 2LLLA 1UKPA 3Q6GL 2GJ6B 1V0KA 1G7UA 1PD0A 2I57A 1QFWM 2WLLB 4AEFA 1NDZA 2ZWLT 1W8OA 2DQEH 3S8GB 2XKNB 4HNUA 2FZ9A 5I8OL 4N2GA 1BRLA 3FT4B 1CDYA 1FO0A 4QAIA 2UZ9A 5L8LB 4P4KA 2OTUA 4N25A 4CSTA 1YRRA 3UD6A 4J39A 5ENLA 5JDSA 1U8OA 4P5TB 2EXWC 2XTJE 3MBEB 1F02I 3RHWF 1UFGA 2DICA 2ZUNA 2VABA 3DRQA 4QJ4B 3W1QA 5D32A 3CXOA 1D9KC 3LKSB 1GKEA 2B7NA 1P9MA 1NCNA 3F05A 3WGVB 4KRPB 4J2MA 3P9MA 3MVSA 3E12A 2FHBA 5LGZA 3HW7A 2GJNA 2VN7A 3UPCA 2EIBA 2IQAA 4V2BA 2GCYB 2BVPA 3N6JA 4ODBD 4QRTB 3KPOA 4DFHA 3L4XA 1G01A 5H37H 5DR5L 3CE1A 3DRTB 1NVMA 1C8XA 3EX4A 3WH8A 3MV01 2O5XH 1EHXA 2XH0A 4X5XB 2YPLA 4MJHA 4E4PA 1K8ZA 1TR1A 3ARTA 4B9JA 1B3IA 4DF0A 2YPLE 4FERA 4ONFH 3UPRB 1FNAA 1AQ0A 1M3JA 4R4BB 3P54A 3T2PA 5H8UA 3PUEA 3LM7A 3UZEA 5T1KB 3TN0C 4G56A 3QI9A 4X4YB 5CZVH 4EOWH 1GZPA 2YK1H 1ONXA 4M1DH 2CLOA 3B8DA 1KXVC 4EDWH 1T5XA 1PZ0A 1HCZA 1KTRL 4JTCA 1JGUH 3K5XA 4MYXA 3D2UD 2IAAC 5IMKB 2FYVA 2XXFA 2XN2A 4GBXC 4UUJB 3DIPA 2GG1A 1E4XH 3MBXH 4F33B 2CCVA 3TTSA 3P67A 4NP4H 3SQOH 3B04A 1E67A 7PTDA 1GOFA 4QHMB 3WUFA 2ALAA 4IS6A 3RN6A 3W1AA 1GOOA 4PY7B 3WS3A 5JOEA 5M03A 2UVEA 2JK5B 4UQBA 4W70A 2F8VA 2WJEA 3NTCL 4OLUL 4KEMA 4B0MM 1TSRA 4YNYB 4RISH 1RXOB 1M03A 5EOQL 2AQRA 5C9UA 5BZWB 2JKWA 3I65A 4XAGA 5DT1L 3RM8A 4E6MA 3VA6A 5SWQB 3NQVA 1KCUL 4LPVA 4ZTPH 3LV3B 4WW2B 4Y9NA 3G6AB 3FB8B 3QK0A 5F7BA 3N44F 1VBGA 3EG9A 2ZX7A 3LMYA 1Q0YH 1IV8A 1XFPA 1OABA 3MAWA 2NLJB 5HYEA 2IXVA 2VW6A 3D9AL 1JZEA 2ALWA 1REQA 5D8JL 5BWFA 3ZHFA 1UB6A 1DVZA 3QORD 2BP0B 3NCBB 1RCQA 2BX7A 1IILE 4NJ9H 1OC5A 4P7QA 2CGYA 1MOEA 4QEEA 1F4YH 1TJHH 2VELA 3DVIA 4PRHD 2WHLA 2HPIA 5ANHA 3L95B 3ETSA 2CDFA 3L8QA 4Z9KB 3IXTB 