3BBCA

Crystal structure of r88a mutant of the nm23-h2 transcription factor
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
151
structure length
151
Chain Sequence
b'ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGAVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase B
publication title NM23-H2 may play an indirect role in transcriptional activation of c-myc gene expression but does not cleave the nuclease hypersensitive element III1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 47
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3bbcA00
3EVOA 3G2XA 4DZ6A 5CAAA 1HLWA 2BX6A 1PAEX 3Q8UA 3PRVA 3ZTRA 3Q83A 3Q8YA 5BXIA 5IOLA 1NPKA 1NUEA 3NGSA 1EHWA 4DI6A 4C6AA 3FC9A 3EMTA 1HIYA 1NDPA 1NDCA 1BHNA 1U8WA 4O0NA 3FBEA 1NSPA 2BEFA 4ENOA 2HURA 1MN9A 4UOGA 2CWKA 1BE4A 3VGTA 1VYAA 2DXDA 3VVUA 4UOHA 5C7PA 3ZTSA 3JS9A 1PKUA 4FKXA 3Q8VA 1XIQA 2DXEA 3ENAA 3EVMA 2B8QA 3FCWA 4KPCA 1WKKA 2DY9A 1B99A 1F3FA 4S0MA 1UCNA 3NGUA 2AZ3A 1JXVA 1ZS6A 3FBCA 3PJ9A 3BBBA 3BBFA 1MN7A 3GP9A 1NSKL 1XQIA 1LWXA 3VGUA 1NDKA 3VVTA 4UOFA 5CABA 2DYAA 1NB2A 3ZTOA 3B54A 4F4AA 1K44A 4HR2A 2HVEA 3L7UA 4DUTA 1B4SA 3BH7B 1NHKL 4F36A 3NGTA 3WX8A 4FKYA 4EK2A 1NSQA 4W98A 3Q89A 3EM1A 4CP5A 2AZ1A 3VGVA 3DKDA 2HVDA 1F6TA 3EE3A 3EICA 2VU5A 1NCLA 3ELHA 3ETMA 3FCVA 3GPAA 1S5ZA 1NLKL 2B8PA 3MPDA 4ANDA 1LEOA 3FKBA 1WKJA 3ZTPA 1KDNA 2NCKL 3EVWA 1NDLA 3FBBA 2ZUAA 1W7WA 3VGSA 3B6BA 3NGRA 3DDIA 3R9LA 1WKLA 3EJMA 3FBFA 4ANCA 3BH6B 3ZTQA 4ANEA 3Q86A 1BUXA 4WBFA 1S57A 3BBCA 1HHQA 2DXFA 1S59A
chains in the Genus database with same CATH superfamily
1KLNA 1X9SA 2VHGA 1FVSA 2YNIA 3CPWR 4ZCIA 1L3VA 5ETTA 3TP2A 2GVDB 1UVKA 3MEEA 1G7CB 5CCLA 3N5BA 1FDDA 2IMOA 3J7YI 2CQ4A 2XCPA 1KKHA 1UKUA 1GQEA 2W25A 3DOMB 1RK8A 1BQXA 5KFPA 1HR0J 2HVZA 3HJVA 5KFCA 1HBMB 2AX1A 4HHJA 4RPFA 5IFMA 3P96A 5AXKA 1DURA 3NAHA 4OYXA 2HGLA 3CC7S 3NNHA 3M8YA 5HLFA 4AUKA 3VGUA 3A3NB 2XEXA 1MU2B 2B7BB 5H1SV 3EXCX 4R0EA 4RLEA 2HLTA 4NEZA 2AJ1A 4IOCQ 2R8IA 2XWYA 2B9XA 4KFBA 1ACMB 3KLEB 1SKRA 1YGYA 3MPUB 2PMHA 3AH6A 4DU7A 2GA7A 3IS9A 1TK5A 3DDIA 1FKPA 1N32F 2KJWA 5EN1A 1D09B 4DR2F 4GVLA 1JLEA 5M2PA 1J5OA 2Z2ZA 2MHNA 3F0NA 1EAYC 2QL7B 2HZCA 4Y28C 1HYSA 4R5PB 3C15B 2H1YA 2UUWA 4YEAA 2UUCJ 1VYAA 1WEXA 4AD6A 2CAJA 2V4RA 2HYIB 2ZBPA 3PEHA 2XZTB 1IQZA 3QFHA 1G1XA 2QL9B 3HCXA 2H9ZA 5BYRA 2MLYA 2LEBA 3H40A 4FNHA 2YQ3A 5HANA 2WVCA 2NZ4A 3UO0A 1TL7B 1H6KX 4DFMA 1OMSA 1KOOA 3G8SA 3GILA 1OSDA 2YNGB 4NYPA 4ZVGA 3CNQP 3KJQB 1FE4A 3TZZA 1TKZB 2XCAA 1NDLA 2BJ7A 2LP4A 3K8VA 1RAOA 4NLTA 4C8NA 2J0XA 5KT2A 2OPSA 3DU6A 4WCEQ 1IKVA 2EC2A 2VC1A 3OTBA 4DDFA 2F4FA 4NL5A 3CSKA 4K4SA 1FTCA 3CD0A 4HI2A 5EHHA 2J0QD 1VJQA 2Q6BA 3W9HA 4LF8J 2WSFC 1WOPA 1U7LA 2E5IA 3CJSA 1AYEA 2W24A 4AYBD 4GKKF 2QZ8A 5KG1A 2ZOMA 3DRSB 9RUBA 4WU2A 2E7WA 2CPIA 1M5VC 3FRYA 1ITPA 2GVZA 5T14A 4RUBA 5L38A 2W7OA 5A6PA 1RHMB 4ES3A 3QYYA 1Y9OA 1JLFA 1B0TA 2GNKA 2O66A 2BRKA 3KLHB 3MMAA 1LXJA 2OMOA 4BLGA 2A10A 4ZK7M 4DPUA 3QZ7A 4DV0J 5EUHA 2KFZA 5KFEA 2F5GA 4KT0C 1EJ7L 2AWZA 3OFFA 5BXIA 1B7FA 1JIHA 3OFHA 4J9VA 1QTMA 1RBLA 2BJ8A 1JXEA 3QIPA 3TX0A 2ZH9A 4JI5F 2DR8A 4PXBA 3KJNB 3UDCA 3NNCA 4ZLPA 4DUYF 2QSFA 1XN9A 2B8QA 3IBCB 1R0CB 3UCZP 3GE9A 1TVRB 2PMWA 2FJEB 4ZVFA 2Y9HA 3WX4A 4HDHA 1VRTB 1QLNA 5D0RA 4L76A 2HG4A 3N79A 4FS2A 3NS5A 4Z7YA 2K06A 1RCXB 4C9DA 4G3IA 4EWTA 3FSXA 3GSIA 4LFCJ 4X65F 4I2PA 2VB6A 4JI8J 5CXTA 1RHJB 3M7VA 2RDJA 4R0JA 4CT9A 4QWEA 4B3RF 4DHVA 3D6FB 1WG4A 2XMAA 3US5A 2WOMA 1HW9A 3ZNUA 2G2ZA 2E5LJ 1PCAA 3M6VA 2KDOA 2XBPA 4P72A 2BANB 5J2PB 4P2FA 3HLUA 1RKJA 3UD5A 1LWEA 4FYVB 4PWUA 2CQBA 4GC6A 2LCWA 4F4XA 4FBUA 4A8YA 1WHWA 2IJFA 1I6JA 3TQEA 3ZZRA 1WDTA 5H9EJ 4NX9A 5E0OA 1RP5A 1FWLA 1SBRA 1UZHA 3VAJA 2CXEA 5D0GA 3GIKA 4KPYA 3FDSA 2RQKA 3EDQB 3Q8QB 5DO2A 4WTOB 3CEDA 5IM0A 2DCUB 1FRHA 3EM1A 3KUEA 3GIJA 1Q79A 2R2UA 4OX8A 2CZVC 4DV1J 1N33J 2JC0A 2XMUA 1SUQA 4KHPF 3DOLB 3BEGB 3FBBA 4ZHRB 4NOHA 4PXDA 2A1BA 1N48A 3OD2A 2VH7A 3K7RA 2ZBCA 4YMEA 4B3OB 1W2IA 3CMAS 2KM8B 2XS2A 2F7VA 2D9PA 5B0EA 4DR1J 1NSPA 3H5UA 3IFEA 5CCMA 4NLPA 2EG2A 3TQ1A 5JVHQ 3QRQA 5K8OA 1MWZA 3OVAA 1RSCA 3PIOQ 1P8GA 5HP1A 3OTEA 1FEHA 1KS2A 3LOUA 4NYZA 1IBMJ 1LW2B 1OPIA 1KLMA 3TZWA 1MWYA 3MCNA 2IC3B 2M88A 3GV5B 1X0FA 3ET6B 3B82A 1Y3JA 1XR7A 5I3UA 1F0XA 3TYTA 4C98A 4M63A 3CIZA 3EE3A 1FRKA 4KE5A 1HBOA 2C3MA 5EX3A 4MKVA 3M2VA 2I8EA 1NJWA 1HWUA 1Y7PA 1HHQA 2DNPA 4HT5A 2OPQA 1M0SA 1BWEA 4A8OA 3BJYA 2ZM6J 2VIHA 2VICA 3UN2A 4P9SA 2AT1B 4Q2MA 3PW2A 2Q3PA 4YN3B 2QC3A 2VJUA 1U24A 2DT9A 1UVMA 4CT8A 4QR2A 4X84A 1WDDA 3WQPA 2WB1D 3MM8A 2M7SA 2P9GA 3OFGA 2OPRB 1IN0A 2XGPA 3Q8VA 2K1RA 3AQOA 5FLXY 2VPWB 3QZ8A 4DV0F 2F9DA 4USWA 4IG3B 3PJ9A 2RKIB 5KFUA 4FN5A 1GT8A 5D3GA 1KP6A 3UCUP 1ZZFA 3MM6A 1VQOS 1HNIA 2AYMA 3A3OB 2XQCA 4DV4J 1SI9A 4ZPBA 4G1IA 3W5YA 1FDBA 4PXEA 3H98A 1WORA 4ZVSB 2V8VA 4M1KA 2XULA 2ZKUA 3NP5A 4C7QA 2PI5A 1GH8A 5I42A 1VQYA 3D2WA 5HI7A 2HRYA 1Q86T 3GU0A 4GC7A 5KG4A 4Y2AA 2FHKA 5L46A 2CZ9A 1X7VA 5KFKA 3W8GA 2P6TA 2RD5C 3CW2C 2FZGB 3DFEA 3M30A 5IXUA 1FFGB 1YJRA 2WTFA 3BGOP 4DQRA 2RHQB 3W9JA 2N7YA 1NJIT 2F3JA 2DGVA 2QYGA 3M2UA 2WSEC 1S76D 1WJ9A 2BKNA 2NPFA 2OHDA 4ZJLA 4IRKA 1ZBTA 3FJ2A 2EWHA 4CO0A 2Y0SD 2VUGA 1S6QB 2R3VA 4V1Ak 3ILJA 2CVIA 4YDXA 4P74A 3VHQA 1R31A 4DSEA 3GSDA 2EFGA 1YQHA 3GQCA 1YJ7A 2AJ0A 1C1CB 2QO3A 4PUOB 4QPTA 5CYQB 4ELVA 4F4AA 1WC6A 2U1AA 5DETA 1FTRA 1S49A 1RTIB 3KLFB 1Y00A 5DS7A 1IWAA 4ZLJA 1RHUB 1OYDA 3H42A 3BN7A 4C0BA 2GC8A 4A47A 2GJFA 3ZZPA 1FJCA 2B3TB 3BH6B 4RU9A 4ZIWA 3BDEA 5KFLA 1JJCB 4O4GB 4RW8A 4QBUA 4ILMA 3ZZTA 1YITS 4KHMA 3HT3A 2B5JB 2E1RA 3KMQA 2HFZA 3HULA 2BA9A 4RWXA 3AODA 3OR1A 4DV1F 3MDFA 4K4XA 4DL7A 4X4NA 1DLOB 5M2UA 1YJTA 1N88A 3G6XA 1GEHA 3EVMA 4F3QA 4DWIA 2RRNA 4G1QB 4M5IA 1CJKB 2HFSA 1OWXA 2RHSB 2Z0GA 3A13A 4ECXA 1X4DA 1V3ZA 2MY8A 1S1XA 3C6TA 3MM7A 4YHHJ 3H90A 4NCGB 3TJ8A 2VG5B 2LXIA 1NK4A 4RW4A 2JFDA 4IH7A 3AXMA 2RE1A 3F73A 5HSPA 5IC4B 3AJDA 2DNNA 3RAMA 4EYHB 2R2TA 4K59A 3UNYA 4WFZA 3I0RA 2G4BA 1IBMF 2LKZA 3MPYA 4LSLA 3CJ4A 8RUCA 3TVKA 3G87A 3HZEA 1Q1KA 1RAIB 4NPOA 1G6BA 4PWDA 5A0YB 2AJQA 2ZUGA 2HS3A 4K2JA 1V3RA 4ECWA 2M4MA 1U8WA 5JJBA 3NS7B 4ITSA 4BDPA 1PO6A 4RUHA 4QYZJ 2R7WA 3E01A 3TZYA 4C11A 4KC5A 1VCTA 3KG4A 3CJ3A 4U95A 1H2UX 2E66A 1J27A 3BGUA 2DTJA 3OHBA 1JJHA 2ZM6F 3E2EA 5AE3A 3M2RB 2QYCA 2R7UA 4UQTA 4OLPA 2AJFE 1Q81T 2NLWA 2GQQA 4QZVB 4WYLA 5SUHA 2A18A 4FBTA 2HS0A 2VG6A 5KFGA 3G6VA 2AD9A 1UETA 2CPFA 1KDNA 4ZP6A 3R8YA 3T1YF 4NLVA 4WXWA 3Q2SC 2YKMB 1Y0HA 3P45B 3Q8SB 1LFWA 1OQ6A 3Q2TC 2WONB 3Q8YA 1KQKA 4KRWA 1NAQA 2N4CA 3GIMA 2Y0BB 5D78A 2QFIA 2B9EA 4KYZA 1YJVA 4ZDNA 1N5YB 3JSMA 2DNGA 4LF7J 1WACA 4ZP8A 3CF5Q 3K89A 3TEHB 5LMNJ 1AXQA 3JQMA 5J2NB 1UPPA 4E2FB 3DOKA 4JI1F 3NOGA 3OL9A 5E3PA 2KYXA 4I7FB 2DYAA 3E8OA 4P2XA 1TFWA 1WTBA 2CDQA 4OYPA 2PO4A 3W8PA 1NHKL 1NH7A 4C8LA 1T9UA 2L41A 1VBXA 2C3UA 1IUJA 5GAGU 1C4CA 2AEFA 3MCSA 2BW2A 3PJWA 2CPDA 1ZOTA 2OMLA 5DJBA 2YTCA 1YBUA 3DGPB 1K1QA 3LPEA 2QLXA 4OI2A 3GR1A 1TFYA 3A8JA 1RAAB 4ES1A 4DSKA 1FRJA 2FVSA 2VC0A 2QMXA 3TAMB 1V6HA 2VFVA 2YKAA 4QW9A 1KQFB 1HQUA 3QO9A 3KG1A 4WK1A 4QCLA 5CZVA 5HL7Q 2LFVA 1CVJA 3LP0A 1LOUA 2Z8QA 3DLJA 2I5JB 2B4OA 3H5YA 2IM1A 4NZ7A 2A6MA 5H9EK 3KOAA 3M9OB 4LREA 3OFEA 1RT5B 2R7RA 1NHVA 1FCAA 5DLFA 3IO1A 3QGGA 1RDRA 3BO4A 3OVBA 1TV6B 3ETMA 4ANDA 2MZJA 4QWDA 2MKCA 4F7VA 1FT8A 1R7IA 1Y3KA 4WTYA 2P9EA 4B9MA 1WC5A 3I56S 3QRRA 2YPYA 3F41A 1T3OA 4B3TJ 1YRTA 2ZC4A 3BYPA 3OV7A 3CGIA 1RB0A 4YHHF 2AGQA 4F2SA 3LTOA 1NPKA 1RTHB 2C2RA 4JI4F 5DGAA 5B08A 1UZDA 4EBCA 2E5HA 4TNOA 4IFVB 1WSRA 2RF2B 2FJVA 2DY1A 4B9VA 1WC3A 1S9EA 1YSJA 1WWHA 1I94J 2LLZA 4C3MA 1VLOA 1CQMA 1B99A 1F3FA 3DM2A 1MG7A 5ETRA 1TL1A 1SJFA 4L6V3 3RRKA 1WHXA 1CJUB 5D77A 3R1LA 4U9RA 5HJXA 1U26A 4PABA 4ED4A 2NXUA 1YJUA 3L3CA 2I1RA 4I0WA 3AJ2A 1VR6A 4FYWB 2FD2A 1JNRB 5B09A 1CC8A 2ZH5A 4DS5A 4OX6A 1KHWA 3ILLA 3CCJS 2MKYA 3UD4P 2ZH7A 1BQNB 4IH5A 5C24A 3M8PA 2DXFA 2XSJB 1YJ9S 2BX6A 5LJ5Y 5LJ3Y 3DHWC 2VJVA 1NZAA 1RCOB 2CJYB 4URQU 3A3PB 1LWFB 5FDLA 1JLGB 4JBCA 3MEDB 2DNMA 3GCXP 2AHOB 4JP8A 4KIAA 1E6YB 4UW2A 1C0UA 4DBQA 3CCRS 1Y11A 1KFDA 2XHWA 1RHKB 4PPZA 3GG0A 4HVZA 2HZAA 4UTGA 3M8QA 2GAHC 4TU8A 2B7CB 5KFOA 4KGXB 1S1TA 4TU9A 1SIZA 4BC7A 4O23A 3FEXB 3VVTA 3HK2A 3B8HA 2XMJA 3AFGA 3NGTA 2HNDA 4FYDA 5LM7E 3MMBB 3R7BB 1H2VZ 3MCMA 1FKOA 4LF7F 4Z37A 2VBWA 2HGMA 3RAQA 1H38A 1RAGB 3GJQB 4CYUA 2PD1A 3H5SA 1ZM2A 4DV3J 1HMVA 3HSJA 2DGUA 3MZIA 1RLDA 1RWXB 2KZMA 2MJUA 2MGZB 2DR7A 3EGZA 2XYGB 1NHUA 5KT3A 3PKMA 3GZ7A 1DTTA 3MEKA 2BQRA 2MY7A 1LV5A 4JV0A 1RT2A 2AX0A 1T3NA 2ZDOA 2G2YA 5D4NA 4AFFA 1MROB 2P8IA 5BR8J 2CQPA 2Q43A 4WKRA 1PGZA 3DXBA 4TYBA 2L9NA 2V9KA 2QJ3A 4DQSA 1U1MA 3BO2A 3V5RA 5KOWA 2VG7A 5CYMA 1N4LA 3KLGB 4JYAF 4U96A 1LQ9A 4Q44A 2FJAB 1UEUA 3HHDA 2OPPA 3FNNA 4HR2A 1UFWA 3R5CA 3MUMP 2HHHJ 2HVHA 1K0TA 3Q24A 1U1QA 1GTHA 1APSA 3R5GA 3CDWA 5A8RB 5HQLA 1RAFB 3TRGA 3DMJB 2HQ3A 3KJVB 2ASYA 4U8YA 2UXCJ 1REVA 1FRMA 4H4MA 2C2OB 2L9DA 2UP1A 2LECA 1HLWA 3O2IA 3GV7B 1OJ4A 5DDQC 2Z58B 1VDHA 1ZTTA 3POTA 3DNCA 4OLOA 5J2MB 3SIPB 2KFNA 4BC9A 2VDIA 5G0RA 2O5DA 3THTA 4OZ5A 4P6QA 3RUBL 1R0AA 2MQMA 3N6NA 3P8BB 3U02A 4P75A 2APOA 2IFXA 1CJVA 1RTJA 5ETMA 2ILYA 4B3TF 3HF5A 1MMLA 4CLPA 3MWBA 3X3UA 5JVGQ 3IN5A 1S1UB 2MKIA 1VIXA 2YPZA 3SV4A 5CD4A 4ER8A 3UVJA 2ZOGA 3OL6A 3QT7A 4DR5J 1L3TA 3KK3A 1EQ0A 1GMVA 2O3DA 2ZVIA 1RT7B 4QOTA 4HDGA 2HMIB 3AY0A 3DI6A 4CLYA 1I94F 3NOCA 3ZTQA 4K4YA 4U8VA 3QGHA 3NAIA 4AL7A 4DFPA 5KG0A 5A2QU 3NRBA 2MZTA 2NQPA 4CLUA 5T41A 4LFAF 4IFYB 1HBNB 1VJWA 1D9AA 2ACMA 4P2SA 1R6VA 1RWOB 2OO4A 3DYAA 2DNKA 4O0NA 4B17A 2M0GB 1U6FA 1XMOJ 2VFSA 4QYZK 3MECA 1H7XA 1HA1A 3VTIA 1SL2A 3IWXA 3JXOA 1UJ6A 5AE2A 2ASDA 1RAJA 1BQMB 1S4EA 4K50A 1UWBA 3TEGA 1JKHB 2G0IA 1R8BA 4F2RA 5ETVA 2V6AA 2MQPA 1IKWB 1YRXA 3JAMY 1GXLA 2V0NA 4YDDB 2CQHA 2E29A 3TOQA 4B9LA 2BXJA 1MNEA 4ZP7A 3ITHA 1HNZJ 3SSSA 1NK7A 1YBTA 3D6TB 3F56A 2HHXA 4DR4F 2DPIA 3DRRA 4H54A 3UWTA 2G1HA 3V4IB 4RUCA 2YKNB 1JLQB 4KV8A 1CSJA 2OSQA 4KH1B 2ZZMA 3D54A 3OLBA 2LEAA 5LXRA 4UZBA 1EHWA 1RAEB 1U2RA 3HZGA 4N56A 5HVHA 4K0KJ 5AJ3F 3T5JA 3UN5A 3M4XA 4A8WA 2XNQA 4DV3F 4MK9A 3DU5A 3CC4S 2JLFA 2F65A 2XY7A 1XMQF 3M1VB 1Q5YA 2NS1B 2D3ZA 2GHWA 3ENAA 2HGNA 4CLSA 2LEPA 1T0TV 1JK9B 1RQ0A 2GMJA 4DL0C 2LXFA 4O44A 4LQ9A 3TA1A 1Q82T 1N36F 3C14B 1YDLA 2DRBA 5BR8F 2FVQA 3K5LA 4OYWA 3B4DA 3MR3A 4Y3CA 4NLUA 3TUIC 5A6WA 3THVA 4UF4A 4NEYA 4YQWA 2VOOA 5KG3A 5HBMB 4KSEB 1O8BA 1FXLA 2E1CA 1QTNB 3LAKA 1BUXA 3CCMS 2KL8A 5B0AA 1H98A 4EYIB 4AL5A 3HHLB 1NK9A 2W9BA 4P71A 3GJTB 1HNXJ 4WFYA 4QIFA 