3BAWA

Human pancreatic alpha-amylase complexed with azide
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Alternative catalytic anions differentially modulate human alpha-amylase activity and specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 178
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bawA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bawA01
3CZ8A 3EJPA 2RGMA 1ZBCA 2IUZA 5DFAA 3BH4A 3EDEA 1PPIA 4HU0A 1EQCA 3I3BA 2W5FA 3N12A 5A6KA 3N15A 1J0JA 1J12A 3M6DA 5A6SA 4CGTA 3BUPA 3A4WA 5E6YA 1QI0A 1UR1A 4LPCA 1CENA 2UY4A 1GOMA 1K6AA 1Q6GA 1C8YA 1GHSA 2WNWA 4GI8A 1KWGA 1CLVA 3UG5A 2CEQA 4FNTA 4NI3A 1WDPA 5GQBA 4CD8A 1HXKA 3VIFA 3N11A 3U5YA 2WVSA 1W3KA 4F9DA 4IPLA 3NUKA 2J8FA 1RD6A 4MB5A 3CUHA 1R86A 2WVTA 2EPLX 4WLCA 1HKIA 3L4XA 1CBGA 3T09A 1NQ6A 1JYXA 2BS9A 4OOZA 4UQBA 2F1AA 5D9NA 2MANA 4WSKA 4DO5A 2DGAA 1JIBA 2BNJA 1KBKA 3BSGA 1CGVA 4AZGA 4U3CA 2WK2A 3MMDA 3BMWA 4WF7A 2X09A 1XH0A 3N17A 4H41A 2EADA 4YHEA 3DHUA 1E0XA 4UOQA 4MAZA 3LRKA 1WZLA 1HX0A 3D51A 2W66A 1W3JA 1BF2A 3WELA 1JNEA 5A8NA 1PJ9A 3PZMA 2GDUA 7A3HA 5LA1A 1E4IA 1FH8A 3CHCA 4ZENA 2QMJA 3VGFA 3VMOA 1C91A 1ITCA 4W8AA 1M01A 4UCFA 3BLPX 5A2BA 1BAGA 4AMXA 3ARWA 2ZX8A 3HG4A 3EDFA 3TA9A 1HKMA 3WUFA 3WF0A 2ZX9A 1OSEA 2VX4A 3F5KA 2XSBA 3L2MA 3WUEA 1MXGA 4D6DA 4IISA 3L4VA 1JNDA 2DSZA 4HMDA 1J0IA 2C8NA 4D6FA 2OW6A 4GKLA 2D1ZA 4OUEA 4AEEA 2ZXAA 1V03A 3BUQA 3ECQA 4P8XA 4AD4A 3RMEA 3TP4A 2X2YA 1UZ4A 1OB0A 1DWJM 4BA0A 1CEOA 3GM8A 3W53A 2CETA 3J7HA 2WVUA 2FHBA 1G5AA 1ZBKA 2VO5A 1HVQA 2YA0A 2DT1A 5CZKA 4HMCA 2GK1B 2Y5EA 1VEOA 4D6CA 5A1AA 3AMKA 1YHTA 1EOKA 2J7BA 5BCAA 2WZIA 2J7GA 4UFKA 1NH6A 1P6WA 1BG4A 5CGMA 2PWEA 1HP5A 3ARUA 3W24A 2WSKA 3VGDA 4D1IA 2YJQA 4YN5A 3IGUA 8A3HA 5LYRA 3AHXA 1HJQA 3NSMA 2DIEA 2XIBA 1MFVA 4NX0A 1UYQA 4NXSA 2BFGA 1JZ3A 3WDQA 3WEOA 3OBAA 4AD0A 3SCQA 4KRTA 3HU7A 2A3CA 3SURA 1EQPA 1H2JA 2A3HA 2VX6A 3O2LA 1QNQA 3AQUA 1E56A 1UD3A 2BY2A 1KCKA 2ESCA 4UFMA 1V3IA 7TAAA 1GOWA 4PTMA 3ARRA 6TAAA 1GQJA 3ALGA 1QBAA 3D50A 2J4GA 4KWUA 2XN1A 3WQVA 2D20A 2ZUTA 3VM5A 3U57A 1FA2A 3GYCA 4CUCA 5JIWA 1GZJA 3W6MA 2XVKA 3LXCA 4IUGA 3AHTA 4JCLA 3GXMA 3S5YA 2VJXA 1NWRA 5I78A 1E6ZA 4K68A 6A3HA 5A6JA 2GJRA 3ARQA 1R8LA 1CGWA 1CXHA 4PCTA 1VBUA 1PBGA 2EACA 2V3DA 3UERA 4HP5A 3BLBA 3ZO9A 3DX1A 2VZSA 3CLWA 4P7NA 2CNCA 4JAWA 5IHSA 5A3HA 3SUWA 4LYQA 1G01A 2HVMA 4H8UA 1US2A 3W38A 5A69A 3HJEA 3BVUA 4Q22A 3AROA 4OIFA 5D9PA 1CDGA 2ZUSA 3VGBA 3WF1A 1W3LA 1C8XA 2V5CA 3DYMA 3MKKA 4B15A 1R7AA 5M03A 1JGIA 3VX0A 1B31A 3CZNA 4JZ5A 4UQ9A 1TQSA 1JYVA 2J7FA 3B8SA 2PWFA 5C8BB 2BXZA 3BLKA 4XV0A 1DEDA 4FF5A 2E8YA 3ALFA 2J25A 1JDCA 4UQAA 2GJXB 4TX8A 1XCWA 3UEQA 1H3GA 2F1BA 1CXEA 4HU8A 1FHDA 3DX0A 3MUZ1 2PC8A 3VGEA 5EB8A 4LYPA 2EJ1A 3U5UA 3PBGA 4PMRA 3BAJA 1A47A 3WH6A 3DHPA 2OYKA 2NT1A 4ATWA 4CU6A 1RPKA 1WZAA 4QFUA 4PMOA 1GPFA 4OJYA 5KZ6A 4D72A 5FD0A 3WNKA 5CLWA 3LPPA 3UR7A 5A95A 5FIPA 3CHFA 3TV8A 3THDA 4KRUA 1E4NA 3NSXA 5GNXA 1F4AA 2EAEA 1WAWA 2VRJA 3WF3A 2XYLA 2E0PA 4LGXA 3RCNA 2GDVA 4LYRA 2GUYA 4DO4A 4GQRA 4HOWA 3AZTA 5I23A 4L4PA 1GOKA 2WMGA 3GZAA 3GNRA 3PTKA 1HTYA 3FAWA 4JKLA 3WY2A 4PYSA 2UY2A 3IANA 4GO8A 5GPRA 1V0KA 1LWJA 1TR1A 3ZSSA 4TTUA 3AIWA 1B0IA 1R85A 5HXMA 5AY7A 3VIPA 1HJSA 3EMQA 4KGJA 3OIHA 2CKRA 1X6NA 1LL6A 3FHQA 1BYAA 1E6QM 2XUCA 1BHGA 3AICA 3VOCA 3PZOA 4A3HA 4CU7A 1OIFA 1W9DM 2GVYA 3LPOA 3EJSA 3OGSA 1QVBA 3KWXA 1SFSA 5I77A 1OD0A 2VRKA 4ML4A 3RIKA 3T0BA 3WSUA 3AIRA 4PSRA 1UASA 1JDDA 4JFWA 2WC3A 2BVDA 4TOQA 2DIJA 1UR4A 3MV11 4W93A 3N04A 4PMZA 3AISA 3H54A 1SMDA 5ABEA 3VUPA 3WBAA 4AZ7A 1VJSA 5F7UA 2ZXDA 1XGZA 2QHAA 1PZ3A 1E70M 3DYPA 3I3EA 3AYSA 1FHLA 3DECA 2OLHA 1Q6FA 1PX8A 4AZCB 5E0FA 1J01A 1QI4A 3CTTA 1UKSA 4B9ZA 2Y8VA 2VCBA 2WMJA 4B3LA 2XN2A 2TAAA 1JZ6A 1V6XA 2OWWA 4J3SA 2WHJA 4ZEPA 1OGGA 4FLSA 2WKLA 3KE0A 5I0DA 1K9EA 1JG9A 4J3XA 4X0NA 5BRPA 3AHVA 4J3TA 3D4ZA 3O6AA 1GJWA 1TG7A 2XFRA 3W25A 4NZFA 1Q6CA 5I2UA 3ZJ6A 1LJYA 1L8NA 3PZGA 2WMIA 2AOSA 5IFPA 4HA3A 4ZXOA 2NW0A 1PEZA 2VCAA 3VD3A 3II1A 4UZSA 1UQYA 4CD5A 2BXYA 3VGHA 5BXTA 2EO7A 2O9OA 1UH2A 3BGAA 2VZUA 3U7BA 3OLEA 4PMNA 1AVAA 5DT5A 1SR0A 2GK1A 3N9KA 1H1NA 2YLLA 4NSBA 1UR8A 2CBIA 3KEHA 4FNQA 1MFUA 1E3XA 1OM0A 5GNZA 4WSJA 3ARSA 1DHKA 4W8LA 2XGIA 2JE8A 3BXWA 1G9HA 2ZXQA 4HA4A 4C7GA 3ARVA 4JHZA 4JFTA 2X05A 1CXLA 4QP0A 3ZR5A 4CD7A 5A2CA 3CZGA 1HNYA 1DP0A 3MV01 1QPKA 1E5JA 2VOTA 2ZX5A 1Q6EA 1JZ5A 3FNDA 4XUYA 1NM9A 1TQUA 1MW0A 3JUGA 2B31A 4PUEA 2FDMA 2CYGA 1HIZA 3WH5A 2A3BA 3ZJ8A 5ABHA 4HA1A 1UA7A 2BV9A 4Z2GA 4GZEA 2WMHA 4NRSA 1BG9A 3AMLA 2V3EA 2YDQA 4B9YA 5JBDA 2OWCA 1ZBWA 2JFEX 1EHAA 2ZUVA 2F2HA 3WY3A 1M04A 4U2YA 2EPOA 3FHAA 4MTVA 4HZ6A 3AS0A 4ATDA 1NOUA 2J79A 3WDIA 5A6AA 1VEMA 3T2PA 2PI6A 3VIKA 4LQ1A 3FN9A 3POHA 4C7FA 3VU2A 1ITXA 1H09A 1UWRA 1W1TA 4HZ8A 4MPKA 4DM1A 1E5NA 2XHYA 1HJXA 1JZ2A 1ZBVA 4AWEA 1BGAA 3ZT7A 1GJUA 1E1FA 1MW3A 1VRXA 4P8VA 4XZWA 5CPTA 2QLYA 4MNKA 3NJ3A 3ARXA 2VVSA 3SCVA 3AS3A 4Z2KA 4U5KA 2Y4SA 2XPKA 4CD6A 3WH9A 3CPUA 1HVXA 1LL4A 1H49A 3K4DA 1SZNA 1BVZA 5C71A 2D3NA 2J7HA 2WM0A 1ZL1A 2D23A 3IAQA 3W82A 