3BBYA

Crystal structure of glutathione s-transferase (np_416804.1) from escherichia coli k12 at 1.85 a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
209
structure length
191
Chain Sequence
KPAITLWSDAHFFSPYVLSAWVALQEKGLSFHIKTIDRVPLLQIDDFELSESSAIAEYLEDRFAPPTWERIYPLDLENRARARQIQAWLRSDLMPIREERPTDVVFAGAKKAPLTAEGKASAEKLFAMAEHLLVLGQPNLFGEWCIADTDLALMINRLVLHGDEVPERLVDYATFQWQRASVQRFIALSAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized GST-like protein yfcF
publication title Crystal structure of glutathione S-transferase (NP_416804.1) from Escherichia coli K12 at 1.85 A resolution
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 65
structure length 191
sequence length 209
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2007-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14834 GST_C_4 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3bbyA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3bbyA01
3UVHA 1V9WA 3SBCA 4BL7B 3LXZA 4V2LA 1S3DA 2LRTA 1MD4A 4KDYA 1ZL9A 4YQMA 5IPGA 2FWHA 5AN1A 4I5QA 4OD7A 2DJ3A 2CZ2A 5ECHB 4HU7A 3ZMLA 3IR4A 4DSQA 3HJOA 1XVQA 1I5GA 3UBKA 4GWRA 2HRKA 4EVMA 3D0ZA 1UN2A 1DE1A 2YJ7A 2D2ZA 1CQHA 1YDKA 3QCPA 3LWAA 2VL2A 3AY8A 4P3YB 2VL2C 2WCIA 2E2MA 4AF2A 1YEPA 4KX4A 4PUFC 4HUAA 3LYKA 2WULA 3EC3A 1HNAA 1UC7A 1YF0A 3ME7A 2ZCTA 5DJLA 3FZ4A 5CAXA 2C0GA 2YJHA 2ON7A 1O8WA 3UJ1A 2H76A 1HNCA 1QUWA 4GRFA 5L71A 5IQYA 2A4VA 2M80A 4OO5A 1TK8B 3BCIA 4GLTA 4XS1A 3PGTA 2PBJA 2AJQB 5F8BA 1K0AA 4JU5A 3MWHA 4TR1B 1K0NA 3FW2A 1IYIA 2H0IA 4I8BA 3A3TA 1O81A 4HI7A 3EURA 1EP8A 5GAND 3G7IA 1GUHA 1Z5YE 2C1YA 1B9YC 4YAPA 4TR4A 1ST9A 3IK7A 3HD5A 1BG5A 2K18A 1U6TA 2O8VB 2B6MA 3EU3A 5J9BA 3R3EA 1R7HA 1M0UA 1ZYQB 4V1Ag 2BJXA 3IV4A 3LG6A 5EL8A 2H6YA 2DMLA 3CSHA 3KD0A 3J7Yk 3H4KA 2LNSA 3MAKA 1GSUA 3N9JA 4K8MA 1HQOA 1JZWA 4K7OA 3NOFA 1A2MA 20GSA 3H1NA 1A0RP 5ECLB 2VLUA 1XWAA 1PL2A 3IPZA 3WGDA 2LV3A 5D9VA 4EO3A 3OR5A 4HQSA 2C0FA 1FVJA 4HEA2 4O32A 2VLVA 3F4RA 2LS5A 18GSA 4PQ1A 3GYKA 1ERUA 4G2EA 1V2AA 4PTSA 5HR0A 3HVSA 5F0GA 4POKA 2VCXA 4RQRA 2LJKA 1V40A 2JSZA 4K0NA 4WXTA 1U3AA 1T3BA 2X8HA 4PNFA 1K3OA 2WJUA 4CW9A 2H75A 4GQFA 4FYUA 4XHMA 1FG4A 7GSSA 1O7UA 5CO3A 5IMDA 5G2ZA 4TN8A 2GTUA 3BCKA 2L6CA 2C80A 2O87A 2C8UA 4CHSA 2P5RA 1PA3A 3Q18A 2YOIA 2VCVA 5DBQA 4XS4B 1TK5B 1M99A 2PVQA 3GN3A 4TW5A 2MMAA 1F37A 4N30A 4J57E 5HFIA 3G7JA 4MABA 3HDCA 1GRXA 3D6IA 2XPEA 2LUSA 3KGKA 1BJXA 1MD3A 2V1MA 4HZ2A 1O85A 1YF1A 5COHA 3LYPA 4TXVA 1GP1A 2FY6A 4HQZA 4MP4A 3D4TA 4F0BA 3ERWA 5J9CA 5ECNB 3LJRA 3M3MA 5BMUA 4MMMA 2GVPA 2I1UA 2HXKA 3I69A 1H4OA 5DCGA 2GZYA 3GUSA 1FOVA 1K0OA 2HSHA 1PL1A 2H70A 3D4MA 2GQMA 1GTAA 1KNGA 2IL3A 5ENUA 2WDUA 4JR4A 2R37A 2FNOA 5DAKB 2O85A 5ECOB 1X5EA 14GSA 1GWCA 1R26A 1QGVA 3MNGA 2GSTA 1NSWA 2LQQA 5IO0A 3IXRA 1XVWA 2TRXA 2ON5A 4KF9A 3LGCA 5J5NA 2M46A 2F3MA 4OCFA 3UIWA 22GSA 3P7XA 4BVYB 2L59A 5AIVA 1DSBA 1SL0B 3F8UA 4JE1A 1OKTA 1SK1A 2I81A 2M72A 3H8QA 3QDNA 5AISA 3W6GA 1HNBA 4EF0A 2PVOC 1DE2A 3W8SA 2YN1A 1T00A 4FO5A 1MDJA 4J2FA 3ERGA 1B4QA 1AQXA 2P0GA 5DALB 2KP2A 2V2GA 1OVNA 2HI7A 4POLA 5B8AA 3ZREA 3QAVA 6GSVA 5DQYA 4IELA 1KTEA 2NBSA 5AIXA 2BMXA 3APOA 3TJFA 9GSSA 3IBHA 4WR4A 2H1AA 4H86A 4X0XA 5H5RA 3TJJA 5F05A 4BPYA 2OE0A 3A5WA 3FEUA 5ABRA 2JSYA 3FZ5A 4F03A 1GTUA 5DCHA 2RUFA 1QQ2A 4MDCA 2DC5A 3HJMA 4WF5A 2VLTA 1VF4A 5JCWA 4ECIA 2H1DA 3CRUA 4BVXB 3F63A 2H6ZA 2V32A 4PNGA 3KTLA 3WT1A 1K0DA 3GSSA 2JADA 1GL8A 4IQ1A 2DJ2A 1TXXA 3VWXA 2UZ8A 3H79A 4K7IA 4TXOB 4ZB8A 2XPDA 3FR3A 1J08A 3C73A 3TKQA 5IM9A 4MCUA 3DIEA 4LMWA 3G7YA 2ZNMA 1F9MA 1CQGA 2PWJA 3TKSE 5DAKA 5LNKe 1PQNA 1WRYA 1E2YA 2HZEA 4XS6A 3UBLA 4Q5NA 4L8EA 4JRRA 4IJIA 3DKSA 2I3YA 1RK4A 1TRSA 3LFLA 1EV4A 3GTUB 4IVFA 3VI7A 1J9BA 2ES7A 11GSA 3VLNA 3KXOA 1G7EA 4ML1A 4ZL8A 4TRXA 1TW9A 2TRCP 3S9FA 2IPAA 2HZFA 1VF3A 2V6KA 5HR3A 4WETA 4IKHA 2CVKA 2CZ3A 4K0GA 2YP6A 2B7JA 2H72A 2JZTA 4ACSA 1Y6EA 1SYXA 4FH8A 4MJCA 3IDVA 3ED3A 4QL7A 2H0HA 3PPUA 5FHIA 1RW1A 6GSYA 4YQUA 4LL4B 1GSQA 5ECSA 1PX7A 5CRWA 2FD3A 3GIXA 4TR0A 1B9XC 2PN8A 1G7OA 1VF2A 3GKXA 1BEDA 1W4VA 4OMVA 4MJEA 5KN2A 3CTGA 3HYPA 4GSNA 1PD21 2H19A 1XCCA 2X8CA 2XHFA 3IRAA 3LXTA 2RUEA 5D9WA 2O89A 3HZ8A 3KMOA 3EU4A 1XOAA 1M7TA 1XPVA 4KNDA 2R4VA 1X5CA 4HDEA 1JFUA 3IHQA 4HJ2A 3QR6A 3E0UA 4KA0A 1GTBA 4EL1A 4D73B 2X8GA 2LRNA 1TI3A 2C0DA 3M9KA 5ELAA 3ZVJD 1E6BA 5C00A 2JU5A 5JWQB 2PPTA 4ZBAA 1A23A 4MZWA 3UEMA 3DVWA 4X43A 2FA8A 1GNEA 1W89A 1PMTA 3L9SA 4OFMA 1YEXA 5CNWA 5ID2B 1A8YA 1SD8A 4BWQA 1K3LA 5KN0A 4E8HA 3FHKA 4K9ZA 3FZ9A 5ECIB 1XW6A 1THOA 1OC8A 2NDOA 4YAVA 2QGVA 4G10A 3UARA 3FZAA 5JWOB 4MJAA 3GV1A 3ZIJA 1R5AA 3GRXA 1PX6A 3HVVA 1YKAA 3CYNA 1AIUA 3CBUA 1EZKA 2H8LA 5IMFA 5ECKB 1SYRA 2AV4A 2VOCA 1XWGA 2IMIA 1V58A 1UA5A 1FW1A 3HZ4A 4NV5A 2DSAA 1I9DA 2C4JA 2HE3A 2HRNA 3G9BA 2GSQA 2R2JA 2HRFA 5B7CA 1AW9A 3ERFA 1PKZA 4N0VA 1KBNA 3A2WA 2F8AA 1J0FA 2NPBA 1OE7A 3APQA 4IBPA 1TTZA 5LD0A 4MZCA 2FGXA 2HFDA 2B5EA 2L4QA 1GSYA 4ZB9A 3DGQA 4XRDA 3IC8A 2WRTA 2YWMA 1M2BA 4BL7A 5HFKA 2FWEA 3VPQA 3O6TA 1K0MA 4Q5RA 4YQVA 1OKDA 4IP6A 3APSA 1S3CA 2MYGA 4G0KA 3GURA 1EGOA 2A2SA 3CSJA 1ERVA 1XW9A 3LSZA 2GZPA 2H74A 4RI6A 1M2AA 4N0ZA 1OE8A 5ECPB 3M9JA 3RAZA 1A2LA 3KH9A 4JBBA 1X9MB 2AB6A 2CX4A 3TKRA 5J4UA 1PN9A 1FHEA 2C3QA 4KCAA 3TKSA 3WGXA 4ZBBA 4ZIJA 2N5FA 2IMDA 1SL2B 1X0RA 1XBSA 4GSTA 2VL9A 5CREA 3VWWA 2G2QA 1QXHA 5A4VA 3J7Yb 1AXDA 1C72A 3C7MA 3KM6A 3V1WA 2EC4A 2YV9A 2WFCA 3TGZA 2VCQA 3TB2A 4BWSA 4TR1A 3LQ7A 4RQXA 2PMTA 2LTKA 1V57A 4ISDA 4KDUA 4EC0A 3I43A 4PXOA 3KP9A 5DDLA 1R5PA 2C3TA 1TI1A 1QK8A 1ERTA 3VPTA 2YPMA 2XBQA 3GH9A 3EMXA 3Q74A 4L5LA 4KUNA 3UMAA 6GSUA 1TRVA 3GH6A 4NHZA 2AYTA 3TUEA 3C1SA 2B1KA 4MPGA 3UOMA 4PUAA 3IE3A 1ZOFA 4WR5A 3WGEA 4ECBA 4IHUA 2EIOA 2YCDA 4PQIA 1HYUA 2X64A 1ILOA 2L57A 1SENA 1AQVA 4CDOA 4KAEA 2QSIA 1TU8A 3E3EA 2DIYA 2XBIA 2KP1A 1M9AA 2E7PA 2GSSA 1SJZA 3WT2A 4PQHA 2WZ9A 2VM1A 1BAYA 3HKRA 4LLRA 3PR8A 1SKSB 1B4PA 3RPNA 2YV7A 5E4WA 1GSSA 1Z3EA 3HHVA 1OC3A 3O3TA 1A0FA 1UVZA 5DQSA 4E8EA 2IFQB 3BBYA 4ML6A 1AQWA 5G1KA 3FRCA 1XIYA 3L0HA 3Q19A 2YZUA 4IGJA 4IN0A 1ACVA 1MEKA 2FWGA 4I2UA 5G1LA 2CVBA 3KTBA 4G0IA 1BYEA 2MMOA 4V2NA 4N11A 1EV9A 2VD0A 3C1RA 3ME8A 3Q6OA 1ZMAA 3A2VA 4L0UA 5INYA 4MJBA 4ZL7A 19GSA 2MBSA 3NZNA 1T4YA 4ZXGA 2B3SA 4GXZA 2GT5A 1EOGA 3F4TA 2JZRA 2N5BA 3IOSA 5KEJA 1TP9A 3CTFA 4NAXA 2VM2A 2I4AA 5IMAA 4IQAA 5KN3A 1FO5A 3KEBA 1TDIA 1Q98A 2AAWA 2CQ9A 5AGYA 4XS4A 4IP1A 2GQKA 2L5LA 2K8SA 1MTCA 2LNTA 2PERA 3TOUA 1NW2A 4I97A 4GSSA 3FY7A 3DD3A 2I9HA 3A2XA 3VWVA 2K8VA 1X9WB 3GA4A 1F2EA 5F06A 2OJLA 4KSOA 3GX0A 3BOAA 4K6XA 1RQMA 3ZZXA 3SWLA 3GX8A 3FKFA 5GSSA 1ZGNA 5GSTA 3GFKA 2HYXA 3ZL5A 4L0WA 1O8XA 1NHYA 1LJRA 1X9SB 3D5JA 1LBKA 4NPBA 4LL1B 4KW6A 5D9TA 1U88A 2O7KA 1WMJA 2V6OA 3DWVA 4WF4A 3I9V2 3GKNA 1EP7A 1VRSD 1OC9B 1SU9A 2HRAA 3ZITA 3F3RA 3US3A 2NVLA 1GTIA 3TOTA 4AJ6A 3EWLA 4BA7A 4MLYA 4BVYA 4EE0A 4XCSA 2MMZA 4F2IA 4OWYA 2OA7A 2REMA 5G30A 1KEBA 3TCOA 4FQUA 4MF7A 2J23A 5A4UA 3IC4A 4QQ7A 3H93A 5JCUA 2B7KA 4DEJA 1AAZA 4MPFA 4DSSB 3N5OA 5G5FA 2PUKC 2VO4A 5DALA 4NXIA 2JACA 1G6YA 2RIIA 1ZYEA 3QFAC 4AGSA 5HR2A 1Q4JA 2LJAA 4KSMA 5GAPD 5D73A 3KJYA 1T8EB 2R6KA 4Q5FA 3RPPA 3M8NA 1SKWB 1THXA 1TJDA 3QD9A 2J9HA 4F0CA 2WB9A 4TKYA 1ML6A 1XZOA 1XOBA 2GDRA 1T7PB 4HJMA 2VD1A 4K7NA 5DJMA 1N2AA 4USSA 1V98A 4KE3A 3WYWA 3ZFBA 5IOWA 1JLVA 5H5QA 3DMLA 4KB3A 3NIVA 3FR6A 4BVXA 4POMA 4EDZA 2A2RA 1FB0A 1R4WA 1JZOA 5ECRB 3TJBA 4MF6A 3VURA 2VAFA 4GTUA 4TXOA 1XFLA 4LA1A 4KDXA 5ECQB 2XC2A 5J41A 4TVEA 5CRDA 3WD6A 1JZDA 2LKUA 4OO4A 4DSRA 4L5OA 2HT9A 3QFBC 3M0FA 2NTOA 4NWYA 2GLRA 1EWXA 1G0TA 4EXJA 5D93A 1SL1B 6GSTA 5EPFA 1OC9A 5CRHA 2ZUPA 4MH2A 2CAIA 5B6NA 1Y25A 3HCZA 2IN3A 1PRXA 2DIZA 1AC1A 3L9VA 3FYGA 2YANA 4ECCA 2FLSA 3GNJA 2CAQA 4I2TA 2IMFA 3EINA 4F9ZA 3GTUA 1EOHA 2F9SA 2DBCA 2IJYA 3QAGA 1HD2A 2YWOA 2QC7A 4HS1A 1WOUA 1A8LA 1A2JA 2OADA 1WE0A 2HSMB 4AJ7A 1XXUA 2E2GA 2OE3A 5E59A 2OBKA 1QFNA 3FR9A 4DSSA 4YH2A 3IAM2 3P90A 2RLIA 2EIQA 2LJRA 4FYBA 3ZYWA 4PGTA 2GS3A 2KLXA 2YWNA 3IA1A 3HXSA 3GHAA 1G6WA 3TDGA 4JR6A 1GNWA 4O92A 3MDKA 3FK8A 1GULA 4OCEA 1DBYA 1TU7A 3CRTA 3BJ5A 4ID0A 3DYRA 2OBIA 4NV2A 1Z7RA 2WGRA 2LRCA 4GF0A 1Z6MA 4K2DA 2FUG2 3EVIA 1ON4A 1FB6A 1EEJA 4V2MA 1S3AA 2PU9C 2MMNA 1K3YA 5IOXA 4ZBDA 4KCEA 1F6MC 2B5XA 1N8JA 3DVXA 2R5GA 3HVXA 4D73A 1FVKA 1TK0B 4QL9A 4TR3A 1BX9A 2CT6A 3MSZA 5G31A 2CVDA 1WJKA 2FWFA 2VUPA 2HNLA 1JLWA 3U6VA 4G9HA 2H1GA 2C0EA 4XRAA 3ZTLA 3TKSC 16GSA 5HFGA 4MH3A 2L5OA 1TRWA 2K9FA 3VWUA 1GSFA 1GUKA 1NHOA 2L4CA 2DMMA 5ID2A 3TJGA 3TRXA 4EUYA 5B6MA 4WKWA 4DVCA 4MZBA 1OAZA 2RM5A 5GZZB 3ZIVA 2VCWA 2EIRA 5EVOA 3R2QA 2KUCA 2LQOA 1A24A 2X99A 4GCIA 1DUGA 2R3XA 4EKZA 3D22A 4MK3A 1YZXA 2YWIA 3KCMA 3TRPA 2B5YA 4ZB6A 1SK2A 1O73A 3L9UA 1YQ1A 8GSSA 1JZRA 4ULXA 1ABAA 1M2DA 1Z7PA 5F07A 1M9BA 10GSA 3KZQA 4ECJA 4G0LA 4O5RA 3TJKA 3U5RE 5J3RA 2OACA 3GL3A 2H6XA 2KHPA 1U87A 2HSMA 3LORA 5H5SA 3F6DA 1ERWA 3P8WA 2E0QA 4V1Ap 1TRUA 2N5AA 2DJJA 4KGIA 2GQLA 3E9JB 1SKRB 1K0CA 1B8XA 2MZCA 5IMZA 2HLSA 1TOFA 2H30A 2L6DA 3DXBA 2HQTA 1X5DA 3EYTA 4MA9A 2G0FA 1SK0A 3QMXA 2PGTA 1GSDA 3RHBA 6GSXA 2KOKA 2YZHA 1ZZYA 4HOJA 4Q5QA 1ZCPA 5CYYA 1QMVA 3F6FA 2WS2A 1Z9HA 2VL3A 4O7HA 5JCGA 12GSA 5G5EA 2HSNB 3CMIA 3UAPA 2GSRA 4GQCA 2H0GA 5IMCA 4KH7A 2VIMA 2YNXA 3VI5A 3VK9A 3EE2A 2F51A 4F82A 4WEYA 1GSEA 4XTSA 5LCZA 3L4NA 4G19A 2HZEB 3HJPA 1Z6NA 4N10A 1YY7A 1LU4A 1USBA 1XWBA 2FHEA 3GKKA 3QPMA 3QAWA 4ZILA 1WPIA 5IIZA 4PX1A 4WBRD 5D8IA 2RM6A 1EEMA 4XIHA 2GZZA 13GSA 2CV4A 2MBTA 2IWTA 6GSWA 2P31A 4IS0A 2P5QA 5B8BA 1PGTA 5A4WA 1F3BA 3KMNA 2FA4A 4K1FA 3RBTA 3O76A 1F3AA 3RHCA 3HY2A 2DJ0A 3L78A 2OKAA 3EMPA 5CRGA 6GSSA 4PURA 4OFTA 3QOUA 1GLPA 1WP0A 5HR1A 2IIYA 3KH7A 1PKWA 5FT3A 1GLQA 3F4SA 2C3NA 3P2AA 3UL3A 2AHEA 3ZFLA 1OYJA 4EDYA 2QKEA 3K8NA 2VCZA 3F3QA 3IK9A 3HA9A 3BD2A 4X1UA 4IJ3A 3DRNA 1SJ6A 5C04A 4HU9A 1WWJA 2ALBA 4FIWA 4JZQA 4LMVA 1SD9A 4AJ8A 1NM3A 4Z7XA 2DJ1A 2CX3A 5ELGA 3F0IA 4RI7A 1H75A 2DJKA 2Z9SA 5A5KA 5IO2A 3RDWA 2CA8A 2TIRA 1K0BA 3ZRDA 2H66A 2LEGA 4FYCA 2HRKB 3CSIA 2FCHA 2OE1A 4ZL9A 3C71A 2GT6A 3IAS2 3W8JA 5HQPA 5DVBA 4I6XA 1XWCA 1AUCA 3UVTA 3I6AA 1JHBA 4NMUA 5KN1A 2B1LA 4JEDA 3TRQA 3C8EA 1XWKA 4RUVA 1T4ZA 3GKMA 5IMVA 2JZSA 2H01A 1PSQA 3GMFA 2LSTA 3GL5A 4NHWA 3ZLPA 1GH2A 3PINA 2IFQA 2F8FA 2H71A 4TOPA 4WBJA 2GGTA 1IYHA 5CP1A 5D9XA 3CXGA 1VF1A 1URMA 5ECMB 5FWGA 1T1VA 17GSA 1MDKA 2VCTA 5D96A 3ZVJA 5JWRB 2H73A 4ILFA 1B48A 1BQ7A 2AUVA 4MF5A 1TKDB 4POBA 1YKCA 4IW9A 4HZ4A 3LEFA 3VFIA 2IMEA 1SJIA 3DEXA 2HSYA 1O6JA 1VGLA 2BTOT 2DLXA 5IPHA 1EGRA 3JCML 2K6VA 1FAAA 3PH9A 2IMKA 1MDIA 3F9UA 1XW5A 1YJ6A 2V41A 2JL4A 3D21A 4OFNA 3TKPA 4J56E 3KP8A 1GUMA 1WIKA 3KIJA 3M1GA 3ISOA 2H1BA 1U3IA 5EY6A 3ZMKA 3GSTA
