3BBYA

Crystal structure of glutathione s-transferase (np_416804.1) from escherichia coli k12 at 1.85 a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
209
structure length
191
Chain Sequence
KPAITLWSDAHFFSPYVLSAWVALQEKGLSFHIKTIDRVPLLQIDDFELSESSAIAEYLEDRFAPPTWERIYPLDLENRARARQIQAWLRSDLMPIREERPTDVVFAGAKKAPLTAEGKASAEKLFAMAEHLLVLGQPNLFGEWCIADTDLALMINRLVLHGDEVPERLVDYATFQWQRASVQRFIALSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized GST-like protein yfcF
publication title Crystal structure of glutathione S-transferase (NP_416804.1) from Escherichia coli K12 at 1.85 A resolution
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 65
structure length 191
sequence length 209
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2007-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14834 GST_C_4 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3bbyA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3bbyA01
1V9WA 2YNXA 2KP1A 3GRXA 1ON4A 4ZBAA 2H1DA 4KCEA 5IOXA 1EWXA 2L6CA 4YH2A 2E7PA 2H75A 1O85A 2C3QA 2GS3A 4AJ8A 3VWUA 4MJBA 3DVWA 4XS1A 5B6MA 1M9AA 5A4UA 4K0GA 1S3CA 4EDYA 1X9WB 1PKZA 4JBBA 2CZ2A 2ALBA 4ECIA 4IKHA 2DIYA 1J9BA 2YANA 2HZFA 1ERVA 5IPGA 2C1YA 4J57E 3LXTA 2BMXA 4KUNA 1FHEA 1RK4A 1E6BA 1EOHA 2CVDA 1EOGA 1SJ6A 1JZOA 4V2MA 5CRGA 1HYUA 1G7EA 4OFTA 2VM1A 3GKKA 2VCQA 1ZZYA 3LJRA 4LMVA 3TB2A 2CAIA 2YPMA 2JACA 3QR6A 3M3MA 3IA1A 3ZVJD 2GSSA 2WULA 1O8XA 3WGXA 2YJ7A 2LJKA 1K0NA 2R3XA 1YKCA 2H66A 1GRXA 5KN1A 4F0BA 3I6AA 2Z9SA 3FY7A 1Q98A 4MCUA 3F6DA 4G10A 2IFQB 2VUPA 2TIRA 4K2DA 1K0BA 2JZSA 4G19A 1DBYA 2LKUA 1OC8A 5DAKB 1WE0A 2YCDA 5B6NA 3VWVA 3ERFA 3P7XA 2WJUA 1THXA 1XW9A 3TUEA 1DE2A 1B9XC 3TKPA 1OE8A 1T1VA 1GSYA 1WWJA 2XPDA 4MF7A 3EC3A 1XWKA 3DKSA 5H5QA 1O8WA 2K18A 4QQ7A 5FT3A 3VI7A 1ZYEA 1TDIA 1VRSD 4PURA 2P5QA 5ECKB 1GH2A 4D73B 4HI7A 1O6JA 2B5XA 4N0ZA 5AIXA 3EU3A 4TOPA 5FWGA 3ZLPA 4MF6A 5JCUA 3N9JA 1MD3A 4PX1A 4I2TA 1W4VA 4MP4A 1QXHA 5ID2A 1JHBA 2OADA 1KNGA 5KEJA 2H72A 3CSJA 4E8HA 2L4QA 4GRFA 3S9FA 1SKRB 2PERA 4GQCA 2AB6A 4GQFA 5J9CA 3Q18A 1NHOA 4AF2A 4BVXA 3L9UA 5IMFA 5D9XA 1J0FA 1TJDA 4J2FA 1AUCA 4DVCA 1K0DA 3F9UA 1T00A 4TR1A 1NW2A 2V2GA 1GNWA 3ZYWA 2LNTA 2C0FA 3DXBA 3H93A 2F51A 1F37A 3FRCA 2PUKC 3TJJA 1Z6MA 1XXUA 5IM9A 3MDKA 4L0WA 3LFLA 5CYYA 3W8JA 2PVQA 3ZFBA 1GUKA 4P3YB 2MMZA 5G30A 3ZRDA 3TRXA 1ACVA 3LSZA 2IMDA 5DALA 5EPFA 5J4UA 2PU9C 1GTAA 5IO0A 3HJPA 3GFKA 1M2BA 4TRXA 4X1UA 2L5OA 1RQMA 4ILFA 4GLTA 1OAZA 3GUSA 3UAPA 1WPIA 3KMOA 4V2NA 1K3OA 1T7PB 2AYTA 2C0GA 2E2GA 1EP8A 3L78A 3D6IA 1HNAA 5ENUA 4Z7XA 1JZWA 3BCIA 2O89A 3HJOA 3FW2A 2F9SA 2LRNA 1BYEA 1V40A 5C00A 3HJMA 4RQXA 3TOUA 4WR4A 11GSA 3DMLA 4MLYA 1EGRA 4IS0A 3EYTA 2YP6A 3KJYA 1WRYA 4MZCA 1AW9A 4XCSA 3GV1A 2R4VA 4TXOB 1A0FA 1LJRA 3JCML 2H0IA 2VCTA 2VCVA 1X0RA 4JU5A 3DIEA 4POKA 1XIYA 4K8MA 5JWQB 4KA0A 2YN1A 5GSTA 3CSIA 5CP1A 4OCFA 2HZEA 4TR3A 2HSMA 3F63A 2CT6A 2H6YA 4FYBA 1FO5A 3LEFA 1IYHA 5ECIB 3M9KA 4G0KA 4HZ2A 4FH8A 2LJRA 1R5AA 3A2WA 4L0UA 3U5RE 2VD0A 1OVNA 1Y25A 3TKRA 1YEPA 1G0TA 4OMVA 3E0UA 4RQRA 5GAPD 4LA1A 1PGTA 3K8NA 1WIKA 3GN3A 1YEXA 5IMCA 4K6XA 2OBIA 5IMDA 3D0ZA 4HU9A 3F6FA 6GSXA 2XC2A 3IRAA 3ISOA 2HLSA 1GL8A 1SD9A 4O32A 1M2DA 2VCZA 3J7Yb 2GSQA 1PA3A 3EURA 4XRAA 1F3BA 1NHYA 4WF4A 2JZTA 3KH9A 4F0CA 4PXOA 1A8YA 3GSSA 3VK9A 3WYWA 2NVLA 2VM2A 1JLWA 1VF2A 4JEDA 2IMKA 4BL7B 4QL9A 4CW9A 1X5CA 4MA9A 2B7KA 2NTOA 4BPYA 3ZTLA 2VAFA 2FA4A 3EMXA 1GSQA 1B8XA 3IAS2 3GHAA 2EIOA 2MMOA 3U6VA 3TKSC 2GLRA 1FVKA 5DCHA 1F9MA 3ZIJA 5CNWA 1UN2A 4N11A 1DUGA 2QC7A 3TJKA 4GTUA 2QGVA 4HQSA 2M46A 4K7NA 4IW9A 2WZ9A 4HJMA 4EL1A 19GSA 1S3DA 5DBQA 3I43A 2HRKA 2ZUPA 5CRHA 2FUG2 1SK2A 4JE1A 5ECNB 5H5SA 1K3LA 4LL4B 2IL3A 5D93A 1W89A 4IN0A 3TCOA 2HI7A 2RM6A 3EWLA 5GSSA 1R7HA 3HHVA 2PVOC 2BJXA 5ECQB 1A0RP 3HZ8A 2IFQA 3TKQA 4OFNA 4I2UA 1FB6A 3UVHA 2WGRA 1NSWA 3HCZA 2DMMA 5DAKA 3N5OA 2EC4A 2FD3A 1ST9A 2DBCA 5BMUA 1QGVA 3US3A 4HJ2A 2C0EA 3FZ4A 5GAND 2G2QA 2C80A 3O6TA 3CBUA 1Z9HA 3L4NA 1TI1A 4EXJA 3F8UA 2ZNMA 2NBSA 4DSQA 2MYGA 1GSFA 4L5OA 4Q5RA 4I5QA 1WMJA 2K9FA 4D73A 4F9ZA 5HQPA 1YF0A 4F82A 5ECRB 3Q74A 1MD4A 3H4KA 1DSBA 1MEKA 5ECSA 3LYKA 2AJQB 3EINA 3BOAA 2V6KA 1ZMAA 3VI5A 2M80A 4MABA 2DMLA 1BJXA 4LL1B 5DVBA 4IGJA 1XPVA 2YWNA 1SKWB 5EL8A 4KF9A 2KUCA 4TKYA 3ME8A 4HQZA 2B6MA 2RM5A 2H71A 4G2EA 3GTUB 2HRFA 2IIYA 2H01A 3CXGA 3G9BA 3CMIA 1Z6NA 3TJBA 4ISDA 4NPBA 3WD6A 3QMXA 1JFUA 3GIXA 1PX7A 2AAWA 4ZL7A 2WCIA 1U88A 4BWSA 5ELAA 1PRXA 4DSRA 2LEGA 1FAAA 4POBA 1USBA 5LNKe 2RIIA 2WFCA 4WBRD 2HFDA 5D8IA 2CAQA 1A23A 1A2JA 3VLNA 1X5EA 4YAPA 5JWOB 3E9JB 4GWRA 2FA8A 1GWCA 4TVEA 4Q5QA 4V1Ag 3NOFA 3LXZA 4PGTA 4KCAA 1X9MB 5JWRB 3A3TA 2HNLA 10GSA 3HYPA 3OR5A 1VGLA 2V32A 1THOA 1SENA 1V98A 3Q6OA 7GSSA 4Q5FA 3C8EA 4DEJA 5D9VA 2HRKB 2HSHA 4CHSA 5HFGA 5DCGA 3TKSE 4OWYA 2B5EA 5IQYA 2LUSA 6GSSA 3I69A 2KLXA 1NM3A 4TXOA 1OYJA 5LCZA 2MMAA 2QKEA 2C3NA 4HZ4A 4EUYA 3HA9A 5E59A 4CDOA 3QD9A 2YWOA 4TR0A 1GUMA 2MZCA 3L9SA 1V58A 4JZQA 1G6YA 2H1AA 3J7Yk 2IN3A 5LD0A 3BCKA 2WB9A 1ERUA 1O81A 3GX0A 1B9YC 2PPTA 1PD21 3GH9A 5ECPB 4G0LA 1QUWA 2UZ8A 3L0HA 4NHWA 5DQSA 2GQKA 2KP2A 2NPBA 2RUEA 4O7HA 1GTUA 4MJCA 3ZFLA 1GNEA 2G0FA 2IMIA 2OE3A 2H1BA 3VWWA 4ULXA 2YZUA 1HNBA 2VD1A 4KB3A 5CO3A 4HU7A 2OBKA 2HQTA 3WGDA 4QL7A 2C8UA 2VLUA 1GLPA 3UL3A 4N10A 1F3AA 1SK1A 5AIVA 1MDJA 22GSA 3D22A 4WF5A 2YV9A 2VCXA 1AQWA 1SYRA 3BBYA 2H6ZA 5D96A 3FKFA 2DJJA 2VL2C 4AJ6A 3F4RA 3KTLA 5ECMB 3HD5A 4MDCA 5AISA 1WP0A 4BL7A 1YKAA 3VPTA 1LU4A 5J41A 3RPNA 3ZREA 3M0FA 2RUFA 2IMEA 1A2LA 1KTEA 5AGYA 4I8BA 4X0XA 1HD2A 1XZOA 5A4VA 4YQMA 2F8FA 4GSNA 3DYRA 3C1RA 5KN0A 3UVTA 4ZXGA 2LTKA 3HVXA 3UMAA 12GSA 2GQMA 3KXOA 1EP7A 3DGQA 1PN9A 1TRSA 4L8EA 4RI7A 2K8VA 4MF5A 4MK3A 4WEYA 1ZL9A 2O85A 3KMNA 1VF3A 5G1KA 1OKTA 2I9HA 5IO2A 4PQ1A 4POLA 4NWYA 1GUHA 3G7YA 3MWHA 3QAGA 2JSYA 2FWHA 4I97A 2LV3A 4KH7A 4K9ZA 1EZKA 4N0VA 1T8EB 1M2AA 3P90A 3UARA 1XW6A 2I3YA 4ECJA 3DWVA 3W8SA 1R4WA 3WT2A 3APSA 2BTOT 5CRWA 3H79A 5E4WA 3EE2A 2GT5A 4ZL8A 2V41A 8GSSA 3IK9A 2A2RA 1Y6EA 2XPEA 3GYKA 2R5GA 5DQYA 1A24A 1QMVA 4ZBBA 3FR3A 5B8BA 5KN3A 2I81A 1QFNA 4IELA 4PNFA 1TI3A 3GKNA 1B4QA 1ZOFA 3IXRA 4ML1A 2GGTA 3O76A 3ME7A 2DLXA 3A5WA 3RDWA 2A2SA 4MPFA 3QCPA 1EV9A 2O7KA 4IJIA 3RAZA 2CV4A 3IE3A 3F4TA 5D9TA 1M99A 4EVMA 1EV4A 3GTUA 2V1MA 4KDYA 5CRDA 4K0NA 2HRNA 4V2LA 3E3EA 3KGKA 4FYUA 2L59A 2YJHA 2TRXA 1B4PA 4JR6A 2XHFA 3HDCA 1XVWA 1AQXA 1N2AA 5ECOB 1SJIA 3GL3A 5A5KA 2F8AA 1URMA 1XOBA 3MNGA 3CYNA 4KDXA 3KD0A 5HR1A 2GVPA 2H0HA 1JLVA 4O92A 5DJMA 1I5GA 2LQQA 3ZMKA 3IBHA 2DSAA 4EO3A 2GT6A 5IMAA 4HDEA 4EKZA 2JSZA 1WJKA 1F6MC 13GSA 4G9HA 2LS5A 2X64A 5CAXA 4MPGA 2VL2A 3KP9A 4BVYB 4GSTA 2H1GA 5G31A 4EE0A 4ZBDA 2FWEA 4V1Ap 3GH6A 2LJAA 4KX4A 3IOSA 1T4ZA 1XWGA 2O8VB 4DSSB 2CX3A 1ERTA 1QK8A 4WETA 3D5JA 2FY6A 3APQA 3UOMA 2RLIA 3M9JA 3FZ9A 2B1KA 2LNSA 2X8CA 1XBSA 4IVFA 2FWGA 2P5RA 1XOAA 4NHZA 3LG6A 3QOUA 1ABAA 20GSA 4GCIA 2O87A 3GKMA 4MJEA 1U6TA 2YZHA 4TR4A 3F0IA 1QQ2A 1VF4A 3M8NA 1JZDA 4G0IA 3CTFA 2GDRA 4J56E 4XS6A 4WKWA 2N5FA 2M72A 5HR2A 3QAWA 3WGEA 1TK5B 3M1GA 3TRQA 3HXSA 4BA7A 2JZRA 2OA7A 1ILOA 3FR6A 1PSQA 2FGXA 1AXDA 1GLQA 4TXVA 3UBLA 1UA5A 4NXIA 3V1WA 4KE3A 1BQ7A 2TRCP 3TDGA 4IP1A 3LYPA 3SBCA 3LGCA 1FVJA 4KW6A 5IPHA 5AN1A 3NIVA 3ZZXA 2HXKA 4ZB8A 2X8HA 3ZMLA 3FZAA 5J3RA 3TJGA 3P2AA 4TN8A 2VCWA 2CVBA 3UIWA 1IYIA 3AY8A 1PL1A 14GSA 3VFIA 1E2YA 4PQIA 4ML6A 4OFMA 4O5RA 5GZZB 2H8LA 2H76A 2QSIA 1FB0A 1BG5A 4OCEA 3P8WA 2OACA 2OKAA 3ZVJA 2B3SA 4IP6A 1SD8A 2YOIA 3UEMA 3R2QA 4KDUA 4IBPA 2I4AA 5JCWA 2FCHA 4KGIA 3EMPA 4LLRA 1Z7RA 3GURA 4KSOA 3GSTA 1TOFA 4GF0A 1YZXA 2JL4A 2A4VA 4PUAA 3EVIA 4RI6A 3GX8A 3KEBA 2AUVA 2H30A 3KIJA 1TRVA 1EGOA 1V2AA 2WS2A 4FIWA 4HEA2 5IIZA 1OKDA 6GSWA 3F3RA 1U3AA 1OC9B 4MZWA 1SU9A 1K0MA 4PQHA 5ABRA 5G2ZA 5ELGA 1H4OA 2H19A 2OE0A 1YQ1A 1FOVA 1HNCA 3KCMA 2VLTA 3DRNA 4NV2A 4ZL9A 2VLVA 4EDZA 1A8LA 2GSTA 2E0QA 5IMZA 3TJFA 3ZIVA 6GSTA 2C4JA 4KSMA 1LBKA 2DJKA 1TTZA 2LRCA 5F07A 3D21A 3ZL5A 2KOKA 1XWCA 2ON7A 3PH9A 4ACSA 3TKSA 4MMMA 5INYA 3CRTA 1SL0B 3FR9A 4ECBA 2K8SA 3IPZA 5HFIA 4BWQA 1HQOA 2X8GA 4OD7A 5F8BA 2ES7A 1S3AA 2PWJA 4F2IA 3IHQA 1PMTA 2VL9A 1XVQA 6GSUA 2WRTA 3IC8A 1N8JA 3A2XA 2OE1A 1AAZA 3Q19A 5EY6A 3D4TA 2CZ3A 2IWTA 1K0CA 3G7JA 2XBIA 3C1SA 1MDKA 1UVZA 2H74A 1OC3A 5F0GA 1B48A 5D73A 4YQUA 2MBTA 1Z5YE 5B8AA 1M0UA 1K0AA 3CRUA 1GTIA 3RBTA 1ERWA 3HZ4A 3PR8A 3PGTA 2GQLA 2HE3A 4XIHA 4K7IA 6GSVA 2GSRA 5EVOA 4NMUA 16GSA 2D2ZA 2GZZA 4OO4A 3H8QA 5JCGA 4PNGA 3W6GA 1ZCPA 3QFBC 4ECCA 1G6WA 3RHCA 1BX9A 1TK0B 5DJLA 2DJ2A 1I9DA 1WOUA 5G5FA 4ZB9A 3ZITA 2IMFA 2GZYA 4XS4B 3C73A 2FNOA 1H75A 3RHBA 4L5LA 1SK0A 4YQVA 1OE7A 2DJ3A 1PKWA 3UJ1A 4IQAA 2REMA 5COHA 3VURA 4WR5A 2GTUA 4EC0A 3DVXA 5ECHB 1O73A 1Z3EA 2R37A 3IC4A 2V6OA 4IHUA 3FYGA 1TKDB 3SWLA 4FYCA 3IDVA 4PUFC 1A2MA 3APOA 3F4SA 3FK8A 3KH7A 5HR3A 3GL5A 1XWAA 4BVYA 3HY2A 1Q4JA 2CX4A 4XRDA 1SKSB 3PINA 5D9WA 3MSZA 2AV4A 3KTBA 4NV5A 4XHMA 3ED3A 5DDLA 2C0DA 3IV4A 4DSSA 4POMA 1EEJA 4ZB6A 4AJ7A 3QDNA 3G7IA 2C3TA 1AIUA 2F3MA 2VO4A 1TU7A 5C04A 1GSUA 2L5LA 1VF1A 2VL3A 3BJ5A 1U87A 2P0GA 1YF1A 1SYXA 4MH2A 1X5DA 1ZGNA 2H0GA 1RW1A 1K0OA 5IOWA 3KZQA 2JU5A 4HS1A 1X9SB 5KN2A 2YV7A 2FWFA 2LRTA 4X43A 3HVVA 3L9VA 3H1NA 3PPUA 4HOJA 2DJ1A 3QPMA 2E2MA 2HYXA 2N5AA 2H73A 2HT9A 1YJ6A 4MH3A 4IJ3A 2LSTA 4HUAA 3F3QA 2HSNB 3KM6A 4JR4A 2L4CA 1ZYQB 2HRAA 2PGTA 4NAXA 2EIQA 1C72A 3UBKA 2NDOA 2ON5A 3MAKA 1XFLA 4USSA 1MTCA 5HR0A 1O7UA 2B7JA 3GA4A 1SJZA 2FLSA 2LQOA 4GSSA 5F05A 2H6XA 1TW9A 3C71A 1FW1A 4MZBA 3A2VA 2L6DA 1PX6A 2YWMA 9GSSA 1XWBA 4E8EA 2CA8A 3IK7A 4TW5A 1FG4A 4FO5A 2IJYA 4F03A 2JADA 5B7CA 1F2EA 5CREA 2MBSA 1KEBA 4EF0A 3GKXA 5J9BA 3TRPA 1MDIA 4ID0A 1BEDA 1PQNA 1G7OA 3CSHA 2WDUA 4IQ1A 1GP1A 4MJAA 5ID2B 2VOCA 5ECLB 1GTBA 3TOTA 2KHPA 4I6XA 1CQHA 1UC7A 4KAEA 2CQ9A 3IAM2 4BVXB 1TU8A 3DD3A 3D4MA 3DEXA 4ZILA 1TRWA 4TR1B 2MMNA 1GSDA 3I9V2 4XTSA 4PTSA 1SL2B 5G5EA 3LORA 2VIMA 4KNDA 5H5RA 2DJ0A 1TRUA 1OC9A 1EEMA 1U3IA 1K3YA 2PBJA 4ZIJA 5DALB 2OJLA 2X99A 2N5BA 1TXXA 5F06A 4YAVA 3QAVA 1DE1A 3RPPA 1T4YA 2DIZA 2IPAA 5FHIA 3ERWA 1R26A 4K1FA 5G1LA 2CVKA 1SL1B 4WBJA 1GSEA 5A4WA 2FHEA 3O3TA 2R6KA 1GSSA 3GNJA 4RUVA 4H86A 2P31A 1JZRA 1XW5A 6GSYA 3FHKA 3ERGA 4JRRA 3WT1A 4FQUA 2I1UA 3FZ5A 5IMVA 3LWAA 5HFKA 1XCCA 1PL2A 2GZPA 1R5PA 1V57A 2B1LA 3KP8A 3HKRA 1M7TA 1Z7PA 1M9BA 3HVSA 2HZEB 4LMWA 3CTGA 2HSMB 18GSA 2R2JA 3IR4A 1BAYA 4GXZA 1T3BA 3BD2A 2XBQA 3QFAC 4OO5A 3VWXA 2HSYA 1KBNA 3NZNA 1TP9A 5J5NA 2H70A 3R3EA 2PMTA 1J08A 2YWIA 1YDKA 4XS4A 3LQ7A 3C7MA 5L71A 2DC5A 2K6VA 4WXTA 1CQGA 3FEUA 3EU4A 4Q5NA 1AC1A 3TGZA 2EIRA 2J23A 2AHEA 2PN8A 1GULA 4AGSA 2B5YA 4K7OA 1TK8B 1AQVA 3GMFA 2ZCTA 17GSA 2L57A 1ML6A 2J9HA 3VPQA 4N30A 1YY7A