1O7AA 2EXOA 3ZM8A 1CTNA 5HNNA 3UG3A 1US3A 1RH9A 2IXVA 3RJYA 4GZJA 1BFNA 2CBVA 1ZJBA 3GXNA 4HPHA 4MNMA 3OLDA 2GJPA 4RL3A 5DMYA 3QHNA 1AQHA 1GOQA 3WD3A 3BC9A 3OGVA 3FAXA 4XX6A 3VM7A 3LX9A 2C7FA 4GI9A 3PZUA 1UH3A 4BZYA 1ISYA 2GJXA 4M24A 3PZVA 3VDAA 1BPLB 4WIWA 4DWSD 4JKMA 2CCRA 3RPMA 3PN8A 1KTCA 2YA2A 1FH7A 1UOKA 5HPOA 3N1AA 2PBGA 4WKHA 3S2CA 3WUBA 1CYGA 3GNOA 4H7VA 5CSUA 3EBVA 1IZJA 4GINA 4JL2A 3BAWA 3BVWA 3ZSTA 1LL7A 3AI0A 2PWHA 4CKQA 4MB3A 3WQ5A 1UG6A 2YL9A 2X1IA 5EFFA 1HN1A 2WLYA 3VIHA 1QHPA 3WF2A 2YDSA 2G8ZA 1R33A 5LA0A 2BHUA 4NRRA 1OGSA 4QLJA 1GONA 4W7WA 1QI3A 3CIVA 2CBJA 3MUAA 4M8UA 1MQRA 4PRWA 2WVVB 1BYDA 3ZJ7A 4UFJA 4CU8A 1NP0A 2XVPA 5A8PA 1E9LA 2OSXA 3A21A 2UY5A 2JEPA 2X0HA 5DT7A 3VIGA 4X9YA 2BHYA 3ZQ9A 2PWGA 4PBGA 4NF7A 4AMWA 1V3MA 1QWUA 1TVNA 2CPUA 1MQQA 1JXKA 5IHRA 1XSIA 1H5VA 1HP4A 2VCCA 5M17A 3HG2A 2YLAA 2WKGA 4MJ4A 3BUDA 5I6SA 1UHVA 2J78A 3ZR6A 1TUXA 5D8WA 3BSHA 4ZE5A 3K4AA 3WQWA 1GQLA 2PBOA 3CUGA 1ISWA 2VC9A 1V6YA 3MUIA 1QWNA 1ODZA 1VEPA 1BSIA 1CPUA 3MI6A 1I75A 1T0OA 2ZXBA 2VQUA 3W37A 3IJ9A 3HG5A 1UQZA 1JZ7A 2XGBA 4PMQA 4LXFA 1UR0A 2DH2A 1QBBA 2QMKA 1E4LA 5HPCA 3BAIA 2YOCA 3DC0A 3LPGA 2VR5A 3WNNA 3AIBA 2DSWA 2WYSA 4M82A 3VIIA 4DWSC 3EJUA 3WDJA 4AD3A 4PMDA 1XRVA 2VI0A 3RM8A 3MMWA 2AAAA 3W28A 4W89A 1UD4A 5C70A 5CPSA 1J11A 1F4HA 1FOBA 2EABA 5ECUA 3HG3A 3T2OA 1W1VA 3OZPA 4EAMA 1MW1A 4FLRA 1WE5A 1XD1A 4AZCA 3K8KA 3WH7A 3CV5A 3SCOA 1V0LA 2DSVA 3VSTA 4PCSA 4PTWA 2WW5A 3WQ8A 1G94A 4JHOA 1UWIA 2UY3A 4H8HA 2D3LA 2F61A 4PSPA 1UKOA 2Y8KA 2E3ZA 3VPLA 3AHYA 5ABFB 1KGXA 3CHEA 2WMFA 3A47A 2CITA 4D1JA 3M07A 3CZLA 1XYZA 3MUY1 4S3JA 5HOSA 9CGTA 3SUTA 3VIMA 3G6LA 2FH6A 2YFNA 3A23A 1UKQA 1LG1A 2WHKA 2DT2A 2WMKA 1JF6A 2WSPA 2XM1A 4E8DA 3ARTA 2CBUA 1Y7VA 4AYGA 2CERA 1UH4A 1GW1A 1CGYA 4AY1A 1M7XA 2EPMX 5JUVA 4DO6A 5BRQA 3QHMA 1GNXA 2OWXA 4N42A 2D0FA 4FLQA 5E09A 1V02A 3SUUA 5FKYA 3L4WA 4PTVA 3M7SA 3ZOAA 3VDBA 4FNPA 1TA3B 2ZIDA 2G3JA 2WZEA 1JAEA 1QHOA 5BXRA 3T2QA 8CGTA 3WUGA 4EKJA 1NWTA 3EDKA 3BUBA 1EO7A 2NSXA 1E73M 3AOFA 4B16A 4AD2A 2ZE0A 1X1NA 3U7VA 2O9PA 2WHMA 2OSYA 1JF5A 2BVYA 4AZHA 1OWQA 1PX4A 3AIQA 3E1F1 3WY1A 4MJ2A 1KGWA 5FOOA 3N18A 1FP8A 4P8WA 4H04A 5JBFA 3VMPA 2ZUUA 1DWHM 2EPKX 5CPQA 3PZNA 3PZ9A 1QW9A 3ZMRA 3OLGA 4AIUA 5CJ5A 1JYWA 1VJZA 3AYRA 1KCLA 4D71A 3TOPA 3DX4A 3CGTA 3NDZA 1D7FA 1DTUA 4CN1A 3EJRA 3WDHA 4DUWA 3TTQA 3SIMA 2J62A 2J74A 2DT0A 1LWHA 1XH2A 1KR0A 2OSWA 2E40A 1EDGA 4U5IA 1VAHA 2YL5A 2WWDA 5E9AA 1XD0A 4W7UA 1EIBA 4UZUA 2DPEA 3IK2A 3EJQA 2X2IA 2DSUA 3BCFA 1XH1A 2WAGA 4M29A 1V3JA 2WHLA 1R46A 2XWEA 1TVPA 1G1YA 1GVIA 1GQIA 1TMQA 1UWSA 3NDYA 4W8BA 4H2CA 3WMSA 3QGVA 4NZJA 4DUVA 4PMVA 3L4YA 1UWTA 4E8CA 4TTGA 5D8ZA 1KB3A 1JL8A 2E4TA 3CUFA 2ALWA 3RO8A 4J3UA 1JD9A 1HXJA 2CESA 2XVNA 2D22A 1K9DA 3EDDA 4AZ6A 3L4UA 3GH7A 3MO4A 1ZB5A 2XFFA 3DDGA 1VBRA 1O6IA 1AQ0A 4R5EA 2J47A 5I5RA 4FLOA 1I1XA 1KGUA 4KMQA 1XSJA 1V02E 2QPSA 5A6BD 1JI1A 2XWDA 1DWFM 4HTYA 4M81A 1FFQA 1QNRA 3UCQA 1Z32X 3D3AA 3GTNA 3VO0A 3W4RA 5CLTA 1E6XM 3AMGA 2VR4A 2C0HA 4ZE4A 4JFUA 4A3YA 1CGUA 2YDRA 1HJVA 3A6OA 5BXPA 3FW6A 1W9PA 2JEQA 1NARA 3F5LA 2D2OA 5EFDA 2OYLA 3T0DA 4MNLA 1PS3A 2OYMA 2W62A 1CGTA 1KFWA 1GUVA 2FHCA 4AYSA 1XYFA 4JL1A 1EDTA 2Y2WA 1OIMA 4AZBA 4CCDA 1ISZA 3RM4A 4F66A 4F9JA 1HL9A 4MB1A 2AMGA 3G6MA 1E3ZA 3L4TA 1FH9A 2X8RA 3ZJKA 3WBEA 1JZ8A 3AXIA 3WKZA 1M03A 4N0RA 5JBEA 1QX1A 1EGZA 3BVXA 3WF4A 2F18A 2J75A 1KXHA 2DDXA 3VDCA 4BQ3A 4AMCA 3EJTA 3GXPA 1B1YA 2D0GA 4D6IA 5I3DA 3K8LA 3O9NA 4D6EA 4DWSB 2WCAA 4BQ4A 1W2VA 4OGZA 1EOMA 1HKJA 3CBWA 4ACZB 3GXIA 3A4XA 4KH2A 3WL0A 4XB3A 2JIWA 4D6HA 1N82A 5CQ1A 1CZ1A 2VZVA 1W1YA 1JXJA 4GI6A 4EK7A 3MS8A 2EQDA 4W86A 3WL1A 3HN3A 5CGTA 1PIGA 1CXKA 3WQ4A 4U31A 1UKTA 2ZICA 2W91A 4WKFA 2ZUNA 2DSKA 1WDSA 2EPNA 4OBRA 1HL8A 3UESA 4GXPA 1OT1A 1HF6A 3VD7A 5ABGA 1S46A 3AMCA 3LXAA 3GBEA 2VX5A 3S6TA 1MYRA 1HWWA 4U33A 1C93A 3LXBA 3GDBA 4PMYA 3SCPA 2XFYA 4UNIA 1UUQA 3PHAA 1E6NA 1B9ZA 3POCA 4NZCA 2VRQA 3A4AA 2JALA 2BY1A 4Z2IA 5A6MA 1V6VA 2VL4A 3AZRA 2WCSA 1WZMA 2Z1SA 2G3MA 2GSJA 2IXUA 4GO9A 2XN0A 3S5ZA 3VSUA 5DF0A 2W61A 3B9DA 1JFXA 1QI2A 5E6ZA 1E6SM 4AZIA 1C3FA 2ZOXA 3VX1A 1GOOA 2F8QA 4CVUA 1J0YA 1VFFA 5BROA 1RP8A 4TUFA 3KLKA 4Z2JA 4AD5A 4C7DA 3WD4A 5ABFA 1TQVA 1EO5A 3WMBA 4W5UA 3BVVA 1GQKA 3AIUA 5LA2A 5A2AA 4AEFA 1V3KA 3VNZA 1NOFA 1ODUA 3WDRA 1E40A 4V28A 5DEZA 4S3KA 2OW7A 3OLIA 1E0WA 5AC5A 1B3XA 3AMDA 3CH9A 3BAKA 4J3WA 4Q7NA 5JIPA 1XCXA 3HZ3A 3BUIA 1E72M 1QNOA 1DWAM 3IJ8A 3AFBA 1FFRA 1UD2A 3VD5A 1UD6A 2QPUA 4PTXA 1U30A 4UQDA 5IFTA 2D73A 1TA3A 1J0ZA 4URIA 1UZ1A 1EXPA 3SUSA 4QDMA 3WIJA 3WFLA 3WEZA 1J18A 3IJ7A 3VD4A 3SCSA 1TE1A 2D0HA 3AS1A 3AJ7A 1WDRA 3GH4A 2ZUWA 1OINA 1EA9C 1J0HA 2JIEA 1AQMA 2XTKA 3MANA 3QR3A 3BMVA 3RJXA 5IDIA 1EHNA 1V6WA 4J7RA 4ZFMA 4BS0A 1W9UA 3A5VA 4AD1A 2Q8XA 2WLZA 4LX4A 1KXTA 2QV4A 1A3HA 3W27A 1LG2A 2VT0A 2VX7A 3VIOA 3PTMA 1B3ZA 3WNMA 4JCMA 1CWYA 2VTFA 3RDKA 1KWKA 3DX3A 4M1RA 4PEEA 1OCQA 2O92A 4A4AA 4ATLA 1GOIA 1VFOA 3A22A 4FK9A 1W1PA 2WC4A 3WMCA 4JIEA 1QW8A 3WN6A 2V38A 2JF6A 2ZX7A 4X0VA 1WKYA 3L4ZA 1E0VA 