3BBCA

Crystal structure of r88a mutant of the nm23-h2 transcription factor
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
151
structure length
151
Chain Sequence
ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGAVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase B
publication title NM23-H2 may play an indirect role in transcriptional activation of c-myc gene expression but does not cleave the nuclease hypersensitive element III1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 47
structure length 151
sequence length 151
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3bbcA00
1NHKL 3FBCA 1LEOA 1W7WA 1ZS6A 4ANEA 1EHWA 3ZTQA 3EJMA 4ANCA 4FKXA 1NLKL 2NCKL 4KPCA 1MN7A 2ZUAA 1F3FA 1F6TA 4F36A 1B4SA 2VU5A 1HLWA 3ELHA 1NSQA 1S59A 1KDNA 3B6BA 3EMTA 3Q8YA 3B54A 1PAEX 4DUTA 1NSKL 1S5ZA 5CABA 1NDLA 2DYAA 4UOGA 3JS9A 2DXEA 3Q83A 5IOLA 2DXDA 1NDKA 3BBFA 3DDIA 1WKJA 3VGSA 3PJ9A 3FCWA 2DY9A 4S0MA 2DXFA 3FCVA 4CP5A 4EK2A 4ENOA 1NUEA 3VVUA 3WX8A 4F4AA 1HIYA 4UOHA 1PKUA 3Q89A 3G2XA 4HR2A 2HVDA 3ZTOA 3Q8VA 5BXIA 1VYAA 4WBFA 3FKBA 3VGVA 1BE4A 1B99A 3DKDA 4DZ6A 1NCLA 3GPAA 1XQIA 2BEFA 3MPDA 1JXVA 3ENAA 3R9LA 4C6AA 3EVMA 3FBBA 3NGTA 2CWKA 2HURA 1NSPA 3ZTPA 1NDCA 4O0NA 3GP9A 3EM1A 1NPKA 3Q8UA 3NGSA 3BH7B 3BBBA 3VGUA 3ZTRA 3NGUA 2AZ1A 3FBFA 5C7PA 3Q86A 3EVWA 2AZ3A 2HVEA 1NDPA 2BX6A 3L7UA 1NB2A 3PRVA 1WKKA 1UCNA 1U8WA 2B8QA 2B8PA 3EICA 3ETMA 3FC9A 3VGTA 3ZTSA 1BUXA 1MN9A 5CAAA 3VVTA 1WKLA 3BH6B 4W98A 1K44A 4DI6A 4FKYA 1LWXA 3EE3A 1HHQA 1XIQA 4UOFA 3FBEA 1S57A 3EVOA 3BBCA 4ANDA 1BHNA 3NGRA
chains in the Genus database with same CATH superfamily
3O5TB 2YKOA 4RBVA 3MUMP 4KE5A 1HNXJ 4K0KJ 3CO9A 1SL0A 1RWNB 2X1BA 3C66A 5I3UA 2KH9A 2SXLA 3RUBL 3ITHA 1GMWA 3A4TA 4NCGA 2V9WA 1SCJB 2DR7A 5KFGA 4O0IA 2PE8A 3UCUP 3QAUA 4LRDA 1GXUA 2OPRA 4CYUB 4DPTA 1RAHB 4ES2A 5CQGA 4KPYA 2RMLA 2Y3YA 2QLBB 4LR9A 3K8VA 1YBTA 1EX8A 2L9NA 4PKDB 3BKTA 5A2QU 4W4MA 2VFSA 3R5DA 5D3GB 1YJ7A 3GYGA 3UN2A 1FFWB 3CMES 4CLKA 4A8XA 2XI3A 1UWAA 5L46A 1CULB 5DS7A 5HO4A 1TAQA 2EW9A 3J80U 3SCIE 2HHQA 3P96A 1QVFR 3T9NA 2QSWA 1WEZA 1MWQA 4B02A 4Q2LA 3EPGA 2KU7A 4J9RA 2GQQA 1Y3JA 3AT1B 2FHJA 4CLZA 2XLJA 3SIPB 4QZVB 1C0UA 2QIFA 4OHVA 3FCVA 2QA4G 4ZDNA 2O5DA 1UVKA 1Z4UA 1NJIT 3L3CA 4O23A 2QA4S 1S6PA 1X4EA 1H38A 3D3CJ 4QR2A 3FUYA 3IWLA 3CMQA 2HK3A 5HBMB 2RRNA 3OTEA 2DT9A 2RJZA 4JI2J 4RNNA 3MWBA 4WJBA 5C42A 4LT6A 2QV6A 3CJ4A 3M2UB 4DSKA 4QWAA 5JXSA 1R27B 2DO4A 3EDQB 4NXNF 3OTDA 1HNXF 3M1VA 2VPXB 3PX6A 1U2CA 1FDDA 4M1KA 4K0KF 3CD7A 2BRKA 4WZQA 1OIAA 2MMYA 4ED1A 2CQCA 4LRCA 4Q0BA 3X1LB 1V3RA 4ZCLA 3QLHA 4K2JA 2E7VA 1VCTA 4ZLJA 3CCRS 1RBLA 3NG8A 4AD6A 1IKYB 1NEEA 4KHPJ 2QMWA 3DMJA 1JKHB 1T9YA 1C1BB 1VYAA 1DARA 1DFDA 2V8VA 4I6AA 4F67A 6FDRA 4H4KA 2FUG9 1IBMF 2A1BA 3VZIA 2AIRB 1E6YB 2KXFA 2M52A 1FFGB 3KUGA 3BREA 4F7VA 1VBKA 5ADZA 3LH2S 2GC8A 2AZ1A 1RZMA 2RE1A 3DLJA 4IG0A 1FHTA 1LFWA 2W7PA 1Z2ZA 2HVHA 4JI7F 1IBLF 2XMJA 3CJSA 4L73A 1RTDA 2RNEA 1FX2A 5H9FK 1RT3B 4B9TA 1W7WA 4F25A 2B6AA 1UAWA 3BGUA 4N8NA 5D4LA 4QR0A 1RAAB 1JLCB 3CJ8A 5JVHQ 2OKQA 4DCOB 3OXFA 4F4ZA 1L3KA 4C0OC 3T5HA 2B4OA 1QD1A 1TUGB 4F2SA 3HJVA 4NCGB 2DNPA 2WB1D 3BO4A 8AT1B 3KKFA 4PWWA 3ZZPA 5B0BA 5HQMA 4IFVB 1H6KX 2E7XA 4DV4J 2KM8C 1UW4A 2I2YA 2MEWA 2MTLA 4NYOA 5EWFA 3D6HB 4AXJA 4KH0B 1AUSL 4RNOA 2UXDJ 4DU8A 4BC9A 1KD1T 2E9ZA 3VGTA 2B8PA 2P9GA 4OI1A 3THPA 1GMUA 2PC6A 4CO2A 4HYKA 2QLJB 3TJAA 4DR1F 1PSDA 4CWBA 5F8HA 2JC1A 3CJ2A 3K17A 3UVJA 1Q5YA 4B08A 3JSYA 2K7KA 3HFZB 1SV5A 4KHPF 1ZM4A 3RB0A 1F5BA 2RU9A 1Z2LA 4YDXA 3QATA 1X5TA 2V2VA 2FVSA 4DR5J 1C0UB 1JLEB 4TVAB 4MKBA 1B0PA 1UWBA 2WVBA 5SUHA 3ZTOA 1U1KA 2NUUG 1F5AA 2L48A 4LRBA 3TOQA 4GKJF 2NXUA 1AB8A 1I5OB 3KJVA 5G0RA 4F4KA 2OGUA 2RU3A 2E7WA 3G6VA 2AQ4A 3W2WA 1NDPA 3MM6A 1HR0J 1FK9A 1HWIA 2BQRA 2W24A 3MR7A 2ZFHA 3DN9A 3ONQA 5C42B 4DV6J 5DM6Q 4BWMA 1K44A 4CM2A 2YTCA 4ELUA 1FX4A 3UDVA 4C0BA 1FWLA 1TL1A 2KHDA 4I6YA 1JLAA 3NAIA 3MCMA 1CJTA 2UXBJ 5A2QY 2B5JA 1VRUB 2DR6A 2GJIA 1VK3A 3KHRA 2YWFA 1N5VA 4ED8A 1GTEA 3I56S 3QLHB 4WU3A 4S0MA 2XULA 2LU2A 3J80Y 4ECSA 5CZVA 2KN4A 2YKAA 4DV4F 5F8GA 3ZZUA 1TAUA 4ZKAA 3SZ2A 3LGMA 3ZZZA 3B82A 1FVQA 5CYQA 3FSYA 4IH7A 4EWTA 2I9SA 1UEVA 4F3MA 3FBBA 3EZ5A 4IRCA 3G82A 2ASLA 5JMNA 4I2PB 3MUVP 2CJXB 1NJWA 4ZVUB 2R8HA 1LW0A 2MQ8A 4X4NA 3RBXA 1Q1KA 2ZHOA 1NB2A 2V4JA 1U8WA 4YR0A 4FXVA 4IG0B 3TA2A 1Y3KA 1NKEA 4FF1A 2EEYA 1Y5LB 2CIMA 2PMWA 4UTGA 1IQZA 1U45A 2XMMA 1RTDB 4O3RA 4X62J 3EJMA 2HFNA 2B6AB 4DR5F 3RRHA 2EFPA 2VFVA 2VH7A 2XGQA 2IYIA 3CW2C 5JUMA 2V69A 2OEKA 2W4CA 4PG5A 1PYOB 2RIJA 1MWYA 4X2BA 4WFZA 2W9BA 2OMOA 2LKZA 2ZH3A 3E01B 5HI7A 2CUYA 4M8LA 4PR6A 1J5EJ 1R0AA 4LMZA 2A2CA 1SC1B 3LP2B 1M0SA 3KDNA 3SQOP 1VI7A 2UUBF 4PEOA 2HFZA 2DPJA 4RW7B 2WONA 4DV6F 2DGQA 1VQKS 4LF7F 1RCOB 3W5XA 2BDPA 3WHIA 5IXUA 2VKZG 4YEAA 3EXCX 2YWEA 4RBTA 4U67Q 4TU7A 5AXNA 4LSNB 2BANB 2PSZA 5E3PA 1Q5VA 2VOPA 3E2EA 2UVWA 2QLWA 1WC3A 3C8YA 4MFBA 4RJVA 2HHXA 3V6KA 3VF0B 3QQCD 4JI5F 3UVJB 1KTVA 2ROPA 1J5OA 5D0RA 5KFLA 1P6TA 3HKZD 4IYQA 2FJWA 4B3MJ 2JDJA 4WFBQ 2FVQA 2NPFA 2B4PA 1XJWB 2V2ZA 1DJ0A 4DS5A 1UFKA 2QA2A 4LF9F 2C42A 2DGVA 3Q23A 2IVFB 2GAGC 4PABA 2M4MA 4CO4A 4DWIA 1XERA 1UTAA 1Q78A 2UU9F 3V5RA 3QWUA 1FKOA 1SUQB 3KTQA 3KJVB 2O01C 3LOUA 1DHMA 1Y0HA 2HVEA 2FIUA 3HHKA 2J8AA 3MCSA 2JL9A 4QR1A 4X62F 1FK9B 3UI3A 3CJTA 4B3OA 2GZOA 4A8SA 1RWVB 1RT1A 2O1PA 3I31A 1GX6A 4ANDA 3KLIB 2AEJA 3NAHA 3D6FB 4PYAA 2G0CA 3PO4A 2A0FB 4O3QA 4C8LA 1CS4A 1JLAB 3CE8A 1OPZA 1CJTB 3D4JA 1RHRB 3NGKA 4DQQA 1U1RA 2V8HA 4Z2XA 2B5JB 2ASJA 3EYZA 3MEDB 3CD6S 4A8YA 2VBXA 1J5EF 1YG0A 3AH6A 3P5BP 1O6XA 5A6WA 2X1GA 4ECUA 3CD5A 3PG9A 4RKUC 5FDLA 1SJ3P 5KFRA 2QSFA 1T94A 3PJWA 5HANA 5BJRA 5HVGA 3TARA 4NXMJ 5CYQB 3HHEA 2ZC3A 2XO6A 5KFCA 2FJBB 3J7A1 2M2BA 3DGPA 1U1MA 2PFDA 4RW8A 1YZ6A 1FEEA 1S79A 1LW0B 2VQFF 2V4JB 1SJ4P 3QSIA 3NLCA 3QRQA 1HWUA 1SJFA 2Y1IA 2BBEA 1RAOA 3NGDA 5KFAA 2WW8A 3FVYA 4IKAA 1LWEB 1VQMS 1BQNA 4B3MF 1YITS 4QU6A 3RRGA 1YRXA 2W2OP 3BM7A 3TEHB 3DLHA 1N33F 5CABA 3SCKE 3V4IA 1RTZA 4F26A 2MZSA 2W9CA 2CZ4A 3CJ3A 1Y00A 4TN2A 3KYLA 4Q44A 3M9OB 2W9BB 3P5TL 2KKHA 2Y8YA 4G65A 1S6QB 3W65A 5IZHA 3FZ2A 3UD4P 3VAJA 1EETA 2DEJA 4HDHA 4ECTA 1T3NA 5C2GA 2MKJA 1R0AB 3ENAA 2PDAA 2CPJA 2IJFA 2GQ2A 3NBPB 3GJQB 2VFTA 3H5UA 4OV6A 2RILA 2M70A 2WONB 2ZBRA 3V6DB 1IXKA 4K4XA 2K3IA 2CJKA 3LW5C 1DLOA 4XO0A 1GXTA 4YS2A 3QT8A 1S6UA 4DDFA 1S1XA 2LEAA 4F0MA 2FY8A 2BJDA 3UR0A 1VJWA 1EP4A 1VQLS 3BGLA 2ATLA 3CJRA 1KWMA 3GV8B 1FI4A 3A8IA 1NLKL 1MN7A 4MFBB 2OTLS 1F9HA 2AF6A 3M8RA 3QNWB 1TMMA 1NSKL 4FYXB 4HT7A 2BOAA 2VD3A 5BR8F 5DGAA 4HEA9 3UDCA 4LBIA 4PYDA 2GMJA 4QIVA 2GO9A 3D68A 3CC2S 3QYYA 4Y2CA 4EUVA 2KRBA 4USJC 4JI3F 1XQIA 2IDEA 1MMDA 4PCQA 1WUUA 4JYAJ 4NYZA 2V34A 4P10A 2PEBA 5M2PA 1N4LA 2KJWA 3FEZA 3Q8UA 3RB4A 2ERRA 3GIJA 5K20B 1TK0A 2FLOA 2GGPB 4FXWA 4KO0A 2HRYA 2F8HA 3ZTSA 3TI0A 4CTAA 3IS9A 4OI2A 1HBNB 3MMJA 3RU0A 4MT1A 1JJ4A 2KYXA 4BBYA 4CNYA 3I82A 5A8WA 4B3OB 3TX0A 1RT1B 4P9SA 4G6VB 2JEIA 4C3MA 4ZP9A 2YXLA 3GSIA 3N6NA 3OV7A 1CS4B 3B6BA 1X5OA 4A8WA 1CPZA 1WNEA 1WEXA 2K7JA 2VPWB 4HI1A 1LQ9A 2HIYA 4WFXA 4N7TA 4JI4J 3MEKA 4D3GA 1HIYA 3H2VE 1PYTA 5L1KA 5FDLB 2KT5A 1RWMB 2KG1A 4DMZA 1CVJA 1IJFB 3NMAA 4RWXA 3FJ2A 4C3LA 2HYIB 2F7VA 3MMCA 1YHQS 4BS2A 3ZTPA 2ZH2A 1H7WA 2RDIA 3TJ8A 3A3NB 2OD6A 4LSZB 1CJKB 5D4NA 4NLVA 5C2CA 1RU2A 3OFFA 5HK4A 3JXOA 4LF6J 2CPYA 2YWKA 2QO3A 2Z2MA 4F4YA 1BLUA 2YNFB 1S99A 3OFGA 4YB5A 3NNHA 4RW4A 1BQNB 3HHLA 2F4VF 1OWXA 2ZJPQ 1PO6A 3GJSB 1S59A 2ZJRQ 1MWZA 3MCOA 2JH3A 2V9KA 4FF3A 2MSSA 3T41A 3MCNA 4WZMA 1CG2A 3SI8A 1M5HA 3ILJA 2W9CB 1UKUA 5AE3A 3IFEA 4HR2A 3JSRA 3RW6A 1NSAA 4WBFA 4CO5A 1TUVA 3LP1A 4U8VA 1EETB 2E29A 1PAUB 3CCUS 2VF3A 1RT6A 1I94J 1H74A 1X4CA 1YSJA 1VQ7S 2ZVSA 3JQMA 4OHXA 4LFAJ 1FRJA 2IJNA 5D15A 1WF1A 2FZCB 2FDNA 3Q8RB 1DLOB 3OBIA 1QVGR 1FDAA 2Z2LA 3H25A 3KMQA 1RGVA 4I69A 2DGTA 3A3OB 5AJ3F 1XIQA 3QPIA 1BQXA 3T6BA 3EGZA 1EP4B 2MZQA 1Z1ZA 5KFJA 4O4RA 4OLOA 5JVGQ 4JI4F 2WVEA 2WVCA 5K8OA 1AYEA 2DGUA 2Y9HA 2FHOB 1JLFA 3SSQA 3AB2B 3CDUA 4QW9A 3M8YA 1IBKF 2BR0A 3KK3B 3UN5A 4CLSA 3C3LA 4O44B 1Y5NB 3ENVA 2KT3A 3OJUA 1NKCA 3J7Z5 3AD7C 1BC6A 2JZ5A 2KJVA 3TZYA 2G0JA 2FQQB 4NLDA 3MAQA 3FBFA 1QSYA 3KXDA 4KO0B 3PHTA 3IS9B 2ZM6F 4UZCA 2R2UA 2L41A 3T1YF 1YGYA 2HFSA 2V4RA 2MZ1A 3UDEA 3FRZA 3G71S 4Y2IA 1F3FA 5A0YA 1X4DA 5IFMA 4WE1A 2DIVA 2AKWB 4IOBA 5L9NA 5BYRA 4C8KA 3TW0A 2JRSA 2CNLB 1I94F 1HW9A 2LCWA 2NXJA 2BM1A 5K8MA 3LGHA 1SIWB 3GR1A 3KLHA 3MR2A 4QBUA 1KLMA 2I5JB 4TY8A 3HDSA 2LEPA 4LVOP 1RJJA 4NEYA 1R89A 4OZNA 2OP5A 3GIMA 3R9LA 1KS2A 3CPWR 3ZZ0A 1HA1A 1NBEB 3MMCB 2Y0SD 4PZVA 1F9EB 3IWXA 3JSBA 4PAAA 3EZUA 3MI7X 2Y0BB 3HX9A 4I2QA 2MB0B 1YWXA 1UVJA 1RT7A 3NY0A 2Z4PA 2QG9B 3DNCA 2I8EA 2PT0A 1APSA 1S57A 2PGCA 4A48A 3ISND 4QJVA 2BJ7A 4DV2F 1GX5A 2N7CA 4OJGA 3MM5A 4NLQA 5HVHA 5J2NA 1MG7A 3ELHA 3OPKA 3HHLB 2B56A 1D1UA 4WP3A 5FLXU 1X0FA 4USKA 3VZHA 4GC6A 2J0QD 5C24A 2J6SA 2XS7A 2C2RA 4NE9C 3V6JA 3TQ1A 1JNRB 4USVA 4Y3CA 4BCAA 3TEGA 2XM3A 1TKDA 1WELA 2C22A 5B0DA 1F2HA 2WSEC 1A9NB 4P2XA 4W92B 1RT6B 5KG1A 1V3SA 4L72B 2LDIA 2HAFA 3DHWC 2YKMA 2MHEA 1SIZA 2H3EB 1UVNA 1QLNA 2B9YA 3PFOA 4K4VA 3OXGA 1OYDA 1QTNB 2ZZTA 2V4QA 2ADCA 4B9NA 3IM8A 3DRRA 2PMHA 1NHKL 4OYMA 4M5HA 4FYVB 1Q8BA 2YPZA 2CQ0A 4ZPTR 4LF1A 2O66A 5DG9A 3JYTA 1WHYA 4JB8B 5GADU 1Q95G 2AW0A 1HW8A 3H90A 2DYAA 1WHVA 4OV1A 4LRFA 1RTIA 1JLFB 1XMOF 1ZOTA 3BO3A 1HQ2A 1DY3A 1U09A 2MQNA 3X3UA 3R7SB 3S7RA 1UP1A 1PBUA 2IVMA 2BKNA 2HGLA 3BN7A 1RADB 3HVAA 1RHUB 3D1QA 5DQIA 4UQTA 4DR7J 5LMUJ 3PIOQ 2ROGA 4LRAA 2FPHX 3V2UC 4UY85 2LLZA 3I5CA 1FRKA 4URGA 5J2MA 4X66J 3SQGA 4EBDA 2QMXA 2W2NP 3BH6B 4CLFA 1G4CA 1I6JA 1M5SA 3J7YU 5ETOA 1X4AA 4NA3A 3HK2A 4OYIA 2V63A 3PYDA 3DLLQ 2VZ9A 1SB6A 2NXCA 3EPIA 3O3LA 3GJTB 2ALYB 2MLZA 2VDIA 5A0YB 1BQMB 2Z56B 1VQPS 1B64A 1RWKB 1U2FA 2JWNA 2W2MP 4QYZK 2DH7A 2HK2A 3OL9A 3DCAA 4UOHA 4N56A 2J76E 3LAMA 1KFSA 2VG6A 1KLMB 4TY8B 4DL3A 2XB2D 5DDRC 2EKYA 2GVDA 2FVPA 4H54A 4C11B 2XHWA 5L38A 4ZJLA 3TX8A 3NL0A 2NYIA 3L4BC 4RU9A 3CCSS 8RUCA 3D6TB 5DDPC 3OTBA 3B78A 4TQSA 1SPBP 1TVRA 1UFWA 2FLLA 1NJXA 3AA9A 4IO1A 3JAMU 3K7RA 2LXUA 4K8RA 3R7NB 2WK4A 2ZNYA 3K5MA 3FMBA 2QFJA 2HW3A 4ZPVR 1KOHA 3RR7A 2EK6A 5ETQA 1K73T 1XR5A 5J2NB 1NDLA 4PWDB 3HT3A 3MEGB 3WDOA 4Z7YA 2VDHA 5E3QA 3EGVA 1PBAA 4ZOSA 2K06A 2X3GA 4FYYB 4DR7F 2JC0A 3F44A 1QAXA 4DPXA 2RAQA 1GH8A 4C98A 1V5IB 2OTJS 4YB7A 2BA9A 2MQQA 4X66F 3PTWA 4OFZA 1SI9A 2HLTA 4DX6A 2BQ3A 3QBCA 4J9UE 3M2VA 4ZS6A 2E1CA 4DR3J 2QE5A 3IC1A 5C7PA 4C8MA 5GADI 1HMVA 2B8QA 2YKMB 