chains in the Genus database with same CATH superfamily
1V9WA 2YNXA 2KP1A 3GRXA 1ON4A 4ZBAA 2H1DA 4KCEA 3HMJG 5IOXA 1EWXA 2L6CA 4YH2A 2E7PA 2H75A 1O85A 2C3QA 2GS3A 4AJ8A 3VWUA 4MJBA 3DVWA 4XS1A 5B6MA 1M9AA 5A4UA 4K0GA 1S3CA 4EDYA 1X9WB 4E68A 1PKZA 4JBBA 2CZ2A 2ALBA 4ECIA 4IKHA 2DIYA 1BF5A 1J9BA 2YANA 2HZFA 1ERVA 2OT3A 5IPGA 2C1YA 4J57E 3LXTA 2BMXA 4KUNA 1FHEA 1RK4A 1E6BA 1EOHA 2CVDA 1EOGA 1SJ6A 1JZOA 4V2MA 5CRGA 1HYUA 1G7EA 4OFTA 2VM1A 3GKKA 2VCQA 1ZZYA 3LJRA 4LMVA 3TB2A 2CAIA 2YPMA 2JACA 3QR6A 3M3MA 3IA1A 3ZVJD 4N3ZA 2GSSA 2WULA 1O8XA 3WGXA 2YJ7A 2LJKA 1K0NA 2R3XA 1YKCA 2H66A 1GRXA 5KN1A 4F0BA 3I6AA 2Z9SA 3FY7A 1Q98A 4MCUA 3F6DA 4G10A 2IFQB 2VUPA 2TIRA 1M3IA 4K2DA 1K0BA 2JZSA 4G19A 4O5UA 1I1IP 1DBYA 2LKUA 1OC8A 5DAKB 1WE0A 2YCDA 5B6NA 3VWVA 5BMUB 3ERFA 3P7XA 2WJUA 1THXA 1XW9A 3TUEA 1DE2A 1B9XC 3TKPA 1OE8A 1T1VA 1GSYA 1WWJA 2XPDA 4MF7A 3EC3A 1XWKA 3DKSA 5H5QA 1O8WA 2K18A 4QQ7A 5FT3A 3VI7A 1ZYEA 1TDIA 1VRSD 4PURA 2EFHA 2P5QA 5ECKB 1GH2A 4D73B 4HI7A 1O6JA 2B5XA 4N0ZA 5AIXA 3EU3A 4TOPA 5FWGA 3ZLPA 4MF6A 5JCUA 3N9JA 1MD3A 4PX1A 4GDFA 4I2TA 1W4VA 4MP4A 1QXHA 5ID2A 1S3RA 1JHBA 2OADA 1KNGA 5KEJA 2H72A 3CSJA 4E8HA 2L4QA 4GRFA 3S9FA 1SKRB 2PERA 4GQCA 2AB6A 4GQFA 5J9CA 3Q18A 1NHOA 4AF2A 4BVXA 3L9UA 5IMFA 5D9XA 1J0FA 1TJDA 4J2FA 1AUCA 4DVCA 1K0DA 3F9UA 1T00A 4TR1A 1NW2A 2V2GA 3CHXC 1GNWA 3ZYWA 2LNTA 2C0FA 3DXBA 3H93A 2F51A 1F37A 3FRCA 2PUKC 3TJJA 1Z6MA 1XXUA 5IM9A 3MDKA 4L0WA 3LFLA 5CYYA 3W8JA 2PVQA 3ZFBA 1GUKA 4P3YB 2MMZA 5G30A 3ZRDA 3TRXA 1ACVA 3LSZA 2IMDA 5DALA 5EPFA 5J4UA 2PU9C 1GTAA 4CY6A 5IO0A 3HJPA 3CQFA 3GFKA 1M2BA 4TRXA 4X1UA 2L5OA 1RQMA 4ILFA 4GLTA 1OAZA 3GUSA 3UAPA 1WPIA 3KMOA 4V2NA 1K3OA 4O5QA 1T7PB 2AYTA 2C0GA 2E2GA 1EP8A 3L78A 3D6IA 1HNAA 5ENUA 4Z7XA 1JZWA 3BCIA 4AI6A 2O89A 3HJOA 3FW2A 2F9SA 2LRNA 1BYEA 1V40A 5C00A 3HJMA 4RQXA 4PHZC 3TOUA 4WR4A 2X4AA 11GSA 3DMLA 4MLYA 1EGRA 4IS0A 3EYTA 2YP6A 3KJYA 1WRYA 4MZCA 4AKIA 1AW9A 4XCSA 3GV1A 2R4VA 4TXOB 1A0FA 1LJRA 3JCML 2H0IA 2VCTA 2VCVA 1X0RA 3IHGA 4JU5A 3DIEA 4POKA 1XIYA 4K8MA 5JWQB 4KA0A 2YN1A 5GSTA 3CSIA 5CP1A 4OCFA 2HZEA 4TR3A 2HSMA 3F63A 2CT6A 2H6YA 4FYBA 1FO5A 3LEFA 1IYHA 5ECIB 3M9KA 4G0KA 4HZ2A 4FH8A 2LJRA 1R5AA 3A2WA 2O3EA 4L0UA 2QA1A 3U5RE 2VD0A 1OVNA 1Y25A 3TKRA 1YEPA 5KOWA 1G0TA 4OMVA 3E0UA 4RQRA 5GAPD 4LA1A 1PGTA 3K8NA 1WIKA 3GN3A 1YEXA 5IMCA 3HVNA 2OBIA 4K6XA 5IMDA 3D0ZA 4HU9A 3F6FA 6GSXA 2XC2A 3IRAA 3ISOA 2HLSA 1GL8A 1SD9A 4O32A 1SVMA 1M2DA 2VCZA 3J7Yb 2GSQA 1PA3A 3EURA 4XRAA 1F3BA 1NHYA 4WF4A 2VKZG 2JZTA 3KH9A 4F0CA 4PXOA 1A8YA 3GSSA 3VK9A 3WYWA 2NVLA 2VM2A 1M3JA 1JLWA 1VF2A 4JEDA 2IMKA 4BL7B 4QL9A 4CW9A 1X5CA 4YKFA 4MA9A 2B7KA 2NTOA 1Y1UA 4BPYA 3ZTLA 2VAFA 2FA4A 3EMXA 1GSQA 1B8XA 3IAS2 3GHAA 2EIOA 2MMOA 3U6VA 3TKSC 2GLRA 1FVKA 5DCHA 1F9MA 3ZIJA 5CNWA 3MIXA 1UN2A 4N11A 1DUGA 2QC7A 3TJKA 4GTUA 5KOXA 2QGVA 4HQSA 2M46A 4K7NA 4IW9A 2WZ9A 4HJMA 4EL1A 19GSA 1S3DA 5DBQA 3I43A 2HRKA 2ZUPA 5CRHA 1TXUA 1SK2A 2FUG2 4JE1A 5ECNB 2R0CA 4HSCX 5H5SA 1K3LA 4LL4B 2IL3A 5D93A 1W89A 3TU3B 4IN0A 3TCOA 2HI7A 2RM6A 3EWLA 5GSSA 1R7HA 2WW3A 3HHVA 2PVOC 2BJXA 5ECQB 1A0RP 3HZ8A 2IFQA 3TKQA 4OFNA 4I2UA 1FB6A 3UVHA 2WGRA 2R0GA 1NSWA 3HCZA 2DMMA 5A5HB 5DAKA 3N5OA 2EC4A 2FD3A 1ST9A 2DBCA 5BMUA 1QGVA 3US3A 4HJ2A 2C0EA 3FZ4A 5GAND 2G2QA 2C80A 3O6TA 3CBUA 1Z9HA 3L4NA 1TI1A 4EXJA 3F8UA 2ZNMA 2WW2A 2NBSA 4DSQA 2MYGA 1GSFA 4L5OA 4Q5RA 4I5QA 1WMJA 2K9FA 4D73A 4F9ZA 5HQPA 1YF0A 4F82A 5ECRB 3Q74A 1MD4A 3H4KA 1DSBA 1MEKA 5ECSA 3LYKA 2AJQB 3EINA 3BOAA 2V6KA 1ZMAA 4EIPA 3VI5A 2M80A 4MABA 2DMLA 1BJXA 4LL1B 5DVBA 4IGJA 1XPVA 2YWNA 1SKWB 5EL8A 4KF9A 2KUCA 4TKYA 3ME8A 4HQZA 2B6MA 2RM5A 2H71A 4G2EA 3GTUB 2A4HA 2HRFA 2IIYA 2H01A 1PN0A 3CXGA 3G9BA 3CMIA 2H1LA 1Z6NA 3TJBA 4ISDA 4NPBA 3WD6A 3QMXA 1JFUA 3GIXA 1PX7A 2AAWA 4ZL7A 2WCIA 1U88A 4BWSA 5ELAA 1PRXA 4DSRA 2LEGA 1FAAA 4POBA 1USBA 5LNKe 2RIIA 2WFCA 4WBRD 2HFDA 5D8IA 2CAQA 1A23A 1A2JA 3VLNA 1X5EA 4YAPA 5JWOB 3E9JB 4GWRA 4Z2UA 2FA8A 1GWCA 4TVEA 4Q5QA 4V1Ag 3RFRC 3NOFA 3LXZA 4PGTA 1FOHA 4KCAA 1X9MB 5JWRB 3A3TA 2HNLA 10GSA 3HYPA 3OR5A 1VGLA 2V32A 1THOA 1SENA 1V98A 3Q6OA 7GSSA 4Q5FA 3C8EA 4DEJA 5D9VA 2HRKB 2HSHA 4CHSA 5HFGA 5DCGA 3TKSE 4OWYA 2B5EA 5IQYA 2LUSA 6GSSA 3I69A 2KLXA 4PI2C 1NM3A 4TXOA 1OYJA 5LCZA 2MMAA 2QKEA 2C3NA 4HZ4A 4EUYA 3HA9A 5E59A 3RGBC 4CDOA 3QD9A 2YWOA 4TR0A 1GUMA 2MZCA 3L9SA 1V58A 4JZQA 1G6YA 2H1AA 2WZSA 3J7Yk 2IN3A 5LD0A 3BCKA 2WB9A 1ERUA 1O81A 3GX0A 1B9YC 2PPTA 1PD21 3GH9A 5ECPB 4G0LA 1QUWA 2UZ8A 3L0HA 4NHWA 5DQSA 2GQKA 2KP2A 2NPBA 2RUEA 4O7HA 1GTUA 4MJCA 3ZFLA 1GNEA 2G0FA 2IMIA 2OE3A 2H1BA 3VWWA 4ULXA 2YZUA 1HNBA 2VD1A 4KB3A 2WVZA 5CO3A 4HU7A 2OBKA 2HQTA 3WGDA 4QL7A 2C8UA 2VLUA 2WVXB 1GLPA 3UL3A 4N10A 1F3AA 1SK1A 5AIVA 1MDJA 22GSA 3D22A 4WF5A 2YV9A 2VCXA 1AQWA 1SYRA 3BBYA 2H6ZA 5D96A 3FKFA 2DJJA 2VL2C 4AJ6A 3F4RA 3KTLA 5ECMB 3HD5A 4MDCA 5AISA 1WP0A 4BL7A 1YKAA 3VPTA 1LU4A 5J41A 3RPNA 3ZREA 3M0FA 2RUFA 2IMEA 1A2LA 4BIKA 1KTEA 5AGYA 4I8BA 4X0XA 1HD2A 1XZOA 5A4VA 4YQMA 2F8FA 4GSNA 3DYRA 3C1RA 5KN0A 3UVTA 4ZXGA 2LTKA 3HVXA 3UMAA 12GSA 2GQMA 3KXOA 5A34B 1EP7A 3DGQA 1PN9A 1TRSA 4L8EA 4RI7A 2K8VA 4MF5A 4MK3A 4WEYA 1ZL9A 2O85A 3KMNA 1VF3A 5G1KA 1OKTA 2I9HA 5IO2A 4PQ1A 1ZYNA 4NWYA 1GUHA 3G7YA 3MWHA 4POLA 3QAGA 2JSYA 2FWHA 4I97A 2LV3A 4KH7A 4K9ZA 1EZKA 4N0VA 1T8EB 1M2AA 3P90A 3UARA 1XW6A 2I3YA 4ECJA 2DKHA 3DWVA 3W8SA 1R4WA 3WT2A 5A5HA 3APSA 4EIQA 2BTOT 5CRWA 3H79A 5E4WA 3EE2A 2GT5A 4ZL8A 2V41A 8GSSA 3IK9A 2A2RA 1Y6EA 2XPEA 3GYKA 2R5GA 2R0PA 5DQYA 4Z2RA 1A24A 1QMVA 4A5PA 4ZBBA 3FR3A 5B8BA 5KN3A 2I81A 1QFNA 4IELA 4PNFA 1TI3A 3GKNA 1B4QA 1YVLA 1ZOFA 3IXRA 4ML1A 2GGTA 3O76A 3ME7A 2DLXA 3A5WA 3RDWA 2A2SA 4MPFA 3QCPA 1EV9A 2O7KA 4IJIA 3RAZA 2CV4A 3IE3A 3F4TA 5D9TA 1M99A 4EVMA 1EV4A 3GTUA 2V1MA 4KDYA 5CRDA 4K0NA 2HRNA 4V2LA 4Z2TA 3E3EA 3KGKA 4FYUA 2L59A 2YJHA 2TRXA 4X4JA 1B4PA 4PI0C 5J47A 4JR6A 2XHFA 3HDCA 1XVWA 1AQXA 1N2AA 5ECOB 1SJIA 3GL3A 5A5KA 2F8AA 1URMA 1XOBA 3MNGA 3CYNA 4KDXA 4K2XA 3KD0A 5HR1A 2GVPA 2H0HA 1JLVA 4O92A 5DJMA 1I5GA 2LQQA 3ZMKA 3IBHA 2DSAA 4EO3A 2GT6A 5IMAA 4HDEA 4AKXB 4EKZA 2JSZA 1WJKA 1F6MC 13GSA 4G9HA 2LS5A 2X64A 5CAXA 4MPGA 2VL2A 3KP9A 4BVYB 4GSTA 2H1GA 5G31A 4EE0A 4ZBDA 2FWEA 4V1Ap 3GH6A 2LJAA 4KX4A 3IOSA 2O5VA 1T4ZA 1XWGA 2O8VB 3LW9A 5J4YA 4DSSB 2CX3A 1ERTA 1QK8A 4WETA 3D5JA 2FY6A 3APQA 3UOMA 4YKGA 2RLIA 3M9JA 3FZ9A 2B1KA 2LNSA 2X8CA 1XBSA 4IVFA 2FWGA 2P5RA 1XOAA 4NHZA 3LG6A 3QOUA 1ABAA 20GSA 4GCIA 2O87A 3GKMA 4MJEA 1U6TA 2YZHA 4TR4A 3F0IA 2DKIA 1QQ2A 1VF4A 3M8NA 1JZDA 4G0IA 3CTFA 2GDRA 4J56E 4XS6A 4WKWA 2N5FA 2M72A 5HR2A 3QAWA 3WGEA 1TK5B 3M1GA 3TRQA 3HXSA 4BA7A 4ICYA 2JZRA 2OA7A 1ILOA 3FR6A 1PSQA 2FGXA 1AXDA 1GLQA 4TXVA 3UBLA 1UA5A 4NXIA 3V1WA 4KE3A 1BQ7A 2TRCP 3TDGA 4IP1A 3LYPA 3SBCA 3LGCA 1FVJA 4KW6A 5IPHA 5AN1A 3NIVA 3ZZXA 2HXKA 4ZB8A 2X8HA 3ZMLA 3FZAA 5J3RA 3TJGA 3P2AA 4QMKA 4TN8A 2VCWA 2WVXA 2CVBA 1SVLA 3UIWA 1IYIA 3AY8A 1PL1A 14GSA 3VFIA 1E2YA 4PQIA 4ML6A 4OFMA 4O5RA 5A1NA 5GZZB 2H8LA 2H76A 2QSIA 1FB0A 1BG5A 4OCEA 3P8WA 2OACA 2OKAA 3ZVJA 2B3SA 4IP6A 1SD8A 2YOIA 3UEMA 1YEWC 3R2QA 2O36A 4KDUA 4IBPA 2I4AA 5JCWA 2FCHA 4KGIA 3EMPA 4LLRA 1Z7RA 3GURA 4KSOA 3GSTA 1TOFA 4GF0A 1YZXA 2JL4A 2A4VA 4PUAA 5A34A 3EVIA 4RI6A 3GX8A 3KEBA 2AUVA 2H30A 3KIJA 1TRVA 1EGOA 1V2AA 2WS2A 4FIWA 4HEA2 5IIZA 1OKDA 6GSWA 3F3RA 1U3AA 2WW0A 1OC9B 4MZWA 1SU9A 1K0MA 4PQHA 5ABRA 5G2ZA 5ELGA 1H4OA 2H19A 2OE0A 1YQ1A 1FOVA 1HNCA 3KCMA 2VLTA 3DRNA 4NV2A 4ZL9A 2VLVA 4EDZA 1A8LA 2GSTA 2E0QA 5IMZA 3TJFA 3ZIVA 6GSTA 2C4JA 4KSMA 4CY8A 1LBKA 2DJKA 1TTZA 2LRCA 5F07A 3D21A 2EFEA 3ZL5A 2KOKA 1XWCA 2ON7A 3PH9A 4MNNA 4FXYP 4ACSA 3TKSA 4MMMA 5INYA 3CRTA 1SL0B 3FR9A 4ECBA 2K8SA 3IPZA 5HFIA 4BWQA 1HQOA 2X8GA 4OD7A 5F8BA 2ES7A 1S3AA 2PWJA 4F2IA 3IHQA 1PMTA 2VL9A 1XVQA 6GSUA 2WRTA 3IC8A 1N8JA 3A2XA 2OE1A 1AAZA 3Q19A 5EY6A 2HSNA 3D4TA 2CZ3A 2IWTA 1K0CA 3G7JA 2XBIA 3C1SA 1MDKA 1UVZA 2H74A 1OC3A 5F0GA 1B48A 5D73A 4YQUA 2MBTA 1Z5YE 5B8AA 2UV8G 1M0UA 1K0AA 3CRUA 1GTIA 3RBTA 1ERWA 3HZ4A 3PR8A 3PGTA 2WVYA 2GQLA 5J4VA 2HE3A 4XIHA 4K7IA 3EPTA 6GSVA 2GSRA 5EVOA 4NMUA 16GSA 2D2ZA 2GZZA 4OO4A 3H8QA 5JCGA 4PNGA 3W6GA 1ZCPA 3QFBC 4ECCA 5A1NB 1G6WA 3RHCA 1BX9A 1TK0B 5DJLA 2DJ2A 1I9DA 1WOUA 5G5FA 4ZB9A 3ZITA 2IMFA 4AKHA 2GZYA 4XS4B 3C73A 2FNOA 1H75A 3RHBA 4L5LA 1SK0A 4YQVA 1OE7A 2DJ3A 1PKWA 3UJ1A 4IQAA 2REMA 5COHA 3VURA 4WR5A 2GTUA 4EC0A 3DVXA 5ECHB 1O73A 1Z3EA 2R37A 3IC4A 2V6OA 4IHUA 3FYGA 1TKDB 3SWLA 4FYCA 3IDVA 4PUFC 1A2MA 3APOA 3F4SA 3FK8A 3KH7A 5HR3A 3GL5A 1XWAA 4BVYA 3HY2A 1SVOA 1Q4JA 2CX4A 2WW1A 4XRDA 1SKSB 3PINA 5D9WA 3MSZA 2A2PA 2AV4A 3KTBA 4NV5A 5J40A 4XHMA 4W66A 5DDLA 3ED3A 2C0DA 3IV4A 4DSSA 