chains in the Genus database with same CATH superfamily
3UVHA 1V9WA 3SBCA 4BL7B 5KOWA 3LXZA 4V2LA 1S3DA 2LRTA 1MD4A 4KDYA 1ZL9A 4YQMA 5IPGA 2FWHA 5AN1A 4I5QA 4OD7A 2DJ3A 2CZ2A 2WW2A 5ECHB 4HU7A 3ZMLA 3IR4A 4DSQA 3HJOA 1XVQA 1I5GA 3UBKA 4GWRA 2HRKA 4EVMA 3D0ZA 1UN2A 1DE1A 2YJ7A 2D2ZA 2WVXA 1CQHA 1YDKA 4QMKA 3QCPA 3LWAA 2VL2A 3AY8A 4P3YB 2VL2C 2UV8G 2WCIA 2EFEA 2E2MA 4AF2A 1YEPA 4KX4A 4PUFC 4HUAA 3LYKA 2WULA 3EC3A 1HNAA 1UC7A 1YF0A 3ME7A 2ZCTA 5DJLA 3FZ4A 5CAXA 2C0GA 2YJHA 2ON7A 1O8WA 3UJ1A 2H76A 1HNCA 1QUWA 4GRFA 5L71A 4EIPA 5IQYA 2A4VA 2M80A 4OO5A 1TK8B 3BCIA 4GLTA 4XS1A 3PGTA 2O5VA 2PBJA 2AJQB 5F8BA 1K0AA 4JU5A 3MWHA 4TR1B 1K0NA 3FW2A 1IYIA 2H0IA 4I8BA 3A3TA 1O81A 4HI7A 3EURA 1EP8A 5GAND 3G7IA 1GUHA 2OT3A 1Z5YE 2C1YA 4G01A 1B9YC 4YAPA 4TR4A 1ST9A 3IK7A 3HD5A 1BG5A 2K18A 1U6TA 2O8VB 2B6MA 3EU3A 5J9BA 2WW0A 3R3EA 1R7HA 1M0UA 4E68A 1ZYQB 4V1Ag 1BG1A 2BJXA 3IV4A 3LG6A 5EL8A 5A34A 2H6YA 2DMLA 3HMJG 3CSHA 3KD0A 3J7Yk 3H4KA 5A1NB 2LNSA 3MAKA 1GSUA 3N9JA 4K8MA 1HQOA 1JZWA 4K7OA 3NOFA 1A2MA 20GSA 3H1NA 2WZSA 1A0RP 5ECLB 2VLUA 1XWAA 1PL2A 3IPZA 3WGDA 2LV3A 5D9VA 4EO3A 3OR5A 4HQSA 2C0FA 1FVJA 4HEA2 4O32A 2VLVA 3F4RA 2LS5A 18GSA 4PQ1A 3GYKA 1ERUA 4G2EA 1V2AA 4PTSA 5HR0A 3HVSA 5F0GA 4POKA 2VCXA 4RQRA 2LJKA 1V40A 2JSZA 3RFRC 4K0NA 4WXTA 1U3AA 1T3BA 2X8HA 4PNFA 1K3OA 2WJUA 4CW9A 2H75A 4GQFA 4FYUA 4XHMA 1FG4A 7GSSA 1O7UA 5CO3A 5IMDA 5G2ZA 4TN8A 2GTUA 2O36A 5J4VA 3A5IA 3BCKA 2L6CA 2C80A 2O87A 2C8UA 5J4YA 4CHSA 5J40A 2P5RA 1PA3A 3Q18A 2YOIA 2VCVA 5DBQA 2X49A 1SVMA 4XS4B 1TK5B 1M99A 2PVQA 3GN3A 4TW5A 2MMAA 1F37A 4N30A 4J57E 5HFIA 3G7JA 4MABA 3HDCA 1GRXA 3D6IA 2XPEA 2LUSA 3KGKA 1BJXA 1MD3A 2V1MA 4HZ2A 1O85A 1YF1A 5COHA 3LYPA 4TXVA 1GP1A 2FY6A 4HQZA 4MP4A 3D4TA 4F0BA 3ERWA 5J9CA 5ECNB 3LJRA 3M3MA 5BMUA 4MMMA 2GVPA 2I1UA 2HXKA 3I69A 1H4OA 5DCGA 2GZYA 3CWGA 3GUSA 1FOVA 1K0OA 2HSHA 1PL1A 2H70A 3D4MA 2GQMA 1GTAA 1KNGA 2IL3A 1SVOA 5ENUA 2WDUA 2X4AA 4JR4A 2R37A 2FNOA 5DAKB 2O85A 5ECOB 1X5EA 14GSA 1GWCA 1R26A 1QGVA 3MNGA 2GSTA 1NSWA 2LQQA 5IO0A 3IXRA 1XVWA 2TRXA 2ON5A 4KF9A 3LGCA 5J5NA 2M46A 2F3MA 4OCFA 3UIWA 22GSA 3P7XA 4BVYB 2L59A 5AIVA 1DSBA 1SL0B 3F8UA 4JE1A 1OKTA 1SK1A 2I81A 1PN0A 2M72A 3H8QA 3QDNA 5AISA 3W6GA 1HNBA 4EF0A 2PVOC 1DE2A 2VKZG 2EFCA 3W8SA 2YN1A 1T00A 4FO5A 1MDJA 4J2FA 3ERGA 1B4QA 1AQXA 2P0GA 5DALB 2KP2A 2V2GA 1OVNA 2HI7A 4POLA 1I1IP 5B8AA 3ZREA 3QAVA 6GSVA 5DQYA 4IELA 1KTEA 2NBSA 4YKFA 5AIXA 2BMXA 3APOA 3TJFA 9GSSA 3IBHA 4WR4A 2H1AA 4H86A 4X0XA 5H5RA 3TJJA 5F05A 4BPYA 2OE0A 3A5WA 3FEUA 5ABRA 2JSYA 3FZ5A 2O3EA 4F03A 1GTUA 5DCHA 2RUFA 1QQ2A 4MDCA 2DC5A 3HJMA 4WF5A 2VLTA 1VF4A 5JCWA 4ECIA 2H1DA 3CRUA 4BVXB 3F63A 2H6ZA 2V32A 4PNGA 3KTLA 3WT1A 1K0DA 3GSSA 2WW1A 2JADA 1GL8A 4IQ1A 2DJ2A 1TXXA 3VWXA 2UZ8A 3H79A 4K7IA 4TXOB 4ZB8A 2XPDA 3FR3A 1J08A 3C73A 3MIXA 3TKQA 5IM9A 4MCUA 3DIEA 2HSNA 4LMWA 1ZYPA 3G7YA 2ZNMA 1F9MA 1CQGA 2PWJA 3TKSE 5DAKA 5LNKe 1PQNA 1WRYA 4YKGA 1E2YA 2HZEA 4XS6A 3UBLA 4Q5NA 4L8EA 4JRRA 4IJIA 3DKSA 2I3YA 1RK4A 1TRSA 3LFLA 1EV4A 3GTUB 4IVFA 3VI7A 1J9BA 2ES7A 11GSA 3VLNA 3KXOA 1G7EA 4ML1A 4ZL8A 1ZYNA 4TRXA 1TW9A 2TRCP 3S9FA 2IPAA 2HZFA 1VF3A 2V6KA 4EIQA 5HR3A 4WETA 4IKHA 2CVKA 2CZ3A 4K0GA 2YP6A 2B7JA 2H72A 2JZTA 4ACSA 2QA2A 1Y6EA 1SYXA 4FH8A 1SVLA 4MJCA 3IDVA 3ED3A 4QL7A 2H0HA 3PPUA 5FHIA 1RW1A 6GSYA 4YQUA 4LL4B 1GSQA 5ECSA 1PX7A 5CRWA 2FD3A 3GIXA 4TR0A 1B9XC 2PN8A 1G7OA 1VF2A 3GKXA 1BEDA 1W4VA 4OMVA 4MJEA 5KN2A 3CTGA 3HYPA 4GSNA 1PD21 2H19A 1XCCA 2X8CA 2XHFA 3IRAA 3LXTA 2RUEA 5D9WA 3HZ8A 2O89A 3KMOA 3EU4A 2QA1A 1XOAA 1XPVA 1M7TA 4KNDA 2R4VA 1X5CA 4HDEA 1JFUA 3IHQA 4HJ2A 3QR6A 3E0UA 4KA0A 1GTBA 4EL1A 4D73B 2X8GA 2LRNA 1TI3A 2C0DA 3M9KA 5ELAA 3ZVJD 2EFHA 1E6BA 5C00A 2JU5A 5JWQB 2PPTA 4ZBAA 1A23A 4MZWA 3UEMA 3DVWA 4X43A 2FA8A 1GNEA 1W89A 1PMTA 3L9SA 4OFMA 1YEXA 5CNWA 5ID2B 1A8YA 1SD8A 4BWQA 1K3LA 5KN0A 4E8HA 3FHKA 4K9ZA 3FZ9A 5ECIB 1XW6A 1THOA 1OC8A 2NDOA 4YAVA 2QGVA 4G10A 3UARA 3FZAA 5JWOB 4MJAA 3GV1A 3ZIJA 1R5AA 3GRXA 1PX6A 3HVVA 1YKAA 2WVZA 3CYNA 1AIUA 3CBUA 1EZKA 2H8LA 5IMFA 5ECKB 1SYRA 2AV4A 2VOCA 1XWGA 2IMIA 1V58A 1UA5A 1FW1A 3HZ4A 4NV5A 1FOHA 2DSAA 1I9DA 2C4JA 2HE3A 2HRNA 3G9BA 2GSQA 1S3RA 2R2JA 4Z2TA 2HRFA 5B7CA 1AW9A 3ERFA 1PKZA 4N0VA 1KBNA 3A2WA 2F8AA 1J0FA 2NPBA 1OE7A 3APQA 4IBPA 1TTZA 5LD0A 4MZCA 2FGXA 2HFDA 2B5EA 2L4QA 1GSYA 4ZB9A 3DGQA 3RGBC 4XRDA 3IC8A 4ICYA 2WRTA 2YWMA 1M2BA 4BL7A 3CQFA 5HFKA 2FWEA 3VPQA 1N25A 3O6TA 1K0MA 4Q5RA 4YQVA 1OKDA 4IP6A 3APSA 1S3CA 2MYGA 4G0KA 3GURA 1EGOA 2A2SA 3CSJA 1ERVA 1XW9A 3LSZA 2GZPA 2H74A 4RI6A 1M2AA 4N0ZA 1OE8A 5ECPB 3M9JA 3RAZA 1A2LA 3KH9A 4JBBA 1X9MB 2AB6A 4K5RA 2CX4A 2R0GA 3TKRA 5J4UA 1PN9A 1FHEA 2C3QA 4KCAA 3TKSA 3WGXA 4ZBBA 4ZIJA 2N5FA 2IMDA 1SL2B 1X0RA 1XBSA 4GSTA 2VL9A 5CREA 3VWWA 2G2QA 1QXHA 5A4VA 3J7Yb 1AXDA 1C72A 4W66A 3C7MA 3KM6A 3V1WA 2EC4A 2YV9A 2WFCA 3TGZA 2VCQA 3TB2A 4BWSA 4TR1A 3LQ7A 4RQXA 2PMTA 4HSCX 2LTKA 1V57A 4ISDA 4KDUA 4EC0A 3I43A 4PXOA 3KP9A 5DDLA 1R5PA 2C3TA 1TI1A 1QK8A 1ERTA 3VPTA 2YPMA 2XBQA 3GH9A 3EMXA 3Q74A 4L5LA 4KUNA 3UMAA 6GSUA 1TRVA 4MNNA 3GH6A 4NHZA 2AYTA 1YVLA 3TUEA 3C1SA 2B1KA 4MPGA 3UOMA 4PUAA 3IE3A 4K2XA 1ZOFA 4WR5A 3WGEA 4ECBA 4IHUA 2EIOA 2YCDA 4PQIA 1HYUA 2X64A 1ILOA 2L57A 1SENA 1AQVA 5A1NA 4CDOA 4KAEA 2QSIA 1TU8A 3E3EA 2DIYA 2XBIA 2KP1A 1M9AA 2E7PA 1YEWC 2GSSA 1SJZA 3WT2A 4PQHA 2WZ9A 2VM1A 1BAYA 3HKRA 4LLRA 3PR8A 1SKSB 1B4PA 3RPNA 2YV7A 5E4WA 4AKXB 1GSSA 1Z3EA 3HHVA 1OC3A 3O3TA 1A0FA 1UVZA 5DQSA 4E8EA 2IFQB 3BBYA 4ML6A 1AQWA 5G1KA 3FRCA 1XIYA 3L0HA 3Q19A 2YZUA 4IGJA 4IN0A 1ACVA 1MEKA 2FWGA 4I2UA 5G1LA 2H1LA 2CVBA 3KTBA 4G0IA 1BYEA 2MMOA 4V2NA 4N11A 1EV9A 2VD0A 3C1RA 3ME8A 3HVNA 3Q6OA 1ZMAA 3A2VA 4L0UA 5INYA 4MJBA 4ZL7A 19GSA 2MBSA 3NZNA 4PI2C 1T4YA 4ZXGA 2B3SA 4GXZA 2GT5A 1EOGA 3F4TA 2JZRA 1M3JA 2N5BA 3IOSA 5KEJA 1TP9A 3CTFA 4NAXA 2VM2A 2I4AA 5IMAA 4IQAA 5KN3A 1FO5A 3KEBA 1TDIA 1Q98A 2AAWA 2CQ9A 5AGYA 4XS4A 4IP1A 2GQKA 2L5LA 4AKHA 2K8SA 1MTCA 2LNTA 2PERA 3TOUA 3CHXC 1NW2A 4I97A 4GSSA 3FY7A 3DD3A 2I9HA 3A2XA 3VWVA 2K8VA 1X9WB 3GA4A 1F2EA 5F06A 2OJLA 4KSOA 3GX0A 3BOAA 4K6XA 1RQMA 3ZZXA 3SWLA 3GX8A 3FKFA 5GSSA 1ZGNA 5GSTA 3GFKA 2HYXA 3ZL5A 4L0WA 1O8XA 1NHYA 1LJRA 1X9SB 3D5JA 1LBKA 4NPBA 4LL1B 4KW6A 5D9TA 4O5UA 1M3IA 1U88A 2O7KA 5A5HB 1WMJA 2V6OA 3DWVA 4WF4A 3I9V2 3GKNA 1EP7A 1VRSD 1OC9B 1Y1UA 1SU9A 2HRAA 3ZITA 3LW9A 3F3RA 3US3A 2NVLA 1GTIA 3TOTA 4Z2UA 4AJ6A 3EWLA 4BA7A 4MLYA 4BVYA 4AKGA 4EE0A 4XCSA 2MMZA 4F2IA 4OWYA 2OA7A 2REMA 3IHGA 5G30A 1KEBA 3TCOA 2R0PA 4FQUA 4MF7A 4ZB7A 2J23A 5A4UA 3IC4A 4QQ7A 2DKHA 3H93A 5JCUA 2B7KA 4DEJA 1AAZA 4MPFA 4GDFA 4DSSB 3N5OA 5G5FA 1PFOA 2PUKC 2VO4A 5DALA 4NXIA 2JACA 1G6YA 2RIIA 1ZYEA 3QFAC 4AGSA 5HR2A 4N3ZA 1Q4JA 2LJAA 4KSMA 5GAPD 5D73A 3KJYA 1T8EB 2R6KA 4Q5FA 3RPPA 2WW3A 3M8NA 5A34B 1SKWB 1THXA 1TJDA 3QD9A 2J9HA 4F0CA 2WB9A 4O5QA 4TKYA 1ML6A 1XZOA 1XOBA 2GDRA 1T7PB 4HJMA 2VD1A 4K7NA 5DJMA 1N2AA 4USSA 1V98A 4KE3A 3WYWA 3ZFBA 5IOWA 1JLVA 5H5QA 3DMLA 4KB3A 3NIVA 3FR6A 4BVXA 4POMA 4EDZA 2A2RA 1FB0A 1R4WA 4PI0C 1JZOA 5ECRB 3TJBA 4MF6A 3VURA 2VAFA 4GTUA 4TXOA 1XFLA 4LA1A 4KDXA 5ECQB 2XC2A 5J41A 4TVEA 5CRDA 3WD6A 5A5HA 1JZDA 2LKUA 4OO4A 4DSRA 4L5OA 2HT9A 3QFBC 3M0FA 2NTOA 4NWYA 2GLRA 1EWXA 1G0TA 4EXJA 5D93A 1SL1B 6GSTA 5EPFA 1OC9A 5CRHA 2ZUPA 4MH2A 2CAIA 5B6NA 1Y25A 3HCZA 2IN3A 1PRXA 4FXYP 2DIZA 1AC1A 3L9VA 3FYGA 2YANA 4ECCA 4CY8A 2FLSA 3GNJA 2CAQA 4I2TA 2IMFA 3EINA 4F9ZA 3GTUA 1EOHA 2F9SA 2DBCA 2IJYA 3QAGA 1HD2A 2YWOA 2QC7A 3EPTA 4AI6A 4HS1A 1WOUA 1A8LA 1A2JA 2OADA 4A5PA 1WE0A 2HSMB 4AJ7A 1XXUA 2E2GA 2OE3A 5E59A 2OBKA 1QFNA 3FR9A 5BRTA 4DSSA 4YH2A 3IAM2 3P90A 2RLIA 2EIQA 2LJRA 4FYBA 3ZYWA 4PGTA 2GS3A 2KLXA 2YWNA 3IA1A 3HXSA 3GHAA 1G6WA 3TDGA 4JR6A 1GNWA 4O92A 3MDKA 3FK8A 1GULA 4OCEA 1DBYA 1TU7A 3CRTA 3BJ5A 4ID0A 3DYRA 2OBIA 4NV2A 1Z7RA 2WGRA 2LRCA 4GF0A 1Z6MA 4K2DA 2FUG2 5BMUB 3EVIA 1ON4A 1FB6A 4Z2RA 1EEJA 4V2MA 1S3AA 2PU9C 2MMNA 1K3YA 5IOXA 4ZBDA 4KCEA 1F6MC 2B5XA 1N8JA 3DVXA 4AKIA 2R5GA 3HVXA 4D73A 1FVKA 1TK0B 4QL9A 4TR3A 1BX9A 2CT6A 3MSZA 5G31A 2CVDA 1WJKA 2FWFA 2VUPA 2HNLA 1JLWA 3U6VA 4G9HA 2H1GA 2C0EA 4XRAA 3ZTLA 3TKSC 16GSA 5HFGA 4MH3A 2L5OA 1TRWA 2K9FA 3VWUA 1GSFA 1GUKA 1NHOA 2L4CA 2DMMA 5ID2A 3TJGA 3TRXA 4EUYA 5B6MA 4WKWA 4DVCA 4MZBA 1OAZA 2RM5A 5GZZB 1XG8A 3ZIVA 2VCWA 2EIRA 5EVOA 3R2QA 2KUCA 2LQOA 1A24A 2X99A 4GCIA 1DUGA 2R3XA 4EKZA 3D22A 4MK3A 1S4BP 1YZXA 2YWIA 3KCMA 3TRPA 2B5YA 4ZB6A 1SK2A 1O73A 3L9UA 1YQ1A 8GSSA 1JZRA 4ULXA 1ABAA 1M2DA 1Z7PA 5F07A 2EFDA 1M9BA 10GSA 3KZQA 4ECJA 4G0LA 4O5RA 3TJKA 3U5RE 5J3RA 2OACA 3GL3A 2H6XA 2KHPA 1U87A 2HSMA 3LORA 5H5SA 3F6DA 1ERWA 5KOXA 3P8WA 2E0QA 4V1Ap 1TRUA 4K5SA 2N5AA 