5KT3A 1KBRA 3CDBA 1RWWB 2XMVA 2RD5C 3IBWA 2RQCA 3K5PA 4USWA 3CC7S 1E6VA 3OL6A 2F8EX 4UUWA 1T11A 3A12A 3B4MA 2BRLA 4HHJA 2YKQA 4DV0J 4KBIA 3DRRB 3ZTQA 4NLYA 1W2BR 4ER8A 3PXGa 2YNIA 1AZSB 3JYTB 1U1PA 1P1LA 1A7GE 1HWKA 1IKWB 2CPZA 5KOXA 5L1JA 3CC4S 2VBZA 2VJUA 3MEEA 1RTIB 4R8UA 4L75A 5KFMA 2OFHX 3HULA 4DSIA 1LW2B 4M5MA 4KGKA 3GJRB 2H65B 9ATCB 1N0VC 2OLWA 4DFKA 5FLXY 4C6AA 3J7YI 3DRXA 5DM7Q 2HSEB 2JFDA 3Q22A 2R7UA 3MR5A 1P9QC 2W7OA 1JK9B 4KQZA 3DU6A 3IXQA 3KK2B 3N28A 4NPOA 4CLUA 3H5XA 2AU0A 2UV8A 1TL3A 2FHKA 1BWEA 3FZBA 5J2MB 4P72A 1ZAVA 5DLFA 4TY9A 3W1YC 3QO9A 3DFEA 1Y9OA 2XNQA 4ZVEA 1WF0A 1GAOA 3T1HF 1VOMA 1S1TB 3MAHA 4R0EA 2BE2A 2M0GB 2GS8A 1R0CB 4KAIA 4RBUA 2LP4A 3POTA 3RAMA 3QT7A 3ILLA 1XEZA 2CRLA 3FNNA 1WOOA 4KFBA 1H0HB 5IWAJ 3CIMA 3O44A 1QTMA 2X1AA 4RZRA 2ZH7A 3BDPA 3PO5A 5F0WA 4FF2A 4NLTA 4W90B 3WC0A 1TFYA 3MOJB 2OMLA 4RNMA 5L39A 3WIUA 5F9NA 3QRPA 2D3ZA 4DFMA 2VG6B 1S77D 4DR3F 1XTZA 4N8OA 1UFLA 2BJ3A 1CQNA 2MHNA 2MDAA 3T9ZA 2GVDB 4Q43A 4AYBD 2DR5A 2R8KA 3CWJA 2M3DA 4TKTA 1S76D 1MROA 1FJGJ 4O3SA 2VG7A 2W8LA 3RTVA 2L9DA 3IMQJ 4F04B 1HQEA 2M7SA 5U47A 1YJRA 4OQJA 2OEJA 3V6HA 5H9EJ 5DJBA 3RB3A 1KNZA 1TVRB 1PC5A 2QT7A 4J7CA 4X4UA 4MKVA 2K1RA 4JV0A 1HQUA 2DXEA 4N77A 1HYSB 1WKJA 2GAHC 1SC6A 4X4RA 4OJ1A 4C48A 3I0SA 3QAEA 3VHQA 1ZZNA 2KT2A 1R8BA 1OS5A 2LMIA 3CCMS 1NCLA 1NK0A 3MUTP 3OTOF 3OD2A 3PX0A 3R6LB 1CC7A 1K47A 3EVMA 3U02A 2MLXA 3KLVA 3P4UB 1YK9A 1NK5A 1ULRA 4JV5F 1WDDA 3IGVA 2HNDB 4UZBA 1LV5A 4JV2A 2IPOB 4X4SA 4DR6J 3KLFA 5F8IA 1ZTTA 3IO1A 2GW8A 3W60A 2P9EA 3BZQA 3M8ZA 1Y10A 4ZLLA 2AHOB 5KG7A 3VWSA 3C19A 1HWLA 1U1NA 4OX9F 2XSFA 1DBDA 3DRYA 4DL6A 2LA4A 1N36F 1N48A 3R5GA 3EMTA 1ZTWA 3L9ZA 1H72C 2YNIB 2W2PP 4DUTA 2DPIA 4NLXA 4B3TJ 4JI8J 2CZVC 2JLEA 2MZTA 2DY9A 1X4BA 1RI7A 3BN4A 1OMSA 2J9EA 3W2VA 1FJCA 4H4KC 3JAMY 4K4UA 3MEEB 4LBHA 4R8UB 2MQLA 4LSLA 1DQ9A 3IN5A 2G1DA 5E41A 3D0IE 4F02A 4DF4A 4Q45A 4LIRA 4ZA1A 4O4GB 1NXIA 3IRXA 3LTOA 1HBUA 1NO8A 3GWCA 2XYHB 5ETKA 3DC2A 5DQGA 3RJMB 2OHDA 1HPZA 2WBMA 3ZZTA 1YDLA 1S9EA 3QFWA 4B3SF 2G1HA 1R6YA 4OI3A 1SBRA 1UZHA 4CCHA 4LF5J 1RCXB 3QO9B 1WC6A 4C8ZA 2J9CA 3K0JA 1TL7A 2HIQA 3U1NA 4QPTA 2FGOA 2BE2B 5CHCB 1UETA 3JQJA 3C6TA 4NL5A 2RB7A 3ZFVA 4WCEQ 4N41A 3LPEA 2DJWA 2MLYA 5CD4H 2XEXA 4ZVTB 2QRRA 3P49B 1YBUA 1OSCA 2YWWA 1T8EA 4UT4A 1CBKA 2CQ2A 4IQMA 2ZNZA 1CJUB 1SH0A 1VQ6S 4M94A 5E33A 1RE1B 4URQU 4FBTA 3HI9A 1KHWA 2BMBA 5AT1B 1RACB 2HQIA 3C15A 4RPFA 3FK4A 1S1UA 2LA6A 2OPSB 2XZTB 5HL7Q 1F5CA 1RB0A 2G2OA 1R0BG 2K2PA 4YHHF 5KG0A 1MROB 4OL8A 2QL7B 4X4VA 5HQ8A 2VG7B 5J2QA 3AHPA 1JB0C 5D0HA 3VALA 4YR2A 3TAMB 3RBDA 3G87A 3SYZA 2XYPB 1HQEB 1YJNS 2VICA 4EGLA 4YDDB 1VRTB 3BBCA 2K8GA 3BGFA 3W64A 3CCJS 2J6TA 3NGRA 4QW8A 2EXUA 2A6MA 2V0NA 3I9V9 1HWJA 2Z30B 3SBMA 2KM8B 4JI8F 3RBZA 3QGPA 3UDLA 1C0TB 4NLUA 1CJVA 3NRBA 1RTHB 2CPIA 3CDAA 1HQUB 3F56A 3VGSA 2BW2A 3AJ1A 5KFSA 2B43A 1WTBA 1R8CA 2NSCA 3N6LA 3IP0A 1RBAA 3I0SB 2VBYA 2HRUA 5K14A 2E5HA 5D3GA 1VQ9S 3TANA 4ECZA 5EDWA 2BEFA 1DAXA 3EGNA 1CLFA 3TVZA 1CULA 5ETNA 5ETMA 2DHAA 3R2CJ 1T9TA 2EK1A 3MR3A 1SL2A 4LF5F 4KHMA 5KFWA 2N7YA 2AD9A 1YJVA 2CDRB 1XWLA 2RQMA 3PRVA 4M5KA 5K5MA 2LXFA 1KP6A 3KLFB 4ERDA 1LXJA 2JOQA 2BKPA 3D67A 3D66A 2VA3A 2Y1RI 1OO0B 2B0GA 1GEHA 1O51A 2I38A 2CQPA 2ZD1A 4DL5A 3UE2A 3HT0A 1RA6A 2F63A 2W8KA 2RRAA 1ROFA 4DV7F 4YY3F 4X4OA 3JS9A 3E3XA 2DXDA 2DNMA 1P27B 1JLGA 1FXRA 2ZDPA 5KG3A 2GJFA 3U1LA 2KHCA 3U27A 3HO1A 1X9WA 4KSEB 3ETOA 3W2VB 2CQHA 1VLYA 2KDOA 5HBMA 4B9MA 4E8UA 2XHCA 2YNHA 4LSLB 3G6YA 2VA2A 3OXLA 3DRSA 5L1LA 4C8YA 1FCAA 2RSQA 3OL7A 2HBYB 4ITSA 4DLGA 2P5VA 3C6UA 2GCFA 3TA0A 1MW7A 3CTRA 3LAKA 4J9OA 3PNIA 5DQHA 4KY3A 2F65A 2QYCA 3DOKA 4UOFA 3NCPA 4HDGA 5FIIA 1TL7B 1ZS6A 3KG0A 2MY7A 1X31C 3OVAA 1MU2B 1C1BA 1NB7A 3EUNA 4U6PA 1HFEL 2IIHA 3JB9k 2XQCA 4KGVB 1U49A 4KC5A 1R3NA 2C1EB 1J27A 2J6UA 2VUGA 3MR6A 5EGYA 2QL5B 1L3UA 2OIHA 2H5IB 1BE4A 1W26A 2CQBA 3PR4A 4EYIB 1X5SA 2OI2A 4DG1B 2HS4A 2R7VA 3C15B 1NK9A 4ZIWA 1AROP 4H4OB 2ZITA 2MQMA 4PPZA 3NGSA 1RT3A 2AGPA 3M8QA 2AX1A 4XK8C 2W1BA 3P45B 4CLWA 4ZVOB 1TV6A 5HROB 5J2QB 2N4DA 4NXNJ 4BC7A 4W98A 1JLCA 3ULHA 1ZZFA 3ZZYA 3BGRB 3DLEA 3LGNA 2PFFB 4L76A 2ZEJA 4B9LA 1UVMA 3G9CA 3G6ES 2WOMB 4RU2A 3NNCA 4Y2AA 5F3TA 4ANCA 4ZP8A 3Q8PB 2HBRB 2VU5A 3GFXA 5CYMA 1CJVB 3GFHA 4DQRA 5MAOA 3CCZA 3VR1A 2RS2A 4IFVA 1Q79A 3BQ0A 2R7QA 3TYTA 3TUZC 1X5PA 2CJQA 1KVJA 1HBOB 4OYWA 1IBMJ 2KL8A 3L7OA 5K14B 3PEJA 3HJFA 4HTJA 1S9FA 1JQGA 4ZK7M 3T5LA 1NK8A 2M88A 1Q0NA 4DCPB 3HZEA 2DKOB 3UCZP 5HSPA 1RWOB 1FWKA 3CIZA 1EKRA 4RW9A 1RTJB 2HQGA 2FVCA 2J7WA 2WVDA 3Q86A 3EVWA 1BWVA 3GG1A 4USUA 1VQSA 4NLOA 4XTTA 1S6OA 2DGWA 1TKZA 2YWHA 4JI7J 1IBLJ 1U6BA 2NQPA 3AD8C 1HHQA 2C3MA 3SV4A 2JVOA 1RYSA 4FNHA 4DL4A 1YRTA 3KJNB 4O3OA 3ZNUA 1JLEA 2KO1A 2ZWOA 1B0VA 2ZD1B 4FKXA 4RX6A 1RT2A 1ZA2B 4UOGA 2ILYA 3H7HB 4DUYF 1RHMB 1JLGB 3PX4A 2XMUA 1K9MT 4ECVA 2UUAF 2EG2A 4ZPAA 3THTA 4ZLPA 1T9UA 4ELTA 4DR4J 1AT1B 4AL7A 5I3QA 2IJRA 2YNHB 2DO0A 1TFWA 5H9FJ 2A18A 3DRSB 3HSJA 2MYFA 2ILZA 1KEKA 3MM7B 4JOUA 2XI2A 3DXBA 1B7YB 3RW7A 3C6UB 4A8MP 4E98A 4WIIA 5CAAA 2IHR1 3PEHA 1HI1A 4DN0A 1VRUA 2R7RA 1WEYA 2KG0A 4DR1J 2K3KA 3CNQP 1RT5A 4FYWB 4RL1A 3DOKB 1RAJA 3DYAA 4V1Ak 3NXZA 2M9KA 5BYQA 1HNWJ 3PW5A 4USTA 3BQ1A 3AAWB 4Z37A 2ZOMA 4OZ1A 1GMVA 3UCGA 3RBEA 3V81B 2IRUA 4Y2KA 4X64F 3EWGA 4I2PA 3R27A 1K1SA 2PI4A 1DTTA 4MK8A 4UOCA 2DH8A 1N5YA 2V8DA 4JUZA 3Q24A 1PKUA 5FD1A 2VIHA 1VDHA 3N0VA 3KUEA 4GKJJ 4I56A 3MHYA 3HHNB 3DLKA 4ZIVA 2EPIA 4K4YA 3ZZRA 3PDNA 5KOWA 3BSCA 2PO4A 4JI6J 1X7VA 3B8HA 4ECWA 2R7OA 2BW7A 4OI4A 1MNEA 4RO0A 1SKWA 3M8QB 4DXLA 2RDDA 3QRRA 1JXEA 2J9DA 4WKRA 1R8PA 1TV6B 5KFFA 2FB0A 5DDOC 3KHLA 1RXOB 3I87A 2YQ0A 1DTQB 3DLEB 1FRLA 3CGIA 4OZ3A 4WIQA 2HQCA 3NOCA 3TJ9A 4Y65A 1F6TA 3E01A 3AQOA 4WK3A 2DRBA 3F41A 5CYMB 1FF2A 4BDPA 3LP2A 2DR8A 3WIVA 4DR4F 3JTPA 4B3RF 4ZPWR 4RW7A 2FLNA 2HQ3A 2J9DE 4F8RA 2HVDA 1UMJA 4I0WA 1BMQB 3OHBA 1IKXA 5D77A 1OY8A 2F9JA 5D4OA 1KOOA 3ILIA 1C1CA 4LSNA 2BANA 3LWMA 5C25B 4RUBA 4K50A 3HXMA 4RW9B 4K59A 4P2MA 1YKWA 1LWFA 1U02A 1U0HA 1HNWF 3DI6B 4Y0FA 1TKZB 3SSSA 1YX2A 5A6PA 5CCMA 2XTJP 1VK8A 5A8RA 3LALA 2BJ9A 4ZP7A 4ATNA 2W2QP 1WC0A 1JX4A 4F50A 2ZOFA 3HFKA 2CQ4A 4F2RA 2CNKB 2BUNA 4N47A 4DOZA 2CG8A 5GAGU 1RT2B 4DV1J 4DL2A 2EFOA 2DH9A 2UVUA 1SUQA 5HMZA 1M1GA 4WPAA 2W4PA 3QSYB 2GMHA 2MY8A 3G2XA 2OFGX 4KGMA 3PVXA 1JJHA 2RUGA 4JI6F 3MXHP 2D3O1 1QAJA 3D0GE 3JTNA 2UUBJ 2VFRA 3PW0A 1M5VC 4B9UA 4ZVPB 3DGVA 4M63A 4AL6A 3TR5A 1KQGB 4LF7J 4DBQA 3T1AA 5KT2A 2LYVA 2V67A 4NA1A 1NPKA 1JLQA 3KLIA 2VPZB 4WKYA 2MKIA 1A6LA 1NKBA 1UW9A 1EB0A 1D9DA 1N34F 4WF9Q 2MJNA 5CH7B 2YPYA 3MEDA 1M5PC 1I51B 3HHLC 3R7BB 3EDRB 4ZVHA 2ZBPA 2NXEA 1RT5B 3T5KA 5KFZA 4JI5J 3DYAB 4TNOA 2P2CB 3IR7B 5LM7E 4MTPA 2H48B 3R1HA 1IR2A 1PAEX 4OJHA 4WFNQ 3M05A 2W9AA 4LF9J 2RH3A 1RK8A 3PV8A 4J9QA 1DTTB 3OLAA 2UU9J 1N5YB 1KVIA 2CFXA 2PA8D 4XDDA 2BM0A 2D1CA 2V2QA 3DLKB 1DQAA 3H42A 2GX8A 4HH0A 4PQUA 2XNRA 2JLGA 2ALZA 3W5ZA 1OPIA 4DPYA 1KTQA 4J5OA 2PN6A 2JNJA 2R42A 4U7UD 3R3TA 5E0OA 2DRDA 3ZZOA 1WG1A 1LWEA 1L3TA 4GKKF 2MKHA 1S10A 1Q4RA 3RAQA 4WYWA 3VAHA 1EQMA 4LR7A 4A8QA 2Q79A 3DDNA 5A8KB 1JWWA 2XMWA 3QMQA 4ZCMA 4DV1F 3G4SS 2KZMA 3BS9A 2R4FA 1S6QA 3QJLA 2D9OA 2U2FA 1J2VA 1F1BB 1K0VA 3FCHA 2KVIA 5HJYA 4RNHA 3NBPA 3C16B 1M5KC 3K58A 2FD2A 5IM0B 3D5MA 4IO9Q 3KK1A 3V6DA 5KFEA 3D9BA 2UUWA 1VC0A 3NS5A 3MPUB 4DN9A 3M2RB 1IKXB 4OZ5A 1VQNS 1QUVA 4YOEA 4ICLA 2ROEA 2BABA 2BJEA 1NDCA 4H4MA 4NLSA 1C1CB 2GFFA 4QCLA 1PYSB 1WD6A 3IBCB 2VQFJ 2LECA 2XZDB 5AXKA 2C3PA 2HHTA 5GAGI 2QA1A 3ZO7A 4Y34A 1LWFB 1U0HB 5B08A 1IKVA 3AFGA 4NOHA 2Z0GA 2NXNA 4ED3A 5ETTA 1WC5A 5DLGA 5A8RB 4DSJA 4KRWA 2IBOA 4HL9A 1RAFB 3EXYA 1N33J 1HLWA 2A10A 2DK2A 4MAKA 4GO7X 2IA0A 4XPCA 2BOPA 3TNVA 3EX7B 5F3ZA 2MQOA 3AD9C 4EO8A 3TAQA 2FZKB 2R8GA 1O8BA 2M8HA 5GMEA 3TWZA 2YX1A 4DV5F 1TR0A 3QIDA 1XN9A 2DNLA 2GGPA 2XMTA 5IS2A 1T02A 3G8QA 2R9LA 1HBNA 5BYSA 2H4YB 1WI8A 5M2UA 2ZHAA 4IG3B 2HURA 3BKUA 3FQLA 1HNVA 1JLQB 5KFHA 5B0EA 1O5JA 2J0XA 2D7SA 3OR1B 2CPFA 4X65F 1RQ0A 4XPEA 3CULA 1UJ4A 4J9LA 3C14B 2CG4A 3D0HE 4CLPA 4EFAC 3TZZA 3FBEA 5E7OB 3RG6A 3A1YG 3KLEB 2HGMA 3D1OA 4GVLA 4NRUA 5KT6A 4F4XA 3I0RB 2R3VA 4KTQA 3P3DA 5BR8J 3G96A 3BYPA 4ZN3A 4YQWA 2HS3A 2XZWA 4ZHRB 1S48A 1RHQB 3AB4B 4FPIA 5ETSA 2HNZB 3RAXA 3R6GB 2Z2YB 4OI0A 1SJ1A 2DNKA 2ZKTA 3Q89A 4OYPA 4Q5VA 1FTRA 2BXJA 2CPDA 4U96A 4JI3J 4ILLA 3DXSX 3M8WA 5IV3A 5DG7A 4DZ6A 1CJKA 4J9PA 2RF2B 4CO3A 2AMCB 2HS0A 2KI2A 2AJ0A 4QWCA 1CQMA 4PQUB 3CCWA 2BQUA 5AE1A 4IFYA 2RT3A 2YNFA 1SC4B 3D28A 2JEFA 3G6XA 3A3PB 5DDQC 2O3DA 1EQ0A 4ED4A 2BE9B 3M6UA 3K59A 2E5IA 2L3MA 4P75A 4QIFA 2VBWA 2HVIA 3MFHA 3FEXB 1U6FA 3QIPB 1F9FA 5DGBA 9RUBA 3HF5A 4XAKA 4ED7A 3MDFA 4QPXA 3A8JA 4QWEA 2ZH5A 2MGZA 3W5YA 2AGQA 1TTHB 2Q43A 2OPPA 2OSQA 4MH8A 4M95A 4LJMA 2F3JA 1NMEB 1VR6A 3W66A 4A46A 3FCWA 5HP1B 3AJ2A 1U7LA 3RZAA 3PCOB 4M5DB 2Z8QA 2ZH1A 4V19X 3CJKA 3BR8A 1HKAA 3VGVA 3KK1B 1WF2A 3FRYA 1QSSA 2CQDA 1T03A 1P9YA 3T5JA 5LT5A 4LFBJ 2FJEB 2VKRA 3M8PA 3HVTB 4M5IA 2DY1A 4HI2A 4ICLB 4OYBA 2HHHF 1SKRA 4H4MB 4AL5A 3S01A 3OUYA 3NGUA 3N6MA 3MMAB 4OHWA 4DQIA 4WWSA 2UVVA 3CVKA 4FDFA 3DHXA 5DG8A 4TLRA 4NLPA 2BE7D 2LEBA 3D54A 1ZM2A 3Q2SC 3O6QA 5HMYA 1FXDA 3OSPA 1IKVB 1UEKA 3CF5Q 4NI2B 3KFWX 3U1MA 5IT0A 2JHEA 5DETA 1FNMA 4FVCA 2YBVA 2F4VJ 4ANEA 2FLPA 3KK3A 1Q86T 3W7BA 4O44A 3LA0A 1RYRA 4LBPA 2F8MA 3VV2B 1XNRF 4KB7A 1JMTA 4WYLA 2AX0A 4DPWA 2XY6A 3T6JA 2UVRA 2YX4A 4C9DA 2XS5A 1OJ4A 4MKAA 3M30B 4USHA 1TKTA 2GJ2A 1D9FA 4M5GA 4OIXA 1V5VA 1AFJA 3I6PA 5ITHA 3R5AA 1U48A 1FD2A 4NCAA 2V50A 4G1QB 3R2DJ 4NZ0A 4J90A 3SCLE 3GP9A 1DQ8A 1YBAA 1HNVB 2AYGA 1XMQF 2B9WA 4ED2A 3UW1A 1X0PA 3ETMA 2QEXS 1VRQC 1KQSR 1FXLA 1WC1A 3GTYX 2IY5B 2MJUA 2G2ZA 1G1XA 5AJ3J 2M5YA 4G1PA 4CLLA 3PKYA 1VGYA 3N9UC 1BHNA 2D3UA 1XNQJ 3MPVA 3QWPA 3GMGA 4B9SA 4KPCA 3CJ0A 4DQSA 2D3OR 2HKEA 3L7PA 3G8SA 3HCXA 2I5JA 2MZRA 3KG4A 5J1EA 5LOQA 1I1GA 1ELOA 1YIJS 4MJKA 2AEMA 2APOA 1IBKJ 4QOTA 4CQ1A 2BZ2A 1VQ5S 4LFBF 3MMBA 1NHVA 1NNDA 4IRKA 1Q7LB 3S1TA 2B9XA 4I6WA 2HLUA 5IC4B 4CO1A 4CLTA 4ID5A 2HHSA 1G7CB 2OPQA 4WK1A 3GE9A 1BGXT 1M1HA 2WZ1A 5EX0A 4IFYB 4G3IA 2W25A 2JX2A 4A8FA 3HM9A 1PILA 2ZM6J 2FHMA 4AUKA 1JIHA 4CRJA 3T1YJ 3NP5A 2ZC4A 3UPFA 4DI6A 1VLOA 1LWXA 4C0HA 7FD1A 3I55S 1AXQA 5EHHA 5HJXA 1SH3A 1RLCL 1IJEB 2MGZB 4Q8FA 5T14A 2ZZNA 2XLKA 3BPDA 1URNA 4FN5A 1VC6A 2OPPB 1MSWD 1HD1A 1T7PA 1S5ZA 4ZN1A 2QJ3A 2B51A 3PJ9A 4ECRA 2AYEA 2VB6A 3AOCA 3UN3A 4LF2A 4O3PA 1GQEA 4DHVA 1QM9A 2DNZA 2XBPA 3FMWA 3VAMA 4KV8A 3AXMA 4FS2A 4KHRA 3CJKB 4MMOA 1LXNA 3GV5B 4OJ3A 2ACMA 1T03B 2IRXA 2HAIA 3CXCR 2E9RX 3GYXB 5KT7A 3IWNC 3M8PB 3KJFB 5K8PA 4DZDA 3BQ2A 2DTJA 3BBBA 3DOLA 3NCQA 3ZTRA 2DIUA 4QU7A 3OUYB 3MM9A 1ZAWA 3TAPA 2UUCJ 2H1YA 1XNQF 4NRTA 5T41A 2QTWA 4RNFA 4FKYA 4K4SA 2FC9A 4DV2J 4ILMA 2C2NA 3Q2TC 1N52B 2B4UA 1IWAA 5J1PA 2YKPA 4DSFA 2P8IA 1UL3A 3DU5A 1EKSA 3OVSA 2H4WB 2R7XA 4ZVFA 5LL6d 3PYFA 3CJ5A 5F8MA 2KXNB 4DF8A 3PJXA 2W01A 3NWGA 1PJ6A 4ZVSB 5HVFA 1WOPA 2R7WA 4GC7A 3GFZA 4WTOB 1B99A 3D1HA 1TKTB 1JXLA 4CH1A 1WACA 2BYCA 5I3UB 2ZVIA 3R5BA 3N4WA 2Q6BA 4OZJA 2GNKA 2ZE2A 3ITHB 2G13A 2NS1B 1RWUA 2QGFB 5IQQA 4K5SA 1LOUA 1QJHA 4LR8A 5F9LA 4JI2F 3KOAA 5KFVA 2Q1LA 3OHAA 1BQMA 2OPRB 4GMKA 2CQ1A 2C2EA 2WAQD 2HZAA 4YB1P 5EWGA 2EFVA 1MMNA 3K89A 3RYLA 4P52A 3HPOA 1ZA1B 5HMWA 3WX4A 5LSOA 4I68A 2ATCB 2MKKA 1RISA 1Y4ZB 1FE0A 2IM0A 3FDSA 3IR5B 3G86A 5J1EB 2VFUA 2DRAA 3SMZA 3UO0A 1XMOJ 2G9OA 1VQYA 5K9FA 2YKNA 4R25A 4C11A 3N5FA 3VAKA 4FF4A 2ZOGA 3MMBB 4PG7A 2E5GA 1KLNA 5D0EA 4K2XA 1VQOS 2XMKA 3MPDA 4LFCJ 5KFNA 1XC9A 1OYEA 4ZPBA 4NCBA 2ASYA 2UUCF 3H20A 4ID5B 4BWJA 1OQ3A 4I4BA 2OPQB 2CYYA 2DR9A 1Y11A 4WXWA 4DX7A 4P2FA 4R0JA 3Q8QB 2AZ3A 1S6PB 1WKKA 1U1LA 1WWHA 3O1LA 1NH7A 2X7IA 1JLBA 1ZAXA 2BKOA 4KT0C 1D09B 4PWDA 2V94A 1IM4A 2VG5A 4NEZA 1TU0B 3H5YA 3MEGA 3MD3A 1WSVA 2P9CA 5JJBA 1YVFA 4E0DA 2XYGB 1ICEB 5KFDA 2FY1A 3W9JA 1SQEA 4A47A 4LIWA 3PIPQ 1QDUB 2VOOA 1RAIB 1LNQA 2CAJA 4EMDA 5KG5A 1FE4A 1V9OA 1TL4A 3M1VB 2A3JA 2R8IA 2E5JA 2Z2ZA 2HBQB 1RP5A 1ZPVA 3CCES 2ACYA 4DFJA 1AW0A 2EC2A 5IQ6A 3HVWA 3W9HA 4C2MA 1R31A 2IMWP 4KV8B 2OO4A 4Q0BB 1MMLA 4UF4A 2DGXA 4C97A 1NK4A 1SJRA 4GRSA 4NLGA 4NX9A 2V8GA 3C46A 2WCXA 1VIXA 2DHHA 3OTCA 1R7IA 3DMJB 3MF5A 1NAQA 3QFHA 3DOLB 2DNOA 1R43A 5KT5A 3HSGA 2UXDF 3PKMA 1TUWA 1QUPA 4C8OA 1AZSA 1EIYB 3MM9B 4RUHA 3G8TA 4L3KA 2VQEJ 1YQHA 1IKWA 3IAS9 4QYZJ 2E1PA 2U1AA 3CCQS 3EVOA 1KVKA 1JJ2R 2E9TA 3I32A 4WFAQ 2ABYA 2CNOB 1LW2A 3OL8A 3Q0AA 4CLYA 4J37A 2ASDA 5F8NA 2PI5A 3PRBA 1B70B 3NWRA 2WW4A 4U7CA 3K5LA 4LFCF 1C4AA 3VCDA 5AE2A 3KK2A 1N56A 3ZNJ1 1Q81T 1U6ZA 4NA2A 4F4WA 3GONA 4Y6IA 3N5BA 3HLUA 3HHDA 3UWTA 4ED5A 5ETRA 1T05A 1FA0A 2DNHA 1S1TA 2ZE2B 1VBZA 1T0TV 3KDOA 4I7FA 4CIOA 2COLA 4Q8EA 4DX5A 3W62A 4N76A 5KG2A 3QJJA 4C3KA 2RUSA 3M7VA 1HR0F 1F60B 1ITPA 4DSLA 4G1IA 3K5NA 2R2SA 2IM2A 2BJ8A 2C3OA 4KH1B 1GXLA 1BXNA 2HWIA 3M32A 1NSQA 5D78A 2UXBF 5IOLA 1S1VA 2HG4A 4RW6A 1TK8A 1P1TA 4RLEA 4EEYA 2AYMA 2E66A 3K57A 3AA8A 4ZPCA 3FGVA 4PXCA 2YKNB 4RUCA 2EBGA 1NK7A 3W9IA 2YQ3A 1GMWD 1SV5B 2HBZB 2NR0A 3IG1A 3BB5A 3CCVS 2PA3A 4WXOA 1XR7A 2CWKA 1UWBB 2FYXA 4PG8A 2VQEF 4DV3J 3AODA 2J5AA 4WP8A 2XY5A 4QIEA 3EICA 1YJ9S 1N5TA 1IN0A 3T1HJ 2QC3A 4Y2MA 2HEKA 1F3VA 1JLBB 1AUDA 3KUHA 5G0RB 2G2YA 1HYSA 1KR4A 4ED6A 3QT5A 3I4PA 2VG5B 3WQPA 1FEHA 3H8YA 4DUZJ 3W2WB 3AJDA 1EHWA 2Q6CA 1VJQA 3MM6B 2CPHA 4NZ6A 3HD1A 2X3DA 1HHTP 2RHSB 4YP3A 1CEZA 1H3DA 3AOAA 3LO3A 1NDKA 2XCPA 4WU2A 3PFEA 5KFYA 5HAOA 1TL1B 3HKWA 4ECYA 1WDTA 2CQ3A 2FHJD 2HNDA 4NLWA 3LQVA 4MIWA 3KHGA 3KJQB 4NYPA 1Y5IB 3FEYB 2CDQA 4HVZA 2XWXA 4DFPA 4V19J 5B0AA 4M5JA 5F41A 1UZDA 4O0NA 3I96A 4F3OA 1Y7PA 3UQSA 2HHWA 2LFVA 1SVDA 1D8ZA 1RKIA 2EI5A 3E8OA 3H59A 2MSTA 3G82B 5F0UA 2KFYA 3MFIA 3SV3A 4K5RA 1V3ZA 4EBEA 2HGNA 2VC1A 3DDKA 1X4GA 2CZ9A 2YY3A 3J81U 4OHZA 1QY7A 2WTFA 5LMNJ 4GO5X 3F73A 5GMKa 1OSDA 4TU8A 2C2DA 2YH1A 4O4GA 4U95A 5M2RA 4Y00A 4DEZA 4OZLA 2IMOA 2ZDOA 1GT8A 5LXYA 3KHHA 3OTOJ 4ZVQB 2FJVA 2WBRA 4DV3F 4P6QA 2XMAA 2HPUA 3IRWP 4JV5J 1R6VA 5LJ5Y 1R8AA 1T05B 3LPYA 1T9WA 3PYEA 7AT1B 4IOCQ 4I7FB 1TL5A 1QAIA 2R7SA 1IWGA 4DUZF 4ECXA 2Z58B 2H9ZA 1TELA 4KGXB 2KFNA 1H2TZ 1TMJA 2CADA 4OX9J 1HNIA 1PIEA 2GIFA 4CO0A 1N36J 5L8RC 4HH1A 4YUDA 5C5JA 1CJUA 2VONA 4BHQA 1TK5A 1U2RA 2RHQB 4MK7A 4L6V3 1TZ0A 4F0KA 1H2UX 5KFKA 1U24A 3M32B 4EI2A 1RDRA 1XMBA 3R8YA 3BBFA 2C2KB 4A8KA 1S1VB 4RW6B 2AJ1A 2OPSA 4ENOA 1U1OA 3MECA 2QN6B 3H98A 1KKHA 2OELA 3D2WA 1WC4A 1J5OB 1LK7A 2R8JA 3UNYA 1KC8T 2WHOA 1CSJA 3TAMA 5HATA 3R97A 3IG1B 4NXMF 1L3SA 2F9DA 2IM1A 3NCRA 1VRTA 2P6TA 2FJAB 3I5AA 1FRXA 4B3SJ 2MQPA 1C0TA 1H98A 3M9NB 1WI6A 4NZ7A 2R2RA 2NYHA 4QWDA 5DRKA 5DO2A 1RTHA 1WG5A 2IVYA 1FKOB 3TZXA 5K8NA 4ED0A 3M4XA 3H2UB 2YNGA 4DL7A 5MLCV 4ES1A 1IR1A 5LMNF 3CDEA 4ZMMA 3K8WA 2QLXA 2QZ8A 1FESA 3SCJE 1HBMA 4ZVRB 2AYBA 2HMIA 4HHHA 4JP8A 3FSXA 5I42A 4DLEA 1X9SA 1B0TA 2HFUA 5D0GA 4TYAA 2F40A 4EO6A 2R7TA 4USIA 3DLBA 2YVSA 2VPYB 1FD8A 3I4HX 2GIQA 2GO8A 3QGGA 4HHUA 4CM0A 1NSPA 2RRBA 4DX8H 4YHHJ 1RKJA 1BY9A 2B7CB 3CD0A 1S97A 1FNOA 2KTQA 3MPWA 4Q7AA 3GZ7A 3PHEA 1BUXA 2MZJA 4OX6A 5D6GA 4J9KA 2N82B 2DITA 1ACMB 3V4MA 3CCLS 2AJ2A 3DGPB 3MTKA 4RW8B 4N5SA 3EZOA 1QAYA 3OR2A 2VL1A 2ZUAA 5I4MA 2DHGA 1YJUA 5AXLA 1NK6A 2KVQE 3BDEA 2DNRA 1XBWA 3Q83A 3GLJA 3I9ZA 2C2MB 1HARA 1P8GA 5E3RA 3BF4A 1S12A 3GYNA 4NMLA 1UA0A 2EVZA 1B7FA 2B3TB 3VVUA 5IT4A 2AGOA 4EZ9A 3FKBA 3C2PA 3UFCX 3TZWA 4X4QA 3V4IB 4YB6A 1HI0P 1D3WA 2NLWA 3CEDA 1U47A 4JYAF 1ZM9A 3IGNA 2L9WA 3AQPA 4O3NA 3AY0A 7FDRA 3VGUA 4Y28C 5KFXA 5ETVA 2X1FA 3W61A 4HT5A 1MU2A 1LFPA 4DCJB 4LREA 3RGIA 2J7UA 3FQKA 4NWBA 3US5A 5RUBA 3SFUA 5IT9U 2AJ4A 2DNNA 3BV8A 1HNIB 3JSMA 1GFWB 3S8SA 4DV7J 1KRPA 4YY3J 3SFGA 4AXIA 1S1XB 3CT9A 2ZH6A 4DG1A 1T3OA 4OX7A 4KIAA 3HSDA 4CP5A 1TKXA 4H4OA 4U9RA 4QIGA 3MECB 3GFYA 2JSXA 4OI6A 4ETXA 3SEOA 1S0NA 1A0OB 5HROA 3HMJG 2O67A 5THWA 2EKNA 4NLRA 3J81Y 5CCLA 4WFYA 3FFIA 2DBBA 1FKPA 3BGRA 1U26A 4M5NA 2CPEA 2WOMA 4YR3A 3NEKA 4OHYA 5KFPA 2G4BA 3WBZA 2M8DB 3LP0A 1Q16B 1S7HA 4C8NA 1KONA 2VHGA 3LUYA 2RKIA 4IH5A 4LF6F 5E5NA 3VQSA 2P6SA 2YNGB 2J0SD 1S9GA 4LVNP 1F0XA 1HBOA 3BO2A 4CTAB 2DHXA 1NJYA 1ZM3A 5LSLA 3E51A 2DGOA 3O8WA 3BKFA 3ZXWA 3DLGA 1UEUA 2VJVA 2CVEA 5A8WB 3GIIA 2DXFA 1HBMB 1W25A 5T7LA 5D8HB 4P71A 2NUHA 1RTJA 2HMIB 5CZXA 2XWYA 5I42B 1TP7A 4ZVGA 4B9VA 2KZZA 3DKDA 4OYOA 4OZ0A 1G3OA 2VASA 1JNZB 4HKQA 2VV5A 2HQDA 3H2LA 1PCAA 3RRKA 5FJ4A 4F3QA 2XGPA 4LFAF 1Q8KA 2AJFE 2YX7A 4P73A 2GIRA 2A2DA 2LXIA 5KFUA 4I64A 2RQ4A 4DR2J 4ETZA 3OFHA 1S7IA 2DGSA 3MTJA 2E1MC 1LEOA 1S0MA 4PUOA 4PWUA 5CXTA 1Q82T 3OR2B 3BSNA 2HQFA 2Y1JA 2I1RA 1V6HA 5DZ6A 4TYBA 1D8YA 2XSJA 1HHSA 3QGIA 3MM7A 3OFEA 1RLDA 3PACA 4RW4B 1X60A 4IQXA 1VISA 8ATCB 3PW7A 1K8AT 3F0NA 3BSOA 3UR3C 1JXVA 4QYRA 4UW2A 4KKOA 4ZCIA 2UXCJ 5HN0A 2WRMA 4CT9A 1ZBTA 2I6WA 2R2TA 1YLXA 3LP1B 2DCLA 1QSLA 1VS3A 3EGWB 1LWCA 2YH0A 2I0XA 2F4FA 3V81A 1RHKB 3PRDA 3CMAS 2V2KA 2NREA 3SSRA 1VQ8S 2XS2A 3JSMB 3UNGC 4ID8A 1UPMB 4DUYJ 1ZPWX 3GB0A 4MIAA 4KR0B 4RR5A 3DDIA 4CH0S 4AE5A 2YWGA 5G4DA 2UUAJ 1Q53A 4PG6A 3CDWA 1TKXB 4TXSA 2IC3A 3GR0A 2CVIA 2Y8WA 2V68A 1URRA 3OJSA 2IAJA 3IBFB 1EJ7L 2ZH8A 4RUAA 4AQYJ 1SQGA 1T9XA 2NSBA 3CCTA 4DR2F 1DTQA 3FFIB 1FKPB 3QZ8A 3ICLA 3HP6A 2PIIA 1DRZA 3JTOA 2HZCA 1WKLA 2UZAA 1RABB 3LP0B 2EFNA 4WTYA 5HQLA 5L9XA 4CI0B 4CZCA 2PEHA 3KMSA 2OJ3A 1IBCB 3TUJC 3OT9A 2RKIB 5F8JA 3DOMA 5F8LA 2ZWPA 3FBCA 2NZ4A 2C28A 1S9GB 4F36A 1VQ4S 2QX0A 1FRMA 5EWEA 2EG1A 4U8YA 1NM2A 2POKA 5DZ7A 2B9EA 3B54A 2CQGA 5A76A 1UPPA 2MKSA 1QE1A 2IFXA 5KFBA 3DLGB 3OSNA 4X64J 1NH8A 1RAGB 2DB1A 1VHFA 4ZLNA 5C25A 5IT9Y 1VFJA 4F4AA 5T7LB 6AT1B 2HZVA 4QIWD 1M1KT 2UXCF 2D9PA 3CB4A 4K4WA 1S1WA 4WE1B 2N4CA 4P7TA 3M9MB 4X84A 2EWHA 1IVZA 2ZZMA 3DI6A 2N3OA 4HTIA 3NGTA 1SJQA 2CXEA 3P8BB 4EYHB 3QGHA 5I3PA 5B0CA 3PY8A 4Q2MA 2X51A 3UD5A 3KNGA 3KLHB 1X8DA 3ISNC 3SDEA 2AJQA 3FC9A 1S49A 5J1NA 1WTFA 3RB6A 2AEFA 3BEGB 3KG1A 3EE3A 4J9SA 2CJ9A 3L95X 4MYTA 1ZYQA 1FJEB 1R8HA 4PUOB 2CA9A 2G0IA 1B4SA 1KQFB 1D0EA 2C3UA 2VODA 3TP2A 1VBYA 4I2QB 2IYGA 2RVJA 4B3RJ 1RT7B 2MPUA 2GMLA 4X4PA 2XSJB 1WSRA 4E2FB 1WORA 2HWHA 2GQCA 3WX8A 3IA0A 3ILOA 4AQYF 2OAUA 3MM5B 2EC0A 3R5JB 4MK9A 3NOGA 5KTQA 2HRTA 3B4DA 3GSDA 2D69A 1KN6A 3GCXP 5E2QA 3GQCA 5C24B 2FC8A 4KKOB 4OZ2A 2VC0A 3QZ7A 2N3LA 1YI2S 1YJWS 1Q7YT 2XC9A 5LMUF 4L3NA 3MM8A 2PMZD 1HL6A 3GU0A 1IR0A 1FDBA 1WOSA 2C2ZB 2DISA 3VVTA 3M8SA 1ZETA 1S72S 2J7KA 1GK8A 3MOZA 2DNGA 1LWCB 1N54B 1OY9A 4U7UK 2PD1A 1PJ5A 1X9MA 1SC3B 1K0TA 5HMXA 1UVIA 3TUIC 1VHIA 1M5OC 5CYJA 2E5LJ 2LQ9A 1KFDA 3H5SA 2H5EA 2A6OA 2IDLA 4D3HA 2JEGA 2QYGA 3ZC4A 3HHLD 4HLBA 4KJIA 2C3YA 1FFSB 5GAEU 1HNZJ 4FNIA 3VAGA 2AWZA 5IC6B 1SXLA 2IC3B 4P7VA 5IV4A 1N8RT 1S0OA 4JI1J 1REGX 3KLGA 2HWTA 1RU1A 5KG4A 3W63A 4IDKA 2OEMA 3M6WA 5A8KA 2IAJB 4P2SA 3M6VA 1NPRA 2V6AA 6FD1A 2Q3PA 3HSZA 4ELVA 1JJCB 1N34J 1EAYC 3GIKA 3IR6B 5B0GA 4YFUA 4ZITA 4PQAA 4DQPA 4LF4J 3A8KA 4KYZA 4ZP6A 1XK8A 4LQ9A 1CC8A 1N5SA 3OLBA 4MIBA 1VMBA 2GV1A 3VTIA 4X4TA 3W3SA 1NRKA 2XY7A 1FKAF 1U25A 1RAEB 3C16A 2OH2A 1FTCA 1FDNA 3DOMB 5LXRA 5IM0A 2LQJA 4EZ6A 1O0PA 2F5GA 3BR9A 1Q8IA 3BPSP 4MYUA 3SQGB 1C4CA 4LF8J 1T95A 4K4TA 2H5JB 3HVRA 2FJXA 4Z7CA 3M2RA 1IUJA 1QE1B 2V5HG 4JV1A 4J91A 2FZGB 4GVBA 1NUEA 1SKSA 3TVYA 3BSAA 1U0SA 2IRYA 4J9VA 2CWXA 3Q8VA 1VBXA 2RS8A 1S1WB 2Z57B 5CD4A 1FNXH 2ZUGA 2KRRA 3NS6A 3ENQA 1FO1A 1ZH5A 4AFFA 2QL9B 2HFOA 2KFZA 3P6YC 3UD3P 4GKKJ 3NS7B 3BH7B 2LU1A 1U1QA 3L09A 3ET6A 2D41A 5L1IA 3GCWP 1U8SA 2IBKA 3L7UA 1UCNA 3SDEB 3LWLA 4I67A 4CDIA 4DPUA 2QFIA 5KAKA 5ETPA 3GV7B 2E5LF 2NPIA 1B3TA 4PPDA 4OYZA 2J0WA 3KNAA 3PW4A 3TUPA 3NNAA 1RSCA 4DV0F 1HNZF 4OYAA 3CUNA 1KDNA 3DM2A 4FVMA 2D74B 4ALZA 4FPRA 1G6BA 1FWPA 2L08A 2V8PA 4JI1F 4IG3A 2AV5A 4IUFA 4PXBA 4RWWA 3DRPA 4OYXA 3OR1A 3K5OA 2GHPA 1RBOB 2JVRA 4TU9A 1X4HA 1REVA 4OLPA 3J81j 3PW2A 3C14A 1FERA 4LF4F 3KLEA 3BJYA 3ENWA 3ISZA 2CJYB 1N5QA 1WG4A 1N6QA 4OX8A 2UP1A 2FVRA 2EFGA 3MM8B 4TLQA 3I0RA 1PC4A 1EARA 1HI8A 1LKZA 1YJTA 2LQ8A 3MZIA 2MKCA 1UJ6A 2UV8G 2WB4A 3MAAA 5GAEI 1OY6A 2WVFA 4LF8F 4ZHRA 4JI0J 2ZH9A 2MXYA 2E44A 2HNZA 3M2VB 4YN3B 3I5BA 1FRHA 1HMVB 1WJ9A 1U4BA 1FVSA 1FT8A 3ADAC 5GAHU 3OVBA 3BGOP 3IM9A 2RF2A 1E6VB 3GIRA 3CO0P 3VQTA 2DVIA 4UUXA 5IWAF 2HHPA 1T9VA 1SH2A 4DV5J 5CA5A 1FRIA 1M90T 4YMEA 5H9EK 4NMXA 1X4FA 2LDYA 2JEJA 4BLGA 2FTRA 2E1RA 2DEIA 1GTHA 3AXKA 1DZ5A 1LK5A 3KLGB 1L5UA 5H1SV 5KT4A 2BJ1A 2F1FA 4IDKB 2XG8A 4JBCA 3QIPA 4EBCA 3VAFA 4IOAQ 1N88A 4R5PA 2DHSA 5LSRA 1G2EA 5KFQA 1H2VZ 1NPPA 4FBUA 1AFIA 2ZBQA 4X65J 2BX6A 3PYGA 1FJGF 3BYRA 4DS4A 1RUSA 2W4DA 1KSPA 3W8GA 5HLFA 2ZH4A 5B7WA 3H0PA 4B17A 1N0UA 5E3CA 1NJZA 4C7QA 3IAM9 1IQTA 3W8PA 5HP1A 4XIUA 4J9NA 2Q66A 4M5DA 4MKYA 1TL3B 1BD6A 3LF0A 4HACA 4UQGA 2BVZA 1AA1B 1WHWA 2GA7A 3S6EA 2B7BB 1NU4A 5B09A 2KB2A 2CNNB 3SXLA 2IM3A 4ECQA 1RWXB 4KGZB 2DD8S 2AP6A 2OSRA 3D7SB 3HVTA 4TQRA 4NASA 4GVBB 4ZPDA 2CKWA 3POTB 2HHUA 1YTYA 2GVZA 5B0FA 3MMAA 3MGJA 1UA1A 1NHUA 1VIOA 2LVWA 4KFBB 1Q8LA 3PR5B 4DU7A 1YRUA 3GG0A 3J7ZT 4ILRA 3H4DA 4NI2A 2HNYA 5KFTA 2B4VA 3TO8A 3EM1A 3RR8A 2HHVA 1RT4A 3R5CA 4JI0F 1IM6A 1L3VA 3CSKA 3ET6B 2YQ1A 4DR6F 4DPOA 4QQBA 5EX3A 2EBEA 1YZ7A 5J2PA 2FJDB 1RHJB 3KWMA 2C2OB 4ZJOA 4CH7A 3QJPA 4ES3A 3R1LA 3M30A 3AOBA 2E1AA 1EZZB 1H73A 5EUHA 3Q8YA 3Q8SB 3DM2B 1UVLA 4DJBA 2WSFC 1MLAA 4B3TF 4OMFG 4G1QA 4K4ZA 3T3FA 5GVQA 3H4BA 3M6XA 4FXDA 2K1RB 3T19A 4LQ3A 5EN1A 4PRFA 3DRPB 5GMDA 4PXDA 3GPAA 5D4PA 2KYZA 4ZCKA 1D9AA 1XR6A 2AT1B 1S0VA 4CYUA 4K7QA 2HVZA 1REVB 3N01A 2HHHJ 4DL0C 3PM9A 2RDJA 2XCAA 4CNZA 2Y1LB 4P74A 2DNQA 2DCUB 2ADBA 4IR1A 1N6QB 1SKUB 5GAHI 2NZCA 4PXEA 4FP9A 2JLFA 4ZJQA 2LQBA 4F0HA 4J9MA 3MAAB 1N32J 3N79A 3WC2A 1K1QA 3GILA 5ETLA 3A8EA 1NZAA 4EU0A 3H40A 1XNRJ 5SZTA 2CJAA 3TA1A 2WSCC 4I1TA 1FJ7A 2KXHA 4PG4A 2MKYA 2BV3A 1GNKA 1WHXA 1H7XA 3NMRA 5E3AA 4A8OA 3WZ0A 3J7AN 2UUTA 3D3BJ 2OUGA 4L74A 4LUBA 3K2YA 3PZPA 5AXMA 5KG6A 4FYDA 1SL1A 1OQ6A 1DURA 2CJBA 1XMQJ 3OW2R 3HD2A 3VAIA 4AT1B 4R5PB 2CQIA 4C4WA 3M2UA 1MN9A 2XLIA 4IR9A 1NZ8A 1C2PA 3THVA 2IA6A 4URSA 1RWPB 2OD4A 5HLFB 3IRXB 1HBUB 1UJ5A 2W7AA 2ZKUA 1I3OB 4A4JA 4IRDA 3QT6A 5LJ3Y 4CT8A 4FS1A 1HPZB 3MD1A 2JFKA 2NCKL 2QMUB 1S9EB 2GHWA 3TVKA 3FSIA 2CPXA 1KHVA 1KQKA 2J8SA 1PGZA 2QLFB 4HACB 2ZJQQ 4IH6A 3LANA 3OQ2A 3NKYA 4XDCA 3CJQA 1IKYA 4EK2A 4QWBA 1S4FA 3HFVA 1JKHA 3C6TB 5KFOA 5BXIA 3D6MB 2GHVC 4FZVA 4USMA 2GVZB 1E6YA 3U7JA 3HZGA 3JQKA 1S4EA 3A13A 1F2GA 2LQ5A 1PJ7A 1RA7A 1SQFA 2XO7A 1PG5B 2JJ4D 3MPYA 1HD0A 4DSEA 2ZBCA 2RQKA 2BACA 2HNYB 2H54B 1RT4B 5KFIA 1N32F 4UY8T 3TQEA 2DNYA 1W2IA 2ZHBA 3O2IA 2H51B 2ZBIA 3MURP 5J2PB 1S1UB 3TRGA 4M5LA 2FGCA 2EFQA 1VC5A 4WP9A 1TQLA 2HFVA
