3BC9A

Alpha-amylase b in complex with acarbose
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
585
structure length
585
Chain Sequence
SLFLIESEPSTGASVSKNLTEIILIFSNDINKVSQLALTDLITDSDIQGIDYNIEGNKVIINNFSLEPTCNYRLSYEVIDIYDNHLQGYIEFLVNQSNYPQIPDQEVNHTILQAFYWEMNTGEYATEHPEEANLWNLLAERAPELAEAGFTAVWLPPANKGMAGIHDVGYGTYDLWDLGEFDQKGTVRTKYGTKGELENAIDALHNNDIKVYFDAVLNHRMGADYAETVLLDENSRDKPGQYIKAWTGFNFPGRNGEYSNFTWNGQCFDGTDWDDYSKESGKYLFDEKSWDWTYNWDEDYLMGADVDYENEAVQNDVIDWGQWIINNIDFDGFRLDAVKHIDYRFIDKWMSAVQNSSNRDVFFVGEAWVEDVDDLKGFLDTVGNPDLRVFDFPLRSFFVDMLNGAYMADLRNAGLVNSPGYENRAVTFVDNHDTDRDEGSYTVSIYSRKYQAYAYILTRAEGVPTVYWKDYYIWEMKEGLDKLLTARRYYAYGPGYEVDNNDADIYSYVRSGFPDVAGDGLVLMISDGTSGNVAGKWINSRQPDTEFYDLTGHIKEHVTTDSEGYGNFKVIKSEDKGWSIWVPVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha amylase, catalytic region
publication title Crystal Structure of the Polyextremophilic alpha-Amylase AmyB from Halothermothrix orenii: Details of a Productive Enzyme-Substrate Complex and an N Domain with a Role in Binding Raw Starch
pubmed doi rcsb
source organism Halothermothrix orenii
molecule tags Hydrolase
total genus 200
structure length 585
sequence length 585
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3bc9A03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bc9A04
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3bc9A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bc9A02
1Q6EA 1QI0A 5A6KA 3I3EA 3W81A 1WDRA 3SEPA 1AQHA 1CLVA 3MSDA 4RE2A 5F7UA 1UHVA 1SFSA 2E9MA 3WBEA 3DX2A 2XIIA 3O9NA 1NM4A 3TTOA 1WPCA 5DF0A 3GDBA 1HT6A 4J27A 3VGEA 3W38A 3M46A 3KL3A 3WENA 3EJTA 2WMJA 3GXFA 1UD4A 1K6AA 2VZVA 3AHYA 3B9EA 1OIMA 1FP8A 3CO4A 4PMXA 3AICA 4KH2A 3BVVA 3BMWA 2WLYA 4E8DA 1HJVA 5ABHA 5CSYA 3WUEA 4W89A 5DEZA 1CNVA 3DECA 2WWDA 3TTYA 3GH4A 1VIWA 1CTNA 2OMTA 2EBNA 1O6VA 1OWQA 3TV8A 4MJ2A 4V28A 4F9DA 5A1AA 3AMCA 1OD8A 3HG3A 4NZJA 1Z32X 1BYDA 4WKHA 1H2JA 1UZ4A 2VO5A 3PTMA 1MQRA 2E8YA 2QF8A 5IXEA 4D72A 1M03A 3FAWA 1V3LA 1E6PA 2CBJA 3CUHA 4W88A 3WF2A 1M53A 1JDCA 3VNZA 5BYWA 1JFXA 2BV9A 2XG9A 1QHZA 4W7WA 2VVNA 3T0BA 4XZBA 1E70M 5I23A 1R75A 3VIIA 1XGZA 4GQRA 1WZMA 2NT0A 3WUBA 3W37A 2CBUA 4UQBA 3CHCA 1QHPA 1B3WA 1V0LA 2XFFA 3BZ5A 3WDHA 4TVDA 1B31A 1TA3B 4DM2A 2WM0A 3UG5A 1QI4A 3ZOAA 4B16A 1HWWA 2WMFA 2J7FA 4QAWA 1QOXA 1BYBA 1JDDA 3AQUA 1UUQA 1C3FA 4UZUA 2VZUA 4H8UA 3AHVA 1KCKA 4AMCA 1J0KA 1JXJA 3BLKA 1GQKA 1JAEA 3AZSA 3WL1A 1HXJA 3K8KA 5BWFA 3RIKA 3GXDA 4WKFA 1TVPA 1KR0A 1M9SA 1NH6A 2VCBA 3CPUA 3GXNA 5CXPA 3CZEA 4MNJA 3WY3A 3AZRA 5M5DA 2WCSA 3MV11 4AZ6A 2OWXA 4CU6A 4E8CA 3EDDA 1PIFA 1E9LA 2J47A 1G1YA 5GNXA 4U5KA 3PBGA 5FL0A 4AIEA 2YLAA 4PRWA 1J11A 3AMLA 3CUJA 4KWUA 1UKOA 1C90A 1V0KA 4WIWA 1J0JA 4PTXA 5A69A 5HOSA 4J3XA 4CGTA 1H0IA 1H11A 