3SCUA 3ARZA 1SMAA 3PTQA 3H53A 3WD1A 1JI2A 4AC1X 1E6PA 3CHDA 2YL6A 3UR8A 1UD8A 2WMIB 2V5DA 1ECEA 3CUJA 4W87A 4DM2A 1MXDA 2XSAA 4YHGA 3CMJA 2YBTA 2FGZA 3DYOA 5CXPA 2E8ZA 2E9MA 3B9EA 3CZKA 4J27A 3RILA 2DT3A 2A3EA 2RGLA 4P7OA 2VNCA 4OKDA 1V3LA 1K9FA 3W0KA 1ZJAA 5AC4A 1WB0A 1J9YA 1PX3A 1KBBA 1W2PA 3DDFA 1B2YA 4MDPA 2FGLA 1IV8A 1LF1A 3MSDA 3WQ6A 4W88A 3WY4A 1R87A 3GXFA 3CZJA 2QF8A 1DWGM 4UFLA 1H41A 2DEPA 2GFTA 1K9TA 4Z2HA 1QI5A 1E6RA 1CECA 2X0YA 4TVDA 1QNSA 4UQCA 3W81A 3GBDA 5AYBA 4GPNA 4UQEA 2CHNA 1UD5A 4FNSA 1EH9A 1B3WA 2D24A 3WNLA 3M46A 2XIIA 2YKKA 3SCWA 3WFZA 3EMZA 1UA3A 2WPGA 3OGRA 3VILA 4J28A 4U2ZA 7CGTA 1KXQA 2XM2A 3EDJA 2BVTA 3BCDA 3WD0A 1L0PA 1H0GA 1OBAA 2G4FA 4J3VA 2ZWZA 3UG4A 3IAPA 1UWQA 3OZOA 2W92A 1CNVA 1VF8A 2WBKA 1E4MM 1U2YA 3L2LA 4TVCA 4P8UA 1EDQA 1QNPA 2BHZA 2YA1A 1IZKA 2IGTA 1DWIM 3UETA 4D6GA 1VB9A 2W4XA 3QOKA 3F4VA 3D5HA 4Z2LA 3SCNA 4FNRA 4JFVA 3VNYA 3CZEA 2PWDA 1D3CA 3BAXA 1KR1A 3GH5A 3OG2A 3EYPA 2WB5A 1OT2A 2VVNA 3WENA 2YBUA 1B3YA 4GZIA 5D9OA 1WPCA 1J10A 4CCCA 3I3DA 2V3GA 3TTOA 4DWSA 1E71M 2BY0A 1XC6A 4DUXA 2DH3A 4NXKA 2CKSA 5A94A 4V2XA 4ACZA 5BYWA 1AMYA 1GHRA 1VFUA 3GXDA 1HJWA 2XVGA 4L4OA 4EANA 3TTYA 2VQTA 5GNYA 3FY1A 2YIHA 3GNPA 3VKKA 4PN2A 3FXYA 4AIOA 2EEXA 4HOXA 3LMYA 3AHZA 1B90A 2UWFA 3K46A 2J7EA 3LPFA 1UKPA 2DQXA 4M56A 3ZIZA 1JD7A 1U33A 1KXVA 2V3FA 3LRLA 2WZHA 1CXFA 3SCRA 1V0MA 3BAYA 3KZSA 2E9BA 1E55A 4HPGA 1W32A 4TX6A 6CGTA 2J8GA 1MVYA 4R27A 1XV8A 3T08A 1C8QA 1NP2A 3VDHA 2W63A 4GQQA 3LRMA 2CHOA 1J0KA 1HJUA 1R7OA 2G3NA 2O9RA 5M3WA 3KL5A 4CD4A 1VFMA 2WCGA 2F7QA 4PMXA 4QAWA 1WZKA 3WEMA 3OA5A 1MWOA 4H8VA 4HZ7A 1ESWA 3AIVA 4XZBA 4JFSA 3KLLA 4CN6A 3WH8A 3WD2A 5EBAA 4RE2A 1W9BM 1M53A 3W29A 3W26A 4FNUA 4YPJA 4BQ2A 3TONA 4UR9A 4F79A 3KL3A 3DX2A 2WXDM 3MMUA 1E1EA 5HDRA 4Y7EA 2XJ7A 4AW7A 1XHGA 1G0CA 3WDPP 4QCFA 1WDQA 2A3AA 1C7SA 5TD4A 1JYNA 1H4PA 1LQ0A 4UTFA 3AXHA 2VUYA 1BGGA 3F5JA 1LLOA 4RE4A 3SUVA 4QLLA 5BWFA 5CSYA 1V08A 3PZQA 2J7CA 4AXNA 3BVTA 1QHZA 3VGGA 2VZTA 4UOJA 4HOZA 1H0IA 3AS2A 5FL0A 1VENA 3CUIA 4UOZA 2XG9A 5FL1A 1UWUA 2O9TA 5I79A 4UFIA 3W6LA 1QOXA 3T0AA 3VD9A 4W7VA 1SYTA 4M80A 1WNOA 3AXXA 1RP9A 4IPNB 4RE3A 5I24A 3SCTA 3KL0A 3QHOA 1BTCA 4MNJA 4B3KA 2WANA 1TQWA 4KGLA 5AYIA 2VURA 4AISA 3SEPA 1C90A 3ARYA 4WKAA 1UR2A 2VMFA 1BQCA 1MQPA 1W91A 4OBSA 1E43A 4OZOA 1D2KA 3PZTA 3MSGA 3ZT6A 1ISVA 1B30A 3QOMA 4P7RA 3NSNA 1VIWA 1C92A 2CIPA 5HBFA 2FE0A 3NIYA 2Z1KA 1GORA 3K1DA 5A8MA 1FP9A 4BCEA 1W9VA 4U3AA 1HT6A 1V3HA 1KQZA 3CC1A 2BY3A 3AZSA 4W5ZA 1R75A 5E0CA 3EMCA 4OOUA 4V27A 1TZ7A 1BLIA 1JDAA 1JZ4A 5IXEA 2X2JA 5A8OA 5A6LA 1UR9A 3ARPA 4IM4A 3B9AA 2ZUMA 2X2HA 1JFHA 3OB8A 4UFHA 1BVNP 1B3VA 2JF7A 4P7QA 3AIEA 2HISA 1PAMA 2ZX6A 1XSKA 2VZOA 2J7DA 5EMYA 1W3HA 1X6LA 5DO8A 5D9MA 3D4YA 4E2OA 1HKKA 5D4YA 3GXTA 4MAVA 1Q6DA 5A8QA 3RM9A 4QCEA 3MU7A 1W9XA 1NOWA 4QLKA 4W85A 3CMGA 4TXEA 1C7TA 4HMEA 1TFVA 2WVVA 3VSVA 3WNOA 2G3IA 4GIAA 3NCOA 3VINA 4AZ5A 2F7OA 5CG0A 1CLXA 2F7RA 2WBGA 4W84A 3VTRA 1MW2A 2ZWYA 1WP6A 1V6UA 2YL8A 2J77A 2WWCA 4BF7A 2EBNA 3H55A 1V0NA 4BQ5A 5FCZA 2NT0A 1ZU8A 1TQTA 2CXGA 2XVLA 3NYDA 4P7LA 1YQ2A 2W67A 3PZIA 3APGA 1TCMA 4AIEA 4CCEA 1WCGA 4F8XA 1ZS2A 4TVUA 1CIUA 3TTSA 3N13A 3WNPA 3VVGA 2E9LA 4PMUA 1PZ2A 2FYVA 1JAKA 4E4PA 4JKKA 1PIFA 3CO4A 4MADA 3VIJA 4MDOA 4FMVA 1R34A 1KTBA 4CVWA 1ISXA 1H11A 1IT0A 3CZSA 1NWSA 4D6JA 3ZT5A 1O7DC 5KEZA 5E1QA 1OD8A 1GCYA 3THCA 3A3HA 4EE9A 4CN4A 4WJXA 1NWUA 4PUDA 5M5DA 1R47A 1Q4NX 3K8MA 4MB4A 2Y24A 1CGXA 3VMNA 1WO2A 2G41A 4ZXLA 3HMCA 1E15A 1GVYA 1BYCA 1CXIA 3D52A 4WK9A 2FH8A 4ACYA 2F7PA 3A24A 2PF0A 1KQYA 1OGBA 2PB1A 2YFOA 1I1WA 1BYBA 5BXSA 5E70A 2WC7A 5A6BA 2FHFA
chains in the Genus database with same CATH superfamily
4EMZA 3CFJB 4FFZL 5CEXA 1Y0LA 4LAJH 5LBSH 2NLJB 2BNRB 2OMXB 1PYWA 1FG2B 4WWNA 3EHBB 1QPXA 2EIBA 5EEUA 1GZPA 3S2MA 3WTWA 1F8MA 3II2A 3VFWB 2A38A 2P3EA 5FUOL 3CHRA 1RD6A 5CJXA 2HA1A 4JN1H 2EPLX 1MFBH 3MWCA 3CU7A 3QJFA 3EBIA 2AFNA 4DCQB 2ED8A 5ICUA 4GT7A 1H7OA 3VVVA 2WXKA 3T05A 3BE1L 2NQHA 1YNKH 4G9DA 1E4KC 2QAFA 1YXCA 1WZLA 3ZYZA 5MEQA 3W39A 2N0KA 2VQ1B 4ILSA 1EHLH 1TNNA 3LRHA 1W5MA 1SUJA 3C3NA 3NVQA 2PXYC 3BWUF 4WY0B 1IEAA 4GG8A 4L37A 3UGEA 3OVGA 3WUEA 5KBPA 1MJ7L 4RFNC 2C9XA 2V67A 4NO0B 2DLTA 6REQB 1CI1A 1DBKH 1DSYA 1OF8A 1IC7L 2ZXAA 4P8XA 3W2NA 3CVHH 2ZUYA 1EDYA 2VUNA 1DVSA 4HWBL 1DWJM 4O14A 2CAKA 5DURD 3NM3A 1G5AA 2YPKB 3LM3A 3P02A 3G1RA 1NGXA 2DT1A 4NM8H 4HMCA 2Y5EA 3ZDYF 5FYLD 1EEQA 4IIBA 4YHLL 3KRBA 4ML9A 1SO4A 3FDWA 5D7JD 3GHRA 3PWJA 2PDGA 1SVZA 4H9YA 3QEQE 3UTTB 1W6WA 5EWIL 4V15A 4F7EA 1AYRA 3C6LB 3STBA 1AZRA 3QUYA 1EYEA 3NA8A 3LHPH 3RY6A 4WHDA 1KYOJ 3CX2A 3MYPA 1W0WA 5EU3A 3WS3A 1A7BA 1E0TA 2IF7A 1UC6A 5D93C 3JR2A 1WCQA 3QQ9D 2AEOA 1OHQA 4G2AA 4HBCL 5L6YL 4CDHA 1MVFA 2E5EA 4CQ9A 4I2XA 1NWRA 4LSDA 5GS1B 4K68A 3N5AA 4AGQA 3ECUA 2NUYA 4PCTA 4JNMA 5I16B 1QPOA 1JCKA 3CH8A 5D1XE 4AW4A 5A3HA 5RUBA 3OODA 1C08A 1G01A 4P46A 5A69A 3HJEA 1NZRA 3LZPA 5G5DB 1MCOH 4NO3A 2ZUSA 1ADQH 4A05A 2A2QT 2G9HB 3FOMA 3ZJAA 2OELA 3E0VA 1H0DA 2OKMA 4K23L 1H7RA 2CXKA 3S6OA 3IJEA 3HNSH 