chains in the Genus database with same CATH topology
1NHKL 3FBCA 1LEOA 1W7WA 1ZS6A 4ANEA 1EHWA 3ZTQA 3EJMA 4ANCA 4FKXA 1NLKL 2NCKL 4KPCA 1MN7A 2ZUAA 1F3FA 1F6TA 4F36A 1B4SA 2VU5A 1HLWA 3ELHA 1NSQA 1S59A 1KDNA 3B6BA 3EMTA 3Q8YA 3B54A 1PAEX 4DUTA 1NSKL 1S5ZA 5CABA 1NDLA 2DYAA 4UOGA 3JS9A 2DXEA 3Q83A 5IOLA 2DXDA 1NDKA 3BBFA 3DDIA 1WKJA 3VGSA 3PJ9A 3FCWA 2DY9A 4S0MA 2DXFA 3FCVA 4CP5A 4EK2A 4ENOA 1NUEA 3VVUA 3WX8A 4F4AA 1HIYA 4UOHA 1PKUA 3Q89A 3G2XA 4HR2A 2HVDA 3ZTOA 3Q8VA 5BXIA 1VYAA 4WBFA 3FKBA 3VGVA 1BE4A 1B99A 3DKDA 4DZ6A 1NCLA 3GPAA 1XQIA 2BEFA 3MPDA 1JXVA 3ENAA 3R9LA 4C6AA 3EVMA 3FBBA 3NGTA 2CWKA 2HURA 1NSPA 3ZTPA 1NDCA 4O0NA 3GP9A 3EM1A 1NPKA 3Q8UA 3NGSA 3BH7B 3BBBA 3VGUA 3ZTRA 3NGUA 2AZ1A 3FBFA 5C7PA 3Q86A 3EVWA 2AZ3A 2HVEA 1NDPA 2BX6A 3L7UA 1NB2A 3PRVA 1WKKA 1UCNA 1U8WA 2B8QA 2B8PA 3EICA 3ETMA 3FC9A 3VGTA 3ZTSA 1BUXA 1MN9A 5CAAA 3VVTA 1WKLA 3BH6B 4W98A 1K44A 4DI6A 4FKYA 1LWXA 3EE3A 1HHQA 1XIQA 4UOFA 3FBEA 1S57A 3EVOA 3BBCA 4ANDA 1BHNA 3NGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHK L;  3FBC A;  1LEO A;  1W7W A;  1ZS6 A;  4ANE A;  1EHW A;  3ZTQ A;  3EJM A;  4ANC A;  4FKX A;  1NLK L;  2NCK L;  4KPC A;  1MN7 A;  2ZUA A;  1F3F A;  1F6T A;  4F36 A;  1B4S A;  2VU5 A;  1HLW A;  3ELH A;  1NSQ A;  1S59 A;  1KDN A;  3B6B A;  3EMT A;  3Q8Y A;  3B54 A;  1PAE X;  4DUT A;  1NSK L;  1S5Z A;  5CAB A;  1NDL A;  2DYA A;  4UOG A;  3JS9 A;  2DXE A;  3Q83 A;  5IOL A;  2DXD A;  1NDK A;  3BBF A;  3DDI A;  1WKJ A;  3VGS A;  3PJ9 A;  3FCW A;  2DY9 A;  4S0M A;  2DXF A;  3FCV A;  4CP5 A;  4EK2 A;  4ENO A;  1NUE A;  3VVU A;  3WX8 A;  4F4A A;  1HIY A;  4UOH A;  1PKU A;  3Q89 A;  3G2X A;  4HR2 A;  2HVD A;  3ZTO A;  3Q8V A;  5BXI A;  1VYA A;  4WBF A;  3FKB A;  3VGV A;  1BE4 A;  1B99 A;  3DKD A;  4DZ6 A;  1NCL A;  3GPA A;  1XQI A;  2BEF A;  3MPD A;  1JXV A;  3ENA A;  3R9L A;  4C6A A;  3EVM A;  3FBB A;  3NGT A;  2CWK A;  2HUR A;  1NSP A;  3ZTP A;  1NDC A;  4O0N A;  3GP9 A;  3EM1 A;  1NPK A;  3Q8U A;  3NGS A;  3BH7 B;  3BBB A;  3VGU A;  3ZTR A;  3NGU A;  2AZ1 A;  3FBF A;  5C7P A;  3Q86 A;  3EVW A;  2AZ3 A;  2HVE A;  1NDP A;  2BX6 A;  3L7U A;  1NB2 A;  3PRV A;  1WKK A;  1UCN A;  1U8W A;  2B8Q A;  2B8P A;  3EIC A;  3ETM A;  3FC9 A;  3VGT A;  3ZTS A;  1BUX A;  1MN9 A;  5CAA A;  3VVT A;  1WKL A;  3BH6 B;  4W98 A;  1K44 A;  4DI6 A;  4FKY A;  1LWX A;  3EE3 A;  1HHQ A;  1XIQ A;  4UOF A;  3FBE A;  1S57 A;  3EVO A;  3BBC A;  4AND A;  1BHN A;  3NGR A; 
#chains in the Genus database with same CATH topology
 3O5T B;  2YKO A;  4RBV A;  3MUM P;  4KE5 A;  1HNX J;  4K0K J;  3CO9 A;  1SL0 A;  1RWN B;  2X1B A;  3C66 A;  5I3U A;  2KH9 A;  2SXL A;  3RUB L;  3ITH A;  1GMW A;  3A4T A;  4NCG A;  2V9W A;  1SCJ B;  2DR7 A;  5KFG A;  4O0I A;  2PE8 A;  3UCU P;  3QAU A;  4LRD A;  1GXU A;  2OPR A;  4CYU B;  4DPT A;  1RAH B;  4ES2 A;  5CQG A;  4KPY A;  2RML A;  2Y3Y A;  2QLB B;  4LR9 A;  3K8V A;  1YBT A;  1EX8 A;  2L9N A;  4PKD B;  3BKT A;  5A2Q U;  4W4M A;  2VFS A;  3R5D A;  5D3G B;  1YJ7 A;  3GYG A;  3UN2 A;  1FFW B;  3CME S;  4CLK A;  4A8X A;  2XI3 A;  1UWA A;  5L46 A;  1CUL B;  5DS7 A;  5HO4 A;  1TAQ A;  2EW9 A;  3J80 U;  3SCI E;  2HHQ A;  3P96 A;  1QVF R;  3T9N A;  2QSW A;  1WEZ A;  1MWQ A;  4B02 A;  4Q2L A;  3EPG A;  2KU7 A;  4J9R A;  2GQQ A;  1Y3J A;  3AT1 B;  2FHJ A;  4CLZ A;  2XLJ A;  3SIP B;  4QZV B;  1C0U A;  2QIF A;  4OHV A;  3FCV A;  2QA4 G;  4ZDN A;  2O5D A;  1UVK A;  1Z4U A;  1NJI T;  3L3C A;  4O23 A;  2QA4 S;  1S6P A;  1X4E A;  1H38 A;  3D3C J;  4QR2 A;  3FUY A;  3IWL A;  3CMQ A;  2HK3 A;  5HBM B;  2RRN A;  3OTE A;  2DT9 A;  2RJZ A;  4JI2 J;  4RNN A;  3MWB A;  4WJB A;  5C42 A;  4LT6 A;  2QV6 A;  3CJ4 A;  3M2U B;  4DSK A;  4QWA A;  5JXS A;  1R27 B;  2DO4 A;  3EDQ B;  4NXN F;  3OTD A;  1HNX F;  3M1V A;  2VPX B;  3PX6 A;  1U2C A;  1FDD A;  4M1K A;  4K0K F;  3CD7 A;  2BRK A;  4WZQ A;  1OIA A;  2MMY A;  4ED1 A;  2CQC A;  4LRC A;  4Q0B A;  3X1L B;  1V3R A;  4ZCL A;  3QLH A;  4K2J A;  2E7V A;  1VCT A;  4ZLJ A;  3CCR S;  1RBL A;  3NG8 A;  4AD6 A;  1IKY B;  1NEE A;  4KHP J;  2QMW A;  3DMJ A;  1JKH B;  1T9Y A;  1C1B B;  1VYA A;  1DAR A;  1DFD A;  2V8V A;  4I6A A;  4F67 A;  6FDR A;  4H4K A;  2FUG 9;  1IBM F;  2A1B A;  3VZI A;  2AIR B;  1E6Y B;  2KXF A;  2M52 A;  1FFG B;  3KUG A;  3BRE A;  4F7V A;  1VBK A;  5ADZ A;  3LH2 S;  2GC8 A;  2AZ1 A;  1RZM A;  2RE1 A;  3DLJ A;  4IG0 A;  1FHT A;  1LFW A;  2W7P A;  1Z2Z A;  2HVH A;  4JI7 F;  1IBL F;  2XMJ A;  3CJS A;  4L73 A;  1RTD A;  2RNE A;  1FX2 A;  5H9F K;  1RT3 B;  4B9T A;  1W7W A;  4F25 A;  2B6A A;  1UAW A;  3BGU A;  4N8N A;  5D4L A;  4QR0 A;  1RAA B;  1JLC B;  3CJ8 A;  5JVH Q;  2OKQ A;  4DCO B;  3OXF A;  4F4Z A;  1L3K A;  4C0O C;  3T5H A;  2B4O A;  1QD1 A;  1TUG B;  4F2S A;  3HJV A;  4NCG B;  2DNP A;  2WB1 D;  3BO4 A;  8AT1 B;  3KKF A;  4PWW A;  3ZZP A;  5B0B A;  5HQM A;  4IFV B;  1H6K X;  2E7X A;  4DV4 J;  2KM8 C;  1UW4 A;  2I2Y A;  2MEW A;  2MTL A;  4NYO A;  5EWF A;  3D6H B;  4AXJ A;  4KH0 B;  1AUS L;  4RNO A;  2UXD J;  4DU8 A;  4BC9 A;  1KD1 T;  2E9Z A;  3VGT A;  2B8P A;  2P9G A;  4OI1 A;  3THP A;  1GMU A;  2PC6 A;  4CO2 A;  4HYK A;  2QLJ B;  3TJA A;  4DR1 F;  1PSD A;  4CWB A;  5F8H A;  2JC1 A;  3CJ2 A;  3K17 A;  3UVJ A;  1Q5Y A;  4B08 A;  3JSY A;  2K7K A;  3HFZ B;  1SV5 A;  4KHP F;  1ZM4 A;  3RB0 A;  1F5B A;  2RU9 A;  1Z2L A;  4YDX A;  3QAT A;  1X5T A;  2V2V A;  2FVS A;  4DR5 J;  1C0U B;  1JLE B;  4TVA B;  4MKB A;  1B0P A;  1UWB A;  2WVB A;  5SUH A;  3ZTO A;  1U1K A;  2NUU G;  1F5A A;  2L48 A;  4LRB A;  3TOQ A;  4GKJ F;  2NXU A;  1AB8 A;  1I5O B;  3KJV A;  5G0R A;  4F4K A;  2OGU A;  2RU3 A;  2E7W A;  3G6V A;  2AQ4 A;  3W2W A;  1NDP A;  3MM6 A;  1HR0 J;  1FK9 A;  1HWI A;  2BQR A;  2W24 A;  3MR7 A;  2ZFH A;  3DN9 A;  3ONQ A;  5C42 B;  4DV6 J;  5DM6 Q;  4BWM A;  1K44 A;  4CM2 A;  2YTC A;  4ELU A;  1FX4 A;  3UDV A;  4C0B A;  1FWL A;  1TL1 A;  2KHD A;  4I6Y A;  1JLA A;  3NAI A;  3MCM A;  1CJT A;  2UXB J;  5A2Q Y;  2B5J A;  1VRU B;  2DR6 A;  2GJI A;  1VK3 A;  3KHR A;  2YWF A;  1N5V A;  4ED8 A;  1GTE A;  3I56 S;  3QLH B;  4WU3 A;  4S0M A;  2XUL A;  2LU2 A;  3J80 Y;  4ECS A;  5CZV A;  2KN4 A;  2YKA A;  4DV4 F;  5F8G A;  3ZZU A;  1TAU A;  4ZKA A;  3SZ2 A;  3LGM A;  3ZZZ A;  3B82 A;  1FVQ A;  5CYQ A;  3FSY A;  4IH7 A;  4EWT A;  2I9S A;  1UEV A;  4F3M A;  3FBB A;  3EZ5 A;  4IRC A;  3G82 A;  2ASL A;  5JMN A;  4I2P B;  3MUV P;  2CJX B;  1NJW A;  4ZVU B;  2R8H A;  1LW0 A;  2MQ8 A;  4X4N A;  3RBX A;  1Q1K A;  2ZHO A;  1NB2 A;  2V4J A;  1U8W A;  4YR0 A;  4FXV A;  4IG0 B;  3TA2 A;  1Y3K A;  1NKE A;  4FF1 A;  2EEY A;  1Y5L B;  2CIM A;  2PMW A;  4UTG A;  1IQZ A;  1U45 A;  2XMM A;  1RTD B;  4O3R A;  4X62 J;  3EJM A;  2HFN A;  2B6A B;  4DR5 F;  3RRH A;  2EFP A;  2VFV A;  2VH7 A;  2XGQ A;  2IYI A;  3CW2 C;  5JUM A;  2V69 A;  2OEK A;  2W4C A;  4PG5 A;  1PYO B;  2RIJ A;  1MWY A;  4X2B A;  4WFZ A;  2W9B A;  2OMO A;  2LKZ A;  2ZH3 A;  3E01 B;  5HI7 A;  2CUY A;  4M8L A;  4PR6 A;  1J5E J;  1R0A A;  4LMZ A;  2A2C A;  1SC1 B;  3LP2 B;  1M0S A;  3KDN A;  3SQO P;  1VI7 A;  2UUB F;  4PEO A;  2HFZ A;  2DPJ A;  4RW7 B;  2WON A;  4DV6 F;  2DGQ A;  1VQK S;  4LF7 F;  1RCO B;  3W5X A;  2BDP A;  3WHI A;  5IXU A;  2VKZ G;  4YEA A;  3EXC X;  2YWE A;  4RBT A;  4U67 Q;  4TU7 A;  5AXN A;  4LSN B;  2BAN B;  2PSZ A;  5E3P A;  1Q5V A;  2VOP A;  3E2E A;  2UVW A;  2QLW A;  1WC3 A;  3C8Y A;  4MFB A;  4RJV A;  2HHX A;  3V6K A;  3VF0 B;  3QQC D;  4JI5 F;  3UVJ B;  1KTV A;  2ROP A;  1J5O A;  5D0R A;  5KFL A;  1P6T A;  3HKZ D;  4IYQ A;  2FJW A;  4B3M J;  2JDJ A;  4WFB Q;  2FVQ A;  2NPF A;  2B4P A;  1XJW B;  2V2Z A;  1DJ0 A;  4DS5 A;  1UFK A;  2QA2 A;  4LF9 F;  2C42 A;  2DGV A;  3Q23 A;  2IVF B;  2GAG C;  4PAB A;  2M4M A;  4CO4 A;  4DWI A;  1XER A;  1UTA A;  1Q78 A;  2UU9 F;  3V5R A;  3QWU A;  1FKO A;  1SUQ B;  3KTQ A;  3KJV B;  2O01 C;  3LOU A;  1DHM A;  1Y0H A;  2HVE A;  2FIU A;  3HHK A;  2J8A A;  3MCS A;  2JL9 A;  4QR1 A;  4X62 F;  1FK9 B;  3UI3 A;  3CJT A;  4B3O A;  2GZO A;  4A8S A;  1RWV B;  1RT1 A;  2O1P A;  3I31 A;  1GX6 A;  4AND A;  3KLI B;  2AEJ A;  3NAH A;  3D6F B;  4PYA A;  2G0C A;  3PO4 A;  2A0F B;  4O3Q A;  4C8L A;  1CS4 A;  1JLA B;  3CE8 A;  1OPZ A;  1CJT B;  3D4J A;  1RHR B;  3NGK A;  4DQQ A;  1U1R A;  2V8H A;  4Z2X A;  2B5J B;  2ASJ A;  3EYZ A;  3MED B;  3CD6 S;  4A8Y A;  2VBX A;  1J5E F;  1YG0 A;  3AH6 A;  3P5B P;  1O6X A;  5A6W A;  2X1G A;  4ECU A;  3CD5 A;  3PG9 A;  4RKU C;  5FDL A;  1SJ3 P;  5KFR A;  2QSF A;  1T94 A;  3PJW A;  5HAN A;  5BJR A;  5HVG A;  3TAR A;  4NXM J;  5CYQ B;  3HHE A;  2ZC3 A;  2XO6 A;  5KFC A;  2FJB B;  3J7A 1;  2M2B A;  3DGP A;  1U1M A;  2PFD A;  4RW8 A;  1YZ6 A;  1FEE A;  1S79 A;  1LW0 B;  2VQF F;  2V4J B;  1SJ4 P;  3QSI A;  3NLC A;  3QRQ A;  1HWU A;  1SJF A;  2Y1I A;  2BBE A;  1RAO A;  3NGD A;  5KFA A;  2WW8 A;  3FVY A;  4IKA A;  1LWE B;  1VQM S;  1BQN A;  4B3M F;  1YIT S;  4QU6 A;  3RRG A;  1YRX A;  2W2O P;  3BM7 A;  3TEH