3BBPA

Rab6-gtp:gcc185 rab binding domain complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
161
structure length
161
Chain Sequence
FKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGLERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rab and Arl GTPase family members cooperate in the localization of the golgin GCC185.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/splicing
molecule keywords Ras-related protein Rab-6A
total genus 51
structure length 161
sequence length 161
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3bbpA00
3QXSA 1HA3A 2CHGA 1HY3A 2XZLA 3I4LA 1U8ZA 4LDJA 1NJFA 5DYIA 4HUTA 1WBDA 2ZSEA 2JLUA 5IK2D 4K46A 5DGXA 5JRZA 4MYUA 3BB4A 4AKEA 4OYHA 3OHMA 3IDQA 2GJ8A 4C0SA 1P2SA 4Q48A 1J8YF 2GWHA 5JLJA 4IDHA 2BMDA 4HLQB 1BMFA 4FN5A 3THXA 3KJHA 1CR0A 4L5BA 1KO7A 4RZXA 1TUEA 1Z0DA 1FMJA 4BLTA 3A1UA 4US1R 4QNMA 2FGJA 3DM9B 2BC9A 4Q21A 1N0VC 3GD7A 4KSBA 2GA8A 2FPLA 2CL6X 3EA0A 1NMYA 3WNBA 3TVTA 2ORWA 5JECA 2NPIA 4B3XA 1WMSA 1OW3B 5AJVB 4IVPA 4DDWA 3GFTA 3O8CA 2AR7A 3WYGA 4PSKA 1E1RD 1VIYA 1NLFA 4OK3A 4KI0A 1RRFA 4YLGA 4DHEA 4CRWB 4YMUA 2ZEJA 3BJIC 3LLUA 5HE8A 3PV0A 1W2HA 1BH2A 1W4AA 2NPFA 1JR3E 1Z0IA 4JL8A 2FSGA 1FQJA 2FGKA 2RGEA 1BO6A 2WSSD 1AKEA 1HEIA 3SN6A 2QBYA 3T1TA 1Z0AA 1GUAA 1GRNA 1KSJA 1XEWX 1G6OA 2H7VA 1SZPA 2O0HA 2GEVA 1DTSA 4KLZA 1YR9A 4A8JC 3DOEA 1JBKA 2R62A 2IA5A 2CK3A 3X1YA 4E22A 2B6HA 4GBMA 4OI1A 1VYTA 1AA9A 1GRRA 621PA 3T35A 4AK9A 1OF1A 1YR6A 2WWXA 2VP6A 4YMVA 1CEEA 2UKDA 2AD5A 5JBQA 1VKJA 3GLFA 1D8TA 4V0ME 2D3WA 4PZLA 3I8SA 2ZI4A 3EG5A 3QPUA 5FI1B 3ADKA 5GJVC 1L4YA 2WSSA 5FR1A 3WHKA 3TUJC 1K5GA 1CR4A 821PA 1KDTA 1XXHE 2BWJA 1IM2A 3I73A 1NSFA 4DEYA 2R6CA 1U8AA 3FKSD 2OFOA 1KNQA 3K53A 2HDNB 4KFRA 2O0KA 5AWFC 3CWZA 5L3SA 3MLEA 4C9BA 1VMAA 2W2VA 3TQFA 2V8OA 3C4JA 1T8UA 2YC2C 3KXLA 2LWIA 4FXPA 4O3MA 3KB2A 2O8EB 1DPFA 3WNCA 1R2QA 1N5JA 4TMVA 1DELA 4LJ6A 3TUIC 4L4UA 4CEHB 2F3RA 3GJ0A 1RRGA 4IOKA 4X8MA 4P0TA 1W4RA 1T8TA 2QMUA 5FUYA 1EX6A 1OYYA 4TMWA 5EXSA 3GJ7A 1DAHA 4KBGA 2HCBA 3NBYC 1TAGA 5H1YA 3FPAA 4IOLA 1COWA 2QROA 4DDVA 4PSAA 5DO9A 3IBYA 4LHXA 1RYFA 2IYWA 4QL3A 1UEJA 3KTAB 1ZC4A 2BM1A 4GP6A 3BFVA 4QG7A 3EWSA 3C7KA 2XZOA 2ODWA 3QG5A 4MDFA 2JJ2D 2C2HA 2F1RA 1R7RA 2VEDA 1SHKA 5IT5A 1UPTA 5EJEA 4YMSA 3C5HA 1YRBA 3LX8A 5BYKA 3GEHA 4QBHA 4URZR 3ZZ0A 5BN5A 3DL0A 2FFAA 3B1YA 4UXJA 1RRPA 2WJVA 4D6PA 4EAQA 2H8KA 4M53A 5G53C 3SS8A 1QG2A 4B34A 4XIGS 3FMIA 4EPWA 1LB1B 3VX4A 4GZLA 5FPHA 4P31A 4GOJA 2HT6A 1EK0A 3K0CC 3ADBA 3KZ1E 2P5SA 3JVVA 4X8LA 4PQYA 5FL7A 4F92B 2IF0A 4ZKDA 2ZJAA 2QSYA 3EZ9A 4QXAA 1LS6A 1GZSA 2JA1A 1NBMA 3F8TA 3NHAA 3LFUA 5AJXA 3WBJA 4QNRA 1OFHA 1QRAA 4C0HA 2WAXA 1BYIA 2ATXA 1MKYA 3GCGA 2GBLA 2O8BA 4M22A 5JWHA 1E2PA 4UNPA 5FPTA 4ASUD 1SULA 3GEIA 4DKXA 3MSXA 1X1RA 3P4YA 4IFBA 2OCAA 1KI1A 4RY2A 1UBCA 1DAGA 3ONWA 4IEIA 4QJ5A 3PEUA 5DI9A 5D3MA 4Q1BA 2LCFA 2GJSA 4YXWD 5P21A 4XTCS 4JLBA 3TBKA 2YHSA 4B6FA 1NLYA 4P4UA 2CJWA 4UKDA 4D0GA 1G19A 4TN1A 3PG5A 1E0SA 4DUGD 1XNJA 2JJ2A 1W0JD 4XSHA 3NXSA 4G3XA 1W5SA 4DT1B 1CLUA 4E5UA 3I5XA 3B13B 4I4LA 5DN6D 1G8GA 1GSIA 1A7JA 4F7WA 4TLDA 1ZBDA 1XJCA 2FN4A 3M0EA 4AG5A 5DISB 2H1LA 4EIWA 1G7RA 1T6NA 4NCHA 5A0FA 2OZEA 1Q1BA 4BZQA 4AD8A 5JSZB 2J59A 1J70A 2ZYTX 2N42A 2VH5R 4EQ6A 1XEXB 5GJWC 2DFLA 1TUIA 1XJ0A 2VO1A 3S1AB 3M1IA 1T5IA 3X1WA 4E07A 3A4NA 3CKLA 3U7GA 4TYPA 2EQBA 4TTQA 1SGWA 2VP2A 4DSTA 4NYIQ 2YWHA 4NCJA 3L0OA 3CUEF 1W46A 2ZITA 1T0JB 1W2GA 5BQ5A 4Q02A 1NMZA 1TQ6A 4Q1CA 4UXHA 3RS0A 2XOKA 4KVGA 2QP3A 4DT1A 4M8NE 4GZMA 4HAUA 1UM8A 4CW7A 4YC7A 1Q1QA 5JHHB 2HT1A 5L3RA 3V00A 1ZNWA 4KCGA 1R6BX 2F9MA 4RD3A 2A78A 3SBDA 5HPYB 3L82B 3NEYA 1NVWQ 1Z2CA 5KSPA 1RC8A 2CHQA 1T5LA 4B3DA 2LKCA 3AKYA 1G8HA 2AXNA 2G83A 4M1OA 2QMEA 3X1XA 1NL3A 5TVKA 4C7OA 5B64A 2PZGA 1OLOA 2ODNA 3KJGA 3PUVA 1NBMD 2IHBA 2VP9A 3ZVMA 3KUCA 1VCMA 3EPLA 2FDCA 3U61B 2ZM5A 2PMDA 4B3CA 4R9UC 2HXYA 5KNCA 1VHLA 1UKYA 3JZMA 4AIIA 1G291 4MGYR 3VAAA 2ECKA 3K0SA 1SQ5A 1XFAA 2GVZC 4LGMA 5B2ZA 3QNUA 4EFNA 5KDDA 2WMOB 2CBZA 3Q5DA 4XWOA 2VPPA 2NO1A 1EFRD 1NN1A 2YWFA 2ZRLA 4QGGA 3TSOA 1FW6A 2ZE6A 5KPJA 3IIMA 3TJZA 1DEKA 1AIPA 2XX3A 4R2HA 1OJLA 1P60A 3C16C 1XB2A 2ZRIA 1MABA 2IYXA 3BFKA 3AVTA 3GLIE 5CM9C 4PTLA 4A82A 3CW2A 2XZPA 5DHAA 5HTKA 3U7HB 4PHFA 3TUZC 1E2GA 3P1JA 4MITA 4ZO4A 4UNRA 3F3YA 1EG7A 1L4UA 1MH1A 3QEJA 3RANA 4NCIA 3B9PA 1JEEA 3QF7A 4L15A 2ORIA 4N3NA 1SXJA 4PO1A 2YINC 4N0EA 1NG1A 3OEEA 3AKCA 1I2DA 1Z22A 2BOVA 2Z83A 3CPJB 4TL7A 4LHVA 1ZCAA 1ZC3A 1OXUA 1U90A 2SHKA 3SZRA 1H8HD 2OFWA 1F60A 2V9PA 2ZRKA 4ON9A 5H68A 4M1YA 5EE1A 1Z47A 1W36D 1HT2E 1XTIA 1G3IA 3PUZA 3ZIAA 2OSBA 4JMPA 6Q21A 4WXPA 2MMGA 2QTHA 2DWQA 4HB4A 2I1VB 3T1VA 2QAGB 2P6UA 3K0CA 5DHFA 3DKVA 1OV4A 2MSCB 1Q12A 3CIOA 2BBWA 2HV8A 2RHMA 4MUAA 3R9XA 1R0ZA 2PBRA 3CWQA 4DWJA 2HF8A 3GLHB 1NG9A 4QM7A 3DDCA 4XSGA 1WBBA 5FBWB 3MUFA 1KMQA 2G0NA 1CS4C 3P27A 2A9KA 2OCBA 2PEYA 3SDZA 4PSVA 3HWSA 2P0EA 2AWOA 5FL3A 3QXXA 1S1MA 5EP2A 4Q4JA 1SKQA 4B43A 1HTWA 1BOFA 1HYQA 2A5GA 3P32A 1XWIA 1ZW6A 1AJEA 5TARA 4M9ZA 2EVWX 2ZRDA 4LJ4A 5EP1A 2C99A 3EPKA 3BXZA 