4POMA 1EEJA 4ZB6A 4AJ7A 3QDNA 3G7IA 2C3TA 1AIUA 2F3MA 2VO4A 1TU7A 5C04A 1GSUA 2L5LA 1VF1A 2VL3A 1S4BP 3BJ5A 1U87A 2P0GA 1YF1A 1SYXA 4MH2A 1X5DA 1ZGNA 2H0GA 1RW1A 1K0OA 5IOWA 3KZQA 3CWGA 2JU5A 4HS1A 1X9SB 5KN2A 2YV7A 2FWFA 2LRTA 4X43A 4ZB7A 3HVVA 3L9VA 3H1NA 3PPUA 4HOJA 2DJ1A 3QPMA 2E2MA 2HYXA 2N5AA 3FMWA 2H73A 2HT9A 1ZYPA 1YJ6A 4MH3A 4IJ3A 2LSTA 4HUAA 3F3QA 2HSNB 3KM6A 4JR4A 2L4CA 1ZYQB 2HRAA 2PGTA 4NAXA 2EIQA 1C72A 3UBKA 2NDOA 2ON5A 3MAKA 1XFLA 4USSA 1MTCA 5HR0A 1O7UA 2B7JA 3GA4A 1SJZA 2FLSA 2LQOA 4GSSA 5F05A 2H6XA 1TW9A 3C71A 1FW1A 4MZBA 3A2VA 2L6DA 1PX6A 2YWMA 9GSSA 1XWBA 4E8EA 2CA8A 3IK7A 3MYDA 4TW5A 1FG4A 4FO5A 2IJYA 4F03A 2JADA 5B7CA 1F2EA 5CREA 2MBSA 1KEBA 4EF0A 3GKXA 5J9BA 3TRPA 1MDIA 4ID0A 1BEDA 4G01A 1PQNA 1G7OA 3CSHA 3A5IA 2WDUA 4IQ1A 1GP1A 4MJAA 5ID2B 2VOCA 5ECLB 1GTBA 3TOTA 2KHPA 4I6XA 1CQHA 1UC7A 4KAEA 2CQ9A 3IAM2 2EFDA 4BVXB 1TU8A 3DD3A 3D4MA 3DEXA 4ZILA 1TRWA 4TR1B 2MMNA 1GSDA 3I9V2 4XTSA 4PTSA 1SL2B 5G5EA 3LORA 2VIMA 4KNDA 5H5RA 2DJ0A 1TRUA 1OC9A 1EEMA 1U3IA 1K3YA 2PBJA 4ZIJA 5DALB 2OJLA 2X99A 2N5BA 1TXXA 2QA2A 5F06A 4YAVA 3QAVA 1DE1A 3RPPA 1T4YA 1N25A 2DIZA 2IPAA 5FHIA 4AKGA 3ERWA 1R26A 4K1FA 5G1LA 2CVKA 1SL1B 4WBJA 1GSEA 5A4WA 5BRTA 2FHEA 3O3TA 2R6KA 1GSSA 2X49A 3GNJA 1PFOA 4RUVA 4H86A 2P31A 1JZRA 1XW5A 6GSYA 3FHKA 3ERGA 4JRRA 3WT1A 4FQUA 2I1UA 3FZ5A 5IMVA 3LWAA 5HFKA 1XCCA 1PL2A 2GZPA 1R5PA 1V57A 2B1LA 3KP8A 3HKRA 1M7TA 1Z7PA 1XG8A 1M9BA 4K5SA 3HVSA 2HZEB 1BG1A 4LMWA 3CTGA 2HSMB 18GSA 2R2JA 3IR4A 1BAYA 4GXZA 1T3BA 3BD2A 2XBQA 3QFAC 4OO5A 3VWXA 2HSYA 1KBNA 1TP9A 5J5NA 2H70A 3NZNA 3R3EA 4K5RA 2PMTA 1J08A 2YWIA 1YDKA 4XS4A 3LQ7A 3C7MA 5L71A 2DC5A 2K6VA 4WXTA 1CQGA 3FEUA 3EU4A 4Q5NA 1AC1A 3TGZA 2EIRA 2J23A 2AHEA 2EFCA 2PN8A 1GULA 4AGSA 2B5YA 4K7OA 1TK8B 1AQVA 3GMFA 2ZCTA 17GSA 2L57A 1ML6A 2J9HA 3VPQA 4N30A 1YY7A
chains in the Genus database with same CATH topology
1V9WA 2YNXA 2KP1A 3GRXA 1ON4A 4ZBAA 2H1DA 4KCEA 3HMJG 5IOXA 1EWXA 2L6CA 4YH2A 2E7PA 2H75A 1O85A 2C3QA 2GS3A 4AJ8A 3VWUA 4MJBA 3DVWA 4XS1A 5B6MA 1M9AA 5A4UA 4K0GA 1S3CA 4EDYA 1X9WB 4E68A 1PKZA 4JBBA 2CZ2A 2ALBA 4ECIA 4IKHA 2DIYA 1BF5A 1J9BA 2YANA 2HZFA 1ERVA 2OT3A 5IPGA 2C1YA 4J57E 3LXTA 2BMXA 4KUNA 1FHEA 1RK4A 1E6BA 1EOHA 2CVDA 1EOGA 1SJ6A 1JZOA 4V2MA 5CRGA 1HYUA 1G7EA 4OFTA 2VM1A 3GKKA 2VCQA 1ZZYA 3LJRA 4LMVA 3TB2A 2CAIA 2YPMA 2JACA 3QR6A 3M3MA 3IA1A 3ZVJD 4N3ZA 2GSSA 2WULA 1O8XA 3WGXA 2YJ7A 2LJKA 1K0NA 2R3XA 1YKCA 2H66A 1GRXA 5KN1A 4F0BA 3I6AA 2Z9SA 3FY7A 1Q98A 4MCUA 3F6DA 4G10A 2IFQB 2VUPA 2TIRA 4K2DA 1K0BA 2JZSA 4G19A 4O5UA 1DBYA 2LKUA 1OC8A 5DAKB 1WE0A 2YCDA 5B6NA 3VWVA 5BMUB 3ERFA 3P7XA 2WJUA 1THXA 1XW9A 3TUEA 1DE2A 1B9XC 3TKPA 1OE8A 1T1VA 1GSYA 1WWJA 2XPDA 4MF7A 3EC3A 1XWKA 3DKSA 5H5QA 1O8WA 2K18A 4QQ7A 5FT3A 3VI7A 1ZYEA 1TDIA 1VRSD 4PURA 2EFHA 2P5QA 5ECKB 1GH2A 4D73B 4HI7A 1O6JA 2B5XA 4N0ZA 5AIXA 3EU3A 4TOPA 5FWGA 3ZLPA 4MF6A 5JCUA 3N9JA 1MD3A 4PX1A 4GDFA 4I2TA 1W4VA 4MP4A 1QXHA 5ID2A 1JHBA 2OADA 1KNGA 5KEJA 2H72A 3CSJA 4E8HA 2L4QA 4GRFA 3S9FA 1SKRB 2PERA 4GQCA 2AB6A 4GQFA 5J9CA 3Q18A 1NHOA 4AF2A 4BVXA 3L9UA 5IMFA 5D9XA 1J0FA 1TJDA 4J2FA 1AUCA 4DVCA 1K0DA 3F9UA 1T00A 4TR1A 1NW2A 2V2GA 1GNWA 3ZYWA 2LNTA 2C0FA 3DXBA 3H93A 2F51A 1F37A 3FRCA 2PUKC 3TJJA 1Z6MA 1XXUA 5IM9A 3MDKA 4L0WA 3LFLA 5CYYA 3W8JA 2PVQA 3ZFBA 1GUKA 4P3YB 2MMZA 5G30A 3ZRDA 3TRXA 1ACVA 3LSZA 2IMDA 5DALA 5EPFA 5J4UA 2PU9C 1GTAA 4CY6A 5IO0A 3HJPA 3GFKA 1M2BA 4TRXA 4X1UA 2L5OA 1RQMA 4ILFA 4GLTA 1OAZA 3GUSA 3UAPA 1WPIA 3KMOA 4V2NA 1K3OA 4O5QA 1T7PB 2AYTA 2C0GA 2E2GA 1EP8A 3L78A 3D6IA 1HNAA 5ENUA 4Z7XA 1JZWA 3BCIA 4AI6A 2O89A 3HJOA 3FW2A 2F9SA 2LRNA 1BYEA 1V40A 5C00A 3HJMA 4RQXA 3TOUA 4WR4A 2X4AA 11GSA 3DMLA 4MLYA 1EGRA 4IS0A 3EYTA 2YP6A 3KJYA 1WRYA 4MZCA 4AKIA 1AW9A 4XCSA 3GV1A 2R4VA 4TXOB 1A0FA 1LJRA 3JCML 2H0IA 2VCTA 2VCVA 1X0RA 3IHGA 4JU5A 3DIEA 4POKA 1XIYA 4K8MA 5JWQB 4KA0A 2YN1A 5GSTA 3CSIA 5CP1A 4OCFA 2HZEA 4TR3A 2HSMA 3F63A 2CT6A 2H6YA 4FYBA 1FO5A 3LEFA 1IYHA 5ECIB 3M9KA 4G0KA 4HZ2A 4FH8A 2LJRA 1R5AA 3A2WA 4L0UA 2QA1A 3U5RE 2VD0A 1OVNA 1Y25A 3TKRA 1YEPA 5KOWA 1G0TA 4OMVA 3E0UA 4RQRA 5GAPD 4LA1A 1PGTA 3K8NA 1WIKA 3GN3A 1YEXA 5IMCA 4K6XA 2OBIA 5IMDA 3D0ZA 4HU9A 3F6FA 6GSXA 2XC2A 3IRAA 3ISOA 2HLSA 1GL8A 1SD9A 4O32A 1SVMA 1M2DA 2VCZA 3J7Yb 2GSQA 1PA3A 3EURA 4XRAA 1F3BA 1NHYA 4WF4A 2VKZG 2JZTA 3KH9A 4F0CA 4PXOA 1A8YA 3GSSA 3VK9A 3WYWA 2NVLA 2VM2A 1JLWA 1VF2A 4JEDA 2IMKA 4BL7B 4QL9A 4CW9A 1X5CA 4YKFA 4MA9A 2B7KA 2NTOA 1Y1UA 4BPYA 3ZTLA 2VAFA 2FA4A 3EMXA 1GSQA 1B8XA 3IAS2 3GHAA 2EIOA 2MMOA 3U6VA 3TKSC 2GLRA 1FVKA 5DCHA 1F9MA 3ZIJA 5CNWA 3MIXA 1UN2A 4N11A 1DUGA 2QC7A 3TJKA 4GTUA 5KOXA 2QGVA 4HQSA 2M46A 4K7NA 4IW9A 2WZ9A 4HJMA 4EL1A 19GSA 1S3DA 5DBQA 3I43A 2HRKA 2ZUPA 5CRHA 1TXUA 1SK2A 2FUG2 4JE1A 5ECNB 2R0CA 5H5SA 1K3LA 4LL4B 2IL3A 5D93A 1W89A 3TU3B 4IN0A 3TCOA 2HI7A 2RM6A 3EWLA 5GSSA 1R7HA 3HHVA 2PVOC 2BJXA 5ECQB 1A0RP 3HZ8A 2IFQA 3TKQA 4OFNA 4I2UA 1FB6A 3UVHA 2WGRA 2R0GA 1NSWA 3HCZA 2DMMA 5A5HB 5DAKA 3N5OA 2EC4A 2FD3A 1ST9A 2DBCA 5BMUA 1QGVA 3US3A 4HJ2A 2C0EA 3FZ4A 5GAND 2G2QA 2C80A 3O6TA 3CBUA 1Z9HA 3L4NA 1TI1A 4EXJA 3F8UA 2ZNMA 2NBSA 4DSQA 2MYGA 1GSFA 4L5OA 4Q5RA 4I5QA 1WMJA 2K9FA 4D73A 4F9ZA 5HQPA 1YF0A 4F82A 5ECRB 3Q74A 1MD4A 3H4KA 1DSBA 1MEKA 5ECSA 3LYKA 2AJQB 3EINA 3BOAA 2V6KA 1ZMAA 4EIPA 3VI5A 2M80A 4MABA 2DMLA 1BJXA 4LL1B 5DVBA 4IGJA 1XPVA 2YWNA 1SKWB 5EL8A 4KF9A 2KUCA 4TKYA 3ME8A 4HQZA 2B6MA 2RM5A 2H71A 4G2EA 3GTUB 2A4HA 2HRFA 2IIYA 2H01A 1PN0A 3CXGA 3G9BA 3CMIA 2H1LA 1Z6NA 3TJBA 4ISDA 4NPBA 3WD6A 3QMXA 1JFUA 3GIXA 1PX7A 2AAWA 4ZL7A 2WCIA 1U88A 4BWSA 5ELAA 1PRXA 4DSRA 2LEGA 1FAAA 4POBA 1USBA 5LNKe 2RIIA 2WFCA 4WBRD 2HFDA 5D8IA 2CAQA 1A23A 1A2JA 3VLNA 1X5EA 4YAPA 5JWOB 3E9JB 4GWRA 4Z2UA 2FA8A 1GWCA 4TVEA 4Q5QA 4V1Ag 3NOFA 3LXZA 4PGTA 1FOHA 4KCAA 1X9MB 5JWRB 3A3TA 2HNLA 10GSA 3HYPA 3OR5A 1VGLA 2V32A 1THOA 1SENA 1V98A 3Q6OA 7GSSA 4Q5FA 3C8EA 4DEJA 5D9VA 2HRKB 2HSHA 4CHSA 5HFGA 5DCGA 3TKSE 4OWYA 2B5EA 5IQYA 2LUSA 6GSSA 3I69A 2KLXA 1NM3A 4TXOA 1OYJA 5LCZA 2MMAA 2QKEA 2C3NA 4HZ4A 4EUYA 3HA9A 5E59A 4CDOA 3QD9A 2YWOA 4TR0A 1GUMA 2MZCA 3L9SA 1V58A 4JZQA 1G6YA 2H1AA 3J7Yk 2IN3A 5LD0A 3BCKA 2WB9A 1ERUA 1O81A 3GX0A 1B9YC 2PPTA 1PD21 3GH9A 5ECPB 4G0LA 1QUWA 2UZ8A 3L0HA 4NHWA 5DQSA 2GQKA 2KP2A 2NPBA 2RUEA 4O7HA 1GTUA 4MJCA 3ZFLA 1GNEA 2G0FA 2IMIA 2OE3A 2H1BA 3VWWA 4ULXA 2YZUA 1HNBA 2VD1A 4KB3A 5CO3A 4HU7A 2OBKA 2HQTA 3WGDA 4QL7A 2C8UA 2VLUA 1GLPA 3UL3A 4N10A 1F3AA 1SK1A 5AIVA 1MDJA 22GSA 3D22A 4WF5A 2YV9A 2VCXA 1AQWA 1SYRA 3BBYA 2H6ZA 5D96A 3FKFA 2DJJA 2VL2C 4AJ6A 3F4RA 3KTLA 5ECMB 3HD5A 4MDCA 5AISA 1WP0A 4BL7A 1YKAA 3VPTA 1LU4A 5J41A 3RPNA 3ZREA 3M0FA 2RUFA 2IMEA 1A2LA 1KTEA 5AGYA 4I8BA 4X0XA 1HD2A 1XZOA 5A4VA 4YQMA 2F8FA 4GSNA 3DYRA 3C1RA 5KN0A 3UVTA 4ZXGA 2LTKA 3HVXA 3UMAA 12GSA 2GQMA 3KXOA 5A34B 1EP7A 3DGQA 1PN9A 1TRSA 4L8EA 4RI7A 2K8VA 4MF5A 4MK3A 4WEYA 1ZL9A 2O85A 3KMNA 1VF3A 5G1KA 1OKTA 2I9HA 5IO2A 4PQ1A 1ZYNA 4NWYA 1GUHA 3G7YA 3MWHA 4POLA 3QAGA 2JSYA 2FWHA 4I97A 2LV3A 4KH7A 4K9ZA 1EZKA 4N0VA 1T8EB 1M2AA 3P90A 3UARA 1XW6A 2I3YA 4ECJA 2DKHA 3DWVA 3W8SA 1R4WA 3WT2A 5A5HA 3APSA 4EIQA 2BTOT 5CRWA 3H79A 5E4WA 3EE2A 2GT5A 4ZL8A 2V41A 8GSSA 3IK9A 2A2RA 1Y6EA 2XPEA 3GYKA 2R5GA 2R0PA 5DQYA 4Z2RA 1A24A 1QMVA 4A5PA 4ZBBA 3FR3A 5B8BA 5KN3A 2I81A 1QFNA 4IELA 4PNFA 1TI3A 3GKNA 1B4QA 1YVLA 1ZOFA 3IXRA 4ML1A 2GGTA 3O76A 3ME7A 2DLXA 3A5WA 3RDWA 2A2SA 4MPFA 3QCPA 1EV9A 2O7KA 4IJIA 3RAZA 2CV4A 3IE3A 3F4TA 5D9TA 1M99A 4EVMA 1EV4A 3GTUA 2V1MA 4KDYA 5CRDA 4K0NA 2HRNA 4V2LA 4Z2TA 3E3EA 3KGKA 4FYUA 2L59A 2YJHA 2TRXA 4X4JA 1B4PA 5J47A 4JR6A 2XHFA 3HDCA 1XVWA 1AQXA 1N2AA 5ECOB 1SJIA 3GL3A 5A5KA 2F8AA 1URMA 1XOBA 3MNGA 3CYNA 4KDXA 4K2XA 3KD0A 5HR1A 2GVPA 2H0HA 1JLVA 4O92A 5DJMA 1I5GA 2LQQA 3ZMKA 3IBHA 2DSAA 4EO3A 2GT6A 5IMAA 4HDEA 4AKXB 4EKZA 2JSZA 1WJKA 1F6MC 13GSA 4G9HA 2LS5A 2X64A 5CAXA 4MPGA 2VL2A 3KP9A 4BVYB 4GSTA 2H1GA 5G31A 4EE0A 4ZBDA 2FWEA 4V1Ap 3GH6A 2LJAA 4KX4A 3IOSA 2O5VA 1T4ZA 1XWGA 2O8VB 3LW9A 5J4YA 4DSSB 2CX3A 1ERTA 1QK8A 4WETA 3D5JA 2FY6A 3APQA 3UOMA 4YKGA 2RLIA 3M9JA 3FZ9A 2B1KA 2LNSA 2X8CA 1XBSA 4IVFA 2FWGA 2P5RA 1XOAA 4NHZA 3LG6A 3QOUA 1ABAA 20GSA 4GCIA 2O87A 3GKMA 4MJEA 1U6TA 2YZHA 4TR4A 3F0IA 2DKIA 1QQ2A 1VF4A 3M8NA 1JZDA 4G0IA 3CTFA 2GDRA 4J56E 4XS6A 4WKWA 2N5FA 2M72A 5HR2A 3QAWA 3WGEA 1TK5B 3M1GA 3TRQA 3HXSA 4BA7A 4ICYA 2JZRA 2OA7A 1ILOA 3FR6A 1PSQA 2FGXA 1AXDA 1GLQA 4TXVA 3UBLA 1UA5A 4NXIA 3V1WA 4KE3A 1BQ7A 2TRCP 3TDGA 4IP1A 3LYPA 3SBCA 3LGCA 1FVJA 4KW6A 5IPHA 5AN1A 3NIVA 3ZZXA 2HXKA 4ZB8A 2X8HA 3ZMLA 3FZAA 5J3RA 3TJGA 3P2AA 4QMKA 4TN8A 2VCWA 2CVBA 1SVLA 3UIWA 1IYIA 3AY8A 1PL1A 14GSA 3VFIA 1E2YA 4PQIA 4ML6A 4OFMA 4O5RA 5A1NA 5GZZB 2H8LA 2H76A 2QSIA 1FB0A 1BG5A 4OCEA 3P8WA 2OACA 2OKAA 3ZVJA 2B3SA 4IP6A 1SD8A 2YOIA 3UEMA 3R2QA 4KDUA 4IBPA 2I4AA 5JCWA 2FCHA 4KGIA 3EMPA 4LLRA 1Z7RA 3GURA 4KSOA 3GSTA 1TOFA 4GF0A 1YZXA 2JL4A 2A4VA 4PUAA 5A34A 3EVIA 4RI6A 3GX8A 3KEBA 2AUVA 2H30A 3KIJA 1TRVA 1EGOA 1V2AA 2WS2A 4FIWA 4HEA2 5IIZA 1OKDA 6GSWA 3F3RA 1U3AA 1OC9B 4MZWA 1SU9A 1K0MA 4PQHA 5ABRA 5G2ZA 5ELGA 1H4OA 2H19A 2OE0A 1YQ1A 1FOVA 1HNCA 3KCMA 2VLTA 3DRNA 4NV2A 4ZL9A 2VLVA 4EDZA 1A8LA 2GSTA 2E0QA 5IMZA 3TJFA 3ZIVA 6GSTA 2C4JA 4KSMA 4CY8A 1LBKA 2DJKA 1TTZA 2LRCA 5F07A 3D21A 2EFEA 3ZL5A 2KOKA 1XWCA 2ON7A 3PH9A 4MNNA 4ACSA 3TKSA 4MMMA 5INYA 3CRTA 1SL0B 3FR9A 4ECBA 2K8SA 3IPZA 5HFIA 4BWQA 1HQOA 2X8GA 4OD7A 5F8BA 2ES7A 1S3AA 2PWJA 4F2IA 3IHQA 1PMTA 2VL9A 1XVQA 6GSUA 2WRTA 3IC8A 1N8JA 3A2XA 2OE1A 1AAZA 3Q19A 5EY6A 2HSNA 3D4TA 2CZ3A 2IWTA 1K0CA 3G7JA 2XBIA 3C1SA 1MDKA 1UVZA 2H74A 1OC3A 5F0GA 1B48A 5D73A 4YQUA 2MBTA 1Z5YE 5B8AA 2UV8G 1M0UA 1K0AA 3CRUA 