2DJJA 4KGIA 2GQLA 3E9JB 1SKRB 1K0CA 1B8XA 2MZCA 5IMZA 2A4HA 2HLSA 1TOFA 2H30A 2L6DA 3DXBA 2HQTA 1X5DA 3EYTA 4MA9A 2G0FA 1SK0A 3QMXA 2PGTA 1GSDA 3RHBA 2WVYA 6GSXA 2KOKA 4X4JA 2YZHA 4BIKA 1ZZYA 4HOJA 4Q5QA 1ZCPA 5CYYA 1QMVA 3F6FA 2WS2A 1Z9HA 2VL3A 4O7HA 5JCGA 12GSA 5G5EA 2HSNB 3CMIA 3UAPA 2GSRA 4GQCA 2H0GA 5IMCA 4KH7A 2VIMA 2R0CA 2YNXA 3VI5A 3VK9A 3EE2A 1TXUA 2F51A 4F82A 4WEYA 1GSEA 4XTSA 5LCZA 3L4NA 4G19A 2HZEB 3HJPA 1Z6NA 4N10A 1YY7A 1LU4A 1USBA 1XWBA 2FHEA 3GKKA 3QPMA 3QAWA 4ZILA 1WPIA 5IIZA 4PX1A 4WBRD 5D8IA 2RM6A 1EEMA 4XIHA 2GZZA 13GSA 2CV4A 2MBTA 2IWTA 6GSWA 2P31A 4IS0A 2P5QA 5B8BA 1PGTA 5A4WA 1F3BA 3KMNA 2FA4A 3FMWA 3RBTA 3O76A 1F3AA 4K1FA 3RHCA 3HY2A 2DJ0A 3L78A 4CY6A 2OKAA 3EMPA 5CRGA 6GSSA 4PURA 4OFTA 3QOUA 1GLPA 1WP0A 5HR1A 2IIYA 3KH7A 1PKWA 5FT3A 1GLQA 3F4SA 2C3NA 3P2AA 3UL3A 2AHEA 3ZFLA 1OYJA 4EDYA 2QKEA 3K8NA 2VCZA 3F3QA 3IK9A 3HA9A 3BD2A 4X1UA 4IJ3A 1BF5A 3DRNA 1SJ6A 5C04A 4HU9A 1WWJA 2ALBA 4FIWA 4JZQA 4LMVA 1SD9A 4AJ8A 1NM3A 4Z7XA 2DJ1A 2CX3A 5ELGA 3F0IA 4RI7A 1H75A 2DJKA 2Z9SA 5A5KA 5IO2A 3RDWA 2CA8A 2TIRA 1K0BA 3ZRDA 2H66A 2LEGA 4FYCA 2HRKB 3CSIA 2FCHA 2DKIA 2OE1A 3TU3B 2WVXB 3MYDA 4ZL9A 3C71A 2GT6A 3IAS2 3W8JA 5HQPA 5DVBA 4I6XA 1XWCA 1AUCA 3UVTA 3I6AA 1JHBA 4NMUA 5KN1A 2B1LA 4JEDA 3TRQA 3C8EA 5J47A 1XWKA 4RUVA 1T4ZA 3GKMA 5IMVA 2JZSA 2H01A 1PSQA 3GMFA 2LSTA 3GL5A 4NHWA 3ZLPA 1GH2A 3PINA 2IFQA 2F8FA 2H71A 4TOPA 4WBJA 2GGTA 1IYHA 5CP1A 5D9XA 3CXGA 1VF1A 1URMA 5ECMB 5FWGA 1T1VA 4PHZC 17GSA 1MDKA 2VCTA 5D96A 3ZVJA 5JWRB 2H73A 4ILFA 1B48A 1BQ7A 2AUVA 4MF5A 1TKDB 4POBA 1YKCA 4IW9A 4HZ4A 3LEFA 3VFIA 2IMEA 1SJIA 3DEXA 2HSYA 1O6JA 1VGLA 2BTOT 2DLXA 5IPHA 1EGRA 3JCML 2K6VA 1FAAA 3PH9A 2IMKA 1MDIA 3F9UA 1XW5A 1YJ6A 2V41A 2JL4A 3D21A 4OFNA 3TKPA 4J56E 3KP8A 1GUMA 1WIKA 2A2PA 3KIJA 3M1GA 3ISOA 2H1BA 1U3IA 5EY6A 3ZMKA 3GSTA
chains in the Genus database with same CATH topology
3UVHA 1V9WA 3SBCA 4BL7B 5KOWA 3LXZA 4V2LA 1S3DA 2LRTA 1MD4A 4KDYA 1ZL9A 4YQMA 5IPGA 2FWHA 5AN1A 4I5QA 4OD7A 2DJ3A 2CZ2A 5ECHB 4HU7A 3ZMLA 3IR4A 4DSQA 3HJOA 1XVQA 1I5GA 3UBKA 4GWRA 2HRKA 4EVMA 3D0ZA 1UN2A 1DE1A 2YJ7A 2D2ZA 1CQHA 1YDKA 4QMKA 3QCPA 3LWAA 2VL2A 3AY8A 4P3YB 2VL2C 2UV8G 2WCIA 2EFEA 2E2MA 4AF2A 1YEPA 4KX4A 4PUFC 4HUAA 3LYKA 2WULA 3EC3A 1HNAA 1UC7A 1YF0A 3ME7A 2ZCTA 5DJLA 3FZ4A 5CAXA 2C0GA 2YJHA 2ON7A 1O8WA 3UJ1A 2H76A 1HNCA 1QUWA 4GRFA 5L71A 4EIPA 5IQYA 2A4VA 2M80A 4OO5A 1TK8B 3BCIA 4GLTA 4XS1A 3PGTA 2O5VA 2PBJA 2AJQB 5F8BA 1K0AA 4JU5A 3MWHA 4TR1B 1K0NA 3FW2A 1IYIA 2H0IA 4I8BA 3A3TA 1O81A 4HI7A 3EURA 1EP8A 5GAND 3G7IA 1GUHA 2OT3A 1Z5YE 2C1YA 4G01A 1B9YC 4YAPA 4TR4A 1ST9A 3IK7A 3HD5A 1BG5A 2K18A 1U6TA 2O8VB 2B6MA 3EU3A 5J9BA 3R3EA 1R7HA 1M0UA 4E68A 1ZYQB 4V1Ag 1BG1A 2BJXA 3IV4A 3LG6A 5EL8A 5A34A 2H6YA 2DMLA 3HMJG 3CSHA 3KD0A 3J7Yk 3H4KA 5A1NB 2LNSA 3MAKA 1GSUA 3N9JA 4K8MA 1HQOA 1JZWA 4K7OA 3NOFA 1A2MA 20GSA 3H1NA 1A0RP 5ECLB 2VLUA 1XWAA 1PL2A 3IPZA 3WGDA 2LV3A 5D9VA 4EO3A 3OR5A 4HQSA 2C0FA 1FVJA 4HEA2 4O32A 2VLVA 3F4RA 2LS5A 18GSA 4PQ1A 3GYKA 1ERUA 4G2EA 1V2AA 4PTSA 5HR0A 3HVSA 5F0GA 4POKA 2VCXA 4RQRA 2LJKA 1V40A 2JSZA 4K0NA 4WXTA 1U3AA 1T3BA 2X8HA 4PNFA 1K3OA 2WJUA 4CW9A 2H75A 4GQFA 4FYUA 4XHMA 1FG4A 7GSSA 1O7UA 5CO3A 5IMDA 5G2ZA 4TN8A 2GTUA 5J4VA 3A5IA 3BCKA 2L6CA 2C80A 2O87A 2C8UA 5J4YA 4CHSA 5J40A 2P5RA 1PA3A 3Q18A 2YOIA 2VCVA 5DBQA 2X49A 1SVMA 4XS4B 1TK5B 1M99A 2PVQA 3GN3A 4TW5A 2MMAA 1F37A 4N30A 4J57E 5HFIA 3G7JA 4MABA 3HDCA 1GRXA 3D6IA 2XPEA 2LUSA 3KGKA 1BJXA 1MD3A 2V1MA 4HZ2A 1O85A 1YF1A 5COHA 3LYPA 4TXVA 1GP1A 2FY6A 4HQZA 4MP4A 3D4TA 4F0BA 3ERWA 5J9CA 5ECNB 3LJRA 3M3MA 5BMUA 4MMMA 2GVPA 2I1UA 2HXKA 3I69A 1H4OA 5DCGA 2GZYA 3CWGA 3GUSA 1FOVA 1K0OA 2HSHA 1PL1A 2H70A 3D4MA 2GQMA 1GTAA 1KNGA 2IL3A 1SVOA 5ENUA 2WDUA 2X4AA 4JR4A 2R37A 2FNOA 5DAKB 2O85A 5ECOB 1X5EA 14GSA 1GWCA 1R26A 1QGVA 3MNGA 2GSTA 1NSWA 2LQQA 5IO0A 3IXRA 1XVWA 2TRXA 2ON5A 4KF9A 3LGCA 5J5NA 2M46A 2F3MA 4OCFA 3UIWA 22GSA 3P7XA 4BVYB 2L59A 5AIVA 1DSBA 1SL0B 3F8UA 4JE1A 1OKTA 1SK1A 2I81A 1PN0A 2M72A 3H8QA 3QDNA 5AISA 3W6GA 1HNBA 4EF0A 2PVOC 1DE2A 2VKZG 2EFCA 3W8SA 2YN1A 1T00A 4FO5A 1MDJA 4J2FA 3ERGA 1B4QA 1AQXA 2P0GA 5DALB 2KP2A 2V2GA 1OVNA 2HI7A 4POLA 5B8AA 3ZREA 3QAVA 6GSVA 5DQYA 4IELA 1KTEA 2NBSA 4YKFA 5AIXA 2BMXA 3APOA 3TJFA 9GSSA 3IBHA 4WR4A 2H1AA 4H86A 4X0XA 5H5RA 3TJJA 5F05A 4BPYA 2OE0A 3A5WA 3FEUA 5ABRA 2JSYA 3FZ5A 4F03A 1GTUA 5DCHA 2RUFA 1QQ2A 4MDCA 2DC5A 3HJMA 4WF5A 2VLTA 1VF4A 5JCWA 4ECIA 2H1DA 3CRUA 4BVXB 3F63A 2H6ZA 2V32A 4PNGA 3KTLA 3WT1A 1K0DA 3GSSA 2JADA 1GL8A 4IQ1A 2DJ2A 1TXXA 3VWXA 2UZ8A 3H79A 4K7IA 4TXOB 4ZB8A 2XPDA 3FR3A 1J08A 3C73A 3MIXA 3TKQA 5IM9A 4MCUA 3DIEA 2HSNA 4LMWA 1ZYPA 3G7YA 2ZNMA 1F9MA 1CQGA 2PWJA 3TKSE 5DAKA 5LNKe 1PQNA 1WRYA 4YKGA 1E2YA 2HZEA 4XS6A 3UBLA 4Q5NA 4L8EA 4JRRA 4IJIA 3DKSA 2I3YA 1RK4A 1TRSA 3LFLA 1EV4A 3GTUB 4IVFA 3VI7A 1J9BA 2ES7A 11GSA 3VLNA 3KXOA 1G7EA 4ML1A 4ZL8A 1ZYNA 4TRXA 1TW9A 2TRCP 3S9FA 2IPAA 2HZFA 1VF3A 2V6KA 4EIQA 5HR3A 4WETA 4IKHA 2CVKA 2CZ3A 4K0GA 2YP6A 2B7JA 2H72A 2JZTA 4ACSA 2QA2A 1Y6EA 1SYXA 4FH8A 1SVLA 4MJCA 3IDVA 3ED3A 4QL7A 2H0HA 3PPUA 5FHIA 1RW1A 6GSYA 4YQUA 4LL4B 1GSQA 5ECSA 1PX7A 5CRWA 2FD3A 3GIXA 4TR0A 1B9XC 2PN8A 1G7OA 1VF2A 3GKXA 1BEDA 1W4VA 4OMVA 4MJEA 5KN2A 3CTGA 3HYPA 4GSNA 1PD21 2H19A 1XCCA 2X8CA 2XHFA 3IRAA 3LXTA 2RUEA 5D9WA 3HZ8A 2O89A 3KMOA 3EU4A 2QA1A 1XOAA 1M7TA 1XPVA 4KNDA 2R4VA 1X5CA 4HDEA 1JFUA 3IHQA 4HJ2A 3QR6A 3E0UA 4KA0A 1GTBA 4EL1A 4D73B 2X8GA 2LRNA 1TI3A 2C0DA 3M9KA 5ELAA 3ZVJD 2EFHA 1E6BA 5C00A 2JU5A 5JWQB 2PPTA 4ZBAA 1A23A 4MZWA 3UEMA 3DVWA 4X43A 2FA8A 1GNEA 1W89A 1PMTA 3L9SA 4OFMA 1YEXA 5CNWA 5ID2B 1A8YA 1SD8A 4BWQA 1K3LA 5KN0A 4E8HA 3FHKA 4K9ZA 3FZ9A 5ECIB 1XW6A 1THOA 1OC8A 2NDOA 4YAVA 2QGVA 4G10A 3UARA 3FZAA 5JWOB 4MJAA 3GV1A 3ZIJA 1R5AA 3GRXA 1PX6A 3HVVA 1YKAA 3CYNA 1AIUA 3CBUA 1EZKA 2H8LA 5IMFA 5ECKB 1SYRA 2AV4A 2VOCA 1XWGA 2IMIA 1V58A 1UA5A 1FW1A 3HZ4A 4NV5A 1FOHA 2DSAA 1I9DA 2C4JA 2HE3A 2HRNA 3G9BA 2GSQA 2R2JA 4Z2TA 2HRFA 5B7CA 1AW9A 3ERFA 1PKZA 4N0VA 1KBNA 3A2WA 2F8AA 1J0FA 2NPBA 1OE7A 3APQA 4IBPA 1TTZA 5LD0A 4MZCA 2FGXA 2HFDA 2B5EA 2L4QA 1GSYA 4ZB9A 3DGQA 4XRDA 3IC8A 4ICYA 2WRTA 2YWMA 1M2BA 4BL7A 5HFKA 2FWEA 3VPQA 1N25A 3O6TA 1K0MA 4Q5RA 4YQVA 1OKDA 4IP6A 3APSA 1S3CA 2MYGA 4G0KA 3GURA 1EGOA 2A2SA 3CSJA 1ERVA 1XW9A 3LSZA 2GZPA 2H74A 4RI6A 1M2AA 4N0ZA 1OE8A 5ECPB 3M9JA 3RAZA 1A2LA 3KH9A 4JBBA 1X9MB 2AB6A 4K5RA 2CX4A 2R0GA 3TKRA 5J4UA 1PN9A 1FHEA 2C3QA 4KCAA 3TKSA 3WGXA 4ZBBA 4ZIJA 2N5FA 2IMDA 1SL2B 1X0RA 1XBSA 4GSTA 2VL9A 5CREA 3VWWA 2G2QA 1QXHA 5A4VA 3J7Yb 1AXDA 1C72A 4W66A 3C7MA 3KM6A 3V1WA 2EC4A 2YV9A 2WFCA 3TGZA 2VCQA 3TB2A 4BWSA 4TR1A 3LQ7A 4RQXA 2PMTA 2LTKA 1V57A 4ISDA 4KDUA 4EC0A 3I43A 4PXOA 3KP9A 5DDLA 1R5PA 2C3TA 1TI1A 1QK8A 1ERTA 3VPTA 2YPMA 2XBQA 3GH9A 3EMXA 3Q74A 4L5LA 4KUNA 3UMAA 6GSUA 1TRVA 4MNNA 3GH6A 4NHZA 2AYTA 1YVLA 3TUEA 3C1SA 2B1KA 4MPGA 3UOMA 4PUAA 3IE3A 4K2XA 1ZOFA 4WR5A 3WGEA 4ECBA 4IHUA 2EIOA 2YCDA 4PQIA 1HYUA 2X64A 1ILOA 2L57A 1SENA 1AQVA 5A1NA 4CDOA 4KAEA 2QSIA 1TU8A 3E3EA 2DIYA 2XBIA 2KP1A 1M9AA 2E7PA 2GSSA 1SJZA 3WT2A 4PQHA 2WZ9A 2VM1A 1BAYA 3HKRA 4LLRA 3PR8A 1SKSB 1B4PA 3RPNA 2YV7A 5E4WA 4AKXB 1GSSA 1Z3EA 3HHVA 1OC3A 3O3TA 1A0FA 1UVZA 5DQSA 4E8EA 2IFQB 3BBYA 4ML6A 1AQWA 5G1KA 3FRCA 1XIYA 3L0HA 3Q19A 2YZUA 4IGJA 4IN0A 1ACVA 1MEKA 2FWGA 4I2UA 5G1LA 2H1LA 2CVBA 3KTBA 4G0IA 1BYEA 2MMOA 4V2NA 4N11A 1EV9A 2VD0A 3C1RA 3ME8A 3Q6OA 1ZMAA 3A2VA 4L0UA 5INYA 4MJBA 4ZL7A 19GSA 2MBSA 3NZNA 1T4YA 4ZXGA 2B3SA 4GXZA 2GT5A 1EOGA 3F4TA 2JZRA 2N5BA 3IOSA 5KEJA 1TP9A 3CTFA 4NAXA 2VM2A 2I4AA 5IMAA 4IQAA 5KN3A 1FO5A 3KEBA 1TDIA 1Q98A 2AAWA 2CQ9A 5AGYA 4XS4A 4IP1A 2GQKA 2L5LA 4AKHA 2K8SA 1MTCA 2LNTA 2PERA 3TOUA 1NW2A 4I97A 4GSSA 3FY7A 3DD3A 2I9HA 3A2XA 3VWVA 2K8VA 1X9WB 3GA4A 1F2EA 5F06A 2OJLA 4KSOA 3GX0A 3BOAA 4K6XA 1RQMA 3ZZXA 3SWLA 3GX8A 3FKFA 5GSSA 1ZGNA 5GSTA 3GFKA 2HYXA 3ZL5A 4L0WA 1O8XA 1NHYA 1LJRA 1X9SB 3D5JA 1LBKA 4NPBA 4LL1B 4KW6A 5D9TA 4O5UA 1U88A 2O7KA 5A5HB 1WMJA 2V6OA 3DWVA 4WF4A 3I9V2 3GKNA 1EP7A 1VRSD 1OC9B 1Y1UA 1SU9A 2HRAA 3ZITA 3LW9A 3F3RA 3US3A 2NVLA 1GTIA 3TOTA 4Z2UA 4AJ6A 3EWLA 4BA7A 4MLYA 4BVYA 4AKGA 4EE0A 4XCSA 2MMZA 4F2IA 4OWYA 2OA7A 2REMA 3IHGA 5G30A 1KEBA 3TCOA 2R0PA 4FQUA 4MF7A 4ZB7A 2J23A 5A4UA 3IC4A 4QQ7A 2DKHA 3H93A 5JCUA 2B7KA 4DEJA 1AAZA 4MPFA 4GDFA 4DSSB 3N5OA 5G5FA 2PUKC 2VO4A 5DALA 4NXIA 2JACA 1G6YA 2RIIA 1ZYEA 3QFAC 4AGSA 5HR2A 4N3ZA 1Q4JA 2LJAA 4KSMA 5GAPD 5D73A 3KJYA 1T8EB 2R6KA 4Q5FA 3RPPA 3M8NA 5A34B 1SKWB 1THXA 1TJDA 3QD9A 2J9HA 4F0CA 2WB9A 4O5QA 4TKYA 1ML6A 1XZOA 1XOBA 2GDRA 1T7PB 4HJMA 2VD1A 4K7NA 5DJMA 1N2AA 4USSA 1V98A 4KE3A 3WYWA 3ZFBA 5IOWA 1JLVA 5H5QA 3DMLA 4KB3A 3NIVA 3FR6A 4BVXA 4POMA 4EDZA 2A2RA 1FB0A 1R4WA 1JZOA 5ECRB 3TJBA 4MF6A 3VURA 2VAFA 4GTUA 4TXOA 1XFLA 4LA1A 4KDXA 5ECQB 2XC2A 5J41A 4TVEA 5CRDA 3WD6A 5A5HA 1JZDA 2LKUA 4OO4A 4DSRA 4L5OA 2HT9A 3QFBC 3M0FA 2NTOA 4NWYA 2GLRA 1EWXA 1G0TA 4EXJA 5D93A 1SL1B 6GSTA 5EPFA 1OC9A 5CRHA 2ZUPA 4MH2A 2CAIA 5B6NA 1Y25A 3HCZA 2IN3A 1PRXA 2DIZA 1AC1A 3L9VA 3FYGA 2YANA 4ECCA 4CY8A 2FLSA 3GNJA 2CAQA 4I2TA 2IMFA 3EINA 4F9ZA 3GTUA 1EOHA 2F9SA 2DBCA 2IJYA 3QAGA 1HD2A 2YWOA 2QC7A 3EPTA 4AI6A 4HS1A 1WOUA 1A8LA 1A2JA 2OADA 4A5PA 1WE0A 2HSMB 4AJ7A 1XXUA 2E2GA 2OE3A 5E59A 2OBKA 1QFNA 3FR9A 5BRTA 4DSSA 4YH2A 3IAM2 3P90A 2RLIA 2EIQA 2LJRA 4FYBA 3ZYWA 4PGTA 2GS3A 2KLXA 2YWNA 3IA1A 3HXSA 3GHAA 1G6WA 3TDGA 4JR6A 1GNWA 4O92A 3MDKA 3FK8A 1GULA 4OCEA 1DBYA 1TU7A 3CRTA 3BJ5A 4ID0A 3DYRA 2OBIA 4NV2A 1Z7RA 2WGRA 2LRCA 4GF0A 1Z6MA 4K2DA 2FUG2 5BMUB 3EVIA 1ON4A 1FB6A 4Z2RA 1EEJA 4V2MA 1S3AA 2PU9C 2MMNA 1K3YA 5IOXA 4ZBDA 4KCEA 1F6MC 2B5XA 1N8JA 3DVXA 4AKIA 