3SQGB 2FZCB 4KKOB 2MPUA 4O3NA 2A2CA 2I6WA 3RYLA 1KVIA 3W1YC 2IYGA 3KTQA 4WE1B 3BREA 4HYKA 2EI5A 4LR8A 5CYJA 2HK2A 1KFSA 2GMHA 4DX8H 3L9ZA 1SQGA 5DLGA 2H65B 3I0SB 1R8PA 2RU9A 1AFJA 4L3NA 1FDNA 2LU2A 2B4UA 3NEKA 1VMBA 2ZNZA 4OI0A 3V4MA 4J9RA 4DR3J 3RBZA 4OYAA 4ZN3A 5DDRC 1RWMB 3WHIA 3DRPA 4RU2A 2OD6A 3PDNA 4Y34A 4LF6J 1U49A 4J90A 4WP3A 1REGX 1WKJA 2GVDA 1SJ4P 4K5RA 4PEOA 2O01C 3M9MB 2M2BA 3DOMA 1RWWB 1NK6A 1D8YA 1FO1A 3RRGA 3HXMA 1HBMA 3LP2B 3JSYA 1N5SA 5A8WB 1RWPB 1JLCB 3FRZA 3QRPA 4HACB 2D1CA 4DR5F 5E3RA 3MPVA 5CD4H 1DJ0A 1MU2A 2HS4A 4GKJJ 4BWMA 1WELA 3UFCX 4HHUA 2B6AB 3HVWA 3VAHA 2XB2D 4CLTA 2NR0A 5HN0A 3KK1B 1HL6A 3KLEA 4P73A 1ZETA 1NB2A 4G1PA 1Q95G 4CLKA 4OHXA 4IG0B 1F5CA 1BMQB 1XMOF 2VBZA 4C48A 2HAIA 4DF8A 4PG7A 2R7OA 2IAJB 1L3KA 2H5EA 4J9SA 2KI2A 1FHTA 1EP4B 4Y2MA 4R5PA 4ECQA 2CJXB 3C15A 2HRTA 1TELA 3OTDA 3ETOA 4DLEA 5FIIA 5I3QA 2ERRA 2AKWB 2DNLA 1QAXA 3H2VE 3Q8UA 3UN3A 3MR7A 2HPUA 3T41A 2VASA 5DM7Q 3MFHA 4OI6A 3SMZA 3JTNA 2DR9A 3N9UC 2KVQE 1VOMA 2LDYA 4ICLB 3SBMA 2K2PA 2EK1A 5KFAA 3G82B 2EKYA 3GB0A 3A8KA 3ILOA 2Y1RI 1TL7A 1EKRA 2ZD1B 3RGIA 4KPCA 2MB0B 1A0OB 2W7PA 4B9SA 4ZVUB 4LF5J 4RL1A 4WJBA 3CMQA 5KFMA 2CPJA 2D7SA 3JTOA 1NSKL 3C19A 3TAPA 3VAFA 2YNGA 3N01A 1TKZA 5DG9A 1YIJS 2YWWA 3EGWB 3K8WA 3ZO7A 4CTAB 3UW1A 4K4VA 2VODA 4WPAA 1S72S 2DEJA 4K0KF 3RZAA 3SFUA 1IQTA 3D66A 3RB0A 4JI7J 4DPWA 1HNWJ 1NO8A 2YWKA 4ED0A 1UP1A 2XMWA 1EIYB 2VONA 3R9LA 4OZ0A 1UA1A 9ATCB 2COLA 3CCZA 2OEJA 4L74A 5EX0A 2PN6A 1IBKF 2QTWA 5IOLA 2YVSA 2GQ2A 4CIOA 3MOJB 1QDUB 1I5OB 2CG8A 2IVFB 2XWXA 4F3MA 5KFQA 2HURA 4TYAA 1FRLA 4DSFA 1QM9A 4DSJA 3ENVA 3DRSA 1S10A 2V8DA 1WUUA 1KOHA 1BXNA 2J0SD 3U7JA 1X9WA 3ZC4A 1ZM9A 2NUHA 3IRWP 4OYOA 3V81B 1Q5VA 2QG9B 4LFBJ 3N6MA 1HNXF 4OHWA 4LBIA 1Z2LA 4WFBQ 4DV7J 4DS4A 4C97A 2B9YA 1KEKA 3KLHA 1PYOB 3BH7B 3MAQA 1VQPS 3MUTP 2B4VA 1HI1A 1UVLA 4AQYJ 3G8TA 4ZLLA 2C2MB 2W9CA 4EO8A 2RUSA 2RB7A 3GCWP 4HHHA 4JI2J 1DY3A 1TUVA 1RBOB 1XEZA 2KM8C 2RAQA 1QVGR 2XC9A 4XPCA 2DNYA 1GX5A 3I6PA 4YR2A 1YK9A 2FVPA 2M52A 4ZA1A 3OHAA 3CCSS 5D4OA 3VF0B 3I55S 2XY5A 3I9ZA 5ETPA 2R8HA 5GAGI 2JZ5A 4LF6F 1TVRA 5GAHU 3DLLQ 4OZ3A 5KG6A 4PG8A 1VRTA 1SC1B 1UA0A 4Z7CA 2XLKA 1FNMA 1DQ8A 3MAHA 2MSTA 4I64A 3BB5A 3K5PA 3QPIA 4U67Q 5HROB 1X5TA 4HT7A 4MFBB 4DOZA 3V6DB 4KGMA 1A9NB 3IR6B 2GAGC 4CRJA 3MURP 4WIQA 1LWEB 1F9EB 4MAKA 4M94A 4GKJF 3HFVA 3PJXA 5RUBA 5T7LB 2FUG9 1X0PA 2D69A 3NGRA 3PYDA 4DPTA 5ETQA 2BANA 1Y5IB 5J2PA 3VAIA 4XDCA 5F3ZA 4J91A 4CM0A 3AOAA 4WFXA 2OAUA 2R8KA 5KFTA 4C4WA 3A12A 5IQQA 2YX4A 1RHRB 4J9MA 5L1JA 3HHNB 4GRSA 5HMYA 4ZVPB 3GJSB 1TU0B 2IDEA 3ISND 3CB4A 1MMNA 3BKUA 1WKKA 1YTYA 3BBFA 1R0BG 5C2CA 4G65A 2DIVA 3D7SB 1WEZA 5E33A 3N28A 5LT5A 3DOLA 3OXLA 1O5JA 2B0GA 3R2DJ 3U27A 3NGDA 4ZHRA 2F8EX 5IQ6A 4OZNA 1CULB 4OJ1A 3T5KA 3W63A 4OL8A 4J9OA 1FJGJ 5AT1B 1F5BA 2F8HA 5I3PA 3C2PA 4NZ6A 3PX6A 2EC0A 3BM7A 4W4MA 4B3OA 4I56A 2ZHOA 4C8KA 2PI4A 1YBAA 4C0OC 2YNFB 1PILA 1VISA 2HIYA 1T9XA 4QIWD 2GX8A 2KG0A 3S01A 1AUSL 1F5AA 4JV2A 2C2ZB 1SJRA 3FFIB 3GONA 1Q53A 1YG0A 5KT4A 1G3OA 3AQPA 2X1GA 4IKAA 4NA3A 3AOCA 1H0HB 2RQ4A 2L9WA 5HVFA 4V19X 1CC7A 4BS2A 1HNWF 2BV3A 1LW2A 3OUYB 4QPXA 2JVOA 1XC9A 3KXDA 3HSZA 1IBLF 2IC3A 5EDWA 3PZPA 2DGXA 2N3LA 3LWMA 3I4PA 1WF0A 4IQMA 2IRXA 3JB9k 4L3KA 4RNFA 5JXSA 4FVCA 4HTIA 2QIFA 2CJKA 3THPA 5SZTA 1KQGB 2R8GA 1FD2A 1R3NA 1QUPA 2HHPA 4NI2B 1LNQA 1T94A 2ZNYA 3HD1A 3EZ5A 4B9NA 1HPZB 3MM8B 1FX2A 2HHTA 1F9FA 4DMZA 1Z4UA 4LFBF 3DXSX 1KVJA 4DV7F 4LQ3A 1PAEX 3W65A 4NXNJ 1OY6A 1NUEA 4MKBA 5B0FA 4ED6A 4R25A 3K58A 2IVYA 3EMTA 4A8QA 5HMZA 4AQYF 5L9NA 3IGNA 4IG3A 1S0NA 2RKIA 2NZCA 4ENOA 2LQ8A 1SIWB 4AE5A 4NLGA 4IRCA 2KZZA 1UL3A 3OBIA 2DGWA 2KJVA 4JI2F 2CYYA 4BBYA 4WP8A 5B0GA 3R6GB 4ELUA 4QR1A 1PJ6A 3SCLE 4USVA 2DB1A 1S4FA 5C5JA 2QT7A 2MEWA 2PIIA 3KUHA 3MM9B 3J80Y 1GFWB 3SFGA 3IRXB 3MD3A 5LSOA 1WC4A 3RB4A 4CP5A 1VRUB 2JRSA 2WHOA 2RILA 3P49B 4CWBA 4ZPVR 3M8SA 4URGA 3KHRA 2R7SA 3CCWA 2DNOA 3AD7C 3LP1B 1OQ3A 4DV5F 2HHSA 4M5DB 1FWKA 4ZCMA 2Z57B 4RO0A 2ZHBA 1EETB 2E7XA 1S9FA 1UFLA 2BW7A 3IG1B 1C1CA 4XK8C 2FQQB 4PUOA 2AYBA 4YY3J 4A46A 2OIHA 2DR6A 3DC2A 4FYYB 1RTIA 1N8RT 3KLFA 2Z56B 4J7CA 1JQGA 3CJ5A 5HJYA 1DFDA 1GXUA 4WK3A 2G1DA 1K44A 2GS8A 3HSGA 2W7AA 4MYUA 5IT9Y 2ZZNA 4NA1A 2DR5A 3SDEB 3CIMA 4O4GA 2XS5A 4F0HA 1WHVA 5DG7A 2ZKTA 4NASA 3W3SA 3HVAA 2B5JA 3R6LB 2M70A 3PACA 1RLCL 5KFXA 5KAKA 1AW0A 1NKEA 2B51A 2V2ZA 3CDUA 3VALA 2XHCA 1DLOA 5IWAJ 1YI2S 4R8UB 2IA6A 4PZVA 3P5TL 2GHVC 4DI6A 4N76A 4WWSA 4EFAC 1BHNA 4G1QA 1CJKA 2U2FA 4RJVA 1MN9A 2KVIA 4HEA9 1TKXA 4DQPA 5F8LA 3TANA 2K3KA 4NCGA 2VG5A 4DCPB 1UCNA 1VQ6S 2HIQA 4B3SJ 3J7A1 3V6HA 1AFIA 3GYNA 3DHXA 4LSLB 2YWGA 4F26A 4DUTA 2ZEJA 3UDVA 2ADBA 1B3TA 1FE0A 3GYXB 2DITA 3ADAC 1HNVB 3TUJC 4NCAA 3EZOA 5C42B 3CD6S 3KYLA 1MMDA 2VA3A 2IBOA 2DCLA 5IT0A 1YVFA 5A0YA 4JI6F 4KQZA 2DH8A 1N0UA 1MLAA 2UUAJ 3I82A 1XNRJ 1X5SA 1UVJA 2HWTA 1SQEA 1VQ7S 1Q16B 4NYOA 2KKHA 4OYZA 3W2VB 1NU4A 2H3EB 3ZZ0A 2RU3A 4ZMMA 1RT4B 1JLBB 2V4QA 2EKNA 3TO8A 3SZ2A 3H4DA 2EPIA 3KHGA 1ZAVA 4U7UD 3TX8A 4DG1B 3M2RA 4DUZJ 3RB3A 2ABYA 1RA6A 1IXKA 1P1TA 1TUGB 3HVTB 1SH3A 4OZ2A 3KK2B 1DTQB 1RJJA 1X4GA 2KYZA 4QYRA 3JSRA 2FY1A 1ULRA 3LF0A 2YKMA 3J81Y 1JLAB 2WONA 3R5DA 1S6PB 5KFBA 3GMGA 3PR4A 4KTQA 4DX6A 3K17A 1N5YA 1NPPA 3G8QA 1V9OA 1WOOA 2KRRA 4HH1A 4KHRA 1CQNA 5J2NA 1RT1B 1D9FA 3D6HB 2XYHB 4ECUA 4RZRA 4RR5A 5THWA 3R5BA 4I7FA 5C7PA 3BF4A 2W01A 2GIRA 4FKXA 2NXNA 3N0VA 4N41A 2HNYB 2X3GA 4WP9A 2UVUA 5F9LA 5IV3A 5CABA 3P5BP 4O3QA 2GO9A 3TVYA 3N5FA 3DGPA 1T7PA 2HSEB 3H7HB 4F36A 2V2QA 4HI1A 2J6SA 5GMKa 2AZ1A 2ATCB 1X31C 3PHEA 1F3VA 1U1RA 2YH1A 3TAMA 4F0KA 4OHZA 3IAS9 3GFYA 1SV5B 3PX4A 4J9NA 2FHMA 4PCQA 2W8LA 3TARA 3PYGA 3M6WA 1U6ZA 2I5JA 2PEBA 3GTYX 3O3LA 2BACA 4F02A 4C6AA 1RT6B 2ZVSA 4LR7A 2C3OA 4MIWA 1PC4A 5H9FK 2R42A 1X4AA 2Y8WA 2DGQA 3UCGA 4LIWA 1TL4A 3KNGA 2ZBRA 2IPOB 4IDKB 4Q45A 1SJ1A 2N3OA 3HI9A 3RAXA 1FJ7A 3D3CJ 1I3OB 4OJ3A 3PIPQ 4X64J 3ISNC 2HW3A 2VQFJ 1HHSA 1HR0F 4JV5J 3X1LB 5IWAF 1KRPA 1TV6A 5DQGA 4J9UE 4DR6J 1S1WB 4PYDA 3CUNA 4Y6IA 4FF3A 2C22A 4B08A 3N6LA 2VU5A 2H48B 2VQEJ 2M5YA 1C0TB 4QWCA 1UMJA 2LQ5A 3I32A 1RTHA 4LR9A 3EVWA 1M1KT 3CULA 3G6YA 4B3SF 2XY6A 4F04B 1S79A 1EARA 5FLXU 4BWJA 2V8PA 3D28A 4WKYA 2E1AA 2FJDB 4IFVA 2RF2A 5CAAA 1S1VB 4F50A 2XNRA 1W25A 4YR3A 1H7WA 2W2MP 4NA2A 3FSYA 4FDFA 1G2EA 3DDKA 5HAOA 1CJUA 1XR5A 4ELTA 1SQFA 1AROP 3JS9A 3A1YG 2IA0A 3C46A 3T1AA 4FXDA 2ZOFA 2UUCF 4ZOSA 2W4DA 2X51A 4UY85 1A7GE 4J9KA 1N56A 2KHDA 1TTHB 1J2VA 4XAKA 1BQNA 4TKTA 2YKQA 2AMCB 3ICLA 2XSJA 4CQ1A 2B9WA 2AJ2A 3QNWB 1LWFA 2MSSA 2GO8A 4IR1A 1JLGA 3S1TA 1XR6A 3MEDA 4I6AA 3GFHA 1N5TA 2HHVA 2HK3A 2NXCA 4DZ6A 3OXGA 4RNHA 1AZSB 3SCJE 2X3DA 3ZTRA 4XTTA 4H4OB 3KLIB 4I67A 3G9CA 2Z2YB 4KO0B 3M8WA 2W2QP 4LF4J 4FF4A 2HRUA 2LQ9A 4RBUA 3GJRB 4UOGA 1FFWB 1NPRA 1YJWS 3V2UC 8AT1B 1Q8KA 4YOEA 2UVVA 2HFUA 4XPEA 1M5PC 2BBEA 5F0WA 4USKA 3MMBA 4RNMA 3AJ1A 4LF8F 4IRDA 2KFYA 2VKZG 1NXIA 5D6GA 2G0JA 2HVEA 4NLQA 2R9LA 3W9IA 3EZUA 1U2FA 3Q89A 5KG5A 3HPOA 1X60A 2GV1A 3I96A 1BY9A 3KG0A 2MGZA 1SCJB 3AXKA 2ZBQA 1VQ4S 3DLGB 1BWVA 3HO1A 4FZVA 1CEZA 1WKLA 3IBFB 1N6QA 1MROA 1M5OC 4ES2A 2JL9A 3L4BC 4OZLA 4F25A 3E3XA 2QLBB 1SVDA 1SH2A 3MEGB 3MUVP 4ZPAA 3MMCA 3NMRA 4C8MA 1NEEA 2QX0A 2OPPB 2HQIA 3EUNA 1HKAA 1PIEA 2BRLA 4H4KC 1U45A 1JWWA 2R7QA 2BE2A 3OSNA 3OL8A 3KLGA 2HWIA 2ZH1A 2JNJA 1BLUA 1KN6A 2HNZB 4DU8A 1M1GA 1URRA 4MT1A 3QLHB 1J5EJ 1PG5B 1T9TA 2QV6A 1CJTB 1VIOA 3TZXA 5A8RA 3DMJA 2EFOA 3KJVA 1S7IA 1F2GA 2FPHX 3UDEA 1RISA 3F44A 3W2WB 2ADCA 1S0VA 4PQAA 4Y2IA 1WF2A 5GAHI 3FCVA 1ROFA 3OLAA 2RT3A 1UEKA 4EGLA 2CQDA 3PM9A 3WC0A 3O5TB 1OY9A 3OT9A 4ID5B 1W7WA 4K4WA 3H4BA 1Y4ZB 4X64F 1E6VB 4USJC 2UV8A 1L3UA 4O0IA 2C1EB 4JV1A 4LFCF 2WBRA 1TKTB 4DR6F 4JI8F 4TXSA 2BJ3A 4OX7A 1IKYB 3C8YA 2LA4A 5HMXA 2KT2A 2KB2A 1NDPA 2I2YA 4B3MJ 1D8ZA 4ZVRB 1NNDA 3PRBA 2JDJA 3WC2A 3QAEA 2WK4A 4WYWA 1TL3B 2E5LF 4DQIA 3D1QA 2JHEA 1NB7A 2ZE2B 3GYGA 1S1UA 3QAUA 5KT6A 3C6UB 1W2BR 3GFZA 4LRBA 2C42A 1RT7A 4LSZB 2HMIA 2X1FA 2AQ4A 3IXQA 4X2BA 2MHEA 3IA0A 2GCFA 1RT3B 5F0UA 4B02A 3I5BA 3QT5A 5ADZA 4NLYA 4ZLNA 1N32J 1WC0A 4DR2J 4ZVEA 3HHLC 4EUVA 3O1LA 1AA1B 4IFYA 2UVWA 4DV2J 1HBNA 1FDAA 3EJMA 2R7TA 2E9RX 1CPZA 1N33F 3T9ZA 2JVRA 1GAOA 5K14B 4KJIA 4H4KA 2QMUB 3ZFVA 1OS5A 3I5AA 1JXLA 1HIYA 1X4EA 3B4MA 3EXYA 4ZVQB 3L7PA 1BQMA 4W90B 2H4WB 2J7WA 4N8OA 2V94A 2FHOB 2A3JA 4MTPA 1JKHA 4GVBB 4C8OA 3K5OA 5GADU 3CCQS 1FNXH 2W4CA 4DR1F 1IKWA 3VAKA 1WSVA 3PO4A 3MCOA 3IP0A 2B43A 4I68A 4TY9A 4CDIA 3VWSA 4JI0J 5CH7B 2AYEA 2V9WA 1CLFA 3KKFA 3O44A 4TN2A 2ACYA 2DHGA 3C16B 4PYAA 3K57A 2A2DA 3V4IA 1V5VA 5MLCV 5A8KB 1JLQA 3U1NA 3GPAA 2MXYA 4A8MP 5EGYA 2DGOA 4FF2A 1Q78A 3UR0A 3W60A 3QT6A 5CA5A 3EVOA 2J7UA 2DKOB 2NYIA 1UPMB 4O44B 2CNNB 2X1AA 3M1VA 4LBPA 4U6PA 2WBMA 3T5LA 4IYQA 3FBEA 5J1NA 1O6XA 3TWZA 5K8PA 1S6UA 1FXRA 5GMDA 1RXOB 4LSNB 3M32B 1MSWD 5F8HA 3C14A 2XZDB 3CCTA 3FQKA 3K0JA 2WVEA 3FBCA 2J76E 1N5VA 4LRCA 2VPXB 4F4KA 4CCHA 4OYIA 5F8GA 4EEYA 7FDRA 2VPYB 2W2NP 3ZXWA 3Q8RB 3TW0A 3WX8A 5HBMA 3RBEA 3W61A 4LIRA 2DO4A 3NG8A 3EYZA 4WU3A 3CJKB 5F8MA 2WZ1A 3VQTA 4Q5VA 4DV4F 1NJYA 3HHLA 2AYGA 5IS2A 3SQGA 4KKOA 2DGTA 4CO4A 5D4LA 3MTJA 2DD8S 4OX9J 1DQAA 1OYEA 3SSQA 4EZ9A 4RW6B 4WE1A 4NLWA 3O6QA 2KXNB 2GGPB 2E44A 1FJEB 2WW8A 1VBYA 2JEIA 3AAWB 3CE8A 3I0SA 2V4JB 2F63A 5CZXA 3NGKA 5C25B 1IKXB 1NDCA 3KLVA 1QD1A 3KUGA 4QJVA 3VGTA 2QRRA 3AD8C 2HBYB 3AHPA 2V2KA 5CQGA 1LWCB 1KD1T 3DLHA 4I4BA 2Q6CA 2DRDA 2P5VA 4DFKA 3MR2A 5KTQA 4CH7A 1VQSA 3NBPB 4O3OA 1V3SA 4YP3A 3BR9A 2BOPA 3MI7X 2J7KA 4X65J 5E3CA 4B3MF 2MKJA 4RWWA 2HFNA 5HVGA 1RZMA 3PW5A 1FNOA 1F6TA 2QE5A 2IRUA 2AGOA 4B3RJ 2PT0A 5D15A 4GO7X 5BJRA 4CO3A 1GMWD 2XMMA 2V69A 4QIEA 3TNVA 3TR5A 4NE9C 2DIUA 2W9AA 4QU7A 3LP2A 4NLRA 5A8WA 1JLCA 1CS4B 2XLJA 4LT6A 4HACA 3MPWA 2MDAA 3M8ZA 2IDLA 1VHFA 3RBXA 4X4UA 2LU1A 4L73A 1CBKA 2B6AA 1AB8A 1B7YB 1RA7A 4XIUA 3Q8PB 2BOAA 2OD4A 4PRFA 4URSA 4TU7A 1S0MA 2OSRA 3K5NA 3KK1A 3O8WA 2C2NA 2QA2A 4DX5A 2YWHA 4DV2F 2CWXA 3KJFB 5ETSA 2IYIA 2E9ZA 4IG0A 3FCWA 2XMVA 5DQIA 1X5PA 3SEOA 5F3TA 2IAJA 4USHA 2QA4G 1EP4A 3J81j 1HWJA 4KHPJ 2FLOA 2YKPA 2OELA 2YKOA 2ROGA 1C2PA 4DX7A 2CFXA 1JJ2R 3G6ES 3ELHA 2HWHA 3FZBA 4EI2A 2ZH4A 2KN4A 3VGSA 3IBWA 1UVIA 4ECRA 1T9WA 1EX8A 4PG5A 5C2GA 3AD9C 4N8NA 3MTKA 3U1MA 5DGBA 4ED2A 4ICLA 3FCHA 4JI0F 3PRVA 3G82A 4TLRA 1LK5A 2VOPA 4PWWA 4WIIA 2MLZA 3R7NB 2MKSA 2ZD1A 4RBTA 3QGPA 2E5GA 2CPHA 1GXTA 2ALZA 3WDOA 3CJTA 2DK2A 3MOZA 3IR7B 2FTRA 2ILZA 1LW0A 1Q8IA 1B0VA 1Z2ZA 3BGFA 1XIQA 2JWNA 4CTAA 2DY9A 1TZ0A 1RACB 3V6KA 2R7XA 