1XCGB 2BJWA 1AKYA 3K0AB 1Q20A 1G16A 3NVAA 2CNWA 3CRVA 4DVGA 2YOHA 5FPYA 3KXIA 3B82A 1R0XA 1ODFA 3HP1A 1KJYA 2Q9CA 3OIWA 4BWYA 4EFMA 2JASA 1IY0A 3IEUA 1TTTA 5CJ2A 2RGNA 1SVSA 2JIZA 3WBKA 4JLDA 3KQLA 3A6PC 5HR5A 3PIRA 2ZUCA 3QJYA 4GI7A 4URXR 1ELOA 3KQHA 5KNBA 1DAKA 1FX0B 4Q9HA 4DLRA 1IQPA 3CO5A 4ZDKA 3GLGB 1HQYE 4KITB 5CJPA 4ZI3A 4JLJA 2X77A 2PJZA 4UQOA 2HCJB 2VHCA 4WXRA 3V4RA 1D5CA 1GDDA 2VHUA 4OHXA 2Z43A 1YZNA 5LBIA 3K70C 1OKKD 2BJVA 4DBLC 1ZJ6A 4WA7A 1UDXA 4JYCA 3TW8B 4A92A 4PAMA 2W6JD 1WF3A 4U00A 2NZ8A 2ZRJA 1YU9A 3NEJA 3TMKA 4B71A 3CX6A 2PLRA 3MG9A 1DO0A 1ZM3A 4A0HA 1NIPA 3TAHA 2QAJA 3N70A 3OEED 1K6MA 1RZ3A 4NTZA 2IF2A 3R20A 3IGFA 5LPNA 1WA5A 3QPVA 2C95A 5BW8A 1SKYB 4ESVA 2YYZA 4NYMQ 1ZM4A 1FL9A 4L8GA 1AZTA 2CCJA 4LC0A 2GEDA 2GKSA 2HF9A 3C15C 2B92A 3MD0A 3NBXX 4ARZB 1XJQA 4RKFA 1KZGB 1JI0A 1DG1G 3LRPA 3NKVA 1OXSC 5J40A 4TWZA 1CULC 1Z07A 2FMXA 1G17A 3GJ3A 5AK0A 1AQYA 2YV5A 3W5IA 5KPDA 3GJ5A 1R5OA 2F1JA 3KDSE 3IEVA 2FFQA 4RKEA 2OLKA 4PQRA 3UATA 2GXQA 3LLMA 4QM6A 3UANA 2WJHA 4GFDA 4JVSB 1Z0KA 1KSFX 4GPTA 3LVRE 1GITA 4HB0A 3A36A 3QE0A 5E7MA 4BLRA 5EUMA 4TSFA 3WP1B 3EASA 1IJFA 2C8VA 4NDZA 3THWA 4FCTA 4JLKA 4NL4H 5CK4A 5D3MB 1CF4A 3WMFA 2O0JA 3D8BA 1Z3IX 3BBPA 1OXXK 1QHGA 3BGWA 3OIUA 4IOJA 4PC6A 2GJ9A 2IEZA 3GEEA 2QRNA 1VG0B 1NKTA 1V5WA 3KJEA 4N0DA 3TIFA 3QKSB 4Q9JA 4F38A 2GILA 3BB3A 4WVFA 4BFWA 1JJ7A 4B33A 1ESMA 3KX2A 2ZJOA 1XCPA 3QIAA 1E4VA 1JXMA 1NBME 3NHBA 3VR1A 2VYFA 3QXJA 1CXZA 2IT1A 3HR8A 721PA 4OK6A 3AGQA 4BRUA 2QGZA 4LJ7A 1YZTA 3ZVLA 5K8UA 4BECA 2OM2A 1ZM2A 4EKDA 2XITA 1ZNYA 2AFHE 3AUXA 2JJ1D 3W6OA 3RABA 4WAUA 3GLIA 3U4QB 2BBSA 3CF0A 1GNPA 4XD7D 4TL9A 4DCNA 1CU1A 2GBLC 3VHXA 4Q66C 3W8RA 4MRPA 1KAGA 2OEPA 4P4SA 1COWD 1GKIA 2E87A 2XJ4A 4B73A 5HZKA 5G40A 2JIZD 1OB2A 1F6BA 1LF5A 4MGZR 4C3ZA 5HKKA 2NIPA 1FNNA 3SI7A 4AY2A 3RDPA 4KFTA 4A36A 4TLEA 3IPXA 3QENA 2ERXA 3HU2A 4LY6A 5DN6A 1R10A 1Z6AA 2BMEA 4EJSA 4TLAA 2AX4A 3SEAA 1A2KC 4TLBA 3UMFA 4DCVA 4V0LA 4MH0R 3R9IA 4AG6A 1I4LD 3TSWA 3SQWA 4NHOA 4P33A 4CEJA 3L0SA 4LHZA 2O8DA 3SC3A 4NCKA 1VYUA 5JI2E 1MRNA 1RIFA 1JAHA 5FTNA 2IWHA 3AVWA 5KDLA 4PC7A 3SHFA 1TU4A 1P72A 3AVVA 2ZRMA 1XX6A 4M1MA 1Z06A 2G1JA 2X1VA 1MRSA 1ZAKA 4TLCA 3D7MA 3QKUA 3BFXA 5ANRB 4ZDWA 3AB3A 5JMTA 3N2EA 3GLIB 1WQ1R 4DSOA 3CPEA 4EPTA 1TADA 3QI2A 4TYYA 5FBRB 3U6KA 3KL4A 3K0FA 1SKYE 3JZAA 3L0IB 1A4RA 4D4JA 4MA4A 2QI9C 2J0SA 1Q21A 3N2IA 1S9HA 1N0WA 2ZI5A 5H8WA 4QGFA 1G4UR 1NP6A 1Q1ZA 2G6BA 2YC4C 4WOPA 2CCGA 4LJ5A 1JPNA 2J7PA 2BMFA 1OPXA 1W1WA 5L3SB 2VLIA 2IL1A 2D4HA 1F2UB 3M4YA 4DCSA 4F4CA 4GL2A 2X2EA 2XSZA 1G7SA 5G3YA 4M1WA 4AYWA 5IK2A 3PFIA 2QT1A 4GOXA 3B60A 3A1TA 2BV3A 4KBFA 1L7VC 3PEYA 2BKUA 2WJIA 3ZGXA 3T5GA 2H16A 3B9QA 1UF9A 3PVSA 1JR6A 1AZSC 3LWNA 1IN6A 2OLJA 1U81A 4HYYA 2C04A 4TMKA 3VX3A 4Z51A 4BFZA 2QBYB 1BKDR 1FFHA 1KK3A 2OXRA 1CJUC 1S96A 4JVNA 4Q19A 4CVNA 4BFYA 1J7KA 2WV9A 2FFHA 4DJTA 4KHZA 3G82C 4IOMA 2G0TA 1XPUA 3FE2A 4XOIA 3AVQA 2H92A 5FOUA 1MABB 1ZD9A 2J0UB 3L8YA 1XMIA 4CYMA 2ZYWX 1NLZA 3RS2A 3CF2A 4HAYA 3UWKA 3E5HA 4HZUB 4DLSA 1IN4A 1AS0A 2VHQA 1Q1EA 3B1WA 1NVXQ 1XMJA 5FI0B 2A5DA 1EGAA 4JKIA 2ZYVX 4MRRA 3WXMA 5B58C 1RW4A 2RKOA 3RYTC 2IUSA 4QC2A 3WMEA 1SHZA 1M7GA 1GFIA 3ASZA 1VG8A 1W0KD 1YHNA 5J4VA 3CB4A 5FPSA 4PC3A 2ZUDA 4FD2A 2XSZD 3UKDA 3SE0A 2C98A 1W7AA 1P9RA 2R6DA 2IYLD 3KKPA 4IHQA 2DFKB 3VMFA 2YZ2A 3ZYCA 2P65A 2O8FA 1NVVQ 1U2RA 2Q3HA 1RJ9B 2X8AA 3CZPA 1G9XA 2IK8A 3WYAA 1OSNA 1XCMA 2VF8A 4OHWA 1UJ2A 5AJYA 1LY1A 2IUUA 5K8TA 1SXJC 5AJZA 3U44B 2GF9A 2JLQA 2Y8EA 2GJAA 1P3JA 1JB1A 1KI8A 1P2TA 3PQCA 3L8ZA 1MO5A 4BLPA 1CBUA 2V7QA 2WIBA 1S3GA 3HPRA 5CIWA 3GJ8A 3C41J 1U98A 2Q3FA 1XD8A 1OKKA 3KQNA 4ZDJA 5A5GA 3CRQA 1E2JA 2GJKA 4HAZA 2QM7A 1GL9B 1A2BA 1J8MF 1TMKA 2I3BA 2VP4A 4NBSA 4TL6A 1F5NA 3SFZA 3AP3A 4TZ6A 3BK7A 5LB4A 2QA5A 4BQSA 2C77A 2HEIA 1GL7A 2J0UA 2ZRFA 3RAPR 4XH9B 2Z6VA 3A1VA 3QXCA 4RD0A 5FOTA 1IBRA 5JEEA 1KHTA 1RJ9A 2CJWB 1E9BA 3V4FA 1KI9A 1VCNA 2B8TA 2PJRA 1R8SA 4IJMA 4W7SA 2QZ4A 4EPVA 4WBSA 5DIFA 3SU8A 4BASA 4ILEA 2CLSA 1N5IA 3MMPA 1KAOA 3OIVA 2IS4A 3O47A 3UWOA 1C1YA 4OQFA 4C30A 1U99A 2JJ8A 5CIQA 2X2FA 2CNWD 3W9YA 2QM8A 1ZMXA 1E4YA 1DO2A 3NBFA 3Q8XB 1P2VA 2TMKA 5JJLA 4TQ9A 1UAAA 3LBNA 4JZKA 5JWOA 1M6NA 2ERYA 1KJWA 3I8XA 2VHTA 4ITRC 2HXSA 3LQQA 3PUXA 3THOA 4MKIA 3EC1A 3O8BA 4B6EA 3RRYA 4JBXA 2YVUA 2A3RA 2OAQ1 2H18A 5DSZA 1N6HA 5E4FA 2NO7A 1Z63A 2ONJA 1F2TB 3QVVA 4HI0E 1KDOA 1E3MA 1E2DA 1I4TD 4XTRA 2J41A 3EZ6A 5EE0A 5JSZA 1DAEA 3NC0C 3NG1A 5TY0A 2WKQA 4AYTA 3KKOA 3K1JA 4ACAA 4G01B 1OIWA 5C46F 5E3HA 3AF4A 1KSHA 1Z6TA 4A6XA 4ARZA 2ZI7A 4M1KA 3PEWA 5EXXA 1XTRA 5SZKB 3MWLA 4Z1MD 2OILA 3SJBA 1MV5A 5C4GB 3EIQA 2BIFA 4W5JA 1ZUHA 2KI5A 1ZUNB 2WIAA 4AC9A 5BXQC 2BVNA 2FWRA 4E03A 2GXAA 3WMGA 5GVSA 4Q4LA 3DVLA 1G6HA 1E9SA 4WW0A 3UIEA 1MT0A 4TMTA 1KO4A 2MMCA 4HB3A 2JLSA 2FPMA 3D3QA 2XNDD 4QOSA 1VIAA 3CONA 4A0RA 1G5PA 3IO5A 4I1OA 2O8CA 3B1ZA 2DR3A 8OHMA 3ADDA 1KI6A 2P67A 4Q4HB 4XWAA 4LBYA 2ATVA 5DI3A 1EX7A 2WOOA 3B7GA 4NONA 1R0WA 2BBOA 2F3TA 4QHTA 2EWWA 5FR2A 2ODBA 1AK2A 1TU3A 1JNYA 5JS7A 2BBTA 1E9FA 3U4QA 3IQXA 