2R5GA 3HVXA 4D73A 1FVKA 1TK0B 4QL9A 4TR3A 1BX9A 2CT6A 3MSZA 5G31A 2CVDA 1WJKA 2FWFA 2VUPA 2HNLA 1JLWA 3U6VA 4G9HA 2H1GA 2C0EA 4XRAA 3ZTLA 3TKSC 16GSA 5HFGA 4MH3A 2L5OA 1TRWA 2K9FA 3VWUA 1GSFA 1GUKA 1NHOA 2L4CA 2DMMA 5ID2A 3TJGA 3TRXA 4EUYA 5B6MA 4WKWA 4DVCA 4MZBA 1OAZA 2RM5A 5GZZB 3ZIVA 2VCWA 2EIRA 5EVOA 3R2QA 2KUCA 2LQOA 1A24A 2X99A 4GCIA 1DUGA 2R3XA 4EKZA 3D22A 4MK3A 1YZXA 2YWIA 3KCMA 3TRPA 2B5YA 4ZB6A 1SK2A 1O73A 3L9UA 1YQ1A 8GSSA 1JZRA 4ULXA 1ABAA 1M2DA 1Z7PA 5F07A 2EFDA 1M9BA 10GSA 3KZQA 4ECJA 4G0LA 4O5RA 3TJKA 3U5RE 5J3RA 2OACA 3GL3A 2H6XA 2KHPA 1U87A 2HSMA 3LORA 5H5SA 3F6DA 1ERWA 5KOXA 3P8WA 2E0QA 4V1Ap 1TRUA 4K5SA 2N5AA 2DJJA 4KGIA 2GQLA 3E9JB 1SKRB 1K0CA 1B8XA 2MZCA 5IMZA 2A4HA 2HLSA 1TOFA 2H30A 2L6DA 3DXBA 2HQTA 1X5DA 3EYTA 4MA9A 2G0FA 1SK0A 3QMXA 2PGTA 1GSDA 3RHBA 6GSXA 2KOKA 4X4JA 2YZHA 1ZZYA 4HOJA 4Q5QA 1ZCPA 5CYYA 1QMVA 3F6FA 2WS2A 1Z9HA 2VL3A 4O7HA 5JCGA 12GSA 5G5EA 2HSNB 3CMIA 3UAPA 2GSRA 4GQCA 2H0GA 5IMCA 4KH7A 2VIMA 2R0CA 2YNXA 3VI5A 3VK9A 3EE2A 1TXUA 2F51A 4F82A 4WEYA 1GSEA 4XTSA 5LCZA 3L4NA 4G19A 2HZEB 3HJPA 1Z6NA 4N10A 1YY7A 1LU4A 1USBA 1XWBA 2FHEA 3GKKA 3QPMA 3QAWA 4ZILA 1WPIA 5IIZA 4PX1A 4WBRD 5D8IA 2RM6A 1EEMA 4XIHA 2GZZA 13GSA 2CV4A 2MBTA 2IWTA 6GSWA 2P31A 4IS0A 2P5QA 5B8BA 1PGTA 5A4WA 1F3BA 3KMNA 2FA4A 3FMWA 3RBTA 3O76A 1F3AA 4K1FA 3RHCA 3HY2A 3L78A 2DJ0A 4CY6A 2OKAA 3EMPA 5CRGA 6GSSA 4PURA 4OFTA 3QOUA 1GLPA 1WP0A 5HR1A 2IIYA 3KH7A 1PKWA 5FT3A 1GLQA 3F4SA 2C3NA 3P2AA 3UL3A 2AHEA 3ZFLA 1OYJA 4EDYA 2QKEA 3K8NA 2VCZA 3F3QA 3IK9A 3HA9A 3BD2A 4X1UA 4IJ3A 1BF5A 3DRNA 1SJ6A 5C04A 4HU9A 1WWJA 2ALBA 4FIWA 4JZQA 4LMVA 1SD9A 4AJ8A 1NM3A 4Z7XA 2DJ1A 2CX3A 5ELGA 3F0IA 4RI7A 1H75A 2DJKA 2Z9SA 5A5KA 5IO2A 3RDWA 2CA8A 2TIRA 1K0BA 3ZRDA 2H66A 2LEGA 4FYCA 2HRKB 3CSIA 2FCHA 2DKIA 2OE1A 3TU3B 3MYDA 4ZL9A 3C71A 2GT6A 3IAS2 3W8JA 5HQPA 5DVBA 4I6XA 1XWCA 1AUCA 3UVTA 3I6AA 1JHBA 4NMUA 5KN1A 2B1LA 4JEDA 3TRQA 3C8EA 5J47A 1XWKA 4RUVA 1T4ZA 3GKMA 5IMVA 2JZSA 2H01A 1PSQA 3GMFA 2LSTA 3GL5A 4NHWA 3ZLPA 1GH2A 3PINA 2IFQA 2F8FA 2H71A 4TOPA 4WBJA 2GGTA 1IYHA 5CP1A 5D9XA 3CXGA 1VF1A 1URMA 5ECMB 5FWGA 1T1VA 17GSA 1MDKA 2VCTA 5D96A 3ZVJA 5JWRB 2H73A 4ILFA 1B48A 1BQ7A 2AUVA 4MF5A 1TKDB 4POBA 1YKCA 4IW9A 4HZ4A 3LEFA 3VFIA 2IMEA 1SJIA 3DEXA 2HSYA 1O6JA 1VGLA 2BTOT 2DLXA 5IPHA 1EGRA 3JCML 2K6VA 1FAAA 3PH9A 2IMKA 1MDIA 3F9UA 1XW5A 1YJ6A 2V41A 2JL4A 3D21A 4OFNA 3TKPA 4J56E 3KP8A 1GUMA 1WIKA 2A2PA 3KIJA 3M1GA 3ISOA 2H1BA 1U3IA 5EY6A 3ZMKA 3GSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UVH A;  1V9W A;  3SBC A;  4BL7 B;  3LXZ A;  4V2L A;  1S3D A;  2LRT A;  1MD4 A;  4KDY A;  1ZL9 A;  4YQM A;  5IPG A;  2FWH A;  5AN1 A;  4I5Q A;  4OD7 A;  2DJ3 A;  2CZ2 A;  5ECH B;  4HU7 A;  3ZML A;  3IR4 A;  4DSQ A;  3HJO A;  1XVQ A;  1I5G A;  3UBK A;  4GWR A;  2HRK A;  4EVM A;  3D0Z A;  1UN2 A;  1DE1 A;  2YJ7 A;  2D2Z A;  1CQH A;  1YDK A;  3QCP A;  3LWA A;  2VL2 A;  3AY8 A;  4P3Y B;  2VL2 C;  2WCI A;  2E2M A;  4AF2 A;  1YEP A;  4KX4 A;  4PUF C;  4HUA A;  3LYK A;  2WUL A;  3EC3 A;  1HNA A;  1UC7 A;  1YF0 A;  3ME7 A;  2ZCT A;  5DJL A;  3FZ4 A;  5CAX A;  2C0G A;  2YJH A;  2ON7 A;  1O8W A;  3UJ1 A;  2H76 A;  1HNC A;  1QUW A;  4GRF A;  5L71 A;  5IQY A;  2A4V A;  2M80 A;  4OO5 A;  1TK8 B;  3BCI A;  4GLT A;  4XS1 A;  3PGT A;  2PBJ A;  2AJQ B;  5F8B A;  1K0A A;  4JU5 A;  3MWH A;  4TR1 B;  1K0N A;  3FW2 A;  1IYI A;  2H0I A;  4I8B A;  3A3T A;  1O81 A;  4HI7 A;  3EUR A;  1EP8 A;  5GAN D;  3G7I A;  1GUH A;  1Z5Y E;  2C1Y A;  1B9Y C;  4YAP A;  4TR4 A;  1ST9 A;  3IK7 A;  3HD5 A;  1BG5 A;  2K18 A;  1U6T A;  2O8V B;  2B6M A;  3EU3 A;  5J9B A;  3R3E A;  1R7H A;  1M0U A;  1ZYQ B;  4V1A g;  2BJX A;  3IV4 A;  3LG6 A;  5EL8 A;  2H6Y A;  2DML A;  3CSH A;  3KD0 A;  3J7Y k;  3H4K A;  2LNS A;  3MAK A;  1GSU A;  3N9J A;  4K8M A;  1HQO A;  1JZW A;  4K7O A;  3NOF A;  1A2M A;  20GS A;  3H1N A;  1A0R P;  5ECL B;  2VLU A;  1XWA A;  1PL2 A;  3IPZ A;  3WGD A;  2LV3 A;  5D9V A;  4EO3 A;  3OR5 A;  4HQS A;  2C0F A;  1FVJ A;  4HEA 2;  4O32 A;  2VLV A;  3F4R A;  2LS5 A;  18GS A;  4PQ1 A;  3GYK A;  1ERU A;  4G2E A;  1V2A A;  4PTS A;  5HR0 A;  3HVS A;  5F0G A;  4POK A;  2VCX A;  4RQR A;  2LJK A;  1V40 A;  2JSZ A;  4K0N A;  4WXT A;  1U3A A;  1T3B A;  2X8H A;  4PNF A;  1K3O A;  2WJU A;  4CW9 A;  2H75 A;  4GQF A;  4FYU A;  4XHM A;  1FG4 A;  7GSS A;  1O7U A;  5CO3 A;  5IMD A;  5G2Z A;  4TN8 A;  2GTU A;  3BCK A;  2L6C A;  2C80 A;  2O87 A;  2C8U A;  4CHS A;  2P5R A;  1PA3 A;  3Q18 A;  2YOI A;  2VCV A;  5DBQ A;  4XS4 B;  1TK5 B;  1M99 A;  2PVQ A;  3GN3 A;  4TW5 A;  2MMA A;  1F37 A;  4N30 A;  4J57 E;  5HFI A;  3G7J A;  4MAB A;  3HDC A;  1GRX A;  3D6I A;  2XPE A;  2LUS A;  3KGK A;  1BJX A;  1MD3 A;  2V1M A;  4HZ2 A;  1O85 A;  1YF1 A;  5COH A;  3LYP A;  4TXV A;  1GP1 A;  2FY6 A;  4HQZ A;  4MP4 A;  3D4T A;  4F0B A;  3ERW A;  5J9C A;  5ECN B;  3LJR A;  3M3M A;  5BMU A;  4MMM A;  2GVP A;  2I1U A;  2HXK A;  3I69 A;  1H4O A;  5DCG A;  2GZY A;  3GUS A;  1FOV A;  1K0O A;  2HSH A;  1PL1 A;  2H70 A;  3D4M A;  2GQM A;  1GTA A;  1KNG A;  2IL3 A;  5ENU A;  2WDU A;  4JR4 A;  2R37 A;  2FNO A;  5DAK B;  2O85 A;  5ECO B;  1X5E A;  14GS A;  1GWC A;  1R26 A;  1QGV A;  3MNG A;  2GST A;  1NSW A;  2LQQ A;  5IO0 A;  3IXR A;  1XVW A;  2TRX A;  2ON5 A;  4KF9 A;  3LGC A;  5J5N A;  2M46 A;  2F3M A;  4OCF A;  3UIW A;  22GS A;  3P7X A;  4BVY B;  2L59 A;  5AIV A;  1DSB A;  1SL0 B;  3F8U A;  4JE1 A;  1OKT A;  1SK1 A;  2I81 A;  2M72 A;  3H8Q A;  3QDN A;  5AIS A;  3W6G A;  1HNB A;  4EF0 A;  2PVO C;  1DE2 A;  3W8S A;  2YN1 A;  1T00 A;  4FO5 A;  1MDJ A;  4J2F A;  3ERG A;  1B4Q A;  1AQX A;  2P0G A;  5DAL B;  2KP2 A;  2V2G A;  1OVN A;  2HI7 A;  4POL A;  5B8A A;  3ZRE A;  3QAV A;  6GSV A;  5DQY A;  4IEL A;  1KTE A;  2NBS A;  5AIX A;  2BMX A;  3APO A;  3TJF A;  9GSS A;  3IBH A;  4WR4 A;  2H1A A;  4H86 A;  4X0X A;  5H5R A;  3TJJ A;  5F05 A;  4BPY A;  2OE0 A;  3A5W A;  3FEU A;  5ABR A;  2JSY A;  3FZ5 A;  4F03 A;  1GTU A;  5DCH A;  2RUF A;  1QQ2 A;  4MDC A;  2DC5 A;  3HJM A;  4WF5 A;  2VLT A;  1VF4 A;  5JCW A;  4ECI A;  2H1D A;  3CRU A;  4BVX B;  3F63 A;  2H6Z A;  2V32 A;  4PNG A;  3KTL A;  3WT1 A;  1K0D A;  3GSS A;  2JAD A;  1GL8 A;  4IQ1 A;  2DJ2 A;  1TXX A;  3VWX A;  2UZ8 A;  3H79 A;  4K7I A;  4TXO B;  4ZB8 A;  2XPD A;  3FR3 A;  1J08 A;  3C73 A;  3TKQ A;  5IM9 A;  4MCU A;  3DIE A;  4LMW A;  3G7Y A;  2ZNM A;  1F9M A;  1CQG A;  2PWJ A;  3TKS E;  5DAK A;  5LNK e;  1PQN A;  1WRY A;  1E2Y A;  2HZE A;  4XS6 A;  3UBL A;  4Q5N A;  4L8E A;  4JRR A;  4IJI A;  3DKS A;  2I3Y A;  1RK4 A;  1TRS A;  3LFL A;  1EV4 A;  3GTU B;  4IVF A;  3VI7 A;  1J9B A;  2ES7 A;  11GS A;  3VLN A;  3KXO A;  1G7E A;  4ML1 A;  4ZL8 A;  4TRX A;  1TW9 A;  2TRC P;  3S9F A;  2IPA A;  2HZF A;  1VF3 A;  2V6K A;  5HR3 A;  4WET A;  4IKH A;  2CVK A;  2CZ3 A;  4K0G A;  2YP6 A;  2B7J A;  2H72 A;  2JZT A;  4ACS A;  1Y6E A;  1SYX A;  4FH8 A;  4MJC A;  3IDV A;  3ED3 A;  4QL7 A;  2H0H A;  3PPU A;  5FHI A;  1RW1 A;  6GSY A;  4YQU A;  4LL4 B;  1GSQ A;  5ECS A;  1PX7 A;  5CRW A;  2FD3 A;  3GIX A;  4TR0 A;  1B9X C;  2PN8 A;  1G7O A;  1VF2 A;  3GKX A;  1BED A;  1W4V A;  4OMV A;  4MJE A;  5KN2 A;  3CTG A;  3HYP A;  4GSN A;  1PD2 1;  2H19 A;  1XCC A;  2X8C A;  2XHF A;  3IRA A;  3LXT A;  2RUE A;  5D9W A;  2O89 A;  3HZ8 A;  3KMO A;  3EU4 A;  1XOA A;  1M7T A;  1XPV A;  4KND A;  2R4V A;  1X5C A;  4HDE A;  1JFU A;  3IHQ A;  4HJ2 A;  3QR6 A;  3E0U A;  4KA0 A;  1GTB A;  4EL1 A;  4D73 B;  2X8G A;  2LRN A;  1TI3 A;  2C0D A;  3M9K A;  5ELA A;  3ZVJ D;  1E6B A;  5C00 A;  2JU5 A;  5JWQ B;  2PPT A;  4ZBA A;  1A23 A;  4MZW A;  3UEM A;  3DVW A;  4X43 A;  2FA8 A;  1GNE A;  1W89 A;  1PMT A;  3L9S A;  4OFM A;  1YEX A;  5CNW A;  5ID2 B;  1A8Y A;  1SD8 A;  4BWQ A;  1K3L A;  5KN0 A;  4E8H A;  3FHK A;  4K9Z A;  3FZ9 A;  5ECI B;  1XW6 A;  1THO A;  1OC8 A;  2NDO A;  4YAV A;  2QGV A;  4G10 A;  3UAR A;  3FZA A;  5JWO B;  4MJA A;  3GV1 A;  3ZIJ A;  1R5A A;  3GRX A;  1PX6 A;  3HVV A;  1YKA A;  3CYN A;  1AIU A;  3CBU A;  1EZK A;  2H8L A;  5IMF A;  5ECK B;  1SYR A;  2AV4 A;  2VOC A;  1XWG A;  2IMI A;  1V58 A;  1UA5 A;  1FW1 A;  3HZ4 A;  4NV5 A;  2DSA A;  1I9D A;  2C4J A;  2HE3 A;  2HRN A;  3G9B A;  2GSQ A;  2R2J A;  2HRF A;  5B7C A;  1AW9 A;  3ERF A;  1PKZ A;  4N0V A;  1KBN A;  3A2W A;  2F8A A;  1J0F A;  2NPB A;  1OE7 A;  3APQ A;  4IBP A;  1TTZ A;  5LD0 A;  4MZC A;  2FGX A;  2HFD A;  2B5E A;  2L4Q A;  1GSY A;  4ZB9 A;  3DGQ A;  4XRD A;  3IC8 A;  2WRT A;  2YWM A;  1M2B A;  4BL7 A;  5HFK A;  2FWE A;  3VPQ A;  3O6T A;  1K0M A;  4Q5R A;  4YQV A;  1OKD A;  4IP6 A;  3APS A;  1S3C A;  2MYG A;  4G0K A;  3GUR A;  1EGO A;  2A2S A;  3CSJ A;  1ERV A;  1XW9 A;  3LSZ A;  2GZP A;  2H74 A;  4RI6 A;  1M2A A;  4N0Z A;  1OE8 A;  5ECP B;  3M9J A;  3RAZ A;  1A2L A;  3KH9 A;  4JBB A;  1X9M B;  2AB6 A;  2CX4 A;  3TKR A;  5J4U A;  1PN9 A;  1FHE A;  2C3Q A;  4KCA A;  3TKS A;  3WGX A;  4ZBB A;  4ZIJ A;  2N5F A;  2IMD A;  1SL2 B;  1X0R A;  1XBS A;  4GST A;  2VL9 A;  5CRE A;  3VWW A;  2G2Q A;  1QXH A;  5A4V A;  3J7Y b;  1AXD A;  1C72 A;  3C7M A;  3KM6 A;  3V1W A;  2EC4 A;  2YV9 A;  2WFC A;  3TGZ A;  2VCQ A;  3TB2 A;  4BWS A;  4TR1 A;  3LQ7 A;  4RQX A;  2PMT A;  2LTK A;  1V57 A;  4ISD A;  4KDU A;  4EC0 A;  3I43 A;  4PXO A;  3KP9 A;  5DDL A;  1R5P A;  2C3T A;  1TI1 A;  1QK8 A;  1ERT A;  3VPT A;  2YPM A;  2XBQ A;  3GH9 A;  3EMX A;  3Q74 A;  4L5L A;  4KUN A;  3UMA A;  6GSU A;  1TRV A;  3GH6 A;  4NHZ A;  2AYT A;  3TUE A;  3C1S A;  2B1K A;  4MPG A;  3UOM A;  4PUA A;  3IE3 A;  1ZOF A;  4WR5 A;  3WGE A;  4ECB