2GQHA 2J7FA 5DGQA 4RV3A 3LTYA 2E9WA 3UBFA 5E7BA 3GR4A 4PC8A 3ARGA 3KXFD 4DEWA 1A9EB 1PXGA 2AW2A 4ZW7A 2XH2A 1UWFA 5D2TA 3T1WA 4LUTA 1RVGA 3E3HA 3QAZB 1R1CA 3DKJA 4FF9A 3MBED 1KD0A 4NKDA 4Y16D 3D25A 5IGXH 2NTFB 2PCFA 1A0QL 4FFZA 4MMXB 2B8OT 1MY5A 1AQFA 1OZTG 1XDTT 2QJJA 3CFJA 6XIMA 1A4KB 5L8LB 4OF3A 3RCNA 1GKRA 2NLJA 2BNRA 2OMXA 4BCZA 1FG2A 3IWPA 3PIQB 5HHMB 5G1YA 2XWCA 4FIRA 4HXAH 8XIMA 2ZA1A 1V0KA 3NFPB 4YTTA 2DQCH 3VFWA 5KVEL 4S10A 4X3ZA 5IVXF 3OPZH 1G4TA 3W7QA 4ZB2A 1FH5H 3F4CA 3H9ZA 5GS2H 1T96A 4OCWH 5FACA 1E5ZA 3JRKA 4DCQA 1DQKA 3NK3A 2HT2D 3OGSA 4H8WL 4TNVF 2ZOTA 3MAWA 3UZQB 3QYMA 4U3XA 2TPSA 2V5SA 3QXVA 3QW4B 2XWXA 4L9DA 4IIQB 3ZBMA 1SY6H 1Q4WA 2VQ1A 5EN3A 2YUXA 3GSQB 1WA2X 2PDWA 3WLQA 3WBAA 1MMFA 3MOBH 4QWWC 1IGFL 1FHLA 4KAQL 4WY0A 4IU2B 4PB5A 1L2UA 1OJXA 5IHUL 1KB9J 3OZLA 5K9XA 3P3YA 4FQ1H 3SJVD 4KWWA 3W11D 1N70A 6REQA 1RAMA 2F38A 1E65A 3BSMA 2XTLA 2F53B 3RVXC 1JCVA 3PZGA 6XIAA 2PU1A 3SPIA 2AOSA 3NCEB 4GJJA 1OAKH 2E74C 2IG2L 5E8NB 4QX4A 4AQ8A 2NZ9C 5BXTA 2EO7A 5F6HI 2YPKA 3KCPB 4BBWA 1MDTA 4HK3J 1RUPL 4QIUA 2VFEA 3VXUD 2FT7A 4JHZA 1XICA 1TQBB 1QA9B 4Q14A 3UTTA 5G55A 3LNMA 1FIGH 4GZEA 2JCCA 1P48A 3AMLA 5SX5H 1JDFA 1BJ1H 1EHAA 1BQHG 2QSCH 4AAJA 1F4XH 3B8DA 3MHGA 4KEMA 3FFDB 2YXGA 1OTUD 4ORMA 2NY1C 2CZVA 2WZ5A 3APTA 2XGZA 4JTCA 1VERA 3Q8EA 3ZT7A 3THML 5GS1A 5EL1A 3PQYB 4K7YA 5EBMB 3WLMA 5I16A 4CD6A 4LOEA 4FXTA 1FWBC 4OT1H 4G59C 5I1HL 2O55A 3N50A 5G5DA 1LK3H 3SBRA 2Y88A 2Z1VA 1F86A 1MHEB 2G9HA 3B7TA 5EUOB 4LSRH 1AS8A 1AC0A 2CWXA 5E2VH 4LEOB 4EN3C 1QW7A 1UH3A 3C5JA 1SUXA 3DFTA 1A9EA 4DWSD 3URAA 4JM0A 4ZR8A 4BK8A 3STEA 1FH7A 1UOKA 2J88H 3URBA 1TYRA 2NTFA 3TFXA 4U6YB 2KERA 4MMXA 3CLFH 3H2FA 2F6KA 4XO6A 2BS8A 3QFJE 3K1GA 3MLWH 5MENB 3T8LA 1A4KA 4X6CF 4C4KT 4OI7A 1C1EH 1ML1A 4PUBL 3PIQA 3FQ2A 1MJ8H 3HA1A 3U7WL 1NM4A 3QQ1A 2Z7WA 3U4BL 1GKQA 5CJQL 3NFPA 3L3GB 1TV2A 2YLAA 4BWLC 1E5CA 1IVLA 1F61A 4UUJB 5I6SA 3FEQA 1WAAE 3WQWA 3QJHB 3CFCH 3MRGB 3TR9A 4WZHA 4F7CB 1F4WH 3UZQA 3CEPA 4QSFA 3QEHB 3FQXB 4Q8TA 3BAIA 1R3IL 3L3JA 3VUAA 4IIQA 5FC9A 4OCSL 2OMWB 1F2XK 3LM7A 4IBUA 5KSBF 1J11A 2EABA 5JIQA 4LESA 4LSPL 3S5LG 4KWOA 3WQ8A 3CFDB 1XGTB 1KCRL 3C3UA 1IKFH 2WJEA 1FNAA 4DBEA 5ABFB 1AIZA 2D4FA 2DMHA 4GXVH 3CHEA 1G7LA 2F53A 1XBZA 4HT3A 4OLXL 5HOSA 4JRXE 3G0SA 5DBUA 1WFMA 4C57C 2FTWA 5F6IB 5E8NA 12E8H 2VEMA 3KD4A 3RWDB 2WMKA 4K71B 3CAFA 3KCPA 1XF4B 4PGEB 1D5BA 2EIKB 2OZ4L 4J2MA 3DX6B 3P5YA 1SW3A 2AZAA 4Y5VB 1K8ZA 3G1SA 2WJFA 1IBBA 3L3OC 1QFPA 1OOWA 3OF6D 3ZOAA 4FNPA 3RA7H 5JPMC 1O94A 1BQRA 3Q8FA 3BUBA 4JREC 3WHXB 2OSYA 1QA9A 3S7GA 3WY1A 4OD1L 4P8WA 3VMPA 3IIPA 5D2VA 1T7XA 4LSVL 1Q7QA 4DN3L 4DQOH 3TOPA 1PUDA 3P2DA 3CK5A 1DTUA 4E42B 1WQVT 4MVAA 4DKAA 3CHOA 1KR0A 2AC0A 5I26A 4H8QA 1IU1A 1U4EA 5HYSG 2HPTA 2DMGA 4JTQA 4TMPA 3K2IA 4H7ZA 3R10A 4KEZA 2XWEA 3TASA 4R84A 4NG3A 2C26A 3PQYA 1TMQA 5EBMA 1MAKA 4RX4A 5E00A 1KJ2H 5IMLB 3CVDA 3SYOA 3IXAB 3B0VC 2BOEX 2Q3OA 2VL5B 4XVUD 5L9DH 4H1ZA 3LQAL 1XSOA 1MHEA 1N6UA 4LCVA 5EUOA 3QR1A 3HI6H 4HTYA 2N4IA 3D3AA 5I74C 3H9SE 2QCCA 3BLDA 1FCGA 4LEOA 1SHSA 3A6OA 2YD4A 3A67L 4LRTA 3CJJA 1OSZB 1GUVA 3QIUC 1IBGL 2E6QA 3P3TA 3HURA 3RM4A 5E1HB 1LQ2A 3TT1H 2NSQA 1YEGL 2WWMC 3WMPA 4U6YA 4ADSA 5DQDH 1SNRA 2FQIA 5G4HC 4BQ3A 1FJ1B 4BHUA 3HN5A 5MENA 2D0GA 3O9NA 3SB0A 4OGZA 1A5CA 4GWEA 3MV7B 2V0TA 4HKBB 2O1AA 3TYGL 1QFOA 3OC8A 4TOYL 3WL0A 4QRTA 2YZ1A 3CLMA 1IT9H 2WZMA 3MACH 5T1DL 1U41A 2ICSA 3THUA 2EQDA 3HN3A 2Z4TA 4P23D 5TH2B 3WIFB 5G2WA 2ZICA 3OV6A 3JWNC 2W91A 3B7SA 4A7VA 4UUJA 1CQKA 4PVBA 3RIFF 4KF1A 5DC4B 3QJHA 3MRGA 4EVNB 3G5YB 3AMCA 5F3FA 1P1XA 4NWTL 4F7CA 2K0RA 5F9OL 1LL1A 2XT1B 3QEHA 2PPAA 3FQXA 5JHAA 3ZTJH 2B4CL 2TRSA 4LL1A 4P9HC 3EOSA 1UUQA 5F1VA 1QR1A 3POCA 3K72B 2OMWA 2VDRB 3A4AA 4KPHL 5CJXC 4F15B 2BY1A 4Z2IA 2CGRL 2WCSA 5D09A 3TK7A 3WSQL 3AQYA 3EB2A 2A6NA 2BB0A 5DF0A 3HFTA 1R5VB 4F8QA 1JFXA 3CFDA 4KBXA 2CJTA 4NQDB 3S6CA 5BVJA 2D7MA 4KKBD 4M6PA 3D08A 3IU4H 4YIWA 2Y70A 5ABFA 3RZCC 4CNIA 4AY8A 3TLRA 1FNFA 3K2MC 3C86A 4PB3A 5JQ6H 4HIPA 4LPYA 1ODUA 1E40A 3RWDA 3OLIA 1UACH 1XF4A 3TBTA 5HHOE 4PGEA 4Q7NA 3EGXA 1YQVL 4D9QD 3C0LA 4Y5VA 1S7QB 5BQDA 2MPAH 1AQDB 3WBYA 4HLZH 3SUSA 1W1ZA 5C7VA 4ZGYA 3IJ7A 4YTQA 3TFBA 3WHXA 1UJ3B 1OINA 2JIEA 5IJKA 3NEOA 4WNJA 4OECA 5DXXA 4P9MH 2E5CA 1V6WA 3S36X 3KVKA 3WNIA 1YXYA 3NZGA 3DHJA 4B96A 5HHPB 3D7PA 3QHTC 4YBHA 3W27A 1CWYA 2K3TA 3UU0A 2XUWA 4G6CA 1LQBC 2PR4L 2VC2H 4FL4C 4KIEA 4H20H 3O2WH 5C6WH 3V16A 2GB2A 2AS5M 4AMKL 4M0XA 3QUYC 4TQ8A 4M03A 2P5EA 3RY6C 4GY4A 4U0RC 3B9EA 4N3UA 3DCPA 4JDTH 1QK2A 3VXGA 3IXAA 3R8RA 3B5HA 2DQWA 4ZMQA 4FSAA 1PY4A 5JHDB 1TTCA 3DRTB 3ULUF 3L9RB 3GXFA 2ROYA 1XO8A 1VFHA 4TVDA 1RJYB 3GNMH 4BD4A 4UQCA 3VB9A 3ZMNA 2PTVA 4MMYA 2NY2C 4AWSA 2MUCA 4L6OA 4NPYB 4P46C 4I7VA 1OSZA 3W2LA 2G4FA 3DX9A 5HNUA 1UWQA 3CK0L 3CHQA 2N7SA 4RRPG 5AVSB 4XB8A 5J12C 5F7FA 5E2UH 2OULB 3QA3B 1JPEA 3CIXA 1WHPA 2ZYRA 2QUVA 5F7MC 3M1BB 2HE8A 3UAJD 3HNVH 3ARGC 3WENA 1IKNA 2I9UA 1FJ1A 1S5HA 2V3GA 4AKOA 2BY0A 3MV7A 3BPCA 2OTUB 5HGBB 4HKBA 1EAPA 4U1MB 3TN6A 3CASA 3O6LH 1P7KB 2TYSA 