5E95A 521PA 1Z2AA 4BFSA 4KV9A 3NH6A 1P75A 1P7CA 3RHFA 4ZCIA 3AVYA 3VHLB 4RD1A 1OT3A 4EPYA 1TF5A 1ZUIA 4U5XA 2GEUA 4XD7A 2DFNA 4DLWA 2QAGA 2VA8A 3OE7D 4M21A 5EXPA 1N6OA 3GPLA 2D7DA 2PCJA 3CRRA 2R9VA 4A4DA 1M7BA 3RRZA 2WWHA 2XOKD 2LKDA 4A0GA 1N6LA 5TMPA 4BGDA 1OH7A 2VTKA 2ZSDA 1X6VA 3LA6A 4D26A 4PC2A 1M1YE 3MAAC 1OIXA 3AP1A 4Q9LA 4H9GA 4Q1EA 2W00A 4QJ4A 4FINA 1O3YA 3NIBA 4Q7MB 1VCOA 5CLLA 2KBFA 4D0LB 1R4AA 4EJSB 2XNSA 4KYIB 4GOKA 2ZE7A 4RZUA 1EFCA 1LV7A 2W6IA 2F1IA 4HAWA 4QJ3A 3U3OA 1XMVA 1S1CA 2ZU0C 1N6IA 1TPZA 3DEFA 3KKMA 4ZIRB 2XNDA 4GMDA 1Z6YA 3CRW1 3EX7C 1KKLA 1IN8A 4V0MA 2C9OA 1LF0A 2PCLA 2UVQA 2ZJZA 3A1WA 5CYPA 3VKGA 1FZQA 2FJUA 5HE9A 2ZJYA 3ZVNA 2CL0X 1X3SA 2FPKA 2DY1A 2QENA 5AUQA 1ZP6A 1RPZA 2ZSAA 1F3OA 5J4KA 3NDPA 4NKRA 4Q9IA 5KHOC 5CDFA 1ESNA 3I1FA 1EWRA 1E9RA 1L8QA 4V0KA 4DC9A 1QVRA 5FTKA 5JEDA 1K5DA 1NRJB 4W5WA 3FTQA 1JQJC 4LBZA 2QUZA 3AGPA 4POAA 4EPRA 3B2EA 1CJVC 3KB1A 5JCZA 4URWR 5FPKA 2XTMA 4LHYA 4JT2A 3JVUA 2IC5A 1U0LA 3OAAD 3A8TA 5LDDC 4V02A 1OE0A 2J5XA 1DAFA 4XVQA 3U2QA 3VKWA 4NYMR 5J5CA 4ZV4A 1XTQA 2GZHA 2WAYA 4HLUC 2GNOA 4JLVA 3QOFA 3SBEA 5KTYA 1TL7C 2NOAA 4TT3A 2QTFA 3R7WA 5TV2A 1YRAA 1E0JA 1XD2B 1ZIPA 2ZRCA 4OHVA 2JDIA 3X1DA 2Q9BA 2IS1A 1W5TA 4C0QC 2WSMA 1AS3A 4TT3D 1D2MA 4JLMA 4TYQA 1QHHB 4ACBA 5EZ6B 1CR1A 2VSXA 2QP9X 3ND8A 1HV8A 4MGIR 4PZZA 3ICQB 4MKFA 4IRUB 4BFUA 2GAOA 2B21A 2GK7A 1NMXA 1XBTA 2H5EA 4BE7B 4D2IA 1Z0JA 1WP9A 1PUJA 3BWDD 1W36B 3VR6A 2OBLA 1R8QA 3A4LA 1XU4A 2OT3B 2OFXA 3GQBA 4C0AC 4ZI2A 1QHIA 1KK1A 5FOXA 3W8NA 4HEJA 4FMDF 2OCYC 2NO0A 2RGDA 2C9YA 2CDNA 1G3QA 3MWYW 2QPOA 4M1SA 1IXSB 2AL7A 4Q7KA 5KU1A 1NJGA 4D4MA 2AD1A 5A4JA 4G5GA 1IY1A 4DCTA 2FEOA 2R6AA 1Z6XA 3NH9A 2VL7A 1B0UA 4JSYA 1VYVA 4TL8A 4CT5A 4Q7LA 1W36C 1XP8A 4A0FA 5LD2B 2AHOA 4EDHA 3FB4A 2PZFA 3FKQA 3U5ZB 4TSFD 3HU3A 1NSTA 5F98A 3BORA 3UPUA 2AK2A 1WE2A 3VR3A 1ZD1A 3EA5A 3AVUA 4PC1A 2J9RA 2C96A 2PZEA 3FMOB 3P20A 3AF3A 5CB6A 1SXJE 1K8RA 5C2JB 2JLZA 4B3GA 2KSQA 3AKDA 1PVOA 2WPDA 5IF9A 2VSFA 3H84A 2Q6TA 2NZJA 2Z4SA 1NN3A 4FCVA 5FUWA 3T06B 3ZS8A 2IYZA 3FMFA 3CNLA 4MYCA 3K0AA 2AWNA 3K70B 4IDOA 1JALA 2QMOA 2PT5A 4ZPXA 3WHLA 3LD9A 4GSYA 2IEYA 2WM9B 4PQFA 1G64A 2ZI6A 1IXZA 4HAXA 3DZ8A 4ESHA 2DB3A 2CL7X 4G5OA 2ZREA 2IYSA 4IDNA 4Z8XA 3MWKA 2E1RA 3QEOA 1E2QA 2WJGA 1J99A 3W3ZB 4BLSA 1JPJA 4H1VA 4WIAA 2EFGA 3QBTA 4JIMA 5IDVA 4A2QA 2RGBA 1X8JA 2RMKA 3AVPA 4M9XA 2FSIA 4P3YA 3L43A 3OAAA 2AK3A 3TQCA 1NF3A 4BEBA 5G41A 3N5CA 4B3FX 1FOEB 1KKMA 2XAUA 3QKRB 4LPSA 1UADA 2QGNA 1Z08A 1G18A 5DH9A 1KO5A 4BRWA 5EE3A 4QGHA 3TNFA 4TZ0A 1EXMA 1LTQA 2NO9A 2QL6A 2CLCX 1KMHB 5L3VA 3K9LA 3ND9A 1CRPA 1S3SA 1N5LA 1DOAA 2JLRA 4LK2A 3MWJA 3SYLA 3Q72A 1WRBA 3I32A 4WZ6A 4DLZA 1OH5A 3PUWA 3RLFA 1FTSA 4AKIA 2F7SA 1ZYUA 3OFND 3VFDA 2FG5A 221PA 1H65A 4Y0VA 4DDTA 3AV0B 4D82A 1N6NA 3NTUA 4TYNA 5EP4A 1W47A 1E98A 1N5KA 2QORA 2FU5C 4OBEA 1ZIOA 4J0QA 1PJRA 1ZM9A 1W4BA 2YNMA 3ZQJA 1AQUA 5SZJA 5G3ZA 2OBNA 2FV8A 2ZTSA 3VR4A 3PJRA 3UXMA 3IIJA 1E2EA 2FZLA 1CIPA 1KOFA 1SVKA 1OHHD 3DM5A 2CVFA 2WWYA 3MCAA 1RE0A 4M9QA 1PLLA 1WCV1 2J0VA 1SVIA 2ZR9A 3O8DA 2WJJA 4JBWA 3E70C 2O8CB 4FWTA 2G88A 1IONA 4NH0A 2VP5A 2FX3A 1W49A 3T15A 1XRJA 2D2EA 3NBZC 2W2TA 3QVUA 1KTVA 2FH5B 1NNEA 3U3JA 3FMPB 4LRWA 2G9NA 2V55B 2RGAA 3Q7PA 1XD9A 2GZAA 2AKYA 1D2NA 1XDBA 1OXTA 1OB5A 2G3YA 4IFEA 4OK5A 1KJZA 2W2XA 4NPHA 4PHGA 2DFTA 4DIEA 1G20E 4MKHA 2ZQ5A 4A2PA 3CNNA 2EYQA 2BMJA 3TVDA 2IS2A 1QZXA 4QBGB 1VG9B 3OF5A 2JEOA 1GP2A 1MR3F 2WKRA 3BE4A 3W3AA 1RVDA 1YZLA 3B1VA 2KBEA 4AURA 2ZAOA 5D3QA 3OEHD 4B2PA 3EPJA 2ZJBA 4CEJB 2O8DB 2XB4A 1IXRC 2ZXUA 2CCKA 4U02A 4EPXA 1SVWA 2NGRA 2ORVA 4GP7A 3TR0A 2ZANA 1GM5A 4HLDA 5AUOB 4CZ2A 2W83A 4LYAA 2IUTA 1R0YA 4PFSA 1YE8A 4H1UA 121PA 1KO1A 2WPDD 4RZ2A 3PUYA 3LV8A 1VPLA 3KQUA 4JJKA 4M2LA 3UMSA 3RWOA 5AR1A 2C78A 2FEMA 4PO8A 1TEXA 3SJZA 5C4MA 3MRSA 1G7CA 3B1XA 2VRWA 3K09C 2Q9AA 4KXFB 4MRSA 1NY6A 1YZQA 4ERNA 4RSGA 3H1TA 4NP6A 5CM8B 1P61B 1Y3AA 1FP7A 3R9WA 4FMCB 3G5UA 4LPKA 2PX3A 2REOA 1KYIA 2EW1A 3EPHA 2GDJA 2J7KA 3TW4A 1RRCA 3EZ2A 4OQXA 3GLFE 4Q4AB 3BH6A 2JCSA 2WMNB 4IDPA 1FP6A 1VHTA 4JLAA 4D0NA 1IY2A 4QFMA 2V1XA 1WXQA 2Q0HA 2WZQA 1VTKA 1DS6A 3FKSA 3RSOA 2QRZA 5FTLA 3LQRA 2ASEA 1A82A 3OFNA 4FMCF 2WWFA 3I62A 1X8LA 5KSZA 3SYKA 2OO7A 1N6RA 4PPGA 4Z8YA 4UNQA 1DARA 1UBGA 2F9LA 4LHWA 1II8A 2VP0A 4B75A 4I1VA 4FI3C 1ANKA 4OJKA 4YMTA 4ZCMA 3KUDA 2WHXA 4UNSA 3GLHE 3T61A 5E7JA 1ETUA 1OFIA 2HJGA 2QNRA 4MQBA 5KUTA 4HLUA 4NYJR 1SVOA 2EYUA 1JR3A 1II8B 4JYBA 2RCNA 4D4KA 1YKSA 4DZZA 4RCZA 4Q03A 4LBWA 1XXHB 1N2CE 4A8JB 3J81k 1U0JA 2PL3A 4MUBA 4MGKR 4FWIB 2UZIR 2CHVA 3M6AA 3LX5A 2XEXA 1R5BA 4QKQA 4A6PA 1G8PA 1AM4D 1JQLB 3T34A 4BEJA 4L9WA 3ADCA 3ZZUA 4QHSA 4A2WA 4C0LA 4JLNA 2V3CC 3BD9A 4Z54A 3THXB 4N1AA 3R8FA 1SXJD 4P4TA 4Q4AA 1YR8A 1XZPA 1X8KA 5FFMA 3Q3JB 4LWZA 3SJCA 1QHHA 1KZ7B 3EIHA 3KFVA 4FIDA 2JLVA 4Q5IA 4MDEA 1PUIA 1Q0UA 2GTPA 4Q18A 1QDEA 1XD2A 4LV5B 2P3SA 1A1VA 2WJYA 1E9EA 3Q85A 2QE7A 1CJTC 5FBLB 1G1MA 4MKGA 3CR7A 3U60B 3IIKA 3LY5A 4A1FA 1E2LA 3GLGE 4Q4JB 2K5UA 4Q01A 1TEVA 4X8OA 3SHWA 4KAXA 3THYB 4L9SA 3WRXC 3U44A 