B;  3DLH A;  1N33 F;  5CAB A;  3SCK E;  3V4I A;  1RTZ A;  4F26 A;  2MZS A;  2W9C A;  2CZ4 A;  3CJ3 A;  1Y00 A;  4TN2 A;  3KYL A;  4Q44 A;  3M9O B;  2W9B B;  3P5T L;  2KKH A;  2Y8Y A;  4G65 A;  1S6Q B;  3W65 A;  5IZH A;  3FZ2 A;  3UD4 P;  3VAJ A;  1EET A;  2DEJ A;  4HDH A;  4ECT A;  1T3N A;  5C2G A;  2MKJ A;  1R0A B;  3ENA A;  2PDA A;  2CPJ A;  2IJF A;  2GQ2 A;  3NBP B;  3GJQ B;  2VFT A;  3H5U A;  4OV6 A;  2RIL A;  2M70 A;  2WON B;  2ZBR A;  3V6D B;  1IXK A;  4K4X A;  2K3I A;  2CJK A;  3LW5 C;  1DLO A;  4XO0 A;  1GXT A;  4YS2 A;  3QT8 A;  1S6U A;  4DDF A;  1S1X A;  2LEA A;  4F0M A;  2FY8 A;  2BJD A;  3UR0 A;  1VJW A;  1EP4 A;  1VQL S;  3BGL A;  2ATL A;  3CJR A;  1KWM A;  3GV8 B;  1FI4 A;  3A8I A;  1NLK L;  1MN7 A;  4MFB B;  2OTL S;  1F9H A;  2AF6 A;  3M8R A;  3QNW B;  1TMM A;  1NSK L;  4FYX B;  4HT7 A;  2BOA A;  2VD3 A;  5BR8 F;  5DGA A;  4HEA 9;  3UDC A;  4LBI A;  4PYD A;  2GMJ A;  4QIV A;  2GO9 A;  3D68 A;  3CC2 S;  3QYY A;  4Y2C A;  4EUV A;  2KRB A;  4USJ C;  4JI3 F;  1XQI A;  2IDE A;  1MMD A;  4PCQ A;  1WUU A;  4JYA J;  4NYZ A;  2V34 A;  4P10 A;  2PEB A;  5M2P A;  1N4L A;  2KJW A;  3FEZ A;  3Q8U A;  3RB4 A;  2ERR A;  3GIJ A;  5K20 B;  1TK0 A;  2FLO A;  2GGP B;  4FXW A;  4KO0 A;  2HRY A;  2F8H A;  3ZTS A;  3TI0 A;  4CTA A;  3IS9 A;  4OI2 A;  1HBN B;  3MMJ A;  3RU0 A;  4MT1 A;  1JJ4 A;  2KYX A;  4BBY A;  4CNY A;  3I82 A;  5A8W A;  4B3O B;  3TX0 A;  1RT1 B;  4P9S A;  4G6V B;  2JEI A;  4C3M A;  4ZP9 A;  2YXL A;  3GSI A;  3N6N A;  3OV7 A;  1CS4 B;  3B6B A;  1X5O A;  4A8W A;  1CPZ A;  1WNE A;  1WEX A;  2K7J A;  2VPW B;  4HI1 A;  1LQ9 A;  2HIY A;  4WFX A;  4N7T A;  4JI4 J;  3MEK A;  4D3G A;  1HIY A;  3H2V E;  1PYT A;  5L1K A;  5FDL B;  2KT5 A;  1RWM B;  2KG1 A;  4DMZ A;  1CVJ A;  1IJF B;  3NMA A;  4RWX A;  3FJ2 A;  4C3L A;  2HYI B;  2F7V A;  3MMC A;  1YHQ S;  4BS2 A;  3ZTP A;  2ZH2 A;  1H7W A;  2RDI A;  3TJ8 A;  3A3N B;  2OD6 A;  4LSZ B;  1CJK B;  5D4N A;  4NLV A;  5C2C A;  1RU2 A;  3OFF A;  5HK4 A;  3JXO A;  4LF6 J;  2CPY A;  2YWK A;  2QO3 A;  2Z2M A;  4F4Y A;  1BLU A;  2YNF B;  1S99 A;  3OFG A;  4YB5 A;  3NNH A;  4RW4 A;  1BQN B;  3HHL A;  2F4V F;  1OWX A;  2ZJP Q;  1PO6 A;  3GJS B;  1S59 A;  2ZJR Q;  1MWZ A;  3MCO A;  2JH3 A;  2V9K A;  4FF3 A;  2MSS A;  3T41 A;  3MCN A;  4WZM A;  1CG2 A;  3SI8 A;  1M5H A;  3ILJ A;  2W9C B;  1UKU A;  5AE3 A;  3IFE A;  4HR2 A;  3JSR A;  3RW6 A;  1NSA A;  4WBF A;  4CO5 A;  1TUV A;  3LP1 A;  4U8V A;  1EET B;  2E29 A;  1PAU B;  3CCU S;  2VF3 A;  1RT6 A;  1I94 J;  1H74 A;  1X4C A;  1YSJ A;  1VQ7 S;  2ZVS A;  3JQM A;  4OHX A;  4LFA J;  1FRJ A;  2IJN A;  5D15 A;  1WF1 A;  2FZC B;  2FDN A;  3Q8R B;  1DLO B;  3OBI A;  1QVG R;  1FDA A;  2Z2L A;  3H25 A;  3KMQ A;  1RGV A;  4I69 A;  2DGT A;  3A3O B;  5AJ3 F;  1XIQ A;  3QPI A;  1BQX A;  3T6B A;  3EGZ A;  1EP4 B;  2MZQ A;  1Z1Z A;  5KFJ A;  4O4R A;  4OLO A;  5JVG Q;  4JI4 F;  2WVE A;  2WVC A;  5K8O A;  1AYE A;  2DGU A;  2Y9H A;  2FHO B;  1JLF A;  3SSQ A;  3AB2 B;  3CDU A;  4QW9 A;  3M8Y A;  1IBK F;  2BR0 A;  3KK3 B;  3UN5 A;  4CLS A;  3C3L A;  4O44 B;  1Y5N B;  3ENV A;  2KT3 A;  3OJU A;  1NKC A;  3J7Z 5;  3AD7 C;  1BC6 A;  2JZ5 A;  2KJV A;  3TZY A;  2G0J A;  2FQQ B;  4NLD A;  3MAQ A;  3FBF A;  1QSY A;  3KXD A;  4KO0 B;  3PHT A;  3IS9 B;  2ZM6 F;  4UZC A;  2R2U A;  2L41 A;  3T1Y F;  1YGY A;  2HFS A;  2V4R A;  2MZ1 A;  3UDE A;  3FRZ A;  3G71 S;  4Y2I A;  1F3F A;  5A0Y A;  1X4D A;  5IFM A;  4WE1 A;  2DIV A;  2AKW B;  4IOB A;  5L9N A;  5BYR A;  4C8K A;  3TW0 A;  2JRS A;  2CNL B;  1I94 F;  1HW9 A;  2LCW A;  2NXJ A;  2BM1 A;  5K8M A;  3LGH A;  1SIW B;  3GR1 A;  3KLH A;  3MR2 A;  4QBU A;  1KLM A;  2I5J B;  4TY8 A;  3HDS A;  2LEP A;  4LVO P;  1RJJ A;  4NEY A;  1R89 A;  4OZN A;  2OP5 A;  3GIM A;  3R9L A;  1KS2 A;  3CPW R;  3ZZ0 A;  1HA1 A;  1NBE B;  3MMC B;  2Y0S D;  4PZV A;  1F9E B;  3IWX A;  3JSB A;  4PAA A;  3EZU A;  3MI7 X;  2Y0B B;  3HX9 A;  4I2Q A;  2MB0 B;  1YWX A;  1UVJ A;  1RT7 A;  3NY0 A;  2Z4P A;  2QG9 B;  3DNC A;  2I8E A;  2PT0 A;  1APS A;  1S57 A;  2PGC A;  4A48 A;  3ISN D;  4QJV A;  2BJ7 A;  4DV2 F;  1GX5 A;  2N7C A;  4OJG A;  3MM5 A;  4NLQ A;  5HVH A;  5J2N A;  1MG7 A;  3ELH A;  3OPK A;  3HHL B;  2B56 A;  1D1U A;  4WP3 A;  5FLX U;  1X0F A;  4USK A;  3VZH A;  4GC6 A;  2J0Q D;  5C24 A;  2J6S A;  2XS7 A;  2C2R A;  4NE9 C;  3V6J A;  3TQ1 A;  1JNR B;  4USV A;  4Y3C A;  4BCA A;  3TEG A;  2XM3 A;  1TKD A;  1WEL A;  2C22 A;  5B0D A;  1F2H A;  2WSE C;  1A9N B;  4P2X A;  4W92 B;  1RT6 B;  5KG1 A;  1V3S A;  4L72 B;  2LDI A;  2HAF A;  3DHW C;  2YKM A;  2MHE A;  1SIZ A;  2H3E B;  1UVN A;  1QLN A;  2B9Y A;  3PFO A;  4K4V A;  3OXG A;  1OYD A;  1QTN B;  2ZZT A;  2V4Q A;  2ADC A;  4B9N A;  3IM8 A;  3DRR A;  2PMH A;  1NHK L;  4OYM A;  4M5H A;  4FYV B;  1Q8B A;  2YPZ A;  2CQ0 A;  4ZPT R;  4LF1 A;  2O66 A;  5DG9 A;  3JYT A;  1WHY A;  4JB8 B;  5GAD U;  1Q95 G;  2AW0 A;  1HW8 A;  3H90 A;  2DYA A;  1WHV A;  4OV1 A;  4LRF A;  1RTI A;  1JLF B;  1XMO F;  1ZOT A;  3BO3 A;  1HQ2 A;  1DY3 A;  1U09 A;  2MQN A;  3X3U A;  3R7S B;  3S7R A;  1UP1 A;  1PBU A;  2IVM A;  2BKN A;  2HGL A;  3BN7 A;  1RAD B;  3HVA A;  1RHU B;  3D1Q A;  5DQI A;  4UQT A;  4DR7 J;  5LMU J;  3PIO Q;  2ROG A;  4LRA A;  2FPH X;  3V2U C;  4UY8 5;  2LLZ A;  3I5C A;  1FRK A;  4URG A;  5J2M A;  4X66 J;  3SQG A;  4EBD A;  2QMX A;  2W2N P;  3BH6 B;  4CLF A;  1G4C A;  1I6J A;  1M5S A;  3J7Y U;  5ETO A;  1X4A A;  4NA3 A;  3HK2 A;  4OYI A;  2V63 A;  3PYD A;  3DLL Q;  2VZ9 A;  1SB6 A;  2NXC A;  3EPI A;  3O3L A;  3GJT B;  2ALY B;  2MLZ A;  2VDI A;  5A0Y B;  1BQM B;  2Z56 B;  1VQP S;  1B64 A;  1RWK B;  1U2F A;  2JWN A;  2W2M P;  4QYZ K;  2DH7 A;  2HK2 A;  3OL9 A;  3DCA A;  4UOH A;  4N56 A;  2J76 E;  3LAM A;  1KFS A;  2VG6 A;  1KLM B;  4TY8 B;  4DL3 A;  2XB2 D;  5DDR C;  2EKY A;  2GVD A;  2FVP A;  4H54 A;  4C11 B;  2XHW A;  5L38 A;  4ZJL A;  3TX8 A;  3NL0 A;  2NYI A;  3L4B C;  4RU9 A;  3CCS S;  8RUC A;  3D6T B;  5DDP C;  3OTB A;  3B78 A;  4TQS A;  1SPB P;  1TVR A;  1UFW A;  2FLL A;  1NJX A;  3AA9 A;  4IO1 A;  3JAM U;  3K7R A;  2LXU A;  4K8R A;  3R7N B;  2WK4 A;  2ZNY A;  3K5M A;  3FMB A;  2QFJ A;  2HW3 A;  4ZPV R;  1KOH A;  3RR7 A;  2EK6 A;  5ETQ A;  1K73 T;  1XR5 A;  5J2N B;  1NDL A;  4PWD B;  3HT3 A;  3MEG B;  3WDO A;  4Z7Y A;  2VDH A;  5E3Q A;  3EGV A;  1PBA A;  4ZOS A;  2K06 A;  2X3G A;  4FYY B;  4DR7 F;  2JC0 A;  3F44 A;  1QAX A;  4DPX A;  2RAQ A;  1GH8 A;  4C98 A;  1V5I B;  2OTJ S;  4YB7 A;  2BA9 A;  2MQQ A;  4X66 F;  3PTW A;  4OFZ A;  1SI9 A;  2HLT A;  4DX6 A;  2BQ3 A;  3QBC A;  4J9U E;  3M2V A;  4ZS6 A;  2E1C A;  4DR3 J;  2QE5 A;  3IC1 A;  5C7P A;  4C8M A;  5GAD I;  1HMV A;  2B8Q A;  2YKM B;  5KT3 A;  1KBR A;  3CDB A;  1RWW B;  2XMV A;  2RD5 C;  3IBW A;  2RQC A;  3K5P A;  4USW A;  3CC7 S;  1E6V A;  3OL6 A;  2F8E X;  4UUW A;  1T11 A;  3A12 A;  3B4M A;  2BRL A;  4HHJ A;  2YKQ A;  4DV0 J;  4KBI A;  3DRR B;  3ZTQ A;  4NLY A;  1W2B R;  4ER8 A;  3PXG a;  2YNI A;  1AZS B;  3JYT B;  1U1P A;  1P1L A;  1A7G E;  1HWK A;  1IKW B;  2CPZ A;  5KOX A;  5L1J A;  3CC4 S;  2VBZ A;  2VJU A;  3MEE A;  1RTI B;  4R8U A;  4L75 A;  5KFM A;  2OFH X;  3HUL A;  4DSI A;  1LW2 B;  4M5M A;  4KGK A;  3GJR B;  2H65 B;  9ATC B;  1N0V C;  2OLW A;  4DFK A;  5FLX Y;  4C6A A;  3J7Y I;  3DRX A;  5DM7 Q;  2HSE B;  2JFD A;  3Q22 A;  2R7U A;  3MR5 A;  1P9Q C;  2W7O A;  1JK9 B;  4KQZ A;  3DU6 A;  3IXQ A;  3KK2 B;  3N28 A;  4NPO A;  4CLU A;  3H5X A;  2AU0 A;  2UV8 A;  1TL3 A;  2FHK A;  1BWE A;  3FZB A;  5J2M B;  4P72 A;  1ZAV A;  5DLF A;  4TY9 A;  3W1Y C;  3QO9 A;  3DFE A;  1Y9O A;  2XNQ A;  4ZVE A;  1WF0 A;  1GAO A;  3T1H F;  1VOM A;  1S1T B;  3MAH A;  4R0E A;  2BE2 A;  2M0G B;  2GS8 A;  1R0C B;  4KAI A;  4RBU A;  2LP4 A;  3POT A;  3RAM A;  3QT7 A;  3ILL A;  1XEZ A;  2CRL A;  3FNN A;  1WOO A;  4KFB A;  1H0H B;  5IWA J;  3CIM A;  3O44 A;  1QTM A;  2X1A A;  4RZR A;  2ZH7 A;  3BDP A;  3PO5 A;  5F0W A;  4FF2 A;  4NLT A;  4W90 B;  3WC0 A;  1TFY A;  3MOJ B;  2OML A;  4RNM A;  5L39 A;  3WIU A;  5F9N A;  3QRP A;  2D3Z A;  4DFM A;  2VG6 B;  1S77 D;  4DR3 F;  1XTZ A;  4N8O A;  1UFL A;  2BJ3 A;  1CQN A;  2MHN A;  2MDA A;  3T9Z A;  2GVD B;  4Q43 A;  4AYB D;  2DR5 A;  2R8K A;  3CWJ A;  2M3D A;  4TKT A;  1S76 D;  1MRO A;  1FJG J;  4O3S A;  2VG7 A;  2W8L A;  3RTV A;  2L9D A;  3IMQ J;  4F04 B;  1HQE A;  2M7S A;  5U47 A;  1YJR A;  4OQJ A;  2OEJ A;  3V6H A;  5H9E J;  5DJB A;  3RB3 A;  1KNZ A;  1TVR B;  1PC5 A;  2QT7 A;  4J7C A;  4X4U A;  4MKV A;  2K1R A;  4JV0 A;  1HQU A;  2DXE A;  4N77 A;  1HYS B;  1WKJ A;  2GAH C;  1SC6 A;  4X4R A;  4OJ1 A;  4C48 A;  3I0S A;  3QAE A;  3VHQ A;  1ZZN A;  2KT2 A;  1R8B A;  1OS5 A;  2LMI A;  3CCM S;  1NCL A;  1NK0 A;  3MUT P;  3OTO F;  3OD2 A;  3PX0 A;  3R6L B;  1CC7 A;  1K47 A;  3EVM A;  3U02 A;  2MLX A;  3KLV A;  3P4U B;  1YK9 A;  1NK5 A;  1ULR A;  4JV5 F;  1WDD A;  3IGV A;  2HND B;  4UZB A;  1LV5 A;  4JV2 A;  2IPO B;  4X4S A;  4DR6 J;  3KLF A;  5F8I A;  1ZTT A;  3IO1 A;  2GW8 A;  3W60 A;  2P9E A;  3BZQ A;  3M8Z A;  1Y10 A;  4ZLL A;  2AHO B;  5KG7 A;  3VWS A;  3C19 A;  1HWL A;  1U1N A;  4OX9 F;  2XSF A;  1DBD A;  3DRY A;  4DL6 A;  2LA4 A;  1N36 F;  1N48 A;  3R5G A;  3EMT A;  1ZTW A;  3L9Z A;  1H72 C;  2YNI B;  2W2P P;  4DUT A;  2DPI A;  4NLX A;  4B3T J;  4JI8 J;  2CZV C;  2JLE A;  2MZT A;  2DY9 A;  1X4B A;  1RI7 A;  3BN4 A;  1OMS A;  2J9E A;  3W2V A;  1FJC A;  4H4K C;  3JAM Y;  4K4U A;  3MEE B;  4LBH A;  4R8U B;  2MQL A;  4LSL A;  1DQ9 A;  3IN5 A;  2G1D A;  5E41 A;  3D0I E;  4F02 A;  4DF4 A;  4Q45 A;  4LIR A;  4ZA1 A;  4O4G B;  1NXI A;  3IRX A;  3LTO A;  1HBU A;  1NO8 A;  3GWC A;  2XYH B;  5ETK A;  3DC2 A;  5DQG A;  3RJM B;  2OHD A;  1HPZ A;  2WBM A;  3ZZT A;  1YDL A;  1S9E A;  3QFW A;  4B3S F;  2G1H A;  1R6Y A;  4OI3 A;  1SBR A;  1UZH A;  4CCH A;  4LF5 J;  1RCX B;  3QO9 B;  1WC6 A;  4C8Z A;  2J9C A;  3K0J A;  1TL7 A;  2HIQ A;  3U1N A;  4QPT A;  2FGO A;  2BE2 B;  5CHC B;  1UET A;  3JQJ A;  3C6T A;  4NL5 A;  2RB7 A;  3ZFV A;  4WCE Q;  4N41 A;  3LPE A;  2DJW A;  2MLY A;  5CD4 H;  2XEX A;  4ZVT B;  2QRR A;  3P49 B;  1YBU A;  1OSC A;  2YWW A;  1T8E A;  4UT4 A;  1CBK A;  2CQ2 A;  4IQM A;  2ZNZ A;  1CJU B;  1SH0 A;  1VQ6 S;  4M94 A;  5E33 A;  1RE1 B;  4URQ U;  4FBT A;  3HI9 A;  1KHW A;  2BMB A;  5AT1 B;  1RAC B;  2HQI A;  3C15 A;  4RPF A;  3FK4 A;  1S1U A;  2LA6 A;  2OPS B;  2XZT B;  5HL7 Q;  1F5C