2ZZ7A 4Y2DD 1HZHL 4NP7A 4PJ5B 3E5BA 2J7EA 3CZFB 4N6EA 4ERAA 5HI3C 4G6KL 1PKMA 1KCSH 5TH2A 3WIFA 2QCHA 3LRLA 4NZUL 4PM1A 1E55A 2X6CA 3A3YB 3TA3D 4EVNA 4B50A 5IFAH 3WE1A 3G5YA 4NZ1A 3UZZA 3W7EA 1NCAH 3CAKA 1W8NA 4L4TE 3EHBC 4RKAA 1DBBL 4XPTH 3NCWA 4L1SA 4IIZA 1F76A 1BVKB 2OPCA 3K72A 3QRGH 4BH7B 3UTQA 4UR9A 3FSZA 1Z5LA 4ZQKB 4UNLA 3MMUA 4XX1E 3KPSB 3TW6A 5J5EA 3CG8A 5J4MA 3ZE1F 3II3A 3GMLB 1KV7A 4RX0A 2IGFL 4LZKA 3V7AG 1R5VA 5I3HA 4QLLA 2UWEE 4L61A 1TIWA 5DEGB 4XMLH 4NQDA 3BVTA 1OC6A 2YXVA 3W22A 5LNSA 2HT3C 1ACZA 1KUMA 4YQXL 3V4BA 1CZ8H 5BWAA 4TF4A 4O00A 4HUVA 5K59F 4KGLA 3SEPA 2HAZA 1IGIL 1AFVH 4KFNA 2YD5A 4OZOA 1S7QA 3QOMA 1AQDA 3RKDD 3S2AA 1UJ3A 3HI1B 4K8RH 4S3DA 4AQ8C 2ZWSA 5CLZA 1OVZA 5AAPA 4OOUA 1TQJA 4NQCE 1TZ7A 4XE5B 1SU5A 4FI6A 4OZGB 3KBVA 4AHPA 2ZOOA 2C1GA 3W6YA 2V2TB 1EXHA 3D39E 1IGSA 5DO8A 1JZJA 4OLZL 2EDOA 2J1YA 4AZ5A 3Q8AA 2QS8A 3OAUH 4PWIA 4ZMYA 1FWWA 5JOEA 2YK1L 4DETA 1I9IL 3C09B 1CF8H 1JNNL 5JHDA 1XKJA 3OTTA 3MUHL 3DRTA 3A3XA 4MF4A 2OLAA 4XNUL 2D2JA 3L9RA 2FYVA 3EFDL 4E4PA 3PFMA 3B5TA 2KPWA 4MDOA 2R1YB 1RJYA 5GS1C 3GD6A 4IOSA 2RKXA 1UB6B 1VPOL 5I3KA 1G7PB 5AVWB 2FK9A 1NWUA 3W7KA 4LO9A 2A1WL 1T5AA 1IEIA 4PJEB 4Q9RH 1E15A 4NT6B 3BWSA 1YPIA 2YFOA 4GG9A 4RMWA 1BYBA 2IUZA 3UNTA 1CJYA 4B7IA 4EE2A 5D05A 1M2OA 2OV0A 3QA3A 4PBWD 4LRNL 1VCGA 5SV3A 5DS8B 2CLZB 5A6SA 4CGTA 4HNCA 4YYFA 3M1BA 3F58H 4KTDH 2ZWLT 4YL2A 2P44B 4YR6B 3H2NA 3S5OA 2WNWA 4Z95L 4WI4A 1BOGB 2OTUA 5HGBA 3GRBA 2F15A 3H70A 2YUZA 1GGIL 3QAZC 3QV9A 1XGPB 2QGDA 4B4HA 3QDJB 4X5WB 4G8GB 4PJ5A 1P0BA 1S7UB 1HAUA 3CZFA 2DGAA 1LRNA 4MMXC 2BNJA 1DQJB 1J5CA 1CDBA 5EPMB 3MMDA 2NR6D 2KLRA 1KC5L 4WI2A 2TRYA 1P7BA 1QUNB 2X1OA 2YZ8A 1NCDL 2HEJA 4G9FB 2MOQA 3QE5A 3N42B 4EWJA 4UCFA 5A2BA 2Y0FA 4OM1L 1BAGA 4LF3B 4W9CC 1TJIH 4RWHA 5TE4L 4BH7A 3S47A 4ZQKA 4R4BB 5LAXB 3RO6A 1ORSB 4G7VH 5AW2B 1GZHA 3R0MA 1HILB 2BRRL 3GMLA 1NTDA 1SOSA 1TPH1 3GWJA 3FJNA 4XSLA 4IIQC 4YXGA 5IJBC 4PLNC 3RHWF 1YNLL 5JXAH 5CZKA 4OGQC 5E93A 1XB3A 4UQ2B 4H00A 5I0XA 5AALA 2ZRVA 1V4YA 1HP5A 4UI2A 2XOTA 4AVNA 3NJLA 1LO2L 3VFCA 5EEVA 2BFGA 3HG1B 1D5XB 3JBG7 4G5DA 3ILPB 4F92B 5EF2A 3AO0A 3VI4B 3SURA 1X7TA 3NZ8B 3EJZC 2W0LA 2VERA 3NIGB 1EZVY 4OFIA 3V18A 4LLWB 5L2KD 3S42A 3QULB 3TT3H 4PWHA 4CUCA 4OZGA 4GCXA 3LEXB 4L9ZA 4A3QA 4P05A 3PPFA 3MBFA 4JO5A 4Y9EA 2V2TA 4DK5A 4TV6A 4JIHA 2J20A 3W0WE 2FFIA 2PODA 5TQLA 3S9DB 3JUYA 1TQBC 3DX8A 1LO3H 4H26B 1US2A 5IHLB 1LD9B 3QISA 3ZX1A 1J1PH 4Q22A 4HKZB 5B8CB 2ATAA 5A2FA 3JSSA 1H8LA 4WW2B 2IANE 2FBJH 2ESVA 3B8SA 4RMTA 3OOQA 2PWFA 1O5KA 1P1ZB 3B3BA 3QHFL 3EJYD 4C56D 1UBSA 1RIUH 3V1PA 2R1YA 5U4NA 1FHDA 1Y6MR 5L4IA 4YHKH 2ZP9A 1UB6A 1QBML 4DESA 1MRCH 3EYQD 3BWWA 3UYCA 4S0SD 3SOBH 1G7PA 1KSRA 2A3TA 1RUAL 5I2IB 1GT8A 4OJYA 4PJEA 4NT6A 2FSEB 2QGYA 1ED3B 1S7VB 3OXRB 5DD5L 3Q7JA 1J5OH 3X13B 4REQB 3MFGB 1XUUA 2GK2A 2GUYA 2OQYA 1QYGL 2MHAB 1UBPC 5IBUG 2X7VA 5DS8A 2CLZA 2H3KA 43CAB 2AQQA 3NJJA 5C0DB 4YR6A 3FTGB 2PCQA 3VK5A 2YB1A 4TTUA 1JRHI 1BOGA 3VIPA 3UXFA 4MHBA 3NSJA 3EMQA 5EBLB 3OIHA 2YXOA 1T80A 3QCVL 1AE6L 1HXMB 4DGIL 4DNMA 1XGPA 1E6QM 4W9HC 3QDJA 4FZEL 4A3HA 2BGQA 4CU7A 4G8GA 1KYUA 1W9DM 1S7UA 4S1QL 1ICPA 1Q5MA 1A9VA 5C8JB 1A50A 4KJQD 4GX9A 4FJ6A 1DQJA 4L4VB 5DVPA 1JCTA 2EDQA 2OTPA 4ERSL 1UMYA 1QUNA 4W93A 4G9FA 3KDPB 2BXVA 1JK8B 3DTXB 4GIRA 1R9ZA 4I3SL 5AFAA 5BNKA 5AHLA 5ESQB 3D8MA 5GJPA 4LF3A 4EXBA 1ECQA 4LOCA 3U1SH 4C6DA 5KYWB 4I7ZC 4IGBD 2OG9A 1OGGA 5FFGA 4R4BA 5LAXA 2DV6A 1ORSA 2P7TB 1BOYA 4JX4A 1HILA 1C12B 3NEXA 2YX0A 3CJPA 4KQNA 2XFRA 4P07A 2FVKA 3TFCA 4HWZB 1LJYA 2B20A 2DI7A 3TQPA 5HY9B 3ITOA 3II1A 2J27A 5LXGL 3FFCD 4QMEA 4TM9A 1KDJA 1IRAY 1TCRB 3O05A 2MQ0A 3C5SB 1XFPA 5CN3A 2GHWB 4UQ2A 5LGHL 1E3XA 4FFWC 3ESNA 4W8LA 2XGIA 4PBXA 1R0MA 2WZAA 4H9UA 4F2BA 3CSYB 3D87B 2D9QB 2G30A 2XBDA 2VXUH 5MEOA 1A1NB 1H3PL 1QPKA 2ZX5A 3HG1A 4E41E 3RLSA 5I6LA 1MW0A 2XH7A 2YRBA 3ILPA 2CYGA 1EMTH 3CN4A 2EG6A 3VI4A 2FSDA 4Z2GA 4WWPA 2IPWA 3BUYA 3FCSB 3NZ8A 2QCGA 1VKFA 1GYMA 3WY3A 5H1WA 5F6IC 1M05A 3D30A 4K71C 1F4YH 5C7ZA 1S4IA 4KRPB 1QJWA 3QULA 4AM0B 3C6SB 4EIZC 3V6ZB 3CVBA 2J6EL 3L3OB 4C7FA 3LEXA 1MUMA 2BSED 4H6KA 4Y5VC 3QCUH 1J1OL 4J23A 2FZNA 4JM4L 1VGKB 5DMKA 2C1PB 5BMFH 4WRHA 4U5KA 2PD9A 3WH9A 5AC7A 1GYAA 4GJIA 5IJKC 4U1GB 3DXIA 1UPPA 4Q6IB 1CT5A 1RAKA 4H26A 3YPIA 4TRPL 3SW6A 1LD9A 4HKZA 2DQJH 4NRZB 2JKWA 5B8CA 1K3ZA 3N2OA 1US3A 4WW2A 4JG9A 5A2IH 1TELA 4GZJA 2Y5TB 4DJED 2GJNA 4GP5B 4G8AC 5B39G 4JPWH 1P1ZA 3HZVB 3B4NA 5HDBE 3MMEA 1QFEA 4XX6A 4ZVJA 3PXHA 1BQ5A 1QRNE 1O5RA 2PP3A 3PZVA 3TO2B 1XLGA 4WDXA 1S6NA 2X3CA 5KSUB 4HHMA 4OUIA 3S1GA 3SY0B 4E9TA 3NG3A 4JTAA 1M7DB 4GQGA 2I85A 3HUJB 3WMLA 1TV5A 4NPJA 4WK2B 5I2IA 4OW6A 1U0QA 2FSEA 1ED3A 1S7VA 3TYDA 5HK4A 3X13A 4REQA 4IDJL 7FABH 3W7CA 4HCHA 2W0FA 3GSWB 2MHAA 3MUAA 43CAA 4CU8A 1SO5A 4O50A 5C0DA 2OSXA 3QIUB 3BQVA 3FTGA 4RDWA 1I9RL 4ES4A 4DYEA 3IMSA 1O5QA 4X6DB 2GJ6D 2XZZA 5EBLA 1XSIA 3SGGA 1MCDA 1HXMA 3FKRA 2J78A 1O1ZA 1KM3A 1R3WA 5H94A 4CCZA 2EDBA 4E9YA 5C8JA 2UXFA 4DIAA 4P5SA 1DQDH 2XGBA 4L4VA 3JYCA 5HQEA 3GO2A 4PY8J 2V37A 5ID1A 1IKNC 