3BBHA

M. jannaschii nep1 complexed with sinefungin
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
Knots found
sequence length
204
structure length
204
Chain Sequence
b'TYNIILAKSALELIPEEIKNKIRKSRVYKYDILDSNYHYKAMEKLKDKEMRGRPDIIHISLLNILDSPINHEKKLNIYIHTYDDKVLKINPETRLPRNYFRFLGVMEKVLKGERNHLIKMEEKTLEDLLNEINAKKIAIMTKTGKLTHPKLLKEYDTFIIGGFPYGKLKINKEKVFGDIKEISIYNKGLMAWTVCGIICYSLSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosome biogenesis protein NEP1-like
publication title The crystal structure of Nep1 reveals an extended SPOUT-class methyltransferase fold and a pre-organized SAM-binding site.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 69
structure length 204
sequence length 204
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03587 EMG1 EMG1/NEP1 methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 3bbhA00
2I6DA 4MCCA 2V3JA 4YQRA 3IC6A 4YQIA 4H3YA 4JAKA 4YQ8A 3L8UA 3N4KA 1VHYA 4YQDA 1ZJRA 4CNDA 2EGWA 3AIAA 4X3LA 1UAJA 4YQ0A 3KNUA 3DCMX 2V3KA 4E8BA 4YQ1A 4YQNA 4YVJA 4XBOA 3AI9X 4YVIA 3O7BA 4YQLA 3QUVA 4YPYA 1X7PA 4KGNA 4YQKA 3KY7A 4YQ2A 4YVKA 5CO4A 4YQ6A 1NXZA 4J3CA 4YQBA 4CNEA 4JALA 3E5YA 4MCBA 5D9FA 3KTYA 3OIJA 4YPWA 4YQCA 3BBEA 1V2XA 5FAIA 3NK6A 4MCDA 1V6ZA 1P9PA 3N4JA 4IG6A 1MXIA 3ONPA 2CX8A 3NK7A 4YQTA 4YQ4A 2O3AA 4FAKA 4H3ZA 1TO0A 4YPZA 1J85A 3OINA 1O6DA 3BBDA 5GMBA 4RG1A 4YQQA 4YQGA 5GMCA 4YQ5A 4CNGA 1GZ0A 2Z0YA 1VH0A 3BBHA 4CNFA 4YQPA 3OIIA 2EGVA 1K3RA 3GYQA 2YY8A 4YPXA 2QWVA 4YVGA 1OY5A 4L69A 1VHKA 2HA8A 2QMMA 4X3MA 3AXZA 4YQOA 1NS5A 1UAKA 4YQ9A 4YQ7A 4YQ3A 3IEFA 1UAMA 4YQJA 4YVHA 3KW2A 1UALA 4YQSA 1IPAA 1X7OA 5GM8A 4PZKA 3ILKA 1Z85A 4YQAA 4KDZA
chains in the Genus database with same CATH superfamily
2I6DA 4MCCA 4JWFA 2V3JA 4YQRA 3IC6A 4YQIA 4H3YA 4JAKA 4YQ8A 3L8UA 3N4KA 1VHYA 4YQDA 1ZJRA 4CNDA 2EGWA 3AIAA 4X3LA 1UAJA 4YQ0A 3KNUA 4JWHA 3DCMX 2V3KA 4E8BA 4YQ1A 4YQNA 4YVJA 4JWJA 4XBOA 3AI9X 4YVIA 3O7BA 4YQLA 3QUVA 4YPYA 1X7PA 4KGNA 4YQKA 3KY7A 4YQ2A 4YVKA 5CO4A 4YQ6A 1NXZA 4J3CA 4FMWA 4YQBA 4CNEA 4JALA 3E5YA 4MCBA 5D9FA 3KTYA 3OIJA 4YPWA 4JWGA 4YQCA 3BBEA 1V2XA 5FAIA 3NK6A 4MCDA 1V6ZA 1P9PA 3N4JA 4IG6A 1MXIA 3ONPA 2CX8A 3NK7A 4YQTA 4YQ4A 2O3AA 4FAKA 4H3ZA 1TO0A 4YPZA 1J85A 3OINA 1O6DA 3BBDA 5GMBA 4RG1A 4YQQA 4YQGA 5GMCA 4YQ5A 4CNGA 1GZ0A 2Z0YA 1VH0A 3BBHA 4CNFA 4YQPA 3OIIA 2EGVA 1K3RA 3GYQA 2YY8A 4YPXA 2QWVA 4YVGA 1OY5A 4L69A 1VHKA 2HA8A 2QMMA 4X3MA 3AXZA 4YQOA 1NS5A 1UAKA 4YQ9A 4YQ7A 4YQ3A 3IEFA 1UAMA 4YQJA 4YVHA 3KW2A 1UALA 4YQSA 1IPAA 1X7OA 5GM8A 4PZKA 3ILKA 1Z85A 4YQAA 4KDZA