4KAIA 2PC6A 2RH3A 1T03B 3AA9A 3LALA 3RG6A 2D74B 1ZYQA 4ZN1A 1N54B 2UXDJ 1XBWA 2HQDA 1NSQA 1NK5A 3JYTB 1R27B 3BSOA 2I9SA 4CLFA 5KFFA 2MKKA 2F9JA 5KFNA 3DLKB 4LJMA 1GTEA 3QMQA 3BKFA 2BE7D 3R5AA 1U09A 2WAQD 4OHVA 1X4CA 2HQFA 4DF4A 1HI8A 1H2TZ 4NLSA 2G9OA 1U02A 2QFJA 4YUDA 1VFJA 2RQCA 1Q7YT 3V81A 3RRHA 3M9NB 2DVIA 4PQUB 3FEZA 2W9CB 2M9KA 4USTA 1RWNB 1GX6A 5KFHA 5J2QB 5D0EA 4OX9F 1S9GB 3OJUA 2OEMA 4S0MA 4TY8B 4FXWA 4CNZA 3BZQA 5GVQA 4O3RA 2WVBA 4ZVHA 1U48A 2OH2A 5LMNF 2LQJA 6FDRA 1S0OA 4OV6A 3GFXA 2J9DA 4ILLA 1C1BB 3MMJA 4J9PA 7AT1B 1T11A 1UJ4A 2CJBA 3TA2A 3H8YA 4WFAQ 4P2MA 3R97A 3PKYA 3UI3A 4RW7B 4IH6A 1FD8A 2AEMA 3J7Z5 4J9QA 4P10A 4NMXA 2RQMA 1DQ9A 1SKUB 5K5MA 3SXLA 1KNZA 3ENQA 2HFOA 3T9NA 2P6SA 4MIBA 3JQJA 4D3HA 3HKZD 2OEKA 5J1EB 3CD7A 1RTDB 3JAMU 3MR6A 1KHVA 2KH9A 5HROA 3G86A 3AA8A 4DFJA 4ZVTB 4MFBA 1TQLA 3V6DA 4KR0B 3PVXA 5KFVA 1JB0C 4WZMA 2YX1A 3SYZA 3D1OA 1XQIA 4QQBA 3LUYA 2PE8A 4CM2A 1SPBP 1VBKA 1X4BA 3U1LA 5T7LA 5DM6Q 4K2XA 4ETXA 4OIXA 3H59A 2OTJS 1P6TA 4I2QB 4K8RA 2FJXA 2BMBA 1N52B 4K4TA 3PRDA 4CH0S 4L75A 3CJRA 3PG9A 1R8CA 1NKBA 3UPFA 2NCKL 3MAAB 2FC8A 1JNZB 4TVAB 3R27A 5L39A 2V2VA 3DN9A 1T05B 3LGHA 4CLLA 3PV8A 2B4PA 4DL2A 3AT1B 2Y1LB 3H20A 1WG5A 5E3AA 1QAIA 2PMZD 2DGSA 3BSNA 1WG1A 2ZBIA 3W5ZA 1FWPA 4DEZA 1NZ8A 5KFRA 3HKWA 4B9TA 2IY5B 4YB5A 3HVRA 1CULA 1YKWA 2FB0A 4RW9B 1HQEB 2K7JA 2V68A 1XTZA 3R3TA 5D4PA 1EZZB 2YNHB 2CQ1A 2FYXA 4OMFG 5E5NA 2YNFA 2YX7A 4U7CA 3NKYA 2ZC3A 3I31A 2IIHA 2HQGA 2MQOA 1UEVA 2C3PA 4FS1A 1B64A 4F4WA 3NXZA 3Q23A 3FFIA 1FA0A 5HATA 4FP9A 3HMJG 2E9TA 4GO5X 2WB4A 4WBFA 1F2HA 4AT1B 1WF1A 2BVZA 3OUYA 3FQLA 2UXDF 3QJPA 1B70B 3CVKA 5GMEA 3HD2A 1SJQA 1SH0A 2G13A 2AW0A 1N0VC 1DHMA 4Y2CA 2J5AA 4UY8T 4A48A 3MM5B 2IM0A 4NRTA 2Q79A 2YQ1A 1Q8LA 2DXEA 2QLWA 1OY8A 3IC1A 2ZFHA 2VL1A 2CPXA 4OHYA 1ELOA 4ETZA 3OR2B 1RABB 4NI2A 3W62A 1XJWB 4IO1A 1A6LA 1PYSB 4JI3J 2CQGA 1HPZA 5K20B 3DDNA 5HQMA 5DRKA 2XYPB 1H73A 2IRYA 2J8SA 3T1YJ 5DZ6A 4UT4A 1JJ4A 5I4MA 1S5ZA 2ZITA 4MK7A 4DCJB 2IM3A 1YJNS 1SKSA 2E5JA 4Q7AA 3DLEB 1KQSR 3BQ1A 4Q0BB 3BGRB 3MFIA 5F9NA 2XI2A 2QA4S 5F8NA 4E8UA 1U1NA 1QSSA 2UVRA 3FC9A 1XERA 4N47A 4F0MA 4V19J 2PEHA 2XSFA 3R2CJ 3KDNA 3S6EA 4JI1J 1RBAA 1UW4A 3PCOB 4IOAQ 2FHJA 1M90T 3WBZA 3OW2R 3BS9A 2AU0A 1PKUA 3MM9A 1QY7A 3IRXA 1RU2A 3J7AN 4DR7J 2ZH8A 4F4ZA 5K8MA 2V67A 2EBEA 3LA0A 1VRUA 1NDKA 4UOFA 4YFUA 1P9YA 5KFYA 3HM9A 1S99A 3VCDA 1B4SA 2L48A 1FK9B 1MWQA 5K9FA 4P52A 4E0DA 3BGLA 2M8DB 3LP1A 2HBRB 4YB7A 3W5XA 4ZS6A 4IQXA 2HHHF 1YZ6A 5J1PA 1R6YA 4M5DA 4ZJQA 1WD6A 1RKIA 4M95A 1M1HA 1EETA 2ZJQQ 2NSBA 2KT3A 2I0XA 1HHTP 3IG1A 4TQRA 2UU9J 1U0SA 2ATLA 2UXCF 1QE1B 1HBUB 3ZNJ1 1YHQS 2DRAA 1U0HB 1PYTA 4I6YA 4E98A 2GHPA 2P2CB 4XO0A 1VQ9S 2PFFB 2YNIB 2J0WA 3MGJA 1NK8A 2DXDA 1SC4B 2EFQA 3R7SB 3MEEB 5A76A 3LGNA 2CZ4A 4N77A 2Y1JA 2PFDA 3SDEA 5F8IA 3QFWA 1AUDA 1ZA1B 2MTLA 3SI8A 1S12A 4DLGA 2GW8A 3IR5B 3BYRA 4IO9Q 1IM4A 5HLFB 1KONA 3LW5C 3BKTA 4ZPDA 2XI3A 3GIRA 1TKXB 4KH0B 4UUWA 1I51B 4R8UA 5IC6B 3AB4B 2ZH3A 1R8HA 2K8GA 1GMUA 3TJAA 1CG2A 4JI4J 1M5KC 4N5SA 1S57A 2EBGA 2FZKB 4M5KA 3QBCA 4KFBB 4DL6A 3MR5A 5KFZA 2MZRA 5KFDA 3HDSA 2Q1LA 3H0PA 3IS9B 1FKPB 1U6BA 4KBIA 4LBHA 3UQSA 3NY0A 1JLEB 4FPRA 1FVQA 1J5OB 2JFKA 1HYSB 1X4FA 4NXMJ 4MK8A 2GZOA 4FPIA 1Z1ZA 2F1FA 1D9DA 3JTPA 4DN0A 1TAQA 1HNVA 5C42A 1IR2A 5HQ8A 3ZTOA 3GR0A 2BQUA 2BDPA 4DN9A 1R8AA 3QJLA 2CQ3A 1WI8A 4C8YA 4KGVB 1RGVA 3R1HA 3W2VA 5GADI 4X4RA 4QW8A 3PR5B 1OO0B 2RDIA 1RT4A 1JLBA 1GMWA 2C2DA 3D0IE 4ECZA 3PW4A 1HNZF 4JI3F 4HKQA 4OZ1A 2OTLS 2QLFB 4OI3A 2GQCA 4DG1A 4ED7A 4BHQA 2H5JB 2UUBJ 2D41A 1D3WA 2RS2A 2R2SA 2CA9A 3HVTA 2OPSB 3KK2A 1DTQA 2FJWA 3PW7A 1IKVB 1BE4A 4L72B 2XO7A 2JEJA 1NRKA 1EKSA 1RI7A 4I1TA 2POKA 2V5HG 4IUFA 3NGUA 2D3OR 2MZSA 1KR4A 2NREA 3GV8B 3H5XA 4EU0A 2CNOB 1JLAA 4O3SA 1S6PA 1LFPA 2NYHA 2I38A 3I87A 3MD1A 4FKYA 3QGIA 1O51A 3VGVA 4NLXA 4JUZA 2DNHA 2DHHA 5KFSA 3BSAA 3HHKA 3G71S 2BYCA 1NLKL 4LF9J 2MMYA 4MH8A 3VZIA 4ATNA 1FKAF 2CPEA 2CG4A 3M8RA 4DR7F 3LANA 2GVZB 5AXLA 3TA0A 4RBVA 4N7TA 1RT1A 4MMOA 3BBCA 5DZ7A 1Y10A 2HBQB 1JLFB 3NCPA 2DNQA 4LMZA 4ECSA 3MMAB 2Z30B 3W66A 2FVRA 3M05A 2HNYA 5GAEU 3EGVA 1VQLS 1GNKA 4JYAJ 2W4PA 3KMSA 2IM2A 1ZS6A 3QIPB 4P7VA 2H54B 4ED3A 3T6BA 1IJEB 4ZCKA 1T95A 1VQ8S 2MQQA 3CMES 4PXCA 2UU9F 1SB6A 2O1PA 3K5MA 1K47A 1BC6A 4MKAA 2CIMA 2ZDPA 5KFJA 3C66A 3UDLA 1OIAA 2Z2MA 3FGVA 1SV5A 3Q0AA 4OJHA 4LRFA 2XTJP 2EVZA 4A8KA 3EICA 4DR3F 4DSIA 3QQCD 3SQOP 1M5HA 2K3IA 1ZAXA 5BYQA 3D1HA 2H5IB 1DZ5A 1RT6A 3H25A 4M8LA 4IR9A 1TK8A 2CUYA 2HLUA 2G0CA 5ETLA 5JUMA 3FSIA 3JQKA 3IWNC 4KGKA 3AB2B 4I2PB 1UFKA 4IDKA 4ECYA 4O4RA 1OPZA 5EWGA 1HI0P 2CWKA 2UZAA 5LL6d 4QWAA 2DEIA 2IMWP 1VRQC 2WOMB 4UOHA 2FGOA 4ED8A 4PG6A 1S1WA 2PDAA 2W1BA 1PJ5A 1UAWA 2EFVA 2C2KB 2DO0A 1Q4RA 2FIUA 1C0TA 1U1KA 1RWVB 2X7IA 5B0BA 2J9EA 4J37A 1BD6A 4ECVA 2LYVA 2CQCA 1R43A 2VBXA 1RWKB 4JOUA 3TUZC 1S1VA 5BYSA 1ZM4A 4NXMF 2DBBA 3QJJA 3CDBA 5IM0B 3NCQA 1V5IB 4LFAJ 2MQ8A 1TMMA 3QIDA 2CQ2A 3GLJA 3HX9A 2LVWA 4QWBA 3W7BA 3BQ0A 1SUQB 1U2CA 1F9HA 2RMLA 3KWMA 1VGYA 2XMKA 3J80U 4PR6A 2UUTA 1VC0A 8ATCB 5D0HA 1IM6A 5HK4A 1AT1B 1QAJA 2CRLA 3K59A 2YXLA 1KWMA 2F8MA 3N4WA 2BKOA 3CC2S 2CNLB 3P3DA 1IJFB 3CD5A 3SCIE 1XNQJ 1IVZA 2BR0A 2HBZB 2UUBF 3QT8A 4LF5F 1F60B 2NXJA 2WSCC 2J9DE 2AV5A 5HP1B 3RU0A 2FJBB 2OJ3A 2HHQA 1Y5LB 3CJ8A 4DR4J 4ZJOA 4OI1A 1AZSA 4C3KA 2UV8G 4UQGA 4H4OA 4ZPCA 1UTAA 3KLIA 2JEGA 3BR8A 3OXFA 1KLMB 4EBDA 5ITHA 3OL7A 4KO0A 2IVMA 4Q43A 1PC5A 1WC1A 2PA8D 3DCAA 5I3UB 4ECTA 4JI7F 2BJ9A 5AJ3J 2JH3A 1HBOB 2DJWA 6FD1A 2EXUA 3M2VB 1LK7A 1XMQJ 3KNAA 3OTOJ 3ET6A 5IT9U 4CLWA 4DXLA 4DJBA 5F8JA 1FRXA 2CDRB 3PY8A 2XGQA 2OPQB 3CT9A 2BJ1A 4X4SA 4LF9F 3HP6A 2EFNA 3NS6A 4Q8FA 2Z2LA 1TL5A 2F40A 1NSAA 4Y00A 2EK6A 1N36J 4JB8B 1VQNS 2GMLA 1N6QB 1Q7LB 2PGCA 3GWCA 3ZZYA 5IZHA 1F1BB 2FY8A 3I9V9 3PW0A 3MMCB 1YX2A 2QGFB 3DLGA 2Y3YA 2HVIA 2K1RB 1FXDA 4EK2A 1ZPWX 3RR8A 4QIVA 2J6UA 2BE2B 5D3GB 4ZITA 2HVDA 3D6MB 3MM6B 5DDOC 1VC5A 2YH0A 1HNIB 3MEGA 1Q0NA 1C4AA 2FVCA 3LQVA 4RX6A 4X62J 2OPRA 2ZUAA 3B6BA 2CKWA 1FERA 4B9UA 3V6JA 1UJ5A 2CQIA 3EPGA 5I42B 3UNGC 2HNZA 4RNOA 2X1BA 2VPZB 3CCES 3QLHA 2DNRA 2OGUA 4DPXA 4MJKA 2DHSA 4OV1A 4NWBA 3UE2A 2FLLA 3A4TA 1CJTA 3M30B 2M8HA 5LSLA 4TQSA 4X66J 3M6XA 3PYFA 2RRAA 3PHTA 2D3UA 2Z4PA 4ZKAA 1IBCB 2XZWA 3W2WA 3M2UB 5MAOA 1WTFA 4RUAA 2GIQA 1NK0A 3VAGA 2BZ2A 4K5SA 1KSPA 3I4HX 5LMUJ 1EB0A 1HFEL 2MQLA 1PBAA 3PX0A 4ID5A 3FZ2A 2HKEA 3J7ZT 1P27B 1E6VA 3L09A 3J7YU 1KTVA 4QIGA 3BO3A 3DKDA 2XS7A 2JLEA 1I1GA 1TKTA 3BDPA 3RBDA 5EWFA 1IKYA 1S6QA 2KU7A 1B0PA 3A8IA 4UOCA 5M2RA 1Q8BA 3D5MA 1N5QA 3FVYA 3PFOA 2VZ9A 4LF1A 5CYQA 1HD1A 1SL1A 1TL3A 3CO0P 2BE9B 3HFKA 5D8HB 4A4JA 3ILIA 4DQQA 4X4PA 2ZE2A 2CJ9A 1SL0A 3C6UA 1S48A 4RW8B 3AOBA 3J81U 4FYXB 1FEEA 5AXMA 2EFPA 3RTVA 1NJXA 1RT3A 3GIIA 2VA2A 2V8GA 1ZZNA 3OR1B 5L9XA 3CTRA 3GP9A 3SSRA 4EBEA 2RSQA 1PSDA 2DHXA 4Y2KA 1W26A 1HARA 4CZCA 1M5SA 3CDEA 2NUUG 4CI0B 2R7VA 2YQ0A 1YZ7A 3GG1A 4J9LA 2HHUA 2IBKA 4USMA 3ZZOA 1NCLA 1S1XB 3T1HJ 1WEYA 3C6TB 3MM7B 5K14A 1NKCA 2ASLA 4AXIA 2E1PA 1FJGF 1GK8A 2AJ4A 1WI6A 2RRBA 1WHYA 4RW4B 1VI7A 3TAQA 1LXNA 2P9CA 4CO2A 1XNQF 4NZ0A 5G4DA 4GVBA 4X4TA 3D9BA 4LVOP 3OTCA 1S77D 3I5CA 4LRDA 4M5JA 2PSZA 3I0RB 2RIJA 3QWUA 2QA1A 3ULHA 4P7TA 2W2OP 2VDHA 3BV8A 4PWDB 3NL0A 2WVFA 4LRAA 2MYFA 4I69A 3C16A 3HHLD 4ERDA 1KVKA 1U1LA 2MJNA 4C2MA 3E01B 5A8KA 4OYMA 4EZ6A 3DRYA 4YS2A 2Y1IA 2VF3A 1VK3A 4ZIVA 1DAXA 4C11B 2BM1A 1ZAWA 3OTOF 3QSIA 4TLQA 4KY3A 1Y5NB 1KBRA 2F4VJ 3MPDA 1LEOA 1QUVA 1MW7A 1IBKJ 2KHCA 2V50A 2V8HA 4KGZB 3CJ0A 3PO5A 2HHWA 1UW9A 5KG7A 3B78A 6AT1B 2VG6B 5DG8A 3OJSA 4LSNA 3NGSA 3M32A 2D9OA 2OLWA 1URNA 2GIFA 3T19A 4YB1P 4PG4A 2GJIA 4G6VB 3HJFA 4NXNF 3EX7B 2WVDA 4KB7A 4YB6A 1P1LA 4OYBA 3D68A 1TP7A 4X62F 1TKDA 3ZTSA 3H2LA 2GFFA 1VQMS 2V63A 1HD0A 5FJ4A 3BSCA 3HHEA 2XG8A 3JSMB 4W92B 5A2QY 3RB6A 3RJMB 3CJKA 2WCXA 4X4OA 3RR7A 5F41A 2R4FA 1QAYA 2DPJA 3KHHA 2NPIA 2MQNA 2AP6A 2OKQA 2BKPA 2VBYA 3DOKB 4RW6A 3CJQA 4J5OA 4X66F 2GGPA 2B8PA 1PBUA 4WF9Q 3HT0A 1HW8A 4MIAA 2VV5A 2V4JA 2KT5A 4ILRA 1T02A 3BN4A 3FBFA 5C25A 1IKXA 4Y65A 1S59A 5LMUF 2ZWPA 4NLOA 3D67A 1WNEA 4DV6J 1SC6A 4K7QA 3S8SA 1K0VA 4ZCLA 2FGCA 1LWCA 3MHYA 5ETKA 5DQHA 5KOXA 5LXYA 2RJZA 4CH1A 3BPSP 2JX2A 2QSWA 4HL9A 2BEFA 2W8KA 3IM8A 3NBPA 3LWLA 2C3YA 1HQUB 3QO9B 3OPKA 4DZDA 4DL3A 2CVEA 3L95X 3LP0B 4YY3F 2BUNA 2OI2A 2VKRA 3KHLA 2VFUA 1L5UA 4Q2LA 1JX4A 4C3LA 1CS4A 4M5HA 5U47A 4NCBA 4WFNQ 3UD3P 3CCLS 1UWAA 2HQCA 3WIUA 4WZQA 1SC3B 2C2EA 1N34J 2OFGX 2ASJA 4M5LA 3W64A 1RT5A 4CO1A 2UXBJ 2J6TA 2FLPA 2ZZTA 2YBVA 2HFVA 4U7UK 3KFWX 5JMNA 4XDDA 4AL6A 5IT4A 1U25A 5E7OB 2SXLA 4HLBA 3T1HF 2YWFA 2OP5A 4UZCA 1UVNA 2EG1A 1X4HA 2QMWA 5L1LA 2AF6A 3WZ0A 1VQKS 1FRIA 4M5NA 4USIA 3JSBA 1SXLA 1RUSA 3IMQJ 7FD1A 1IR0A 1U1OA 3BQ2A 1S9EB 2RUGA 4A8XA 2LDIA 4F4YA 3VZHA 3DM2B 3MF5A 1QSLA 4ZP9A 1TL1B 3OVSA 1TK0A 3ZTPA 1LW0B 4F67A 2XLIA 1DARA 3G2XA 1NH8A 2DH7A 5L1IA 2ZJPQ 4M5GA 2KG1A 3IAM9 4MYTA 3Q22A 2UUAF 3FK4A 3T6JA 1XNRF 1KC8T 4ED1A 1IBLJ 3QWPA 5C24B 3M8PB 3HSDA 4D3GA 4DCOB 2F4VF 1SJ3P 1T9VA 3D0HE 1T03A 2Q66A 5ETOA 5FDLB 3S7RA 4ZVOB 3FMWA 3NNAA 3JYTA 3CCVS 3UR3C 1LWXA 5KT7A 1C0UB 4UUXA 1FFSB 1VQ5S 4LUBA 3R5JB 4DUZF 3H2UB 1T9YA 1QVFR 3DLKA 2FDNA 4ZPWR 5E3QA 2JJ4D 1D0EA 3M8QB 4ALZA 4LF2A 1E6YA 1S1TB 2LA6A 1H74A 4AXJA 1S97A 4ID8A 3PXGa 1X5OA 5B7WA 5KFIA 2NXEA 2KXFA 3LAMA 4EMDA 1VBZA 2RVJA 3L7OA 5LSRA 3NCRA 2DHAA 2HNDB 1NBEB 3Q86A 1FKOB 2YY3A 3OQ2A 3QATA 4I6WA 2CPYA 4CYUB 4PQUA 1IWGA 1HMVB 2Y8YA 2A0FB 3ZZUA 1X8DA 5J2QA 4CLZA 1S9GA 1BGXT 3BPDA 2QEXS 2MZQA 2OUGA 4TY8A 2ZHAA 4DSLA 1FX4A 1DTTB 3NLCA 3M6UA 5KFWA 1RT2B 2RDDA 3ZZZA 3NMAA 4K4ZA 2ZH6A 2CJAA 1C1BA 3CDAA 4DV6F 5KG2A 3FUYA 4MKYA 2B56A 5L8RC 4DL4A 2VG7B 1ICEB 4RW7A 5GAEI 2ROPA 5CYMB 2VFRA 1RYRA 1H3DA 2BJEA 3C3LA 5AE1A 1YRUA 2ROEA 1YWXA 1ZM3A 5HMWA 4DPYA 4DV5J 1NMEB 3RW6A 4ANEA 3T5HA 3NWRA 4ZPTR 4BCAA 2WW4A 5J1EA 5E2QA 1RTDA 2BQ3A 1XK8A 4DPOA 3D4JA 1VLYA 5HO4A 2V34A 2YWEA 4EO6A 4K4UA 1FI4A 3CWJA 3LO3A 1REVB 4IOBA 1DRZA 4LVNP 1FESA 4H4MB 4PKDB 4OFZA 3D3BJ 1PJ7A 2VFTA 2LXUA 3ONQA 3POTB 2R2RA 2IJNA 5H9FJ 3IWLA 2BJDA 1N34F 2N7CA 1JXVA 3T3FA 2EW9A 1WOSA 2H51B 1X9MA 3BBBA 4I2QA 5G0RB 4O3PA 5E41A 2RNEA 1ZA2B 2UXBF 2DISA 1R0AB 1HWLA 1P9QC 2LQBA 5LOQA 3DGVA 4OQJA 3MAAA 3E51A 3DLBA 4QR0A 2KXHA 1CJVB 1RTJB 4RKUC 2VQFF 5J2MA 3WIVA 4W98A 2LMIA 4JV5F 1D1UA 5FD1A 2CNKB 1TMJA 1T05A 3PFEA 2JSXA 3ENWA 2G2OA 2ZH2A 4Q8EA 1L3SA 1HQ2A 2L08A 3EDRB 4C8ZA 4ANCA 5B0DA 1HWIA 3UVJB 2VQEF 1O0PA 3KK3B 2MZ1A 5IV4A 3DI6B 1PAUB 4FF1A 3QSYB 3TVZA 4OZJA 2R8JA 1KTQA 2CADA 3CJ2A 4RW9A 3RW7A 3NWGA 1HQEA 1XMBA 4FXVA 3IGVA 3A8EA 2D3O1 1S7HA 2GJ2A 4DL5A 2YNHA 1RE1B 5K8NA 4FNIA 3DYAB 2AZ3A 1TR0A 3D0GE 3SV3A 2QN6B 1DBDA 1ZTWA 3PYEA 3B54A 3TUPA 2HEKA 3MECB 1EQMA 2OFHX 3HFZB 5ETNA 1ZPVA 1YLXA 2PA3A 4JI6J 2DNZA 2AGPA 1TUWA 2ZJRQ 3G4SS 2MLXA 4QU6A 1RTZA 1UWBB 1VC6A 1SKWA 2JC1A 2AIRB 3SCKE 3VV2B 3VR1A 3LPYA 4CNYA 2HAFA 2FHJD 4YR0A 2WRMA 3VAMA 4CO5A 1NM2A 3LH2S 3Q83A 2MKHA 1S6OA 2C28A 3MM5A 1G4CA 3ITHB 3PNIA 1K1SA 2XO6A 2HZVA 1U4BA 4PAAA 1QSYA 3CO9A 2H4YB 2XM3A 1LKZA 2L3MA 3DRRB 5B0CA 4Y0FA 4KV8B 3OR2A 3ISZA 2BM0A 4HTJA 1TAUA 2BABA 4X4QA 2QL5B 5EWEA 3VVUA 3TI0A 2K7KA 3PTWA 1FF2A 4LF4F 2VD3A 4OI4A 1QJHA 4USUA 3DRXA 3MXHP 5CHCB 4NLDA 2YKNA 1T8EA 2CJQA 2QLJB 4HH0A 2N4DA 3EGNA 2KRBA 2KO1A 3PEJA 4A8FA 4GMKA 3CXCR 3DLEA 3KDOA 3TJ9A 1RU1A 4Q0BA 1IR1A 3P4UB 1RADB 5DDPC 2FC9A 3EPIA 3BGRA 1U47A 5AXNA 3FKBA 1VHIA 2DH9A 4NMLA 3VQSA 2NSCA 4F3OA 3OSPA 1U8SA 2JLGA 1OSCA 2CQ0A 4GKKJ 2ALYB 1RAHB 2IHR1 3LGMA 1H72C 5L1KA 1HWKA 2IJRA 1NJZA 4FVMA 2W9BB 2KTQA 4WXOA 2JOQA 2FLNA 1K73T 3FEYB 4OJGA 1U1PA 1FK9A 1XWLA 3P6YC 3EWGA 1R89A 1MN7A 3G96A 1JMTA 2M3DA 4Z2XA 4NRUA 1VK8A 2EEYA 2J8AA 4PPDA 3K2YA 3L7UA 4F8RA 1J5EF 2E7VA 2XMTA 1K9MT 4X4VA 2A6OA 4C0HA 2N82B 2RS8A 5KT5A 1RWUA 3FMBA 4M5MA 1RHQB 2AEJA 2CPZA 4JI5J 2JEFA 1K8AT 3IM9A 2O67A 4ED5A 1QE1A 3CCUS 1HBUA 4DUYJ 2J9CA 1U0HA 3DRPB 1ZH5A 4RNNA 2E1MC 4A8SA 2W2PP 1VS3A 2ZWOA 1RYSA