A;  4IHU A;  2EIO A;  2YCD A;  4PQI A;  1HYU A;  2X64 A;  1ILO A;  2L57 A;  1SEN A;  1AQV A;  4CDO A;  4KAE A;  2QSI A;  1TU8 A;  3E3E A;  2DIY A;  2XBI A;  2KP1 A;  1M9A A;  2E7P A;  2GSS A;  1SJZ A;  3WT2 A;  4PQH A;  2WZ9 A;  2VM1 A;  1BAY A;  3HKR A;  4LLR A;  3PR8 A;  1SKS B;  1B4P A;  3RPN A;  2YV7 A;  5E4W A;  1GSS A;  1Z3E A;  3HHV A;  1OC3 A;  3O3T A;  1A0F A;  1UVZ A;  5DQS A;  4E8E A;  2IFQ B;  3BBY A;  4ML6 A;  1AQW A;  5G1K A;  3FRC A;  1XIY A;  3L0H A;  3Q19 A;  2YZU A;  4IGJ A;  4IN0 A;  1ACV A;  1MEK A;  2FWG A;  4I2U A;  5G1L A;  2CVB A;  3KTB A;  4G0I A;  1BYE A;  2MMO A;  4V2N A;  4N11 A;  1EV9 A;  2VD0 A;  3C1R A;  3ME8 A;  3Q6O A;  1ZMA A;  3A2V A;  4L0U A;  5INY A;  4MJB A;  4ZL7 A;  19GS A;  2MBS A;  3NZN A;  1T4Y A;  4ZXG A;  2B3S A;  4GXZ A;  2GT5 A;  1EOG A;  3F4T A;  2JZR A;  2N5B A;  3IOS A;  5KEJ A;  1TP9 A;  3CTF A;  4NAX A;  2VM2 A;  2I4A A;  5IMA A;  4IQA A;  5KN3 A;  1FO5 A;  3KEB A;  1TDI A;  1Q98 A;  2AAW A;  2CQ9 A;  5AGY A;  4XS4 A;  4IP1 A;  2GQK A;  2L5L A;  2K8S A;  1MTC A;  2LNT A;  2PER A;  3TOU A;  1NW2 A;  4I97 A;  4GSS A;  3FY7 A;  3DD3 A;  2I9H A;  3A2X A;  3VWV A;  2K8V A;  1X9W B;  3GA4 A;  1F2E A;  5F06 A;  2OJL A;  4KSO A;  3GX0 A;  3BOA A;  4K6X A;  1RQM A;  3ZZX A;  3SWL A;  3GX8 A;  3FKF A;  5GSS A;  1ZGN A;  5GST A;  3GFK A;  2HYX A;  3ZL5 A;  4L0W A;  1O8X A;  1NHY A;  1LJR A;  1X9S B;  3D5J A;  1LBK A;  4NPB A;  4LL1 B;  4KW6 A;  5D9T A;  1U88 A;  2O7K A;  1WMJ A;  2V6O A;  3DWV A;  4WF4 A;  3I9V 2;  3GKN A;  1EP7 A;  1VRS D;  1OC9 B;  1SU9 A;  2HRA A;  3ZIT A;  3F3R A;  3US3 A;  2NVL A;  1GTI A;  3TOT A;  4AJ6 A;  3EWL A;  4BA7 A;  4MLY A;  4BVY A;  4EE0 A;  4XCS A;  2MMZ A;  4F2I A;  4OWY A;  2OA7 A;  2REM A;  5G30 A;  1KEB A;  3TCO A;  4FQU A;  4MF7 A;  2J23 A;  5A4U A;  3IC4 A;  4QQ7 A;  3H93 A;  5JCU A;  2B7K A;  4DEJ A;  1AAZ A;  4MPF A;  4DSS B;  3N5O A;  5G5F A;  2PUK C;  2VO4 A;  5DAL A;  4NXI A;  2JAC A;  1G6Y A;  2RII A;  1ZYE A;  3QFA C;  4AGS A;  5HR2 A;  1Q4J A;  2LJA A;  4KSM A;  5GAP D;  5D73 A;  3KJY A;  1T8E B;  2R6K A;  4Q5F A;  3RPP A;  3M8N A;  1SKW B;  1THX A;  1TJD A;  3QD9 A;  2J9H A;  4F0C A;  2WB9 A;  4TKY A;  1ML6 A;  1XZO A;  1XOB A;  2GDR A;  1T7P B;  4HJM A;  2VD1 A;  4K7N A;  5DJM A;  1N2A A;  4USS A;  1V98 A;  4KE3 A;  3WYW A;  3ZFB A;  5IOW A;  1JLV A;  5H5Q A;  3DML A;  4KB3 A;  3NIV A;  3FR6 A;  4BVX A;  4POM A;  4EDZ A;  2A2R A;  1FB0 A;  1R4W A;  1JZO A;  5ECR B;  3TJB A;  4MF6 A;  3VUR A;  2VAF A;  4GTU A;  4TXO A;  1XFL A;  4LA1 A;  4KDX A;  5ECQ B;  2XC2 A;  5J41 A;  4TVE A;  5CRD A;  3WD6 A;  1JZD A;  2LKU A;  4OO4 A;  4DSR A;  4L5O A;  2HT9 A;  3QFB C;  3M0F A;  2NTO A;  4NWY A;  2GLR A;  1EWX A;  1G0T A;  4EXJ A;  5D93 A;  1SL1 B;  6GST A;  5EPF A;  1OC9 A;  5CRH A;  2ZUP A;  4MH2 A;  2CAI A;  5B6N A;  1Y25 A;  3HCZ A;  2IN3 A;  1PRX A;  2DIZ A;  1AC1 A;  3L9V A;  3FYG A;  2YAN A;  4ECC A;  2FLS A;  3GNJ A;  2CAQ A;  4I2T A;  2IMF A;  3EIN A;  4F9Z A;  3GTU A;  1EOH A;  2F9S A;  2DBC A;  2IJY A;  3QAG A;  1HD2 A;  2YWO A;  2QC7 A;  4HS1 A;  1WOU A;  1A8L A;  1A2J A;  2OAD A;  1WE0 A;  2HSM B;  4AJ7 A;  1XXU A;  2E2G A;  2OE3 A;  5E59 A;  2OBK A;  1QFN A;  3FR9 A;  4DSS A;  4YH2 A;  3IAM 2;  3P90 A;  2RLI A;  2EIQ A;  2LJR A;  4FYB A;  3ZYW A;  4PGT A;  2GS3 A;  2KLX A;  2YWN A;  3IA1 A;  3HXS A;  3GHA A;  1G6W A;  3TDG A;  4JR6 A;  1GNW A;  4O92 A;  3MDK A;  3FK8 A;  1GUL A;  4OCE A;  1DBY A;  1TU7 A;  3CRT A;  3BJ5 A;  4ID0 A;  3DYR A;  2OBI A;  4NV2 A;  1Z7R A;  2WGR A;  2LRC A;  4GF0 A;  1Z6M A;  4K2D A;  2FUG 2;  3EVI A;  1ON4 A;  1FB6 A;  1EEJ A;  4V2M A;  1S3A A;  2PU9 C;  2MMN A;  1K3Y A;  5IOX A;  4ZBD A;  4KCE A;  1F6M C;  2B5X A;  1N8J A;  3DVX A;  2R5G A;  3HVX A;  4D73 A;  1FVK A;  1TK0 B;  4QL9 A;  4TR3 A;  1BX9 A;  2CT6 A;  3MSZ A;  5G31 A;  2CVD A;  1WJK A;  2FWF A;  2VUP A;  2HNL A;  1JLW A;  3U6V A;  4G9H A;  2H1G A;  2C0E A;  4XRA A;  3ZTL A;  3TKS C;  16GS A;  5HFG A;  4MH3 A;  2L5O A;  1TRW A;  2K9F A;  3VWU A;  1GSF A;  1GUK A;  1NHO A;  2L4C A;  2DMM A;  5ID2 A;  3TJG A;  3TRX A;  4EUY A;  5B6M A;  4WKW A;  4DVC A;  4MZB A;  1OAZ A;  2RM5 A;  5GZZ B;  3ZIV A;  2VCW A;  2EIR A;  5EVO A;  3R2Q A;  2KUC A;  2LQO A;  1A24 A;  2X99 A;  4GCI A;  1DUG A;  2R3X A;  4EKZ A;  3D22 A;  4MK3 A;  1YZX A;  2YWI A;  3KCM A;  3TRP A;  2B5Y A;  4ZB6 A;  1SK2 A;  1O73 A;  3L9U A;  1YQ1 A;  8GSS A;  1JZR A;  4ULX A;  1ABA A;  1M2D A;  1Z7P A;  5F07 A;  1M9B A;  10GS A;  3KZQ A;  4ECJ A;  4G0L A;  4O5R A;  3TJK A;  3U5R E;  5J3R A;  2OAC A;  3GL3 A;  2H6X A;  2KHP A;  1U87 A;  2HSM A;  3LOR A;  5H5S A;  3F6D A;  1ERW A;  3P8W A;  2E0Q A;  4V1A p;  1TRU A;  2N5A A;  2DJJ A;  4KGI A;  2GQL A;  3E9J B;  1SKR B;  1K0C A;  1B8X A;  2MZC A;  5IMZ A;  2HLS A;  1TOF A;  2H30 A;  2L6D A;  3DXB A;  2HQT A;  1X5D A;  3EYT A;  4MA9 A;  2G0F A;  1SK0 A;  3QMX A;  2PGT A;  1GSD A;  3RHB A;  6GSX A;  2KOK A;  2YZH A;  1ZZY A;  4HOJ A;  4Q5Q A;  1ZCP A;  5CYY A;  1QMV A;  3F6F A;  2WS2 A;  1Z9H A;  2VL3 A;  4O7H A;  5JCG A;  12GS A;  5G5E A;  2HSN B;  3CMI A;  3UAP A;  2GSR A;  4GQC A;  2H0G A;  5IMC A;  4KH7 A;  2VIM A;  2YNX A;  3VI5 A;  3VK9 A;  3EE2 A;  2F51 A;  4F82 A;  4WEY A;  1GSE A;  4XTS A;  5LCZ A;  3L4N A;  4G19 A;  2HZE B;  3HJP A;  1Z6N A;  4N10 A;  1YY7 A;  1LU4 A;  1USB A;  1XWB A;  2FHE A;  3GKK A;  3QPM A;  3QAW A;  4ZIL A;  1WPI A;  5IIZ A;  4PX1 A;  4WBR D;  5D8I A;  2RM6 A;  1EEM A;  4XIH A;  2GZZ A;  13GS A;  2CV4 A;  2MBT A;  2IWT A;  6GSW A;  2P31 A;  4IS0 A;  2P5Q A;  5B8B A;  1PGT A;  5A4W A;  1F3B A;  3KMN A;  2FA4 A;  4K1F A;  3RBT A;  3O76 A;  1F3A A;  3RHC A;  3HY2 A;  2DJ0 A;  3L78 A;  2OKA A;  3EMP A;  5CRG A;  6GSS A;  4PUR A;  4OFT A;  3QOU A;  1GLP A;  1WP0 A;  5HR1 A;  2IIY A;  3KH7 A;  1PKW A;  5FT3 A;  1GLQ A;  3F4S A;  2C3N A;  3P2A A;  3UL3 A;  2AHE A;  3ZFL A;  1OYJ A;  4EDY A;  2QKE A;  3K8N A;  2VCZ A;  3F3Q A;  3IK9 A;  3HA9 A;  3BD2 A;  4X1U A;  4IJ3 A;  3DRN A;  1SJ6 A;  5C04 A;  4HU9 A;  1WWJ A;  2ALB A;  4FIW A;  4JZQ A;  4LMV A;  1SD9 A;  4AJ8 A;  1NM3 A;  4Z7X A;  2DJ1 A;  2CX3 A;  5ELG A;  3F0I A;  4RI7 A;  1H75 A;  2DJK A;  2Z9S A;  5A5K A;  5IO2 A;  3RDW A;  2CA8 A;  2TIR A;  1K0B A;  3ZRD A;  2H66 A;  2LEG A;  4FYC A;  2HRK B;  3CSI A;  2FCH A;  2OE1 A;  4ZL9 A;  3C71 A;  2GT6 A;  3IAS 2;  3W8J A;  5HQP A;  5DVB A;  4I6X A;  1XWC A;  1AUC A;  3UVT A;  3I6A A;  1JHB A;  4NMU A;  5KN1 A;  2B1L A;  4JED A;  3TRQ A;  3C8E A;  1XWK A;  4RUV A;  1T4Z A;  3GKM A;  5IMV A;  2JZS A;  2H01 A;  1PSQ A;  3GMF A;  2LST A;  3GL5 A;  4NHW A;  3ZLP A;  1GH2 A;  3PIN A;  2IFQ A;  2F8F A;  2H71 A;  4TOP A;  4WBJ A;  2GGT A;  1IYH A;  5CP1 A;  5D9X A;  3CXG A;  1VF1 A;  1URM A;  5ECM B;  5FWG A;  1T1V A;  17GS A;  1MDK A;  2VCT A;  5D96 A;  3ZVJ A;  5JWR B;  2H73 A;  4ILF A;  1B48 A;  1BQ7 A;  2AUV A;  4MF5 A;  1TKD B;  4POB A;  1YKC A;  4IW9 A;  4HZ4 A;  3LEF A;  3VFI A;  2IME A;  1SJI A;  3DEX A;  2HSY A;  1O6J A;  1VGL A;  2BTO T;  2DLX A;  5IPH A;  1EGR A;  3JCM L;  2K6V A;  1FAA A;  3PH9 A;  2IMK A;  1MDI A;  3F9U A;  1XW5 A;  1YJ6 A;  2V41 A;  2JL4 A;  3D21 A;  4OFN A;  3TKP A;  4J56 E;  3KP8 A;  1GUM A;  1WIK A;  3KIJ A;  3M1G A;  3ISO A;  2H1B A;  1U3I A;  5EY6 A;  3ZMK A;  3GST A; 
#chains in the Genus database with same CATH topology
 3UVH A;  1V9W A;  3SBC A;  4BL7 B;  5KOW A;  3LXZ A;  4V2L A;  1S3D A;  2LRT A;  1MD4 A;  4KDY A;  1ZL9 A;  4YQM A;  5IPG A;  2FWH A;  5AN1 A;  4I5Q A;  4OD7 A;  2DJ3 A;  2CZ2 A;  2WW2 A;  5ECH B;  4HU7 A;  3ZML A;  3IR4 A;  4DSQ A;  3HJO A;  1XVQ A;  1I5G A;  3UBK A;  4GWR A;  2HRK A;  4EVM A;  3D0Z A;  1UN2 A;  1DE1 A;  2YJ7 A;  2D2Z A;  2WVX A;  1CQH A;  1YDK A;  4QMK A;  3QCP A;  3LWA A;  2VL2 A;  3AY8 A;  4P3Y B;  2VL2 C;  2UV8 G;  2WCI A;  2EFE A;  2E2M A;  4AF2 A;  1YEP A;  4KX4 A;  4PUF C;  4HUA A;  3LYK A;  2WUL A;  3EC3 A;  1HNA A;  1UC7 A;  1YF0 A;  3ME7 A;  2ZCT A;  5DJL A;  3FZ4 A;  5CAX A;  2C0G A;  2YJH A;  2ON7 A;  1O8W A;  3UJ1 A;  2H76 A;  1HNC A;  1QUW A;  4GRF A;  5L71 A;  4EIP A;  5IQY A;  2A4V A;  2M80 A;  4OO5 A;  1TK8 B;  3BCI A;  4GLT A;  4XS1 A;  3PGT A;  2O5V A;  2PBJ A;  2AJQ B;  5F8B A;  1K0A A;  4JU5 A;  3MWH A;  4TR1 B;  1K0N A;  3FW2 A;  1IYI A;  2H0I A;  4I8B A;  3A3T A;  1O81 A;  4HI7 A;  3EUR A;  1EP8 A;  5GAN D;  3G7I A;  1GUH A;  2OT3 A;  1Z5Y E;  2C1Y A;  4G01 A;  1B9Y C;  4YAP A;  4TR4 A;  1ST9 A;  3IK7 A;  3HD5 A;  1BG5 A;  2K18 A;  1U6T A;  2O8V B;  2B6M A;  3EU3 A;  5J9B A;  2WW0 A;  3R3E A;  1R7H A;  1M0U A;  4E68 A;  1ZYQ B;  4V1A g;  1BG1 A;  2BJX A;  3IV4 A;  3LG6 A;  5EL8 A;  5A34 A;  2H6Y A;  2DML A;  3HMJ G;  3CSH A;  3KD0 A;  3J7Y k;  3H4K A;  5A1N B;  2LNS A;  3MAK A;  1GSU A;  3N9J A;  4K8M A;  1HQO A;  1JZW A;  4K7O A;  3NOF A;  1A2M A;  20GS A;  3H1N A;  2WZS A;  1A0R P;  5ECL B;  2VLU A;  1XWA A;  1PL2 A;  3IPZ A;  3WGD A;  2LV3 A;  5D9V A;  4EO3 A;  3OR5 A;  4HQS A;  2C0F A;  1FVJ A;  4HEA 2;  4O32 A;  2VLV A;  3F4R A;  2LS5 A;  18GS A;  4PQ1 A;  3GYK A;  1ERU A;  4G2E A;  1V2A A;  4PTS A;  5HR0 A;  3HVS A;  5F0G A;  4POK A;  2VCX A;  4RQR A;  2LJK A;  1V40 A;  2JSZ A;  3RFR C;  4K0N A;  4WXT A;  1U3A A;  1T3B A;  2X8H A;  4PNF A;  1K3O A;  2WJU A;  4CW9 A;  2H75 A;  4GQF A;  4FYU A;  4XHM A;  1FG4 A;  7GSS A;  1O7U A;  5CO3 A;  5IMD A;  5G2Z A;  4TN8 A;  2GTU A;  2O36 A;  5J4V A;  3A5I A;  3BCK A;  2L6C A;  2C80 A;  2O87 A;  2C8U A;  5J4Y A;  4CHS A;  5J40 A;  