2PEZA 5FOWA 3T1QA 4I81A 1BYUA 4II7A 1KK0A 4RD4A 1WB9A 2JLWA 1UEIA 5HZHA 1E96A 4UNNA 1UBFA 2RGNC 1KDRA 2ZETA 3KKNA 2VBCA 1OIVA 2V4ZA 1JR3D 2REBA 4ZCLA 1E6CA 2OE2A 2J87A 1E69A 4US0R 1SXJB 3AF2A 4QHYA 3RS4A 1Y63A 2NG1A 3QQ5A 1DAMA 3NC1C 2NTYC 2ZJ2A 2ZPTX 1RKBA 1XZQA 4LI0A 4RFSB 4IEEA 1BMFD 4RD2A 3QF4A 5C1BA 1G5TA 4FCWA 2IS6A 1NY5A 4F4JA 5EP3A 2BEJA 4IKEA 4V0NA 1E2FA 1H8EA 4HB2A 5EE9A 3SJAA 5IRCD 2O8BB 2JLXA 5JWRA 2ZS9A 5CLQA 5FL7D 2R8RA 1P6XA 2GHIA 4RD6A 2HJVA 1XMSA 2IYYA 4B2LA 2A5YB 2C5LA 2CXXA 2N46A 1YZGA 3RNLA 4EFLA 5BN3A 1G8YA 2V1UA 1FPMA 4DRZA 1US8B 2FSFA 2XTNA 1II0A 1EWQA 3FDIA 3CF6R 1G3MA 2NQ2C 2DBYA 1DAIA 4CEIA 3CZQA 4JLPA 1Q57A 2V7QD 3MFYA 5KO2A 1M2OB 3H86A 4G5RA 1US8A 3DKPA 3V9PA 3AKEA 2CE2X 3THYA 2AKAB 2YJTD 1Q44A 2HUPA 3E1SA 1AN0A 2P5TB 3U3MA 2WWWA 1BS1A 2OHFA 4TMXA 1OH8A 4V03A 1KI4A 3CPHA 4B48A 2GXSA 3B78A 4D80A 3I5YA 3LXXA 3CM0A 3HR7A 3H0KA 1ZRHA 3HU1A 2QSZA 2OUKA 1P9WA 1PLJA 3ZJYA 1UKEA 2OXCA 3ICEA 4IW3B 4JSTA 4MYHA 1OFTA 4I1UA 1X1SA 3QSYA 1ONBA 4HAVA 1O87A 1S9DA 2WICA 3ASYA 1FTNA 4HUQB 2ZR7A 3I61A 2C03A 3SOPA 3ZH9B 2Z4RA 4B32A 1D2EA 2V54A 1KY3A 5UKDA 1EESA 5GJBA 2C9CA 4KLNA 3KQKA 1OHHA 2YWEA 4M4SA 1N25A 2Z0MA 4G5SA 4KVAA 2XGJA 5KDOA 5GVRA 4B47A 1ZCBA 2GZDA 3A1SA 3LBIA 5GADl 5FUXA 4R98A 2ZRHA 3TE6A 1L2TA 2QQEA 1NN5A 3DMDA 5ELXA 4DB4A 1T9HA 3DMNA 1PV4A 4BLQA 3QPWA 3DHWC 4K8OA 3TRFA 1LVGA 1P9NA 4OI2A 3UG6A 1NN0A 3ZD7A 4IXNA 5J47A 5SZHB 1KI6B 1S2MA 2GCNA 2GESA 1XXHA 2QAGC 1D9ZA 1M8PA 3K70D 4OHZA 3LVQE 4ZKEA 4ZDIA 2G1KA 1EFRA 5DYGA 1T4GA 3BERA 1E0KA 4BZPA 3PEVA 2JGNA 2IYRA 1P62B 4P4SB 4G5QA 3WYFA 5L8VA 4NE2A 4CIDA 2QMHA 2WKPA 2OBMA 3H4MA 3OESA 5M04A 5HKKD 2ZI9A 1GG2A 2OG2A 3GFPA 4B74A 1UKVY 1KGDA 2QY9A 4DIDA 5K8IA 4JLOA 1GNQA 5KNDA 2ANBA 2KB0A 3U7EB 1U0HC 4F93B 4JKYA 2RH5A 4AWXA 4EJSC 1XEWY 2BKEA 2CEAA 1A5TA 2CVHA 4LYHA 4C0BA 2IYVA 4CF7A 1Q3TA 1RYHA 1N3BA 1XEFA 3IKJA 1CP2A 1N0UA 5FH9A 4DCUA 3EC2A 5TB5A 4L16A 4YDHB 3TH5A 4AI6A 2A7QA 1PLKA 1CJKC 1DVRA 2J1LA 4BZXA 1FUUA 2W6JA 4A9AA 4OQNA 5CB8A 3EW9A 4Q9KA 4KYUA 3BOSA 2A30A 4PHHA 1Z5ZA 1OYWA 1W0KA 4A8JA 3IUYA 4YXWA 1KI2A 4LV8B 2O5VA 1E94E 3CBQA 3GLGA 3WP0A 1JAIA 1VG1A 2EFEB 3W6NA 4HDCA 3LXRA 3AVXA 2WTUA 1NKSA 2ZRAA 3SFVA 3FWYA 4KFSA 2BCJQ 4G1UC 3QKTA 3RVBA 4OI4A 3KKQA 4B3BA 2XB2A 3ECCA 1U9IA 2RAPA 2RGGA 2IYUA 3B5JA 2YOGA 3I92A 1E1RA 2DWPA 1UDWA 3FYHA 1DADA 3AH8A 2A5FA 3B85A 4QRHA 1YQTA 2H57A 4CGZA 3OE7A 1JJVA 2GCOA 2ZR0A 2QP4A 1KY2A 2VF7A 5JZVA 2VSOA 4YMWA 4D4LA 4YQFA 5JHGB 3BH0A 1XF9A 4P32A 4WZBE 1G8FA 4ASUA 2W0MA 1E2NA 4DLXA 1RFLA 1HT1E 1YVDA 2D62A 1QG4A 2BDTA 3UMRA 5GJCA 5DE3A 2ZS7A 1C9KA 3MJRA 4OKSA 4TTPA 1X86B 2R6GA 3AUYA 3LW8A 4PXAA 4C2TA 2BM0A 2ODEA 2WVJA 4NU0A 5TDHA 1GOTA 3ZLJA 1MOZA 5J4HA 1HH4A 1TF2A 4NZYA 1D6JA 3HYRA 1DE0A 4G0NA 3FFBA 3ZDQA 1G21E 4R7ZA 421PA 3SR0A 1KNXA 1II9A 3D6TB 5LD2C 4RVCA 5AJWA 1OFUX 2I1QA 4LCBA 4PX9A 1GTVA 3A4MA 4RFVA 2W0SA 1ZU5A 2JJ1A 4B44A 3EZ7A 2GRJA 4W5HA 2ZUBA 1HE1C 3RS7A 4GT1A 1XTSA 4OHYA 4TTRA 3HJNA 1SVMA 2FFBA 4URVR 3WY9A 3RC3A 4KO8A 1Z83A 1P2UA 1I2MA 2QEQA 1FNMA 4X8HA 2PMKA 3G0HA 1G7TA 1ZD8A 3QG1A 1KO8A 3ZD6A 3NDBB 1J90A 1QBKC 3K0FB 1T91A 2GF0A 4GNKA 1NI3A 5JS8A 3OEHA 3MJHA 2YWGA 3QY0A 3Q9LA 3LDAA 4KODA 3GP8A 4CDGA 2QPTA 4JS0A 1TQ2A 4PHTA 3TSZA 5E7IA 3T12A 4FW9A 3TLXA 1E2HA 1N6PA 4PZYA 2OESA 4Q00A 3ZVRA 3P26A 5HCNA 1KI3A 4RCYA 1JECA 2IYTA 1CJMA 1OXVA 2QE7D 1QHYA 3PR1A 5EE5B 1H8ED 2G77B 1E9CA 1R5NA 1YZKA 5LB2A 4B76A 2O52A 2PX0A 3KFXA 1IJEA 1LS1A 1HUQA 2BCGY 2GETA 1EFUA 4RZ3A 4JL5A 2AXPA 3EWAA 4Q4HA 3LBHA 3K9NA 1TF7A 1V43A 2W58A 2ZJ5A 3P4XA 1FQKA 1T3SA 2IW3A 3AF0A 1IHUA 2KWIA 1C4OA 4Q1AA 3X2SA 3RRMA 1PZNA 3IO3A 1GAJA 2FOLA 3DO6A 1CRQA 3IPYA 3L0PA 2EFCB 4TQUS 5F9HA 2GCPA 3C5CA 3ZQ6A 3KXKA 5F2EA 5KSYA 4CEIB 1IOZA 2QU8A 4LV6A 2R6FA 1IN5A 2FA9A 5B30A 3MGCA 4DXAA 3CRMA 2R65A 2ANCA 3HDTA 3LW7A 3QKRA 1AS2A 2EFDB 3PXGA 2J45A 3X1ZA 2A2ZA 1QHSA 3RS5A 2AN9A 2QG6A 4UJ5A 3EAQA 3FFAA 5B57C 3CH5A 1U8YA 2F1HA 4TQAA 2CLDX 3NWJA 1M7HA 1NIJA 4FMDB 2PLFA 4LJYA 4JBYA 3VU9A 2CK3D 3H2YA 4CT4B 2D06A 5C18A 3S1AA 3E2IA 1YJ5A 3W5JA 2E9SA 4DLUA 2IX3A 1LFDB 3A58B 4IVQA 3U6BA 4C7OB 2CE7A 1S8FA 5DLQC 2HYDA 1EFTA 3GMTA 2J46A 4FMBB 3REFA 4LC1A 3K09A 2Z5FA 3VKHA 1E99A 1JEDA 3EIEA 2NMVA 4OQLA 3CLVA 4DUGA 2P6NA 4LYJA 3HPQA 1XTKA 5CK5A 1AGRA 1CR2A 4Q7JB 3C8UA 2FF7A 1KDPA 2QT0A 2I4IA 1Z8FA 4HSEA 4LUCA 1G3RA 4UJ3A 2XJ9A 5FBQB 2KE5A 4O0MA 4EQ6B 2Q21A 4PPQA 4URUR 5KSOA 1TQ4A 2WWGA 1Q3HA 2F43B 4PR0A 4LX0A 4Q47A 3REGA 1NVUQ 2L0XA 3TR5A 5JRJA 2IXFA 1J2JA 4RJLA 1TNDA 2QTVB 1B23P 1E0AA 1KK2A 1W0JA 2B8WA 1XEXA 3VU9B 3LNCA 5CDFE 4US2R 4XWKA 3LH5A 1W4CA 2V6JA 3F0TA 1TQDA 5EQTA 3TK1A 2MSEB 2GXUA 1MO4A 4BFVA 1T0HB 1NVVR 4Y0AA 4B2IA 2EU8A 2ONKA 4PPNA 3OZXA 2WWIA 4F4IA 5JFGA 3FGNA 3CNOA 4R2IA 2NO6A 1E9DA 5FTMA 5CYOA 4JVLA 2DPXA 1T3LA 1P4SA 1Z6GA 5BYJA 2ZU6A 2RB4A 3SNHA 3HYTA 3R7WB 2FNAA 2GAAA 2BEKA 3FHCB 3U7FB 1QHXA 1H8HA 2GCOB 3CR8A 2GK6A 3AQ4A 5EXTA 5KYKA 4KJZA 3ETLA 1M74A 2B7BA 3BB1A 1W44A 4HDOB 4HZUA 3B6EA 3THWB 3LO5A 4PO9A 5JCPA 3PITA 4HUQA 2ZE8A 3DOFA 4Q1FA 1G4AE 2WBLC 1E79A 3AF1A 