1GTIA 3RBTA 1ERWA 3HZ4A 3PR8A 3PGTA 2GQLA 5J4VA 2HE3A 4XIHA 4K7IA 3EPTA 6GSVA 2GSRA 5EVOA 4NMUA 16GSA 2D2ZA 2GZZA 4OO4A 3H8QA 5JCGA 4PNGA 3W6GA 1ZCPA 3QFBC 4ECCA 5A1NB 1G6WA 3RHCA 1BX9A 1TK0B 5DJLA 2DJ2A 1I9DA 1WOUA 5G5FA 4ZB9A 3ZITA 2IMFA 4AKHA 2GZYA 4XS4B 3C73A 2FNOA 1H75A 3RHBA 4L5LA 1SK0A 4YQVA 1OE7A 2DJ3A 1PKWA 3UJ1A 4IQAA 2REMA 5COHA 3VURA 4WR5A 2GTUA 4EC0A 3DVXA 5ECHB 1O73A 1Z3EA 2R37A 3IC4A 2V6OA 4IHUA 3FYGA 1TKDB 3SWLA 4FYCA 3IDVA 4PUFC 1A2MA 3APOA 3F4SA 3FK8A 3KH7A 5HR3A 3GL5A 1XWAA 4BVYA 3HY2A 1SVOA 1Q4JA 2CX4A 4XRDA 1SKSB 3PINA 5D9WA 3MSZA 2A2PA 2AV4A 3KTBA 4NV5A 5J40A 4XHMA 4W66A 5DDLA 3ED3A 2C0DA 3IV4A 4DSSA 4POMA 1EEJA 4ZB6A 4AJ7A 3QDNA 3G7IA 2C3TA 1AIUA 2F3MA 2VO4A 1TU7A 5C04A 1GSUA 2L5LA 1VF1A 2VL3A 3BJ5A 1U87A 2P0GA 1YF1A 1SYXA 4MH2A 1X5DA 1ZGNA 2H0GA 1RW1A 1K0OA 5IOWA 3KZQA 3CWGA 2JU5A 4HS1A 1X9SB 5KN2A 2YV7A 2FWFA 2LRTA 4X43A 4ZB7A 3HVVA 3L9VA 3H1NA 3PPUA 4HOJA 2DJ1A 3QPMA 2E2MA 2HYXA 2N5AA 3FMWA 2H73A 2HT9A 1ZYPA 1YJ6A 4MH3A 4IJ3A 2LSTA 4HUAA 3F3QA 2HSNB 3KM6A 4JR4A 2L4CA 1ZYQB 2HRAA 2PGTA 4NAXA 2EIQA 1C72A 3UBKA 2NDOA 2ON5A 3MAKA 1XFLA 4USSA 1MTCA 5HR0A 1O7UA 2B7JA 3GA4A 1SJZA 2FLSA 2LQOA 4GSSA 5F05A 2H6XA 1TW9A 3C71A 1FW1A 4MZBA 3A2VA 2L6DA 1PX6A 2YWMA 9GSSA 1XWBA 4E8EA 2CA8A 3IK7A 3MYDA 4TW5A 1FG4A 4FO5A 2IJYA 4F03A 2JADA 5B7CA 1F2EA 5CREA 2MBSA 1KEBA 4EF0A 3GKXA 5J9BA 3TRPA 1MDIA 4ID0A 1BEDA 4G01A 1PQNA 1G7OA 3CSHA 3A5IA 2WDUA 4IQ1A 1GP1A 4MJAA 5ID2B 2VOCA 5ECLB 1GTBA 3TOTA 2KHPA 4I6XA 1CQHA 1UC7A 4KAEA 2CQ9A 3IAM2 2EFDA 4BVXB 1TU8A 3DD3A 3D4MA 3DEXA 4ZILA 1TRWA 4TR1B 2MMNA 1GSDA 3I9V2 4XTSA 4PTSA 1SL2B 5G5EA 3LORA 2VIMA 4KNDA 5H5RA 2DJ0A 1TRUA 1OC9A 1EEMA 1U3IA 1K3YA 2PBJA 4ZIJA 5DALB 2OJLA 2X99A 2N5BA 1TXXA 2QA2A 5F06A 4YAVA 3QAVA 1DE1A 3RPPA 1T4YA 1N25A 2DIZA 2IPAA 5FHIA 4AKGA 3ERWA 1R26A 4K1FA 5G1LA 2CVKA 1SL1B 4WBJA 1GSEA 5A4WA 5BRTA 2FHEA 3O3TA 2R6KA 1GSSA 2X49A 3GNJA 4RUVA 4H86A 2P31A 1JZRA 1XW5A 6GSYA 3FHKA 3ERGA 4JRRA 3WT1A 4FQUA 2I1UA 3FZ5A 5IMVA 3LWAA 5HFKA 1XCCA 1PL2A 2GZPA 1R5PA 1V57A 2B1LA 3KP8A 3HKRA 1M7TA 1Z7PA 1M9BA 4K5SA 3HVSA 2HZEB 1BG1A 4LMWA 3CTGA 2HSMB 18GSA 2R2JA 3IR4A 1BAYA 4GXZA 1T3BA 3BD2A 2XBQA 3QFAC 4OO5A 3VWXA 2HSYA 1KBNA 1TP9A 5J5NA 2H70A 3NZNA 3R3EA 4K5RA 2PMTA 1J08A 2YWIA 1YDKA 4XS4A 3LQ7A 3C7MA 5L71A 2DC5A 2K6VA 4WXTA 1CQGA 3FEUA 3EU4A 4Q5NA 1AC1A 3TGZA 2EIRA 2J23A 2AHEA 2EFCA 2PN8A 1GULA 4AGSA 2B5YA 4K7OA 1TK8B 1AQVA 3GMFA 2ZCTA 17GSA 2L57A 1ML6A 2J9HA 3VPQA 4N30A 1YY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V9W A;  2YNX A;  2KP1 A;  3GRX A;  1ON4 A;  4ZBA A;  2H1D A;  4KCE A;  5IOX A;  1EWX A;  2L6C A;  4YH2 A;  2E7P A;  2H75 A;  1O85 A;  2C3Q A;  2GS3 A;  4AJ8 A;  3VWU A;  4MJB A;  3DVW A;  4XS1 A;  5B6M A;  1M9A A;  5A4U A;  4K0G A;  1S3C A;  4EDY A;  1X9W B;  1PKZ A;  4JBB A;  2CZ2 A;  2ALB A;  4ECI A;  4IKH A;  2DIY A;  1J9B A;  2YAN A;  2HZF A;  1ERV A;  5IPG A;  2C1Y A;  4J57 E;  3LXT A;  2BMX A;  4KUN A;  1FHE A;  1RK4 A;  1E6B A;  1EOH A;  2CVD A;  1EOG A;  1SJ6 A;  1JZO A;  4V2M A;  5CRG A;  1HYU A;  1G7E A;  4OFT A;  2VM1 A;  3GKK A;  2VCQ A;  1ZZY A;  3LJR A;  4LMV A;  3TB2 A;  2CAI A;  2YPM A;  2JAC A;  3QR6 A;  3M3M A;  3IA1 A;  3ZVJ D;  2GSS A;  2WUL A;  1O8X A;  3WGX A;  2YJ7 A;  2LJK A;  1K0N A;  2R3X A;  1YKC A;  2H66 A;  1GRX A;  5KN1 A;  4F0B A;  3I6A A;  2Z9S A;  3FY7 A;  1Q98 A;  4MCU A;  3F6D A;  4G10 A;  2IFQ B;  2VUP A;  2TIR A;  4K2D A;  1K0B A;  2JZS A;  4G19 A;  1DBY A;  2LKU A;  1OC8 A;  5DAK B;  1WE0 A;  2YCD A;  5B6N A;  3VWV A;  3ERF A;  3P7X A;  2WJU A;  1THX A;  1XW9 A;  3TUE A;  1DE2 A;  1B9X C;  3TKP A;  1OE8 A;  1T1V A;  1GSY A;  1WWJ A;  2XPD A;  4MF7 A;  3EC3 A;  1XWK A;  3DKS A;  5H5Q A;  1O8W A;  2K18 A;  4QQ7 A;  5FT3 A;  3VI7 A;  1ZYE A;  1TDI A;  1VRS D;  4PUR A;  2P5Q A;  5ECK B;  1GH2 A;  4D73 B;  4HI7 A;  1O6J A;  2B5X A;  4N0Z A;  5AIX A;  3EU3 A;  4TOP A;  5FWG A;  3ZLP A;  4MF6 A;  5JCU A;  3N9J A;  1MD3 A;  4PX1 A;  4I2T A;  1W4V A;  4MP4 A;  1QXH A;  5ID2 A;  1JHB A;  2OAD A;  1KNG A;  5KEJ A;  2H72 A;  3CSJ A;  4E8H A;  2L4Q A;  4GRF A;  3S9F A;  1SKR B;  2PER A;  4GQC A;  2AB6 A;  4GQF A;  5J9C A;  3Q18 A;  1NHO A;  4AF2 A;  4BVX A;  3L9U A;  5IMF A;  5D9X A;  1J0F A;  1TJD A;  4J2F A;  1AUC A;  4DVC A;  1K0D A;  3F9U A;  1T00 A;  4TR1 A;  1NW2 A;  2V2G A;  1GNW A;  3ZYW A;  2LNT A;  2C0F A;  3DXB A;  3H93 A;  2F51 A;  1F37 A;  3FRC A;  2PUK C;  3TJJ A;  1Z6M A;  1XXU A;  5IM9 A;  3MDK A;  4L0W A;  3LFL A;  5CYY A;  3W8J A;  2PVQ A;  3ZFB A;  1GUK A;  4P3Y B;  2MMZ A;  5G30 A;  3ZRD A;  3TRX A;  1ACV A;  3LSZ A;  2IMD A;  5DAL A;  5EPF A;  5J4U A;  2PU9 C;  1GTA A;  5IO0 A;  3HJP A;  3GFK A;  1M2B A;  4TRX A;  4X1U A;  2L5O A;  1RQM A;  4ILF A;  4GLT A;  1OAZ A;  3GUS A;  3UAP A;  1WPI A;  3KMO A;  4V2N A;  1K3O A;  1T7P B;  2AYT A;  2C0G A;  2E2G A;  1EP8 A;  3L78 A;  3D6I A;  1HNA A;  5ENU A;  4Z7X A;  1JZW A;  3BCI A;  2O89 A;  3HJO A;  3FW2 A;  2F9S A;  2LRN A;  1BYE A;  1V40 A;  5C00 A;  3HJM A;  4RQX A;  3TOU A;  4WR4 A;  11GS A;  3DML A;  4MLY A;  1EGR A;  4IS0 A;  3EYT A;  2YP6 A;  3KJY A;  1WRY A;  4MZC A;  1AW9 A;  4XCS A;  3GV1 A;  2R4V A;  4TXO B;  1A0F A;  1LJR A;  3JCM L;  2H0I A;  2VCT A;  2VCV A;  1X0R A;  4JU5 A;  3DIE A;  4POK A;  1XIY A;  4K8M A;  5JWQ B;  4KA0 A;  2YN1 A;  5GST A;  3CSI A;  5CP1 A;  4OCF A;  2HZE A;  4TR3 A;  2HSM A;  3F63 A;  2CT6 A;  2H6Y A;  4FYB A;  1FO5 A;  3LEF A;  1IYH A;  5ECI B;  3M9K A;  4G0K A;  4HZ2 A;  4FH8 A;  2LJR A;  1R5A A;  3A2W A;  4L0U A;  3U5R E;  2VD0 A;  1OVN A;  1Y25 A;  3TKR A;  1YEP A;  1G0T A;  4OMV A;  3E0U A;  4RQR A;  5GAP D;  4LA1 A;  1PGT A;  3K8N A;  1WIK A;  3GN3 A;  1YEX A;  5IMC A;  4K6X A;  2OBI A;  5IMD A;  3D0Z A;  4HU9 A;  3F6F A;  6GSX A;  2XC2 A;  3IRA A;  3ISO A;  2HLS A;  1GL8 A;  1SD9 A;  4O32 A;  1M2D A;  2VCZ A;  3J7Y b;  2GSQ A;  1PA3 A;  3EUR A;  4XRA A;  1F3B A;  1NHY A;  4WF4 A;  2JZT A;  3KH9 A;  4F0C A;  4PXO A;  1A8Y A;  3GSS A;  3VK9 A;  3WYW A;  2NVL A;  2VM2 A;  1JLW A;  1VF2 A;  4JED A;  2IMK A;  4BL7 B;  4QL9 A;  4CW9 A;  1X5C A;  4MA9 A;  2B7K A;  2NTO A;  4BPY A;  3ZTL A;  2VAF A;  2FA4 A;  3EMX A;  1GSQ A;  1B8X A;  3IAS 2;  3GHA A;  2EIO A;  2MMO A;  3U6V A;  3TKS C;  2GLR A;  1FVK A;  5DCH A;  1F9M A;  3ZIJ A;  5CNW A;  1UN2 A;  4N11 A;  1DUG A;  2QC7 A;  3TJK A;  4GTU A;  2QGV A;  4HQS A;  2M46 A;  4K7N A;  4IW9 A;  2WZ9 A;  4HJM A;  4EL1 A;  19GS A;  1S3D A;  5DBQ A;  3I43 A;  2HRK A;  2ZUP A;  5CRH A;  2FUG 2;  1SK2 A;  4JE1 A;  5ECN B;  5H5S A;  1K3L A;  4LL4 B;  2IL3 A;  5D93 A;  1W89 A;  4IN0 A;  3TCO A;  2HI7 A;  2RM6 A;  3EWL A;  5GSS A;  1R7H A;  3HHV A;  2PVO C;  2BJX A;  5ECQ B;  1A0R P;  3HZ8 A;  2IFQ A;  3TKQ A;  4OFN A;  4I2U A;  1FB6 A;  3UVH A;  2WGR A;  1NSW A;  3HCZ A;  2DMM A;  5DAK A;  3N5O A;  2EC4 A;  2FD3 A;  1ST9 A;  2DBC A;  5BMU A;  1QGV A;  3US3 A;  4HJ2 A;  2C0E A;  3FZ4 A;  5GAN D;  2G2Q A;  2C80 A;  3O6T A;  3CBU A;  1Z9H A;  3L4N A;  1TI1 A;  4EXJ A;  3F8U A;  2ZNM A;  2NBS A;  4DSQ A;  2MYG A;  1GSF A;  4L5O A;  4Q5R A;  4I5Q A;  1WMJ A;  2K9F A;  4D73 A;  4F9Z A;  5HQP A;  1YF0 A;  4F82 A;  5ECR B;  3Q74 A;  1MD4 A;  3H4K A;  1DSB A;  1MEK A;  5ECS A;  3LYK A;  2AJQ B;  3EIN A;  3BOA A;  2V6K A;  1ZMA A;  3VI5 A;  2M80 A;  4MAB A;  2DML A;  1BJX A;  4LL1 B;  5DVB A;  4IGJ A;  1XPV A;  2YWN A;  1SKW B;  5EL8 A;  4KF9 A;  2KUC A;  4TKY A;  3ME8 A;  4HQZ A;  2B6M A;  2RM5 A;  2H71 A;  4G2E A;  3GTU B;  2HRF A;  2IIY A;  2H01 A;  3CXG A;  3G9B A;  3CMI A;  1Z6N A;  3TJB A;  4ISD A;  4NPB A;  3WD6 A;  3QMX A;  1JFU A;  3GIX A;  1PX7 A;  2AAW A;  4ZL7 A;  2WCI A;  1U88 A;  4BWS A;  5ELA A;  1PRX A;  4DSR A;  2LEG A;  1FAA A;  4POB A;  1USB A;  5LNK e;  2RII A;  2WFC A;  4WBR D;  2HFD A;  5D8I A;  2CAQ A;  1A23 A;  1A2J A;  3VLN A;  1X5E A;  4YAP A;  5JWO B;  3E9J B;  4GWR A;  2FA8 A;  1GWC A;  4TVE A;  4Q5Q A;  4V1A g;  3NOF A;  3LXZ A;  4PGT A;  4KCA A;  1X9M B;  5JWR B;  3A3T A;  2HNL A;  10GS A;  3HYP A;  3OR5 A;  1VGL A;  2V32 A;  1THO A;  1SEN A;  1V98 A;  3Q6O A;  7GSS A;  4Q5F A;  3C8E A;  4DEJ A;  5D9V A;  2HRK B;  2HSH A;  4CHS A;  5HFG A;  5DCG A;  3TKS E;  4OWY A;  2B5E A;  5IQY A;  2LUS A;  6GSS A;  3I69 A;  2KLX A;  1NM3 A;  4TXO A;  1OYJ A;  5LCZ A;  2MMA A;  2QKE A;  2C3N A;  4HZ4 A;  4EUY A;  3HA9 A;  5E59 A;  4CDO A;  3QD9 A;  2YWO A;  4TR0 A;  1GUM A;  2MZC A;  3L9S A;  1V58 A;  4JZQ A;  1G6Y A;  2H1A A;  3J7Y k;  2IN3 A;  5LD0 A;  3BCK A;  2WB9 A;  1ERU A;  1O81 A;  3GX0 A;  1B9Y C;  2PPT A;  1PD2 1;  3GH9 A;  5ECP B;  4G0L A;  1QUW A;  2UZ8 A;  3L0H A;  4NHW A;  5DQS A;  2GQK A;  2KP2 A;  2NPB A;  2RUE A;  4O7H A;  1GTU A;  4MJC A;  3ZFL A;  1GNE A;  2G0F A;  2IMI A;  2OE3 A;  2H1B A;  3VWW A;  4ULX A;  2YZU A;  1HNB A;  2VD1 A;  4KB3 A;  5CO3 A;  4HU7 A;  2OBK A;  2HQT A;  3WGD A;  4QL7 A;  2C8U A;  2VLU A;  1GLP A;  3UL3 A;  4N10 A;  1F3A A;  1SK1 A;  5AIV A;  1MDJ A;  22GS A;  3D22 A;  4WF5 A;  2YV9 A;  2VCX A;  1AQW A;  1SYR A;  3BBY A;  2H6Z A;  5D96 A;  3FKF A;  2DJJ A;  2VL2 C;  4AJ6 A;  3F4R A;  3KTL A;  5ECM B;  3HD5 A;  4MDC A;  5AIS A;  1WP0 A;  4BL7 A;  1YKA A;  3VPT A;  1LU4 A;  5J41 A;  3RPN A;  3ZRE A;  3M0F A;  2RUF A;  2IME A;  1A2L A;  1KTE A;  5AGY A;  4I8B A;  4X0X A;  1HD2 A;  1XZO A;  5A4V A;  4YQM A;  2F8F A;  4GSN A;  3DYR A;  3C1R A;  5KN0 A;  3UVT A;  4ZXG A;  2LTK A;  3HVX A;  3UMA A;  12GS A;  2GQM A;  3KXO A;  1EP7 A;  3DGQ A;  1PN9 A;  1TRS A;  4L8E A;  4RI7 A;  2K8V A;  4MF5 