4UOQA 4UIMA 3QP3A 4KK6C 3J27A 3T09A 1DBMH 1S7SA 2KC0A 2DMGA 3KYKL 3N19B 3TC6A 3S2CA 2PWDA 4OJEH 3MTWA 3VGFA 4AQ8C 3RLGA 3I4EA 4H40A 1OEZW 2AI0H 2EXSA 5HJ3B 5FF0A 3VRIB 2R1WB 1A3LL 5CP3H 1V5XA 2CZDA 4F27A 4JFFA 4XVOA 5HI4D 4IH3A 4XP6H 4HIBA 2A7NA 1DIDA 5BOEA 3TCEA 3VX0A 3WEBA 2CUMA 2EDDA 1EJ8A 5JIKA 3F2CA 2QR0A 2X38A 1CENA 4X22A 4YBHA 3Q2NA 2APSA 5AYQA 5IMMA 3S8HA 5E99H 2F74B 5KVEL 4DBUA 2JALA 1M56B 4BM7A 5I17A 2IXQB 5CPLA 2YRLA 1YEJH 5I3FA 3FN0H 4IXXA 1E50A 1KB5L 2AITA 1N70A 1K6WA 4OGXL 3EHBD 3BXWA 1DQIA 4Y5XB 4M7LL 2GTWB 4M81A 3RZCD 4BEIA 1JDAA 1EIBA 5CSRA 4FAAB 3WK2A 4RMWA 2GUBA 3ZXWA 3P4NB 1LO0L 4FABH 5CGYD 3TJPA 4OGYH 4BKSC 1A5LC 3QO1B 1B4TA 3EBVA 4XX6A 4JZNA 4JZOA 1HS6A 4L8SB 1GKPA 1FX6A 1S2EA 5IQ9B 1OP5K 3MACL 2EP6A 1PD1A 4D9RE 1CN4A 1FZMB 5DJ8B 4WWPA 2MCPH 4ALAH 2WGNB 3CFKB 5EPMB 1HTIA 2FX9H 5HK4A 1NMAL 4MJMA 4A7TA 1OFEA 3S37H 1PHQA 3S88H 3HJEA 4Q2ZB 4D0BB 1QFWH 3BJSA 2DB8A 1KUMA 2A6KB 3ABGA 1FWBC 1JQVA 2ZUMA 3N0AA 2V3EA 3DARA 1NEZB 1YVLA 2TODA 1CLOH 1INEH 4M7SA 4TOQA 3A6CH 1R5YA 4XP1H 4YSDA 2Z91B 3SD5A 4EI5B 3OMIB 1QEXA 3REVB 3NWRA 3G2GA 4AMWA 4C6DA 5JW3H 4EI6B 1Q9OA 2VITB 1ANUA 3AXLA 1BZDA 4LKXB 1L9WA 4LSRH 5FFGA 5I1KH 1IEBA 1P7KA 5C0FA 2F53A 4LF3A 2K8MA 3DTXB 4EPBC 4KRNA 5J11B 3ZHKA 4UTKA 2YL5A 4C6LA 2F53E 4IX2A 3GM0A 5DYOA 3BVXA 1DHPA 1KPVB 4CN1A 4V2XA 3QDJD 1RSFA 1PFCA 1BD2D 4UTFA 4IFRA 3W72A 4XMKH 2ZWKA 3SDAD 1DFBL 1MWAL 1H3XA 2W0UA 5HQMA 1MEXH 4DW2L 3GNDA 5ABHA 4O4YL 4CNIA 2IH1B 5DWUL 1YMHB 2TSBA 4AIZB 1MRDL 1I85A 1V7AA 2PO6D 2Z0BA 4Q8PA 1LGVA 3FA5A 3UXKA 1IGMH 2AEIT 3L3OC 5K69A 1UBPC 1T99A 3KPPA 3P81A 3G5XB 1NBVL 3BFQG 1KIUB 3XIMA 