4PANA 5FUVA 1S4QA 4HATA 1GIAA 5EUQB 3KJIA 3K0EA 1E2IA 3IHLA 2DCUA 1LW7A 5AUPB 3UK6A 3CX7A 2F43A 4MRNA 3K9HA 3GLHA 4K81B 3BH7A 3BRWD 2ZVPX 1HE8B 4LJ8A 3T5DA 1XTJA 4ZIRA 4I99A 3VNVA 2JDID 2QN6A 4NMMA 4U7DA 4BFXA 4S35A 3RSLA 4C0JA 2ZVQX 4PPFA 3IBGA 4URYR 4XVRA 3QXHA 1YR7A 1E79D 1D9XA 5F3WB 4NCNA 2OV2A 3SYNA 1QVAA 4PAOA 2UZ3A 3I3SR 3QUSA 5JJKA 3O8RA 1N6KA 4JL6A 3AVOA 4HZIA 5EZ5A 4E09A 4AKGA 3EXAA 2IXGA 3RWMB 1BIFA 1KIMA 5L3QB 2V6IA 3BAFA 4KU4A 3ZS9A 3FHTA 1FUKA 1TX4B 3VQTA 2RGXA 4F91B 1JXOA 1I4DD 2GVDC 2CMKA 1G3UA 1P73A 2W6ID 2P6RA 4AYXA 3GFOA 4PAQA 4DSUA 5JJIA 3GJ4A 3FVQA 2ZROA 3AM1A 4BLOA 4BFTA 2F55A 5SZIA 2O8EA 4C4PA 3F5FA 2ZJ8A 4S2EA 4LJAA 2XXAA 3Q5EA 4CEHA 2KJQA 1Z28A 2HLDA 1ZM7A 1MO3A 1F48A 2ZRPA 3RC8A 5DNYB 1GKUB 3KTAA 3EARA 3GJXC 3U3RA 2QQ0A 5JI3E 4W9MC 3BC1A 3VR2A 3LAWA 1DBSA 1LNZA 5FOSA 2JAQA 4D81A 4OI0A 1M34E 4YDSA 4XVUA 2ZI3A 4DB2A 1FX0A 2D7CA 4YONB 4LJ9A 4DLYA 4DDUA 2EWVA 4JVMA 3VNUA 5FOVA 1Z0FA 1QF9A 1P5ZB 4DLTA 1OH6A 4C0KA 4QGAA 1E2KA 3W34A 2JLYA 2ZRGA 1E9AA 1UKZA 1F2UA 1ZINA 2YKGA 1YZUA 4GMXA 4KFUA 3DPUA 2YOFA 4GDFA 2HLDD 3FOZA 1E32A 3QBVA 4RFSA 4MYTA 1W48A 1KSGA 1GRQA 5F9FA 4R71A 3A37A 1FMLA 1GKYA 3RS3A 2PH1A 4KSCA 2AFIE 1U9IC 4Q1DA 2ZRNA 5L3QA 2XTZA 3B8HA 3GLFB 3W6PA 2ZSFA 3AEZA 3VTKA 2OAP1 4JT4A 4LYFA 1ZVQA 1KMHA 2EFHB 2XXAB 2DWOA 1SVLA 1XPOA 1E2MA 1GVNB 1F2TA 3AP2A 3PENA 5J4LA 2B7CA 2F6RA 1VECA 2FZ4A 3CX8A 2FSHA 3TGPA 2QPAA 1GL6A 2D2FA 4OJQA 5K8LA 4A15A 2X19A 4LSGA 3FHOA 5IHPA 4IDQA 4TMZA 3WNDA 3TAUA 3QF4B 2P2LA 4IVRA 4B35A 4DEXA 4Z1MA 5AUNB 1AGPA 3IHWA 3L2OB 2FE4A 3ZIAD 1Q22A 1VDZA 4XJXA 3PCRB 3Q7QA 5DI3B 4LOAA 4LBVA 1CKEA 3VR5A 5BWMA 4C2UA 2J7PD 2DYKA 4HLCA 2DHRA 3D31A 2OCPA 1KI7A 3BS4A 2MSDB 1HURA 2R44A 3DZDA 4V0OA 2VHJA 4EUNA 2ZS8A 2IBMA 3R8CA 2WOJA 4AKHA 1IN7A 2IHYA 2ZAMA 1GWNA 2O8FB 2J0QA 1ZNXA 1WDTA 3IQWA 3OIYA 1VCIA 4QBFA 4LZZA 3RRNA 4HDQB 3IILA 2RHDA 3C14C 5FBVB 2REXB 4I1SA 4BPBA 1G5RA 1GNRA 1UFQA 4D25A 2ZRBA 3EZFA 5BN4A 4OQMA 2J3EA 1XPRA 1U94A 2ZIAA 3K8YA 5KOYA 4O2RA 2ZYUX 2Q3MA 3I72A 1DG3A 4IXMA 1QHNA 2BHRA 3T1OA 2H17A 1G41A 1E1QA 1IAQA 2VIIA 1UBEA 2A5JA 4TYWA 2ZSBA 1S0UA 3SQXA 4NYJQ 1Z29A 4O25A 2IWRA 4WZAE 2PT7A 3UG7A 4OL0A 1T3HA 1HQCA 2R2AA 2RGCA 2VQSA 3K9GA 3WRYC 5J4YA 1ZNZA 5H70A 4BUJA 3BIFA 4GRAA 1E1QD 2ZE5A 3GJ6A 3ZZTA 4ABYA 4M0LA 4QBIA 5HCIA 4M1TA 2IYQA 5CITA 2N1BA 5FTJA 2HYIC 3W90A 4DSNA 3TKLA 4DLVA 2D74A 3U3KA 1EFHA 2JATA 4NYIR 1GILA 4O2LA 1ZU4A 1MO6A 5TXGA 1CTQA 3QKSA 4JJZA 4MRVA 2IXEA 4UXIA 4M9SA 3CH4B
chains in the Genus database with same CATH superfamily
1GZ4A 3CVWA 1NM5A 1G2IA 1PVDA 3UOGA 2NACA 1U8ZA 4U7WA 1TJ5A 1AUOA 1P3Y1 1GKKA 4J1TA 1LDGA 3R5XA 1NP3A 4K46A 5DGXA 2OQRA 4E6EA 4OYHA 2WF5A 4EJ6A 2GJ8A 1P2SA 1RMTA 2AZDA 2BMDA 2V7BA 2VAMA 4DG9A 1DCKA 3LKVA 4RZXA 2O3QA 4RJJA 4BLTA 1RXWA 4GLBA 1JHAA 2D2IA 3A1UA 4US1R 4QNMA 5CT4A 3AEXA 4ZVKA 1CEQA 2VQ3A 4Q21A 2H54A 4Q3NA 4RTPA 2R1UA 2GA8A 3EA0A 3IR6A 1E62A 3NYRA 1OMOA 4G63A 4YTEA 2CLEB 4BQOA 1TE2A 4P7JA 5DIZA 2NPIA 4B3XA 1WMSA 4TS9A 5AVUA 1T6XA 5AJVB 1U0FA 1BRMA 3QPDA 2UV8A 4RULA 1Y48E 2AR7A 3WYGA 2RH9B 4PSKA 4OK3A 1NLFA 3V8PA 4YAUA 4BWVA 1PKXA 3JATB 3KBOA 3PFCA 2NPFA 1BH2A 4K9RA 1DX4A 1JR3E 1DRVA 2I34A 3GB9A 3NYIA 1ZKDA 2EFYA 2FGKA 3CNHA 2VPIA 3UYLA 6NULA 1HETA 3SQLA 3MGKA 1UBSB 1XEWX 2H7VA 2G8LA 4JYZA 1ACJA 4FUQA 5BNIA 2ADOA 3EN0A 4XYLA 1R0CA 2O2YA 3PNMA 1N57A 5GTDA 4E5PA 2IA5A 2CK3A 1F2DA 3AYZB 2PKXA 1U2GA 1RLOA 2Q2QA 3WSTA 1R9JA 5BSHA 3UBTA 3N6RA 5HKAA 3HCCA 3JQ8B 621PA 4AK9A 5JASA 2OMEA 3HY6A 2WWXA 5IXJA 3C5VA 1PE0A 2C54A 1TAHA 3C1OA 1NI4A 1KQOA 5LQRA 4JB2A 1D8TA 4H7HA 2A58A 1R0RE 4V0ME 2D3WA 2EJVA 3I8SA 3EDQA 1YL6A 3IBCA 3B6MA 5CH8A 3IPAA 2FHSA 3P9NA 2FE1A 5FOQA 3QPUA 5BWNA 2Z6QA 3G6WA 1CY6A 1I3LA 3K72B 4MR8A 1Q5PA 2OORA 3SHVA 4UREA 5HS4A 2H2DA 4LN1A 1CEXA 3WWPA 5C8XA 4MS1B 3UT0A 5JDCA 4KQ6A 1XXHE 4ER0A 3I73A 4HDMB 2I2XB 4KE7A 5K3OA 3K5WA 1U8AA 2ISSD 2W6NA 3IKLA 1VMDA 1QJ4A 1ZCFA 2HDNB 2HXGA 2JD2A 2I54A 5AWFC 4ZMBA 3B1FA 2W2VA 3KKKA 3ZJ5A 4CLRA 4ND1A 2R66A 4QDOA 4Z2AA 2YC2C 2LWIA 3SVZA 4AJPA 2FRDA 2X8BA 3KB2A 3SJUA 4FGUA 2O8EB 1B1CA 1DPFA 3WNCA 1R2QA 5HTOA 4BDTA 2CHUA 4LDPA 2FW9A 1XMOB 1H3EA 5HS6A 3TUIC 4L4UA 3TS1A 4BEVA 1WPQA 3GJ0A 4OGGA 1ULHA 5YASA 3VPFA 4D43A 4P0TA 1W4RA 3UWPA 1EX6A 2G5PA 3JS5A 1M1ZA 3B7PA 5DHRA 2AMLA 1DAHA 2OV8A 4IIUA 4LE1A 3ZWBA 4YX9A 5FWYA 2FN3A 1TEHA 3FPAA 1A9XB 2H52A 3GVIA 3I6YA 5AQEA 4FFDA 5DO9A 5G2OA 4RHFA 1RYFA 1U2PA 2IYWA 1E18A 3MEQA 2QLNA 4QL3A 3VR0A 3NBKA 3EWSA 1TUGA 1U28A 4G09A 5E9AA 3ISTA 4AQDA 4AY4A 1W29A 5GM1A 2XZOA 3BZUA 2FJPA 4KGDA 4MDFA 1R7RA 3OM9A 3OPYI 1R3DA 3PKIA 4Z9FA 1UPTA 5IFKA 4I5FA 3ES9A 1P0MA 1W93A 5IT5A 2Y76A 3IMCA 1HFEL 1EQUA 1HEYA 3ZE8A 1N8KA 1QP0A 2W43A 3LE8A 4JOBA 1QGDA 1FFDA 3U81A 4AJ1A 5BN5A 3DL0A 3K30A 3BMNB 3QFSA 5ARBA 4UXJA 3V8EA 3SQNA 4R7GA 4YI5A 2O4UX 4BZZA 2DWUA 2WJVA 4UNIA 3ZGYA 3HFJA 4EAQA 4M53A 4XR9A 5HIJA 3SS7X 4EPWA 3HVJA 3VX4A 4Z4GA 2CXHA 1G8MA 5FPHA 4C6SA 2YFYA 1EK0A 4MUEA 4NU5A 3KZ1E 4DBZA 3UT5A 1CUDA 3JVVA 4X8LA 2H4WA 4YEDA 5KI6A 3WO0A 4YV2A 1B16A 1B6GA 5C8VA 5ITZA 1I0LA 