chains in the Genus database with same CATH topology
2I6DA 4MCCA 4JWFA 2V3JA 4YQRA 3IC6A 4YQIA 4H3YA 4JAKA 4YQ8A 3L8UA 3N4KA 1VHYA 4YQDA 1ZJRA 4CNDA 2EGWA 3AIAA 4X3LA 1UAJA 4YQ0A 3KNUA 4JWHA 3DCMX 2V3KA 4E8BA 4YQ1A 4YQNA 4YVJA 4JWJA 4XBOA 3AI9X 4YVIA 3O7BA 4YQLA 3QUVA 4YPYA 1X7PA 4KGNA 4YQKA 3KY7A 4YQ2A 4YVKA 5CO4A 4YQ6A 1NXZA 4J3CA 4FMWA 4YQBA 4CNEA 4JALA 3E5YA 4MCBA 5D9FA 3KTYA 3OIJA 4YPWA 4JWGA 4YQCA 3BBEA 1V2XA 5FAIA 3NK6A 4MCDA 1V6ZA 1P9PA 3N4JA 4IG6A 1MXIA 3ONPA 2CX8A 3NK7A 4YQTA 4YQ4A 2O3AA 4FAKA 4H3ZA 1TO0A 4YPZA 1J85A 3OINA 1O6DA 3BBDA 5GMBA 4RG1A 4YQQA 4YQGA 5GMCA 4YQ5A 4CNGA 1GZ0A 2Z0YA 1VH0A 3BBHA 4CNFA 4YQPA 3OIIA 2EGVA 1K3RA 3GYQA 2YY8A 4YPXA 2QWVA 4YVGA 1OY5A 4L69A 1VHKA 2HA8A 2QMMA 4X3MA 3AXZA 4YQOA 1NS5A 1UAKA 4YQ9A 4YQ7A 4YQ3A 3IEFA 1UAMA 4YQJA 4YVHA 3KW2A 1UALA 4YQSA 1IPAA 1X7OA 5GM8A 4PZKA 3ILKA 1Z85A 4YQAA 4KDZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I6D A;  4MCC A;  2V3J A;  4YQR A;  3IC6 A;  4YQI A;  4H3Y A;  4JAK A;  4YQ8 A;  3L8U A;  3N4K A;  1VHY A;  4YQD A;  1ZJR A;  4CND A;  2EGW A;  3AIA A;  4X3L A;  1UAJ A;  4YQ0 A;  3KNU A;  3DCM X;  2V3K A;  4E8B A;  4YQ1 A;  4YQN A;  4YVJ A;  4XBO A;  3AI9 X;  4YVI A;  3O7B A;  4YQL A;  3QUV A;  4YPY A;  1X7P A;  4KGN A;  4YQK A;  3KY7 A;  4YQ2 A;  4YVK A;  5CO4 A;  4YQ6 A;  1NXZ A;  4J3C A;  4YQB A;  4CNE A;  4JAL A;  3E5Y A;  4MCB A;  5D9F A;  3KTY A;  3OIJ A;  4YPW A;  4YQC A;  3BBE A;  1V2X A;  5FAI A;  3NK6 A;  4MCD A;  1V6Z A;  1P9P A;  3N4J A;  4IG6 A;  1MXI A;  3ONP A;  2CX8 A;  3NK7 A;  4YQT A;  4YQ4 A;  2O3A A;  4FAK A;  4H3Z A;  1TO0 A;  4YPZ A;  1J85 A;  3OIN A;  1O6D A;  3BBD A;  5GMB A;  4RG1 A;  4YQQ A;  4YQG A;  5GMC A;  4YQ5 A;  4CNG A;  1GZ0 A;  2Z0Y A;  1VH0 A;  3BBH A;  4CNF A;  4YQP A;  3OII A;  2EGV A;  1K3R A;  3GYQ A;  2YY8 A;  4YPX A;  2QWV A;  4YVG A;  1OY5 A;  4L69 A;  1VHK A;  2HA8 A;  2QMM A;  4X3M A;  3AXZ A;  4YQO A;  1NS5 A;  1UAK A;  4YQ9 A;  4YQ7 A;  4YQ3 A;  3IEF A;  1UAM A;  4YQJ A;  4YVH A;  3KW2 A;  1UAL A;  4YQS A;  1IPA A;  1X7O A;  5GM8 A;  4PZK A;  3ILK A;  1Z85 A;  4YQA A;  4KDZ A; 
#chains in the Genus database with same CATH topology