5FUCC 1QWKA 1RK1B 5BRQA 2V2TA 2FDSA 4KK9D 4BE5A 2XI9A 3EJSA 1AGBB 2ADYA 4PYSA 4GAJL 4LVOB 2XTLA 2WQUA 3ZSTA 1IEVA 5MKGB 2VGFA 3LXAA 4FX8A 3WHXA 2FNBA 4D9PA 4A3YA 3GBNL 1NIEA 4K3EL 4PD4J 1FP9A 3WUWA 4JPVL 1V5JA 4QT5A 1GOXA 5I1DA 4LCCB 1W9UA 4LWWA 3DXAE 2OELA 2VQUA 1GVYA 1HL2A 5AHMA 1GVFA 3JWDC 5DY3A 4AYFA 3BZDA 4WZ9A 3B9NA 1AD0A 4MWAE 2XRAL 3E2RA 4MJIA 3F7YA 2OMAA 2R2HB 4NI3A 4AVFA 3W56A 3NGBC 2GOUA 4MJIE 1HZKA 1PBYA 3WD1A 4ZAKD 2QS8A 2XIOA 1ESOA 2VLMD 3JZEA 4ROPA 5I66B 3KVMA 3LD5A 3W5MA 3MLWL 4AYBA 5DD5H 4NAEB 4UQ3A 1V51A 4RXFA 2YDAA 2VD9A 5FO2A 5TE4H 3UG5A 2XSBA 4L8CA 5CN1A 3QDAA 3UWQA 2C0AA 3UZYA 1KJ2H 3QIUB 4QXWA 2MQGA 1LT8A 3PXHA 4XIMA 1A4AA 2VM9A 3RWEA 3RPIB 1G67A 5I16B 3CHOA 1S5NA 3ZE1E 1RZ8A 3UYIA 1GIGL 1F8IA 3OR6B 3VFSA 1AXSB 3I6TA 3M07A 4UBPC 3NSNA 4DUXA 2VE6B 4O2EB 4IIQC 3VXUB 4PJIF 4MKSA 3MNZB 3TAOA 3QORC 2ARWA 3PFMA 1JPTH 4CNUA 3QJQB 4E3TA 2PUZA 4LANA 3EIFA 1RXLA 3PWVB 5CU5A 4UM9B 1UWEH 2QVFB 1HWWA 4R6UA 3WJLC 2E40A 4ZNEA 5IK3A 3FTWA 1XIFA 2EO1A 3RIAK 1W6TA 1S9XA 2C9RA 4X6DF 4ZNEE 1Z69A 1VRSA 4WX2A 4AQLA 4FTVD 2PDUA 3CSTA 3THDA 4NQEA 5HP5A 1XB3A 4BH8B 4NQEE 3K46A 2VM4A 3WQFA 4B16A 4XKYA 1X96A 1FYTA 4D9QE 5HI4C 2R2BA 3JWNH 4B53A 3BVNB 4UU9A 3TYDA 1FYTE 1CW2A 3UZQB 1NKRA 2NSMA 1MZYA 5L7XL 3K7UA 3BWAB 5IJKC 1CO1A 4CQ8A 5AZUA 2R8SH 3VXQA 4S38A 4IKJA 1AQKH 4AZ6A 1T04B 1MO0A 1HHIB 2A4CA 1R3JB 4NQVB 5AAMA 1QUNB 3SRHA 3HS0B 4JLRA 2BZDA 4WEVX 4QLJA 3M7OA 1DBTA 3EHBC 1ZSHA 1JPGB 3G1RA 4YDKH 3JWOH 3KBMA 4G1KA 1V3JA 4EBQL 2JLLA 2X1QA 2D7MA 4MMXA 4UV7H 1SYVA 1U8PA 3OZPA 1AZNA 3HFML 3HZKB 4K71B 3MLYL 3BDBA 4PG2A 2FJFA 3AC0A 1DYZA 5CGYC 3WFEL 1S1RA 1QBLL 