1KGCD 5EU6D 4FULA 5FGCB 1NF7A 4AWJC 4NAMA 5K9CA 3EX1A 4HS8H 5CPSA 1JK8A 2FWUA 2ZXEB 3DTXA 4XMVA 5DHVH 1AHMA 5DJYB 5ESQA 5AFDA 5E99H 3HE6A 3WH7A 4JFXA 2FD6L 3SCOA 3W1QA 4UM8B 2DUZA 5KYWA 4QIRA 4KFMA 5CEXB 3ZYOA 3DERA 2UY3A 2P7TA 4PU2A 1ZE3C 3IN2A 2E3ZA 4Y90A 1C12A 5DLMH 1ULVA 1I9JL 5HHQA 5GGTL 3T5WA 2H2PD 2B4CC 5GZOD 3U2IA 3RB7A 2NZLA 1IC5H 3VIMA 1CU4H 3WAJA 5HY9A 2YD6A 2A1YA 1UKQA 4B9IA 1JF6A 1UZ6F 2XV0A 1TCRA 1NDWA 4AY1A 3C5SA 4IHOB 5JUVA 4NC2B 3QJFB 4F15C 2WM1A 5E09A 3K7UA 3B3IB 4Y5XB 3CWGA 3CV2A 3CSYA 2QXWA 2NW3A 4C1NB 3SDXE 4DGYL 3AIQA 4PJHF 4HIIA 1A1NA 4L6DA 3W39B 2DZWA 3RZCB 2YRPA 2VC7A 4MJID 4UILH 3N6HA 1EGVA 2VDLB 1KCBA 3VXMB 1VJZA 3MGTB 1TZOA 3FCSA 4WFEE 5BUGA 4NKIH 4BGLA 4INFA 1G7JB 1QK0A 4YHML 2J6EA 1XLCA 2J8UF 4P4KD 5C07E 4B9CA 4XZLX 1T66D 4AM0A 3C6SA 5DMMA 3V6ZA 1XD0A 4QKXB 3W01A 5KETA 1KJ3H 5J5DA 4E5TA 5GS2D 2WYTA 3OR7A 4NM4L 1VGKA 3V6FB 1T8XA 2C1PA 1DJQA 1UJ3C 1KB3A 4I85A 2E4TA 5HGDB 3F2LA 5HATA 2GUUA 3Q4DA 4Q6IA 3G5VA 2D22A 1FPTH 2X4PB 4N85A 1P1VA 3BQ6A 4NRZA 3NSYA 1BP3B 3DSFL 3RX9A 3SHSA 1BEXA 3CXFA 5D2LB 2IDTA 1A7RH 3U3HA 1QRQA 3LV3B 1O9VA 4FRWA 4BWTA 5D33A 2VR4A 1YNTB 4IIFA 2CU9A 1OCOB 1ZLVK 3FCPA 3U6XS 2OYLA 5EC2B 2JV6A 4KY2A 1OM3L 5KSUA 1I2RA 4ANUA 1X6UA 2QGEA 3F7KA 4AZBA 3SY0A 4F66A 2DQGL 1M7DA 3HUJA 3MLRL 4F8NA 1ZP4A 4JGDA 2VDQB 1NIDA 1VGEH 2ZWKA 2QSTA 5DZVA 4N0RA 1EGZA 3BV4A 5E6ID 1XX1A 1KXHA 1XLHA 5FO9B 4PJBB 2AQRA 5G2HA 3IU3B 3K8LA 2WCAA 3UCCA 3GSWA 2JB5H 2CUIA 1JPSH 4I4WB 5KS9F 5DHXB 5JIMA 5I76B 5HJGA 2Q09A 3V5HB 4FHKA 1Q8AA 3STLB 5H35B 3L5HA 1WA0X 3HQOA 4X6DA 1RA0A 4YDNA 3WL1A 3FOMB 5CGTA 1ITQA 3MRFA 2JKPA 4G6JH 4K7PX 3QY6A 1Z69A 2B0MA 2NY4B 3W02A 1HF6A 3OVQA 3U7AA 5C97A 5D71L 4BKTC 3WFCL 4HCIA 3K6DA 3PWNA 1N5YL 1AY1H 3QWQB 1EFQA 1N2RB 3VH8G 2QW5A 4WJG3 3HI5L 3PGDA 1ZA3B 3IDGB 2ENYA 3IFLL 5A6MA 1A5KC 2VL4A 2PCFB 1AA1B 1MHHB 1PLGH 5DJYA 2PDNA 3GZQA 2OR8A 2R0ZL 2OBGA 3SQBB 2KC0A 3B9DA 4UM8A 2PRLA 1CTMA 3WBDA 4HJWA 4YXLL 1LT8A 5EBUA 1X7IA 3S8HA 3L2NA 1JF1B 5D32A 3P60A 3M0JA 2O4MA 1AJZA 4W5UA 2CKBL 5CD5D 2YD0A 1U8MB 1NQKA 4QISA 1TZGL 1MFAL 1XL6A 2VEKA 4GSDH 2EHHA 3I7QA 2OMBA 5D1ZI 3AT9A 4TUOB 1XG3A 4ZNEA 2ACQA 4IHOA 1XIDA 5TE6H 3RWIB 4WWID 1KFKA 1GZHC 3B3IA 2QQLH 4Y5XA 1EXPA 4ZZFA 4XOEA 3GI8H 3BDBA 4C1NA 5AOLA 3INOA 1RCXB 5HYJB 1EA9C 4JTGA 1BXAA 5CAKA 4HG4J 1UB3A 3RZCA 4PI0A 3G1FA 3L0KA 1W9UA 3QZLA 3VXMA 3MGTA 3EPMA 1QUPA 2EG8A 1FXQA 1G7JA 3EO0B 3PUEA 4GRWF 5AKSA 1OCJA 5EY5A 2WC4A 4JANB 1QW8A 2OTWB 3GSRB 2H0JA 4DKTA 2ZADA 3D4CA 2L7QA 4AC1X 1E6PA 4S0HA 2H47C 3CBJB 3V6FA 2VFGA 4ZBJA 2V5DA 5ICYA 3APFA 4WGWB 1S5WA 3NQCA 1MHCB 2Q8AH 5HGDA 3CZKA 4ZTEA 4XVTH 3MTRA 1S5NA 3MV9E 4HCLA 2GJJA 2BIOA 1JPHA 2X4PA 2E6AA 4PG2A 3NZHL 3MSDA 4PRIE 2YGOA 3WY4A 4PCNA 1I85A 4YSEA 5D2LA 3PWPE 3LV3A 3W81A 3K1KC 4HA0A 1YNTA 4QE4A 2JJVA 5D8JL 4J28A 2NRDA 1IEHA 1RH8A 3UJFA 2A74B 5EC2A 3CDGB 4HPJA 2JCCB 3NQBA 1OBAA 3KHDA 2PS2A 2ZXGA 4DAIA 4GGBA 3VFRA 5TBOA 2IWGA 4YTSA 2IGTA 3C09C 4KRNA 1DWIM 3NCCB 3ZL4L 4KCUA 4K2UH 5BOFA 3SCNA 3TNNB 5I5JA 1XBYA 3GIZH 1VCBC 5DMGD 1D3CA 3GDTA 4QKTA 4IQJA 3EYPA 4ICCX 5FO9A 4PJBA 1J10A 3IU3A 1G4EA 1L6PA 4FTDA 1TENA 4ODTL 3G6AB 3H7RA 4NB7A 1HJWA 3KYOB 2YIHA 4ODHH 4I4WA 3FXYA 5I76A 4EZLA 1VZIA 3V5HA 4XNBA 3NNTA 1BZOA 3STLA 1RUSA 5H35A 4UTIA 5G1MA 3OG4B 1IGWA 4GG6B 2K45A 1GKEA 1U33A 1OGAB 3DETC 1X8CA 4RBPH 1TETH 1UATA 2YGPA 4PCKA 2J6WA 1U3JA 4RDVA 4KQ3H 1AODA 1F90L 3VA8A 4JRLA 1C8QA 1U3YA 3WUWG 3C5JB 4GUJA 2WCGA 3NO3A 2F7QA 1FSKB 2Q2LA 4OF6A 1N2RA 1MWOA 4MWAB 3S4TA 4FYQA 2FIQA 1O75A 3TJEL 2H32B 1ILSA 1QMLA 4UNTA 2QQ6A 2ZZ1A 5HUPA 4K4KA 1CF1A 3PL6B 1ZA3A 3IDGA 3H2WA 3NJXA 1KOAA 3OXSB 1MHHA 2F19L 3BO9A 4Z7QB 4WXYA 3SQBA 4KHXL 1OK0A 3SUVA 2IFFH 3AUJA 3L1EA 3V8OA 5T3XE 1JF1A 5L6UA 3AACA 1U8MA 4HWEH 1XHHA 4JG0L 2RMNA 2VGLM 2VITB 3ISWA 1KBGH 4B3KA 5HGHB 4ORGB 4XO3A 2Z1BA 5AYIA 4TUOA 4DGVL 4F2EA 2BOFX 2AVGA 3TJ4A 4XTDA 3RWIA 1UWGH 3ZT6A 1RKRA 2YEQA 2C9SA 4PGDB 2WZTA 2ZCLH 5HBFA 1T22B 3S36H 4FFYL 2ZNWA 4P2OA 3L3JB 1KRBC 4PJIB 2R4SH 5HYJA 1QNZL 5DR5L 4EOWL 2AJSH 1AZ2A 3LNGA 3CWOX 3EMCA 3TJXA 1XIWD 4AV5A 1JZ4A 3L3IB 1XR8B 1GHFL 3ZDXE 3B9AA 2O6FA 3EO0A 1BVNP 1ZRUA 2VZOA 4JMXA 4PFEA 1DUYB 3APDA 4JANA 1M3JA 2OTWA 1W9XA 3GSRA 4LDOB 4H9VA 4HALA 3MLXL 4HWBA 4Q2ZA 1G7LB 5IQMA 1Q6QA 4MJZA 2WWCA 3UR5A 3W7LA 5A3ID 2W67A 4ZW6A 2H6OA 1MHCA 5AW7B 2J71A 4F91B 3N43B 4QUOA 3INUL 1HEJC 1D5BB 2PTYA 5DZOA 3MP3A 3CO4A 5SV4A 3R79A 2DTMH 5DZ9A 2EIEA 3KBHE 1NWSA 3WLWC 4FG4A 4PY7A 5E1QA 1RQHA 3GHEL 3ARDD 5IOKA 1U22A 3HPXA 1YTDA 2A74A 4WNSA 2XN9E 3CDGA 4BK4A 3A4JA 3HMCA 2DWSA 1JGEB 2PDLA 3G9AB 5B8CC 2ZUQB 2ZOKB 3KOZA 3BH9B 3NJGA 4WW2C 5KVFE 2EVIA 5A6BA 3CZ8A 1N8WA 3IPFA 1JFQL 4HU0A 1EYWA 5LKNA 3TNNA 3WBXA 1PW3A 4R7LA 1OFDA 3PSVA 1JV2B 3FN0L 2X4SA 4M1GH 4Q6JA 5E00B 1T03L 3G6AA 1USZA 2EEDA 5D7LD 3KYOA 4OGXL 1N68A 5DUMH 4FYRA 1FBIH 1FWFC 4BI6A 4C59B 2YMXH 4GG6A 1OGAA 4WSKA 3O2DL 3STZB 1YMME 4HUNB 1T0NB 2DW7A 2VEPA 3BKYL 2LVEA 3MKVA 1OARH 4NRYB 3LERA 4I9MA 1BF2A 3PCYA 1C91A 1CYXA 4MWAA 4AMXA 2H32A 2KZ1B 4HT1L 1YEEL 4IG2B 2HE5A 