3WH8A 4WF7A 1JGIA 3CMGA 5EB8A 2Q8XA 3PHAA 5D8ZA 2XSAA 4JZ5A 2OW6A 1V6WA 1Q6FA 4U31A 2WVUA 3ARWA 4FNTA 1V0MA 1ZBKA 1ZJAA 2VX6A 2YL6A 3IJ9A 1NOUA 2Z1KA 3N9KA 2WSPA 2YLLA 2XYLA 2PWGA 3VVGA 1LWJA 1WNOA 5LA0A 4S3KA 3ZR5A 4GZJA 4J3UA 1CGUA 1BSIA 5A95A 1J9YA 4LGXA 1E4LA 5ABGA 4BQ4A 3RM4A 3UETA 1RP8A 2ZX6A 4XX6A 1TUXA 1NP2A 1HXKA 5BXTA 8CGTA 1JYNA 4UFKA 4MDPA 5A2AA 3D4ZA 3HG5A 3L2MA 4OJYA 3WD3A 3WDPP 4AZGA 3CZNA 2OWWA 4CN6A 4AXNA 2XVLA 4MNLA 2YL9A 4PCSA 3RJYA 1P6WA 2ZXAA 3W53A 5A6LA 1PX4A 2J25A 5I5RA 1A3HA 3AISA 5EFDA 1TMQA 1CYGA 3BAYA 3VIGA 2IXUA 1CBGA 4W5ZA 3EJUA 1LQ0A 1PAMA 4MDOA 1EHAA 2ZX7A 5DO8A 2UY3A 4JFVA 3LPOA 3MANA 2QMJA 3EJSA 4FNUA 5DFAA 5TD4A 1FP9A 3VPLA 2C8NA 2D22A 1UWSA 3QGVA 4NXKA 1E0XA 1R33A 2DIEA 1ZB5A 2V5CA 5BRPA 5C8BB 3KWXA 1WO2A 3FN9A 4QCEA 4TX6A 3BCFA 3CZSA 4FNRA 1CGVA 2PWEA 3GZAA 2PWDA 1FH8A 3A21A 3VDAA 4P7OA 2PI6A 4PMVA 2GJXB 2OSXA 1JZ6A 3LPFA 3ARUA 2JFEX 4BQ2A 5ABEA 1DTUA 5AC5A 1VEPA 2YOCA 2DIJA 1WAWA 3VIFA 4CN4A 2AAAA 4S3JA 4RE4A 3HMCA 3FHAA 2F1AA 2FDMA 3VIKA 4UNIA 4ATWA 3K8LA 1NWUA 3WY1A 1NOFA 4NSBA 3QHOA 2NT1A 2WB5A 4AZCB 4B3KA 1EO7A 3N11A 1O6IA 1H4PA 2G41A 1JZ8A 4A4AA 5I0DA 2ZICA 1UOKA 1C8YA 5A8MA 1W2PA 1XD1A 1KGXA 5JBDA 3EJPA 1HL9A 1QI2A 3WY4A 4M80A 4UCFA 2GJPA 1MYRA 1TQUA 4U2ZA 4UQAA 1E15A 4UTFA 3CZKA 4D6GA 3DYPA 3OBAA 4OBRA 1W3LA 3ZT6A 1WKYA 3IJ7A 3DYOA 4JKLA 4DUXA 1MW1A 1TZ7A 1VEOA 5D4YA 1CXKA 1GPFA 3CZLA 4YHGA 3MU7A 2UZYA 4DUVA 4GKLA 3L4TA 1E6NA 2XPKA 5CGTA 3M07A 5E1QA 3WNNA 1E4IA 4DO4A 1WDPA 3FHQA 3NUKA 3CZJA 3UEQA 1GW1A 2BVYA 3LRLA 1D3CA 1M7XA 1GOIA 1J0ZA 3G6MA 1OT4A 1GQJA 4CCEA 4F8XA 1ITCA 3GXPA 1YQ2A 1JI1A 2OYMA 1RD6A 1CLXA 4NI3A 3VGBA 1D7FA 1V02E 1E55A 5IHRA 2W63A 3ARPA 3KLKA 1HX0A 2WCGA 2D3NA 3LXAA 1J18A 1YHTA 2WQVA 1LL6A 3B9AA 4AZBA 3WDJA 1WZAA 3MUY1 1TQVA 4OOUA 4XUYA 1BPLA 3K4DA 2OYKA 1OGSA 1E56A 3WH9A 3EMCA 4KRTA 1N82A 4J7RA 3PZVA 2D1ZA 2XHYA 4MAVA 4AISA 5BROA 4ACZB 1UASA 4ZE4A 1FFRA 1UA3A 2DT0A 3WEMA 1XCXA 3B9DA 5E70A 3TA9A 2CXGA 1FA2A 2WQWA 4AW4A 4R5EA 2V3GA 4PMUA 1VJZA 1HP5A 4HPGA 3WMBA 1W1YA 4HMDA 2DDXA 3RDKA 2CITA 4LQ1A 1DWIM 2J7HA 2D0GA 3CBWA 1MW0A 1W2VA 4HPHA 3N18A 4M81A 1AQ0A 2WMIA 3EMZA 2GJXA 2WC3A 2DT1A 5I77A 4PYSA 3NSMA 1QHOA 3A4WA 3DDGA 1H5VA 3NYDA 3ARVA 1BFNA 2WVSA 3WEZA 3BAKA 4M82A 2DSWA 1MWOA 3GBDA 4ZENA 1PIGA 3ARSA 1A47A 2J8FA 4CVUA 3VMPA 3AS2A 3BGAA 3GM8A 2BY1A 3DX3A 1IZJA 1JZ7A 4UQEA 3UR8A 1UKTA 4FNQA 1J0HA 1ISZA 2YDRA 5LA1A 2RA1A 2EPLX 1UWTA 2C7FA 1V0NA 1X6NA 3AOFA 4LX4A 2VX5A 1W9PA 1JL8A 2WPGA 2CERA 2DSUA 1TQTA 1LF1A 4K68A 4TOQA 4CU8A 2MANA 1JD9A 1F4AA 1OM0A 3BAJA 3THCA 3VM5A 2XVPA 4M29A 2ZUNA 4UZSA 3OGRA 1IX2A 2YDQA 3W27A 1EXPA 3VTRA 4XB3A 3NSXA 4DM1A 3POHA 3SCOA 1TFVA 3TP4A 1MXGA 1IT0A 1EO5A 1NARA 3BXWA 1E43A 4IPNB 2UZXA 4PMYA 3F4VA 3IAQA 3ZR6A 2WVVA 2O9TA 