1TVLA 1BZ8A 1PLAA 2NNRA 4NI6A 3G9VA 3WS6A 5J6GA 4POYA 1S5IL 4XB3A 3RFZB 3B8SA 1GTNA 1NSNH 4ZD3L 3MUUA 1TVBA 1S5HB 5MEOB 1QRKA 1W9VA 3WKML 4OAWA 4FXGA 5E1AA 3RYSA 3ARSA 1LG2A 2OL3L 1QZ1A 3BHBB 4W7VA 1I1XA 5BOPA 3TVMB 4KOCA 1KD0A 2OSYA 4TPRL 4F8QA 4HG4K 2XVGA 4PHXA 5HHVL 4JKMA 4GXFA 1E5UI 3CX2A 4I2XB 1DVYA 3VU2A 4G5AA 4RGMC 3WFHA 1V27A 4MA1B 4PRNB 4NQCA 3KYAA 2DQCL 3HJZA 2ESVD 1ZT7B 2XQ0A 2CIIA 1X4YA 3V6FA 1FL3A 2HT3D 4GAAA 3KBHE 2WINA 2Y72A 2E1WA 3O0FA 4KMQA 5ACZB 5AYZA 1YHPA 3CMOL 4OCWL 5D93C 5U4NA 3SDAC 1L8NA 4GKSA 5T1MA 4IG2A 4NP7A 4X4XB 3XISA 2MNRA 5F7WC 5BQ7B 6TAAA 5DEGB 5C0CB 2C7UA 5CN2A 5AG8A 1FL5B 3QDMA 5DR5H 2VLRD 4F7KA 4L1LA 1TE6A 1BZQK 3ECBA 4HUUA 3QDME 3HHRB 5FM5O 5K3VA 2PCEA 4NUJA 4ADUA 2XA3A 3UJ2A 4PYGA 4PMYA 4RMBA 4U6XA 1TPXB 2I7SA 3PUOA 3BC9A 1E43A 4P07A 2A38A 2INZA 4KK9C 5I78A 1QNIA 2VC5A 2YL8A 1RZ7L 3VXTA 3UNTA 1WDDA 3ASOB 5H4ZA 5E9AA 1OC6A 3OPZL 4OJYA 1MUCA 4MNJA 1J4EA 3J07A 2EDXA 4PTTB 4GI8A 5E5MA 4PLKD 2B5IB 3L9RB 2IFFL 5BUPA 5E6ID 5TQ2L 4NAFB 2CLLA 1NUDA 3CZ8A 1OB0A 1CFMA 5E9DB 1LP9F 2O30A 2NY4D 1S7XB 2EAEA 3PSVA 1BG4A 3BAJA 5JQ9A 4QKXB 1BF6A 2VZVA 3SRDA 4ZAKC 4NUMA 3TN0B 4A6YL 1M42A 1IFRA 1DORA 4MD0B 4NRXA 2Y85A 3WLOA 3C9NA 3CL8A 2JCCB 5DTFB 4F93B 1C12A 3VH8A 3TA3B 3FTSA 1QRQA 4N2EA 3HCVA 5CR8A 3UJRA 4OLUH 2YLAA 1WAUA 5I6MA 5EOQH 1ICQA 2I1OA 4OFQA 5I6LA 1RIVL 4GBXB 4I3SL 2GSMB 2BMKB 1UC5A 2WJZA 5DT1H 4LXFA 1KCUH 4PJCA 3DHUA 4FK9A 3FGCB 1YY8B 4PJCE 3URNA 1AW2A 5F6HI 1DKWA 2DYRB 1NAMB 3WNKA 5FV1L 1VDGA 4LEEA 1ZLUH 1IAKA 4NL1A 2BOBA 2E25A 5D8JH 3U4EB 5JHBA 5EBLB 1Q7QA 2ZUWA 4QXUL 1SO6A 3NZUA 1TR9A 4ELMA 1T0MA 1SF5A 4H41A 3O6CA 1O7DE 