A;  4MK3 A;  4WEY A;  1ZL9 A;  2O85 A;  3KMN A;  1VF3 A;  5G1K A;  1OKT A;  2I9H A;  5IO2 A;  4PQ1 A;  4POL A;  4NWY A;  1GUH A;  3G7Y A;  3MWH A;  3QAG A;  2JSY A;  2FWH A;  4I97 A;  2LV3 A;  4KH7 A;  4K9Z A;  1EZK A;  4N0V A;  1T8E B;  1M2A A;  3P90 A;  3UAR A;  1XW6 A;  2I3Y A;  4ECJ A;  3DWV A;  3W8S A;  1R4W A;  3WT2 A;  3APS A;  2BTO T;  5CRW A;  3H79 A;  5E4W A;  3EE2 A;  2GT5 A;  4ZL8 A;  2V41 A;  8GSS A;  3IK9 A;  2A2R A;  1Y6E A;  2XPE A;  3GYK A;  2R5G A;  5DQY A;  1A24 A;  1QMV A;  4ZBB A;  3FR3 A;  5B8B A;  5KN3 A;  2I81 A;  1QFN A;  4IEL A;  4PNF A;  1TI3 A;  3GKN A;  1B4Q A;  1ZOF A;  3IXR A;  4ML1 A;  2GGT A;  3O76 A;  3ME7 A;  2DLX A;  3A5W A;  3RDW A;  2A2S A;  4MPF A;  3QCP A;  1EV9 A;  2O7K A;  4IJI A;  3RAZ A;  2CV4 A;  3IE3 A;  3F4T A;  5D9T A;  1M99 A;  4EVM A;  1EV4 A;  3GTU A;  2V1M A;  4KDY A;  5CRD A;  4K0N A;  2HRN A;  4V2L A;  3E3E A;  3KGK A;  4FYU A;  2L59 A;  2YJH A;  2TRX A;  1B4P A;  4JR6 A;  2XHF A;  3HDC A;  1XVW A;  1AQX A;  1N2A A;  5ECO B;  1SJI A;  3GL3 A;  5A5K A;  2F8A A;  1URM A;  1XOB A;  3MNG A;  3CYN A;  4KDX A;  3KD0 A;  5HR1 A;  2GVP A;  2H0H A;  1JLV A;  4O92 A;  5DJM A;  1I5G A;  2LQQ A;  3ZMK A;  3IBH A;  2DSA A;  4EO3 A;  2GT6 A;  5IMA A;  4HDE A;  4EKZ A;  2JSZ A;  1WJK A;  1F6M C;  13GS A;  4G9H A;  2LS5 A;  2X64 A;  5CAX A;  4MPG A;  2VL2 A;  3KP9 A;  4BVY B;  4GST A;  2H1G A;  5G31 A;  4EE0 A;  4ZBD A;  2FWE A;  4V1A p;  3GH6 A;  2LJA A;  4KX4 A;  3IOS A;  1T4Z A;  1XWG A;  2O8V B;  4DSS B;  2CX3 A;  1ERT A;  1QK8 A;  4WET A;  3D5J A;  2FY6 A;  3APQ A;  3UOM A;  2RLI A;  3M9J A;  3FZ9 A;  2B1K A;  2LNS A;  2X8C A;  1XBS A;  4IVF A;  2FWG A;  2P5R A;  1XOA A;  4NHZ A;  3LG6 A;  3QOU A;  1ABA A;  20GS A;  4GCI A;  2O87 A;  3GKM A;  4MJE A;  1U6T A;  2YZH A;  4TR4 A;  3F0I A;  1QQ2 A;  1VF4 A;  3M8N A;  1JZD A;  4G0I A;  3CTF A;  2GDR A;  4J56 E;  4XS6 A;  4WKW A;  2N5F A;  2M72 A;  5HR2 A;  3QAW A;  3WGE A;  1TK5 B;  3M1G A;  3TRQ A;  3HXS A;  4BA7 A;  2JZR A;  2OA7 A;  1ILO A;  3FR6 A;  1PSQ A;  2FGX A;  1AXD A;  1GLQ A;  4TXV A;  3UBL A;  1UA5 A;  4NXI A;  3V1W A;  4KE3 A;  1BQ7 A;  2TRC P;  3TDG A;  4IP1 A;  3LYP A;  3SBC A;  3LGC A;  1FVJ A;  4KW6 A;  5IPH A;  5AN1 A;  3NIV A;  3ZZX A;  2HXK A;  4ZB8 A;  2X8H A;  3ZML A;  3FZA A;  5J3R A;  3TJG A;  3P2A A;  4TN8 A;  2VCW A;  2CVB A;  3UIW A;  1IYI A;  3AY8 A;  1PL1 A;  14GS A;  3VFI A;  1E2Y A;  4PQI A;  4ML6 A;  4OFM A;  4O5R A;  5GZZ B;  2H8L A;  2H76 A;  2QSI A;  1FB0 A;  1BG5 A;  4OCE A;  3P8W A;  2OAC A;  2OKA A;  3ZVJ A;  2B3S A;  4IP6 A;  1SD8 A;  2YOI A;  3UEM A;  3R2Q A;  4KDU A;  4IBP A;  2I4A A;  5JCW A;  2FCH A;  4KGI A;  3EMP A;  4LLR A;  1Z7R A;  3GUR A;  4KSO A;  3GST A;  1TOF A;  4GF0 A;  1YZX A;  2JL4 A;  2A4V A;  4PUA A;  3EVI A;  4RI6 A;  3GX8 A;  3KEB A;  2AUV A;  2H30 A;  3KIJ A;  1TRV A;  1EGO A;  1V2A A;  2WS2 A;  4FIW A;  4HEA 2;  5IIZ A;  1OKD A;  6GSW A;  3F3R A;  1U3A A;  1OC9 B;  4MZW A;  1SU9 A;  1K0M A;  4PQH A;  5ABR A;  5G2Z A;  5ELG A;  1H4O A;  2H19 A;  2OE0 A;  1YQ1 A;  1FOV A;  1HNC A;  3KCM A;  2VLT A;  3DRN A;  4NV2 A;  4ZL9 A;  2VLV A;  4EDZ A;  1A8L A;  2GST A;  2E0Q A;  5IMZ A;  3TJF A;  3ZIV A;  6GST A;  2C4J A;  4KSM A;  1LBK A;  2DJK A;  1TTZ A;  2LRC A;  5F07 A;  3D21 A;  3ZL5 A;  2KOK A;  1XWC A;  2ON7 A;  3PH9 A;  4ACS A;  3TKS A;  4MMM A;  5INY A;  3CRT A;  1SL0 B;  3FR9 A;  4ECB A;  2K8S A;  3IPZ A;  5HFI A;  4BWQ A;  1HQO A;  2X8G A;  4OD7 A;  5F8B A;  2ES7 A;  1S3A A;  2PWJ A;  4F2I A;  3IHQ A;  1PMT A;  2VL9 A;  1XVQ A;  6GSU A;  2WRT A;  3IC8 A;  1N8J A;  3A2X A;  2OE1 A;  1AAZ A;  3Q19 A;  5EY6 A;  3D4T A;  2CZ3 A;  2IWT A;  1K0C A;  3G7J A;  2XBI A;  3C1S A;  1MDK A;  1UVZ A;  2H74 A;  1OC3 A;  5F0G A;  1B48 A;  5D73 A;  4YQU A;  2MBT A;  1Z5Y E;  5B8A A;  1M0U A;  1K0A A;  3CRU A;  1GTI A;  3RBT A;  1ERW A;  3HZ4 A;  3PR8 A;  3PGT A;  2GQL A;  2HE3 A;  4XIH A;  4K7I A;  6GSV A;  2GSR A;  5EVO A;  4NMU A;  16GS A;  2D2Z A;  2GZZ A;  4OO4 A;  3H8Q A;  5JCG A;  4PNG A;  3W6G A;  1ZCP A;  3QFB C;  4ECC A;  1G6W A;  3RHC A;  1BX9 A;  1TK0 B;  5DJL A;  2DJ2 A;  1I9D A;  1WOU A;  5G5F A;  4ZB9 A;  3ZIT A;  2IMF A;  2GZY A;  4XS4 B;  3C73 A;  2FNO A;  1H75 A;  3RHB A;  4L5L A;  1SK0 A;  4YQV A;  1OE7 A;  2DJ3 A;  1PKW A;  3UJ1 A;  4IQA A;  2REM A;  5COH A;  3VUR A;  4WR5 A;  2GTU A;  4EC0 A;  3DVX A;  5ECH B;  1O73 A;  1Z3E A;  2R37 A;  3IC4 A;  2V6O A;  4IHU A;  3FYG A;  1TKD B;  3SWL A;  4FYC A;  3IDV A;  4PUF C;  1A2M A;  3APO A;  3F4S A;  3FK8 A;  3KH7 A;  5HR3 A;  3GL5 A;  1XWA A;  4BVY A;  3HY2 A;  1Q4J A;  2CX4 A;  4XRD A;  1SKS B;  3PIN A;  5D9W A;  3MSZ A;  2AV4 A;  3KTB A;  4NV5 A;  4XHM A;  3ED3 A;  5DDL A;  2C0D A;  3IV4 A;  4DSS A;  4POM A;  1EEJ A;  4ZB6 A;  4AJ7 A;  3QDN A;  3G7I A;  2C3T A;  1AIU A;  2F3M A;  2VO4 A;  1TU7 A;  5C04 A;  1GSU A;  2L5L A;  1VF1 A;  2VL3 A;  3BJ5 A;  1U87 A;  2P0G A;  1YF1 A;  1SYX A;  4MH2 A;  1X5D A;  1ZGN A;  2H0G A;  1RW1 A;  1K0O A;  5IOW A;  3KZQ A;  2JU5 A;  4HS1 A;  1X9S B;  5KN2 A;  2YV7 A;  2FWF A;  2LRT A;  4X43 A;  3HVV A;  3L9V A;  3H1N A;  3PPU A;  4HOJ A;  2DJ1 A;  3QPM A;  2E2M A;  2HYX A;  2N5A A;  2H73 A;  2HT9 A;  1YJ6 A;  4MH3 A;  4IJ3 A;  2LST A;  4HUA A;  3F3Q A;  2HSN B;  3KM6 A;  4JR4 A;  2L4C A;  1ZYQ B;  2HRA A;  2PGT A;  4NAX A;  2EIQ A;  1C72 A;  3UBK A;  2NDO A;  2ON5 A;  3MAK A;  1XFL A;  4USS A;  1MTC A;  5HR0 A;  1O7U A;  2B7J A;  3GA4 A;  1SJZ A;  2FLS A;  2LQO A;  4GSS A;  5F05 A;  2H6X A;  1TW9 A;  3C71 A;  1FW1 A;  4MZB A;  3A2V A;  2L6D A;  1PX6 A;  2YWM A;  9GSS A;  1XWB A;  4E8E A;  2CA8 A;  3IK7 A;  4TW5 A;  1FG4 A;  4FO5 A;  2IJY A;  4F03 A;  2JAD A;  5B7C A;  1F2E A;  5CRE A;  2MBS A;  1KEB A;  4EF0 A;  3GKX A;  5J9B A;  3TRP A;  1MDI A;  4ID0 A;  1BED A;  1PQN A;  1G7O A;  3CSH A;  2WDU A;  4IQ1 A;  1GP1 A;  4MJA A;  5ID2 B;  2VOC A;  5ECL B;  1GTB A;  3TOT A;  2KHP A;  4I6X A;  1CQH A;  1UC7 A;  4KAE A;  2CQ9 A;  3IAM 2;  4BVX B;  1TU8 A;  3DD3 A;  3D4M A;  3DEX A;  4ZIL A;  1TRW A;  4TR1 B;  2MMN A;  1GSD A;  3I9V 2;  4XTS A;  4PTS A;  1SL2 B;  5G5E A;  3LOR A;  2VIM A;  4KND A;  5H5R A;  2DJ0 A;  1TRU A;  1OC9 A;  1EEM A;  1U3I A;  1K3Y A;  2PBJ A;  4ZIJ A;  5DAL B;  2OJL A;  2X99 A;  2N5B A;  1TXX A;  5F06 A;  4YAV A;  3QAV A;  1DE1 A;  3RPP A;  1T4Y A;  2DIZ A;  2IPA A;  5FHI A;  3ERW A;  1R26 A;  4K1F A;  5G1L A;  2CVK A;  1SL1 B;  4WBJ A;  1GSE A;  5A4W A;  2FHE A;  3O3T A;  2R6K A;  1GSS A;  3GNJ A;  4RUV A;  4H86 A;  2P31 A;  1JZR A;  1XW5 A;  6GSY A;  3FHK A;  3ERG A;  4JRR A;  3WT1 A;  4FQU A;  2I1U A;  3FZ5 A;  5IMV A;  3LWA A;  5HFK A;  1XCC A;  1PL2 A;  2GZP A;  1R5P A;  1V57 A;  2B1L A;  3KP8 A;  3HKR A;  1M7T A;  1Z7P A;  1M9B A;  3HVS A;  2HZE B;  4LMW A;  3CTG A;  2HSM B;  18GS A;  2R2J A;  3IR4 A;  1BAY A;  4GXZ A;  1T3B A;  3BD2 A;  2XBQ A;  3QFA C;  4OO5 A;  3VWX A;  2HSY A;  1KBN A;  3NZN A;  1TP9 A;  5J5N A;  2H70 A;  3R3E A;  2PMT A;  1J08 A;  2YWI A;  1YDK A;  4XS4 A;  3LQ7 A;  3C7M A;  5L71 A;  2DC5 A;  2K6V A;  4WXT A;  1CQG A;  3FEU A;  3EU4 A;  4Q5N A;  1AC1 A;  3TGZ A;  2EIR A;  2J23 A;  2AHE A;  2PN8 A;  1GUL A;  4AGS A;  2B5Y A;  4K7O A;  1TK8 B;  1AQV A;  3GMF A;  2ZCT A;  17GS A;  2L57 A;  1ML6 A;  2J9H A;  3VPQ A;  4N30 A;  1YY7 A; 
#chains in the Genus database with same CATH topology
 1V9W A;  2YNX A;  2KP1 A;  3GRX A;  1ON4 A;  4ZBA A;  2H1D A;  4KCE A;  3HMJ G;  5IOX A;  1EWX A;  2L6C A;  4YH2 A;  2E7P A;  2H75 A;  1O85 A;  2C3Q A;  2GS3 A;  4AJ8 A;  3VWU A;  4MJB A;  3DVW A;  4XS1 A;  5B6M A;  1M9A A;  5A4U A;  4K0G A;  1S3C A;  4EDY A;  1X9W B;  4E68 A;  1PKZ A;  4JBB A;  2CZ2 A;  2ALB A;  4ECI A;  4IKH A;  2DIY A;  1BF5 A;  1J9B A;  2YAN A;  2HZF A;  1ERV A;  2OT3 A;  5IPG A;  2C1Y A;  4J57 E;  3LXT A;  2BMX A;  4KUN A;  1FHE A;  1RK4 A;  1E6B A;  1EOH A;  2CVD A;  1EOG A;  1SJ6 A;  1JZO A;  4V2M A;  5CRG A;  1HYU A;  1G7E A;  4OFT A;  2VM1 A;  3GKK A;  2VCQ A;  1ZZY A;  3LJR A;  4LMV A;  3TB2 A;  2CAI A;  2YPM A;  2JAC A;  3QR6 A;  3M3M A;  3IA1 A;  3ZVJ D;  4N3Z A;  2GSS A;  2WUL A;  1O8X A;  3WGX A;  2YJ7 A;  2LJK A;  1K0N A;  2R3X A;  1YKC A;  2H66 A;  1GRX A;  5KN1 A;  4F0B A;  3I6A A;  2Z9S A;  3FY7 A;  1Q98 A;  4MCU A;  3F6D A;  4G10 A;  2IFQ B;  2VUP A;  2TIR A;  1M3I A;  4K2D A;  1K0B A;  2JZS A;  4G19 A;  4O5U A;  1I1I P;  1DBY A;  2LKU A;  1OC8 A;  5DAK B;  1WE0 A;  2YCD A;  5B6N A;  3VWV A;  5BMU B;  3ERF A;  3P7X A;  2WJU A;  1THX A;  1XW9 A;  3TUE A;  1DE2 A;  1B9X C;  3TKP A;  1OE8 A;  1T1V A;  1GSY A;  1WWJ A;  2XPD A;  4MF7 A;  3EC3 A;  1XWK A;  3DKS A;  5H5Q A;  1O8W A;  2K18 A;  4QQ7 A;  5FT3 A;  3VI7 A;  1ZYE A;  1TDI A;  1VRS D;  4PUR A;  2EFH A;  2P5Q A;  5ECK B;  1GH2 A;  4D73 B;  4HI7 A;  1O6J A;  2B5X A;  4N0Z A;  5AIX A;  3EU3 A;  4TOP A;  5FWG A;  3ZLP A;  4MF6 A;  5JCU A;  3N9J A;  1MD3 A;  4PX1 A;  4GDF A;  4I2T A;  1W4V A;  4MP4 A;  1QXH A;  5ID2 A;  1S3R A;  1JHB A;  2OAD A;  1KNG A;  5KEJ A;  2H72 A;  3CSJ A;  4E8H A;  2L4Q A;  4GRF A;  3S9F A;  1SKR B;  2PER A;  4GQC A;  2AB6 A;  4GQF A;  5J9C A;  3Q18 A;  1NHO A;  4AF2 A;  4BVX A;  3L9U A;  5IMF A;  5D9X A;  1J0F A;  1TJD A;  4J2F A;  1AUC A;  4DVC A;  1K0D A;  3F9U A;  1T00 A;  4TR1 A;  1NW2 A;  2V2G A;  3CHX C;  1GNW A;  3ZYW A;  2LNT A;  2C0F A;  3DXB A;  3H93 A;  2F51 A;  1F37 A;  3FRC A;  2PUK C;  3TJJ A;  1Z6M A;  1XXU A;  5IM9 A;  3MDK A;  4L0W A;  3LFL A;  5CYY A;  3W8J A;  2PVQ A;  3ZFB A;  1GUK A;  