chains in the Genus database with same CATH topology
3EVOA 3G2XA 4DZ6A 5CAAA 1HLWA 2BX6A 1PAEX 3Q8UA 3PRVA 3ZTRA 3Q83A 3Q8YA 5BXIA 5IOLA 1NPKA 1NUEA 3NGSA 1EHWA 4DI6A 4C6AA 3FC9A 3EMTA 1HIYA 1NDPA 1NDCA 1BHNA 1U8WA 4O0NA 3FBEA 1NSPA 2BEFA 4ENOA 2HURA 1MN9A 4UOGA 2CWKA 1BE4A 3VGTA 1VYAA 2DXDA 3VVUA 4UOHA 5C7PA 3ZTSA 3JS9A 1PKUA 4FKXA 3Q8VA 1XIQA 2DXEA 3ENAA 3EVMA 2B8QA 3FCWA 4KPCA 1WKKA 2DY9A 1B99A 1F3FA 4S0MA 1UCNA 3NGUA 2AZ3A 1JXVA 1ZS6A 3FBCA 3PJ9A 3BBBA 3BBFA 1MN7A 3GP9A 1NSKL 1XQIA 1LWXA 3VGUA 1NDKA 3VVTA 4UOFA 5CABA 2DYAA 1NB2A 3ZTOA 3B54A 4F4AA 1K44A 4HR2A 2HVEA 3L7UA 4DUTA 1B4SA 3BH7B 1NHKL 4F36A 3NGTA 3WX8A 4FKYA 4EK2A 1NSQA 4W98A 3Q89A 3EM1A 4CP5A 2AZ1A 3VGVA 3DKDA 2HVDA 1F6TA 3EE3A 3EICA 2VU5A 1NCLA 3ELHA 3ETMA 3FCVA 3GPAA 1S5ZA 1NLKL 2B8PA 3MPDA 4ANDA 1LEOA 3FKBA 1WKJA 3ZTPA 1KDNA 2NCKL 3EVWA 1NDLA 3FBBA 2ZUAA 1W7WA 3VGSA 3B6BA 3NGRA 3DDIA 3R9LA 1WKLA 3EJMA 3FBFA 4ANCA 3BH6B 3ZTQA 4ANEA 3Q86A 1BUXA 4WBFA 1S57A 3BBCA 1HHQA 2DXFA 1S59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EVO A;  3G2X A;  4DZ6 A;  5CAA A;  1HLW A;  2BX6 A;  1PAE X;  3Q8U A;  3PRV A;  3ZTR A;  3Q83 A;  3Q8Y A;  5BXI A;  5IOL A;  1NPK A;  1NUE A;  3NGS A;  1EHW A;  4DI6 A;  4C6A A;  3FC9 A;  3EMT A;  1HIY A;  1NDP A;  1NDC A;  1BHN A;  1U8W A;  4O0N A;  3FBE A;  1NSP A;  2BEF A;  4ENO A;  2HUR A;  1MN9 A;  4UOG A;  2CWK A;  1BE4 A;  3VGT A;  1VYA A;  2DXD A;  3VVU A;  4UOH A;  5C7P A;  3ZTS A;  3JS9 A;  1PKU A;  4FKX A;  3Q8V A;  1XIQ A;  2DXE A;  3ENA A;  3EVM A;  2B8Q A;  3FCW A;  4KPC A;  1WKK A;  2DY9 A;  1B99 A;  1F3F A;  4S0M A;  1UCN A;  3NGU A;  2AZ3 A;  1JXV A;  1ZS6 A;  3FBC A;  3PJ9 A;  3BBB A;  3BBF A;  1MN7 A;  3GP9 A;  1NSK L;  1XQI A;  1LWX A;  3VGU A;  1NDK A;  3VVT A;  4UOF A;  5CAB A;  2DYA A;  1NB2 A;  3ZTO A;  3B54 A;  4F4A A;  1K44 A;  4HR2 A;  2HVE A;  3L7U A;  4DUT A;  1B4S A;  3BH7 B;  1NHK L;  4F36 A;  3NGT A;  3WX8 A;  4FKY A;  4EK2 A;  1NSQ A;  4W98 A;  3Q89 A;  3EM1 A;  4CP5 A;  2AZ1 A;  3VGV A;  3DKD A;  2HVD A;  1F6T A;  3EE3 A;  3EIC A;  2VU5 A;  1NCL A;  3ELH A;  3ETM A;  3FCV A;  3GPA A;  1S5Z A;  1NLK L;  2B8P A;  3MPD A;  4AND A;  1LEO A;  3FKB A;  1WKJ A;  3ZTP A;  1KDN A;  2NCK L;  3EVW A;  1NDL A;  3FBB A;  2ZUA A;  1W7W A;  3VGS A;  3B6B A;  3NGR A;  3DDI A;  3R9L A;  1WKL A;  3EJM A;  3FBF A;  4ANC A;  3BH6 B;  3ZTQ A;  4ANE A;  3Q86 A;  1BUX A;  4WBF A;  1S57 A;  3BBC A;  1HHQ A;  2DXF A;  1S59 A; 
#chains in the Genus database with same CATH topology
 1KLN A;  1X9S A;  2VHG A;  1FVS A;  2YNI A;  3CPW R;  4ZCI A;  1L3V A;  5ETT A;  3TP2 A;  2GVD B;  1UVK A;  3MEE A;  1G7C B;  5CCL A;  3N5B A;  1FDD A;  2IMO A;  3J7Y I;  2CQ4 A;  2XCP A;  1KKH A;  1UKU A;  1GQE A;  2W25 A;  3DOM B;  1RK8 A;  1BQX A;  5KFP A;  1HR0 J;  2HVZ A;  3HJV A;  5KFC A;  1HBM B;  2AX1 A;  4HHJ A;  4RPF A;  5IFM A;  3P96 A;  5AXK A;  1DUR A;  3NAH A;  4OYX A;  2HGL A;  3CC7 S;  3NNH A;  3M8Y A;  5HLF A;  4AUK A;  3VGU A;  3A3N B;  2XEX A;  1MU2 B;  2B7B B;  5H1S V;  3EXC X;  4R0E A;  4RLE A;  2HLT A;  4NEZ A;  2AJ1 A;  4IOC Q;  2R8I A;  2XWY A;  2B9X A;  4KFB A;  1ACM B;  3KLE B;  1SKR A;  1YGY A;  3MPU B;  2PMH A;  3AH6 A;  4DU7 A;  2GA7 A;  3IS9 A;  1TK5 A;  3DDI A;  1FKP A;  1N32 F;  2KJW A;  5EN1 A;  1D09 B;  4DR2 F;  4GVL A;  1JLE A;  5M2P A;  1J5O A;  2Z2Z A;  2MHN A;  3F0N A;  1EAY C;  2QL7 B;  2HZC A;  4Y28 C;  1HYS A;  4R5P B;  3C15 B;  2H1Y A;  2UUW A;  4YEA A;  2UUC J;  1VYA A;  1WEX A;  4AD6 A;  2CAJ A;  2V4R A;  2HYI B;  2ZBP A;  3PEH A;  2XZT B;  1IQZ A;  3QFH A;  1G1X A;  2QL9 B;  3HCX A;  2H9Z A;  5BYR A;  2MLY A;  2LEB A;  3H40 A;  4FNH A;  2YQ3 A;  5HAN A;  2WVC A;  2NZ4 A;  3UO0 A;  1TL7 B;  1H6K X;  4DFM A;  1OMS A;  1KOO A;  3G8S A;  3GIL A;  1OSD A;  2YNG B;  4NYP A;  4ZVG A;  3CNQ P;  3KJQ B;  1FE4 A;  3TZZ A;  1TKZ B;  2XCA A;  1NDL A;  2BJ7 A;  2LP4 A;  3K8V A;  1RAO A;  4NLT A;  4C8N A;  2J0X A;  5KT2 A;  2OPS A;  3DU6 A;  4WCE Q;  1IKV A;  2EC2 A;  2VC1 A;  3OTB A;  4DDF A;  2F4F A;  4NL5 A;  3CSK A;  4K4S A;  1FTC A;  3CD0 A;  4HI2 A;  5EHH A;  2J0Q D;  1VJQ A;  2Q6B A;  3W9H A;  4LF8 J;  2WSF C;  1WOP A;  1U7L A;  2E5I A;  3CJS A;  1AYE A;  2W24 A;  4AYB D;  4GKK F;  2QZ8 A;  5KG1 A;  2ZOM A;  3DRS B;  9RUB A;  4WU2 A;  2E7W A;  2CPI A;  1M5V C;  3FRY A;  1ITP A;  2GVZ A;  5T14 A;  4RUB A;  5L38 A;  2W7O A;  5A6P A;  1RHM B;  4ES3 A;  3QYY A;  1Y9O A;  1JLF A;  1B0T A;  2GNK A;  2O66 A;  2BRK A;  3KLH B;  3MMA A;  1LXJ A;  2OMO A;  4BLG A;  2A10 A;  4ZK7 M;  4DPU A;  3QZ7 A;  4DV0 J;  5EUH A;  2KFZ A;  5KFE A;  2F5G A;  4KT0 C;  1EJ7 L;  2AWZ A;  3OFF A;  5BXI A;  1B7F A;  1JIH A;  3OFH A;  4J9V A;  1QTM A;  1RBL A;  2BJ8 A;  1JXE A;  3QIP A;  3TX0 A;  2ZH9 A;  4JI5 F;  2DR8 A;  4PXB A;  3KJN B;  3UDC A;  3NNC A;  4ZLP A;  4DUY F;  2QSF A;  1XN9 A;  2B8Q A;  3IBC B;  1R0C B;  3UCZ P;  3GE9 A;  1TVR B;  2PMW A;  2FJE B;  4ZVF A;  2Y9H A;  3WX4 A;  4HDH A;  1VRT B;  1QLN A;  5D0R A;  4L76 A;  2HG4 A;  3N79 A;  4FS2 A;  3NS5 A;  4Z7Y A;  2K06 A;  1RCX B;  4C9D A;  4G3I A;  4EWT A;  3FSX A;  3GSI A;  4LFC J;  4X65 F;  4I2P A;  2VB6 A;  4JI8 J;  5CXT A;  1RHJ B;  3M7V A;  2RDJ A;  4R0J A;  4CT9 A;  4QWE A;  4B3R F;  4DHV A;  3D6F B;  1WG4 A;  2XMA A;  3US5 A;  2WOM A;  1HW9 A;  3ZNU A;  2G2Z A;  2E5L J;  1PCA A;  3M6V A;  2KDO A;  2XBP A;  4P72 A;  2BAN B;  5J2P B;  4P2F A;  3HLU A;  1RKJ A;  3UD5 A;  1LWE A;  4FYV B;  4PWU A;  2CQB A;  4GC6 A;  2LCW A;  4F4X A;  4FBU A;  4A8Y A;  1WHW A;  2IJF A;  1I6J A;  3TQE A;  3ZZR A;  1WDT A;  5H9E J;  4NX9 A;  5E0O A;  1RP5 A;  1FWL A;  1SBR A;  1UZH A;  3VAJ A;  2CXE A;  5D0G A;  3GIK A;  4KPY A;  3FDS A;  2RQK A;  3EDQ B;  3Q8Q B;  5DO2 A;  4WTO B;  3CED A;  5IM0 A;  2DCU B;  1FRH A;  3EM1 A;  3KUE A;  3GIJ A;  1Q79 A;  2R2U A;  4OX8 A;  2CZV C;  4DV1 J;  1N33 J;  2JC0 A;  2XMU A;  1SUQ A;  4KHP F;  3DOL B;  3BEG B;  3FBB A;  4ZHR B;  4NOH A;  4PXD A;  2A1B A;  1N48 A;  3OD2 A;  2VH7 A;  3K7R A;  2ZBC A;  4YME A;  4B3O B;  1W2I A;  3CMA S;  2KM8 B;  2XS2 A;  2F7V A;  2D9P A;  5B0E A;  4DR1 J;  1NSP A;  3H5U A;  3IFE A;  5CCM A;  4NLP A;  2EG2 A;  3TQ1 A;  5JVH Q;  3QRQ A;  5K8O A;  1MWZ A;  3OVA A;  1RSC A;  3PIO Q;  1P8G A;  5HP1 A;  3OTE A;  1FEH A;  1KS2 A;  3LOU A;  4NYZ A;  1IBM J;  1LW2 B;  1OPI A;  1KLM A;  3TZW A;  1MWY A;  3MCN A;  2IC3 B;  2M88 A;  3GV5 B;  1X0F A;  3ET6 B;  3B82 A;  1Y3J A;  1XR7 A;  5I3U A;  1F0X A;  3TYT A;  4C98 A;  4M63 A;  3CIZ A;  3EE3 A;  1FRK A;  4KE5 A;  1HBO A;  2C3M A;  5EX3 A;  4MKV A;  3M2V A;  2I8E A;  1NJW A;  1HWU A;  1Y7P A;  1HHQ A;  2DNP A;  4HT5 A;  2OPQ A;  1M0S A;  1BWE A;  4A8O A;  3BJY A;  2ZM6 J;  2VIH A;  2VIC A;  3UN2 A;  4P9S A;  2AT1 B;  4Q2M A;  3PW2 A;  2Q3P A;  4YN3 B;  2QC3 A;  2VJU A;  1U24 A;  2DT9 A;  1UVM A;  4CT8 A;  4QR2 A;  4X84 A;  1WDD A;  3WQP A;  2WB1 D;  3MM8 A;  2M7S A;  2P9G A;  3OFG A;  2OPR B;  1IN0 A;  2XGP A;  3Q8V A;  2K1R A;  3AQO A;  5FLX Y;  2VPW B;  3QZ8 A;  4DV0 F;  2F9D A;  4USW A;  4IG3 B;  3PJ9 A;  2RKI B;  5KFU A;  4FN5 A;  1GT8 A;  5D3G A;  1KP6 A;  3UCU P;  1ZZF A;  3MM6 A;  1VQO S;  1HNI A;  2AYM A;  3A3O B;  2XQC A;  4DV4 J;  1SI9 A;  4ZPB A;  4G1I A;  3W5Y A;  1FDB A;  4PXE A;  3H98 A;  1WOR A;  4ZVS B;  2V8V A;  4M1K A;  2XUL A;  2ZKU A;  3NP5 A;  4C7Q A;  2PI5 A;  1GH8 A;  5I42 A;  1VQY A;  3D2W A;  5HI7 A;  2HRY A;  1Q86 T;  3GU0 A;  4GC7 A;  5KG4 A;  4Y2A A;  2FHK A;  5L46 A;  2CZ9 A;  1X7V A;  5KFK A;  3W8G A;  2P6T A;  2RD5 C;  3CW2 C;  2FZG B;  3DFE A;  3M30 A;  5IXU A;  1FFG B;  1YJR A;  2WTF A;  3BGO P;  4DQR A;  2RHQ B;  3W9J A;  2N7Y A;  1NJI T;  2F3J A;  2DGV A;  2QYG A;  3M2U A;  2WSE C;  1S76 D;  1WJ9 A;  2BKN A;  2NPF A;  2OHD A;  4ZJL A;  4IRK A;  1ZBT A;  3FJ2 A;  2EWH A;  4CO0 A;  2Y0S D;  2VUG A;  1S6Q B;  2R3V A;  4V1A k;  3ILJ A;  2CVI A;  4YDX A;  4P74 A;  3VHQ A;  1R31 A;  4DSE A;  3GSD A;  2EFG A;  1YQH A;  3GQC A;  1YJ7 A;  2AJ0 A;  1C1C B;  2QO3 A;  4PUO B;  4QPT A;  5CYQ B;  4ELV A;  4F4A A;  1WC6 A;  2U1A A;  5DET A;  1FTR A;  1S49 A;  1RTI B;  3KLF B;  1Y00 A;  5DS7 A;  1IWA A;  4ZLJ A;  1RHU B;  1OYD A;  3H42 A;  3BN7 A;  4C0B A;  2GC8 A;  4A47 A;  2GJF A;  3ZZP A;  1FJC A;  2B3T B;  3BH6 B;  4RU9 A;  4ZIW A;  3BDE A;  5KFL A;  1JJC B;  4O4G B;  4RW8 A;  4QBU A;  4ILM A;  3ZZT A;  1YIT S;  4KHM A;  3HT3 A;  2B5J B;  2E1R A;  3KMQ A;  2HFZ A;  3HUL A;  2BA9 A;  4RWX A;  3AOD A;  3OR1 A;  4DV1 F;  3MDF A;  4K4X A;  4DL7 A;  4X4N A;  1DLO B;  5M2U A;  1YJT A;  1N88 A;  3G6X A;  1GEH A;  3EVM A;  4F3Q A;  4DWI A;  2RRN A;  4G1Q B;  4M5I A;  1CJK B;  2HFS A;  1OWX A;  2RHS B;  2Z0G A;  3A13 A;  4ECX A;  1X4D A;  1V3Z A;  2MY8 A;  1S1X A;  3C6T A;  3MM7 A;  4YHH J;  3H90 A;  4NCG B;  3TJ8 A;  2VG5 B;  2LXI A;  1NK4 A;  4RW4 A;  2JFD A;  4IH7 A;  3AXM A;  2RE1 A;  3F73 A;  5HSP A;  5IC4 B;  3AJD A;  2DNN A;  3RAM A;  4EYH B;  2R2T A;  4K59 A;  3UNY A;  4WFZ A;  3I0R A;  2G4B A;  1IBM F;  2LKZ A;  3MPY A;  4LSL A;  3CJ4 A;  8RUC A;  3TVK A;  3G87 A;  3HZE A;  1Q1K A;  1RAI B;  4NPO A;  1G6B A;  4PWD A;  5A0Y B;  2AJQ A;  2ZUG A;  2HS3 A;  4K2J A;  1V3R A;  4ECW A;  2M4M A;  1U8W A;  5JJB A;  3NS7 B;  4ITS A;  4BDP A;  1PO6 A;  4RUH A;  4QYZ J;  2R7W A;  3E01 A;  3TZY A;  4C11 A;  4KC5 A;  1VCT A;  3KG4 A;  3CJ3 A;  4U95 A;  1H2U X;  2E66 A;  1J27 A;  3BGU A;  2DTJ A;  3OHB A;  1JJH A;  2ZM6 F;  3E2E A;  5AE3 A;  3M2R B;  2QYC A;  2R7U A;  4UQT A;  4OLP A;  2AJF E;  1Q81 T;  2NLW A;  2GQQ A;  4QZV B;  4WYL A;  5SUH A;  2A18 A;  4FBT A;  2HS0 A;  2VG6 A;  5KFG A;  3G6V A;  2AD9 A;  1UET A;  2CPF A;  1KDN A;  4ZP6 A;  3R8Y A;  3T1Y F;  4NLV A;  4WXW A;  3Q2S C;  2YKM B;  1Y0H A;  3P45 B;  3Q8S B;  1LFW A;  1OQ6 A;  3Q2T C;  2WON B;  3Q8Y A;  1KQK A;  4KRW A;  1NAQ A;  2N4C A;  3GIM A;  2Y0B B;  5D78 A;  2QFI A;  2B9E A;  4KYZ A;  1YJV A;  4ZDN A;  1N5Y B;  3JSM A;  2DNG A;  4LF7 J;  1WAC A;  4ZP8 A;  3CF5 Q;  3K89 A;  3TEH B;  5LMN J;  1AXQ A;  3JQM A;  5J2N B;  1UPP A;  4E2F B;  3DOK A;  4JI1 F;  3NOG A;  3OL9 A;  5E3P A;  2KYX A;  4I7F B;  2DYA A;  3E8O A;  4P2X A;  1TFW A;  1WTB A;  2CDQ A;  4OYP A;  2PO4 A;  3W8P A;  1NHK L;  1NH7 A;  4C8L A;  1T9U A;  2L41 A;  1VBX A;  2C3U A;  1IUJ A;  5GAG U;  1C4C A;  2AEF A;  3MCS A;  2BW2 A;  3PJW A;  2CPD A;  1ZOT A;  2OML A;  5DJB A;  2YTC A;  1YBU A;  3DGP B;  1K1Q A;  3LPE A;  2QLX A;  4OI2 A;  3GR1 A;  1TFY A;  3A8J A;  1RAA B;  4ES1 A;  4DSK A;  1FRJ A;  2FVS A;  2VC0 A;  2QMX A;  3TAM B;  1V6H A;  2VFV A;  2YKA A;  4QW9 A;  1KQF B;  1HQU A;  3QO9 A;  3KG1 A;  4WK1 A;  4QCL A;  5CZV A;  5HL7 Q;  2LFV A;  1CVJ A;  3LP0 A;  1LOU A;  2Z8Q A;  3DLJ A;  2I5J B;  2B4O A;  3H5Y A;  2IM1 A;  4NZ7 A;  2A6M A;  5H9E K;  3KOA A;  3M9O B;  4LRE A;  3OFE A;  1RT5 B;  2R7R A;  1NHV A;  1FCA A;  5DLF A;  3IO1 A;  3QGG A;  1RDR A;  3BO4 A;  3OVB A;  1TV6 B;  3ETM A;  4AND A;  2MZJ A;  4QWD A;  2MKC A;  4F7V A;  1FT8 A;  1R7I A;  1Y3K A;  4WTY A;  2P9E A;  4B9M A;  1WC5 A;  3I56 S;  3QRR A;  2YPY A;  3F41 A;  1T3O A;  4B3T J;  1YRT A;  2ZC4 A;  3BYP A;  3OV7 A;  3CGI A;  1RB0 A;  4YHH F;  2AGQ A;  4F2S A;  3LTO A;  1NPK A;  1RTH B;  2C2R A;  4JI4 F;  5DGA A;  5B08 A;  1UZD A;  4EBC A;  2E5H A;  4TNO A;  4IFV B;  1WSR A;  2RF2 B;  2FJV A;  2DY1 A;  4B9V A;  1WC3 A;  1S9E A;  1YSJ A;  1WWH A;  1I94 J;  2LLZ A;  4C3M A;  1VLO A;  1CQM A;  1B99 A;  1F3F A;  3DM2 A;  1MG7 A;  5ETR A;  1TL1 A;  1SJF A;  4L6V 3;  3RRK A;  1WHX A;  1CJU B;  5D77 A;  3R1L A;  4U9R A;  5HJX A;  1U26 A;  4PAB A;  4ED4 A;  2NXU A;  1YJU A;  3L3C A;  2I1R A;  4I0W A;  3AJ2 A;  1VR6 A;  4FYW B;  2FD2 A;  1JNR B;  5B09 A;  1CC8 A;  2ZH5 A;  4DS5 A;  4OX6 A;  1KHW A;  3ILL A;  3CCJ S;  2MKY A;  3UD4 P;  2ZH7 A;  1BQN B;  4IH5 A;  5C24 A;  3M8P A;  2DXF A;  2XSJ B;  1YJ9 S;  2BX6 A;  5LJ5 Y;  5LJ3 Y;  3DHW C;  2VJV A;  1NZA A;  1RCO B;  2CJY B;  4URQ U;  3A3P B;  1LWF B;  5FDL A;  1JLG B;  4JBC A;  3MED B;  2DNM A;  3GCX P;  2AHO B;  4JP8 A;  4KIA A;  1E6Y B;  4UW2 A;  1C0U A;  4DBQ A;  3CCR S;  1Y11 A;  1KFD A;  2XHW A;  1RHK B;  4PPZ A;  3GG0 A;  4HVZ A;  2HZA A;  4UTG A;  3M8Q A;  2GAH C;  4TU8 A;  2B7C B;  5KFO A;  4KGX B;  1S1T A;  4TU9 A;  1SIZ A;  4BC7 A;  4O23 A;  3FEX B;  3VVT A;  3HK2 A;  3B8H A;  2XMJ A;  3AFG A;  3NGT A;  2HND A;  4FYD A;  5LM7 E;  3MMB B;  3R7B B;  1H2V Z;  3MCM A;  1FKO A;  4LF7 F;  4Z37 A;  2VBW A;  2HGM A;  3RAQ A;  1H38 A;  1RAG B;  3GJQ B;  4CYU A;  2PD1 A;  3H5S A;  1ZM2 A;  4DV3 J;  1HMV A;  3HSJ A;  2DGU A;  3MZI A;  1RLD A;  1RWX B;  2KZM A;  2MJU A;  2MGZ B;  2DR7 A;  3EGZ A;  2XYG B;  1NHU A;  5KT3 A;  3PKM A;  3GZ7 A;  1DTT A;  3MEK A;  2BQR A;  2MY7 A;  1LV5 A;  4JV0 A;  1RT2 A;  2AX0 A;  1T3N A;  2ZDO A;  2G2Y A;  5D4N A;  4AFF A;  1MRO B;  2P8I A;  5BR8 J;  2CQP A;  2Q43 A;  4WKR A;  1PGZ A;  3DXB A;  4TYB A;  2L9N A;  2V9K A;  2QJ3 A;  4DQS A;  1U1M A;  3BO2 A;  3V5R A;  5KOW A;  2VG7 A;  5CYM A;  1N4L A;  3KLG B;  4JYA F;  4U96 A;  1LQ9 A;  4Q44 A;  2FJA B;  1UEU A;  3HHD A;  2OPP A;  3FNN A;  4HR2 A;  1UFW A;  3R5C A;  3MUM P;  2HHH J;  2HVH A;  1K0T A;  3Q24 A;  1U1Q A;  1GTH A;  1APS A;  3R5G A;  3CDW A;  5A8R B;  5HQL A;  1RAF B;  3TRG A;  3DMJ B;  2HQ3 A;  3KJV B;  2ASY A;  4U8Y A;  2UXC J;  1REV A;  1FRM A;  4H4M A;  2C2O B;  2L9D A;  2UP1 A;  2LEC A;  1HLW A;  3O2I A;  3GV7 B;  1OJ4 A;  5DDQ C;  2Z58 B;  1VDH A;  1ZTT A;  3POT A;  3DNC A;  4OLO A;  5J2M B;  3SIP B;  2KFN A;  4BC9 A;  2VDI A;  5G0R A;  2O5D A;  3THT A;  4OZ5 A;  4P6Q A;  3RUB L;  1R0A A;  2MQM A;  3N6N A;  3P8B B;  3U02 A;  4P75 A;  2APO A;  2IFX A;  1CJV A;  1RTJ A;  5ETM A;  2ILY A;  4B3T F;  3HF5 A;  1MML A;  4CLP A;  3MWB A;  3X3U A;  5JVG Q;  3IN5 A;  1S1U B;  2MKI A;  1VIX A;  2YPZ A;  3SV4 A;  5CD4 A;  4ER8 A;  3UVJ A;  2ZOG A;  3OL6 A;  3QT7 A;  4DR5 J;  1L3T A;  3KK3 A;  1EQ0 A;  1GMV A;  2O3D A;  2ZVI A;  1RT7 B;  4QOT A;  4HDG A;  2HMI B;  3AY0 A;  3DI6 A;  4CLY A;  1I94 F;  3NOC A;  3ZTQ A;  4K4Y A;  4U8V A;  3QGH A;  3NAI A;  4AL7 A;  4DFP A;  5KG0 A;  5A2Q U;  3NRB A;  2MZT A;  2NQP A;  4CLU A;  5T41 A;  4LFA F;  4IFY B;  1HBN B;  1VJW A;  1D9A A;  2ACM A;  4P2S A;  1R6V A;  1RWO B;  2OO4 A;  3DYA A;  2DNK A;  4O0N A;  4B17 A;  2M0G B;  1U6F A;  1XMO J;  2VFS A;  4QYZ K;  3MEC A;  1H7X A;  1HA1 A;  3VTI A;  1SL2 A;  3IWX A;  3JXO A;  1UJ6 A;  5AE2 A;  2ASD A;  1RAJ A;  1BQM B;  1S4E A;  4K50 A;  1UWB A;  3TEG A;  1JKH B;  2G0I A;  1R8B A;  4F2R A;  5ETV A;  2V6A A;  2MQP A;  1IKW B;  1YRX A;  3JAM Y;  1GXL A;  2V0N A;  4YDD B;  2CQH A;  2E29 A;  3TOQ A;  4B9L A;  2BXJ A;  1MNE A;  4ZP7 A;  3ITH A;  1HNZ J;  3SSS A;  1NK7 A;  1YBT A;  3D6T B;  3F56 A;  2HHX A;  4DR4 F;  2DPI A;  3DRR A;  4H54 A;  3UWT A;  2G1H A;  3V4I B;  4RUC A;  2YKN B;  1JLQ B;  4KV8 A;  1CSJ A;  2OSQ A;  4KH1 B;  2ZZM A;  3D54 A;  3OLB A;  2LEA A;  5LXR A;  4UZB A;  1EHW A;  1RAE B;  1U2R A;  3HZG A;  4N56 A;  5HVH A;  4K0K J;  5AJ3 F;  3T5J A;  3UN5 A;  3M4X A;  4A8W A;  2XNQ A;  4DV3 F;  4MK9 A;  3DU5 A;  3CC4 S;  2JLF A;  2F65 A;  2XY7 A;  1XMQ F;  3M1V B;  1Q5Y A;  2NS1 B;  2D3Z A;  2GHW A;  3ENA A;  2HGN A;  4CLS A;  2LEP A;  1T0T V;  1JK9 B;  1RQ0 A;  2GMJ A;  4DL0 C;  2LXF A;  4O44 A;  4LQ9 A;  3TA1 A;  1Q82 T;  1N36 F;  3C14 B;  1YDL A;  2DRB A;  5BR8 F;  2FVQ A;  3K5L A;  4OYW A;  3B4D A;  3MR3 A;  4Y3C A;  4NLU A;  3TUI C;  5A6W A;  3THV A;  4UF4 A;  4NEY A;  4YQW A;  2VOO A;  5KG3 A;  5HBM B;  4KSE B;  1O8B A;  1FXL A;  2E1C A;  1QTN B;  3LAK A;  1BUX A;  3CCM S;  2KL8 A;  5B0A A;  1H98 A;  4EYI B;  4AL5 A;  3HHL B;  1NK9 A;  2W9B A;  4P71 A;  3GJT B;  1HNX J;  4WFY A;  4QIF A;  3SQG B;  2FZC B;  4KKO B;  2MPU A;  4O3N A;  2A2C A;  2I6W A;  3RYL A;  1KVI A;  3W1Y C;  2IYG A;  3KTQ A;  4WE1 B;  3BRE A;  4HYK A;  2EI5 A;  4LR8 A;  5CYJ A;  2HK2 A;  1KFS A;  2GMH A;  4DX8 H;  3L9Z A;  1SQG A;  5DLG A;  2H65 B;  3I0S B;  1R8P A;  2RU9 A;  1AFJ A;  4L3N A;  1FDN A;  2LU2 A;  2B4U A;  3NEK A;  1VMB A;  2ZNZ A;  4OI0 A;  3V4M A;  4J9R A;  4DR3 J;  3RBZ A;  4OYA A;  4ZN3 A;  5DDR C;  1RWM B;  3WHI A;  3DRP A;  4RU2 A;  2OD6 A;  3PDN A;  4Y34 A;  4LF6 J;  1U49 A;  4J90 A;  4WP3 A;  1REG X;  1WKJ A;  2GVD A;  1SJ4 P;  4K5R A;  4PEO A;  2O01 C;  3M9M B;  2M2B A;  3DOM A;  1RWW B;  1NK6 A;  1D8Y A;  1FO1 A;  3RRG A;  3HXM A;  1HBM A;  3LP2 B;  3JSY A;  1N5S A;  5A8W B;  1RWP B;  1JLC B;  3FRZ A;  3QRP A;  4HAC B;  2D1C A;  4DR5 F;  5E3R A;  3MPV A;  5CD4 H;  1DJ0 A;  1MU2 A;  2HS4 A;  4GKJ J;  4BWM A;  1WEL A;  3UFC X;  4HHU A;  2B6A B;  3HVW A;  3VAH A;  2XB2 D;  4CLT A;  2NR0 A;  5HN0 A;  3KK1 B;  1HL6 A;  3KLE A;  4P73 A;  1ZET A;  1NB2 A;  4G1P A;  1Q95 G;  4CLK A;  4OHX A;  4IG0 B;  1F5C A;  1BMQ B;  1XMO F;  2VBZ A;  4C48 A;  2HAI A;  4DF8 A;  4PG7 A;  2R7O A;  2IAJ B;  1L3K A;  2H5E A;  4J9S A;  2KI2 A;  1FHT A;  1EP4 B;  4Y2M A;  4R5P A;  4ECQ A;  2CJX B;  3C15 A;  2HRT A;  1TEL A;  3OTD A;  3ETO A;  4DLE A;  5FII A;  5I3Q A;  2ERR A;  2AKW B;  2DNL A;  1QAX A;  3H2V E;  3Q8U A;  3UN3 A;  3MR7 A;  2HPU A;  3T41 A;  2VAS A;  5DM7 Q;  3MFH A;  4OI6 A;  3SMZ A;  3JTN A;  2DR9 A;  3N9U C;  2KVQ E;  1VOM A;  2LDY A;  4ICL B;  3SBM A;  2K2P A;  2EK1 A;  5KFA A;  3G82 B;  2EKY A;  3GB0 A;  3A8K A;  3ILO A;  2Y1R I;  1TL7 A;  1EKR A;  2ZD1 B;  3RGI A;  4KPC A;  2MB0 B;  1A0O B;  2W7P A;  4B9S A;  4ZVU B;  4LF5 J;  4RL1 A;  4WJB A;  3CMQ A;  5KFM A;  2CPJ A;  2D7S A;  3JTO A;  1NSK L;  3C19 A;  3TAP A;  3VAF A;  2YNG A;  3N01 A;  1TKZ A;  5DG9 A;  1YIJ S;  2YWW A;  3EGW B;  3K8W A;  3ZO7 A;  4CTA B;  3UW1 A;  4K4V A;  2VOD A;  4WPA A;  1S72 S;  2DEJ A;  4K0K F;  3RZA A;  3SFU A;  1IQT A;  3D66 A;  3RB0 A;  4JI7 J;  4DPW A;  1HNW J;  1NO8 A;  2YWK A;  4ED0 A;  1UP1 A;  2XMW A;  1EIY B;  2VON A;  3R9L A;  4OZ0 A;  1UA1 A;  9ATC B;  2COL A;  3CCZ A;  2OEJ A;  4L74 A;  5EX0 A;  2PN6 A;  1IBK F;  2QTW A;  5IOL A;  2YVS A;  2GQ2 A;  4CIO A;  3MOJ B;  1QDU B;  1I5O B;  2CG8 A;  2IVF B;  2XWX A;  4F3M A;  5KFQ A;  2HUR A;  4TYA A;  1FRL A;  4DSF A;  1QM9 A;  4DSJ A;  3ENV A;  3DRS A;  1S10 A;  2V8D A;  1WUU A;  1KOH A;  1BXN A;  2J0S D;  3U7J A;  1X9W A;  3ZC4 A;  1ZM9 A;  2NUH A;  3IRW P;  4OYO A;  3V81 B;  1Q5V A;  2QG9 B;  4LFB J;  3N6M A;  1HNX F;  4OHW A;  4LBI A;  1Z2L A;  4WFB Q;  4DV7 J;  4DS4 A;  4C97 A;  2B9Y A;  1KEK A;  3KLH A;  1PYO B;  3BH7 B;  3MAQ A;  1VQP S;  3MUT P;  2B4V A;  1HI1 A;  1UVL A;  4AQY J;  3G8T A;  4ZLL A;  2C2M B;  2W9C A;  4EO8 A;  2RUS A;  2RB7 A;  3GCW P;  4HHH A;  4JI2 J;  1DY3 A;  1TUV A;  1RBO B;  1XEZ A;  2KM8 C;  2RAQ A;  1QVG R;  2XC9 A;  4XPC A;  2DNY A;  1GX5 A;  3I6P A;  4YR2 A;  1YK9 A;  2FVP A;  2M52 A;  4ZA1 A;  3OHA A;  3CCS S;  5D4O A;  3VF0 B;  3I55 S;  2XY5 A;  3I9Z A;  5ETP A;  2R8H A;  5GAG I;  2JZ5 A;  4LF6 F;  1TVR A;  5GAH U;  3DLL Q;  4OZ3 A;  5KG6 A;  4PG8 A;  1VRT A;  1SC1 B;  1UA0 A;  4Z7C A;  2XLK A;  1FNM A;  1DQ8 A;  3MAH A;  2MST A;  4I64 A;  3BB5 A;  3K5P A;  3QPI A;  4U67 Q;  5HRO B;  1X5T A;  4HT7 A;  4MFB B;  4DOZ A;  3V6D B;  4KGM A;  1A9N B;  3IR6 B;  2GAG C;  4CRJ A;  3MUR P;  4WIQ A;  1LWE B;  1F9E B;  4MAK A;  4M94 A;  4GKJ F;  3HFV A;  3PJX A;  5RUB A;  5T7L B;  2FUG 9;  1X0P A;  2D69 A;  3NGR A;  3PYD A;  4DPT A;  5ETQ A;  2BAN A;  1Y5I B;  5J2P A;  3VAI A;  