3OGSA 2G3JA 3DX4A 1XHGA 3N13A 1AVAA 5E6ZA 2F7RA 2ZXBA 4RL3A 3U57A 4ZXOA 1L8NA 1JZ4A 4AY1A 1V3MA 1EIBA 2J7EA 2BHUA 3TTQA 3RM9A 5LYRA 1W3HA 4PTMA 1UH3A 1KXVA 1FHDA 2QPUA 2QLYA 2XVNA 1BF2A 3L4UA 1NOWA 2VURA 3E1F1 3WH5A 4HOWA 1UYQA 1B2YA 1UA7A 3OGVA 5D8WA 1Y7VA 3D51A 3LMYA 3RCNA 3MV01 3A22A 1WZLA 1H6TA 1B3VA 1E6RA 2ZUUA 4JFWA 4BS0A 2IXVA 3MUAA 3F5JA 1SR0A 3OLEA 3WBAA 2DGAA 1ZS2A 3VIMA 3ZJKA 3WF1A 4GINA 1V6UA 3ARRA 3WDRA 3EMQA 1M42A 3M6DA 3WQ5A 2J77A 3CMJA 4UFLA 2EO7A 4FLQA 3RILA 5HPOA 2X2JA 3WH7A 4F9JA 3WNOA 2WHKA 3AIBA 2W5FA 1NWRA 4BQ5A 1GOOA 3NDYA 4GO8A 2WHMA 1QNOA 1PEZA 4AD3A 1BLIA 4HOXA 3VGHA 2DSVA 2XIBA 1BVNP 4QFUA 5I2UA 1L0PA 2ZUVA 3VD7A 3AXIA 2Y5EA 3AIVA 3WNMA 2CHNA 3VGDA 2VI0A 3OLGA 2WLZA 5A3HA 4WKAA 3F5KA 2VZOA 4U3AA 3GBEA 3VUPA 4U33A 4JL1A 1FHLA 2RGLA 4FLOA 4IUGA 4PUDA 3MKKA 5A8OA 1J12A 1H6UA 1JF5A 3NDZA 2BXZA 5FCZA 2G8ZA 1VRXA 3AHXA 2IUZA 1QBBA 3SCVA 2YKKA 2DPEA 1CIUA 2FHBA 3AMGA 1V3JA 3VMOA 1GUVA 3MO4A 3VGGA 2OSYA 2JF6A 3ZM8A 5A6JA 1UD3A 1JDAA 2QPSA 3QOMA 4W7UA 2OMXA 3RJXA 1E6QM 2WYSA 3N17A 1MW3A 1CECA 3VDBA 2F7PA 3OZPA 3CUIA 4GQQA 1UWRA 3BCDA 3QHMA 2VQUA 4CD8A 2VRJA 3AIWA 3N15A 4YPJA 2DQXA 1GJUA 3L4ZA 2G3MA 3CHDA 4AIUA 1W1PA 1C92A 3LXCA 4DO5A 3MMWA 3LRKA 4W85A 4NX0A 1G0CA 2BHZA 1U30A 1B0IA 3L4WA 1ESWA 1LG1A 3WQ8A 2OSWA 4WLCA 3CGTA 3BVTA 1M01A 4P7RA 2EAEA 4KGJA 3WH6A 3MUIA 5CPTA 2ZIDA 1R8LA 1VAHA 4BZYA 5E6YA 4H41A 1US3A 1SMAA 1UKSA 2C0HA 1JD7A 1FOBA 1HKJA 5A8PA 2BY2A 1XSJA 3CHEA 2F61A 2WC7A 1GQIA 1NWTA 2DH3A 1RP9A 4AD0A 5A6AA 1MQPA 5A8QA 4AMWA 3A5VA 3BLPX 3WELA 2X2IA 5FKYA 1VF8A 4NRSA 1WZKA 3VD3A 4JIEA 4FLSA 4IISA 3VDHA 2VCAA 1ZJBA 4PSPA 2A3EA 5GNZA 5CQ1A 2PWHA 3LXBA 1QNSA 2YL5A 2Y8KA 4UFMA 3IGUA 3A47A 4P8XA 3ARYA 4LXFA 2X2YA 4Z2LA 4Z2KA 3BH4A 2XGBA 3SUSA 2VVSA 5FL1A 1HJSA 4TX8A 3UG4A 1PX8A 1H1NA 2J7BA 4Z2HA 5CPQA 1JNDA 2ZXQA 2V38A 5JBFA 2XN2A 1B3YA 4PCTA 2J7CA 2YDSA 4W8LA 4EE9A 4B9YA 1GQLA 2WMHA 4JFSA 3SCSA 4AZ5A 4PMRA 4U5IA 3WIJA 2X05A 3L4YA 2WVTA 2WK2A 3DX0A 3EYPA 4WK9A 1V08A 1LWHA 3MI6A 3W24A 1DWFM 3W28A 2JALA 5IFTA 1QNPA 3AIUA 3NIYA 2DEPA 1IZKA 5CLWA 4D1JA 2DSKA 1KFWA 1CGWA 3SUVA 1GZJA 3NSNA 9CGTA 2FH6A 1BPLB 4CD6A 1UR9A 5I6SA 1VFUA 1XSKA 3OB8A 3D50A 4AD4A 2D0HA 1KCLA 2GFTA 3GXMA 3PZNA 2VZSA 1TCMA 4Z2GA 2WBGA 5A6BD 1W1VA 2X8RA 1MW2A 4JHOA 1UD8A 2EPOA 3WF3A 3I3DA 2BVDA 3AYSA 2PBOA 5I3DA 4CC4C 1MVYA 4X0VA 4W7VA 3ZT5A 1HIZA 1DWJM 1J01A 3GNOA 2J62A 4R27A 2B31A 2YA2A 2VT0A 3SCRA 5CSUA 3A4XA 1UWIA 1PBGA 5LA2A 4H7VA 2CIPA 3BVUA 2EPNA 1NM9A 4W84A 5ECUA 2WMIB 1GHRA 3QOKA 4MNMA 1Q6GA 1HNYA 3SCPA 3KLLA 2GUYA 4PTVA 3WN6A 2J79A 2GK1B 3BSGA 4UFHA 2E9LA 1BYAA 2D73A 7TAAA 2OMYA 3AJ7A 2WQUA 1WDSA 2VX4A 4J3WA 1J10A 1TE1A 3ZSSA 2BY3A 2O9PA 3T09A 3WL0A 4P8UA 3M7SA 4D6FA 1LL4A 1DP0A 5A94A 3D3AA 1Q6CA 3KL0A 4U2YA 4D6HA 