4P3Y B;  2MMZ A;  5G30 A;  3ZRD A;  3TRX A;  1ACV A;  3LSZ A;  2IMD A;  5DAL A;  5EPF A;  5J4U A;  2PU9 C;  1GTA A;  4CY6 A;  5IO0 A;  3HJP A;  3CQF A;  3GFK A;  1M2B A;  4TRX A;  4X1U A;  2L5O A;  1RQM A;  4ILF A;  4GLT A;  1OAZ A;  3GUS A;  3UAP A;  1WPI A;  3KMO A;  4V2N A;  1K3O A;  4O5Q A;  1T7P B;  2AYT A;  2C0G A;  2E2G A;  1EP8 A;  3L78 A;  3D6I A;  1HNA A;  5ENU A;  4Z7X A;  1JZW A;  3BCI A;  4AI6 A;  2O89 A;  3HJO A;  3FW2 A;  2F9S A;  2LRN A;  1BYE A;  1V40 A;  5C00 A;  3HJM A;  4RQX A;  4PHZ C;  3TOU A;  4WR4 A;  2X4A A;  11GS A;  3DML A;  4MLY A;  1EGR A;  4IS0 A;  3EYT A;  2YP6 A;  3KJY A;  1WRY A;  4MZC A;  4AKI A;  1AW9 A;  4XCS A;  3GV1 A;  2R4V A;  4TXO B;  1A0F A;  1LJR A;  3JCM L;  2H0I A;  2VCT A;  2VCV A;  1X0R A;  3IHG A;  4JU5 A;  3DIE A;  4POK A;  1XIY A;  4K8M A;  5JWQ B;  4KA0 A;  2YN1 A;  5GST A;  3CSI A;  5CP1 A;  4OCF A;  2HZE A;  4TR3 A;  2HSM A;  3F63 A;  2CT6 A;  2H6Y A;  4FYB A;  1FO5 A;  3LEF A;  1IYH A;  5ECI B;  3M9K A;  4G0K A;  4HZ2 A;  4FH8 A;  2LJR A;  1R5A A;  3A2W A;  2O3E A;  4L0U A;  2QA1 A;  3U5R E;  2VD0 A;  1OVN A;  1Y25 A;  3TKR A;  1YEP A;  5KOW A;  1G0T A;  4OMV A;  3E0U A;  4RQR A;  5GAP D;  4LA1 A;  1PGT A;  3K8N A;  1WIK A;  3GN3 A;  1YEX A;  5IMC A;  3HVN A;  2OBI A;  4K6X A;  5IMD A;  3D0Z A;  4HU9 A;  3F6F A;  6GSX A;  2XC2 A;  3IRA A;  3ISO A;  2HLS A;  1GL8 A;  1SD9 A;  4O32 A;  1SVM A;  1M2D A;  2VCZ A;  3J7Y b;  2GSQ A;  1PA3 A;  3EUR A;  4XRA A;  1F3B A;  1NHY A;  4WF4 A;  2VKZ G;  2JZT A;  3KH9 A;  4F0C A;  4PXO A;  1A8Y A;  3GSS A;  3VK9 A;  3WYW A;  2NVL A;  2VM2 A;  1M3J A;  1JLW A;  1VF2 A;  4JED A;  2IMK A;  4BL7 B;  4QL9 A;  4CW9 A;  1X5C A;  4YKF A;  4MA9 A;  2B7K A;  2NTO A;  1Y1U A;  4BPY A;  3ZTL A;  2VAF A;  2FA4 A;  3EMX A;  1GSQ A;  1B8X A;  3IAS 2;  3GHA A;  2EIO A;  2MMO A;  3U6V A;  3TKS C;  2GLR A;  1FVK A;  5DCH A;  1F9M A;  3ZIJ A;  5CNW A;  3MIX A;  1UN2 A;  4N11 A;  1DUG A;  2QC7 A;  3TJK A;  4GTU A;  5KOX A;  2QGV A;  4HQS A;  2M46 A;  4K7N A;  4IW9 A;  2WZ9 A;  4HJM A;  4EL1 A;  19GS A;  1S3D A;  5DBQ A;  3I43 A;  2HRK A;  2ZUP A;  5CRH A;  1TXU A;  1SK2 A;  2FUG 2;  4JE1 A;  5ECN B;  2R0C A;  4HSC X;  5H5S A;  1K3L A;  4LL4 B;  2IL3 A;  5D93 A;  1W89 A;  3TU3 B;  4IN0 A;  3TCO A;  2HI7 A;  2RM6 A;  3EWL A;  5GSS A;  1R7H A;  2WW3 A;  3HHV A;  2PVO C;  2BJX A;  5ECQ B;  1A0R P;  3HZ8 A;  2IFQ A;  3TKQ A;  4OFN A;  4I2U A;  1FB6 A;  3UVH A;  2WGR A;  2R0G A;  1NSW A;  3HCZ A;  2DMM A;  5A5H B;  5DAK A;  3N5O A;  2EC4 A;  2FD3 A;  1ST9 A;  2DBC A;  5BMU A;  1QGV A;  3US3 A;  4HJ2 A;  2C0E A;  3FZ4 A;  5GAN D;  2G2Q A;  2C80 A;  3O6T A;  3CBU A;  1Z9H A;  3L4N A;  1TI1 A;  4EXJ A;  3F8U A;  2ZNM A;  2WW2 A;  2NBS A;  4DSQ A;  2MYG A;  1GSF A;  4L5O A;  4Q5R A;  4I5Q A;  1WMJ A;  2K9F A;  4D73 A;  4F9Z A;  5HQP A;  1YF0 A;  4F82 A;  5ECR B;  3Q74 A;  1MD4 A;  3H4K A;  1DSB A;  1MEK A;  5ECS A;  3LYK A;  2AJQ B;  3EIN A;  3BOA A;  2V6K A;  1ZMA A;  4EIP A;  3VI5 A;  2M80 A;  4MAB A;  2DML A;  1BJX A;  4LL1 B;  5DVB A;  4IGJ A;  1XPV A;  2YWN A;  1SKW B;  5EL8 A;  4KF9 A;  2KUC A;  4TKY A;  3ME8 A;  4HQZ A;  2B6M A;  2RM5 A;  2H71 A;  4G2E A;  3GTU B;  2A4H A;  2HRF A;  2IIY A;  2H01 A;  1PN0 A;  3CXG A;  3G9B A;  3CMI A;  2H1L A;  1Z6N A;  3TJB A;  4ISD A;  4NPB A;  3WD6 A;  3QMX A;  1JFU A;  3GIX A;  1PX7 A;  2AAW A;  4ZL7 A;  2WCI A;  1U88 A;  4BWS A;  5ELA A;  1PRX A;  4DSR A;  2LEG A;  1FAA A;  4POB A;  1USB A;  5LNK e;  2RII A;  2WFC A;  4WBR D;  2HFD A;  5D8I A;  2CAQ A;  1A23 A;  1A2J A;  3VLN A;  1X5E A;  4YAP A;  5JWO B;  3E9J B;  4GWR A;  4Z2U A;  2FA8 A;  1GWC A;  4TVE A;  4Q5Q A;  4V1A g;  3RFR C;  3NOF A;  3LXZ A;  4PGT A;  1FOH A;  4KCA A;  1X9M B;  5JWR B;  3A3T A;  2HNL A;  10GS A;  3HYP A;  3OR5 A;  1VGL A;  2V32 A;  1THO A;  1SEN A;  1V98 A;  3Q6O A;  7GSS A;  4Q5F A;  3C8E A;  4DEJ A;  5D9V A;  2HRK B;  2HSH A;  4CHS A;  5HFG A;  5DCG A;  3TKS E;  4OWY A;  2B5E A;  5IQY A;  2LUS A;  6GSS A;  3I69 A;  2KLX A;  4PI2 C;  1NM3 A;  4TXO A;  1OYJ A;  5LCZ A;  2MMA A;  2QKE A;  2C3N A;  4HZ4 A;  4EUY A;  3HA9 A;  5E59 A;  3RGB C;  4CDO A;  3QD9 A;  2YWO A;  4TR0 A;  1GUM A;  2MZC A;  3L9S A;  1V58 A;  4JZQ A;  1G6Y A;  2H1A A;  2WZS A;  3J7Y k;  2IN3 A;  5LD0 A;  3BCK A;  2WB9 A;  1ERU A;  1O81 A;  3GX0 A;  1B9Y C;  2PPT A;  1PD2 1;  3GH9 A;  5ECP B;  4G0L A;  1QUW A;  2UZ8 A;  3L0H A;  4NHW A;  5DQS A;  2GQK A;  2KP2 A;  2NPB A;  2RUE A;  4O7H A;  1GTU A;  4MJC A;  3ZFL A;  1GNE A;  2G0F A;  2IMI A;  2OE3 A;  2H1B A;  3VWW A;  4ULX A;  2YZU A;  1HNB A;  2VD1 A;  4KB3 A;  2WVZ A;  5CO3 A;  4HU7 A;  2OBK A;  2HQT A;  3WGD A;  4QL7 A;  2C8U A;  2VLU A;  2WVX B;  1GLP A;  3UL3 A;  4N10 A;  1F3A A;  1SK1 A;  5AIV A;  1MDJ A;  22GS A;  3D22 A;  4WF5 A;  2YV9 A;  2VCX A;  1AQW A;  1SYR A;  3BBY A;  2H6Z A;  5D96 A;  3FKF A;  2DJJ A;  2VL2 C;  4AJ6 A;  3F4R A;  3KTL A;  5ECM B;  3HD5 A;  4MDC A;  5AIS A;  1WP0 A;  4BL7 A;  1YKA A;  3VPT A;  1LU4 A;  5J41 A;  3RPN A;  3ZRE A;  3M0F A;  2RUF A;  2IME A;  1A2L A;  4BIK A;  1KTE A;  5AGY A;  4I8B A;  4X0X A;  1HD2 A;  1XZO A;  5A4V A;  4YQM A;  2F8F A;  4GSN A;  3DYR A;  3C1R A;  5KN0 A;  3UVT A;  4ZXG A;  2LTK A;  3HVX A;  3UMA A;  12GS A;  2GQM A;  3KXO A;  5A34 B;  1EP7 A;  3DGQ A;  1PN9 A;  1TRS A;  4L8E A;  4RI7 A;  2K8V A;  4MF5 A;  4MK3 A;  4WEY A;  1ZL9 A;  2O85 A;  3KMN A;  1VF3 A;  5G1K A;  1OKT A;  2I9H A;  5IO2 A;  4PQ1 A;  1ZYN A;  4NWY A;  1GUH A;  3G7Y A;  3MWH A;  4POL A;  3QAG A;  2JSY A;  2FWH A;  4I97 A;  2LV3 A;  4KH7 A;  4K9Z A;  1EZK A;  4N0V A;  1T8E B;  1M2A A;  3P90 A;  3UAR A;  1XW6 A;  2I3Y A;  4ECJ A;  2DKH A;  3DWV A;  3W8S A;  1R4W A;  3WT2 A;  5A5H A;  3APS A;  4EIQ A;  2BTO T;  5CRW A;  3H79 A;  5E4W A;  3EE2 A;  2GT5 A;  4ZL8 A;  2V41 A;  8GSS A;  3IK9 A;  2A2R A;  1Y6E A;  2XPE A;  3GYK A;  2R5G A;  2R0P A;  5DQY A;  4Z2R A;  1A24 A;  1QMV A;  4A5P A;  4ZBB A;  3FR3 A;  5B8B A;  5KN3 A;  2I81 A;  1QFN A;  4IEL A;  4PNF A;  1TI3 A;  3GKN A;  1B4Q A;  1YVL A;  1ZOF A;  3IXR A;  4ML1 A;  2GGT A;  3O76 A;  3ME7 A;  2DLX A;  3A5W A;  3RDW A;  2A2S A;  4MPF A;  3QCP A;  1EV9 A;  2O7K A;  4IJI A;  3RAZ A;  2CV4 A;  3IE3 A;  3F4T A;  5D9T A;  1M99 A;  4EVM A;  1EV4 A;  3GTU A;  2V1M A;  4KDY A;  5CRD A;  4K0N A;  2HRN A;  4V2L A;  4Z2T A;  3E3E A;  3KGK A;  4FYU A;  2L59 A;  2YJH A;  2TRX A;  4X4J A;  1B4P A;  4PI0 C;  5J47 A;  4JR6 A;  2XHF A;  3HDC A;  1XVW A;  1AQX A;  1N2A A;  5ECO B;  1SJI A;  3GL3 A;  5A5K A;  2F8A A;  1URM A;  1XOB A;  3MNG A;  3CYN A;  4KDX A;  4K2X A;  3KD0 A;  5HR1 A;  2GVP A;  2H0H A;  1JLV A;  4O92 A;  5DJM A;  1I5G A;  2LQQ A;  3ZMK A;  3IBH A;  2DSA A;  4EO3 A;  2GT6 A;  5IMA A;  4HDE A;  4AKX B;  4EKZ A;  2JSZ A;  1WJK A;  1F6M C;  13GS A;  4G9H A;  2LS5 A;  2X64 A;  5CAX A;  4MPG A;  2VL2 A;  3KP9 A;  4BVY B;  4GST A;  2H1G A;  5G31 A;  4EE0 A;  4ZBD A;  2FWE A;  4V1A p;  3GH6 A;  2LJA A;  4KX4 A;  3IOS A;  2O5V A;  1T4Z A;  1XWG A;  2O8V B;  3LW9 A;  5J4Y A;  4DSS B;  2CX3 A;  1ERT A;  1QK8 A;  4WET A;  3D5J A;  2FY6 A;  3APQ A;  3UOM A;  4YKG A;  2RLI A;  3M9J A;  3FZ9 A;  2B1K A;  2LNS A;  2X8C A;  1XBS A;  4IVF A;  2FWG A;  2P5R A;  1XOA A;  4NHZ A;  3LG6 A;  3QOU A;  1ABA A;  20GS A;  4GCI A;  2O87 A;  3GKM A;  4MJE A;  1U6T A;  2YZH A;  4TR4 A;  3F0I A;  2DKI A;  1QQ2 A;  1VF4 A;  3M8N A;  1JZD A;  4G0I A;  3CTF A;  2GDR A;  4J56 E;  4XS6 A;  4WKW A;  2N5F A;  2M72 A;  5HR2 A;  3QAW A;  3WGE A;  1TK5 B;  3M1G A;  3TRQ A;  3HXS A;  4BA7 A;  4ICY A;  2JZR A;  2OA7 A;  1ILO A;  3FR6 A;  1PSQ A;  2FGX A;  1AXD A;  1GLQ A;  4TXV A;  3UBL A;  1UA5 A;  4NXI A;  3V1W A;  4KE3 A;  1BQ7 A;  2TRC P;  3TDG A;  4IP1 A;  3LYP A;  3SBC A;  3LGC A;  1FVJ A;  4KW6 A;  5IPH A;  5AN1 A;  3NIV A;  3ZZX A;  2HXK A;  4ZB8 A;  2X8H A;  3ZML A;  3FZA A;  5J3R A;  3TJG A;  3P2A A;  4QMK A;  4TN8 A;  2VCW A;  2WVX A;  2CVB A;  1SVL A;  3UIW A;  1IYI A;  3AY8 A;  1PL1 A;  14GS A;  3VFI A;  1E2Y A;  4PQI A;  4ML6 A;  4OFM A;  4O5R A;  5A1N A;  5GZZ B;  2H8L A;  2H76 A;  2QSI A;  1FB0 A;  1BG5 A;  4OCE A;  3P8W A;  2OAC A;  2OKA A;  3ZVJ A;  2B3S A;  4IP6 A;  1SD8 A;  2YOI A;  3UEM A;  1YEW C;  3R2Q A;  2O36 A;  4KDU A;  4IBP A;  2I4A A;  5JCW A;  2FCH A;  4KGI A;  3EMP A;  4LLR A;  1Z7R A;  3GUR A;  4KSO A;  3GST A;  1TOF A;  4GF0 A;  1YZX A;  2JL4 A;  2A4V A;  4PUA A;  5A34 A;  3EVI A;  4RI6 A;  3GX8 A;  3KEB A;  2AUV A;  2H30 A;  3KIJ A;  1TRV A;  1EGO A;  1V2A A;  2WS2 A;  4FIW A;  4HEA 2;  5IIZ A;  1OKD A;  6GSW A;  3F3R A;  1U3A A;  2WW0 A;  1OC9 B;  4MZW A;  1SU9 A;  1K0M A;  4PQH A;  5ABR A;  5G2Z A;  5ELG A;  1H4O A;  2H19 A;  2OE0 A;  1YQ1 A;  1FOV A;  1HNC A;  3KCM A;  2VLT A;  3DRN A;  4NV2 A;  4ZL9 A;  2VLV A;  4EDZ A;  1A8L A;  2GST A;  2E0Q A;  5IMZ A;  3TJF A;  3ZIV A;  6GST A;  2C4J A;  4KSM A;  4CY8 A;  1LBK A;  2DJK A;  1TTZ A;  2LRC A;  5F07 A;  3D21 A;  2EFE A;  3ZL5 A;  2KOK A;  1XWC A;  2ON7 A;  3PH9 A;  4MNN A;  4FXY P;  4ACS A;  3TKS A;  4MMM A;  5INY A;  3CRT A;  1SL0 B;  3FR9 A;  4ECB A;  2K8S A;  3IPZ A;  5HFI A;  4BWQ A;  1HQO A;  2X8G A;  4OD7 A;  5F8B A;  2ES7 A;  1S3A A;  2PWJ A;  4F2I A;  3IHQ A;  1PMT A;  2VL9 A;  1XVQ A;  6GSU A;  2WRT A;  3IC8 A;  1N8J A;  3A2X A;  2OE1 A;  1AAZ A;  3Q19 A;  5EY6 A;  2HSN A;  3D4T A;  2CZ3 A;  2IWT A;  1K0C A;  3G7J A;  2XBI A;  3C1S A;  1MDK A;  1UVZ A;  2H74 A;  1OC3 A;  5F0G A;  1B48 A;  5D73 A;  4YQU A;  2MBT A;  1Z5Y E;  5B8A A;  2UV8 