4XDC A;  5F3Z A;  4J91 A;  4CM0 A;  3AOA A;  4WFX A;  2OAU A;  2R8K A;  5KFT A;  4C4W A;  3A12 A;  5IQQ A;  2YX4 A;  1RHR B;  4J9M A;  5L1J A;  3HHN B;  4GRS A;  5HMY A;  4ZVP B;  3GJS B;  1TU0 B;  2IDE A;  3ISN D;  3CB4 A;  1MMN A;  3BKU A;  1WKK A;  1YTY A;  3BBF A;  1R0B G;  5C2C A;  4G65 A;  2DIV A;  3D7S B;  1WEZ A;  5E33 A;  3N28 A;  5LT5 A;  3DOL A;  3OXL A;  1O5J A;  2B0G A;  3R2D J;  3U27 A;  3NGD A;  4ZHR A;  2F8E X;  5IQ6 A;  4OZN A;  1CUL B;  4OJ1 A;  3T5K A;  3W63 A;  4OL8 A;  4J9O A;  1FJG J;  5AT1 B;  1F5B A;  2F8H A;  5I3P A;  3C2P A;  4NZ6 A;  3PX6 A;  2EC0 A;  3BM7 A;  4W4M A;  4B3O A;  4I56 A;  2ZHO A;  4C8K A;  2PI4 A;  1YBA A;  4C0O C;  2YNF B;  1PIL A;  1VIS A;  2HIY A;  1T9X A;  4QIW D;  2GX8 A;  2KG0 A;  3S01 A;  1AUS L;  1F5A A;  4JV2 A;  2C2Z B;  1SJR A;  3FFI B;  3GON A;  1Q53 A;  1YG0 A;  5KT4 A;  1G3O A;  3AQP A;  2X1G A;  4IKA A;  4NA3 A;  3AOC A;  1H0H B;  2RQ4 A;  2L9W A;  5HVF A;  4V19 X;  1CC7 A;  4BS2 A;  1HNW F;  2BV3 A;  1LW2 A;  3OUY B;  4QPX A;  2JVO A;  1XC9 A;  3KXD A;  3HSZ A;  1IBL F;  2IC3 A;  5EDW A;  3PZP A;  2DGX A;  2N3L A;  3LWM A;  3I4P A;  1WF0 A;  4IQM A;  2IRX A;  3JB9 k;  4L3K A;  4RNF A;  5JXS A;  4FVC A;  4HTI A;  2QIF A;  2CJK A;  3THP A;  5SZT A;  1KQG B;  2R8G A;  1FD2 A;  1R3N A;  1QUP A;  2HHP A;  4NI2 B;  1LNQ A;  1T94 A;  2ZNY A;  3HD1 A;  3EZ5 A;  4B9N A;  1HPZ B;  3MM8 B;  1FX2 A;  2HHT A;  1F9F A;  4DMZ A;  1Z4U A;  4LFB F;  3DXS X;  1KVJ A;  4DV7 F;  4LQ3 A;  1PAE X;  3W65 A;  4NXN J;  1OY6 A;  1NUE A;  4MKB A;  5B0F A;  4ED6 A;  4R25 A;  3K58 A;  2IVY A;  3EMT A;  4A8Q A;  5HMZ A;  4AQY F;  5L9N A;  3IGN A;  4IG3 A;  1S0N A;  2RKI A;  2NZC A;  4ENO A;  2LQ8 A;  1SIW B;  4AE5 A;  4NLG A;  4IRC A;  2KZZ A;  1UL3 A;  3OBI A;  2DGW A;  2KJV A;  4JI2 F;  2CYY A;  4BBY A;  4WP8 A;  5B0G A;  3R6G B;  4ELU A;  4QR1 A;  1PJ6 A;  3SCL E;  4USV A;  2DB1 A;  1S4F A;  5C5J A;  2QT7 A;  2MEW A;  2PII A;  3KUH A;  3MM9 B;  3J80 Y;  1GFW B;  3SFG A;  3IRX B;  3MD3 A;  5LSO A;  1WC4 A;  3RB4 A;  4CP5 A;  1VRU B;  2JRS A;  2WHO A;  2RIL A;  3P49 B;  4CWB A;  4ZPV R;  3M8S A;  4URG A;  3KHR A;  2R7S A;  3CCW A;  2DNO A;  3AD7 C;  3LP1 B;  1OQ3 A;  4DV5 F;  2HHS A;  4M5D B;  1FWK A;  4ZCM A;  2Z57 B;  4RO0 A;  2ZHB A;  1EET B;  2E7X A;  1S9F A;  1UFL A;  2BW7 A;  3IG1 B;  1C1C A;  4XK8 C;  2FQQ B;  4PUO A;  2AYB A;  4YY3 J;  4A46 A;  2OIH A;  2DR6 A;  3DC2 A;  4FYY B;  1RTI A;  1N8R T;  3KLF A;  2Z56 B;  4J7C A;  1JQG A;  3CJ5 A;  5HJY A;  1DFD A;  1GXU A;  4WK3 A;  2G1D A;  1K44 A;  2GS8 A;  3HSG A;  2W7A A;  4MYU A;  5IT9 Y;  2ZZN A;  4NA1 A;  2DR5 A;  3SDE B;  3CIM A;  4O4G A;  2XS5 A;  4F0H A;  1WHV A;  5DG7 A;  2ZKT A;  4NAS A;  3W3S A;  3HVA A;  2B5J A;  3R6L B;  2M70 A;  3PAC A;  1RLC L;  5KFX A;  5KAK A;  1AW0 A;  1NKE A;  2B51 A;  2V2Z A;  3CDU A;  3VAL A;  2XHC A;  1DLO A;  5IWA J;  1YI2 S;  4R8U B;  2IA6 A;  4PZV A;  3P5T L;  2GHV C;  4DI6 A;  4N76 A;  4WWS A;  4EFA C;  1BHN A;  4G1Q A;  1CJK A;  2U2F A;  4RJV A;  1MN9 A;  2KVI A;  4HEA 9;  1TKX A;  4DQP A;  5F8L A;  3TAN A;  2K3K A;  4NCG A;  2VG5 A;  4DCP B;  1UCN A;  1VQ6 S;  2HIQ A;  4B3S J;  3J7A 1;  3V6H A;  1AFI A;  3GYN A;  3DHX A;  4LSL B;  2YWG A;  4F26 A;  4DUT A;  2ZEJ A;  3UDV A;  2ADB A;  1B3T A;  1FE0 A;  3GYX B;  2DIT A;  3ADA C;  1HNV B;  3TUJ C;  4NCA A;  3EZO A;  5C42 B;  3CD6 S;  3KYL A;  1MMD A;  2VA3 A;  2IBO A;  2DCL A;  5IT0 A;  1YVF A;  5A0Y A;  4JI6 F;  4KQZ A;  2DH8 A;  1N0U A;  1MLA A;  2UUA J;  3I82 A;  1XNR J;  1X5S A;  1UVJ A;  2HWT A;  1SQE A;  1VQ7 S;  1Q16 B;  4NYO A;  2KKH A;  4OYZ A;  3W2V B;  1NU4 A;  2H3E B;  3ZZ0 A;  2RU3 A;  4ZMM A;  1RT4 B;  1JLB B;  2V4Q A;  2EKN A;  3TO8 A;  3SZ2 A;  3H4D A;  2EPI A;  3KHG A;  1ZAV A;  4U7U D;  3TX8 A;  4DG1 B;  3M2R A;  4DUZ J;  3RB3 A;  2ABY A;  1RA6 A;  1IXK A;  1P1T A;  1TUG B;  3HVT B;  1SH3 A;  4OZ2 A;  3KK2 B;  1DTQ B;  1RJJ A;  1X4G A;  2KYZ A;  4QYR A;  3JSR A;  2FY1 A;  1ULR A;  3LF0 A;  2YKM A;  3J81 Y;  1JLA B;  2WON A;  3R5D A;  1S6P B;  5KFB A;  3GMG A;  3PR4 A;  4KTQ A;  4DX6 A;  3K17 A;  1N5Y A;  1NPP A;  3G8Q A;  1V9O A;  1WOO A;  2KRR A;  4HH1 A;  4KHR A;  1CQN A;  5J2N A;  1RT1 B;  1D9F A;  3D6H B;  2XYH B;  4ECU A;  4RZR A;  4RR5 A;  5THW A;  3R5B A;  4I7F A;  5C7P A;  3BF4 A;  2W01 A;  2GIR A;  4FKX A;  2NXN A;  3N0V A;  4N41 A;  2HNY B;  2X3G A;  4WP9 A;  2UVU A;  5F9L A;  5IV3 A;  5CAB A;  3P5B P;  4O3Q A;  2GO9 A;  3TVY A;  3N5F A;  3DGP A;  1T7P A;  2HSE B;  3H7H B;  4F36 A;  2V2Q A;  4HI1 A;  2J6S A;  5GMK a;  2AZ1 A;  2ATC B;  1X31 C;  3PHE A;  1F3V A;  1U1R A;  2YH1 A;  3TAM A;  4F0K A;  4OHZ A;  3IAS 9;  3GFY A;  1SV5 B;  3PX4 A;  4J9N A;  2FHM A;  4PCQ A;  2W8L A;  3TAR A;  3PYG A;  3M6W A;  1U6Z A;  2I5J A;  2PEB A;  3GTY X;  3O3L A;  2BAC A;  4F02 A;  4C6A A;  1RT6 B;  2ZVS A;  4LR7 A;  2C3O A;  4MIW A;  1PC4 A;  5H9F K;  2R42 A;  1X4A A;  2Y8W A;  2DGQ A;  3UCG A;  4LIW A;  1TL4 A;  3KNG A;  2ZBR A;  2IPO B;  4IDK B;  4Q45 A;  1SJ1 A;  2N3O A;  3HI9 A;  3RAX A;  1FJ7 A;  3D3C J;  1I3O B;  4OJ3 A;  3PIP Q;  4X64 J;  3ISN C;  2HW3 A;  2VQF J;  1HHS A;  1HR0 F;  4JV5 J;  3X1L B;  5IWA F;  1KRP A;  1TV6 A;  5DQG A;  4J9U E;  4DR6 J;  1S1W B;  4PYD A;  3CUN A;  4Y6I A;  4FF3 A;  2C22 A;  4B08 A;  3N6L A;  2VU5 A;  2H48 B;  2VQE J;  2M5Y A;  1C0T B;  4QWC A;  1UMJ A;  2LQ5 A;  3I32 A;  1RTH A;  4LR9 A;  3EVW A;  1M1K T;  3CUL A;  3G6Y A;  4B3S F;  2XY6 A;  4F04 B;  1S79 A;  1EAR A;  5FLX U;  4BWJ A;  2V8P A;  3D28 A;  4WKY A;  2E1A A;  2FJD B;  4IFV A;  2RF2 A;  5CAA A;  1S1V B;  4F50 A;  2XNR A;  1W25 A;  4YR3 A;  1H7W A;  2W2M P;  4NA2 A;  3FSY A;  4FDF A;  1G2E A;  3DDK A;  5HAO A;  1CJU A;  1XR5 A;  4ELT A;  1SQF A;  1ARO P;  3JS9 A;  3A1Y G;  2IA0 A;  3C46 A;  3T1A A;  4FXD A;  2ZOF A;  2UUC F;  4ZOS A;  2W4D A;  2X51 A;  4UY8 5;  1A7G E;  4J9K A;  1N56 A;  2KHD A;  1TTH B;  1J2V A;  4XAK A;  1BQN A;  4TKT A;  2YKQ A;  2AMC B;  3ICL A;  2XSJ A;  4CQ1 A;  2B9W A;  2AJ2 A;  3QNW B;  1LWF A;  2MSS A;  2GO8 A;  4IR1 A;  1JLG A;  3S1T A;  1XR6 A;  3MED A;  4I6A A;  3GFH A;  1N5T A;  2HHV A;  2HK3 A;  2NXC A;  4DZ6 A;  3OXG A;  4RNH A;  1AZS B;  3SCJ E;  2X3D A;  3ZTR A;  4XTT A;  4H4O B;  3KLI B;  4I67 A;  3G9C A;  2Z2Y B;  4KO0 B;  3M8W A;  2W2Q P;  4LF4 J;  4FF4 A;  2HRU A;  2LQ9 A;  4RBU A;  3GJR B;  4UOG A;  1FFW B;  1NPR A;  1YJW S;  3V2U C;  8AT1 B;  1Q8K A;  4YOE A;  2UVV A;  2HFU A;  4XPE A;  1M5P C;  2BBE A;  5F0W A;  4USK A;  3MMB A;  4RNM A;  3AJ1 A;  4LF8 F;  4IRD A;  2KFY A;  2VKZ G;  1NXI A;  5D6G A;  2G0J A;  2HVE A;  4NLQ A;  2R9L A;  3W9I A;  3EZU A;  1U2F A;  3Q89 A;  5KG5 A;  3HPO A;  1X60 A;  2GV1 A;  3I96 A;  1BY9 A;  3KG0 A;  2MGZ A;  1SCJ B;  3AXK A;  2ZBQ A;  1VQ4 S;  3DLG B;  1BWV A;  3HO1 A;  4FZV A;  1CEZ A;  1WKL A;  3IBF B;  1N6Q A;  1MRO A;  1M5O C;  4ES2 A;  2JL9 A;  3L4B C;  4OZL A;  4F25 A;  3E3X A;  2QLB B;  1SVD A;  1SH2 A;  3MEG B;  3MUV P;  4ZPA A;  3MMC A;  3NMR A;  4C8M A;  1NEE A;  2QX0 A;  2OPP B;  2HQI A;  3EUN A;  1HKA A;  1PIE A;  2BRL A;  4H4K C;  1U45 A;  1JWW A;  2R7Q A;  2BE2 A;  3OSN A;  3OL8 A;  3KLG A;  2HWI A;  2ZH1 A;  2JNJ A;  1BLU A;  1KN6 A;  2HNZ B;  4DU8 A;  1M1G A;  1URR A;  4MT1 A;  3QLH B;  1J5E J;  1PG5 B;  1T9T A;  2QV6 A;  1CJT B;  1VIO A;  3TZX A;  5A8R A;  3DMJ A;  2EFO A;  3KJV A;  1S7I A;  1F2G A;  2FPH X;  3UDE A;  1RIS A;  3F44 A;  3W2W B;  2ADC A;  1S0V A;  4PQA A;  4Y2I A;  1WF2 A;  5GAH I;  3FCV A;  1ROF A;  3OLA A;  2RT3 A;  1UEK A;  4EGL A;  2CQD A;  3PM9 A;  3WC0 A;  3O5T B;  1OY9 A;  3OT9 A;  4ID5 B;  1W7W A;  4K4W A;  3H4B A;  1Y4Z B;  4X64 F;  1E6V B;  4USJ C;  2UV8 A;  1L3U A;  4O0I A;  2C1E B;  4JV1 A;  4LFC F;  2WBR A;  1TKT B;  4DR6 F;  4JI8 F;  4TXS A;  2BJ3 A;  4OX7 A;  1IKY B;  3C8Y A;  2LA4 A;  5HMX A;  2KT2 A;  2KB2 A;  1NDP A;  2I2Y A;  4B3M J;  1D8Z A;  4ZVR B;  1NND A;  3PRB A;  2JDJ A;  3WC2 A;  3QAE A;  2WK4 A;  4WYW A;  1TL3 B;  2E5L F;  4DQI A;  3D1Q A;  2JHE A;  1NB7 A;  2ZE2 B;  3GYG A;  1S1U A;  3QAU A;  5KT6 A;  3C6U B;  1W2B R;  3GFZ A;  4LRB A;  2C42 A;  1RT7 A;  4LSZ B;  2HMI A;  2X1F A;  2AQ4 A;  3IXQ A;  4X2B A;  2MHE A;  3IA0 A;  2GCF A;  1RT3 B;  5F0U A;  4B02 A;  3I5B A;  3QT5 A;  5ADZ A;  4NLY A;  4ZLN A;  1N32 J;  1WC0 A;  4DR2 J;  4ZVE A;  3HHL C;  4EUV A;  3O1L A;  1AA1 B;  4IFY A;  2UVW A;  4DV2 J;  1HBN A;  1FDA A;  3EJM A;  2R7T A;  2E9R X;  1CPZ A;  1N33 F;  3T9Z A;  2JVR A;  1GAO A;  5K14 B;  4KJI A;  4H4K A;  2QMU B;  3ZFV A;  1OS5 A;  3I5A A;  1JXL A;  1HIY A;  1X4E A;  3B4M A;  3EXY A;  4ZVQ B;  3L7P A;  1BQM A;  4W90 B;  2H4W B;  2J7W A;  4N8O A;  2V94 A;  2FHO B;  2A3J A;  4MTP A;  1JKH A;  4GVB B;  4C8O A;  3K5O A;  5GAD U;  3CCQ S;  1FNX H;  2W4C A;  4DR1 F;  1IKW A;  3VAK A;  1WSV A;  3PO4 A;  3MCO A;  3IP0 A;  2B43 A;  4I68 A;  4TY9 A;  4CDI A;  3VWS A;  4JI0 J;  5CH7 B;  2AYE A;  2V9W A;  1CLF A;  3KKF A;  3O44 A;  4TN2 A;  2ACY A;  2DHG A;  3C16 B;  4PYA A;  3K57 A;  2A2D A;  3V4I A;  1V5V A;  5MLC V;  5A8K B;  1JLQ A;  3U1N A;  3GPA A;  2MXY A;  4A8M P;  5EGY A;  2DGO A;  4FF2 A;  1Q78 A;  3UR0 A;  3W60 A;  3QT6 A;  5CA5 A;  3EVO A;  2J7U A;  2DKO B;  2NYI A;  1UPM B;  4O44 B;  2CNN B;  2X1A A;  3M1V A;  4LBP A;  4U6P A;  2WBM A;  3T5L A;  4IYQ A;  3FBE A;  5J1N A;  1O6X A;  3TWZ A;  5K8P A;  1S6U A;  1FXR A;  5GMD A;  1RXO B;  4LSN B;  3M32 B;  1MSW D;  5F8H A;  3C14 A;  2XZD B;  3CCT A;  3FQK A;  3K0J A;  2WVE A;  3FBC A;  2J76 E;  1N5V A;  4LRC A;  2VPX B;  4F4K A;  4CCH A;  4OYI A;  5F8G A;  4EEY A;  7FDR A;  2VPY B;  2W2N P;  3ZXW A;  3Q8R B;  3TW0 A;  3WX8 A;  5HBM A;  3RBE A;  3W61 A;  4LIR A;  2DO4 A;  3NG8 A;  3EYZ A;  4WU3 A;  3CJK B;  5F8M A;  2WZ1 A;  3VQT A;  4Q5V A;  4DV4 F;  1NJY A;  3HHL A;  2AYG A;  5IS2 A;  3SQG A;  4KKO A;  2DGT A;  4CO4 A;  5D4L A;  3MTJ A;  2DD8 S;  4OX9 J;  1DQA A;  1OYE A;  3SSQ A;  4EZ9 A;  4RW6 B;  4WE1 A;  4NLW A;  3O6Q A;  2KXN B;  2GGP B;  2E44 A;  1FJE B;  2WW8 A;  1VBY A;  2JEI A;  3AAW B;  3CE8 A;  3I0S A;  2V4J B;  2F63 A;  5CZX A;  3NGK A;  5C25 B;  1IKX B;  1NDC A;  3KLV A;  1QD1 A;  3KUG A;  4QJV A;  3VGT A;  2QRR A;  3AD8 C;  2HBY B;  3AHP A;  2V2K A;  5CQG A;  1LWC B;  1KD1 T;  3DLH A;  4I4B A;  2Q6C A;  2DRD A;  2P5V A;  4DFK A;  3MR2 A;  5KTQ A;  4CH7 A;  1VQS A;  3NBP B;  4O3O