3F5KA 3PL6A 3MRIB 2BSRB 2H1PL 1CUOA 2K8MA 3OXSA 3BGJA 1BCIA 2CLPA 3FYPA 5B3SB 4DP1X 2V5TA 1IXQA 4BR1A 4Z0JA 1E28B 1DVTA 4L0PB 1MCPL 1SJCA 4BA0A 1A7NH 2CETA 2VXTH 3GLCA 4O1DA 2V8MA 1D8CA 2M26A 1FWSA 1Q63A 4QRTB 3GLAA 3L4CA 3MHFA 4X80L 4ZFQA 1PZBA 1EOKA 3MHZA 4OV4A 3GHBL 2DYPD 2AEPL 2PWEA 2VITA 4ANVA 3HE6C 3W24A 5HGHA 1WH0A 4ORGA 2DEYX 3IGUA 4JTKA 4HXBH 1I7ZB 2QZRA 1HJQA 4XAGA 3QJUB 1MFVA 3HPZA 4NKMB 2XIOA 4PGDA 1T22A 1RULH 2JKTM 3GIVB 2CGYA 5FYKL 4PJIA 3FDGA 4HK6A 1QR1B 1GOWA 4Z7WB 2HMIC 2GZXA 3SQLA 4I77L 1W56A 3HAEA 4JQ4A 1F45A 5JIWA 3L3IA 1XR8A 1DL7H 4S3AA 4EXQA 2AJZB 3N06B 4J3OH 1ZGDA 5FDWB 3PB0A 3S5YA 4UV7L 1EL3A 4P5TA 3L7RA 4X7EC 1VFTA 1OF0A 1DUYA 2C79A 3KDMB 5BVJB 2HKAA 1F73A 1BSLA 3TVMA 1Z5HA 4DY1A 3IGAA 4K39A 4CNIB 4JFDD 4BSJA 1LYQA 3PY9A 2OMAA 4OIFA 3GUTB 4YS4A 3BESR 4HJGB 1RQBA 4EBQH 2PSNA 5I1DA 3NEVA 5ANHA 3TBTB 3VQ2C 4JZ5A 4R33A 2IJ0C 1IIIA 3EGXB 4KRPC 4YVNA 2BXZA 4FYTA 2EYRA 3UWEA 1R9FA 3C0SA 2E6FA 3ULVL 4ZZKA 2EJ1A 4Z7OF 3U5UA 1ID2A 4PMRA 4KKLD 3WJMA 4E0CA 1P69B 4KETA 4U1GC 4Q6IC 5F7AA 2YB4A 4XAPA 5FD0A 1IGJA 3VOJA 1HINH 3MFFA 3LPPA 2F6AA 1JGEA 4FEMA 3IYLW 1TTGA 2ZOKA 3BH9A 4IRSB 2AJVH 3IWUA 4DJDA 2JBMA 3VCLA 5MF5A 3ECBB 2WQVA 5B80A 3VI2A 5JHLH 1ZVNA 4S11A 5DVNA 2PPFA 1Q0YH 2DU2A 1JV2A 25C8L 3KWVA 2P5EB 3QMTA 4NZDA 3MLPA 5BOJA 1HKWA 3IIZA 1FQ9C 4TSCH 3SBWA 4M8VA 3WXVL 4TIMA 1ZY9A 2HFGH 1G9NL 2NVAA 4WTZG 4MYWB 5T5FH 3DUGA 4JQIH 1EJTC 2ZCHH 4W9TA 3TBBA 3NO5A 4N0YL 3EJSA 2VW7A 3E8UL 2E5BA 3STZA 3GFXA 2QADB 4HEPG 2HJLB 1LNUB 3KWXA 1T0NA 2IBGA 5I77A 3N41F 1UYWL 4ICXA 4J2QA 1GG1A 4N2NA 3FA5A 1MIML 1JDDA 4MMYB 3MV11 4NRYA 5CBJA 5HPMB 1GGCL 2BASA 4KK9D 1BAFL 2CLLA 3DX9B 4AZCB 4E4FA 5E0FA 3MLZL 4B9ZA 4YDVB 4IG2A 1GZQB 5H8DA 5CLYA 3MRIA 2BSRA 1T6WA 4OLVL 4JTJA 4ZW5A 3EPNA 2B81A 3VNKA 5BRPA 2H8PA 4GACA 1F05A 5EBGA 3U2CA 4JJ5B 1S5HB 1E28A 2VO8A 1UCTA 3BPCB 1EAPB 3TEWA 5SWSA 4ZXBB 4KCWA 1S7WB 2GI0A 4POCA 1IGCH 4FG0A 4MMZB 3VD0A 3ARSA 4DBWA 5CCKH 3MV8A 2JE8A 3NXLA 1TUPA 1I7ZA 1EBGA 1P7TA 1VDGA 3GQYA 2ED9A 4JFFD 4NKMA 1CD8A 1KBVA 1XW8A 1GYLA 2A3BA 3GIVA 3ZE2F 1VCAA 4HOMA 3KTXA 4B9YA 1J8SA 4AX3A 2AK1L 3SDDD 3MZNA 2X0VA 2EPOA 4Z7WA 1VS1A 4ATDA 3UTQB 3RHGA 2WO5A 4K15A 1Z5LB 3G1HA 5E1AB 5T91A 3RVTC 4KTGA 4YTRA 1ITXA 2D7PA 2AJZA 2V5MA 1W1TA 5FDWA 3B9VA 3SGEH 1ZBVA 3PWVB 4Y5XC 4H6RA 2JWYA 1BQKA 2ZQKA 3SGJA 3KDMA 3O6MH 3SCVA 1TYJA 4HULB 3IE4A 4YX2H 4KNUA 3N34A 1LL4A 3DOHA 4P2RB 3QCTH 4LEXL 1CFQB 1CLYL 3GUTA 4FQHB 1A5UA 2RDXA 4HJGA 2OZ4A 3B34A 4HUVB 5IFHL 4PRPD 3A4DA 4AGPA 4RL3A 4KKAC 3QHNA 3WL9B 3WD3A 3D3VE 4GQZA 3S1VA 3LSOB 2NLIA 2PDKA 3TYUA 1IWBA 2GBVA 4M24A 1DYSA 4EF3A 1VSCA 3B4YA 4XUGA 1I2PA 3S1UA 2XWBB 2ZKHL 4WKHA 2XQYA 3L23A 2NUPB 4JL2A 3T0EE 4XP1H 4JTLA 3JWNE 2HUHA 2GITA 2GVLA 3OO2A 3QXDB 3CN2A 1RU9H 4XVOA 3D4GA 4PG2C 4HYTB 3VXTA 1PKNA 4OWGA 4MDRA 2YSTA 3DG7A 4IRSA 5HJBA 1I85C 3B0UX 4XK2A 1B4RA 3WKYA 1FWAC 4GLEA 2ZZ6A 3DIPA 3ECBA 2ALRA 2J73A 3M47A 3GJFK 3AJXA 4JY4B 2WXHA 3TOYA 3L9CA 2AF2A 4CC4A 4KZ0A 1K3IA 2WLKA 1V3MA 2FZMA 3HR6A 3O0RL 2GOKA 1OEZW 5D8WA 2C4FT 2HWZH 4QD2E 5DFWH 3UABA 4KK6D 1TJ0A 3GPSA 2HJLA 1LNUA 1B6DA 3SQRA 3UYPB 3I75A 1J6OA 1XRVA 4HC1H 3G5ZB 5FM5M 1ZLWH 2AAAA 4HD5A 2I5YH 5HPMA 4CNUA 3UL4A 3E0IA 3T2OA 3OZPA 3PJSA 2Y1HA 1OAXL 3WLSA 1XB8A 4WI8A 4XVJL 4S1DD 3H2AA 2VM3A 4AZCA 3QQ4B 3V4PH 3V0WH 4PGJA 4YDVA 1GZQA 5FSDC 5BZZA 1OAQH 3M0LA 4GMEA 4DAGL 2B2XL 2F61A 1JR1A 1MVUB 2NY4C 2JJWA 3IDYB 3CMOL 4O1BA 3Q58A 1XVSA 4JJ5A 3EXSA 1H60A 2DLEA 5KMYA 1JUFB 1JZEA 3KG5A 4ZXBA 2VDHA 2CBUA 1XZ0B 4AYGA 5JMRA 3RU8H 1CGYA 3WXWH 4UTWA 1S7WA 3I50L 3H12A 1IMHC 4MMZA 1Z1WA 1G67A 2CK0H 3TURA 1NWTA 3BP6B 1X1NA 5D5MB 2YPLD 1AK5A 4UT6L 1Z48A 1KGWA 1PLAA 3ES7A 4ES9A 3UPRB 2VIRB 3QPZA 3PNWB 1QW9A 5DD0L 3E3QC 1KCLA 4NY2A 3NDZA 1D7FA 4CILA 5LNRA 2HTKD 3HHMA 4MZ8A 2C1OB 4J12A 4I2XE 2YL5A 4QXTB 3G3DA 2WWDA 5E1AA 4UDUB 1UCBL 2MEJB 3EJQA 3UBGA 3SGEI 2CW6A 3PWVA 1OX4B 1RZKH 2BNQD 1GVIA 3TCSA 5HJXA 4P2OC 4PMVA 4ZZ9A 5AOZA 3WLOA 4V11A 4P2RA 4MBRA 3S9YA 4UTTA 1CFQA 1T6BX 2H0PA 2OEKA 3O4OB 5I5RA 3CQQA 3P81A 4FQHA 4C4BA 3V5KB 4N1HB 4OGAC 2QPSA 4WK4B 1W37A 4L4LA 1Z32X 3WL9A 4GAYB 4HQVA 3COOA 3LSOA 3N0AA 4A3YA 5IUCA 1HK6A 5EFDA 3FU0A 2GUBA 2XV2A 3C61A 1R3LB 2XWBA 1T0MB 1DDHB 4YSTA 1VACB 1HL9A 1FFNB 2NUPA 4EUPB 1FH9A 3GS4A 4DGUA 5A8GA 1CFVL 3QXDA 1UZ8B 4KRMB 1JGLH 1QR7A 3BVXA 1FWCC 2BNRE 4N0UA 2KX9A 3CUPB 2YD1A 1W1IE 3U83A 4QITA 2HN7B 5I3DA 2WPBA 1TB3A 1EOMA 3B2UD 1S38A 1NMBL 4FKHA 2F84A 3DX8B 2CMRL 5AKVA 4JY4A 1F6PA 2JIWA 1MAJA 3OYXA 3RBGA 3V1HA 2A74C 4MX7B 3UWYA 2NY3D 4CADB 3BIKA 4C58B 3G1AA 4WJEA 1KTRL 2ESVB 3EYVB 4Q52A 4MYXA 1HL2A 3VD7A 4L23A 3EUDA 4RZ6A 2ZD0A 3UYPA 2V5RA 4F7KA 3G5ZA 4P4RB 3U1PA 5IQ7H 4NZCA 5GS0D 1R3HA 3VI3B 2JALA 3LTVA 3P11L 1SPDA 2B16A 2K1MA 3W9ZA 2H45A 5LDUA 4EQ3A 4CAGA 4FFVC 2XN0A 1QPRA 3MP4A 3QQ4A 3Q6GL 2WAQA 1QI2A 3E8VA 4PHXA 1JQVA 1MVUA 3O4LE 1G4MA 1DVJA 1A6TB 2ZC1A 3VXPB 4K5MA 3FJ4A 1FSKC 4FQCL 4MWAC 1JUFA 3BZ4A 1XLIA 1XZ0A 1M71B 3PL6C 3ZXAC 1FFRA 2JELH 1UD6A 4PJ8B 1WZ1L 1SXCA 4MXQD 3UTTE 4URIA 1JWUA 4XD3A 4N90D 