2P5R A;  1PA3 A;  3Q18 A;  2YOI A;  2VCV A;  5DBQ A;  2X49 A;  1SVM A;  4XS4 B;  1TK5 B;  1M99 A;  2PVQ A;  3GN3 A;  4TW5 A;  2MMA A;  1F37 A;  4N30 A;  4J57 E;  5HFI A;  3G7J A;  4MAB A;  3HDC A;  1GRX A;  3D6I A;  2XPE A;  2LUS A;  3KGK A;  1BJX A;  1MD3 A;  2V1M A;  4HZ2 A;  1O85 A;  1YF1 A;  5COH A;  3LYP A;  4TXV A;  1GP1 A;  2FY6 A;  4HQZ A;  4MP4 A;  3D4T A;  4F0B A;  3ERW A;  5J9C A;  5ECN B;  3LJR A;  3M3M A;  5BMU A;  4MMM A;  2GVP A;  2I1U A;  2HXK A;  3I69 A;  1H4O A;  5DCG A;  2GZY A;  3CWG A;  3GUS A;  1FOV A;  1K0O A;  2HSH A;  1PL1 A;  2H70 A;  3D4M A;  2GQM A;  1GTA A;  1KNG A;  2IL3 A;  1SVO A;  5ENU A;  2WDU A;  2X4A A;  4JR4 A;  2R37 A;  2FNO A;  5DAK B;  2O85 A;  5ECO B;  1X5E A;  14GS A;  1GWC A;  1R26 A;  1QGV A;  3MNG A;  2GST A;  1NSW A;  2LQQ A;  5IO0 A;  3IXR A;  1XVW A;  2TRX A;  2ON5 A;  4KF9 A;  3LGC A;  5J5N A;  2M46 A;  2F3M A;  4OCF A;  3UIW A;  22GS A;  3P7X A;  4BVY B;  2L59 A;  5AIV A;  1DSB A;  1SL0 B;  3F8U A;  4JE1 A;  1OKT A;  1SK1 A;  2I81 A;  1PN0 A;  2M72 A;  3H8Q A;  3QDN A;  5AIS A;  3W6G A;  1HNB A;  4EF0 A;  2PVO C;  1DE2 A;  2VKZ G;  2EFC A;  3W8S A;  2YN1 A;  1T00 A;  4FO5 A;  1MDJ A;  4J2F A;  3ERG A;  1B4Q A;  1AQX A;  2P0G A;  5DAL B;  2KP2 A;  2V2G A;  1OVN A;  2HI7 A;  4POL A;  1I1I P;  5B8A A;  3ZRE A;  3QAV A;  6GSV A;  5DQY A;  4IEL A;  1KTE A;  2NBS A;  4YKF A;  5AIX A;  2BMX A;  3APO A;  3TJF A;  9GSS A;  3IBH A;  4WR4 A;  2H1A A;  4H86 A;  4X0X A;  5H5R A;  3TJJ A;  5F05 A;  4BPY A;  2OE0 A;  3A5W A;  3FEU A;  5ABR A;  2JSY A;  3FZ5 A;  2O3E A;  4F03 A;  1GTU A;  5DCH A;  2RUF A;  1QQ2 A;  4MDC A;  2DC5 A;  3HJM A;  4WF5 A;  2VLT A;  1VF4 A;  5JCW A;  4ECI A;  2H1D A;  3CRU A;  4BVX B;  3F63 A;  2H6Z A;  2V32 A;  4PNG A;  3KTL A;  3WT1 A;  1K0D A;  3GSS A;  2WW1 A;  2JAD A;  1GL8 A;  4IQ1 A;  2DJ2 A;  1TXX A;  3VWX A;  2UZ8 A;  3H79 A;  4K7I A;  4TXO B;  4ZB8 A;  2XPD A;  3FR3 A;  1J08 A;  3C73 A;  3MIX A;  3TKQ A;  5IM9 A;  4MCU A;  3DIE A;  2HSN A;  4LMW A;  1ZYP A;  3G7Y A;  2ZNM A;  1F9M A;  1CQG A;  2PWJ A;  3TKS E;  5DAK A;  5LNK e;  1PQN A;  1WRY A;  4YKG A;  1E2Y A;  2HZE A;  4XS6 A;  3UBL A;  4Q5N A;  4L8E A;  4JRR A;  4IJI A;  3DKS A;  2I3Y A;  1RK4 A;  1TRS A;  3LFL A;  1EV4 A;  3GTU B;  4IVF A;  3VI7 A;  1J9B A;  2ES7 A;  11GS A;  3VLN A;  3KXO A;  1G7E A;  4ML1 A;  4ZL8 A;  1ZYN A;  4TRX A;  1TW9 A;  2TRC P;  3S9F A;  2IPA A;  2HZF A;  1VF3 A;  2V6K A;  4EIQ A;  5HR3 A;  4WET A;  4IKH A;  2CVK A;  2CZ3 A;  4K0G A;  2YP6 A;  2B7J A;  2H72 A;  2JZT A;  4ACS A;  2QA2 A;  1Y6E A;  1SYX A;  4FH8 A;  1SVL A;  4MJC A;  3IDV A;  3ED3 A;  4QL7 A;  2H0H A;  3PPU A;  5FHI A;  1RW1 A;  6GSY A;  4YQU A;  4LL4 B;  1GSQ A;  5ECS A;  1PX7 A;  5CRW A;  2FD3 A;  3GIX A;  4TR0 A;  1B9X C;  2PN8 A;  1G7O A;  1VF2 A;  3GKX A;  1BED A;  1W4V A;  4OMV A;  4MJE A;  5KN2 A;  3CTG A;  3HYP A;  4GSN A;  1PD2 1;  2H19 A;  1XCC A;  2X8C A;  2XHF A;  3IRA A;  3LXT A;  2RUE A;  5D9W A;  3HZ8 A;  2O89 A;  3KMO A;  3EU4 A;  2QA1 A;  1XOA A;  1XPV A;  1M7T A;  4KND A;  2R4V A;  1X5C A;  4HDE A;  1JFU A;  3IHQ A;  4HJ2 A;  3QR6 A;  3E0U A;  4KA0 A;  1GTB A;  4EL1 A;  4D73 B;  2X8G A;  2LRN A;  1TI3 A;  2C0D A;  3M9K A;  5ELA A;  3ZVJ D;  2EFH A;  1E6B A;  5C00 A;  2JU5 A;  5JWQ B;  2PPT A;  4ZBA A;  1A23 A;  4MZW A;  3UEM A;  3DVW A;  4X43 A;  2FA8 A;  1GNE A;  1W89 A;  1PMT A;  3L9S A;  4OFM A;  1YEX A;  5CNW A;  5ID2 B;  1A8Y A;  1SD8 A;  4BWQ A;  1K3L A;  5KN0 A;  4E8H A;  3FHK A;  4K9Z A;  3FZ9 A;  5ECI B;  1XW6 A;  1THO A;  1OC8 A;  2NDO A;  4YAV A;  2QGV A;  4G10 A;  3UAR A;  3FZA A;  5JWO B;  4MJA A;  3GV1 A;  3ZIJ A;  1R5A A;  3GRX A;  1PX6 A;  3HVV A;  1YKA A;  2WVZ A;  3CYN A;  1AIU A;  3CBU A;  1EZK A;  2H8L A;  5IMF A;  5ECK B;  1SYR A;  2AV4 A;  2VOC A;  1XWG A;  2IMI A;  1V58 A;  1UA5 A;  1FW1 A;  3HZ4 A;  4NV5 A;  1FOH A;  2DSA A;  1I9D A;  2C4J A;  2HE3 A;  2HRN A;  3G9B A;  2GSQ A;  1S3R A;  2R2J A;  4Z2T A;  2HRF A;  5B7C A;  1AW9 A;  3ERF A;  1PKZ A;  4N0V A;  1KBN A;  3A2W A;  2F8A A;  1J0F A;  2NPB A;  1OE7 A;  3APQ A;  4IBP A;  1TTZ A;  5LD0 A;  4MZC A;  2FGX A;  2HFD A;  2B5E A;  2L4Q A;  1GSY A;  4ZB9 A;  3DGQ A;  3RGB C;  4XRD A;  3IC8 A;  4ICY A;  2WRT A;  2YWM A;  1M2B A;  4BL7 A;  3CQF A;  5HFK A;  2FWE A;  3VPQ A;  1N25 A;  3O6T A;  1K0M A;  4Q5R A;  4YQV A;  1OKD A;  4IP6 A;  3APS A;  1S3C A;  2MYG A;  4G0K A;  3GUR A;  1EGO A;  2A2S A;  3CSJ A;  1ERV A;  1XW9 A;  3LSZ A;  2GZP A;  2H74 A;  4RI6 A;  1M2A A;  4N0Z A;  1OE8 A;  5ECP B;  3M9J A;  3RAZ A;  1A2L A;  3KH9 A;  4JBB A;  1X9M B;  2AB6 A;  4K5R A;  2CX4 A;  2R0G A;  3TKR A;  5J4U A;  1PN9 A;  1FHE A;  2C3Q A;  4KCA A;  3TKS A;  3WGX A;  4ZBB A;  4ZIJ A;  2N5F A;  2IMD A;  1SL2 B;  1X0R A;  1XBS A;  4GST A;  2VL9 A;  5CRE A;  3VWW A;  2G2Q A;  1QXH A;  5A4V A;  3J7Y b;  1AXD A;  1C72 A;  4W66 A;  3C7M A;  3KM6 A;  3V1W A;  2EC4 A;  2YV9 A;  2WFC A;  3TGZ A;  2VCQ A;  3TB2 A;  4BWS A;  4TR1 A;  3LQ7 A;  4RQX A;  2PMT A;  4HSC X;  2LTK A;  1V57 A;  4ISD A;  4KDU A;  4EC0 A;  3I43 A;  4PXO A;  3KP9 A;  5DDL A;  1R5P A;  2C3T A;  1TI1 A;  1QK8 A;  1ERT A;  3VPT A;  2YPM A;  2XBQ A;  3GH9 A;  3EMX A;  3Q74 A;  4L5L A;  4KUN A;  3UMA A;  6GSU A;  1TRV A;  4MNN A;  3GH6 A;  4NHZ A;  2AYT A;  1YVL A;  3TUE A;  3C1S A;  2B1K A;  4MPG A;  3UOM A;  4PUA A;  3IE3 A;  4K2X A;  1ZOF A;  4WR5 A;  3WGE A;  4ECB A;  4IHU A;  2EIO A;  2YCD A;  4PQI A;  1HYU A;  2X64 A;  1ILO A;  2L57 A;  1SEN A;  1AQV A;  5A1N A;  4CDO A;  4KAE A;  2QSI A;  1TU8 A;  3E3E A;  2DIY A;  2XBI A;  2KP1 A;  1M9A A;  2E7P A;  1YEW C;  2GSS A;  1SJZ A;  3WT2 A;  4PQH A;  2WZ9 A;  2VM1 A;  1BAY A;  3HKR A;  4LLR A;  3PR8 A;  1SKS B;  1B4P A;  3RPN A;  2YV7 A;  5E4W A;  4AKX B;  1GSS A;  1Z3E A;  3HHV A;  1OC3 A;  3O3T A;  1A0F A;  1UVZ A;  5DQS A;  4E8E A;  2IFQ B;  3BBY A;  4ML6 A;  1AQW A;  5G1K A;  3FRC A;  1XIY A;  3L0H A;  3Q19 A;  2YZU A;  4IGJ A;  4IN0 A;  1ACV A;  1MEK A;  2FWG A;  4I2U A;  5G1L A;  2H1L A;  2CVB A;  3KTB A;  4G0I A;  1BYE A;  2MMO A;  4V2N A;  4N11 A;  1EV9 A;  2VD0 A;  3C1R A;  3ME8 A;  3HVN A;  3Q6O A;  1ZMA A;  3A2V A;  4L0U A;  5INY A;  4MJB A;  4ZL7 A;  19GS A;  2MBS A;  3NZN A;  4PI2 C;  1T4Y A;  4ZXG A;  2B3S A;  4GXZ A;  2GT5 A;  1EOG A;  3F4T A;  2JZR A;  1M3J A;  2N5B A;  3IOS A;  5KEJ A;  1TP9 A;  3CTF A;  4NAX A;  2VM2 A;  2I4A A;  5IMA A;  4IQA A;  5KN3 A;  1FO5 A;  3KEB A;  1TDI A;  1Q98 A;  2AAW A;  2CQ9 A;  5AGY A;  4XS4 A;  4IP1 A;  2GQK A;  2L5L A;  4AKH A;  2K8S A;  1MTC A;  2LNT A;  2PER A;  3TOU A;  3CHX C;  1NW2 A;  4I97 A;  4GSS A;  3FY7 A;  3DD3 A;  2I9H A;  3A2X A;  3VWV A;  2K8V A;  1X9W B;  3GA4 A;  1F2E A;  5F06 A;  2OJL A;  4KSO A;  3GX0 A;  3BOA A;  4K6X A;  1RQM A;  3ZZX A;  3SWL A;  3GX8 A;  3FKF A;  5GSS A;  1ZGN A;  5GST A;  3GFK A;  2HYX A;  3ZL5 A;  4L0W A;  1O8X A;  1NHY A;  1LJR A;  1X9S B;  3D5J A;  1LBK A;  4NPB A;  4LL1 B;  4KW6 A;  5D9T A;  4O5U A;  1M3I A;  1U88 A;  2O7K A;  5A5H B;  1WMJ A;  2V6O A;  3DWV A;  4WF4 A;  3I9V 2;  3GKN A;  1EP7 A;  1VRS D;  1OC9 B;  1Y1U A;  1SU9 A;  2HRA A;  3ZIT A;  3LW9 A;  3F3R A;  3US3 A;  2NVL A;  1GTI A;  3TOT A;  4Z2U A;  4AJ6 A;  3EWL A;  4BA7 A;  4MLY A;  4BVY A;  4AKG A;  4EE0 A;  4XCS A;  2MMZ A;  4F2I A;  4OWY A;  2OA7 A;  2REM A;  3IHG A;  5G30 A;  1KEB A;  3TCO A;  2R0P A;  4FQU A;  4MF7 A;  4ZB7 A;  2J23 A;  5A4U A;  3IC4 A;  4QQ7 A;  2DKH A;  3H93 A;  5JCU A;  2B7K A;  4DEJ A;  1AAZ A;  4MPF A;  4GDF A;  4DSS B;  3N5O A;  5G5F A;  1PFO A;  2PUK C;  2VO4 A;  5DAL A;  4NXI A;  2JAC A;  1G6Y A;  2RII A;  1ZYE A;  3QFA C;  4AGS A;  5HR2 A;  4N3Z A;  1Q4J A;  2LJA A;  4KSM A;  5GAP D;  5D73 A;  3KJY A;  1T8E B;  2R6K A;  4Q5F A;  3RPP A;  2WW3 A;  3M8N A;  5A34 B;  1SKW B;  1THX A;  1TJD A;  3QD9 A;  2J9H A;  4F0C A;  2WB9 A;  4O5Q A;  4TKY A;  1ML6 A;  1XZO A;  1XOB A;  2GDR A;  1T7P B;  4HJM A;  2VD1 A;  4K7N A;  5DJM A;  1N2A A;  4USS A;  1V98 A;  4KE3 A;  3WYW A;  3ZFB A;  5IOW A;  1JLV A;  5H5Q A;  3DML A;  4KB3 A;  3NIV A;  3FR6 A;  4BVX A;  4POM A;  4EDZ A;  2A2R A;  1FB0 A;  1R4W A;  4PI0 C;  1JZO A;  5ECR B;  3TJB A;  4MF6 A;  3VUR A;  2VAF A;  4GTU A;  4TXO A;  1XFL A;  4LA1 A;  4KDX A;  5ECQ B;  2XC2 A;  5J41 A;  4TVE A;  5CRD A;  3WD6 A;  5A5H A;  1JZD A;  2LKU A;  4OO4 A;  4DSR A;  4L5O A;  2HT9 A;  3QFB C;  3M0F A;  2NTO A;  4NWY A;  2GLR A;  1EWX A;  1G0T A;  4EXJ A;  5D93 A;  1SL1 B;  6GST A;  5EPF A;  1OC9 A;  5CRH A;  2ZUP A;  4MH2 A;  2CAI A;  5B6N A;  1Y25 A;  3HCZ A;  2IN3 A;  1PRX A;  4FXY P;  2DIZ A;  1AC1 A;  3L9V A;  3FYG A;  2YAN A;  4ECC A;  4CY8 A;  2FLS A;  3GNJ A;  2CAQ A;  4I2T A;  2IMF A;  3EIN A;  4F9Z A;  3GTU A;  1EOH A;  2F9S A;  2DBC A;  2IJY A;  3QAG A;  1HD2 A;  2YWO A;  2QC7 A;  3EPT A;  4AI6 A;  4HS1 A;  1WOU A;  1A8L A;  1A2J A;  2OAD A;  4A5P A;  1WE0 A;  2HSM B;  4AJ7 A;  1XXU A;  2E2G A;  2OE3 A;  5E59 A;  2OBK A;  1QFN A;  3FR9 A;  5BRT A;  4DSS A;  4YH2 A;  3IAM 2;  3P90 A;  2RLI A;  2EIQ A;  2LJR A;  4FYB A;  3ZYW A;  4PGT A;  2GS3 A;  2KLX A;  2YWN A;  3IA1 A;  3HXS A;  3GHA A;  1G6W A;  3TDG A;  4JR6 A;  1GNW A;  4O92 A;  3MDK A;  3FK8 A;  1GUL A;  4OCE A;  1DBY A;  1TU7 A;  3CRT A;  3BJ5 A;  4ID0 A;  3DYR A;  2OBI A;  4NV2 A;  1Z7R A;  2WGR A;  2LRC A;  4GF0 A;  1Z6M A;  4K2D A;  2FUG 2;  5BMU B;  3EVI A;  1ON4 A;  1FB6 A;  4Z2R A;  1EEJ A;  4V2M A;  1S3A A;  2PU9 C;  2MMN A;  1K3Y A;  5IOX A;  4ZBD A;  4KCE A;  1F6M C;  2B5X A;  1N8J