A;  1V3S A;  4YP3 A;  3BR9 A;  2BOP A;  3MI7 X;  2J7K A;  4X65 J;  5E3C A;  4B3M F;  2MKJ A;  4RWW A;  2HFN A;  5HVG A;  1RZM A;  3PW5 A;  1FNO A;  1F6T A;  2QE5 A;  2IRU A;  2AGO A;  4B3R J;  2PT0 A;  5D15 A;  4GO7 X;  5BJR A;  4CO3 A;  1GMW D;  2XMM A;  2V69 A;  4QIE A;  3TNV A;  3TR5 A;  4NE9 C;  2DIU A;  2W9A A;  4QU7 A;  3LP2 A;  4NLR A;  5A8W A;  1JLC A;  1CS4 B;  2XLJ A;  4LT6 A;  4HAC A;  3MPW A;  2MDA A;  3M8Z A;  2IDL A;  1VHF A;  3RBX A;  4X4U A;  2LU1 A;  4L73 A;  1CBK A;  2B6A A;  1AB8 A;  1B7Y B;  1RA7 A;  4XIU A;  3Q8P B;  2BOA A;  2OD4 A;  4PRF A;  4URS A;  4TU7 A;  1S0M A;  2OSR A;  3K5N A;  3KK1 A;  3O8W A;  2C2N A;  2QA2 A;  4DX5 A;  2YWH A;  4DV2 F;  2CWX A;  3KJF B;  5ETS A;  2IYI A;  2E9Z A;  4IG0 A;  3FCW A;  2XMV A;  5DQI A;  1X5P A;  3SEO A;  5F3T A;  2IAJ A;  4USH A;  2QA4 G;  1EP4 A;  3J81 j;  1HWJ A;  4KHP J;  2FLO A;  2YKP A;  2OEL A;  2YKO A;  2ROG A;  1C2P A;  4DX7 A;  2CFX A;  1JJ2 R;  3G6E S;  3ELH A;  2HWH A;  3FZB A;  4EI2 A;  2ZH4 A;  2KN4 A;  3VGS A;  3IBW A;  1UVI A;  4ECR A;  1T9W A;  1EX8 A;  4PG5 A;  5C2G A;  3AD9 C;  4N8N A;  3MTK A;  3U1M A;  5DGB A;  4ED2 A;  4ICL A;  3FCH A;  4JI0 F;  3PRV A;  3G82 A;  4TLR A;  1LK5 A;  2VOP A;  4PWW A;  4WII A;  2MLZ A;  3R7N B;  2MKS A;  2ZD1 A;  4RBT A;  3QGP A;  2E5G A;  2CPH A;  1GXT A;  2ALZ A;  3WDO A;  3CJT A;  2DK2 A;  3MOZ A;  3IR7 B;  2FTR A;  2ILZ A;  1LW0 A;  1Q8I A;  1B0V A;  1Z2Z A;  3BGF A;  1XIQ A;  2JWN A;  4CTA A;  2DY9 A;  1TZ0 A;  1RAC B;  3V6K A;  2R7X A;  4KAI A;  2PC6 A;  2RH3 A;  1T03 B;  3AA9 A;  3LAL A;  3RG6 A;  2D74 B;  1ZYQ A;  4ZN1 A;  1N54 B;  2UXD J;  1XBW A;  2HQD A;  1NSQ A;  1NK5 A;  3JYT B;  1R27 B;  3BSO A;  2I9S A;  4CLF A;  5KFF A;  2MKK A;  2F9J A;  5KFN A;  3DLK B;  4LJM A;  1GTE A;  3QMQ A;  3BKF A;  2BE7 D;  3R5A A;  1U09 A;  2WAQ D;  4OHV A;  1X4C A;  2HQF A;  4DF4 A;  1HI8 A;  1H2T Z;  4NLS A;  2G9O A;  1U02 A;  2QFJ A;  4YUD A;  1VFJ A;  2RQC A;  1Q7Y T;  3V81 A;  3RRH A;  3M9N B;  2DVI A;  4PQU B;  3FEZ A;  2W9C B;  2M9K A;  4UST A;  1RWN B;  1GX6 A;  5KFH A;  5J2Q B;  5D0E A;  4OX9 F;  1S9G B;  3OJU A;  2OEM A;  4S0M A;  4TY8 B;  4FXW A;  4CNZ A;  3BZQ A;  5GVQ A;  4O3R A;  2WVB A;  4ZVH A;  1U48 A;  2OH2 A;  5LMN F;  2LQJ A;  6FDR A;  1S0O A;  4OV6 A;  3GFX A;  2J9D A;  4ILL A;  1C1B B;  3MMJ A;  4J9P A;  7AT1 B;  1T11 A;  1UJ4 A;  2CJB A;  3TA2 A;  3H8Y A;  4WFA Q;  4P2M A;  3R97 A;  3PKY A;  3UI3 A;  4RW7 B;  4IH6 A;  1FD8 A;  2AEM A;  3J7Z 5;  4J9Q A;  4P10 A;  4NMX A;  2RQM A;  1DQ9 A;  1SKU B;  5K5M A;  3SXL A;  1KNZ A;  3ENQ A;  2HFO A;  3T9N A;  2P6S A;  4MIB A;  3JQJ A;  4D3H A;  3HKZ D;  2OEK A;  5J1E B;  3CD7 A;  1RTD B;  3JAM U;  3MR6 A;  1KHV A;  2KH9 A;  5HRO A;  3G86 A;  3AA8 A;  4DFJ A;  4ZVT B;  4MFB A;  1TQL A;  3V6D A;  4KR0 B;  3PVX A;  5KFV A;  1JB0 C;  4WZM A;  2YX1 A;  3SYZ A;  3D1O A;  1XQI A;  4QQB A;  3LUY A;  2PE8 A;  4CM2 A;  1SPB P;  1VBK A;  1X4B A;  3U1L A;  5T7L A;  5DM6 Q;  4K2X A;  4ETX A;  4OIX A;  3H59 A;  2OTJ S;  1P6T A;  4I2Q B;  4K8R A;  2FJX A;  2BMB A;  1N52 B;  4K4T A;  3PRD A;  4CH0 S;  4L75 A;  3CJR A;  3PG9 A;  1R8C A;  1NKB A;  3UPF A;  2NCK L;  3MAA B;  2FC8 A;  1JNZ B;  4TVA B;  3R27 A;  5L39 A;  2V2V A;  3DN9 A;  1T05 B;  3LGH A;  4CLL A;  3PV8 A;  2B4P A;  4DL2 A;  3AT1 B;  2Y1L B;  3H20 A;  1WG5 A;  5E3A A;  1QAI A;  2PMZ D;  2DGS A;  3BSN A;  1WG1 A;  2ZBI A;  3W5Z A;  1FWP A;  4DEZ A;  1NZ8 A;  5KFR A;  3HKW A;  4B9T A;  2IY5 B;  4YB5 A;  3HVR A;  1CUL A;  1YKW A;  2FB0 A;  4RW9 B;  1HQE B;  2K7J A;  2V68 A;  1XTZ A;  3R3T A;  5D4P A;  1EZZ B;  2YNH B;  2CQ1 A;  2FYX A;  4OMF G;  5E5N A;  2YNF A;  2YX7 A;  4U7C A;  3NKY A;  2ZC3 A;  3I31 A;  2IIH A;  2HQG A;  2MQO A;  1UEV A;  2C3P A;  4FS1 A;  1B64 A;  4F4W A;  3NXZ A;  3Q23 A;  3FFI A;  1FA0 A;  5HAT A;  4FP9 A;  3HMJ G;  2E9T A;  4GO5 X;  2WB4 A;  4WBF A;  1F2H A;  4AT1 B;  1WF1 A;  2BVZ A;  3OUY A;  3FQL A;  2UXD F;  3QJP A;  1B70 B;  3CVK A;  5GME A;  3HD2 A;  1SJQ A;  1SH0 A;  2G13 A;  2AW0 A;  1N0V C;  1DHM A;  4Y2C A;  2J5A A;  4UY8 T;  4A48 A;  3MM5 B;  2IM0 A;  4NRT A;  2Q79 A;  2YQ1 A;  1Q8L A;  2DXE A;  2QLW A;  1OY8 A;  3IC1 A;  2ZFH A;  2VL1 A;  2CPX A;  4OHY A;  1ELO A;  4ETZ A;  3OR2 B;  1RAB B;  4NI2 A;  3W62 A;  1XJW B;  4IO1 A;  1A6L A;  1PYS B;  4JI3 J;  2CQG A;  1HPZ A;  5K20 B;  3DDN A;  5HQM A;  5DRK A;  2XYP B;  1H73 A;  2IRY A;  2J8S A;  3T1Y J;  5DZ6 A;  4UT4 A;  1JJ4 A;  5I4M A;  1S5Z A;  2ZIT A;  4MK7 A;  4DCJ B;  2IM3 A;  1YJN S;  1SKS A;  2E5J A;  4Q7A A;  3DLE B;  1KQS R;  3BQ1 A;  4Q0B B;  3BGR B;  3MFI A;  5F9N A;  2XI2 A;  2QA4 S;  5F8N A;  4E8U A;  1U1N A;  1QSS A;  2UVR A;  3FC9 A;  1XER A;  4N47 A;  4F0M A;  4V19 J;  2PEH A;  2XSF A;  3R2C J;  3KDN A;  3S6E A;  4JI1 J;  1RBA A;  1UW4 A;  3PCO B;  4IOA Q;  2FHJ A;  1M90 T;  3WBZ A;  3OW2 R;  3BS9 A;  2AU0 A;  1PKU A;  3MM9 A;  1QY7 A;  3IRX A;  1RU2 A;  3J7A N;  4DR7 J;  2ZH8 A;  4F4Z A;  5K8M A;  2V67 A;  2EBE A;  3LA0 A;  1VRU A;  1NDK A;  4UOF A;  4YFU A;  1P9Y A;  5KFY A;  3HM9 A;  1S99 A;  3VCD A;  1B4S A;  2L48 A;  1FK9 B;  1MWQ A;  5K9F A;  4P52 A;  4E0D A;  3BGL A;  2M8D B;  3LP1 A;  2HBR B;  4YB7 A;  3W5X A;  4ZS6 A;  4IQX A;  2HHH F;  1YZ6 A;  5J1P A;  1R6Y A;  4M5D A;  4ZJQ A;  1WD6 A;  1RKI A;  4M95 A;  1M1H A;  1EET A;  2ZJQ Q;  2NSB A;  2KT3 A;  2I0X A;  1HHT P;  3IG1 A;  4TQR A;  2UU9 J;  1U0S A;  2ATL A;  2UXC F;  1QE1 B;  1HBU B;  3ZNJ 1;  1YHQ S;  2DRA A;  1U0H B;  1PYT A;  4I6Y A;  4E98 A;  2GHP A;  2P2C B;  4XO0 A;  1VQ9 S;  2PFF B;  2YNI B;  2J0W A;  3MGJ A;  1NK8 A;  2DXD A;  1SC4 B;  2EFQ A;  3R7S B;  3MEE B;  5A76 A;  3LGN A;  2CZ4 A;  4N77 A;  2Y1J A;  2PFD A;  3SDE A;  5F8I A;  3QFW A;  1AUD A;  1ZA1 B;  2MTL A;  3SI8 A;  1S12 A;  4DLG A;  2GW8 A;  3IR5 B;  3BYR A;  4IO9 Q;  1IM4 A;  5HLF B;  1KON A;  3LW5 C;  3BKT A;  4ZPD A;  2XI3 A;  3GIR A;  1TKX B;  4KH0 B;  4UUW A;  1I51 B;  4R8U A;  5IC6 B;  3AB4 B;  2ZH3 A;  1R8H A;  2K8G A;  1GMU A;  3TJA A;  1CG2 A;  4JI4 J;  1M5K C;  4N5S A;  1S57 A;  2EBG A;  2FZK B;  4M5K A;  3QBC A;  4KFB B;  4DL6 A;  3MR5 A;  5KFZ A;  2MZR A;  5KFD A;  3HDS A;  2Q1L A;  3H0P A;  3IS9 B;  1FKP B;  1U6B A;  4KBI A;  4LBH A;  3UQS A;  3NY0 A;  1JLE B;  4FPR A;  1FVQ A;  1J5O B;  2JFK A;  1HYS B;  1X4F A;  4NXM J;  4MK8 A;  2GZO A;  4FPI A;  1Z1Z A;  2F1F A;  1D9D A;  3JTP A;  4DN0 A;  1TAQ A;  1HNV A;  5C42 A;  1IR2 A;  5HQ8 A;  3ZTO A;  3GR0 A;  2BQU A;  2BDP A;  4DN9 A;  1R8A A;  3QJL A;  2CQ3 A;  1WI8 A;  4C8Y A;  4KGV B;  1RGV A;  3R1H A;  3W2V A;  5GAD I;  4X4R A;  4QW8 A;  3PR5 B;  1OO0 B;  2RDI A;  1RT4 A;  1JLB A;  1GMW A;  2C2D A;  3D0I E;  4ECZ A;  3PW4 A;  1HNZ F;  4JI3 F;  4HKQ A;  4OZ1 A;  2OTL S;  2QLF B;  4OI3 A;  2GQC A;  4DG1 A;  4ED7 A;  4BHQ A;  2H5J B;  2UUB J;  2D41 A;  1D3W A;  2RS2 A;  2R2S A;  2CA9 A;  3HVT A;  2OPS B;  3KK2 A;  1DTQ A;  2FJW A;  3PW7 A;  1IKV B;  1BE4 A;  4L72 B;  2XO7 A;  2JEJ A;  1NRK A;  1EKS A;  1RI7 A;  4I1T A;  2POK A;  2V5H G;  4IUF A;  3NGU A;  2D3O R;  2MZS A;  1KR4 A;  2NRE A;  3GV8 B;  3H5X A;  4EU0 A;  2CNO B;  1JLA A;  4O3S A;  1S6P A;  1LFP A;  2NYH A;  2I38 A;  3I87 A;  3MD1 A;  4FKY A;  3QGI A;  1O51 A;  3VGV A;  4NLX A;  4JUZ A;  2DNH A;  2DHH A;  5KFS A;  3BSA A;  3HHK A;  3G71 S;  2BYC A;  1NLK L;  4LF9 J;  2MMY A;  4MH8 A;  3VZI A;  4ATN A;  1FKA F;  2CPE A;  2CG4 A;  3M8R A;  4DR7 F;  3LAN A;  2GVZ B;  5AXL A;  3TA0 A;  4RBV A;  4N7T A;  1RT1 A;  4MMO A;  3BBC A;  5DZ7 A;  1Y10 A;  2HBQ B;  1JLF B;  3NCP A;  2DNQ A;  4LMZ A;  4ECS A;  3MMA B;  2Z30 B;  3W66 A;  2FVR A;  3M05 A;  2HNY A;  5GAE U;  3EGV A;  1VQL S;  1GNK A;  4JYA J;  2W4P A;  3KMS A;  2IM2 A;  1ZS6 A;  3QIP B;  4P7V A;  2H54 B;  4ED3 A;  3T6B A;  1IJE B;  4ZCK A;  1T95 A;  1VQ8 S;  2MQQ A;  3CME S;  4PXC A;  2UU9 F;  1SB6 A;  2O1P A;  3K5M A;  1K47 A;  1BC6 A;  4MKA A;  2CIM A;  2ZDP A;  5KFJ A;  3C66 A;  3UDL A;  1OIA A;  2Z2M A;  3FGV A;  1SV5 A;  3Q0A A;  4OJH A;  4LRF A;  2XTJ P;  2EVZ A;  4A8K A;  3EIC A;  4DR3 F;  4DSI A;  3QQC D;  3SQO P;  1M5H A;  2K3I A;  1ZAX A;  5BYQ A;  3D1H A;  2H5I B;  1DZ5 A;  1RT6 A;  3H25 A;  4M8L A;  4IR9 A;  1TK8 A;  2CUY A;  2HLU A;  2G0C A;  5ETL A;  5JUM A;  3FSI A;  3JQK A;  3IWN C;  4KGK A;  3AB2 B;  4I2P B;  1UFK A;  4IDK A;  4ECY A;  4O4R A;  1OPZ A;  5EWG A;  1HI0 P;  2CWK A;  2UZA A;  5LL6 d;  4QWA A;  2DEI A;  2IMW P;  1VRQ C;  2WOM B;  4UOH A;  2FGO A;  4ED8 A;  4PG6 A;  1S1W A;  2PDA A;  2W1B A;  1PJ5 A;  1UAW A;  2EFV A;  2C2K B;  2DO0 A;  1Q4R A;  2FIU A;  1C0T A;  1U1K A;  1RWV B;  2X7I A;  5B0B A;  2J9E A;  4J37 A;  1BD6 A;  4ECV A;  2LYV A;  2CQC A;  1R43 A;  2VBX A;  1RWK B;  4JOU A;  3TUZ C;  1S1V A;  5BYS A;  1ZM4 A;  4NXM F;  2DBB A;  3QJJ A;  3CDB A;  5IM0 B;  3NCQ A;  1V5I B;  4LFA J;  2MQ8 A;  1TMM A;  3QID A;  2CQ2 A;  3GLJ A;  3HX9 A;  2LVW A;  4QWB A;  3W7B A;  3BQ0 A;  1SUQ B;  1U2C A;  1F9H A;  2RML A;  3KWM A;  1VGY A;  2XMK A;  3J80 U;  4PR6 A;  2UUT A;  1VC0 A;  8ATC B;  5D0H A;  1IM6 A;  5HK4 A;  1AT1 B;  1QAJ A;  2CRL A;  3K59 A;  2YXL A;  1KWM A;  2F8M A;  3N4W A;  2BKO A;  3CC2 S;  2CNL B;  3P3D A;  1IJF B;  3CD5 A;  3SCI E;  1XNQ J;  1IVZ A;  2BR0 A;  2HBZ B;  2UUB F;  3QT8 A;  4LF5 F;  1F60 B;  2NXJ A;  2WSC C;  2J9D E;  2AV5 A;  5HP1 B;  3RU0 A;  2FJB B;  2OJ3 A;  2HHQ A;  1Y5L B;  3CJ8 A;  4DR4 J;  4ZJO A;  4OI1 A;  1AZS A;  4C3K A;  2UV8 G;  4UQG A;  4H4O A;  4ZPC A;  1UTA A;  3KLI A;  2JEG A;  3BR8 A;  3OXF A;  1KLM B;  4EBD A;  5ITH A;  3OL7 A;  4KO0 A;  2IVM A;  4Q43 A;  1PC5 A;  1WC1 A;  2PA8 D;  3DCA A;  5I3U B;  4ECT A;  4JI7 F;  2BJ9 A;  5AJ3 J;  2JH3 A;  1HBO B;  2DJW A;  6FD1 A;  2EXU A;  3M2V B;  1LK7 A;  1XMQ J;  3KNA A;  3OTO J;  3ET6 A;  5IT9 U;  4CLW A;  4DXL A;  4DJB A;  5F8J A;  1FRX A;  2CDR B;  3PY8 A;  2XGQ A;  2OPQ B;  3CT9 A;  2BJ1 A;  4X4S A;  4LF9 F;  3HP6 A;  2EFN A;  3NS6 A;  4Q8F A;  2Z2L A;  1TL5 A;  2F40 A;  1NSA A;  4Y00 A;  2EK6 A;  1N36 J;  4JB8 B;  1VQN S;  2GML A;  1N6Q B;  1Q7L B;  2PGC A;  3GWC A;  3ZZY A;  5IZH A;  1F1B B;  2FY8 A;  3I9V 9;  3PW0 A;  3MMC B;  1YX2 A;  2QGF B;  3DLG A;  2Y3Y A;  2HVI A;  2K1R B;  1FXD A;  4EK2 A;  1ZPW X;  3RR8 A;  4QIV A;  2J6U A;  2BE2 B;  5D3G B;  4ZIT A;  2HVD A;  3D6M B;  3MM6 B;  5DDO C;  1VC5 A;  2YH0 A;  1HNI B;  3MEG A;  