4QDMA 1YTEA 2D0HA 3AS1A 3BP6A 1WDRA 5D5MA 1AQMA 4BQBA 4NKOB 3EJCA 3UPRA 2VIRA 4QROA 2AXJA 3PNWA 1V8EA 3KOWA 2QSVA 1T04B 1OSPL 4YSQA 5C2BL 3ILEA 3QG7L 1LP9E 5MHSE 2VTFA 3HZYB 2C1OA 3T3MB 4QXTA 1DSFH 4UTAH 3O8XD 2BTMA 4UDUA 4K73A 4H8WC 2WXJA 2F8VA 2ICWJ 2EE2A 3LDBB 1PYMA 3SAZA 3QIWB 1OX4A 1BM3H 4DM2A 3CMJA 3P4OB 3UX9B 3NRFA 4K3DL 4MUZA 3C08H 2A3EA 3RDTB 3VYLA 1YDPA 5DJXB 4ILDA 4XN9A 3TZVD 2ANUA 3QUGA 4KV5F 4Z7UE 3FTSA 2WQXA 4GMSL 3VCCA 3V5KA 3FCTB 2VGIA 3DXAD 3TN0D 3DZ1A 4GAYA 4P5TC 4GPNA 1OCRB 2IQDA 5MEOB 3R2GA 1B3WA 3PGFL 3TVMC 2UZXB 4P2YA 5GJMA 1J8VA 1TJGH 3BUYB 1E2ZA 1R3LA 5AZUA 1T0MA 4XBEH 5DQPA 1DDHA 1GVEA 4PJ6A 3FCUB 3GBLA 1H7NA 4TUUA 1S7SB 4A2LA 1M05B 1VACA 1FFNA 2FYYB 1Q9OA 4EUPA 1TIMA 1UZ8A 5D1ZD 3EGJA 3BKMH 3KLHD 1PVNA 3GGWB 4XNXL 1RZ7L 3C2OA 3GM0A 3CUPA 2SODB 3LLXA 2HN7A 3TTOA 5DMKB 4M5PA 4DIXA 4PRTA 2RDWA 4R0LB 2XVGA 2FGWH 4S3GA 4K7PH 4UR8A 5CC6A 3HGSA 3HPFA 4MX7A 5C0NC 1UKPA 3ETSA 4CADA 3BZFB 1I1FB 2ZUQC 1I0BA 1SZEA 3SCRA 3EYVA 3BAYA 3ME3A 3T6QC 3OR6B 4DJDC 1XV8A 3MMEB 1FO0L 4N5EC 2CHOA 1AXTL 3M7FB 3GIQA 4CD4A 3AADB 2W6RA 1TE6A 4H8VA 3O63A 3QFWA 1DQMH 4XZBA 1G6RL 1A6PA 4P4RA 5GRYA 2V0AA 5G4EA 3VI3A 5AW6B 1S3KH 3TONA 3SBWC 4QLWA 3MCLL 1E7UA 4WUKH 4M00A 1LDSA 2DZXA 3B1TA 3S48A 4PWGA 4YL4A 4AXNA 2W0FB 4LAUA 4LW7A 1I8KB 3BT2L 4QRPE 4RCAA 3CUIA 5LAPA 5DUJA 3KS6A 1A6TA 3BN3B 3VXPA 4FKKA 1TO3A 4K07A 3L7FB 2IPUK 4BZ2H 4AISA 2CO1A 4O0KA 4W9EC 3I9PA 1M71A 2KYIA 1GJPA 3CFMA 4Q4PA 1BQCA 3A64A 3DO3A 5EG6C 1I60A 3NIFE 5H94B 4Z3TA 4FTVE 3DFOA 3M0KA 4PCYA 4PJ8A 3T42A 4D0CB 1O9WA 3LMJH 1FP9A 2YRLA 4G70B 5ID1B 5BRZB 4MIMA 1EUTA 4YTUA 4K8HA 3CQPA 3H6AA 3KBJA 4WWOA 4NKOA 3L6FA 4FXGA 1T04A 5INDB 4IP4A 5BU6A 5A8OA 3HE6B 3HZYA 4JFXB 3GRIA 1JVOA 4LV4A 2HISA 2RCSL 3FQ1A 1CDYA 1XSKA 4HCDA 3K6IA 5EMYA 4DNLA 5D9MA 1HKKA 1P4IH 1WIOA 4OBTA 3TIMA 4NUGL 2YYUA 4UM9B 2A77H 2GK0A 5HHQB 4NQVB 1OAZH 2H6PB 3QIWA 2X1PA 5EO0B 3T6CA 1NDGB 1L7TL 1V0NA 3P4OA 4LAQL 1N9PA 2GQ8A 1WCGA 3RDTA 5HMFA 3UJIH 3KYKH 5DJXA 2W27A 3TTSA 2WKOA 5ADPH 2VP8A 3K80A 1OGPA 1EJOH 4GW1B 4OCXL 2LLNA 1TJHL 5GGSY 4F1SA 1TPXB 3FCTA 3VIJA 3AU0A 4GJ1A 3LLFA 4ICMA 2NW3B 1F2JA 3SGJC 1O7DC 4HIIB 1HUVA 2UZXA 3QARA 3A3HA 1BXBA 4N4PA 4FQXA 1KG0B 3RPTA 4GPVA 1ELSA 3FUNA 3TFKC 4CKVX 5ISZD 1GVYA 2FWLB 5T33L 2E9GA 4DZHA 1S7SA 5GGSA 4QQUA 2DTSA 3QUML 3N6YA 2FYYA 4PD4K 1IVTA 2OKTA 5MENE 3O6KH 4YPGB 1KCVH 2JLPA 2J12B 3GGWA 5JR1H 3M6DA 4JN7A 1YDOA 2WSRA 3RX7A 2F5BH 4YSOA 3O6CA 2DF3A 3OR7B 3UJJL 4WI9A 3JWOH 3NABH 1OCWH 1KWGA 4CD8A 4MFHA 4M51A 3R18A 1UM4L 4R0LA 1L0YA 3G5VB 1TWSA 3FF8A 3L4XA 1EGJH 1DJHA 4PS7A 2M8XA 2BSDA 4Y2NA 4B5ZA 3BGMB 1KBJA 2NDGA 5GS3A 3BZFA 3LHWA 1INDH 1I8MB 1O9ZA 3I6SA 1KBKA 4F3HA 4N6QA 3CXHK 1I1FA 1CGVA 4U3CA 2B3RA 4IRSC 1FO0A 5EB9A 4BEIA 4ABQA 3OR6A 3V4LA 3V0UA 3FTXA 3LEVH 3BTNA 3SDYH 4JTRA 2ODIA 1FGNH 4S0TD 3PZMA 1FH8A 1BXVA 2ENQA 5EOQH 4CC4C 2O30A 2ZKMX 3BDYH 4N8CH 2WB1A 4N86A 4J6RH 6FABH 3QXTA 2E7CA 3LQAC 3ZVHB 4IISA 1MLCB 3IMTA 2GI7A 5E8DL 5J5RA 1J0IA 4PTDA 4D6FA 2OW6A 1TTUA 2XQBH 4A6GA 3M5YA 3ECQA 2QADC 3TP4A 5FJIA 1HZLA 3LKOB 4H2AA 2R0LL 1LEIB 1I8KA 4MCMA 3CNKA 4TQEL 2Z29A 1E27A 3S4SG 4PWKA 5EDSA 4FX5A 5F7NC 3V95A 3L7FA 1OTSC 5ENLA 2VR2A 3MRFB 3BLOA 2G3ZA 1LMIA 4GNJA 3MCG1 1R3SA 4MD5B 3E2RA 5T26A 2A9DA 2DIEA 2CA4A 1OD9A 3H21A 3SZKC 4D0CA 1EPVA 4Y8AA 3PWNB 1TMCB 5BRZA 5MI0B 5DQ9B 1G43A 1AYOA 4UFMA 2X7LB 2WLLA 1MNUL 1QSED 3PGDB 4ZXBC 3QMSA 2R2CA 4Z5RA 1OK8A 5INDA 4HSNA 4UTWC 4MMZC 3AHTA 2VXSH 5IUSA 4W6XB 1AR1B 4L3ED 3XISA 1NEYA 5I1LB 3UO8B 4DZBA 3FX4A 2JTDA 3BRGC 3Q3GB 2I5GA 2IH3A 4UM9A 2OLDA 2WNZA 4NQVA 5AZEL 3VW3H 2H6PA 2VMEA 1KKOA 1DLFH 5EO0A 2R94A 1NDGA 1R3YA 4M1CC 3FQTB 1V54B 4ZD3H 3MKKA 4M62L 5F2FA 1R2RA 4XAZA 1G4SA 3QDMD 1PTZA 4GW1A 2PLCA 1PNCA 1BKSA 5E95B 2APBA 4TKWA 3EO9H 3JW7A 1ND0B 4O12A 3FEMA 3ZLFA 1AZBA 1PKOA 4OZHF 1TNMA 2J8OA 3W56A 3EGDB 1GS6X 4PCPA 2QCLA 4JOMA 4ATWA 4CU6A 1M2VB 5J57B 2DIAA 1KG0A 2Y7SA 4UTTC 2JKLA 4L0YA 3VZXA 1VFAB 3BARA 5I07A 3MQIA 1JCJA 5AOJA 1KPVB 1JBJA 4CNSA 2AQOA 4DYKA 4GQRA 4YPGA 5DTFB 1CN4A 4MGXA 4BE5A 1P4BH 3MV7E 2WY3B 2IKHA 3CDCA 4UF7C 1YIXA 5ICYB 3P30L 3LZQA 2D69A 4M6QA 4Y88A 4JFEE 3RNDA 5GRJL 3BGMA 1NL0L 2AGKA 4XBJA 1I8MA 5IW1B 3SE9H 3SPCA 2V9UA 1JPFB 5F9WB 2WC3A 3KHOA 3S88L 3LYRA 1ONRA 4ERIA 2BK8A 5C9XA 1SMDA 1WISA 5LKYA 3WE6B 2RJMA 3U0WH 3VFRB 1QI4A 5FUCC 3NZQA 2DZTA 4A2DA 2GC7C 2R82A 4Y8DC 3BIBX 3ZVHA 1MLCA 4G7YL 4IJRA 1AXIB 3QV8A 1HZKA 1GSMA 3FZUD 4NQDE 3I2CH 2Y69B 3FUMA 3O11B 3U6RB 5LNWA 3IMUA 4OFPA 1NMAL 3UP6A 1XX9C 3LKOA 5LB1A 2VCAA 1LEIA 4UZSA 1UQYA 2BXYA 5BS0D 1K4GA 1QFHA 3LOTA 2O9OA 3BGAA 1XXXA 4QRRD 4UTHA 4PE8A 2YLLA 5AW8B 5EN2B 4PMEA 2GCYB 5AVVB 2W0KA 1DHKA 4XZ4A 4RNIA 4HA4A 3ARVA 4AQLA 4MD5A 4A38A 1TO4A 2QDDA 1CR9L 1HNYA 5CBBA 1E5JA 2AERT 1EJSC 1EHXA 3JUGA 4NQXB 3ZJ8A 5ABHA 3IDYC 1YRRA 2R6OA 1G7QB 2FYMA 4MRBA 2DOCA 2BM3A 1UEYA 1JE6A 5DQ9A 2X7LA 2PP0A 3GG0A 3WQCA 2Z6FA 3LD8C 2JIXB 5I6MA 4M5ZL 4HKPA 3T2PA 5J6GA 3CVCA 2WXQA 4AB4A 1THAA 3P1VA 6ALDA 3MBWB 3ARBB 5KUMA 5I1LA 3VKAA 4JB9L 4P8VA 2NYYD 4CL7A 3IM1A 5GGTA