A;  1RB0 A;  2G2O A;  1R0B G;  2K2P A;  4YHH F;  5KG0 A;  1MRO B;  4OL8 A;  2QL7 B;  4X4V A;  5HQ8 A;  2VG7 B;  5J2Q A;  3AHP A;  1JB0 C;  5D0H A;  3VAL A;  4YR2 A;  3TAM B;  3RBD A;  3G87 A;  3SYZ A;  2XYP B;  1HQE B;  1YJN S;  2VIC A;  4EGL A;  4YDD B;  1VRT B;  3BBC A;  2K8G A;  3BGF A;  3W64 A;  3CCJ S;  2J6T A;  3NGR A;  4QW8 A;  2EXU A;  2A6M A;  2V0N A;  3I9V 9;  1HWJ A;  2Z30 B;  3SBM A;  2KM8 B;  4JI8 F;  3RBZ A;  3QGP A;  3UDL A;  1C0T B;  4NLU A;  1CJV A;  3NRB A;  1RTH B;  2CPI A;  3CDA A;  1HQU B;  3F56 A;  3VGS A;  2BW2 A;  3AJ1 A;  5KFS A;  2B43 A;  1WTB A;  1R8C A;  2NSC A;  3N6L A;  3IP0 A;  1RBA A;  3I0S B;  2VBY A;  2HRU A;  5K14 A;  2E5H A;  5D3G A;  1VQ9 S;  3TAN A;  4ECZ A;  5EDW A;  2BEF A;  1DAX A;  3EGN A;  1CLF A;  3TVZ A;  1CUL A;  5ETN A;  5ETM A;  2DHA A;  3R2C J;  1T9T A;  2EK1 A;  3MR3 A;  1SL2 A;  4LF5 F;  4KHM A;  5KFW A;  2N7Y A;  2AD9 A;  1YJV A;  2CDR B;  1XWL A;  2RQM A;  3PRV A;  4M5K A;  5K5M A;  2LXF A;  1KP6 A;  3KLF B;  4ERD A;  1LXJ A;  2JOQ A;  2BKP A;  3D67 A;  3D66 A;  2VA3 A;  2Y1R I;  1OO0 B;  2B0G A;  1GEH A;  1O51 A;  2I38 A;  2CQP A;  2ZD1 A;  4DL5 A;  3UE2 A;  3HT0 A;  1RA6 A;  2F63 A;  2W8K A;  2RRA A;  1ROF A;  4DV7 F;  4YY3 F;  4X4O A;  3JS9 A;  3E3X A;  2DXD A;  2DNM A;  1P27 B;  1JLG A;  1FXR A;  2ZDP A;  5KG3 A;  2GJF A;  3U1L A;  2KHC A;  3U27 A;  3HO1 A;  1X9W A;  4KSE B;  3ETO A;  3W2V B;  2CQH A;  1VLY A;  2KDO A;  5HBM A;  4B9M A;  4E8U A;  2XHC A;  2YNH A;  4LSL B;  3G6Y A;  2VA2 A;  3OXL A;  3DRS A;  5L1L A;  4C8Y A;  1FCA A;  2RSQ A;  3OL7 A;  2HBY B;  4ITS A;  4DLG A;  2P5V A;  3C6U A;  2GCF A;  3TA0 A;  1MW7 A;  3CTR A;  3LAK A;  4J9O A;  3PNI A;  5DQH A;  4KY3 A;  2F65 A;  2QYC A;  3DOK A;  4UOF A;  3NCP A;  4HDG A;  5FII A;  1TL7 B;  1ZS6 A;  3KG0 A;  2MY7 A;  1X31 C;  3OVA A;  1MU2 B;  1C1B A;  1NB7 A;  3EUN A;  4U6P A;  1HFE L;  2IIH A;  3JB9 k;  2XQC A;  4KGV B;  1U49 A;  4KC5 A;  1R3N A;  2C1E B;  1J27 A;  2J6U A;  2VUG A;  3MR6 A;  5EGY A;  2QL5 B;  1L3U A;  2OIH A;  2H5I B;  1BE4 A;  1W26 A;  2CQB A;  3PR4 A;  4EYI B;  1X5S A;  2OI2 A;  4DG1 B;  2HS4 A;  2R7V A;  3C15 B;  1NK9 A;  4ZIW A;  1ARO P;  4H4O B;  2ZIT A;  2MQM A;  4PPZ A;  3NGS A;  1RT3 A;  2AGP A;  3M8Q A;  2AX1 A;  4XK8 C;  2W1B A;  3P45 B;  4CLW A;  4ZVO B;  1TV6 A;  5HRO B;  5J2Q B;  2N4D A;  4NXN J;  4BC7 A;  4W98 A;  1JLC A;  3ULH A;  1ZZF A;  3ZZY A;  3BGR B;  3DLE A;  3LGN A;  2PFF B;  4L76 A;  2ZEJ A;  4B9L A;  1UVM A;  3G9C A;  3G6E S;  2WOM B;  4RU2 A;  3NNC A;  4Y2A A;  5F3T A;  4ANC A;  4ZP8 A;  3Q8P B;  2HBR B;  2VU5 A;  3GFX A;  5CYM A;  1CJV B;  3GFH A;  4DQR A;  5MAO A;  3CCZ A;  3VR1 A;  2RS2 A;  4IFV A;  1Q79 A;  3BQ0 A;  2R7Q A;  3TYT A;  3TUZ C;  1X5P A;  2CJQ A;  1KVJ A;  1HBO B;  4OYW A;  1IBM J;  2KL8 A;  3L7O A;  5K14 B;  3PEJ A;  3HJF A;  4HTJ A;  1S9F A;  1JQG A;  4ZK7 M;  3T5L A;  1NK8 A;  2M88 A;  1Q0N A;  4DCP B;  3HZE A;  2DKO B;  3UCZ P;  5HSP A;  1RWO B;  1FWK A;  3CIZ A;  1EKR A;  4RW9 A;  1RTJ B;  2HQG A;  2FVC A;  2J7W A;  2WVD A;  3Q86 A;  3EVW A;  1BWV A;  3GG1 A;  4USU A;  1VQS A;  4NLO A;  4XTT A;  1S6O A;  2DGW A;  1TKZ A;  2YWH A;  4JI7 J;  1IBL J;  1U6B A;  2NQP A;  3AD8 C;  1HHQ A;  2C3M A;  3SV4 A;  2JVO A;  1RYS A;  4FNH A;  4DL4 A;  1YRT A;  3KJN B;  4O3O A;  3ZNU A;  1JLE A;  2KO1 A;  2ZWO A;  1B0V A;  2ZD1 B;  4FKX A;  4RX6 A;  1RT2 A;  1ZA2 B;  4UOG A;  2ILY A;  3H7H B;  4DUY F;  1RHM B;  1JLG B;  3PX4 A;  2XMU A;  1K9M T;  4ECV A;  2UUA F;  2EG2 A;  4ZPA A;  3THT A;  4ZLP A;  1T9U A;  4ELT A;  4DR4 J;  1AT1 B;  4AL7 A;  5I3Q A;  2IJR A;  2YNH B;  2DO0 A;  1TFW A;  5H9F J;  2A18 A;  3DRS B;  3HSJ A;  2MYF A;  2ILZ A;  1KEK A;  3MM7 B;  4JOU A;  2XI2 A;  3DXB A;  1B7Y B;  3RW7 A;  3C6U B;  4A8M P;  4E98 A;  4WII A;  5CAA A;  2IHR 1;  3PEH A;  1HI1 A;  4DN0 A;  1VRU A;  2R7R A;  1WEY A;  2KG0 A;  4DR1 J;  2K3K A;  3CNQ P;  1RT5 A;  4FYW B;  4RL1 A;  3DOK B;  1RAJ A;  3DYA A;  4V1A k;  3NXZ A;  2M9K A;  5BYQ A;  1HNW J;  3PW5 A;  4UST A;  3BQ1 A;  3AAW B;  4Z37 A;  2ZOM A;  4OZ1 A;  1GMV A;  3UCG A;  3RBE A;  3V81 B;  2IRU A;  4Y2K A;  4X64 F;  3EWG A;  4I2P A;  3R27 A;  1K1S A;  2PI4 A;  1DTT A;  4MK8 A;  4UOC A;  2DH8 A;  1N5Y A;  2V8D A;  4JUZ A;  3Q24 A;  1PKU A;  5FD1 A;  2VIH A;  1VDH A;  3N0V A;  3KUE A;  4GKJ J;  4I56 A;  3MHY A;  3HHN B;  3DLK A;  4ZIV A;  2EPI A;  4K4Y A;  3ZZR A;  3PDN A;  5KOW A;  3BSC A;  2PO4 A;  4JI6 J;  1X7V A;  3B8H A;  4ECW A;  2R7O A;  2BW7 A;  4OI4 A;  1MNE A;  4RO0 A;  1SKW A;  3M8Q B;  4DXL A;  2RDD A;  3QRR A;  1JXE A;  2J9D A;  4WKR A;  1R8P A;  1TV6 B;  5KFF A;  2FB0 A;  5DDO C;  3KHL A;  1RXO B;  3I87 A;  2YQ0 A;  1DTQ B;  3DLE B;  1FRL A;  3CGI A;  4OZ3 A;  4WIQ A;  2HQC A;  3NOC A;  3TJ9 A;  4Y65 A;  1F6T A;  3E01 A;  3AQO A;  4WK3 A;  2DRB A;  3F41 A;  5CYM B;  1FF2 A;  4BDP A;  3LP2 A;  2DR8 A;  3WIV A;  4DR4 F;  3JTP A;  4B3R F;  4ZPW R;  4RW7 A;  2FLN A;  2HQ3 A;  2J9D E;  4F8R A;  2HVD A;  1UMJ A;  4I0W A;  1BMQ B;  3OHB A;  1IKX A;  5D77 A;  1OY8 A;  2F9J A;  5D4O A;  1KOO A;  3ILI A;  1C1C A;  4LSN A;  2BAN A;  3LWM A;  5C25 B;  4RUB A;  4K50 A;  3HXM A;  4RW9 B;  4K59 A;  4P2M A;  1YKW A;  1LWF A;  1U02 A;  1U0H A;  1HNW F;  3DI6 B;  4Y0F A;  1TKZ B;  3SSS A;  1YX2 A;  5A6P A;  5CCM A;  2XTJ P;  1VK8 A;  5A8R A;  3LAL A;  2BJ9 A;  4ZP7 A;  4ATN A;  2W2Q P;  1WC0 A;  1JX4 A;  4F50 A;  2ZOF A;  3HFK A;  2CQ4 A;  4F2R A;  2CNK B;  2BUN A;  4N47 A;  4DOZ A;  2CG8 A;  5GAG U;  1RT2 B;  4DV1 J;  4DL2 A;  2EFO A;  2DH9 A;  2UVU A;  1SUQ A;  5HMZ A;  1M1G A;  4WPA A;  2W4P A;  3QSY B;  2GMH A;  2MY8 A;  3G2X A;  2OFG X;  4KGM A;  3PVX A;  1JJH A;  2RUG A;  4JI6 F;  3MXH P;  2D3O 1;  1QAJ A;  3D0G E;  3JTN A;  2UUB J;  2VFR A;  3PW0 A;  1M5V C;  4B9U A;  4ZVP B;  3DGV A;  4M63 A;  4AL6 A;  3TR5 A;  1KQG B;  4LF7 J;  4DBQ A;  3T1A A;  5KT2 A;  2LYV A;  2V67 A;  4NA1 A;  1NPK A;  1JLQ A;  3KLI A;  2VPZ B;  4WKY A;  2MKI A;  1A6L A;  1NKB A;  1UW9 A;  1EB0 A;  1D9D A;  1N34 F;  4WF9 Q;  2MJN A;  5CH7 B;  2YPY A;  3MED A;  1M5P C;  1I51 B;  3HHL C;  3R7B B;  3EDR B;  4ZVH A;  2ZBP A;  2NXE A;  1RT5 B;  3T5K A;  5KFZ A;  4JI5 J;  3DYA B;  4TNO A;  2P2C B;  3IR7 B;  5LM7 E;  4MTP A;  2H48 B;  3R1H A;  1IR2 A;  1PAE X;  4OJH A;  4WFN Q;  3M05 A;  2W9A A;  4LF9 J;  2RH3 A;  1RK8 A;  3PV8 A;  4J9Q A;  1DTT B;  3OLA A;  2UU9 J;  1N5Y B;  1KVI A;  2CFX A;  2PA8 D;  4XDD A;  2BM0 A;  2D1C A;  2V2Q A;  3DLK B;  1DQA A;  3H42 A;  2GX8 A;  4HH0 A;  4PQU A;  2XNR A;  2JLG A;  2ALZ A;  3W5Z A;  1OPI A;  4DPY A;  1KTQ A;  4J5O A;  2PN6 A;  2JNJ A;  2R42 A;  4U7U D;  3R3T A;  5E0O A;  2DRD A;  3ZZO A;  1WG1 A;  1LWE A;  1L3T A;  4GKK F;  2MKH A;  1S10 A;  1Q4R A;  3RAQ A;  4WYW A;  3VAH A;  1EQM A;  4LR7 A;  4A8Q A;  2Q79 A;  3DDN A;  5A8K B;  1JWW A;  2XMW A;  3QMQ A;  4ZCM A;  4DV1 F;  3G4S S;  2KZM A;  3BS9 A;  2R4F A;  1S6Q A;  3QJL A;  2D9O A;  2U2F A;  1J2V A;  1F1B B;  1K0V A;  3FCH A;  2KVI A;  5HJY A;  4RNH A;  3NBP A;  3C16 B;  1M5K C;  3K58 A;  2FD2 A;  5IM0 B;  3D5M A;  4IO9 Q;  3KK1 A;  3V6D A;  5KFE A;  3D9B A;  2UUW A;  1VC0 A;  3NS5 A;  3MPU B;  4DN9 A;  3M2R B;  1IKX B;  4OZ5 A;  1VQN S;  1QUV A;  4YOE A;  4ICL A;  2ROE A;  2BAB A;  2BJE A;  1NDC A;  4H4M A;  4NLS A;  1C1C B;  2GFF A;  4QCL A;  1PYS B;  1WD6 A;  3IBC B;  2VQF J;  2LEC A;  2XZD B;  5AXK A;  2C3P A;  2HHT A;  5GAG I;  2QA1 A;  3ZO7 A;  4Y34 A;  1LWF B;  1U0H B;  5B08 A;  1IKV A;  3AFG A;  4NOH A;  2Z0G A;  2NXN A;  4ED3 A;  5ETT A;  1WC5 A;  5DLG A;  5A8R B;  4DSJ A;  4KRW A;  2IBO A;  4HL9 A;  1RAF B;  3EXY A;  1N33 J;  1HLW A;  2A10 A;  2DK2 A;  4MAK A;  4GO7 X;  2IA0 A;  4XPC A;  2BOP A;  3TNV A;  3EX7 B;  5F3Z A;  2MQO A;  3AD9 C;  4EO8 A;  3TAQ A;  2FZK B;  2R8G A;  1O8B A;  2M8H A;  5GME A;  3TWZ A;  2YX1 A;  4DV5 F;  1TR0 A;  3QID A;  1XN9 A;  2DNL A;  2GGP A;  2XMT A;  5IS2 A;  1T02 A;  3G8Q A;  2R9L A;  1HBN A;  5BYS A;  2H4Y B;  1WI8 A;  5M2U A;  2ZHA A;  4IG3 B;  2HUR A;  3BKU A;  3FQL A;  1HNV A;  1JLQ B;  5KFH A;  5B0E A;  1O5J A;  2J0X A;  2D7S A;  3OR1 B;  2CPF A;  4X65 F;  1RQ0 A;  4XPE A;  3CUL A;  1UJ4 A;  4J9L A;  3C14 B;  2CG4 A;  3D0H E;  4CLP A;  4EFA C;  3TZZ A;  3FBE A;  5E7O B;  3RG6 A;  3A1Y G;  3KLE B;  2HGM A;  3D1O A;  4GVL A;  4NRU A;  5KT6 A;  4F4X A;  3I0R B;  2R3V A;  4KTQ A;  3P3D A;  5BR8 J;  3G96 A;  3BYP A;  4ZN3 A;  4YQW A;  2HS3 A;  2XZW A;  4ZHR B;  1S48 A;  1RHQ B;  3AB4 B;  4FPI A;  5ETS A;  2HNZ B;  3RAX A;  3R6G B;  2Z2Y B;  4OI0 A;  1SJ1 A;  2DNK A;  2ZKT A;  3Q89 A;  4OYP A;  4Q5V A;  1FTR A;  2BXJ A;  2CPD A;  4U96 A;  4JI3 J;  4ILL A;  3DXS X;  3M8W A;  5IV3 A;  5DG7 A;  4DZ6 A;  1CJK A;  4J9P A;  2RF2 B;  4CO3 A;  2AMC B;  2HS0 A;  2KI2 A;  2AJ0 A;  4QWC A;  1CQM A;  4PQU B;  3CCW A;  2BQU A;  5AE1 A;  4IFY A;  2RT3 A;  2YNF A;  1SC4 B;  3D28 A;  2JEF A;  3G6X A;  3A3P B;  5DDQ C;  2O3D A;  1EQ0 A;  4ED4 A;  2BE9 B;  3M6U A;  3K59 A;  2E5I A;  2L3M A;  4P75 A;  4QIF A;  2VBW A;  2HVI A;  3MFH A;  3FEX B;  1U6F A;  3QIP B;  1F9F A;  5DGB A;  9RUB A;  3HF5 A;  4XAK A;  4ED7 A;  3MDF A;  4QPX A;  3A8J A;  4QWE A;  2ZH5 A;  2MGZ A;  3W5Y A;  2AGQ A;  1TTH B;  2Q43 A;  2OPP A;  2OSQ A;  4MH8 A;  4M95 A;  4LJM A;  2F3J A;  1NME B;  1VR6 A;  3W66 A;  4A46 A;  3FCW A;  5HP1 B;  3AJ2 A;  1U7L A;  3RZA A;  3PCO B;  4M5D B;  2Z8Q A;  2ZH1 A;  4V19 X;  3CJK A;  3BR8 A;  1HKA A;  3VGV A;  3KK1 B;  1WF2 A;  3FRY A;  1QSS A;  2CQD A;  1T03 A;  1P9Y A;  3T5J A;  5LT5 A;  4LFB J;  2FJE B;  2VKR A;  3M8P A;  3HVT B;  4M5I A;  2DY1 A;  4HI2 A;  4ICL B;  4OYB A;  2HHH F;  1SKR A;  4H4M B;  4AL5 A;  3S01 A;  3OUY A;  3NGU A;  3N6M A;  3MMA B;  4OHW A;  4DQI A;  4WWS A;  2UVV A;  3CVK A;  4FDF A;  3DHX A;  5DG8 A;  4TLR A;  4NLP A;  2BE7 D;  2LEB A;  3D54 A;  1ZM2 A;  3Q2S C;  3O6Q A;  5HMY A;  1FXD A;  3OSP A;  1IKV B;  1UEK A;  3CF5 Q;  4NI2 B;  3KFW X;  3U1M A;  5IT0 A;  2JHE A;  5DET A;  1FNM A;  4FVC A;  2YBV A;  2F4V J;  4ANE A;  2FLP A;  3KK3 A;  1Q86 T;  3W7B A;  4O44 A;  3LA0 A;  1RYR A;  4LBP A;  2F8M A;  3VV2 B;  1XNR F;  4KB7 A;  1JMT A;  4WYL A;  2AX0 A;  4DPW A;  2XY6 A;  3T6J A;  2UVR A;  2YX4 A;  4C9D A;  2XS5 A;  1OJ4 A;  4MKA A;  3M30 B;  4USH A;  1TKT A;  2GJ2 A;  1D9F A;  4M5G A;  4OIX A;  1V5V A;  1AFJ A;  3I6P A;  5ITH A;  3R5A A;  1U48 