4UOJA 1HTYA 5DT7A 1O6SA 2Z1SA 3WQWA 3AIRA 1XEUA 1QI3A 2WHLA 3W6MA 4PUEA 3WQVA 1XSIA 2WNWA 1QNRA 3AYRA 2Y24A 4JFTA 3CIVA 4AWEA 4W93A 3VIHA 1XH2A 1OGGA 3U7BA 3O6AA 5EBAA 5C70A 1WCGA 3ZQ9A 3RMEA 2WMKA 3BUBA 2WVVB 3WNLA 2VZTA 3SUWA 1VFFA 3WFZA 1QWNA 3VD5A 1K9EA 2Y8VA 4GZEA 4OKDA 1EDGA 3OLDA 3ARQA 4KGLA 1JZ2A 1BTCA 5A6SA 4JHZA 3HG2A 2JEQA 4HU8A 1HKKA 3THDA 2YFOA 5AYIA 2QHAA 3AMKA 4AZ7A 3KZSA 4M1RA 2VR4A 5D9OA 1I1XA 4TVUA 3PZ9A 3WDIA 1UR8A 4X0NA 4AEEA 1HF6A 1KTCA 3SCNA 1KXTA 2C9PA 2VC9A 1R7OA 4J3VA 4JAWA 2UY2A 3W29A 1W9XA 1R34A 3AHTA 1NQ6A 4PN2A 2JF7A 3I3BA 4NRRA 2PWFA 4M24A 2NSXA 1BQCA 3VNYA 1JIBA 4AEFA 3G6LA 4J28A 3II1A 2C9QA 2V3DA 2J4GA 1GCYA 3WQ4A 3S5YA 5ABFA 3A6OA 1KXHA 3QR3A 1H09A 3WEOA 2DSZA 1H0GA 2ZUMA 1J0IA 1DWHM 2OMZA 1BG4A 2EPMX 1HKIA 1OINA 2EQDA 5BXSA 2WQXA 4PMNA 2XFYA 2UY5A 1BYCA 1E0WA 3BAXA 1KGWA 3VSUA 1W32A 2ZXDA 2W92A 4AD1A 2E3ZA 1FH9A 3BUIA 1NWSA 1PX3A 1V6VA 3QHNA 1HP4A 5AY7A 2E8ZA 4BCEA 3K4AA 1HL8A 4BA0A 3VGFA 2HISA 1PPIA 2CEQA 2EJ1A 1PJ9A 2BHYA 3NJ3A 5A6MA 2GK1A 2PBGA 5I24A 4HTYA 4CCDA 4TXEA 2OW7A 3NCOA 1KWGA 1GOKA 3CV5A 3WD4A 1XRVA 3D5HA 1C93A 4CILA 3AS0A 4D6JA 2BFGA 1DHKA 1E5NA 4ZFMA 3CTTA 5A6BA 3GNPA 2V3EA 4CD4A 4XZWA 3WF0A 2W91A 4U3CA 4WSKA 4QLLA 3TONA 4YHEA 3SCQA 4C7DA 2VMFA 1EHNA 2F8QA 4QCFA 4QLJA 4P7NA 2Y5QA 3U7VA 4DWSC 1X1NA 3AXXA 4HZ7A 3AMDA 2C9RA 2BS9A 2X1IA 4AQ1A 3AXHA 4B3LA 2X0HA 2OWCA 2CESA 3ALGA 1OIFA 2D0FA 1E71M 1S46A 4OGZA 3TTSA 4HMCA 4AD5A 1UWUA 4MADA 4HOZA 3PTQA 2YFNA 1H3GA 4OBSA 1C8QA 3HZ3A 1R46A 4L4OA 1SZNA 1ZBVA 1C8XA 1BAGA 2J7GA 2VRQA 3PZGA 2EPKX 3VD9A 1H41A 1I75A 1GVIA 3BMVA 2BVTA 2W67A 3AS3A 3OLIA 2VTFA 2A3HA 4CD7A 3SCUA 4GXPA 1KTBA 1I1WA 2E9BA 1CPUA 1R47A 4Q7NA 3GYCA 3TOPA 4F66A 1BVZA 5HDRA 4V2XA 3LRMA 1UR1A 1DWGM 2A3AA 3EDEA 1VJSA 1LJYA 5JIWA 1GORA 1E3XA 1JAKA 3ZT7A 1JYVA 4PMDA 3EDKA 2F7OA 1HVQA 3MMDA 4NZFA 4HZ6A 3ZJ8A 5GQBA 1QW8A 1KQZA 3VM7A 3WF4A 2OMUA 1H49A 3POCA 2VR5A 1PS3A 1B3XA 2WW5A 3VDCA 3EDJA 4AW7A 1JG9A 3WSUA 2VQTA 2CPUA 1B3ZA 4H8VA 2YIHA 1HJWA 1CXIA 2GDUA 2VL4A 1KWKA 4OZOA 3O2LA 1VBRA 2OYLA 2W61A 5CJ5A 2CYGA 1US2A 4WSJA 3S5ZA 1R7AA 2ZUSA 3WKZA 1OD0A 2EACA 1JI2A 1UH4A 1XH1A 5CPSA 4GZIA 1LLOA 2WZHA 3GXTA 5JIPA 4ATDA 3VSTA 2EEXA 2WANA 2XN1A 4W5UA 4OIFA 4J3SA 1GHSA 1X6LA 3K1DA 3ZJ7A 2ZX5A 3AI0A 3W4RA 1QX1A 1WE5A 4GI9A 3BUDA 1JYWA 2WBKA 2CKRA 2XSBA 1JZ3A 1C91A 5AC4A 1JNEA 1UD2A 1B1YA 1VEMA 3WD1A 1K9TA 4J3TA 2E4TA 2W66A 2UWFA 1VFMA 2ZUWA 3RM8A 4V27A 5E0FA 1CXFA 1PZ2A 1ZL1A 1MXDA 2CHOA 1HVXA 4XV0A 4CKQA 4MNKA 4HA3A 2GVYA 4AYGA 1MQQA 3APGA 2WZIA 1T0OA 1B30A 4PMOA 2ALWA 4Z2JA 5BXRA 1DEDA 2BXYA 2CCRA 3ARTA 3BUPA 1AQMA 2J8GA 4M56A 2VCCA 1OGBA 1CGYA 1W9UA 2XGIA 3A3HA 3T2OA 3AS1A 2ZWZA 1W3KA 2FHCA 2XVGA 1XD0A 4WJXA 2GSJA 1HJXA 3ZO9A 3T08A 1SMDA 3J7HA 4JL2A 4AZHA 3BAIA 4FK9A 