2ZJAA 4NE7A 1O1YA 5IXSA 1GZSA 3SK0A 3V6LA 3EZLA 3NHAA 3WBJA 4QNRA 1DRKA 1QRAA 1VL8A 1Y0BA 3RK4A 2J3JA 2GBLA 1IIRA 3P19A 1CNMA 2BAGA 4D7AA 2KLBA 4P93A 4RY0A 1QPGA 2I6UA 1DQNA 2A0YA 2GO1A 3L7IA 3HB5X 5KJ1A 4QLBA 1NT2A 4LNHA 4M0EA 2PVSA 4ZXPA 2O7NA 4EY7A 1UBHS 3IS3A 3F3MA 4P9NA 2Q8QA 3B52X 3ONWA 2ZGVA 4DNOA 3WB9A 1I7LA 3M2PA 1J56A 2HNAA 2G0AA 4YXWD 2Z6AA 2GPSA 2YHSA 4LRSB 1GPLA 1KA9H 4I9GA 4P4UA 2Y1EA 3H99A 1R6XA 3DT6A 4OUKX 4UKDA 3SOZA 1IZYA 4HMOA 1BJTA 1RXUA 1G19A 3PG5A 4KPGA 3QRWA 3LECA 3BHNA 1M1XB 1W0JD 4HBGA 5DNVA 4D99A 4J3FA 3PLNA 1F14A 1A50B 3DT8A 3NIWA 3ZEAA 4DT1B 5K8VA 4E5UA 1Y6ZA 3P9PA 4EW6A 3H75A 2VDLB 2M6KA 2AZMA 3P94A 2P4UA 3NV7A 1ZBDA 3HGMA 4B83A 3A3OA 1WBDA 3LQKA 4CTOA 5DISB 1JAXA 2YNMC 2H1LA 2XMQA 2VSNA 2H2IA 4HQ6A 1GAWA 1L7BA 1PHRA 1RRKA 3ZUGA 1IG3A 3KYCA 4A6EA 2SCUB 4K0KB 2HDHA 2ZLBA 3AT1A 5AMXA 1DBPA 4R81A 4K9DA 1LPBB 3OMLA 5I01A 2TMDA 2HM7A 3ANLA 3FA2A 5IUKC 5JJBA 1AVTA 2J59A 1JH9A 3U16A 4GP9A 2JEZA 1POWA 4P08A 2VO1A 4RVUA 1VRVA 5E9WA 1VZ2A 2QZSA 5FNVF 2RARA 2WYHA 2OPHA 3A4NA 3CKLA 1VSBA 4ZU1X 4TYPA 4CGYA 2P9QA 1B7GO 1N9GB 2VP2A 3DZGA 3STHA 1SZJG 2YWHA 4FFLA 5I4KA 3CUEF 4Q9DA 3T9CA 1T0JB 4Z4FA 1TQ6A 2F67A 3R0IA 1K6JA 5BWLA 2ZUFA 4X6XA 4X94A 1YB4A 2I3GA 3BK1A 2QP3A 1U2DA 2IUYA 1KAMA 2Q5QA 3I4CA 2AQIA 4DT1A 1L5HA 1CZRA 4UU7A 4CQMB 4BATA 3O4JA 1UM8A 4YC7A 5IT9A 3AONB 4B3HA 4U8GA 1P2FA 1XJWA 4H3SA 1WULS 4E5DA 4EHJA 3DOCA 3EF3A 5L3RA 3V00A 1ZNWA 1UP6A 3S99A 3LQ2A 5C1OA 1PGNA 3AG5A 4KCGA 1R6BX 1QP8A 2VAXA 4EHBA 4U6NA 3B6ZA 4BVFA 5HPYB 3L82B 3JQFC 4ZVPA 1NVWQ 1Z2CA 4S05A 1BMTA 1RC8A 1Q0TA 4B3DA 5AI6A 3RR2A 2G83A 5JFOA 1YVUA 4YJFB 3WIBA 2EBUA 1SUAA 4XIYA 3CW8X 5BR4A 3C4QA 4NLLA 1CUYA 1A8PA 5DM0A 2BTEA 2ZZNA 3B3GA 5HJEA 4C7OA 3V4PB 4D98A 3BG5A 1C3VA 2VDRB 3PUVA 5JNUA 1FFEA 4LDQA 5FWXB 5CIYA 2VP9A 1IZ9A 1VCMA 3HY3A 3IOEA 2FDCA 1BG6A 2ZRQA 2ZM5A 3U61B 2R85A 4Q3AA 4U2EA 4DYHA 3NBUA 2VTBB 1U8FO 1RWVA 1SQ5A 1PR1A 5B2ZA 3WWOA 1GZDA 1M72A 2BFPA 4P3PA 4E70A 4F21A 5AM3A 4JUIA 4XWOA 1N2EA 5TEWA 1FP1D 1NAHA 1OT5A 1E3SA 2NO1A 2XHEA 3LQFA 4PS0A 3D54D 4AZSA 3D3WB 4CUKA 5J2TA 1FW6A 2DBRA 1DKLA 1PQPA 1V9CA 1M2FA 3TJZA 4HADA 1J0EA 1DEKA 1Z4KA 3AR2A 3FPLA 1AIPA 3B1JA 3HKBA 5B2EA 5JVDF 4R2HA 1F8XA 2H1FA 2GRUA 4WE3A 5DF1A 5DDIP 5HF5A 1GCOA 5KHAA 1SCUB 1P33A 2BISA 2QVZX 4P83A 3RRXA 2NSDA 3B8EA 2DVMA 4A82A 3WAJA 5KYWA 2YFQA 3U7HB 1NULA 3TUZC 1KERA 3P1JA 4MITA 3JWPA 1FE8A 4HRVA 2COKA 2HIMA 4ZO4A 4B3MB 1AKWA 5EY5B 1L4UA 4GM4A 4ZQGA 3RYCA 3AL0C 3B9PA 4FGLA 3KYDB 1FS5A 2K87A 4NULA 2K2WA 1I7DA 4B6QA 4YV7A 2FPUA 2B98A 1EKXA 1IDOA 2YINC 5DN9A 1D3AA 2R4QA 3EVNA 4AD8A 1GNLA 1V3VA 3H8SA 5TIIA 2SHKA 3WL4A 3SP1A 3UJ3X 1H8HD 1R0LA 2OFWA 4RIIA 2QTNA 2ZRKA 2FPGA 2V9PA 4ON9A 5H68A 3SBOA 3I05A 3IERA 1B15A 5EE1A 5JD6A 1W36D 1HT2E 4G36A 1G3IA 3MMNA 3P9SA 2OSBA 4MJLA 4YRRA 4W8OA 4C4OA 3T1VA 2I1VB 3O9MA 4LXTA 3RUCA 1MGPA 4YDQA 3UFBA 3ZDXB 1Q12A 3CIOA 2G8NA 2L69A 3C7TA 4D8VA 3LPCA 1O8BA 5L6MB 1ST2A 1QK5A 1AKTA 4H3KB 5DXJA 5KCZA 1QF6A 1Q50A 2FHPA 3BWBA 3INRA 1NG9A 2CB0A 3F2VA 3L92A 5DXFA 4E14A 5FBWB 3VVBA 2GM4A 1JEJA 1OX4A 3DZBA 4IJKA 2JIBA 5IVPA 1RQPA 2OCBA 2PEYA 2Z95A 3FHJA 1NM5C 4GHWA 4HQNA 4HDKB 3H9UA 4MS3A 3SDZA 4HT3B 5FL3A 2VJNA 4Z4HA 4Q4JA 1SKQA 2GZ2A 1HTWA 4B4WA 4OXYA 5HBGA 1XWIA 3NDBB 4GUDA 1ZW6A 4KXNA 1AJEA 5TARA 5HIAA 4J0DA 1C9NA 2EVWX 5EP1A 3ZJVA 2C99A 4KH0A 2JI4A 2FEWB 3BXZA 3OOEA 5GONF 1JLHA 1HZZA 5IH7A 1Q20A 1JKJA 1U7DA 3OPVA 4DNPA 4DVGA 4ZEOA 2YOHA 3DBRA 1M3SA 1LK7A 3HN7A 4JHLA 1ML4A 3B82A 1NI4B 3BRWA 2Q9CA 5HW0A 1TOAA 3L7JA 3LWZA 2VHEA 4E5SA 5CJ2A 3EVFA 4AB1A 3WK8A 5DLDA 2XVXA 3WBKA 4YCMA 4JLDA 5G1OA 2HU7A 4OFWA 3KQHA 3GY0A 2OECA 3E3OA 4MUXA 1RYNA 4D3DA 3EOAI 1GARA 3GLGB 1U0BB 2X77A 1V0JA 4N82A 5A3QA 4XEHA 3QOWA 5CDUA 4XUDA 5CPBA 2OV3A 4TKMA 1GDDA 4COKA 1JPVA 2OAGA 4IGFA 4CQLB 2AC7A 3I9NA 4GSLA 3CF4G 3DYBA 4BTEA 3KELA 2DPLA 3L04A 3MS2A 3O5AA 2UYYA 2XYVA 3P9QA 2BJVA 3WIUA 4DBLC 5ESXA 3PC4A 3TW6A 5KKNB 3DHEA 5B3LA 1JFFA 1HNNA 1NR5A 2G70A 3TW8B 4H7FA 1N2SA 3FBWA 1SUBA 3JR7A 2HWWA 1YU9A 4G8JA 3LXUX 3Q4GA 3TMKA 1AURA 3UHOA 1ZM3A 1NIPA 1Q0HA 5HXAA 5ALXA 2QAJA 1BN6A 1JIJA 1TKBA 3N70A 4P80A 2B8EA 2IF2A 1ISJA 1PBTA 1MV8A 4UM8B 5AJTA 3FOEC 1T2UA 3QVSA 3D0KA 4MZDA 1USIA 1NW8A 5TLSA 3FTDA 4QYMA 2YYZA 3I9V1 4RV9A 3LIPA 1FL9A 1G2PA 5DHSA 4D80A 1X80B 2W8BB 3TLKA 3VVLA 4LC0A 5FDFA 4GE3A 5JAHA 1OXMA 2GKSA 2B7LA 3C15C 1EDDA 3EF0A 4INPA 2H00A 4MW2A 4OFXA 2C2XA 3MD0A 5H7XA 3NBXX 4ARZB 3FAZA 1BU8A 4K7JA 1BFUA 1JI0A 1BD4A 1DG1G 3DZIA 4RH3A 3EQ8A 2OHJA 4TMFA 1ZJ4A 3N39C 4KQIA 3ICVA 4ISCA 1J25A 2YXNA 1YRLA 4JQCA 1FNDA 4M9CA 5AK0A 3A4VA 3QNWA 5LJLA 1ZX1A 2F1KA 3QVKA 2RE8A 3W5IA 5KPDA 1R5OA 3M7IA 4U9UA 2F1JA 5I4IA 1GUDA 3BA1A 1GGNA 1BDHA 2FG6C 4M88A 1RQ7A 3ENVA 4RAOA 5IJZA 4ND5A 3CVUA 3MJVA 4PQRA 3JW8A 3SSAA 1VI6A 4X9XA 2PV7A 4N65A 4QOEA 3E22B 4QM6A 2XMRA 3ZI4A 3DVAA 3L8HA 4W6QA 4AICA 3E4DA 5JDIC 3BRCA 2WJHA 5I7RA 1ZSYA 1QQAA 3U13A 4LXXA 4OYLA 1O97C 4B85A 3MC1A 3LVRE 3A36A 4F3TA 3QE0A 1NWCA 4IIYA 4BLRA 4BNDA 4OVKA 2B3DA 4MS4A 5ENVA 3SEZA 1OBOA 3EASA 1IJFA 4KC0A 5THXA 3K5HA 1J33A 