G;  1M0U A;  1K0A A;  3CRU A;  1GTI A;  3RBT A;  1ERW A;  3HZ4 A;  3PR8 A;  3PGT A;  2WVY A;  2GQL A;  5J4V A;  2HE3 A;  4XIH A;  4K7I A;  3EPT A;  6GSV A;  2GSR A;  5EVO A;  4NMU A;  16GS A;  2D2Z A;  2GZZ A;  4OO4 A;  3H8Q A;  5JCG A;  4PNG A;  3W6G A;  1ZCP A;  3QFB C;  4ECC A;  5A1N B;  1G6W A;  3RHC A;  1BX9 A;  1TK0 B;  5DJL A;  2DJ2 A;  1I9D A;  1WOU A;  5G5F A;  4ZB9 A;  3ZIT A;  2IMF A;  4AKH A;  2GZY A;  4XS4 B;  3C73 A;  2FNO A;  1H75 A;  3RHB A;  4L5L A;  1SK0 A;  4YQV A;  1OE7 A;  2DJ3 A;  1PKW A;  3UJ1 A;  4IQA A;  2REM A;  5COH A;  3VUR A;  4WR5 A;  2GTU A;  4EC0 A;  3DVX A;  5ECH B;  1O73 A;  1Z3E A;  2R37 A;  3IC4 A;  2V6O A;  4IHU A;  3FYG A;  1TKD B;  3SWL A;  4FYC A;  3IDV A;  4PUF C;  1A2M A;  3APO A;  3F4S A;  3FK8 A;  3KH7 A;  5HR3 A;  3GL5 A;  1XWA A;  4BVY A;  3HY2 A;  1SVO A;  1Q4J A;  2CX4 A;  2WW1 A;  4XRD A;  1SKS B;  3PIN A;  5D9W A;  3MSZ A;  2A2P A;  2AV4 A;  3KTB A;  4NV5 A;  5J40 A;  4XHM A;  4W66 A;  5DDL A;  3ED3 A;  2C0D A;  3IV4 A;  4DSS A;  4POM A;  1EEJ A;  4ZB6 A;  4AJ7 A;  3QDN A;  3G7I A;  2C3T A;  1AIU A;  2F3M A;  2VO4 A;  1TU7 A;  5C04 A;  1GSU A;  2L5L A;  1VF1 A;  2VL3 A;  1S4B P;  3BJ5 A;  1U87 A;  2P0G A;  1YF1 A;  1SYX A;  4MH2 A;  1X5D A;  1ZGN A;  2H0G A;  1RW1 A;  1K0O A;  5IOW A;  3KZQ A;  3CWG A;  2JU5 A;  4HS1 A;  1X9S B;  5KN2 A;  2YV7 A;  2FWF A;  2LRT A;  4X43 A;  4ZB7 A;  3HVV A;  3L9V A;  3H1N A;  3PPU A;  4HOJ A;  2DJ1 A;  3QPM A;  2E2M A;  2HYX A;  2N5A A;  3FMW A;  2H73 A;  2HT9 A;  1ZYP A;  1YJ6 A;  4MH3 A;  4IJ3 A;  2LST A;  4HUA A;  3F3Q A;  2HSN B;  3KM6 A;  4JR4 A;  2L4C A;  1ZYQ B;  2HRA A;  2PGT A;  4NAX A;  2EIQ A;  1C72 A;  3UBK A;  2NDO A;  2ON5 A;  3MAK A;  1XFL A;  4USS A;  1MTC A;  5HR0 A;  1O7U A;  2B7J A;  3GA4 A;  1SJZ A;  2FLS A;  2LQO A;  4GSS A;  5F05 A;  2H6X A;  1TW9 A;  3C71 A;  1FW1 A;  4MZB A;  3A2V A;  2L6D A;  1PX6 A;  2YWM A;  9GSS A;  1XWB A;  4E8E A;  2CA8 A;  3IK7 A;  3MYD A;  4TW5 A;  1FG4 A;  4FO5 A;  2IJY A;  4F03 A;  2JAD A;  5B7C A;  1F2E A;  5CRE A;  2MBS A;  1KEB A;  4EF0 A;  3GKX A;  5J9B A;  3TRP A;  1MDI A;  4ID0 A;  1BED A;  4G01 A;  1PQN A;  1G7O A;  3CSH A;  3A5I A;  2WDU A;  4IQ1 A;  1GP1 A;  4MJA A;  5ID2 B;  2VOC A;  5ECL B;  1GTB A;  3TOT A;  2KHP A;  4I6X A;  1CQH A;  1UC7 A;  4KAE A;  2CQ9 A;  3IAM 2;  2EFD A;  4BVX B;  1TU8 A;  3DD3 A;  3D4M A;  3DEX A;  4ZIL A;  1TRW A;  4TR1 B;  2MMN A;  1GSD A;  3I9V 2;  4XTS A;  4PTS A;  1SL2 B;  5G5E A;  3LOR A;  2VIM A;  4KND A;  5H5R A;  2DJ0 A;  1TRU A;  1OC9 A;  1EEM A;  1U3I A;  1K3Y A;  2PBJ A;  4ZIJ A;  5DAL B;  2OJL A;  2X99 A;  2N5B A;  1TXX A;  2QA2 A;  5F06 A;  4YAV A;  3QAV A;  1DE1 A;  3RPP A;  1T4Y A;  1N25 A;  2DIZ A;  2IPA A;  5FHI A;  4AKG A;  3ERW A;  1R26 A;  4K1F A;  5G1L A;  2CVK A;  1SL1 B;  4WBJ A;  1GSE A;  5A4W A;  5BRT A;  2FHE A;  3O3T A;  2R6K A;  1GSS A;  2X49 A;  3GNJ A;  1PFO A;  4RUV A;  4H86 A;  2P31 A;  1JZR A;  1XW5 A;  6GSY A;  3FHK A;  3ERG A;  4JRR A;  3WT1 A;  4FQU A;  2I1U A;  3FZ5 A;  5IMV A;  3LWA A;  5HFK A;  1XCC A;  1PL2 A;  2GZP A;  1R5P A;  1V57 A;  2B1L A;  3KP8 A;  3HKR A;  1M7T A;  1Z7P A;  1XG8 A;  1M9B A;  4K5S A;  3HVS A;  2HZE B;  1BG1 A;  4LMW A;  3CTG A;  2HSM B;  18GS A;  2R2J A;  3IR4 A;  1BAY A;  4GXZ A;  1T3B A;  3BD2 A;  2XBQ A;  3QFA C;  4OO5 A;  3VWX A;  2HSY A;  1KBN A;  1TP9 A;  5J5N A;  2H70 A;  3NZN A;  3R3E A;  4K5R A;  2PMT A;  1J08 A;  2YWI A;  1YDK A;  4XS4 A;  3LQ7 A;  3C7M A;  5L71 A;  2DC5 A;  2K6V A;  4WXT A;  1CQG A;  3FEU A;  3EU4 A;  4Q5N A;  1AC1 A;  3TGZ A;  2EIR A;  2J23 A;  2AHE A;  2EFC A;  2PN8 A;  1GUL A;  4AGS A;  2B5Y A;  4K7O A;  1TK8 B;  1AQV A;  3GMF A;  2ZCT A;  17GS A;  2L57 A;  1ML6 A;  2J9H A;  3VPQ A;  4N30 A;  1YY7 A; 
#chains in the Genus database with same CATH homology
 1V9W A;  2YNX A;  2KP1 A;  3GRX A;  1ON4 A;  4ZBA A;  2H1D A;  4KCE A;  3HMJ G;  5IOX A;  1EWX A;  2L6C A;  4YH2 A;  2E7P A;  2H75 A;  1O85 A;  2C3Q A;  2GS3 A;  4AJ8 A;  3VWU A;  4MJB A;  3DVW A;  4XS1 A;  5B6M A;  1M9A A;  5A4U A;  4K0G A;  1S3C A;  4EDY A;  1X9W B;  4E68 A;  1PKZ A;  4JBB A;  2CZ2 A;  2ALB A;  4ECI A;  4IKH A;  2DIY A;  1BF5 A;  1J9B A;  2YAN A;  2HZF A;  1ERV A;  2OT3 A;  5IPG A;  2C1Y A;  4J57 E;  3LXT A;  2BMX A;  4KUN A;  1FHE A;  1RK4 A;  1E6B A;  1EOH A;  2CVD A;  1EOG A;  1SJ6 A;  1JZO A;  4V2M A;  5CRG A;  1HYU A;  1G7E A;  4OFT A;  2VM1 A;  3GKK A;  2VCQ A;  1ZZY A;  3LJR A;  4LMV A;  3TB2 A;  2CAI A;  2YPM A;  2JAC A;  3QR6 A;  3M3M A;  3IA1 A;  3ZVJ D;  4N3Z A;  2GSS A;  2WUL A;  1O8X A;  3WGX A;  2YJ7 A;  2LJK A;  1K0N A;  2R3X A;  1YKC A;  2H66 A;  1GRX A;  5KN1 A;  4F0B A;  3I6A A;  2Z9S A;  3FY7 A;  1Q98 A;  4MCU A;  3F6D A;  4G10 A;  2IFQ B;  2VUP A;  2TIR A;  4K2D A;  1K0B A;  2JZS A;  4G19 A;  4O5U A;  1DBY A;  2LKU A;  1OC8 A;  5DAK B;  1WE0 A;  2YCD A;  5B6N A;  3VWV A;  5BMU B;  3ERF A;  3P7X A;  2WJU A;  1THX A;  1XW9 A;  3TUE A;  1DE2 A;  1B9X C;  3TKP A;  1OE8 A;  1T1V A;  1GSY A;  1WWJ A;  2XPD A;  4MF7 A;  3EC3 A;  1XWK A;  3DKS A;  5H5Q A;  1O8W A;  2K18 A;  4QQ7 A;  5FT3 A;  3VI7 A;  1ZYE A;  1TDI A;  1VRS D;  4PUR A;  2EFH A;  2P5Q A;  5ECK B;  1GH2 A;  4D73 B;  4HI7 A;  1O6J A;  2B5X A;  4N0Z A;  5AIX A;  3EU3 A;  4TOP A;  5FWG A;  3ZLP A;  4MF6 A;  5JCU A;  3N9J A;  1MD3 A;  4PX1 A;  4GDF A;  4I2T A;  1W4V A;  4MP4 A;  1QXH A;  5ID2 A;  1JHB A;  2OAD A;  1KNG A;  5KEJ A;  2H72 A;  3CSJ A;  4E8H A;  2L4Q A;  4GRF A;  3S9F A;  1SKR B;  2PER A;  4GQC A;  2AB6 A;  4GQF A;  5J9C A;  3Q18 A;  1NHO A;  4AF2 A;  4BVX A;  3L9U A;  5IMF A;  5D9X A;  1J0F A;  1TJD A;  4J2F A;  1AUC A;  4DVC A;  1K0D A;  3F9U A;  1T00 A;  4TR1 A;  1NW2 A;  2V2G A;  1GNW A;  3ZYW A;  2LNT A;  2C0F A;  3DXB A;  3H93 A;  2F51 A;  1F37 A;  3FRC A;  2PUK C;  3TJJ A;  1Z6M A;  1XXU A;  5IM9 A;  3MDK A;  4L0W A;  3LFL A;  5CYY A;  3W8J A;  2PVQ A;  3ZFB A;  1GUK A;  4P3Y B;  2MMZ A;  5G30 A;  3ZRD A;  3TRX A;  1ACV A;  3LSZ A;  2IMD A;  5DAL A;  5EPF A;  5J4U A;  2PU9 C;  1GTA A;  4CY6 A;  5IO0 A;  3HJP A;  3GFK A;  1M2B A;  4TRX A;  4X1U A;  2L5O A;  1RQM A;  4ILF A;  4GLT A;  1OAZ A;  3GUS A;  3UAP A;  1WPI A;  3KMO A;  4V2N A;  1K3O A;  4O5Q A;  1T7P B;  2AYT A;  2C0G A;  2E2G A;  1EP8 A;  3L78 A;  3D6I A;  1HNA A;  5ENU A;  4Z7X A;  1JZW A;  3BCI A;  4AI6 A;  2O89 A;  3HJO A;  3FW2 A;  2F9S A;  2LRN A;  1BYE A;  1V40 A;  5C00 A;  3HJM A;  4RQX A;  3TOU A;  4WR4 A;  2X4A A;  11GS A;  3DML A;  4MLY A;  1EGR A;  4IS0 A;  3EYT A;  2YP6 A;  3KJY A;  1WRY A;  4MZC A;  4AKI A;  1AW9 A;  4XCS A;  3GV1 A;  2R4V A;  4TXO B;  1A0F A;  1LJR A;  3JCM L;  2H0I A;  2VCT A;  2VCV A;  1X0R A;  3IHG A;  4JU5 A;  3DIE A;  4POK A;  1XIY A;  4K8M A;  5JWQ B;  4KA0 A;  2YN1 A;  5GST A;  3CSI A;  5CP1 A;  4OCF A;  2HZE A;  4TR3 A;  2HSM A;  3F63 A;  2CT6 A;  2H6Y A;  4FYB A;  1FO5 A;  3LEF A;  1IYH A;  5ECI B;  3M9K A;  4G0K A;  4HZ2 A;  4FH8 A;  2LJR A;  1R5A A;  3A2W A;  4L0U A;  2QA1 A;  3U5R E;  2VD0 A;  1OVN A;  1Y25 A;  3TKR A;  1YEP A;  5KOW A;  1G0T A;  4OMV A;  3E0U A;  4RQR A;  5GAP D;  4LA1 A;  1PGT A;  3K8N A;  1WIK A;  3GN3 A;  1YEX A;  5IMC A;  4K6X A;  2OBI A;  5IMD A;  3D0Z A;  4HU9 A;  3F6F A;  6GSX A;  2XC2 A;  3IRA A;  3ISO A;  2HLS A;  1GL8 A;  1SD9 A;  4O32 A;  1SVM A;  1M2D A;  2VCZ A;  3J7Y b;  2GSQ A;  1PA3 A;  3EUR A;  4XRA A;  1F3B A;  1NHY A;  4WF4 A;  2VKZ G;  2JZT A;  3KH9 A;  4F0C A;  4PXO A;  1A8Y A;  3GSS A;  3VK9 A;  3WYW A;  2NVL A;  2VM2 A;  1JLW A;  1VF2 A;  4JED A;  2IMK A;  4BL7 B;  4QL9 A;  4CW9 A;  1X5C A;  4YKF A;  4MA9 A;  2B7K A;  2NTO A;  1Y1U A;  4BPY A;  3ZTL A;  2VAF A;  2FA4 A;  3EMX A;  1GSQ A;  1B8X A;  3IAS 2;  3GHA A;  2EIO A;  2MMO A;  3U6V A;  3TKS C;  2GLR A;  1FVK A;  5DCH A;  1F9M A;  3ZIJ A;  5CNW A;  3MIX A;  1UN2 A;  4N11 A;  1DUG A;  2QC7 A;  3TJK A;  4GTU A;  5KOX A;  2QGV A;  4HQS A;  2M46 A;  4K7N A;  4IW9 A;  2WZ9 A;  4HJM A;  4EL1 A;  19GS A;  1S3D A;  5DBQ A;  3I43 A;  2HRK A;  2ZUP A;  5CRH A;  1TXU A;  1SK2 A;  2FUG 2;  4JE1 A;  5ECN B;  2R0C A;  5H5S A;  1K3L A;  4LL4 B;  2IL3 A;  5D93 A;  1W89 A;  3TU3 B;  4IN0 A;  3TCO A;  2HI7 A;  2RM6 A;  3EWL A;  5GSS A;  1R7H A;  3HHV A;  2PVO C;  2BJX A;  5ECQ B;  1A0R P;  3HZ8 A;  2IFQ A;  3TKQ A;  4OFN A;  4I2U A;  1FB6 A;  3UVH A;  2WGR A;  2R0G A;  1NSW A;  3HCZ A;  2DMM A;  5A5H B;  5DAK A;  3N5O A;  2EC4 A;  2FD3 A;  1ST9 A;  2DBC A;  5BMU A;  1QGV A;  3US3 A;  4HJ2 A;  2C0E A;  3FZ4 A;  5GAN D;  2G2Q A;  2C80 A;  3O6T A;  3CBU A;  1Z9H A;  3L4N A;  1TI1 A;  4EXJ A;  3F8U A;  2ZNM A;  2NBS A;  4DSQ A;  2MYG A;  1GSF A;  4L5O A;  4Q5R A;  4I5Q A;  1WMJ A;  2K9F A;  4D73 A;  4F9Z A;  5HQP A;  1YF0 A;  4F82 A;  5ECR B;  3Q74 A;  1MD4 A;  3H4K A;  1DSB A;  1MEK A;  5ECS A;  3LYK A;  2AJQ B;  3EIN A;  3BOA A;  2V6K A;  1ZMA A;  4EIP A;  3VI5 A;  2M80 A;  4MAB A;  2DML A;  1BJX A;  4LL1 B;  5DVB A;  4IGJ A;  1XPV A;  2YWN A;  1SKW B;  5EL8 A;  4KF9 A;  2KUC A;  4TKY A;  3ME8 A;  4HQZ A;  2B6M A;  2RM5 A;  2H71 A;  4G2E A;  3GTU B;  2A4H A;  2HRF A;  2IIY A;  2H01 A;  1PN0 A;  3CXG A;  3G9B A;  3CMI A;  2H1L A;  1Z6N A;  3TJB A;  4ISD A;  4NPB A;  3WD6 A;  3QMX A;  1JFU A;  3GIX A;  1PX7 A;  2AAW A;  4ZL7 A;  2WCI A;  1U88 A;  4BWS A;  5ELA A;  1PRX A;  4DSR A;  2LEG A;  1FAA A;  4POB A;  1USB A;  5LNK e;  2RII A;  2WFC A;  4WBR D;  2HFD A;  5D8I A;  2CAQ A;  1A23 A;  1A2J A;  3VLN A;  1X5E A;  4YAP A;  5JWO B;  3E9J B;  4GWR A;  4Z2U A;  2FA8 A;  1GWC A;  