A;  1FD2 A;  4NCA A;  2V50 A;  4G1Q B;  3R2D J;  4NZ0 A;  4J90 A;  3SCL E;  3GP9 A;  1DQ8 A;  1YBA A;  1HNV B;  2AYG A;  1XMQ F;  2B9W A;  4ED2 A;  3UW1 A;  1X0P A;  3ETM A;  2QEX S;  1VRQ C;  1KQS R;  1FXL A;  1WC1 A;  3GTY X;  2IY5 B;  2MJU A;  2G2Z A;  1G1X A;  5AJ3 J;  2M5Y A;  4G1P A;  4CLL A;  3PKY A;  1VGY A;  3N9U C;  1BHN A;  2D3U A;  1XNQ J;  3MPV A;  3QWP A;  3GMG A;  4B9S A;  4KPC A;  3CJ0 A;  4DQS A;  2D3O R;  2HKE A;  3L7P A;  3G8S A;  3HCX A;  2I5J A;  2MZR A;  3KG4 A;  5J1E A;  5LOQ A;  1I1G A;  1ELO A;  1YIJ S;  4MJK A;  2AEM A;  2APO A;  1IBK J;  4QOT A;  4CQ1 A;  2BZ2 A;  1VQ5 S;  4LFB F;  3MMB A;  1NHV A;  1NND A;  4IRK A;  1Q7L B;  3S1T A;  2B9X A;  4I6W A;  2HLU A;  5IC4 B;  4CO1 A;  4CLT A;  4ID5 A;  2HHS A;  1G7C B;  2OPQ A;  4WK1 A;  3GE9 A;  1BGX T;  1M1H A;  2WZ1 A;  5EX0 A;  4IFY B;  4G3I A;  2W25 A;  2JX2 A;  4A8F A;  3HM9 A;  1PIL A;  2ZM6 J;  2FHM A;  4AUK A;  1JIH A;  4CRJ A;  3T1Y J;  3NP5 A;  2ZC4 A;  3UPF A;  4DI6 A;  1VLO A;  1LWX A;  4C0H A;  7FD1 A;  3I55 S;  1AXQ A;  5EHH A;  5HJX A;  1SH3 A;  1RLC L;  1IJE B;  2MGZ B;  4Q8F A;  5T14 A;  2ZZN A;  2XLK A;  3BPD A;  1URN A;  4FN5 A;  1VC6 A;  2OPP B;  1MSW D;  1HD1 A;  1T7P A;  1S5Z A;  4ZN1 A;  2QJ3 A;  2B51 A;  3PJ9 A;  4ECR A;  2AYE A;  2VB6 A;  3AOC A;  3UN3 A;  4LF2 A;  4O3P A;  1GQE A;  4DHV A;  1QM9 A;  2DNZ A;  2XBP A;  3FMW A;  3VAM A;  4KV8 A;  3AXM A;  4FS2 A;  4KHR A;  3CJK B;  4MMO A;  1LXN A;  3GV5 B;  4OJ3 A;  2ACM A;  1T03 B;  2IRX A;  2HAI A;  3CXC R;  2E9R X;  3GYX B;  5KT7 A;  3IWN C;  3M8P B;  3KJF B;  5K8P A;  4DZD A;  3BQ2 A;  2DTJ A;  3BBB A;  3DOL A;  3NCQ A;  3ZTR A;  2DIU A;  4QU7 A;  3OUY B;  3MM9 A;  1ZAW A;  3TAP A;  2UUC J;  2H1Y A;  1XNQ F;  4NRT A;  5T41 A;  2QTW A;  4RNF A;  4FKY A;  4K4S A;  2FC9 A;  4DV2 J;  4ILM A;  2C2N A;  3Q2T C;  1N52 B;  2B4U A;  1IWA A;  5J1P A;  2YKP A;  4DSF A;  2P8I A;  1UL3 A;  3DU5 A;  1EKS A;  3OVS A;  2H4W B;  2R7X A;  4ZVF A;  5LL6 d;  3PYF A;  3CJ5 A;  5F8M A;  2KXN B;  4DF8 A;  3PJX A;  2W01 A;  3NWG A;  1PJ6 A;  4ZVS B;  5HVF A;  1WOP A;  2R7W A;  4GC7 A;  3GFZ A;  4WTO B;  1B99 A;  3D1H A;  1TKT B;  1JXL A;  4CH1 A;  1WAC A;  2BYC A;  5I3U B;  2ZVI A;  3R5B A;  3N4W A;  2Q6B A;  4OZJ A;  2GNK A;  2ZE2 A;  3ITH B;  2G13 A;  2NS1 B;  1RWU A;  2QGF B;  5IQQ A;  4K5S A;  1LOU A;  1QJH A;  4LR8 A;  5F9L A;  4JI2 F;  3KOA A;  5KFV A;  2Q1L A;  3OHA A;  1BQM A;  2OPR B;  4GMK A;  2CQ1 A;  2C2E A;  2WAQ D;  2HZA A;  4YB1 P;  5EWG A;  2EFV A;  1MMN A;  3K89 A;  3RYL A;  4P52 A;  3HPO A;  1ZA1 B;  5HMW A;  3WX4 A;  5LSO A;  4I68 A;  2ATC B;  2MKK A;  1RIS A;  1Y4Z B;  1FE0 A;  2IM0 A;  3FDS A;  3IR5 B;  3G86 A;  5J1E B;  2VFU A;  2DRA A;  3SMZ A;  3UO0 A;  1XMO J;  2G9O A;  1VQY A;  5K9F A;  2YKN A;  4R25 A;  4C11 A;  3N5F A;  3VAK A;  4FF4 A;  2ZOG A;  3MMB B;  4PG7 A;  2E5G A;  1KLN A;  5D0E A;  4K2X A;  1VQO S;  2XMK A;  3MPD A;  4LFC J;  5KFN A;  1XC9 A;  1OYE A;  4ZPB A;  4NCB A;  2ASY A;  2UUC F;  3H20 A;  4ID5 B;  4BWJ A;  1OQ3 A;  4I4B A;  2OPQ B;  2CYY A;  2DR9 A;  1Y11 A;  4WXW A;  4DX7 A;  4P2F A;  4R0J A;  3Q8Q B;  2AZ3 A;  1S6P B;  1WKK A;  1U1L A;  1WWH A;  3O1L A;  1NH7 A;  2X7I A;  1JLB A;  1ZAX A;  2BKO A;  4KT0 C;  1D09 B;  4PWD A;  2V94 A;  1IM4 A;  2VG5 A;  4NEZ A;  1TU0 B;  3H5Y A;  3MEG A;  3MD3 A;  1WSV A;  2P9C A;  5JJB A;  1YVF A;  4E0D A;  2XYG B;  1ICE B;  5KFD A;  2FY1 A;  3W9J A;  1SQE A;  4A47 A;  4LIW A;  3PIP Q;  1QDU B;  2VOO A;  1RAI B;  1LNQ A;  2CAJ A;  4EMD A;  5KG5 A;  1FE4 A;  1V9O A;  1TL4 A;  3M1V B;  2A3J A;  2R8I A;  2E5J A;  2Z2Z A;  2HBQ B;  1RP5 A;  1ZPV A;  3CCE S;  2ACY A;  4DFJ A;  1AW0 A;  2EC2 A;  5IQ6 A;  3HVW A;  3W9H A;  4C2M A;  1R31 A;  2IMW P;  4KV8 B;  2OO4 A;  4Q0B B;  1MML A;  4UF4 A;  2DGX A;  4C97 A;  1NK4 A;  1SJR A;  4GRS A;  4NLG A;  4NX9 A;  2V8G A;  3C46 A;  2WCX A;  1VIX A;  2DHH A;  3OTC A;  1R7I A;  3DMJ B;  3MF5 A;  1NAQ A;  3QFH A;  3DOL B;  2DNO A;  1R43 A;  5KT5 A;  3HSG A;  2UXD F;  3PKM A;  1TUW A;  1QUP A;  4C8O A;  1AZS A;  1EIY B;  3MM9 B;  4RUH A;  3G8T A;  4L3K A;  2VQE J;  1YQH A;  1IKW A;  3IAS 9;  4QYZ J;  2E1P A;  2U1A A;  3CCQ S;  3EVO A;  1KVK A;  1JJ2 R;  2E9T A;  3I32 A;  4WFA Q;  2ABY A;  2CNO B;  1LW2 A;  3OL8 A;  3Q0A A;  4CLY A;  4J37 A;  2ASD A;  5F8N A;  2PI5 A;  3PRB A;  1B70 B;  3NWR A;  2WW4 A;  4U7C A;  3K5L A;  4LFC F;  1C4A A;  3VCD A;  5AE2 A;  3KK2 A;  1N56 A;  3ZNJ 1;  1Q81 T;  1U6Z A;  4NA2 A;  4F4W A;  3GON A;  4Y6I A;  3N5B A;  3HLU A;  3HHD A;  3UWT A;  4ED5 A;  5ETR A;  1T05 A;  1FA0 A;  2DNH A;  1S1T A;  2ZE2 B;  1VBZ A;  1T0T V;  3KDO A;  4I7F A;  4CIO A;  2COL A;  4Q8E A;  4DX5 A;  3W62 A;  4N76 A;  5KG2 A;  3QJJ A;  4C3K A;  2RUS A;  3M7V A;  1HR0 F;  1F60 B;  1ITP A;  4DSL A;  4G1I A;  3K5N A;  2R2S A;  2IM2 A;  2BJ8 A;  2C3O A;  4KH1 B;  1GXL A;  1BXN A;  2HWI A;  3M32 A;  1NSQ A;  5D78 A;  2UXB F;  5IOL A;  1S1V A;  2HG4 A;  4RW6 A;  1TK8 A;  1P1T A;  4RLE A;  4EEY A;  2AYM A;  2E66 A;  3K57 A;  3AA8 A;  4ZPC A;  3FGV A;  4PXC A;  2YKN B;  4RUC A;  2EBG A;  1NK7 A;  3W9I A;  2YQ3 A;  1GMW D;  1SV5 B;  2HBZ B;  2NR0 A;  3IG1 A;  3BB5 A;  3CCV S;  2PA3 A;  4WXO A;  1XR7 A;  2CWK A;  1UWB B;  2FYX A;  4PG8 A;  2VQE F;  4DV3 J;  3AOD A;  2J5A A;  4WP8 A;  2XY5 A;  4QIE A;  3EIC A;  1YJ9 S;  1N5T A;  1IN0 A;  3T1H J;  2QC3 A;  4Y2M A;  2HEK A;  1F3V A;  1JLB B;  1AUD A;  3KUH A;  5G0R B;  2G2Y A;  1HYS A;  1KR4 A;  4ED6 A;  3QT5 A;  3I4P A;  2VG5 B;  3WQP A;  1FEH A;  3H8Y A;  4DUZ J;  3W2W B;  3AJD A;  1EHW A;  2Q6C A;  1VJQ A;  3MM6 B;  2CPH A;  4NZ6 A;  3HD1 A;  2X3D A;  1HHT P;  2RHS B;  4YP3 A;  1CEZ A;  1H3D A;  3AOA A;  3LO3 A;  1NDK A;  2XCP A;  4WU2 A;  3PFE A;  5KFY A;  5HAO A;  1TL1 B;  3HKW A;  4ECY A;  1WDT A;  2CQ3 A;  2FHJ D;  2HND A;  4NLW A;  3LQV A;  4MIW A;  3KHG A;  3KJQ B;  4NYP A;  1Y5I B;  3FEY B;  2CDQ A;  4HVZ A;  2XWX A;  4DFP A;  4V19 J;  5B0A A;  4M5J A;  5F41 A;  1UZD A;  4O0N A;  3I96 A;  4F3O A;  1Y7P A;  3UQS A;  2HHW A;  2LFV A;  1SVD A;  1D8Z A;  1RKI A;  2EI5 A;  3E8O A;  3H59 A;  2MST A;  3G82 B;  5F0U A;  2KFY A;  3MFI A;  3SV3 A;  4K5R A;  1V3Z A;  4EBE A;  2HGN A;  2VC1 A;  3DDK A;  1X4G A;  2CZ9 A;  2YY3 A;  3J81 U;  4OHZ A;  1QY7 A;  2WTF A;  5LMN J;  4GO5 X;  3F73 A;  5GMK a;  1OSD A;  4TU8 A;  2C2D A;  2YH1 A;  4O4G A;  4U95 A;  5M2R A;  4Y00 A;  4DEZ A;  4OZL A;  2IMO A;  2ZDO A;  1GT8 A;  5LXY A;  3KHH A;  3OTO J;  4ZVQ B;  2FJV A;  2WBR A;  4DV3 F;  4P6Q A;  2XMA A;  2HPU A;  3IRW P;  4JV5 J;  1R6V A;  5LJ5 Y;  1R8A A;  1T05 B;  3LPY A;  1T9W A;  3PYE A;  7AT1 B;  4IOC Q;  4I7F B;  1TL5 A;  1QAI A;  2R7S A;  1IWG A;  4DUZ F;  4ECX A;  2Z58 B;  2H9Z A;  1TEL A;  4KGX B;  2KFN A;  1H2T Z;  1TMJ A;  2CAD A;  4OX9 J;  1HNI A;  1PIE A;  2GIF A;  4CO0 A;  1N36 J;  5L8R C;  4HH1 A;  4YUD A;  5C5J A;  1CJU A;  2VON A;  4BHQ A;  1TK5 A;  1U2R A;  2RHQ B;  4MK7 A;  4L6V 3;  1TZ0 A;  4F0K A;  1H2U X;  5KFK A;  1U24 A;  3M32 B;  4EI2 A;  1RDR A;  1XMB A;  3R8Y A;  3BBF A;  2C2K B;  4A8K A;  1S1V B;  4RW6 B;  2AJ1 A;  2OPS A;  4ENO A;  1U1O A;  3MEC A;  2QN6 B;  3H98 A;  1KKH A;  2OEL A;  3D2W A;  1WC4 A;  1J5O B;  1LK7 A;  2R8J A;  3UNY A;  1KC8 T;  2WHO A;  1CSJ A;  3TAM A;  5HAT A;  3R97 A;  3IG1 B;  4NXM F;  1L3S A;  2F9D A;  2IM1 A;  3NCR A;  1VRT A;  2P6T A;  2FJA B;  3I5A A;  1FRX A;  4B3S J;  2MQP A;  1C0T A;  1H98 A;  3M9N B;  1WI6 A;  4NZ7 A;  2R2R A;  2NYH A;  4QWD A;  5DRK A;  5DO2 A;  1RTH A;  1WG5 A;  2IVY A;  1FKO B;  3TZX A;  5K8N A;  4ED0 A;  3M4X A;  3H2U B;  2YNG A;  4DL7 A;  5MLC V;  4ES1 A;  1IR1 A;  5LMN F;  3CDE A;  4ZMM A;  3K8W A;  2QLX A;  2QZ8 A;  1FES A;  3SCJ E;  1HBM A;  4ZVR B;  2AYB A;  2HMI A;  4HHH A;  4JP8 A;  3FSX A;  5I42 A;  4DLE A;  1X9S A;  1B0T A;  2HFU A;  5D0G A;  4TYA A;  2F40 A;  4EO6 A;  2R7T A;  4USI A;  3DLB A;  2YVS A;  2VPY B;  1FD8 A;  3I4H X;  2GIQ A;  2GO8 A;  3QGG A;  4HHU A;  4CM0 A;  1NSP A;  2RRB A;  4DX8 H;  4YHH J;  1RKJ A;  1BY9 A;  2B7C B;  3CD0 A;  1S97 A;  1FNO A;  2KTQ A;  3MPW A;  4Q7A A;  3GZ7 A;  3PHE A;  1BUX A;  2MZJ A;  4OX6 A;  5D6G A;  4J9K A;  2N82 B;  2DIT A;  1ACM B;  3V4M A;  3CCL S;  2AJ2 A;  3DGP B;  3MTK A;  4RW8 B;  4N5S A;  3EZO A;  1QAY A;  3OR2 A;  2VL1 A;  2ZUA A;  5I4M A;  2DHG A;  1YJU A;  5AXL A;  1NK6 A;  2KVQ E;  3BDE A;  2DNR A;  1XBW A;  3Q83 A;  3GLJ A;  3I9Z A;  2C2M B;  1HAR A;  1P8G A;  5E3R A;  3BF4 A;  1S12 A;  3GYN A;  4NML A;  1UA0 A;  2EVZ A;  1B7F A;  2B3T B;  3VVU A;  5IT4 A;  2AGO A;  4EZ9 A;  3FKB A;  3C2P A;  3UFC X;  3TZW A;  4X4Q A;  3V4I B;  4YB6 A;  1HI0 P;  1D3W A;  2NLW A;  3CED A;  1U47 A;  4JYA F;  1ZM9 A;  3IGN A;  2L9W A;  3AQP A;  4O3N A;  3AY0 A;  7FDR A;  3VGU A;  4Y28 C;  5KFX A;  5ETV A;  2X1F A;  3W61 A;  4HT5 A;  1MU2 A;  1LFP A;  4DCJ B;  4LRE A;  3RGI A;  2J7U A;  3FQK A;  4NWB A;  3US5 A;  5RUB A;  3SFU A;  5IT9 U;  2AJ4 A;  2DNN A;  3BV8 A;  1HNI B;  3JSM A;  1GFW B;  3S8S A;  4DV7 J;  1KRP A;  4YY3 J;  3SFG A;  4AXI A;  1S1X B;  3CT9 A;  2ZH6 A;  4DG1 A;  1T3O A;  4OX7 A;  4KIA A;  3HSD A;  4CP5 A;  1TKX A;  4H4O A;  4U9R A;  4QIG A;  3MEC B;  3GFY A;  2JSX A;  4OI6 A;  4ETX A;  3SEO A;  1S0N A;  1A0O B;  5HRO A;  3HMJ G;  2O67 A;  5THW A;  2EKN A;  4NLR A;  3J81 Y;  5CCL A;  4WFY A;  3FFI A;  2DBB A;  1FKP A;  3BGR A;  1U26 A;  4M5N A;  2CPE A;  2WOM A;  4YR3 A;  3NEK A;  4OHY A;  5KFP A;  2G4B A;  3WBZ A;  2M8D B;  3LP0 A;  1Q16 B;  1S7H A;  4C8N A;  1KON A;  2VHG A;  3LUY A;  2RKI A;  4IH5 A;  4LF6 F;  5E5N A;  3VQS A;  2P6S A;  2YNG B;  2J0S D;  1S9G A;  4LVN P;  1F0X A;  1HBO A;  3BO2 A;  4CTA B;  2DHX A;  1NJY A;  1ZM3 A;  5LSL A;  3E51 A;  2DGO A;  3O8W A;  3BKF A;  3ZXW A;  3DLG A;  1UEU A;  2VJV A;  2CVE A;  5A8W B;  3GII A;  2DXF A;  1HBM B;  1W25 A;  5T7L A;  5D8H B;  4P71 A;  2NUH A;  1RTJ A;  2HMI B;  5CZX A;  2XWY A;  5I42 B;  1TP7 A;  4ZVG A;  4B9V A;  2KZZ A;  3DKD A;  4OYO A;  4OZ0 A;  1G3O A;  2VAS A;  1JNZ B;  4HKQ A;  2VV5 A;  2HQD A;  3H2L A;  1PCA A;  3RRK A;  5FJ4 A;  4F3Q A;  2XGP A;  4LFA F;  1Q8K A;  2AJF E;  2YX7 A;  4P73 A;  2GIR A;  2A2D A;  2LXI A;  5KFU A;  4I64 A;  2RQ4 A;  4DR2 J;  4ETZ A;  3OFH A;  1S7I A;  2DGS A;  3MTJ A;  2E1M C;  1LEO A;  1S0M A;  4PUO A;  4PWU A;  5CXT A;  1Q82 T;  3OR2 B;  3BSN A;  2HQF A;  2Y1J A;  2I1R