2Y4SA 2CBVA 5DT5A 4NF7A 5HPCA 2EABA 3DHPA 2WZEA 1HN1A 3OIHA 4TVCA 4Y7EA 3ARXA 1E1EA 1G5AA 2WMGA 2AMGA 1UQZA 2VJXA 4ZE5A 5FD0A 1C7SA 1CGXA 2WC4A 4PTWA 2XUCA 1GNXA 5CZKA 1C7TA 4QP0A 1UR4A 1E5JA 3CUFA 3DYMA 2YA0A 1GVYA 4HU0A 1U33A 5GNYA 4AZIA 3JUGA 2G4FA 2VUYA 5HBFA 3PZUA 3EDFA 2D3LA 2J75A 2XTKA 1QWUA 3VIJA 1D2KA 4GPNA 1ISVA 2D20A 2O92A 1QW9A 3MSGA 6TAAA 3W25A 3MMUA 3BSHA 2CBIA 4D71A 1UWQA 3BVWA 2YBTA 4PMQA 1SYTA 2EXOA 3LPGA 4TTUA 4JFUA 1QBAA 4HMEA 2F2HA 5C71A 1ODZA 5EMYA 1JF6A 2VX7A 2F1BA 3BAWA 1U2YA 1KQYA 1XC6A 2NW0A 1E0VA 4UFJA 2QMKA 2EADA 3DHUA 2O9RA 1TVNA 1R87A 4MB5A 1RPKA 2BY0A 4JKKA 4IPLA 2BNJA 3GTNA 4D6EA 6A3HA 1GONA 4OOZA 2OMVA 5M17A 4N42A 4TUFA 3GH5A 2WKLA 1GOQA 1V03A 4CD5A 4E4PA 4D6DA 2PF0A 3BUQA 1NP0A 2X0YA 3PZQA 4MB4A 3WNKA 1XH0A 4UFIA 3U5YA 1UKPA 3AHZA 3LPPA 4A3HA 4H04A 4AD2A 5AYBA 1E4MM 3T2PA 4HP5A 3WFLA 2XWEA 4LYPA 3UR7A 4X9YA 3CHFA 3WMCA 5ABFB 2FGLA 4N0RA 5E0CA 3ECQA 4JCMA 5FOOA 3ZIZA 2PC8A 4LPCA 4JCLA 2VNCA 3AIQA 4HA4A 5FIPA 4L4PA 4KRUA 5I79A 5E9AA 2GDVA 3A4AA 1V02A 1OT1A 4URIA 4ATLA 3AFBA 2JEPA 4GI6A 3PZMA 4OUEA 1ZU8A 4AIOA 5M3WA 1QPKA 1F4HA 4PEEA 3PZTA 4W8BA 3AROA 3CZGA 2O9OA 5D9NA 3VO0A 1K9FA 4FLRA 2FGZA 1ZBCA 3D4YA 3RO8A 3EJQA 1J0YA 3FY1A 1W1TA 1LG2A 4RE3A 2Y2WA 1BHGA 3ZJ6A 4D1IA 3SUUA 3FXYA 1QNQA 3W6LA 1QI5A 1TA3A 1R86A 2JIEA 1UH2A 3N1AA 3HU7A 3KL5A 2W62A 2ESCA 2ZE0A 5CLTA 2YJQA 1PZ3A 4UQ9A 3W26A 2WCAA 4FNSA 5KEZA 3SIMA 1EDQA 4MPKA 4W86A 1CXLA 3OG2A 3HN3A 2E0PA 1EOMA 2WXDM 1OCQA 4QLKA 5HNNA 2CKSA 1KB3A 2FH8A 4LYQA 1B9ZA 1W9DM 1JZ5A 5CG0A 4CVWA 5BCAA 1G9HA 1OB0A 2FE0A 5IDIA 2A3CA 1HJQA 2ZOXA 2OLHA 4IM4A 4BF7A 1CGTA 4CN1A 4CC4A 1ISYA 3BC9A 1EOKA 5A2BA 3CLWA 1E6XM 5KZ6A 1EGZA 1VB9A 3VX0A 3VX1A 4PSRA 4DWSD 2QV4A 2J74A 3LX9A 1BGAA 1KBBA 3U5UA 3VD4A 3IK2A 3IJ8A 2G3NA 1WP6A 3WDQA 1W9BM 4FF5A 4UOZA 3ALFA 2WWCA 1TQSA 1UD5A 2V3FA 3WD0A 4DUWA 3AZTA 3SUTA 1AMYA 1CEOA 1V3HA 4YN5A 3A24A 3FAXA 1G01A 3N04A 2OMWA 1GOMA 1EDTA 1GOWA 3SCWA 1TQWA 1QVBA 3ZSTA 3H54A 4C7GA 3MUZ1 2XVKA 3ZMRA 2UY4A 4F79A 4PMZA 4A3YA 3W82A 5DMYA 4TTGA 4GO9A 2W4XA 1BGGA 2G3IA 2VRKA 3HG4A 3K8MA 1KGUA 1OBAA 2IGTA 1ISXA 1KR1A 2RGMA 1JYXA 2HVMA 4GIAA 2E40A 3KE0A 1UD6A 3CUGA 5BXPA 4GI8A 1E40A 3WY2A 1IV8A 2A3BA 3T0AA 4PBGA 3UERA 4W87A 3VSVA 2CETA 1CDGA 2YL8A 3ARZA 4JKMA 2ZUTA 3EBVA 1EH9A 4CUCA 5IHSA 4DWSB 1CZ1A 3GH7A 1OSEA 4EAMA 1V6XA 5A8NA 3SURA 3WD2A 1FH7A 1R85A 4UQCA 1E4NA 4KMQA 1Q4NX 1UZ1A 4Z2IA 1XV8A 4NXSA 4D6IA 3A23A 1Q6DA 4MB3A 4C7FA 2XJ7A 3VIOA 1CXEA 1ISWA 1UKQA 1VFOA 3L2LA 2DH2A 4ZXLA 5CGMA 3F5LA 4B15A 4UOQA 3UG3A 3DC0A 3L4XA 2V5DA 1UR0A 4H2CA 1O7DC 5E09A 4FNPA 4MJ4A 2F7QA 3DDFA 4CU7A 2ZWYA 4DO6A 1HJUA 1ZBWA 4UR9A 4B9ZA 1O7AA 3T0DA 4Q22A 1DWAM 1MFUA 1JXKA 8A3HA 3WMSA 5D9PA 1BG9A 1E73M 3VILA 2JE8A 3CH9A 3OA5A 5M03A 1ITXA 1E6ZA 1O6TA 