1QNOA 4ELME 1AP2A 5CSBA 5FS5A 2FX8L 4JDTL 3KPQB 4AQ1A 3VXMD 4MB4A 1SY6A 3D3VD 1UT1A 4E0RB 3UTPD 5F9JB 2HCVA 1P2CA 3FJNA 1Z0MA 5JBDA 2VP8A 3PZVA 1X4XA 3O6AA 3BYTA 4G7YL 3KYKH 2CO6B 2HLFC 2GITB 1DJSA 5HVGB 2AMGA 5A40E 1TV7A 4F80A 3N43B 3QEQB 3DX1A 5J5RA 1A3LH 1E5NA 3MBFA 4IXHA 4JN7A 3CFJB 1TKKA 2QSVA 2WZIA 1Q9KA 2O5YL 3Q7JA 1K77A 3W7GA 3INUL 4JPGA 3QUXA 5DJ0B 4M5ZL 5F1IB 5EZJA 3NACH 5KVEH 1JGVL 1CGWA 3CM4A 1XTLA 5AVQB 5LNDA 2OPJA 1H49A 3KOXA 4WKHA 4AM0B 4AKOA 2MCAA 1JF6A 4QO1A 3GD1C 3DBXA 2J7EA 2AQ2A 4G8GE 4A2SA 1RJRA 1IAII 3PWGA 1KB5H 4C1NB 1V08A 4OGXH 4E2BA 1K6QL 3VYOA 4QX4A 2AV1B 4IMLA 4IGHA 1KKOA 4KKBC 3A4XA 3VK5A 4H8QA 1BF8A 3KCPB 4GB9A 4PRPD 3U2IA 2BSSA 3ZRSA 2ZAGA 1LO0H 1QP1A 3VIIA 1I2QA 4I48B 5F3HB 3NPXA 3QFJA 3DERA 4AXWB 4G7EB 3QFJE 5A8OA 1ZHKB 3MACH 1P4BL 5IMLA 3WQ8A 1XIIA 3QZEA 2PDBA 2DT3A 4C7GA 5ABTA 3LBMA 5KEZA 4EF8A 4GJIA 3VFWB 1NMAH 4IIGA 1ACCA 1YYML 5BOJA 3JZYA 4UQ2B 1AODA 2E46A 1Y1DA 2A9AA 1BMZA 3MNVB 1LTDA 4Z08A 5FB8A 1KCVH 4Y1AB 3PPCA 3O3RA 3V35A 3FH5A 5HHQB 6CGTA 3H2EA 1F3JB 5K59E 5AVSB 1XDTT 2ISFA 4ZZKA 4XVUD 4GABA 1KBVA 3D48R 3GIVA 2MCMA 4M1GL 1QSFD 4DGYL 1A1OB 4IPNB 4K7FA 1K4CB 3BDYH 4KXDA 1X9UA 2XACC 3FTVA 2OX5A 1XSOA 2HT3C 3PWNA 2IG2L 4X6FB 4OUUB 1R5VB 4DAIA 4FALA 3KBPA 2DJXA 4LIQL 3GR4A 1GPWA 3IE9A 2V0AA 3DFHA 1ORSA 4MYWB 4M24A 5ITFB 4PUBL 2XXCB 1IQDA 1R5WB 1ZE3H 4GXUN 3T4AB 3EXLA 2ANUA 2NTSP 7REQB 3FYEB 4M6QA 2BY1A 2A6IA 3HMWL 3K6DA 5HR7A 1DFBH 1F56A 1UB5A 3L6FA 3ZE0F 3W85A 3QO0A 4DW2H 5CJ5A 1SFDA 4O4YH 5DWUH 3SPCA 4OZIF 1X97A 1CVSC 4QHPA 3M0JA 4ZPVB 2BTMA 4Q4OA 4HUVA 4UTBA 4KKAD 2XWEA 3V5DA 5AVRB 4JTHA 1AUSL 1AS6A 3VINA 3I6LD 