5DNWA 4FCTA 2EIXA 4JLKA 4NICA 1QZTA 2EZ9A 5D3MB 5I4CA 4HQKA 1IOLA 4EABA 5ED0A 4YACA 1CF2O 1K6XA 2O0JA 3NANA 1QZUA 2CDRA 1Z3IX 1Z5WA 3ZDBA 4OKIA 1F51E 3F74A 5FD8A 3ROKA 4EKGA 3MINA 3OOSA 4PC6A 2J85A 3OJLA 1KMNA 4D9FA 3GEEA 4O4IF 2QYTA 2QRNA 4A8PA 1V5WA 3RJMA 3TIFA 4F38A 2CZGA 4ZQCB 2FFJA 4B33A 3IV6A 4E3ZA 5C37A 1I36A 1LBSA 1XCPA 1A9PA 2IQ5A 4CMBA 3WQQA 3ZXSA 4FHFA 4K6HA 2ZB4A 3NM4A 1EBBA 3EUWA 1YQGA 2B4QA 4DUYB 5HM8A 4WY5A 2IZ5A 3AGQA 4LJ7A 4NZZA 4FZVA 4H4DA 2AJLI 3RTEA 3QWHA 5AVTA 3UXHA 3GRRA 2P1DA 1ZM2A 4EKDA 1C1XA 2AFHE 2C4UA 3AUXA 4ARSA 1NVFA 4CG1A 1T2VA 5CTAA 3CUUA 1OZHA 5EKSA 4KPYA 4IV0A 2HU8A 3P71T 2IRWA 4IIEA 2OCDA 4DCNA 1CU1A 2GBLC 2Q45A 3QP9A 4JLSA 3X1KA 5CX1B 1KAGA 2UYCA 4G0QA 4P4SA 5K0FA 3OFSA 2Q49A 4QWWA 3TCNA 3C3CA 3NEAA 4CM9A 1NFFA 2HU5A 4LY3A 2VJMB 4U4AA 1PL8A 4LZAA 1VL2A 5HKKA 4AY2A 1FNNA 1U3UA 2YR0A 1LC0A 3EH2A 1XVLA 3BTOA 4A36A 1JG4A 4TLEA 3QHPA 4W7IA 4DMMA 4OHUA 2ERXA 5C1IA 2J6HA 3HU2A 3WK5A 2PFSA 4LY6A 4W1PA 3IMKA 3Q3GE 4C4RA 3C39A 1Y4SA 1OYOA 2FSUA 2O1EA 5DRYA 5E2BA 3VU1A 4EJSA 4XX1A 2HFKA 1I4LD 2C4NA 2QWXA 4YJ3F 3TSWA 4AJJA 3F1LA 5JAIA 4N48A 3UMGA 4AJ2A 4LHZA 3LHKA 1EAYA 3AR9A 1JSZA 5I9MA 1MRNA 2A0FA 1RIFA 2R79A 3H8VA 2VK1A 5KDLA 3SHFA 3C3WA 3IBTA 4FYJA 4KK4A 3UF0A 4UU0A 4M1MA 1Z06A 4F9GA 1XZGA 3INYA 5H9VA 3JARA 4AIRA 1TCAA 1YS9A 3QWAA 4BNJA 4DRYA 4UBOA 1DX6A 5EJ2A 3COYA 3GP5A 3M1LA 1WQ1R 2RGWA 5LA6B 2DWCA 5TS3A 2JKYA 2HEGA 4KZKA 3H7IA 3VYUB 1TADA 3QI2A 4C03A 4P3NA 4J4TA 3DVSX 1EMDA 5FFNA 4C01A 3D6NB 1OREA 4F8JA 2XYHA 2Y1FA 1AH2A 1ECFA 5A3SA 3WLLA 1S9HA 4WK2B 5H8WA 4GYWA 4QGFA 4UUNA 1G4UR 2J08A 2YC4C 3WBFA 3BSSA 2J7PA 3N2GA 1OPXA 1W1WA 4OL9A 1ATIA 4CLOB 2IL1A 4XWWA 1F2UB 1G5FA 3GFRA 2XRFA 2WJ4A 4ZVUA 3K1YA 5G3YA 2IOHA 4AYWA 4BCDA 3DLTA 5IK2A 3PFIA 2QT1A 4I55B 2DHCA 2PSJA 2BV3A 3B60A 5C53B 3IESA 2BKUA 4IVNA 2JCGA 3IUNA 3T1NA 3ZN2A 4YDRA 1N8TA 1JG1A 1U7WA 1UF9A 3PVSA 4P82A 1JR6A 4G8BA 3LWNA 2NU8B 1E8DA 3PI7A 4OU4A 1U81A 4TMKA 1YA6A 3RARA 5KS2A 5KOJA 2RHOA 1Q2XA 3MLAA 3R3HA 1FFHA 2QBYB 5KJ6A 2OXRA 3DBLB 1NJ5A 4B48A 1MT3A 1GY8A 4UCQA 4UAJA 3GUUA 4DJTA 1NURA 4KHZA 2JLBA 2NYUA 2W98A 3G82C 4IOMA 4NZOA 4KR9A 3MMZA 4PRKA 2JA2A 2H92A 2AYYA 3O8QB 5KNCD 1XRLA 4UAGA 1MAVA 2GTIA 3KB8A 3N53A 4O2BB 3VO9A 4EJ2A 3BKXA 5DOZA 3WQBA 2W11A 3L1VA 3UWKA 4IIJF 4HZUB 5ELLA 4MIYA 1VLVA 4DLSA 1IN4A 1MOSA 3BD6A 2XYQA 1SCJA 1P0CA 5BNZA 4BV9A 2AX3A 3W5AA 1FQWA 1WU8A 4PGMA 1NVXQ 3OPYB 4NMWA 2P69A 1KEZA 2HA7A 4MUNA 2BLNA 2ZYVX 1QYCA 4UHCA 2R7NA 4TV8F 5IFLA 2VJCA 5B58C 2Q8NA 3R6LA 4XVCA 1JSCA 5IPFA 1V7CA 3WMEA 2M1ZA 3THRA 1GFIA 2DKOA 3ASZA 4MYDA 4QUEA 4QQ8A 1VG8A 2HMSA 2IHKA 1U4SA 1W0KD 4JHXA 3W6UA 1ZWLA 2C9DA 5CAEB 4ZK6A 5BR8B 2P9CA 5EMKA 2ROQA 4LNAA 4PC3A 4ARUA 2XSZD 3ONEA 3WKDA 4YCNA 4MQFB 3RUFA 3E81A 1UXHA 2A4KA 4FZRA 2I8LA 1W7AA 2IYLD 3QWIA 2DFKB 3IYLW 2H07A 2P65A 3MHPA 1EIWA 2C5BA 4J2OA 4RXUA 4E4YA 4EGSA 3MPUA 1PUXA 5A4DA 1BE8A 1NXQA 3BXHA 1QHEA 3FYCA 3WYAA 4ZYTA 3MT9A 1EWKA 1O96B 2J9GA 4R8KA 4OHWA 4UEWA 4WOCA 5BV2P 4U3JA 2IUUA 5C51B 1GDHA 4OAOA 3DCJA 5ECGC 1E77A 4XPIA 1NV8A 2Y2VA 4FI3F 5IC6A 4FYHA 4POOA 5CFMA 4E5KA 2E48A 1WUJS 1JB1A 1K97A 1Q0ZA 1WKBA 2I3ZA 2QTAA 2FEAA 2JGJA 2PSDA 3E9MA 3QBDA 2V7QA 2WIBA 4UAUA 3WYCA 3V33A 3HPRA 2Y77A 4GXTA 4MUKA 9LDBA 3N1UA 1Y9DA 1OKKA 4GE0A 3DB2A 3GAAA 4FHCA 3DMYA 3LY9A 3T41A 2FEKA 2GJKA 1I13A 3QMMA 2IBTA 2K6GA 5ALSA 5IJWA 2OGTA 2IV7A 4DA7A 4O08A 2ZDQA 3HLYA 2PL9A 4TL6A 3PDIB 4GQBA 3TLEA 1X1BA 1F5NA 4HR7A 3U40A 3M4ZA 3AP3A 3R5FA 3BQ9A 1CQZA 2QA5A 4BQSA 2AOTA 5AK5A 1T9AA 2HEIA 4O4LA 3QXCA 1K2WA 3GJQA 1CQJB 1OQAA 1KHTA 2CJWB 4L85A 3OQJA 1WCWA 3V1KA 5MN6A 2A9QA 4W5OA 2DJIA 1KAEA 2GNAA 4IJMA 3HV0A 1EXVA 1KH2A 5ERGB 3D3KA 5DIFA 1GZUA 4YRZA 5E0KB 2CLSA 2WG2A 3BXOA 4CMIA 4V1CB 1N5IA 3TRIA 2A0UA 2IS4A 2WHEA 5DLYA 3O47A 4ZYUA 1C1YA 3BHMA 3Q40A 4C30A 2QTTA 5IYZB 1AF4A 2JJ8A 2X2FA 4ZODA 1Q3KA 3T8YA 1E4YA 1DRWA 3NBFA 3Q8XB 4L8YA 1P2VA 4QNNA 4URHA 2VDUE 4AUEA 3DAFA 3OUTA 3O93A 4HK4A 2O1WA 5E9JA 4CHTA 4FGWA 4IGKA 1FVXA 1I3CA 5JWOA 1R74A 3RJZA 1KJWA 3L5OA 4P4LA 5L7TA 2EKBA 3CUTA 4BNWA 2C8LA 4W99A 4XX0A 1EK6A 1O94D 3THOA 4ZMRA 3ON5A 4RK7A 2QTVA 2YVUA 4DEVA 1HL3A 2AOVA 5DSZA 2FR8A 3T7RA 3UT5B 1XQYA 2VLBA 3QVVA 4HI0E 5IBPA 4K6OA 3L7DA 3R5JA 3WGNA 5B4TA 4XARA 3PJEA 1OGIA 2WKQA 4WKBA 3V7FA 4K87A 1DKPA 1ZJ5A 2I4MA 1ECPA 2I4NA 4G01B 5E3HA 1RWOA 1KSHA 3E7FA 3DFIA 3MWLA 4Z1MD 5T6MA 3PGLA 3FZGA 3OLCX 2JC3A 3H17A 4LNUB 4B6JA 4PX2A 4W5JA 1ZUHA 4X1IA 2BVNA 2QS9A 2FWRA 3N2KA 2AOUB 3FF4A 3ZW9A 6YASA 3K73O 1SZDA 3DVLA 1KYXA 2PKQP 2QMZA 2WIGA 4ISBA 4D6XA 4IIBA 1MC1A 2R7AA 4N8DA 2QI9F 3K35A 3N5KA 2ZIXB 4G4IA 4DSAA 2XNDD 2C7VA 5BP7A 4EYOA 2O8CA 1NRXA 1H5QA 3PXUA 2A9VA 1ODJA 2P67A 1MGOA 1XA4A 3W78A 5DI3A 3KPUA 1EX7A 1WG8A 3I1JA 5DX0A 4H3VA 4Q4DA 1Y5LA 5P8WA 3FWKA 4JN6B 5G0TA 4B0OA 1IUKA 2ODBA 5KZMB 4H7DA 1TU3A 2GR9A 4G1BA 3RHSA 3UQYS 5IJ0B 2FZGA 5T4BA 2BGRA 1SQGA 2BBTA 3H8WA 2CLHB 3IQXA 1Z2AA 1W0CA 4M1EA 4WCVA 4IEFB 3NH6A 1IC6A 2IHTA 3I34X 4ZCIA 3VHLB 2ZJFA 1MC8A 3E1KA 4ALMA 3PC7A 5AW5A 4OHOA 3PQEA 1T8SA 3S7TA 2QN8A 1O95D 2NVUA 2K2QB 