3WQ6A 1ECEA 3PN8A 1JFHA 1EQPA 1VENA 5IFPA 4M8UA 2VOTA 2WKGA 5HXMA 1EA9C 1CENA 1TG7A 2DT2A 4ZEPA 1WDQA 3H55A 3RPMA 1KBKA 2X09A 4MTVA 3FNDA 6CGTA 4H8HA 4NZCA 5BRQA 2WAGA 3FW6A 1W3JA 1E72M 5ICUA 4AC1X 3H53A 3AIEA 3K46A 3GXIA 4AZCA 4MAZA 1K9DA 1LYQA 4P8VA 3KEHA 2F18A 3CC1A 1RH9A 4BQ3A 3N12A 4AYSA 1ODUA 1GJWA 1OT2A 2D23A 3PZIA 1UR2A 4LYRA 4EK7A 4W8AA 4P7QA 2XWDA 1V3KA 3PTKA 1E6SM 4QDMA 3WNPA 1M04A 2WSKA 1XYZA 2J78A 3OZOA 7A3HA 1B90A 3BVXA 1E3ZA 4MB1A 3VMNA 1LL7A 1XCWA 2FYVA 7CGTA 3UCQA 1TR1A 2CNCA 1MFVA 4ACYA 4E2OA 2YBUA 3SCTA 3IAPA 1W9VA 3S6TA 5JBEA 2XM1A 3MS8A 4CCCA 3VINA 4P8WA 3VOCA 3BLBA 3GNRA 2FHFA 5I78A 1KXQA 4AMXA 3WUFA 2TAAA 3L4VA 3PZOA 1CWYA 1HKMA 1V6YA 3EJRA 4ML4A 1W91A 4EANA 3D52A 1UQYA 4UQDA 1WB0A 2DT3A 3S2CA 1CXHA 2PB1A 2J7DA 1V3IA 4DWSA 3VKKA 3VU2A 1UG6A 3VIPA 1G94A 2ZX8A 1VBUA 1E1FA 2WHJA 2ZX9A 4HZ8A 2XN0A 2AOSA 5EFFA 3W0KA 3CZ8A 4P7LA 3HJEA 2D24A 5D9MA 5GPRA 4EKJA 3DX1A 2GJRA 5JUVA 2X2HA 4FMVA 1EQCA 4D6CA 2XFRA 1XYFA 2D2OA 3T2QA 4HA1A 5A2CA 3UESA 2YA1A 2JIWA 4ACZA 3IANA 3WUGA 2XM2A 1FFQA 3B8SA
chains in the Genus database with same CATH superfamily
4C65A 1IIIA 3IMTA 1C9DA 4DHGA 1W1ZA 3BJLA 3LEXA 5AB1A 4Q58C 2XV3A 1NM4A 4JDBA 1YPZF 4F2FA 3S5NA 1HT6A 3M46A 5ID0B 4TO8A 3RNDA 1TZGL 3HNSL 1A7QL 2VZVA 1GSMA 2Y3NA 3MGOB 3ARGC 2DWDB 5KSBE 1K5NA 4IOIB 3QUYD 2BVOA 4Y90A 1MFDH 3QGKC 1UWXK 5CIPB 2PTWA 1YY8B 3AMCA 5E5UB 3O2WH 1ZHNB 4FF9A 3DCPA 1TPEA 1PKMA 1M03A 1N2RA 1BQKA 4UT9H 1T80A 3HZMB 3GIYA 2BV9A 3QE2A 4K5NA 2BP8A 1R75A 1XGZA 2NT0A 1AGCA 4GRWB 1Q6LA 3SYPA 1K3ZA 3CB4A 2X0WA 4M9PA 5TAOA 3AREC 4P2RB 1BKHA 3GDTA 4PREA 4YFLF 1CIDA 1GPWA 5CU5A 3F7YB 1VACB 2DW5A 3APMA 3CM4A 3TCEA 1E30A 3V4VL 2YBRA 5DA0B 5ICXA 3CFBB 4XOPA 1EFXB 3RZWA 4E5TA 2UVEA 4PB9H 4LLVA 3ZL4L 5BOJA 1PIFA 2UX7A 1LO4L 3IF1A 2HSAA 1WDDA 5HWJA 5DC0A 3QJHA 4TNVK 1KC7A 5H37G 3GU9A 1H11A 3BARA 5GISL 4ZMWA 3RX3A 2Q8XA 5MP6L 1QYGH 4YUEL 4KZEH 1W80A 2NY5H 4TUJB 1VFAA 3BDKA 3HOGA 4WO4A 4P5TD 1Y07A 2AFNA 4FJZA 12E8H 5SX5K 5BZDB 4GP5B 1TMCB 4BE5A 1RUAL 2CGYA 4HU3A 2DTSA 3GTHA 5BXTA 1QR4A 2DP3A 3VYNA 3UFIA 1S9XA 2NY4C 3PNWA 3QO0A 1ZS8B 2QR0A 5JLZB 3WD5L 2FL5A 4LNRA 1JP5A 3O8XC 1U21A 3RX7A 3EH2A 1U4EA 2Y5SA 4R26H 5DFTA 3VABA 3QQ1A 1BEUA 4KEMA 3FQTB 4ZAKD 4HK3N 1A3RL 5IHZA 3SBPA 1E0XA 2DIEA 2Q9OA 3NK4A 1E51A 2V5CA 4R7DA 1HGWA 3KBSA 3BD3A 3LD5A 1RU9L 4FJ6A 1QSFD 4X5PA 4PI0A 2YZ8A 3QQNA 3FVMA 1V7YA 3N4FA 2DIJA 4JFDA 1Y0YA 4OZHE 3RHWF 3BVJA 3QEZA 3VIKA 3WG6A 4LPWA 2P45B 3WKML 1T03H 4F48A 3HKZA 1DJNA 3CFEA 3SDDA 5DLMH 2QCHA 4AZCB 4B3KA 1S7QB 5HQMA 4F7MB 2G41A 1PNDA 2YAEA 1OF6A 3VWKA 2Z28A 3MWAA 4XLCA 3HG1A 6REQA 3O45B 4DEPB 1ZDSA 4L4LA 5CD3A 3SSZA 3IMUA 5AD0A 1SUHA 3DESA 2F2KA 1BECA 4TSAH 2VN5A 4YHGA 3IUIA 3L9YA 4N0YL 2UZYA 3HNVH 1T7WA 4HV8B 3X1EA 2IFGA 4IFRA 4QT5B 