 2I6D A;  4MCC A;  4JWF A;  2V3J A;  4YQR A;  3IC6 A;  4YQI A;  4H3Y A;  4JAK A;  4YQ8 A;  3L8U A;  3N4K A;  1VHY A;  4YQD A;  1ZJR A;  4CND A;  2EGW A;  3AIA A;  4X3L A;  1UAJ A;  4YQ0 A;  3KNU A;  4JWH A;  3DCM X;  2V3K A;  4E8B A;  4YQ1 A;  4YQN A;  4YVJ A;  4JWJ A;  4XBO A;  3AI9 X;  4YVI A;  3O7B A;  4YQL A;  3QUV A;  4YPY A;  1X7P A;  4KGN A;  4YQK A;  3KY7 A;  4YQ2 A;  4YVK A;  5CO4 A;  4YQ6 A;  1NXZ A;  4J3C A;  4FMW A;  4YQB A;  4CNE A;  4JAL A;  3E5Y A;  4MCB A;  5D9F A;  3KTY A;  3OIJ A;  4YPW A;  4JWG A;  4YQC A;  3BBE A;  1V2X A;  5FAI A;  3NK6 A;  4MCD A;  1V6Z A;  1P9P A;  3N4J A;  4IG6 A;  1MXI A;  3ONP A;  2CX8 A;  3NK7 A;  4YQT A;  4YQ4 A;  2O3A A;  4FAK A;  4H3Z A;  1TO0 A;  4YPZ A;  1J85 A;  3OIN A;  1O6D A;  3BBD A;  5GMB A;  4RG1 A;  4YQQ A;  4YQG A;  5GMC A;  4YQ5 A;  4CNG A;  1GZ0 A;  2Z0Y A;  1VH0 A;  3BBH A;  4CNF A;  4YQP A;  3OII A;  2EGV A;  1K3R A;  3GYQ A;  2YY8 A;  4YPX A;  2QWV A;  4YVG A;  1OY5 A;  4L69 A;  1VHK A;  2HA8 A;  2QMM A;  4X3M A;  3AXZ A;  4YQO A;  1NS5 A;  1UAK A;  4YQ9 A;  4YQ7 A;  4YQ3 A;  3IEF A;  1UAM A;  4YQJ A;  4YVH A;  3KW2 A;  1UAL A;  4YQS A;  1IPA A;  1X7O A;  5GM8 A;  4PZK A;  3ILK A;  1Z85 A;  4YQA A;  4KDZ A; 
#chains in the Genus database with same CATH homology
 2I6D A;  4MCC A;  4JWF A;  2V3J A;  4YQR A;  3IC6 A;  4YQI A;  4H3Y A;  4JAK A;  4YQ8 A;  3L8U A;  3N4K A;  1VHY A;  4YQD A;  1ZJR A;  4CND A;  2EGW A;  3AIA A;  4X3L A;  1UAJ A;  4YQ0 A;  3KNU A;  4JWH A;  3DCM X;  2V3K A;  4E8B A;  4YQ1 A;  4YQN A;  4YVJ A;  4JWJ A;  4XBO A;  3AI9 X;  4YVI A;  3O7B A;  4YQL A;  3QUV A;  4YPY A;  1X7P A;  4KGN A;  4YQK A;  3KY7 A;  4YQ2 A;  4YVK A;  5CO4 A;  4YQ6 A;  1NXZ A;  4J3C A;  4FMW A;  4YQB A;  4CNE A;  4JAL A;  3E5Y A;  4MCB A;  5D9F A;  3KTY A;  3OIJ A;  4YPW A;  4JWG A;  4YQC A;  3BBE A;  1V2X A;  5FAI A;  3NK6 A;  4MCD A;  1V6Z A;  1P9P A;  3N4J A;  4IG6 A;  1MXI A;  3ONP A;  2CX8 A;  3NK7 A;  4YQT A;  4YQ4 A;  2O3A A;  4FAK A;  4H3Z A;  1TO0 A;  4YPZ A;  1J85 A;  3OIN A;  1O6D A;  3BBD A;  5GMB A;  4RG1 A;  4YQQ A;  4YQG A;  5GMC A;  4YQ5 A;  4CNG A;  1GZ0 A;  2Z0Y A;  1VH0 A;  3BBH A;  4CNF A;  4YQP A;  3OII A;  2EGV A;  1K3R A;  3GYQ A;  2YY8 A;  4YPX A;  2QWV A;  4YVG A;  1OY5 A;  4L69 A;  1VHK A;  2HA8 A;  2QMM A;  4X3M A;  3AXZ A;  4YQO A;  1NS5 A;  1UAK A;  4YQ9 A;  4YQ7 A;  4YQ3 A;  3IEF A;  1UAM A;  4YQJ A;  4YVH A;  3KW2 A;  1UAL A;  4YQS A;  1IPA A;  1X7O A;  5GM8 A;  4PZK A;  3ILK A;  1Z85 A;  4YQA A;  4KDZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...