A;  1V6H A;  5DZ6 A;  4TYB A;  1D8Y A;  2XSJ A;  1HHS A;  3QGI A;  3MM7 A;  3OFE A;  1RLD A;  3PAC A;  4RW4 B;  1X60 A;  4IQX A;  1VIS A;  8ATC B;  3PW7 A;  1K8A T;  3F0N A;  3BSO A;  3UR3 C;  1JXV A;  4QYR A;  4UW2 A;  4KKO A;  4ZCI A;  2UXC J;  5HN0 A;  2WRM A;  4CT9 A;  1ZBT A;  2I6W A;  2R2T A;  1YLX A;  3LP1 B;  2DCL A;  1QSL A;  1VS3 A;  3EGW B;  1LWC A;  2YH0 A;  2I0X A;  2F4F A;  3V81 A;  1RHK B;  3PRD A;  3CMA S;  2V2K A;  2NRE A;  3SSR A;  1VQ8 S;  2XS2 A;  3JSM B;  3UNG C;  4ID8 A;  1UPM B;  4DUY J;  1ZPW X;  3GB0 A;  4MIA A;  4KR0 B;  4RR5 A;  3DDI A;  4CH0 S;  4AE5 A;  2YWG A;  5G4D A;  2UUA J;  1Q53 A;  4PG6 A;  3CDW A;  1TKX B;  4TXS A;  2IC3 A;  3GR0 A;  2CVI A;  2Y8W A;  2V68 A;  1URR A;  3OJS A;  2IAJ A;  3IBF B;  1EJ7 L;  2ZH8 A;  4RUA A;  4AQY J;  1SQG A;  1T9X A;  2NSB A;  3CCT A;  4DR2 F;  1DTQ A;  3FFI B;  1FKP B;  3QZ8 A;  3ICL A;  3HP6 A;  2PII A;  1DRZ A;  3JTO A;  2HZC A;  1WKL A;  2UZA A;  1RAB B;  3LP0 B;  2EFN A;  4WTY A;  5HQL A;  5L9X A;  4CI0 B;  4CZC A;  2PEH A;  3KMS A;  2OJ3 A;  1IBC B;  3TUJ C;  3OT9 A;  2RKI B;  5F8J A;  3DOM A;  5F8L A;  2ZWP A;  3FBC A;  2NZ4 A;  2C28 A;  1S9G B;  4F36 A;  1VQ4 S;  2QX0 A;  1FRM A;  5EWE A;  2EG1 A;  4U8Y A;  1NM2 A;  2POK A;  5DZ7 A;  2B9E A;  3B54 A;  2CQG A;  5A76 A;  1UPP A;  2MKS A;  1QE1 A;  2IFX A;  5KFB A;  3DLG B;  3OSN A;  4X64 J;  1NH8 A;  1RAG B;  2DB1 A;  1VHF A;  4ZLN A;  5C25 A;  5IT9 Y;  1VFJ A;  4F4A A;  5T7L B;  6AT1 B;  2HZV A;  4QIW D;  1M1K T;  2UXC F;  2D9P A;  3CB4 A;  4K4W A;  1S1W A;  4WE1 B;  2N4C A;  4P7T A;  3M9M B;  4X84 A;  2EWH A;  1IVZ A;  2ZZM A;  3DI6 A;  2N3O A;  4HTI A;  3NGT A;  1SJQ A;  2CXE A;  3P8B B;  4EYH B;  3QGH A;  5I3P A;  5B0C A;  3PY8 A;  4Q2M A;  2X51 A;  3UD5 A;  3KNG A;  3KLH B;  1X8D A;  3ISN C;  3SDE A;  2AJQ A;  3FC9 A;  1S49 A;  5J1N A;  1WTF A;  3RB6 A;  2AEF A;  3BEG B;  3KG1 A;  3EE3 A;  4J9S A;  2CJ9 A;  3L95 X;  4MYT A;  1ZYQ A;  1FJE B;  1R8H A;  4PUO B;  2CA9 A;  2G0I A;  1B4S A;  1KQF B;  1D0E A;  2C3U A;  2VOD A;  3TP2 A;  1VBY A;  4I2Q B;  2IYG A;  2RVJ A;  4B3R J;  1RT7 B;  2MPU A;  2GML A;  4X4P A;  2XSJ B;  1WSR A;  4E2F B;  1WOR A;  2HWH A;  2GQC A;  3WX8 A;  3IA0 A;  3ILO A;  4AQY F;  2OAU A;  3MM5 B;  2EC0 A;  3R5J B;  4MK9 A;  3NOG A;  5KTQ A;  2HRT A;  3B4D A;  3GSD A;  2D69 A;  1KN6 A;  3GCX P;  5E2Q A;  3GQC A;  5C24 B;  2FC8 A;  4KKO B;  4OZ2 A;  2VC0 A;  3QZ7 A;  2N3L A;  1YI2 S;  1YJW S;  1Q7Y T;  2XC9 A;  5LMU F;  4L3N A;  3MM8 A;  2PMZ D;  1HL6 A;  3GU0 A;  1IR0 A;  1FDB A;  1WOS A;  2C2Z B;  2DIS A;  3VVT A;  3M8S A;  1ZET A;  1S72 S;  2J7K A;  1GK8 A;  3MOZ A;  2DNG A;  1LWC B;  1N54 B;  1OY9 A;  4U7U K;  2PD1 A;  1PJ5 A;  1X9M A;  1SC3 B;  1K0T A;  5HMX A;  1UVI A;  3TUI C;  1VHI A;  1M5O C;  5CYJ A;  2E5L J;  2LQ9 A;  1KFD A;  3H5S A;  2H5E A;  2A6O A;  2IDL A;  4D3H A;  2JEG A;  2QYG A;  3ZC4 A;  3HHL D;  4HLB A;  4KJI A;  2C3Y A;  1FFS B;  5GAE U;  1HNZ J;  4FNI A;  3VAG A;  2AWZ A;  5IC6 B;  1SXL A;  2IC3 B;  4P7V A;  5IV4 A;  1N8R T;  1S0O A;  4JI1 J;  1REG X;  3KLG A;  2HWT A;  1RU1 A;  5KG4 A;  3W63 A;  4IDK A;  2OEM A;  3M6W A;  5A8K A;  2IAJ B;  4P2S A;  3M6V A;  1NPR A;  2V6A A;  6FD1 A;  2Q3P A;  3HSZ A;  4ELV A;  1JJC B;  1N34 J;  1EAY C;  3GIK A;  3IR6 B;  5B0G A;  4YFU A;  4ZIT A;  4PQA A;  4DQP A;  4LF4 J;  3A8K A;  4KYZ A;  4ZP6 A;  1XK8 A;  4LQ9 A;  1CC8 A;  1N5S A;  3OLB A;  4MIB A;  1VMB A;  2GV1 A;  3VTI A;  4X4T A;  3W3S A;  1NRK A;  2XY7 A;  1FKA F;  1U25 A;  1RAE B;  3C16 A;  2OH2 A;  1FTC A;  1FDN A;  3DOM B;  5LXR A;  5IM0 A;  2LQJ A;  4EZ6 A;  1O0P A;  2F5G A;  3BR9 A;  1Q8I A;  3BPS P;  4MYU A;  3SQG B;  1C4C A;  4LF8 J;  1T95 A;  4K4T A;  2H5J B;  3HVR A;  2FJX A;  4Z7C A;  3M2R A;  1IUJ A;  1QE1 B;  2V5H G;  4JV1 A;  4J91 A;  2FZG B;  4GVB A;  1NUE A;  1SKS A;  3TVY A;  3BSA A;  1U0S A;  2IRY A;  4J9V A;  2CWX A;  3Q8V A;  1VBX A;  2RS8 A;  1S1W B;  2Z57 B;  5CD4 A;  1FNX H;  2ZUG A;  2KRR A;  3NS6 A;  3ENQ A;  1FO1 A;  1ZH5 A;  4AFF A;  2QL9 B;  2HFO A;  2KFZ A;  3P6Y C;  3UD3 P;  4GKK J;  3NS7 B;  3BH7 B;  2LU1 A;  1U1Q A;  3L09 A;  3ET6 A;  2D41 A;  5L1I A;  3GCW P;  1U8S A;  2IBK A;  3L7U A;  1UCN A;  3SDE B;  3LWL A;  4I67 A;  4CDI A;  4DPU A;  2QFI A;  5KAK A;  5ETP A;  3GV7 B;  2E5L F;  2NPI A;  1B3T A;  4PPD A;  4OYZ A;  2J0W A;  3KNA A;  3PW4 A;  3TUP A;  3NNA A;  1RSC A;  4DV0 F;  1HNZ F;  4OYA A;  3CUN A;  1KDN A;  3DM2 A;  4FVM A;  2D74 B;  4ALZ A;  4FPR A;  1G6B A;  1FWP A;  2L08 A;  2V8P A;  4JI1 F;  4IG3 A;  2AV5 A;  4IUF A;  4PXB A;  4RWW A;  3DRP A;  4OYX A;  3OR1 A;  3K5O A;  2GHP A;  1RBO B;  2JVR A;  4TU9 A;  1X4H A;  1REV A;  4OLP A;  3J81 j;  3PW2 A;  3C14 A;  1FER A;  4LF4 F;  3KLE A;  3BJY A;  3ENW A;  3ISZ A;  2CJY B;  1N5Q A;  1WG4 A;  1N6Q A;  4OX8 A;  2UP1 A;  2FVR A;  2EFG A;  3MM8 B;  4TLQ A;  3I0R A;  1PC4 A;  1EAR A;  1HI8 A;  1LKZ A;  1YJT A;  2LQ8 A;  3MZI A;  2MKC A;  1UJ6 A;  2UV8 G;  2WB4 A;  3MAA A;  5GAE I;  1OY6 A;  2WVF A;  4LF8 F;  4ZHR A;  4JI0 J;  2ZH9 A;  2MXY A;  2E44 A;  2HNZ A;  3M2V B;  4YN3 B;  3I5B A;  1FRH A;  1HMV B;  1WJ9 A;  1U4B A;  1FVS A;  1FT8 A;  3ADA C;  5GAH U;  3OVB A;  3BGO P;  3IM9 A;  2RF2 A;  1E6V B;  3GIR A;  3CO0 P;  3VQT A;  2DVI A;  4UUX A;  5IWA F;  2HHP A;  1T9V A;  1SH2 A;  4DV5 J;  5CA5 A;  1FRI A;  1M90 T;  4YME A;  5H9E K;  4NMX A;  1X4F A;  2LDY A;  2JEJ A;  4BLG A;  2FTR A;  2E1R A;  2DEI A;  1GTH A;  3AXK A;  1DZ5 A;  1LK5 A;  3KLG B;  1L5U A;  5H1S V;  5KT4 A;  2BJ1 A;  2F1F A;  4IDK B;  2XG8 A;  4JBC A;  3QIP A;  4EBC A;  3VAF A;  4IOA Q;  1N88 A;  4R5P A;  2DHS A;  5LSR A;  1G2E A;  5KFQ A;  1H2V Z;  1NPP A;  4FBU A;  1AFI A;  2ZBQ A;  4X65 J;  2BX6 A;  3PYG A;  1FJG F;  3BYR A;  4DS4 A;  1RUS A;  2W4D A;  1KSP A;  3W8G A;  5HLF A;  2ZH4 A;  5B7W A;  3H0P A;  4B17 A;  1N0U A;  5E3C A;  1NJZ A;  4C7Q A;  3IAM 9;  1IQT A;  3W8P A;  5HP1 A;  4XIU A;  4J9N A;  2Q66 A;  4M5D A;  4MKY A;  1TL3 B;  1BD6 A;  3LF0 A;  4HAC A;  4UQG A;  2BVZ A;  1AA1 B;  1WHW A;  2GA7 A;  3S6E A;  2B7B B;  1NU4 A;  5B09 A;  2KB2 A;  2CNN B;  3SXL A;  2IM3 A;  4ECQ A;  1RWX B;  4KGZ B;  2DD8 S;  2AP6 A;  2OSR A;  3D7S B;  3HVT A;  4TQR A;  4NAS A;  4GVB B;  4ZPD A;  2CKW A;  3POT B;  2HHU A;  1YTY A;  2GVZ A;  5B0F A;  3MMA A;  3MGJ A;  1UA1 A;  1NHU A;  1VIO A;  2LVW A;  4KFB B;  1Q8L A;  3PR5 B;  4DU7 A;  1YRU A;  3GG0 A;  3J7Z T;  4ILR A;  3H4D A;  4NI2 A;  2HNY A;  5KFT A;  2B4V A;  3TO8 A;  3EM1 A;  3RR8 A;  2HHV A;  1RT4 A;  3R5C A;  4JI0 F;  1IM6 A;  1L3V A;  3CSK A;  3ET6 B;  2YQ1 A;  4DR6 F;  4DPO A;  4QQB A;  5EX3 A;  2EBE A;  1YZ7 A;  5J2P A;  2FJD B;  1RHJ B;  3KWM A;  2C2O B;  4ZJO A;  4CH7 A;  3QJP A;  4ES3 A;  3R1L A;  3M30 A;  3AOB A;  2E1A A;  1EZZ B;  1H73 A;  5EUH A;  3Q8Y A;  3Q8S B;  3DM2 B;  1UVL A;  4DJB A;  2WSF C;  1MLA A;  4B3T F;  4OMF G;  4G1Q A;  4K4Z A;  3T3F A;  5GVQ A;  3H4B A;  3M6X A;  4FXD A;  2K1R B;  3T19 A;  4LQ3 A;  5EN1 A;  4PRF A;  3DRP B;  5GMD A;  4PXD A;  3GPA A;  5D4P A;  2KYZ A;  4ZCK A;  1D9A A;  1XR6 A;  2AT1 B;  1S0V A;  4CYU A;  4K7Q A;  2HVZ A;  1REV B;  3N01 A;  2HHH J;  4DL0 C;  3PM9 A;  2RDJ A;  2XCA A;  4CNZ A;  2Y1L B;  4P74 A;  2DNQ A;  2DCU B;  2ADB A;  4IR1 A;  1N6Q B;  1SKU B;  5GAH I;  2NZC A;  4PXE A;  4FP9 A;  2JLF A;  4ZJQ A;  2LQB A;  4F0H A;  4J9M A;  3MAA B;  1N32 J;  3N79 A;  3WC2 A;  1K1Q A;  3GIL A;  5ETL A;  3A8E A;  1NZA A;  4EU0 A;  3H40 A;  1XNR J;  5SZT A;  2CJA A;  3TA1 A;  2WSC C;  4I1T A;  1FJ7 A;  2KXH A;  4PG4 A;  2MKY A;  2BV3 A;  1GNK A;  1WHX A;  1H7X A;  3NMR A;  5E3A A;  4A8O A;  3WZ0 A;  3J7A N;  2UUT A;  3D3B J;  2OUG A;  4L74 A;  4LUB A;  3K2Y A;  3PZP A;  5AXM A;  5KG6 A;  4FYD A;  1SL1 A;  1OQ6 A;  1DUR A;  2CJB A;  1XMQ J;  3OW2 R;  3HD2 A;  3VAI A;  4AT1 B;  4R5P B;  2CQI A;  4C4W A;  3M2U A;  1MN9 A;  2XLI A;  4IR9 A;  1NZ8 A;  1C2P A;  3THV A;  2IA6 A;  4URS A;  1RWP B;  2OD4 A;  5HLF B;  3IRX B;  1HBU B;  1UJ5 A;  2W7A A;  2ZKU A;  1I3O B;  4A4J A;  4IRD A;  3QT6 A;  5LJ3 Y;  4CT8 A;  4FS1 A;  1HPZ B;  3MD1 A;  2JFK A;  2NCK L;  2QMU B;  1S9E B;  2GHW A;  3TVK A;  3FSI A;  2CPX A;  1KHV A;  1KQK A;  2J8S A;  1PGZ A;  2QLF B;  4HAC B;  2ZJQ Q;  4IH6 A;  3LAN A;  3OQ2 A;  3NKY A;  4XDC A;  3CJQ A;  1IKY A;  4EK2 A;  4QWB A;  1S4F A;  3HFV A;  1JKH A;  3C6T B;  5KFO A;  5BXI A;  3D6M B;  2GHV C;  4FZV A;  4USM A;  2GVZ B;  1E6Y A;  3U7J A;  3HZG A;  3JQK A;  1S4E A;  3A13 A;  1F2G A;  2LQ5 A;  1PJ7 A;  1RA7 A;  1SQF A;  2XO7 A;  1PG5 B;  2JJ4 D;  3MPY A;  1HD0 A;  4DSE A;  2ZBC A;  2RQK A;  2BAC A;  2HNY B;  2H54 B;  1RT4 B;  5KFI A;  1N32 F;  4UY8 T;  3TQE A;  2DNY A;  1W2I A;  2ZHB A;  3O2I A;  2H51 B;  2ZBI A;  3MUR P;  5J2P B;  1S1U B;  3TRG A;  4M5L A;  2FGC A;  2EFQ A;  1VC5 A;  4WP9 A;  1TQL A;  2HFV A; 
#chains in the Genus database with same CATH homology
 1NHK L;  3FBC A;  1LEO A;  1W7W A;  1ZS6 A;  4ANE A;  1EHW A;  3ZTQ A;  3EJM A;  4ANC A;  4FKX A;  1NLK L;  2NCK L;  4KPC A;  1MN7 A;  2ZUA A;  1F3F A;  1F6T A;  4F36 A;  1B4S A;  2VU5 A;  1HLW A;  3ELH A;  1NSQ A;  1S59 A;  1KDN A;  3B6B A;  3EMT A;  3Q8Y A;  3B54 A;  1PAE X;  4DUT A;  1NSK L;  1S5Z A;  5CAB A;  1NDL A;  2DYA A;  4UOG A;  3JS9 A;  2DXE A;  3Q83 A;  5IOL A;  2DXD A;  1NDK A;  3BBF A;  3DDI A;  1WKJ A;  3VGS A;  3PJ9 A;  3FCW A;  2DY9 A;  4S0M A;  2DXF A;  3FCV A;  4CP5 A;  4EK2 A;  4ENO A;  1NUE A;  3VVU A;  3WX8 A;  4F4A A;  1HIY A;  4UOH A;  1PKU A;  3Q89 A;  3G2X A;  4HR2 A;  2HVD A;  3ZTO A;  3Q8V A;  5BXI A;  1VYA A;  4WBF A;  3FKB A;  3VGV A;  1BE4 A;  1B99 A;  3DKD A;  4DZ6 A;  1NCL A;  3GPA A;  1XQI A;  2BEF A;  3MPD A;  1JXV A;  3ENA A;  3R9L A;  4C6A A;  3EVM A;  3FBB A;  3NGT A;  2CWK A;  2HUR A;  1NSP A;  3ZTP A;  1NDC A;  4O0N A;  3GP9 A;  3EM1 A;  1NPK A;  3Q8U A;  3NGS A;  3BH7 B;  3BBB A;  3VGU A;  3ZTR A;  3NGU A;  2AZ1 A;  3FBF A;  5C7P A;  3Q86 A;  3EVW A;  2AZ3 A;  2HVE A;  1NDP A;  2BX6 A;  3L7U A;  1NB2 A;  3PRV A;  1WKK A;  1UCN A;  1U8W A;  2B8Q A;  2B8P A;  3EIC A;  3ETM A;  3FC9 A;  3VGT A;  3ZTS A;  1BUX A;  1MN9 A;  5CAA A;  3VVT A;  1WKL A;  3BH6 B;  4W98 A;  1K44 A;  4DI6 A;  4FKY A;  1LWX A;  3EE3 A;  1HHQ A;  1XIQ A;  4UOF A;  3FBE A;  1S57 A;  3EVO A;  3BBC A;  4AND A;  1BHN A;  3NGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...