2NDFA 3EOBB 5IWLC 2P47B 4KFMA 3CZJA 3U4KA 5T1MA 3KW8A 3F4WA 7PTDA 3AM8C 4LLUA 4PC1A 1DQLL 1ITCA 4P3IA 1EUUA 5L2JA 3IXTB 1N8IA 1MIML 25C8L 3I6KA 1MWAB 4Y2DD 2Q87A 2VQ4A 3B4NA 4R2GC 3LXAA 2V5TA 5D5MB 3K4DA 2OQLA 1H3VA 4AM0A 1T5EA 4WWKC 3OSKA 5D2VA 1ZT1A 4GRWE 4KKXA 2X2UA 3BVNB 1HHGB 4YX2H 4B50A 1UGNA 4P2RE 3WQZA 3GO2A 4J2PA 2WQWA 2V3GA 1U93B 4HMNA 3B0VC 4Y2WA 5I5IA 2L4OA 1QGZA 4LL1A 1W1YA 1YW1A 1IVTA 4E2VA 2BVUA 2J88A 3NL3A 2VDLL 4LQ1A 1W2VA 4FF7A 4M81A 2ABBA 2V7XA 1HH9B 1S7WB 3WEBA 4GT0A 1KXVC 3ARVA 1XF3B 1O5DT 2AZUA 3IM1A 1ADWA 1W0MA 2QSQA 2J8FA 1PFOA 3ARGD 4D7PA 4IS6A 2Q5BA 3FXGA 2XG5A 1TYRA 4Y8AA 3PHQB 4UTJA 4WGXA 5DQ9B 3CMFA 5FJOA 4K68A 2FPTA 3ZTNL 4K7YA 5I0XA 1MFBH 4FIRA 1VADB 3W27A 3MR9A 3S5OA 3GSRB 2YOAA 3IMVA 4JBRA 3QYNA 3SCOA 5IGXH 2Q8BH 1CF1A 1G7JB 2HE5A 3OGSA 2G3JA 2D2JA 2ZD0A 1MHCB 1JZ4A 2VLLB 4O1AA 4U1NA 4JO2L 3ARED 1RLWA 1L6PA 3Q43A 2IXQB 3WO8A 1UM5L 1UH3A 2AZAA 3URAA 3VNDA 2YGNA 2EIEA 2B8OT 3PWUB 3HGJA 3SKOB 5LGZA 5E8NA 4GJJA 5DMIL 4PBFA 5I1HH 2GCYA 4K3JL 5GGVH 2K6WA 4FOKA 1SR0A 2DGAA 2JIXA 2MUCA 3WN5B 1V6UA 4YR6A 4PLKC 2X4PA 4NOFA 4D9PA 4JTTA 1UMKA 3HQOA 5CEZD 1RBAA 1GOOA 1S9YA 2KVOA 1BLIA 3GMNB 1U2CA 4N90E 2BPOA 3WMPA 2VI0A 4TULH 3DVNB 4U1KA 1R3HA 2AXGB 3GYEA 1IQWL 2YWZA 3D12B 4YVNA 1JF5A 4XNYL 2QDXA 5C3LD 1H8OA 3QAZC 4WI5A 3ITLA 1ADQA 2XDHA 3IDGA 3QOMA 1DANU 5IKCA 2XU9A 1CLKA 1E6QM 2KERA 4Z1CA 4L37A 3LDBC 4WDTA 1PG7X 4X6CF 4XTRC 1FFNB 3LXCA 1U5HA 1JF1A 3SGJC 3D05A 5AB2A 3ZE0B 1GIGH 1DOSA 4NQCA 4QRRD 2BSTB 1IE7C 4PGDB 4KQNA 1OAUL 4K6AA 3FQUA 1ACXA 4ISVA 4H1LA 1G9ML 4C6JA 3WFBH 2A7PA 4I48B 3PL6B 3MODL 1S9KC 5D5ME 4Y9MA 1SF3A 5B1KA 3QV6A 4GKSA 3UTTB 1US3A 4R9OA 4LB8A 1TJGL 2FBJH 2WIIA 4U7MA 1NLBH 3C6LC 3UWZA 3W2DL 3O41B 5KAQF 4HJIA 3QVQA 3KBJA 2NSMA 4DNLA 3VFOA 3Q8AA 4X7TA 1DQJB 4JREB 3L3OB 3IGUA 3ARYA 4LXFA 5JHDA 2IDQA 1MH5B 5IB3B 4YLCA 3PUMA 1W6WA 2A6JB 5HVFB 3SGUA 4DKEL 4YSUA 4X80H 3GD6A 1GQLA 2OEMA 4JFSA 3VVWA 3EYPA 2ZXCA 3QP3A 1QDSA 1F42A 3C8HA 4UCGA 3Q45A 3BGJA 3MREA 2H4EA 4K3DH 5C0FB 2NQ3A 1UR9A 5BWAA 4XKYB 4F91B 5HPMA 5FGRA 2GFTA 1NC4A 1TENA 3V4PH 3M1OA 1WAAE 1XB8A 3QF0A 1HEZB 1F6LL 1WTGT 1JUFB 5I3DA 4WWKD 3CN4A 1Q81D 2PCPA 3P11L 1A6TA 4ZCMA 1EDHA 4MA1C 3CN3A 4KI1A 1GVFA 4XTIA 3ULVC 3SGEH 2EPNA 2Z2UA 5G1YA 4H6EA 4Z08A 4H26B 4I9AA 2BSSB 1SJEA 3HTWA 5LXGL 3TASA 1WDSA 2NLJB 4NJKA 1UBSA 4NRZB 5CJXA 4N0FB 2NXGA 1YYCA 3T09A 2FX8H 3JZUA 2OTUA 4KQ3H 5ESQB 2ZSVB 4HXBL 1D5XB 4FFTA 1Q6CA 5XINA 1WDAA 3MNZB 5EG6C 3WJJC 4ADTA 1KTNA 3CIVA 4M6NH 2FK9A 4PWIA 5D70H 3G9VA 3WL9B 1D7CA 3KWUA 3AU6A 1XH2A 1BF8A 3TCXA 2VQ1A 4A1RA 4DN4L 3ZQ9A 5GGTH 5C3IA 2KT6A 3A9BA 2JTDA 1ZVSA 1A1NA 1F8TL 2POTA 1LEIB 1JZ2A 4B41A 3UAAA 4HYRA 3QZAA 3A6CH 4AZ7A 5K1JA 2OR2A 1P4MA 5GGVY 4FQHB 4TVUA 3PWGA 3JVGA 1MZRA 3DFPA 4W4OA 4ZXBC 