1BFSA 3P2VA 1U8NB 1TUFA 2IANA 3A24A 3NCCB 2ZZ6A 3AZRA 2WZPD 1NBVH 3GY1A 2R1XB 2IANE 2HBXA 1X5AA 1CMOA 2X4RB 4DJDA 3EBIA 5CZVL 2W27A 1XDMA 4MJ6B 2EDYA 1Q6OA 3GK8L 1UP2A 2ZD0A 4GAJH 4PM1A 4MAYA 2P4AB 1LWHA 3OWRA 5T3XH 3MLZL 5E6IC 1RZIA 3MP5A 3N12A 4P3WA 1QBML 4QRPA 3GBNH 2ATKB 2C4FU 1NCWL 4RA0C 4K3EH 3DBPA 4GO6B 1VFLA 3FNDA 5C0BB 4JPVH 3EAUA 2VXQA 4QRPE 4PREB 1K4DB 2NY4C 4MKVA 3RJOA 5HYSB 5CHNA 4Z2GA 4UMAA 1CNVA 1TE1A 2GVLA 2FLIA 3JTTA 1KIPA 5T33L 5E5UB 2OMWA 1YPZB 1YDYA 3L4VA 4O13A 4OUIA 2VSMB 4F2MA 5B21A 4P5SA 2OTWB 1T1XB 4MMYA 1PKYA 5DEFB 3V4VB 5EZLB 4O16A 1X7FA 3WAJA 1A4JA 5LA2A 4F2ME 2G2RA 4DLFA 1OAJA 4ZQNA 1J11A 3EJQA 4W84A 1Z48A 1L9OA 1EOMA 1HDMB 4IKKA 2OWCA 1TFPA 1S3RA 3DOHA 2E3VA 3MLWH 4BFEA 4PJEB 3WTVA 2WWKO 4Z3IA 5GRZA 2F54D 3FSOA 3VTTA 2BVUA 4OFCA 5B1CA 1KTDA 5F88B 2YSTA 2WC4A 4XPAL 5FX3A 1TQBB 1T22B 1LEKB 1ZAJA 2Y9RT 3M5VA 5DHYA 4PR5B 1GIGH 4MHHG 5DC2A 4EWND 1M9WA 4PFMA 3TK7A 2MNJB 4G6AD 1TVHA 4JPIA 2FSEB 2NY6C 2XN9E 3KPRD 6REQA 4UDUB 3ABOA 2XICA 1OLLA 5FIPA 4WO4A 1FHNA 4Z7NF 2PLCA 5H8MA 3TVAA 4YIQB 1F4YL 1TJHL 2C5DC 2VDQB 2FCBA 2PRMA 2DEYX 2JSFA 1WT5C 4ZK8A 4XVDA 3LK6A 4F92B 5ELIA 1GOQA 2X3AA 3HLAA 2VFGA 3CIVA 2G4EA 1NGYB 4NO0A 2FZDA 4ZW6A 1U9KA 4H8VA 4FXKB 3E9AA 4NQDA 1I8IA 1CC3A 5TBOA 2WWDA 3RX2A 1GZGA 1F0LA 3BGFC 1RCOB 4D6GA 4P2QB 4R7DA 1UGNA 3C3UA 3E49A 4M7ZB 1U92A 5DMIL 4BFGA 1TR7A 3W82A 3CWHA 3B0YA 5I28A 3WBYA 2VLJA 3HE6D 4GQPH 4YU1A 1SJCA 3NEXA 2CUAA 3GX9A 2IALA 2VLJE 5IBUB 2NT0A 2MNUA 2GTZB 1U0QA 2YEZA 4POZC 3NJNA 5FJPA 3ICJA 4RIRA 3BVVA 5M3WA 4X2UA 3LCGA 3ZLHA 2YLKA 4ZQMA 1EQWA 2BC4A 1GG1A 5DCCA 1OZTG 3TZVA 3F03K 5J04A 5LDUA 3FUNA