A;  3DVX A;  4AKI A;  2R5G A;  3HVX A;  4D73 A;  1FVK A;  1TK0 B;  4QL9 A;  4TR3 A;  1BX9 A;  2CT6 A;  3MSZ A;  5G31 A;  2CVD A;  1WJK A;  2FWF A;  2VUP A;  2HNL A;  1JLW A;  3U6V A;  4G9H A;  2H1G A;  2C0E A;  4XRA A;  3ZTL A;  3TKS C;  16GS A;  5HFG A;  4MH3 A;  2L5O A;  1TRW A;  2K9F A;  3VWU A;  1GSF A;  1GUK A;  1NHO A;  2L4C A;  2DMM A;  5ID2 A;  3TJG A;  3TRX A;  4EUY A;  5B6M A;  4WKW A;  4DVC A;  4MZB A;  1OAZ A;  2RM5 A;  5GZZ B;  1XG8 A;  3ZIV A;  2VCW A;  2EIR A;  5EVO A;  3R2Q A;  2KUC A;  2LQO A;  1A24 A;  2X99 A;  4GCI A;  1DUG A;  2R3X A;  4EKZ A;  3D22 A;  4MK3 A;  1S4B P;  1YZX A;  2YWI A;  3KCM A;  3TRP A;  2B5Y A;  4ZB6 A;  1SK2 A;  1O73 A;  3L9U A;  1YQ1 A;  8GSS A;  1JZR A;  4ULX A;  1ABA A;  1M2D A;  1Z7P A;  5F07 A;  2EFD A;  1M9B A;  10GS A;  3KZQ A;  4ECJ A;  4G0L A;  4O5R A;  3TJK A;  3U5R E;  5J3R A;  2OAC A;  3GL3 A;  2H6X A;  2KHP A;  1U87 A;  2HSM A;  3LOR A;  5H5S A;  3F6D A;  1ERW A;  5KOX A;  3P8W A;  2E0Q A;  4V1A p;  1TRU A;  4K5S A;  2N5A A;  2DJJ A;  4KGI A;  2GQL A;  3E9J B;  1SKR B;  1K0C A;  1B8X A;  2MZC A;  5IMZ A;  2A4H A;  2HLS A;  1TOF A;  2H30 A;  2L6D A;  3DXB A;  2HQT A;  1X5D A;  3EYT A;  4MA9 A;  2G0F A;  1SK0 A;  3QMX A;  2PGT A;  1GSD A;  3RHB A;  2WVY A;  6GSX A;  2KOK A;  4X4J A;  2YZH A;  4BIK A;  1ZZY A;  4HOJ A;  4Q5Q A;  1ZCP A;  5CYY A;  1QMV A;  3F6F A;  2WS2 A;  1Z9H A;  2VL3 A;  4O7H A;  5JCG A;  12GS A;  5G5E A;  2HSN B;  3CMI A;  3UAP A;  2GSR A;  4GQC A;  2H0G A;  5IMC A;  4KH7 A;  2VIM A;  2R0C A;  2YNX A;  3VI5 A;  3VK9 A;  3EE2 A;  1TXU A;  2F51 A;  4F82 A;  4WEY A;  1GSE A;  4XTS A;  5LCZ A;  3L4N A;  4G19 A;  2HZE B;  3HJP A;  1Z6N A;  4N10 A;  1YY7 A;  1LU4 A;  1USB A;  1XWB A;  2FHE A;  3GKK A;  3QPM A;  3QAW A;  4ZIL A;  1WPI A;  5IIZ A;  4PX1 A;  4WBR D;  5D8I A;  2RM6 A;  1EEM A;  4XIH A;  2GZZ A;  13GS A;  2CV4 A;  2MBT A;  2IWT A;  6GSW A;  2P31 A;  4IS0 A;  2P5Q A;  5B8B A;  1PGT A;  5A4W A;  1F3B A;  3KMN A;  2FA4 A;  3FMW A;  3RBT A;  3O76 A;  1F3A A;  4K1F A;  3RHC A;  3HY2 A;  2DJ0 A;  3L78 A;  4CY6 A;  2OKA A;  3EMP A;  5CRG A;  6GSS A;  4PUR A;  4OFT A;  3QOU A;  1GLP A;  1WP0 A;  5HR1 A;  2IIY A;  3KH7 A;  1PKW A;  5FT3 A;  1GLQ A;  3F4S A;  2C3N A;  3P2A A;  3UL3 A;  2AHE A;  3ZFL A;  1OYJ A;  4EDY A;  2QKE A;  3K8N A;  2VCZ A;  3F3Q A;  3IK9 A;  3HA9 A;  3BD2 A;  4X1U A;  4IJ3 A;  1BF5 A;  3DRN A;  1SJ6 A;  5C04 A;  4HU9 A;  1WWJ A;  2ALB A;  4FIW A;  4JZQ A;  4LMV A;  1SD9 A;  4AJ8 A;  1NM3 A;  4Z7X A;  2DJ1 A;  2CX3 A;  5ELG A;  3F0I A;  4RI7 A;  1H75 A;  2DJK A;  2Z9S A;  5A5K A;  5IO2 A;  3RDW A;  2CA8 A;  2TIR A;  1K0B A;  3ZRD A;  2H66 A;  2LEG A;  4FYC A;  2HRK B;  3CSI A;  2FCH A;  2DKI A;  2OE1 A;  3TU3 B;  2WVX B;  3MYD A;  4ZL9 A;  3C71 A;  2GT6 A;  3IAS 2;  3W8J A;  5HQP A;  5DVB A;  4I6X A;  1XWC A;  1AUC A;  3UVT A;  3I6A A;  1JHB A;  4NMU A;  5KN1 A;  2B1L A;  4JED A;  3TRQ A;  3C8E A;  5J47 A;  1XWK A;  4RUV A;  1T4Z A;  3GKM A;  5IMV A;  2JZS A;  2H01 A;  1PSQ A;  3GMF A;  2LST A;  3GL5 A;  4NHW A;  3ZLP A;  1GH2 A;  3PIN A;  2IFQ A;  2F8F A;  2H71 A;  4TOP A;  4WBJ A;  2GGT A;  1IYH A;  5CP1 A;  5D9X A;  3CXG A;  1VF1 A;  1URM A;  5ECM B;  5FWG A;  1T1V A;  4PHZ C;  17GS A;  1MDK A;  2VCT A;  5D96 A;  3ZVJ A;  5JWR B;  2H73 A;  4ILF A;  1B48 A;  1BQ7 A;  2AUV A;  4MF5 A;  1TKD B;  4POB A;  1YKC A;  4IW9 A;  4HZ4 A;  3LEF A;  3VFI A;  2IME A;  1SJI A;  3DEX A;  2HSY A;  1O6J A;  1VGL A;  2BTO T;  2DLX A;  5IPH A;  1EGR A;  3JCM L;  2K6V A;  1FAA A;  3PH9 A;  2IMK A;  1MDI A;  3F9U A;  1XW5 A;  1YJ6 A;  2V41 A;  2JL4 A;  3D21 A;  4OFN A;  3TKP A;  4J56 E;  3KP8 A;  1GUM A;  1WIK A;  2A2P A;  3KIJ A;  3M1G A;  3ISO A;  2H1B A;  1U3I A;  5EY6 A;  3ZMK A;  3GST A; 
#chains in the Genus database with same CATH homology
 3UVH A;  1V9W A;  3SBC A;  4BL7 B;  5KOW A;  3LXZ A;  4V2L A;  1S3D A;  2LRT A;  1MD4 A;  4KDY A;  1ZL9 A;  4YQM A;  5IPG A;  2FWH A;  5AN1 A;  4I5Q A;  4OD7 A;  2DJ3 A;  2CZ2 A;  5ECH B;  4HU7 A;  3ZML A;  3IR4 A;  4DSQ A;  3HJO A;  1XVQ A;  1I5G A;  3UBK A;  4GWR A;  2HRK A;  4EVM A;  3D0Z A;  1UN2 A;  1DE1 A;  2YJ7 A;  2D2Z A;  1CQH A;  1YDK A;  4QMK A;  3QCP A;  3LWA A;  2VL2 A;  3AY8 A;  4P3Y B;  2VL2 C;  2UV8 G;  2WCI A;  2EFE A;  2E2M A;  4AF2 A;  1YEP A;  4KX4 A;  4PUF C;  4HUA A;  3LYK A;  2WUL A;  3EC3 A;  1HNA A;  1UC7 A;  1YF0 A;  3ME7 A;  2ZCT A;  5DJL A;  3FZ4 A;  5CAX A;  2C0G A;  2YJH A;  2ON7 A;  1O8W A;  3UJ1 A;  2H76 A;  1HNC A;  1QUW A;  4GRF A;  5L71 A;  4EIP A;  5IQY A;  2A4V A;  2M80 A;  4OO5 A;  1TK8 B;  3BCI A;  4GLT A;  4XS1 A;  3PGT A;  2O5V A;  2PBJ A;  2AJQ B;  5F8B A;  1K0A A;  4JU5 A;  3MWH A;  4TR1 B;  1K0N A;  3FW2 A;  1IYI A;  2H0I A;  4I8B A;  3A3T A;  1O81 A;  4HI7 A;  3EUR A;  1EP8 A;  5GAN D;  3G7I A;  1GUH A;  2OT3 A;  1Z5Y E;  2C1Y A;  4G01 A;  1B9Y C;  4YAP A;  4TR4 A;  1ST9 A;  3IK7 A;  3HD5 A;  1BG5 A;  2K18 A;  1U6T A;  2O8V B;  2B6M A;  3EU3 A;  5J9B A;  3R3E A;  1R7H A;  1M0U A;  4E68 A;  1ZYQ B;  4V1A g;  1BG1 A;  2BJX A;  3IV4 A;  3LG6 A;  5EL8 A;  5A34 A;  2H6Y A;  2DML A;  3HMJ G;  3CSH A;  3KD0 A;  3J7Y k;  3H4K A;  5A1N B;  2LNS A;  3MAK A;  1GSU A;  3N9J A;  4K8M A;  1HQO A;  1JZW A;  4K7O A;  3NOF A;  1A2M A;  20GS A;  3H1N A;  1A0R P;  5ECL B;  2VLU A;  1XWA A;  1PL2 A;  3IPZ A;  3WGD A;  2LV3 A;  5D9V A;  4EO3 A;  3OR5 A;  4HQS A;  2C0F A;  1FVJ A;  4HEA 2;  4O32 A;  2VLV A;  3F4R A;  2LS5 A;  18GS A;  4PQ1 A;  3GYK A;  1ERU A;  4G2E A;  1V2A A;  4PTS A;  5HR0 A;  3HVS A;  5F0G A;  4POK A;  2VCX A;  4RQR A;  2LJK A;  1V40 A;  2JSZ A;  4K0N A;  4WXT A;  1U3A A;  1T3B A;  2X8H A;  4PNF A;  1K3O A;  2WJU A;  4CW9 A;  2H75 A;  4GQF A;  4FYU A;  4XHM A;  1FG4 A;  7GSS A;  1O7U A;  5CO3 A;  5IMD A;  5G2Z A;  4TN8 A;  2GTU A;  5J4V A;  3A5I A;  3BCK A;  2L6C A;  2C80 A;  2O87 A;  2C8U A;  5J4Y A;  4CHS A;  5J40 A;  2P5R A;  1PA3 A;  3Q18 A;  2YOI A;  2VCV A;  5DBQ A;  2X49 A;  1SVM A;  4XS4 B;  1TK5 B;  1M99 A;  2PVQ A;  3GN3 A;  4TW5 A;  2MMA A;  1F37 A;  4N30 A;  4J57 E;  5HFI A;  3G7J A;  4MAB A;  3HDC A;  1GRX A;  3D6I A;  2XPE A;  2LUS A;  3KGK A;  1BJX A;  1MD3 A;  2V1M A;  4HZ2 A;  1O85 A;  1YF1 A;  5COH A;  3LYP A;  4TXV A;  1GP1 A;  2FY6 A;  4HQZ A;  4MP4 A;  3D4T A;  4F0B A;  3ERW A;  5J9C A;  5ECN B;  3LJR A;  3M3M A;  5BMU A;  4MMM A;  2GVP A;  2I1U A;  2HXK A;  3I69 A;  1H4O A;  5DCG A;  2GZY A;  3CWG A;  3GUS A;  1FOV A;  1K0O A;  2HSH A;  1PL1 A;  2H70 A;  3D4M A;  2GQM A;  1GTA A;  1KNG A;  2IL3 A;  1SVO A;  5ENU A;  2WDU A;  2X4A A;  4JR4 A;  2R37 A;  2FNO A;  5DAK B;  2O85 A;  5ECO B;  1X5E A;  14GS A;  1GWC A;  1R26 A;  1QGV A;  3MNG A;  2GST A;  1NSW A;  2LQQ A;  5IO0 A;  3IXR A;  1XVW A;  2TRX A;  2ON5 A;  4KF9 A;  3LGC A;  5J5N A;  2M46 A;  2F3M A;  4OCF A;  3UIW A;  22GS A;  3P7X A;  4BVY B;  2L59 A;  5AIV A;  1DSB A;  1SL0 B;  3F8U A;  4JE1 A;  1OKT A;  1SK1 A;  2I81 A;  1PN0 A;  2M72 A;  3H8Q A;  3QDN A;  5AIS A;  3W6G A;  1HNB A;  4EF0 A;  2PVO C;  1DE2 A;  2VKZ G;  2EFC A;  3W8S A;  2YN1 A;  1T00 A;  4FO5 A;  1MDJ A;  4J2F A;  3ERG A;  1B4Q A;  1AQX A;  2P0G A;  5DAL B;  2KP2 A;  2V2G A;  1OVN A;  2HI7 A;  4POL A;  5B8A A;  3ZRE A;  3QAV A;  6GSV A;  5DQY A;  4IEL A;  1KTE A;  2NBS A;  4YKF A;  5AIX A;  2BMX A;  3APO A;  3TJF A;  9GSS A;  3IBH A;  4WR4 A;  2H1A A;  4H86 A;  4X0X A;  5H5R A;  3TJJ A;  5F05 A;  4BPY A;  2OE0 A;  3A5W A;  3FEU A;  5ABR A;  2JSY A;  3FZ5 A;  4F03 A;  1GTU A;  5DCH A;  2RUF A;  1QQ2 A;  4MDC A;  2DC5 A;  3HJM A;  4WF5 A;  2VLT A;  1VF4 A;  5JCW A;  4ECI A;  2H1D A;  3CRU A;  4BVX B;  3F63 A;  2H6Z A;  2V32 A;  4PNG A;  3KTL A;  3WT1 A;  1K0D A;  3GSS A;  2JAD A;  1GL8 A;  4IQ1 A;  2DJ2 A;  1TXX A;  3VWX A;  2UZ8 A;  3H79 A;  4K7I A;  4TXO B;  4ZB8 A;  2XPD A;  3FR3 A;  1J08 A;  3C73 A;  3MIX A;  3TKQ A;  5IM9 A;  4MCU A;  3DIE A;  2HSN A;  4LMW A;  1ZYP A;  3G7Y A;  2ZNM A;  1F9M A;  1CQG A;  2PWJ A;  3TKS E;  5DAK A;  5LNK e;  1PQN A;  1WRY A;  4YKG A;  1E2Y A;  2HZE A;  4XS6 A;  3UBL A;  4Q5N A;  4L8E A;  4JRR A;  4IJI A;  3DKS A;  2I3Y A;  1RK4 A;  1TRS A;  3LFL A;  1EV4 A;  3GTU B;  4IVF A;  3VI7 A;  1J9B A;  2ES7 A;  11GS A;  3VLN A;  3KXO A;  1G7E A;  4ML1 A;  4ZL8 A;  1ZYN A;  4TRX A;  1TW9 A;  2TRC P;  3S9F A;  2IPA A;  2HZF A;  1VF3 A;  2V6K A;  4EIQ A;  5HR3 A;  4WET A;  4IKH A;  2CVK A;  2CZ3 A;  4K0G A;  2YP6 A;  2B7J A;  2H72 A;  2JZT A;  4ACS A;  2QA2 A;  1Y6E A;  1SYX A;  4FH8 A;  1SVL A;  4MJC A;  3IDV A;  3ED3 A;  4QL7 A;  2H0H A;  3PPU A;  5FHI A;  1RW1 A;  6GSY A;  4YQU A;  4LL4 B;  1GSQ A;  5ECS A;  1PX7 A;  5CRW A;  2FD3 A;  3GIX A;  4TR0 A;  1B9X C;  2PN8 A;  1G7O A;  1VF2 A;  3GKX A;  1BED A;  1W4V A;  4OMV A;  4MJE A;  5KN2 A;  3CTG A;  3HYP A;  4GSN A;  1PD2 1;  2H19 A;  1XCC A;  2X8C A;  2XHF A;  3IRA A;  3LXT A;  2RUE A;  5D9W A;  3HZ8 A;  2O89 A;  3KMO A;  3EU4 A;  2QA1 A;  1XOA A;  1M7T A;  1XPV A;  4KND A;  2R4V A;  1X5C A;  4HDE A;  1JFU A;  3IHQ A;  4HJ2 A;  3QR6 A;  3E0U A;  4KA0 A;  1GTB A;  4EL1 A;  4D73 B;  2X8G A;  2LRN A;  1TI3 A;  2C0D A;  3M9K A;  5ELA A;  3ZVJ D;  2EFH A;  1E6B A;  5C00 A;  2JU5 A;  5JWQ B;  2PPT A;  4ZBA A;  1A23 A;  4MZW A;  3UEM A;  3DVW A;  4X43 A;  2FA8 A;  1GNE A;  1W89 A;  1PMT A;  3L9S A;  4OFM A;  1YEX A;  5CNW A;  5ID2 B;  1A8Y A;  1SD8 A;  4BWQ A;  1K3L A;  5KN0 A;  4E8H A;  3FHK A;  4K9Z A;  3FZ9 A;  5ECI B;  1XW6 A;  1THO A;  1OC8 A;  2NDO A;  4YAV A;  2QGV A;  4G10 A;  3UAR A;  3FZA A;  