4TVE A;  4Q5Q A;  4V1A g;  3NOF A;  3LXZ A;  4PGT A;  1FOH A;  4KCA A;  1X9M B;  5JWR B;  3A3T A;  2HNL A;  10GS A;  3HYP A;  3OR5 A;  1VGL A;  2V32 A;  1THO A;  1SEN A;  1V98 A;  3Q6O A;  7GSS A;  4Q5F A;  3C8E A;  4DEJ A;  5D9V A;  2HRK B;  2HSH A;  4CHS A;  5HFG A;  5DCG A;  3TKS E;  4OWY A;  2B5E A;  5IQY A;  2LUS A;  6GSS A;  3I69 A;  2KLX A;  1NM3 A;  4TXO A;  1OYJ A;  5LCZ A;  2MMA A;  2QKE A;  2C3N A;  4HZ4 A;  4EUY A;  3HA9 A;  5E59 A;  4CDO A;  3QD9 A;  2YWO A;  4TR0 A;  1GUM A;  2MZC A;  3L9S A;  1V58 A;  4JZQ A;  1G6Y A;  2H1A A;  3J7Y k;  2IN3 A;  5LD0 A;  3BCK A;  2WB9 A;  1ERU A;  1O81 A;  3GX0 A;  1B9Y C;  2PPT A;  1PD2 1;  3GH9 A;  5ECP B;  4G0L A;  1QUW A;  2UZ8 A;  3L0H A;  4NHW A;  5DQS A;  2GQK A;  2KP2 A;  2NPB A;  2RUE A;  4O7H A;  1GTU A;  4MJC A;  3ZFL A;  1GNE A;  2G0F A;  2IMI A;  2OE3 A;  2H1B A;  3VWW A;  4ULX A;  2YZU A;  1HNB A;  2VD1 A;  4KB3 A;  5CO3 A;  4HU7 A;  2OBK A;  2HQT A;  3WGD A;  4QL7 A;  2C8U A;  2VLU A;  1GLP A;  3UL3 A;  4N10 A;  1F3A A;  1SK1 A;  5AIV A;  1MDJ A;  22GS A;  3D22 A;  4WF5 A;  2YV9 A;  2VCX A;  1AQW A;  1SYR A;  3BBY A;  2H6Z A;  5D96 A;  3FKF A;  2DJJ A;  2VL2 C;  4AJ6 A;  3F4R A;  3KTL A;  5ECM B;  3HD5 A;  4MDC A;  5AIS A;  1WP0 A;  4BL7 A;  1YKA A;  3VPT A;  1LU4 A;  5J41 A;  3RPN A;  3ZRE A;  3M0F A;  2RUF A;  2IME A;  1A2L A;  1KTE A;  5AGY A;  4I8B A;  4X0X A;  1HD2 A;  1XZO A;  5A4V A;  4YQM A;  2F8F A;  4GSN A;  3DYR A;  3C1R A;  5KN0 A;  3UVT A;  4ZXG A;  2LTK A;  3HVX A;  3UMA A;  12GS A;  2GQM A;  3KXO A;  5A34 B;  1EP7 A;  3DGQ A;  1PN9 A;  1TRS A;  4L8E A;  4RI7 A;  2K8V A;  4MF5 A;  4MK3 A;  4WEY A;  1ZL9 A;  2O85 A;  3KMN A;  1VF3 A;  5G1K A;  1OKT A;  2I9H A;  5IO2 A;  4PQ1 A;  1ZYN A;  4NWY A;  1GUH A;  3G7Y A;  3MWH A;  4POL A;  3QAG A;  2JSY A;  2FWH A;  4I97 A;  2LV3 A;  4KH7 A;  4K9Z A;  1EZK A;  4N0V A;  1T8E B;  1M2A A;  3P90 A;  3UAR A;  1XW6 A;  2I3Y A;  4ECJ A;  2DKH A;  3DWV A;  3W8S A;  1R4W A;  3WT2 A;  5A5H A;  3APS A;  4EIQ A;  2BTO T;  5CRW A;  3H79 A;  5E4W A;  3EE2 A;  2GT5 A;  4ZL8 A;  2V41 A;  8GSS A;  3IK9 A;  2A2R A;  1Y6E A;  2XPE A;  3GYK A;  2R5G A;  2R0P A;  5DQY A;  4Z2R A;  1A24 A;  1QMV A;  4A5P A;  4ZBB A;  3FR3 A;  5B8B A;  5KN3 A;  2I81 A;  1QFN A;  4IEL A;  4PNF A;  1TI3 A;  3GKN A;  1B4Q A;  1YVL A;  1ZOF A;  3IXR A;  4ML1 A;  2GGT A;  3O76 A;  3ME7 A;  2DLX A;  3A5W A;  3RDW A;  2A2S A;  4MPF A;  3QCP A;  1EV9 A;  2O7K A;  4IJI A;  3RAZ A;  2CV4 A;  3IE3 A;  3F4T A;  5D9T A;  1M99 A;  4EVM A;  1EV4 A;  3GTU A;  2V1M A;  4KDY A;  5CRD A;  4K0N A;  2HRN A;  4V2L A;  4Z2T A;  3E3E A;  3KGK A;  4FYU A;  2L59 A;  2YJH A;  2TRX A;  4X4J A;  1B4P A;  5J47 A;  4JR6 A;  2XHF A;  3HDC A;  1XVW A;  1AQX A;  1N2A A;  5ECO B;  1SJI A;  3GL3 A;  5A5K A;  2F8A A;  1URM A;  1XOB A;  3MNG A;  3CYN A;  4KDX A;  4K2X A;  3KD0 A;  5HR1 A;  2GVP A;  2H0H A;  1JLV A;  4O92 A;  5DJM A;  1I5G A;  2LQQ A;  3ZMK A;  3IBH A;  2DSA A;  4EO3 A;  2GT6 A;  5IMA A;  4HDE A;  4AKX B;  4EKZ A;  2JSZ A;  1WJK A;  1F6M C;  13GS A;  4G9H A;  2LS5 A;  2X64 A;  5CAX A;  4MPG A;  2VL2 A;  3KP9 A;  4BVY B;  4GST A;  2H1G A;  5G31 A;  4EE0 A;  4ZBD A;  2FWE A;  4V1A p;  3GH6 A;  2LJA A;  4KX4 A;  3IOS A;  2O5V A;  1T4Z A;  1XWG A;  2O8V B;  3LW9 A;  5J4Y A;  4DSS B;  2CX3 A;  1ERT A;  1QK8 A;  4WET A;  3D5J A;  2FY6 A;  3APQ A;  3UOM A;  4YKG A;  2RLI A;  3M9J A;  3FZ9 A;  2B1K A;  2LNS A;  2X8C A;  1XBS A;  4IVF A;  2FWG A;  2P5R A;  1XOA A;  4NHZ A;  3LG6 A;  3QOU A;  1ABA A;  20GS A;  4GCI A;  2O87 A;  3GKM A;  4MJE A;  1U6T A;  2YZH A;  4TR4 A;  3F0I A;  2DKI A;  1QQ2 A;  1VF4 A;  3M8N A;  1JZD A;  4G0I A;  3CTF A;  2GDR A;  4J56 E;  4XS6 A;  4WKW A;  2N5F A;  2M72 A;  5HR2 A;  3QAW A;  3WGE A;  1TK5 B;  3M1G A;  3TRQ A;  3HXS A;  4BA7 A;  4ICY A;  2JZR A;  2OA7 A;  1ILO A;  3FR6 A;  1PSQ A;  2FGX A;  1AXD A;  1GLQ A;  4TXV A;  3UBL A;  1UA5 A;  4NXI A;  3V1W A;  4KE3 A;  1BQ7 A;  2TRC P;  3TDG A;  4IP1 A;  3LYP A;  3SBC A;  3LGC A;  1FVJ A;  4KW6 A;  5IPH A;  5AN1 A;  3NIV A;  3ZZX A;  2HXK A;  4ZB8 A;  2X8H A;  3ZML A;  3FZA A;  5J3R A;  3TJG A;  3P2A A;  4QMK A;  4TN8 A;  2VCW A;  2CVB A;  1SVL A;  3UIW A;  1IYI A;  3AY8 A;  1PL1 A;  14GS A;  3VFI A;  1E2Y A;  4PQI A;  4ML6 A;  4OFM A;  4O5R A;  5A1N A;  5GZZ B;  2H8L A;  2H76 A;  2QSI A;  1FB0 A;  1BG5 A;  4OCE A;  3P8W A;  2OAC A;  2OKA A;  3ZVJ A;  2B3S A;  4IP6 A;  1SD8 A;  2YOI A;  3UEM A;  3R2Q A;  4KDU A;  4IBP A;  2I4A A;  5JCW A;  2FCH A;  4KGI A;  3EMP A;  4LLR A;  1Z7R A;  3GUR A;  4KSO A;  3GST A;  1TOF A;  4GF0 A;  1YZX A;  2JL4 A;  2A4V A;  4PUA A;  5A34 A;  3EVI A;  4RI6 A;  3GX8 A;  3KEB A;  2AUV A;  2H30 A;  3KIJ A;  1TRV A;  1EGO A;  1V2A A;  2WS2 A;  4FIW A;  4HEA 2;  5IIZ A;  1OKD A;  6GSW A;  3F3R A;  1U3A A;  1OC9 B;  4MZW A;  1SU9 A;  1K0M A;  4PQH A;  5ABR A;  5G2Z A;  5ELG A;  1H4O A;  2H19 A;  2OE0 A;  1YQ1 A;  1FOV A;  1HNC A;  3KCM A;  2VLT A;  3DRN A;  4NV2 A;  4ZL9 A;  2VLV A;  4EDZ A;  1A8L A;  2GST A;  2E0Q A;  5IMZ A;  3TJF A;  3ZIV A;  6GST A;  2C4J A;  4KSM A;  4CY8 A;  1LBK A;  2DJK A;  1TTZ A;  2LRC A;  5F07 A;  3D21 A;  2EFE A;  3ZL5 A;  2KOK A;  1XWC A;  2ON7 A;  3PH9 A;  4MNN A;  4ACS A;  3TKS A;  4MMM A;  5INY A;  3CRT A;  1SL0 B;  3FR9 A;  4ECB A;  2K8S A;  3IPZ A;  5HFI A;  4BWQ A;  1HQO A;  2X8G A;  4OD7 A;  5F8B A;  2ES7 A;  1S3A A;  2PWJ A;  4F2I A;  3IHQ A;  1PMT A;  2VL9 A;  1XVQ A;  6GSU A;  2WRT A;  3IC8 A;  1N8J A;  3A2X A;  2OE1 A;  1AAZ A;  3Q19 A;  5EY6 A;  2HSN A;  3D4T A;  2CZ3 A;  2IWT A;  1K0C A;  3G7J A;  2XBI A;  3C1S A;  1MDK A;  1UVZ A;  2H74 A;  1OC3 A;  5F0G A;  1B48 A;  5D73 A;  4YQU A;  2MBT A;  1Z5Y E;  5B8A A;  2UV8 G;  1M0U A;  1K0A A;  3CRU A;  1GTI A;  3RBT A;  1ERW A;  3HZ4 A;  3PR8 A;  3PGT A;  2GQL A;  5J4V A;  2HE3 A;  4XIH A;  4K7I A;  3EPT A;  6GSV A;  2GSR A;  5EVO A;  4NMU A;  16GS A;  2D2Z A;  2GZZ A;  4OO4 A;  3H8Q A;  5JCG A;  4PNG A;  3W6G A;  1ZCP A;  3QFB C;  4ECC A;  5A1N B;  1G6W A;  3RHC A;  1BX9 A;  1TK0 B;  5DJL A;  2DJ2 A;  1I9D A;  1WOU A;  5G5F A;  4ZB9 A;  3ZIT A;  2IMF A;  4AKH A;  2GZY A;  4XS4 B;  3C73 A;  2FNO A;  1H75 A;  3RHB A;  4L5L A;  1SK0 A;  4YQV A;  1OE7 A;  2DJ3 A;  1PKW A;  3UJ1 A;  4IQA A;  2REM A;  5COH A;  3VUR A;  4WR5 A;  2GTU A;  4EC0 A;  3DVX A;  5ECH B;  1O73 A;  1Z3E A;  2R37 A;  3IC4 A;  2V6O A;  4IHU A;  3FYG A;  1TKD B;  3SWL A;  4FYC A;  3IDV A;  4PUF C;  1A2M A;  3APO A;  3F4S A;  3FK8 A;  3KH7 A;  5HR3 A;  3GL5 A;  1XWA A;  4BVY A;  3HY2 A;  1SVO A;  1Q4J A;  2CX4 A;  4XRD A;  1SKS B;  3PIN A;  5D9W A;  3MSZ A;  2A2P A;  2AV4 A;  3KTB A;  4NV5 A;  5J40 A;  4XHM A;  4W66 A;  5DDL A;  3ED3 A;  2C0D A;  3IV4 A;  4DSS A;  4POM A;  1EEJ A;  4ZB6 A;  4AJ7 A;  3QDN A;  3G7I A;  2C3T A;  1AIU A;  2F3M A;  2VO4 A;  1TU7 A;  5C04 A;  1GSU A;  2L5L A;  1VF1 A;  2VL3 A;  3BJ5 A;  1U87 A;  2P0G A;  1YF1 A;  1SYX A;  4MH2 A;  1X5D A;  1ZGN A;  2H0G A;  1RW1 A;  1K0O A;  5IOW A;  3KZQ A;  3CWG A;  2JU5 A;  4HS1 A;  1X9S B;  5KN2 A;  2YV7 A;  2FWF A;  2LRT A;  4X43 A;  4ZB7 A;  3HVV A;  3L9V A;  3H1N A;  3PPU A;  4HOJ A;  2DJ1 A;  3QPM A;  2E2M A;  2HYX A;  2N5A A;  3FMW A;  2H73 A;  2HT9 A;  1ZYP A;  1YJ6 A;  4MH3 A;  4IJ3 A;  2LST A;  4HUA A;  3F3Q A;  2HSN B;  3KM6 A;  4JR4 A;  2L4C A;  1ZYQ B;  2HRA A;  2PGT A;  4NAX A;  2EIQ A;  1C72 A;  3UBK A;  2NDO A;  2ON5 A;  3MAK A;  1XFL A;  4USS A;  1MTC A;  5HR0 A;  1O7U A;  2B7J A;  3GA4 A;  1SJZ A;  2FLS A;  2LQO A;  4GSS A;  5F05 A;  2H6X A;  1TW9 A;  3C71 A;  1FW1 A;  4MZB A;  3A2V A;  2L6D A;  1PX6 A;  2YWM A;  9GSS A;  1XWB A;  4E8E A;  2CA8 A;  3IK7 A;  3MYD A;  4TW5 A;  1FG4 A;  4FO5 A;  2IJY A;  4F03 A;  2JAD A;  5B7C A;  1F2E A;  5CRE A;  2MBS A;  1KEB A;  4EF0 A;  3GKX A;  5J9B A;  3TRP A;  1MDI A;  4ID0 A;  1BED A;  4G01 A;  1PQN A;  1G7O A;  3CSH A;  3A5I A;  2WDU A;  4IQ1 A;  1GP1 A;  4MJA A;  5ID2 B;  2VOC A;  5ECL B;  1GTB A;  3TOT A;  2KHP A;  4I6X A;  1CQH A;  1UC7 A;  4KAE A;  2CQ9 A;  3IAM 2;  2EFD A;  4BVX B;  1TU8 A;  3DD3 A;  3D4M A;  3DEX A;  4ZIL A;  1TRW A;  4TR1 B;  2MMN A;  1GSD A;  3I9V 2;  4XTS A;  4PTS A;  1SL2 B;  5G5E A;  3LOR A;  2VIM A;  4KND A;  5H5R A;  2DJ0 A;  1TRU A;  1OC9 A;  1EEM A;  1U3I A;  1K3Y A;  2PBJ A;  4ZIJ A;  5DAL B;  2OJL A;  2X99 A;  2N5B A;  1TXX A;  2QA2 A;  5F06 A;  4YAV A;  3QAV A;  1DE1 A;  3RPP A;  1T4Y A;  1N25 A;  2DIZ A;  2IPA A;  5FHI A;  4AKG A;  3ERW A;  1R26 A;  4K1F A;  5G1L A;  2CVK A;  1SL1 B;  4WBJ A;  1GSE A;  5A4W A;  5BRT A;  2FHE A;  3O3T A;  2R6K A;  1GSS A;  2X49 A;  3GNJ A;  4RUV A;  4H86 A;  2P31 A;  1JZR A;  1XW5 A;  6GSY A;  3FHK A;  3ERG A;  4JRR A;  3WT1 A;  4FQU A;  2I1U A;  3FZ5 A;  5IMV A;  3LWA A;  5HFK A;  1XCC A;  1PL2 A;  2GZP A;  1R5P A;  1V57 A;  2B1L A;  3KP8 A;  3HKR A;  1M7T A;  1Z7P A;  1M9B A;  4K5S A;  3HVS A;  2HZE B;  1BG1 A;  4LMW A;  3CTG A;  2HSM B;  18GS A;  2R2J A;  3IR4 A;  1BAY A;  4GXZ A;  1T3B A;  3BD2 A;  2XBQ A;  3QFA C;  4OO5 A;  3VWX A;  2HSY A;  1KBN A;  1TP9 A;  5J5N A;  2H70 A;  3NZN A;  3R3E A;  4K5R A;  2PMT A;  1J08 A;  2YWI A;  1YDK A;  4XS4 A;  3LQ7 A;  3C7M A;  5L71 A;  2DC5 A;  2K6V A;  4WXT A;  1CQG A;  3FEU A;  3EU4 A;  4Q5N A;  1AC1 A;  3TGZ A;  2EIR A;  2J23 A;  2AHE A;  2EFC A;  2PN8 A;  1GUL A;  4AGS A;  2B5Y A;  4K7O A;  1TK8 B;  1AQV A;  3GMF A;  2ZCT A;  17GS A;  2L57 A;  1ML6 A;  2J9H A;  3VPQ A;  4N30 A;  1YY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...