1Q0N A;  1C4A A;  2FVC A;  3LQV A;  4RX6 A;  4X62 J;  2OPR A;  2ZUA A;  3B6B A;  2CKW A;  1FER A;  4B9U A;  3V6J A;  1UJ5 A;  2CQI A;  3EPG A;  5I42 B;  3UNG C;  2HNZ A;  4RNO A;  2X1B A;  2VPZ B;  3CCE S;  3QLH A;  2DNR A;  2OGU A;  4DPX A;  4MJK A;  2DHS A;  4OV1 A;  4NWB A;  3UE2 A;  2FLL A;  3A4T A;  1CJT A;  3M30 B;  2M8H A;  5LSL A;  4TQS A;  4X66 J;  3M6X A;  3PYF A;  2RRA A;  3PHT A;  2D3U A;  2Z4P A;  4ZKA A;  1IBC B;  2XZW A;  3W2W A;  3M2U B;  5MAO A;  1WTF A;  4RUA A;  2GIQ A;  1NK0 A;  3VAG A;  2BZ2 A;  4K5S A;  1KSP A;  3I4H X;  5LMU J;  1EB0 A;  1HFE L;  2MQL A;  1PBA A;  3PX0 A;  4ID5 A;  3FZ2 A;  2HKE A;  3J7Z T;  1P27 B;  1E6V A;  3L09 A;  3J7Y U;  1KTV A;  4QIG A;  3BO3 A;  3DKD A;  2XS7 A;  2JLE A;  1I1G A;  1TKT A;  3BDP A;  3RBD A;  5EWF A;  1IKY A;  1S6Q A;  2KU7 A;  1B0P A;  3A8I A;  4UOC A;  5M2R A;  1Q8B A;  3D5M A;  1N5Q A;  3FVY A;  3PFO A;  2VZ9 A;  4LF1 A;  5CYQ A;  1HD1 A;  1SL1 A;  1TL3 A;  3CO0 P;  2BE9 B;  3HFK A;  5D8H B;  4A4J A;  3ILI A;  4DQQ A;  4X4P A;  2ZE2 A;  2CJ9 A;  1SL0 A;  3C6U A;  1S48 A;  4RW8 B;  3AOB A;  3J81 U;  4FYX B;  1FEE A;  5AXM A;  2EFP A;  3RTV A;  1NJX A;  1RT3 A;  3GII A;  2VA2 A;  2V8G A;  1ZZN A;  3OR1 B;  5L9X A;  3CTR A;  3GP9 A;  3SSR A;  4EBE A;  2RSQ A;  1PSD A;  2DHX A;  4Y2K A;  1W26 A;  1HAR A;  4CZC A;  1M5S A;  3CDE A;  2NUU G;  4CI0 B;  2R7V A;  2YQ0 A;  1YZ7 A;  3GG1 A;  4J9L A;  2HHU A;  2IBK A;  4USM A;  3ZZO A;  1NCL A;  1S1X B;  3T1H J;  1WEY A;  3C6T B;  3MM7 B;  5K14 A;  1NKC A;  2ASL A;  4AXI A;  2E1P A;  1FJG F;  1GK8 A;  2AJ4 A;  1WI6 A;  2RRB A;  1WHY A;  4RW4 B;  1VI7 A;  3TAQ A;  1LXN A;  2P9C A;  4CO2 A;  1XNQ F;  4NZ0 A;  5G4D A;  4GVB A;  4X4T A;  3D9B A;  4LVO P;  3OTC A;  1S77 D;  3I5C A;  4LRD A;  4M5J A;  2PSZ A;  3I0R B;  2RIJ A;  3QWU A;  2QA1 A;  3ULH A;  4P7T A;  2W2O P;  2VDH A;  3BV8 A;  4PWD B;  3NL0 A;  2WVF A;  4LRA A;  2MYF A;  4I69 A;  3C16 A;  3HHL D;  4ERD A;  1KVK A;  1U1L A;  2MJN A;  4C2M A;  3E01 B;  5A8K A;  4OYM A;  4EZ6 A;  3DRY A;  4YS2 A;  2Y1I A;  2VF3 A;  1VK3 A;  4ZIV A;  1DAX A;  4C11 B;  2BM1 A;  1ZAW A;  3OTO F;  3QSI A;  4TLQ A;  4KY3 A;  1Y5N B;  1KBR A;  2F4V J;  3MPD A;  1LEO A;  1QUV A;  1MW7 A;  1IBK J;  2KHC A;  2V50 A;  2V8H A;  4KGZ B;  3CJ0 A;  3PO5 A;  2HHW A;  1UW9 A;  5KG7 A;  3B78 A;  6AT1 B;  2VG6 B;  5DG8 A;  3OJS A;  4LSN A;  3NGS A;  3M32 A;  2D9O A;  2OLW A;  1URN A;  2GIF A;  3T19 A;  4YB1 P;  4PG4 A;  2GJI A;  4G6V B;  3HJF A;  4NXN F;  3EX7 B;  2WVD A;  4KB7 A;  4YB6 A;  1P1L A;  4OYB A;  3D68 A;  1TP7 A;  4X62 F;  1TKD A;  3ZTS A;  3H2L A;  2GFF A;  1VQM S;  2V63 A;  1HD0 A;  5FJ4 A;  3BSC A;  3HHE A;  2XG8 A;  3JSM B;  4W92 B;  5A2Q Y;  3RB6 A;  3RJM B;  3CJK A;  2WCX A;  4X4O A;  3RR7 A;  5F41 A;  2R4F A;  1QAY A;  2DPJ A;  3KHH A;  2NPI A;  2MQN A;  2AP6 A;  2OKQ A;  2BKP A;  2VBY A;  3DOK B;  4RW6 A;  3CJQ A;  4J5O A;  4X66 F;  2GGP A;  2B8P A;  1PBU A;  4WF9 Q;  3HT0 A;  1HW8 A;  4MIA A;  2VV5 A;  2V4J A;  2KT5 A;  4ILR A;  1T02 A;  3BN4 A;  3FBF A;  5C25 A;  1IKX A;  4Y65 A;  1S59 A;  5LMU F;  2ZWP A;  4NLO A;  3D67 A;  1WNE A;  4DV6 J;  1SC6 A;  4K7Q A;  3S8S A;  1K0V A;  4ZCL A;  2FGC A;  1LWC A;  3MHY A;  5ETK A;  5DQH A;  5KOX A;  5LXY A;  2RJZ A;  4CH1 A;  3BPS P;  2JX2 A;  2QSW A;  4HL9 A;  2BEF A;  2W8K A;  3IM8 A;  3NBP A;  3LWL A;  2C3Y A;  1HQU B;  3QO9 B;  3OPK A;  4DZD A;  4DL3 A;  2CVE A;  3L95 X;  3LP0 B;  4YY3 F;  2BUN A;  2OI2 A;  2VKR A;  3KHL A;  2VFU A;  1L5U A;  4Q2L A;  1JX4 A;  4C3L A;  1CS4 A;  4M5H A;  5U47 A;  4NCB A;  4WFN Q;  3UD3 P;  3CCL S;  1UWA A;  2HQC A;  3WIU A;  4WZQ A;  1SC3 B;  2C2E A;  1N34 J;  2OFG X;  2ASJ A;  4M5L A;  3W64 A;  1RT5 A;  4CO1 A;  2UXB J;  2J6T A;  2FLP A;  2ZZT A;  2YBV A;  2HFV A;  4U7U K;  3KFW X;  5JMN A;  4XDD A;  4AL6 A;  5IT4 A;  1U25 A;  5E7O B;  2SXL A;  4HLB A;  3T1H F;  2YWF A;  2OP5 A;  4UZC A;  1UVN A;  2EG1 A;  1X4H A;  2QMW A;  5L1L A;  2AF6 A;  3WZ0 A;  1VQK S;  1FRI A;  4M5N A;  4USI A;  3JSB A;  1SXL A;  1RUS A;  3IMQ J;  7FD1 A;  1IR0 A;  1U1O A;  3BQ2 A;  1S9E B;  2RUG A;  4A8X A;  2LDI A;  4F4Y A;  3VZH A;  3DM2 B;  3MF5 A;  1QSL A;  4ZP9 A;  1TL1 B;  3OVS A;  1TK0 A;  3ZTP A;  1LW0 B;  4F67 A;  2XLI A;  1DAR A;  3G2X A;  1NH8 A;  2DH7 A;  5L1I A;  2ZJP Q;  4M5G A;  2KG1 A;  3IAM 9;  4MYT A;  3Q22 A;  2UUA F;  3FK4 A;  3T6J A;  1XNR F;  1KC8 T;  4ED1 A;  1IBL J;  3QWP A;  5C24 B;  3M8P B;  3HSD A;  4D3G A;  4DCO B;  2F4V F;  1SJ3 P;  1T9V A;  3D0H E;  1T03 A;  2Q66 A;  5ETO A;  5FDL B;  3S7R A;  4ZVO B;  3FMW A;  3NNA A;  3JYT A;  3CCV S;  3UR3 C;  1LWX A;  5KT7 A;  1C0U B;  4UUX A;  1FFS B;  1VQ5 S;  4LUB A;  3R5J B;  4DUZ F;  3H2U B;  1T9Y A;  1QVF R;  3DLK A;  2FDN A;  4ZPW R;  5E3Q A;  2JJ4 D;  1D0E A;  3M8Q B;  4ALZ A;  4LF2 A;  1E6Y A;  1S1T B;  2LA6 A;  1H74 A;  4AXJ A;  1S97 A;  4ID8 A;  3PXG a;  1X5O A;  5B7W A;  5KFI A;  2NXE A;  2KXF A;  3LAM A;  4EMD A;  1VBZ A;  2RVJ A;  3L7O A;  5LSR A;  3NCR A;  2DHA A;  2HND B;  1NBE B;  3Q86 A;  1FKO B;  2YY3 A;  3OQ2 A;  3QAT A;  4I6W A;  2CPY A;  4CYU B;  4PQU A;  1IWG A;  1HMV B;  2Y8Y A;  2A0F B;  3ZZU A;  1X8D A;  5J2Q A;  4CLZ A;  1S9G A;  1BGX T;  3BPD A;  2QEX S;  2MZQ A;  2OUG A;  4TY8 A;  2ZHA A;  4DSL A;  1FX4 A;  1DTT B;  3NLC A;  3M6U A;  5KFW A;  1RT2 B;  2RDD A;  3ZZZ A;  3NMA A;  4K4Z A;  2ZH6 A;  2CJA A;  1C1B A;  3CDA A;  4DV6 F;  5KG2 A;  3FUY A;  4MKY A;  2B56 A;  5L8R C;  4DL4 A;  2VG7 B;  1ICE B;  4RW7 A;  5GAE I;  2ROP A;  5CYM B;  2VFR A;  1RYR A;  1H3D A;  2BJE A;  3C3L A;  5AE1 A;  1YRU A;  2ROE A;  1YWX A;  1ZM3 A;  5HMW A;  4DPY A;  4DV5 J;  1NME B;  3RW6 A;  4ANE A;  3T5H A;  3NWR A;  4ZPT R;  4BCA A;  2WW4 A;  5J1E A;  5E2Q A;  1RTD A;  2BQ3 A;  1XK8 A;  4DPO A;  3D4J A;  1VLY A;  5HO4 A;  2V34 A;  2YWE A;  4EO6 A;  4K4U A;  1FI4 A;  3CWJ A;  3LO3 A;  1REV B;  4IOB A;  1DRZ A;  4LVN P;  1FES A;  4H4M B;  4PKD B;  4OFZ A;  3D3B J;  1PJ7 A;  2VFT A;  2LXU A;  3ONQ A;  3POT B;  2R2R A;  2IJN A;  5H9F J;  3IWL A;  2BJD A;  1N34 F;  2N7C A;  1JXV A;  3T3F A;  2EW9 A;  1WOS A;  2H51 B;  1X9M A;  3BBB A;  4I2Q A;  5G0R B;  4O3P A;  5E41 A;  2RNE A;  1ZA2 B;  2UXB F;  2DIS A;  1R0A B;  1HWL A;  1P9Q C;  2LQB A;  5LOQ A;  3DGV A;  4OQJ A;  3MAA A;  3E51 A;  3DLB A;  4QR0 A;  2KXH A;  1CJV B;  1RTJ B;  4RKU C;  2VQF F;  5J2M A;  3WIV A;  4W98 A;  2LMI A;  4JV5 F;  1D1U A;  5FD1 A;  2CNK B;  1TMJ A;  1T05 A;  3PFE A;  2JSX A;  3ENW A;  2G2O A;  2ZH2 A;  4Q8E A;  1L3S A;  1HQ2 A;  2L08 A;  3EDR B;  4C8Z A;  4ANC A;  5B0D A;  1HWI A;  3UVJ B;  2VQE F;  1O0P A;  3KK3 B;  2MZ1 A;  5IV4 A;  3DI6 B;  1PAU B;  4FF1 A;  3QSY B;  3TVZ A;  4OZJ A;  2R8J A;  1KTQ A;  2CAD A;  3CJ2 A;  4RW9 A;  3RW7 A;  3NWG A;  1HQE A;  1XMB A;  4FXV A;  3IGV A;  3A8E A;  2D3O 1;  1S7H A;  2GJ2 A;  4DL5 A;  2YNH A;  1RE1 B;  5K8N A;  4FNI A;  3DYA B;  2AZ3 A;  1TR0 A;  3D0G E;  3SV3 A;  2QN6 B;  1DBD A;  1ZTW A;  3PYE A;  3B54 A;  3TUP A;  2HEK A;  3MEC B;  1EQM A;  2OFH X;  3HFZ B;  5ETN A;  1ZPV A;  1YLX A;  2PA3 A;  4JI6 J;  2DNZ A;  2AGP A;  1TUW A;  2ZJR Q;  3G4S S;  2MLX A;  4QU6 A;  1RTZ A;  1UWB B;  1VC6 A;  1SKW A;  2JC1 A;  2AIR B;  3SCK E;  3VV2 B;  3VR1 A;  3LPY A;  4CNY A;  2HAF A;  2FHJ D;  4YR0 A;  2WRM A;  3VAM A;  4CO5 A;  1NM2 A;  3LH2 S;  3Q83 A;  2MKH A;  1S6O A;  2C28 A;  3MM5 A;  1G4C A;  3ITH B;  3PNI A;  1K1S A;  2XO6 A;  2HZV A;  1U4B A;  4PAA A;  1QSY A;  3CO9 A;  2H4Y B;  2XM3 A;  1LKZ A;  2L3M A;  3DRR B;  5B0C A;  4Y0F A;  4KV8 B;  3OR2 A;  3ISZ A;  2BM0 A;  4HTJ A;  1TAU A;  2BAB A;  4X4Q A;  2QL5 B;  5EWE A;  3VVU A;  3TI0 A;  2K7K A;  3PTW A;  1FF2 A;  4LF4 F;  2VD3 A;  4OI4 A;  1QJH A;  4USU A;  3DRX A;  3MXH P;  5CHC B;  4NLD A;  2YKN A;  1T8E A;  2CJQ A;  2QLJ B;  4HH0 A;  2N4D A;  3EGN A;  2KRB A;  2KO1 A;  3PEJ A;  4A8F A;  4GMK A;  3CXC R;  3DLE A;  3KDO A;  3TJ9 A;  1RU1 A;  4Q0B A;  1IR1 A;  3P4U B;  1RAD B;  5DDP C;  2FC9 A;  3EPI A;  3BGR A;  1U47 A;  5AXN A;  3FKB A;  1VHI A;  2DH9 A;  4NML A;  3VQS A;  2NSC A;  4F3O A;  3OSP A;  1U8S A;  2JLG A;  1OSC A;  2CQ0 A;  4GKK J;  2ALY B;  1RAH B;  2IHR 1;  3LGM A;  1H72 C;  5L1K A;  1HWK A;  2IJR A;  1NJZ A;  4FVM A;  2W9B B;  2KTQ A;  4WXO A;  2JOQ A;  2FLN A;  1K73 T;  3FEY B;  4OJG A;  1U1P A;  1FK9 A;  1XWL A;  3P6Y C;  3EWG A;  1R89 A;  1MN7 A;  3G96 A;  1JMT A;  2M3D A;  4Z2X A;  4NRU A;  1VK8 A;  2EEY A;  2J8A A;  4PPD A;  3K2Y A;  3L7U A;  4F8R A;  1J5E F;  2E7V A;  2XMT A;  1K9M T;  4X4V A;  2A6O A;  4C0H A;  2N82 B;  2RS8 A;  5KT5 A;  1RWU A;  3FMB A;  4M5M A;  1RHQ B;  2AEJ A;  2CPZ A;  4JI5 J;  2JEF A;  1K8A T;  3IM9 A;  2O67 A;  4ED5 A;  1QE1 A;  3CCU S;  1HBU A;  4DUY J;  2J9C A;  1U0H A;  3DRP B;  1ZH5 A;  4RNN A;  2E1M C;  4A8S A;  2W2P P;  1VS3 A;  2ZWO A;  1RYS A; 
#chains in the Genus database with same CATH homology
 3EVO A;  3G2X A;  4DZ6 A;  5CAA A;  1HLW A;  2BX6 A;  1PAE X;  3Q8U A;  3PRV A;  3ZTR A;  3Q83 A;  3Q8Y A;  5BXI A;  5IOL A;  1NPK A;  1NUE A;  3NGS A;  1EHW A;  4DI6 A;  4C6A A;  3FC9 A;  3EMT A;  1HIY A;  1NDP A;  1NDC A;  1BHN A;  1U8W A;  4O0N A;  3FBE A;  1NSP A;  2BEF A;  4ENO A;  2HUR A;  1MN9 A;  4UOG A;  2CWK A;  1BE4 A;  3VGT A;  1VYA A;  2DXD A;  3VVU A;  4UOH A;  5C7P A;  3ZTS A;  3JS9 A;  1PKU A;  4FKX A;  3Q8V A;  1XIQ A;  2DXE A;  3ENA A;  3EVM A;  2B8Q A;  3FCW A;  4KPC A;  1WKK A;  2DY9 A;  1B99 A;  1F3F A;  4S0M A;  1UCN A;  3NGU A;  2AZ3 A;  1JXV A;  1ZS6 A;  3FBC A;  3PJ9 A;  3BBB A;  3BBF A;  1MN7 A;  3GP9 A;  1NSK L;  1XQI A;  1LWX A;  3VGU A;  1NDK A;  3VVT A;  4UOF A;  5CAB A;  2DYA A;  1NB2 A;  3ZTO A;  3B54 A;  4F4A A;  1K44 A;  4HR2 A;  2HVE A;  3L7U A;  4DUT A;  1B4S A;  3BH7 B;  1NHK L;  4F36 A;  3NGT A;  3WX8 A;  4FKY A;  4EK2 A;  1NSQ A;  4W98 A;  3Q89 A;  3EM1 A;  4CP5 A;  2AZ1 A;  3VGV A;  3DKD A;  2HVD A;  1F6T A;  3EE3 A;  3EIC A;  2VU5 A;  1NCL A;  3ELH A;  3ETM A;  3FCV A;  3GPA A;  1S5Z A;  1NLK L;  2B8P A;  3MPD A;  4AND A;  1LEO A;  3FKB A;  1WKJ A;  3ZTP A;  1KDN A;  2NCK L;  3EVW A;  1NDL A;  3FBB A;  2ZUA A;  1W7W A;  3VGS A;  3B6B A;  3NGR A;  3DDI A;  3R9L A;  1WKL A;  3EJM A;  3FBF A;  4ANC A;  3BH6 B;  3ZTQ A;  4ANE A;  3Q86 A;  1BUX A;  4WBF A;  1S57 A;  3BBC A;  1HHQ A;  2DXF A;  1S59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...