5JWO B;  4MJA A;  3GV1 A;  3ZIJ A;  1R5A A;  3GRX A;  1PX6 A;  3HVV A;  1YKA A;  3CYN A;  1AIU A;  3CBU A;  1EZK A;  2H8L A;  5IMF A;  5ECK B;  1SYR A;  2AV4 A;  2VOC A;  1XWG A;  2IMI A;  1V58 A;  1UA5 A;  1FW1 A;  3HZ4 A;  4NV5 A;  1FOH A;  2DSA A;  1I9D A;  2C4J A;  2HE3 A;  2HRN A;  3G9B A;  2GSQ A;  2R2J A;  4Z2T A;  2HRF A;  5B7C A;  1AW9 A;  3ERF A;  1PKZ A;  4N0V A;  1KBN A;  3A2W A;  2F8A A;  1J0F A;  2NPB A;  1OE7 A;  3APQ A;  4IBP A;  1TTZ A;  5LD0 A;  4MZC A;  2FGX A;  2HFD A;  2B5E A;  2L4Q A;  1GSY A;  4ZB9 A;  3DGQ A;  4XRD A;  3IC8 A;  4ICY A;  2WRT A;  2YWM A;  1M2B A;  4BL7 A;  5HFK A;  2FWE A;  3VPQ A;  1N25 A;  3O6T A;  1K0M A;  4Q5R A;  4YQV A;  1OKD A;  4IP6 A;  3APS A;  1S3C A;  2MYG A;  4G0K A;  3GUR A;  1EGO A;  2A2S A;  3CSJ A;  1ERV A;  1XW9 A;  3LSZ A;  2GZP A;  2H74 A;  4RI6 A;  1M2A A;  4N0Z A;  1OE8 A;  5ECP B;  3M9J A;  3RAZ A;  1A2L A;  3KH9 A;  4JBB A;  1X9M B;  2AB6 A;  4K5R A;  2CX4 A;  2R0G A;  3TKR A;  5J4U A;  1PN9 A;  1FHE A;  2C3Q A;  4KCA A;  3TKS A;  3WGX A;  4ZBB A;  4ZIJ A;  2N5F A;  2IMD A;  1SL2 B;  1X0R A;  1XBS A;  4GST A;  2VL9 A;  5CRE A;  3VWW A;  2G2Q A;  1QXH A;  5A4V A;  3J7Y b;  1AXD A;  1C72 A;  4W66 A;  3C7M A;  3KM6 A;  3V1W A;  2EC4 A;  2YV9 A;  2WFC A;  3TGZ A;  2VCQ A;  3TB2 A;  4BWS A;  4TR1 A;  3LQ7 A;  4RQX A;  2PMT A;  2LTK A;  1V57 A;  4ISD A;  4KDU A;  4EC0 A;  3I43 A;  4PXO A;  3KP9 A;  5DDL A;  1R5P A;  2C3T A;  1TI1 A;  1QK8 A;  1ERT A;  3VPT A;  2YPM A;  2XBQ A;  3GH9 A;  3EMX A;  3Q74 A;  4L5L A;  4KUN A;  3UMA A;  6GSU A;  1TRV A;  4MNN A;  3GH6 A;  4NHZ A;  2AYT A;  1YVL A;  3TUE A;  3C1S A;  2B1K A;  4MPG A;  3UOM A;  4PUA A;  3IE3 A;  4K2X A;  1ZOF A;  4WR5 A;  3WGE A;  4ECB A;  4IHU A;  2EIO A;  2YCD A;  4PQI A;  1HYU A;  2X64 A;  1ILO A;  2L57 A;  1SEN A;  1AQV A;  5A1N A;  4CDO A;  4KAE A;  2QSI A;  1TU8 A;  3E3E A;  2DIY A;  2XBI A;  2KP1 A;  1M9A A;  2E7P A;  2GSS A;  1SJZ A;  3WT2 A;  4PQH A;  2WZ9 A;  2VM1 A;  1BAY A;  3HKR A;  4LLR A;  3PR8 A;  1SKS B;  1B4P A;  3RPN A;  2YV7 A;  5E4W A;  4AKX B;  1GSS A;  1Z3E A;  3HHV A;  1OC3 A;  3O3T A;  1A0F A;  1UVZ A;  5DQS A;  4E8E A;  2IFQ B;  3BBY A;  4ML6 A;  1AQW A;  5G1K A;  3FRC A;  1XIY A;  3L0H A;  3Q19 A;  2YZU A;  4IGJ A;  4IN0 A;  1ACV A;  1MEK A;  2FWG A;  4I2U A;  5G1L A;  2H1L A;  2CVB A;  3KTB A;  4G0I A;  1BYE A;  2MMO A;  4V2N A;  4N11 A;  1EV9 A;  2VD0 A;  3C1R A;  3ME8 A;  3Q6O A;  1ZMA A;  3A2V A;  4L0U A;  5INY A;  4MJB A;  4ZL7 A;  19GS A;  2MBS A;  3NZN A;  1T4Y A;  4ZXG A;  2B3S A;  4GXZ A;  2GT5 A;  1EOG A;  3F4T A;  2JZR A;  2N5B A;  3IOS A;  5KEJ A;  1TP9 A;  3CTF A;  4NAX A;  2VM2 A;  2I4A A;  5IMA A;  4IQA A;  5KN3 A;  1FO5 A;  3KEB A;  1TDI A;  1Q98 A;  2AAW A;  2CQ9 A;  5AGY A;  4XS4 A;  4IP1 A;  2GQK A;  2L5L A;  4AKH A;  2K8S A;  1MTC A;  2LNT A;  2PER A;  3TOU A;  1NW2 A;  4I97 A;  4GSS A;  3FY7 A;  3DD3 A;  2I9H A;  3A2X A;  3VWV A;  2K8V A;  1X9W B;  3GA4 A;  1F2E A;  5F06 A;  2OJL A;  4KSO A;  3GX0 A;  3BOA A;  4K6X A;  1RQM A;  3ZZX A;  3SWL A;  3GX8 A;  3FKF A;  5GSS A;  1ZGN A;  5GST A;  3GFK A;  2HYX A;  3ZL5 A;  4L0W A;  1O8X A;  1NHY A;  1LJR A;  1X9S B;  3D5J A;  1LBK A;  4NPB A;  4LL1 B;  4KW6 A;  5D9T A;  4O5U A;  1U88 A;  2O7K A;  5A5H B;  1WMJ A;  2V6O A;  3DWV A;  4WF4 A;  3I9V 2;  3GKN A;  1EP7 A;  1VRS D;  1OC9 B;  1Y1U A;  1SU9 A;  2HRA A;  3ZIT A;  3LW9 A;  3F3R A;  3US3 A;  2NVL A;  1GTI A;  3TOT A;  4Z2U A;  4AJ6 A;  3EWL A;  4BA7 A;  4MLY A;  4BVY A;  4AKG A;  4EE0 A;  4XCS A;  2MMZ A;  4F2I A;  4OWY A;  2OA7 A;  2REM A;  3IHG A;  5G30 A;  1KEB A;  3TCO A;  2R0P A;  4FQU A;  4MF7 A;  4ZB7 A;  2J23 A;  5A4U A;  3IC4 A;  4QQ7 A;  2DKH A;  3H93 A;  5JCU A;  2B7K A;  4DEJ A;  1AAZ A;  4MPF A;  4GDF A;  4DSS B;  3N5O A;  5G5F A;  2PUK C;  2VO4 A;  5DAL A;  4NXI A;  2JAC A;  1G6Y A;  2RII A;  1ZYE A;  3QFA C;  4AGS A;  5HR2 A;  4N3Z A;  1Q4J A;  2LJA A;  4KSM A;  5GAP D;  5D73 A;  3KJY A;  1T8E B;  2R6K A;  4Q5F A;  3RPP A;  3M8N A;  5A34 B;  1SKW B;  1THX A;  1TJD A;  3QD9 A;  2J9H A;  4F0C A;  2WB9 A;  4O5Q A;  4TKY A;  1ML6 A;  1XZO A;  1XOB A;  2GDR A;  1T7P B;  4HJM A;  2VD1 A;  4K7N A;  5DJM A;  1N2A A;  4USS A;  1V98 A;  4KE3 A;  3WYW A;  3ZFB A;  5IOW A;  1JLV A;  5H5Q A;  3DML A;  4KB3 A;  3NIV A;  3FR6 A;  4BVX A;  4POM A;  4EDZ A;  2A2R A;  1FB0 A;  1R4W A;  1JZO A;  5ECR B;  3TJB A;  4MF6 A;  3VUR A;  2VAF A;  4GTU A;  4TXO A;  1XFL A;  4LA1 A;  4KDX A;  5ECQ B;  2XC2 A;  5J41 A;  4TVE A;  5CRD A;  3WD6 A;  5A5H A;  1JZD A;  2LKU A;  4OO4 A;  4DSR A;  4L5O A;  2HT9 A;  3QFB C;  3M0F A;  2NTO A;  4NWY A;  2GLR A;  1EWX A;  1G0T A;  4EXJ A;  5D93 A;  1SL1 B;  6GST A;  5EPF A;  1OC9 A;  5CRH A;  2ZUP A;  4MH2 A;  2CAI A;  5B6N A;  1Y25 A;  3HCZ A;  2IN3 A;  1PRX A;  2DIZ A;  1AC1 A;  3L9V A;  3FYG A;  2YAN A;  4ECC A;  4CY8 A;  2FLS A;  3GNJ A;  2CAQ A;  4I2T A;  2IMF A;  3EIN A;  4F9Z A;  3GTU A;  1EOH A;  2F9S A;  2DBC A;  2IJY A;  3QAG A;  1HD2 A;  2YWO A;  2QC7 A;  3EPT A;  4AI6 A;  4HS1 A;  1WOU A;  1A8L A;  1A2J A;  2OAD A;  4A5P A;  1WE0 A;  2HSM B;  4AJ7 A;  1XXU A;  2E2G A;  2OE3 A;  5E59 A;  2OBK A;  1QFN A;  3FR9 A;  5BRT A;  4DSS A;  4YH2 A;  3IAM 2;  3P90 A;  2RLI A;  2EIQ A;  2LJR A;  4FYB A;  3ZYW A;  4PGT A;  2GS3 A;  2KLX A;  2YWN A;  3IA1 A;  3HXS A;  3GHA A;  1G6W A;  3TDG A;  4JR6 A;  1GNW A;  4O92 A;  3MDK A;  3FK8 A;  1GUL A;  4OCE A;  1DBY A;  1TU7 A;  3CRT A;  3BJ5 A;  4ID0 A;  3DYR A;  2OBI A;  4NV2 A;  1Z7R A;  2WGR A;  2LRC A;  4GF0 A;  1Z6M A;  4K2D A;  2FUG 2;  5BMU B;  3EVI A;  1ON4 A;  1FB6 A;  4Z2R A;  1EEJ A;  4V2M A;  1S3A A;  2PU9 C;  2MMN A;  1K3Y A;  5IOX A;  4ZBD A;  4KCE A;  1F6M C;  2B5X A;  1N8J A;  3DVX A;  4AKI A;  2R5G A;  3HVX A;  4D73 A;  1FVK A;  1TK0 B;  4QL9 A;  4TR3 A;  1BX9 A;  2CT6 A;  3MSZ A;  5G31 A;  2CVD A;  1WJK A;  2FWF A;  2VUP A;  2HNL A;  1JLW A;  3U6V A;  4G9H A;  2H1G A;  2C0E A;  4XRA A;  3ZTL A;  3TKS C;  16GS A;  5HFG A;  4MH3 A;  2L5O A;  1TRW A;  2K9F A;  3VWU A;  1GSF A;  1GUK A;  1NHO A;  2L4C A;  2DMM A;  5ID2 A;  3TJG A;  3TRX A;  4EUY A;  5B6M A;  4WKW A;  4DVC A;  4MZB A;  1OAZ A;  2RM5 A;  5GZZ B;  3ZIV A;  2VCW A;  2EIR A;  5EVO A;  3R2Q A;  2KUC A;  2LQO A;  1A24 A;  2X99 A;  4GCI A;  1DUG A;  2R3X A;  4EKZ A;  3D22 A;  4MK3 A;  1YZX A;  2YWI A;  3KCM A;  3TRP A;  2B5Y A;  4ZB6 A;  1SK2 A;  1O73 A;  3L9U A;  1YQ1 A;  8GSS A;  1JZR A;  4ULX A;  1ABA A;  1M2D A;  1Z7P A;  5F07 A;  2EFD A;  1M9B A;  10GS A;  3KZQ A;  4ECJ A;  4G0L A;  4O5R A;  3TJK A;  3U5R E;  5J3R A;  2OAC A;  3GL3 A;  2H6X A;  2KHP A;  1U87 A;  2HSM A;  3LOR A;  5H5S A;  3F6D A;  1ERW A;  5KOX A;  3P8W A;  2E0Q A;  4V1A p;  1TRU A;  4K5S A;  2N5A A;  2DJJ A;  4KGI A;  2GQL A;  3E9J B;  1SKR B;  1K0C A;  1B8X A;  2MZC A;  5IMZ A;  2A4H A;  2HLS A;  1TOF A;  2H30 A;  2L6D A;  3DXB A;  2HQT A;  1X5D A;  3EYT A;  4MA9 A;  2G0F A;  1SK0 A;  3QMX A;  2PGT A;  1GSD A;  3RHB A;  6GSX A;  2KOK A;  4X4J A;  2YZH A;  1ZZY A;  4HOJ A;  4Q5Q A;  1ZCP A;  5CYY A;  1QMV A;  3F6F A;  2WS2 A;  1Z9H A;  2VL3 A;  4O7H A;  5JCG A;  12GS A;  5G5E A;  2HSN B;  3CMI A;  3UAP A;  2GSR A;  4GQC A;  2H0G A;  5IMC A;  4KH7 A;  2VIM A;  2R0C A;  2YNX A;  3VI5 A;  3VK9 A;  3EE2 A;  1TXU A;  2F51 A;  4F82 A;  4WEY A;  1GSE A;  4XTS A;  5LCZ A;  3L4N A;  4G19 A;  2HZE B;  3HJP A;  1Z6N A;  4N10 A;  1YY7 A;  1LU4 A;  1USB A;  1XWB A;  2FHE A;  3GKK A;  3QPM A;  3QAW A;  4ZIL A;  1WPI A;  5IIZ A;  4PX1 A;  4WBR D;  5D8I A;  2RM6 A;  1EEM A;  4XIH A;  2GZZ A;  13GS A;  2CV4 A;  2MBT A;  2IWT A;  6GSW A;  2P31 A;  4IS0 A;  2P5Q A;  5B8B A;  1PGT A;  5A4W A;  1F3B A;  3KMN A;  2FA4 A;  3FMW A;  3RBT A;  3O76 A;  1F3A A;  4K1F A;  3RHC A;  3HY2 A;  3L78 A;  2DJ0 A;  4CY6 A;  2OKA A;  3EMP A;  5CRG A;  6GSS A;  4PUR A;  4OFT A;  3QOU A;  1GLP A;  1WP0 A;  5HR1 A;  2IIY A;  3KH7 A;  1PKW A;  5FT3 A;  1GLQ A;  3F4S A;  2C3N A;  3P2A A;  3UL3 A;  2AHE A;  3ZFL A;  1OYJ A;  4EDY A;  2QKE A;  3K8N A;  2VCZ A;  3F3Q A;  3IK9 A;  3HA9 A;  3BD2 A;  4X1U A;  4IJ3 A;  1BF5 A;  3DRN A;  1SJ6 A;  5C04 A;  4HU9 A;  1WWJ A;  2ALB A;  4FIW A;  4JZQ A;  4LMV A;  1SD9 A;  4AJ8 A;  1NM3 A;  4Z7X A;  2DJ1 A;  2CX3 A;  5ELG A;  3F0I A;  4RI7 A;  1H75 A;  2DJK A;  2Z9S A;  5A5K A;  5IO2 A;  3RDW A;  2CA8 A;  2TIR A;  1K0B A;  3ZRD A;  2H66 A;  2LEG A;  4FYC A;  2HRK B;  3CSI A;  2FCH A;  2DKI A;  2OE1 A;  3TU3 B;  3MYD A;  4ZL9 A;  3C71 A;  2GT6 A;  3IAS 2;  3W8J A;  5HQP A;  5DVB A;  4I6X A;  1XWC A;  1AUC A;  3UVT A;  3I6A A;  1JHB A;  4NMU A;  5KN1 A;  2B1L A;  4JED A;  3TRQ A;  3C8E A;  5J47 A;  1XWK A;  4RUV A;  1T4Z A;  3GKM A;  5IMV A;  2JZS A;  2H01 A;  1PSQ A;  3GMF A;  2LST A;  3GL5 A;  4NHW A;  3ZLP A;  1GH2 A;  3PIN A;  2IFQ A;  2F8F A;  2H71 A;  4TOP A;  4WBJ A;  2GGT A;  1IYH A;  5CP1 A;  5D9X A;  3CXG A;  1VF1 A;  1URM A;  5ECM B;  5FWG A;  1T1V A;  17GS A;  1MDK A;  2VCT A;  5D96 A;  3ZVJ A;  5JWR B;  2H73 A;  4ILF A;  1B48 A;  1BQ7 A;  2AUV A;  4MF5 A;  1TKD B;  4POB A;  1YKC A;  4IW9 A;  4HZ4 A;  3LEF A;  3VFI A;  2IME A;  1SJI A;  3DEX A;  2HSY A;  1O6J A;  1VGL A;  2BTO T;  2DLX A;  5IPH A;  1EGR A;  3JCM L;  2K6V A;  1FAA A;  3PH9 A;  2IMK A;  1MDI A;  3F9U A;  1XW5 A;  1YJ6 A;  2V41 A;  2JL4 A;  3D21 A;  4OFN A;  3TKP A;  4J56 E;  3KP8 A;  1GUM A;  1WIK A;  2A2P A;  3KIJ A;  3M1G A;  3ISO A;  2H1B A;  1U3I A;  5EY6 A;  3ZMK A;  3GST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...