3GW8A 3ODPA 1U0NA 3OHSX 2RK4A 1YS2X 3EGOA 4DLWA 2AI3A 4L78A 4FBGA 5ERYA 4CJXA 3OE7D 4M21A 4OMUA 2FPPA 1CFZA 2NM0A 2PCJA 3CRRA 4ZT2A 4A4DA 2V9CA 1M7BA 1E3IA 3U5TA 2IFTA 5DNDA 2CT8A 3H5LA 2WWHA 1USKA 2J0EA 1N6LA 1YA4A 4BGDA 1YB5A 1X6VA 2PH3A 4ZAGA 1E3WB 1ZVKA 2AT1A 2H4ZA 2IPOA 4Q9LA 4DL9A 2YZNA 3V4VB 1TRHA 2UVPB 1ODCA 3PHBE 4Q7MB 1O3YA 4CBVA 4L72A 5ALYA 6AT1A 2NUAB 1XTZA 1R4AA 4EJSB 2XNSA 4KYIB 4CKWA 5TQ2A 4ZK2A 3N8KA 3OZGA 4HAWA 1HDEA 3TO5A 1OVMA 1WPRA 3KKMA 1KQ3A 1L6RA 1S1CA 1TPZA 2ZU0C 4KP7A 4LCEA 3ZCVA 3FAKA 2BN4A 2A4MA 3HZHA 3KBBA 4RTKA 4NG4A 2D2VA 2QVXX 1K4YA 3QK7A 2W2OA 1A9YA 1F7VA 1DXQA 4G84A 1S2IA 1KKLA 1IN8A 5CYPA 2C9OA 1LF0A 2PCLA 3A1WA 3N2KB 2B1QA 1BH6A 1MZPA 4CM1A 3GMDA 5CDTA 2DY1A 2FPKA 1RJGA 4L28A 4CNBA 1QIMA 4NKRA 3GRKA 2V3VA 4UHJA 2BYTA 1EWRA 3I2KA 1L8QA 3KSZO 3KB6A 4F2DA 2XZDA 4E5NA 1QVRA 1TVKA 5FTKA 5IN4A 2CNKA 2RC6A 4X91A 4HGRA 3DE2X 3FTQA 2XQIA 1E6KA 1UPAA 2V7EA 3DE6X 4NK5A 3CEMA 4H31A 4YGYA 4POAA 5ECWA 5EA2A 1CJVC 2PHZA 3B3AA 1KS2A 1NONA 4JQSA 2XTMA 4ND8B 1HQKA 4PRYA 4PVDA 1H2FA 2AE2A 4WK4B 3K6SA 1HI9A 4X7BA 4IDCA 1I5OA 1H3NA 2J5XA 3ITDA 2YIMA 2PX5A 4NYMR 5J5CA 3L4EA 4AJ4A 3L93A 2WAYA 1J0XO 3P9XA 4HLUC 4JLVA 5CCDA 1JQEA 4B8ZA 1YS4A 4HS4A 4RQBA 4TT3A 4H7KA 2W4IA 1D07A 4ODIA 1CPYA 1T29A 2O20A 3COWA 1PZMA 1YR1A 1T9DA 2FLWA 2IPXA 3G3EA 4MB0A 5IXYA 8ATCA 1YFLA 1RR6A 3QW2A 1B76A 1RZRA 3X1DA 2Q9BA 2R8OA 2IS1A 4C0QC 1XQ1A 1AS3A 1CUEA 2O23A 2Z57A 4TYQA 4JLMA 1NJ6A 2G09A 3Q41A 1QHHB 1KZHA 4ACBA 4GS5A 4PHCA 4IRMA 5KHLB 2QP9X 4PZZA 2EARA 4EELA 4JUAA 4BFUA 1Z68A 2H5EA 5F9MA 3ULKA 3MTBA 4K0RA 4V2UA 3TGWA 4OJNA 5K6RA 3UMCA 3QLVC 4LRTB 3QV1A 4S24A 5KYYB 4IUDS 4ZI2A 1KK1A 2F2TA 5JNSA 4HEJA 4FMDF 2OCYC 3PZRA 4YN3A 3MT8A 1LWNA 3MWYW 4ZCRA 1LUAA 1L5OA 3PC6A 1Y1KE 3BWXA 3RFUA 4Q7KA 3KJNA 1NJGA 2AD1A 3Q15C 2GZRA 3GXOA 3ET5A 5IKEA 4G5GA 4K1LA 1K9VF 3QQPA 4CF3A 3WSVA 2YXEA 5FUBA 3ZWAA 1WUIS 3PICA 4TL8A 1SUDA 1QE3A 1R66A 3UWSA 4N6GA 2ZUEA 1HYEA 4PNPA 4NRDA 3REOA 2Q4RA 3NOQA 3FB4A 2CUNA 1BEEA 1L5QA 3CVXA 4C07A 2GB4A 5HX7A 3U5ZB 5K03A 4AZ0A 5DNEA 1EVQA 1YH3A 1YMQA 3HU3A 2IPNA 3W2EA 2XT9A 2V3WA 3GVXA 3RJTA 1Z74A 1N7HA 3H2BA 4RS3A 3OTHA 4IKPA 3S2IA 3VR3A 3PB3A 4BGEA 1XRNA 5GGXA 5BPHA 2UUBB 4RY8A 3NNDA 4I9UA 1O9BA 2C96A 1RWBA 3P20A 4JASB 3NONA 3WHIA 3GBVA 3SC2A 1L8LA 3FCXA 1O0CA 1ESCA 2PGIA 1RHMA 2KSQA 3AKDA 2HMWA 3N6XA 2WPDA 1V95A 1SCQA 1Z4MA 2RK6A 4V1CA 5IF9A 1SD5A 2Q6TA 1Z73A 2RG1A 3RBZA 1GTSA 1DIOB 1EM8B 1UZAA 2DECA 4FCVA 3WGIA 3T5AA 1B8VA 1M6VB 1YJQA 2XLBA 4FHGA 1YQDA 1KOJA 3SSNA 4KMMA 4EVRA 3K70B 3TECE 3E2PA 4ZYLA 2UDPA 1X0VA 1WHSB 3I64A 1WUHS 4C4YA 2AFIB 4ID9A 4ZAYA 1IOWA 2G4CA 2ZI6A 1IXZA 2YJ4A 4L6CA 3R7BA 3EDOA 1O9HA 4YCSA 3BDVA 3GGGA 2P75A 2VDKB 1VIMA 1Z5GA 2QLTA 1Z26A 3P2JA 1IJBA 1DC3A 4I50F 1W4ZA 2GGSA 2I66A 4MDYA 1OJ7A 4H1VA 3W3ZB 3QBTA 4WKNA 4Y6RA 3WR5A 3BMCB 4A2QA 4YP9A 1PGPA 4DJ5X 4UUBA 4JB3A 4M9XA 5BNTA 2NTJA 2INGX 4I08A 5EINA 5LMZA 2VATA 2PWAA 3K0KA 4YJHA 1MQ9A 2QQ5A 5G41A 3M6MD 4YPFA 5BQXA 2H1IA 1NTRA 2QX6A 4EEXA 1S2OA 3QKRB 4ER3A 4LPSA 6REQA 2DBQA 3HHPA 5DW0A 5EZSA 3S8YA 1KMCA 5DH9A 1AO0A 1KO5A 4BRWA 5F5LA 1ZGJA 1CUXA 2ETVA 5FHQA 5ULLA 3TNFA 4TZ0A 4C88A 3AZOA 5CFRA 3N0WA 4R41A 3TF5A 1YC5A 2QL6A 4H1TA 3PVCA 5EVJA 1T0IA 3DCNA 3GQVA 1BRTA 3ND9A 1R4ZA 4NSNA 4RETA 1V2GA 4FNMA 5IH3A 1ECGA 4YCBA 1DOAA 3L7YA 3LCCA 2C5AA 3MWJA 1FFXB 2H31A 4ANFA 3K4PA 4K3UA 3ZHUA 5MN4A 2IYEA 5LYYA 4JXZA 1FTSA 5LDHA 4K03A 5F3DA 5F1YA 5T67A 1CZUA 3I5UA 4GKAA 1ZA1A 221PA 4P22A 1H65A 4Y0VA 4BMSA 4OM8A 2GJ4A 4WLNA 3OQNA 1ZVJA 3AV0B 5KQRA 1N6NA 4Y1FA 1CY0A 1Z34A 2VRBA 1KXJA 1NC1A 2HB6A 3MF4A 4TYNA 4IBOA 1E98A 1XEAA 4NBNA 1N5KA 4OIMA 4R84A 4ZZ0A 1ZIOA 4PXYA 3ASUA 1OLXB 1W4BA 3MWGA 4MQ4A 1N75A 1T1GA 5F1KA 3ZQJA 6LDHA 1XKQA 4CM3A 3ACBA 2FV8A 4FS8A 4OEHA 4CNQA 4Y8VA 3JQAB 3KSDO 2IZ7A 3IIJA 1FFYA 4XZ3A 1IB0A 1JZSA 2CVFA 4G0MA 3VGPA 1EFVB 3A9SA 5KOIA 3MCAA 1UWVA 1GV0A 2XT0A 3NDIA 4KAJA 5JZOA 3O8DA 1MAUA 1KZ9A 1P74A 1W94A 2I2AA 2G88A 3P0HA 4BMOB 2AZXA 2O8CB 2HNKA 3T15A 1TPYA 4N8SA 5BOVA 5IEBA 4FFPA 4TSRA 1WO8A 4UBNA 2FH5B 1TC1A 1XCBA 3I2YX 3Q3IA 3CZRA 1WIWA 2WUVA 1Y4ZA 1BFKA 2ZPUA 3ZHSA 4XRGA 1HRDA 4M8KA 1ZGBA 2GZAA 1D2NA 4BLWA 1XDBA 5U4QA 4OK5A 3QE4A 1UXKA 2W2XA 4PHGA 3MTIA 2DFTA 2ES4A 2W6OA 5CT8A 3ASVA 4HNAB 4R9VA 1U3FA 2D1YA 2EYQA 4GW3A 3KT6A 4IWYA 2OPBA 3TVDA 5B5SA 3FUVA 4EHDA 1YDMA 4BIMA 2V45A 1VG9B 3VYSB 2OXTA 5CFZA 1PO7A 3LC7O 3NTVA 1YZLA 4JQZA 4GLOA 1Z7EA 5AI9A 7GPBA 4LAFA 3FNFA 4DW8A 4BFCA 1T8RA 4E08A 1I0IA 4QRDA 3GT3A 4CEJB 1E3DA 1IXRC 2X0DA 2CCKA 3PL1A 2I76A 1SVWA 3MJEA 2JFHA 2HLHA 2OTCA 3NRJA 4I6JA 5TS2A 3CRNA 4GP7A 3LCRA 5JYEA 2H4JA 1JYFA 5AUOB 3NCHA 3IT3A 4LYAA 2Q4BA 2H1RA 1KJQA 1M2VB 1YE8A 2IUTA 1V6AA 3VR4D 5B12A 3CZAA 5CLIA 3Q87B 3LY8A 1C8LA 3LV8A 4WXHA 5T57A 3SYMA 4MUFA 3T4UA 5AIAA 3ETDA 3UOWA 2HK9A 4JJKA 2O3SA 3CZCA 3F7TA 4G4GA 3PFHA 2C78A 4M7OA 4PO8A 4BGUA 5BT8A 2FRXA 3NGLA 3SJZA 1EK5A 4FGSA 1R00A 1C1HA 3AEQA 4TUYA 5JQGB 1JJAA 4MRSA 2RHWA 5DB4A 1UIMA 3NW9A 2Y27A 3QBEA 2GBPA 1CUAA 1NUUA 2XNHA 1PFGA 1QO9A 4RJKA 3CMCO 5ALGA 2IOQA 2VDOB 3VR4H 3T1HB