4RNRA 5I1DB 1IGYA 4NN6B 1EFQA 3GRWL 3KWSA 3EO0A 5IQ9B 2P3YA 2HA1A 3VFUB 3OWRA 1ONRA 1YPZB 3TYDA 4JDYA 3ZE0E 3WEOA 4PLKD 4UDTB 5BRZA 4YFEA 2X6UA 4BZ2H 2V2TB 2QEJA 1OINA 2HXAA 5J1AB 2W6IA 3QQ4A 1R3WA 4XZUB 5FPIA 3Q9QA 4HT1L 3KPOB 4QXGL 3UTTE 4P2QA 4NZUL 5IW1B 1UW9A 2PGEA 2GG1A 1MFNA 1HXMA 1FAIL 1HILB 3VGFA 2YYTA 1OAQH 3CFTA 4JZNB 2GK1A 3KPNA 2E9IA 3DFNA 4ENZA 5FK9B 4X99A 3FQYA 3IKKA 1DHKA 4IPIA 1E5NA 2JKXA 5C9KA 3WF0A 5IFAH 2Q2LA 3MRHA 2R1PA 4H8WL 2ACRA 3CCQB 5K1NA 4IPPA 4AQ1A 3DX9A 3TVMD 3T0EC 4XTRD 1ZIAA 3CD4A 3RFZC 3TYUA 1F20A 1L5GA 2OI9B 3I02A 2GJZA 2W07A 4MMXA 1GJPA 5IB1A 2QCNA 3ZGIA 1XAKA 2OULB 4NJHA 1BG1A 4YE4H 3SCUA 4V2BA 2HPMA 1PYWA 3ICJA 4I1NB 3C6LD 4GEJA 3GYCA 5L2KD 5E5MB 3WLBA 5GS1A 3BUYA 1SFJA 2H8XA 5AKVA 1KRAC 1HVQA 2YCLB 4WOQA 3DIDA 5D1ZB 1E5UI 1ECYA 3D07A 3HAGA 3BH9A 1W0WB 4YDVA 3AT8A 2CPUA 3PGFL 1XPGA 1U8LA 5DHYA 2H0EA 1CLOH 2WPBA 2GYIA 3FQWB 3NXLA 4PR4A 4WHBA 5C0EB 4WFHE 5IT2L 1B0GB 3NR0A 4P5MB 3DENA 4AVJA 2AJVL 2B7OA 2I85A 3K81A 1ZHBB 3N1FC 2PO6A 3W4RA 4M7JH 3GUTA 1JYWA 4Y9AA 1FNLA 2NXYC 2K70A 5FA3A 4XNXL 3ZW3A 1F2XK 3G1SA 2CRIA 2H41A 1FWTA 1ZSXA 2CHOA 1OE1A 1UURA 2B1AL 3V4PB 3L3DB 1EWHA 3R94A 1Z9PA 1H63A 1YNLH 4NNBA 2GYSA 5BXRA 4GOSA 3ULVD 3KPMB 3FFCD 2FPVA 2OJZH 2OG9A 2FLBT 3HNTH 1W9UA 3T2OA 4P4KD 3FBQA 1YEIL 3QUZB 2C16A 3U0TA 3V7AA 4HSAC 3GSXA 1ZAIA 4CNSA 4WK2B 3RVTD 3B7TA 3S5SA 4JTKA 3OIHA 1JUEA 4HW6A 5HHOA 2WXJA 2GBVA 1YPZE 3IFOB 2AQ2A 3RJOA 1TVHB 1KFAH 4U1IB 2YA0A 4NO5B 4G7QB 4O54A 2RC5A 5KVFE 4BQCA 4KK9C 6TAAA 2DBLH 4JZOB 2I26N 4IWWA 1E6OL 1I8KA 2ED6A 4YXKL 2P28B 3WIAA 3NE5B 4EI0A 1ZRUA 4K3ZA 1V0EA 2QMKA 3ML9A 2W27A 1XIWC 2VXUH 5LGYA 1FWEC 1CE6A 5D4HA 5F72S 4OOZA 1MDRA 3LHAA 3HPLA 1XRTA 2X0YA 3DKLA 2VR6A 1I8MA 3O11A 3UYIA 2AJ3A 4A3HA 5FCUH 4JFOA 4ZXBD 3AQXA 2ZF9A 1SZEA 4LP5A 2BNRB 5G5DA 4HUMB 2FGLA 4YS4A 1S3KH 3UZQA 5HYEA 4JCLA 5FIPA 2YDAA 4OCWH 3UROR 1Q45A 1CD8A 3ME3A 1SU5A 2PW1A 5I3HA 3LNIA 3A64A 1VFBB 5JQ9A 4R71A 1YJDH 2XNCA 3CZGA 5KMYA 4DO7A 3MJ7A 4D0DA 1KFBA 2OZ4H 3GKZA 1VQ6B 2DI9A 4XNZC 1FNSH 1C16A 2YQBA 4C47A 1AJ2A 1KCSL 1EDQA 3WJMB 2PTYA 3HN3A 2JLLA 2CR3A 5BO1H 1UWGL 1CR9H 3T77B 2XGJA 1PHWA 2NR6C 3LAFA 2OLHA 1FC2D 2ZG2A 1HINH 4KMTL 2APFA 5F89A 4B5ZA 4RPPA 1INQB 5DJYA 1BGAA 2UZIH 3VD4A 4ZX6A 1GGCH 4QCIB 1KYOJ 5TY0A 2ATKA 4JPWL 1AIZA 4Y4HC 1QVOB 3H9YA 3FO0L 4XAGA 4ZK8A 1KGCE 3FDKA 1PCWA 3CSFA 4A3YA 3W82A 2Q02A 4OPVA 5CKAA 3T6QC 3WLLA 3U9IA 1JYXA 3CUGA 1WD8A 3BRFA 3PWJA 1DQVA 2VENA 2AQTA 2CETA 3LCFA 4OH2A 1OSEA 3SURA 2IOOA 3WLRA 4UQCA 2TYSA 1H9VA 4M5SA 5ESAB 2JJSC 1X4YA 1UKQA 2ZQKA 4Z17A 2V2CA 4ZXLA 4G3YH 3FUIA 4EPBC 2UV8G 3S1VA 3QQWA 3DOHA 3DC0A 1XH3A 1SQMA 2PPEA 1EP1A 4M8QB 4DO6A 2KDGA 2YCIX 3U1SH 5RUBA 3K6SA 1K9MD 4ZUUA 4YHBA 5MERA 1TUIA 1CFNB 1I3UA 4OSUL 4DZBA 3W39A 1G7RA 2ED8A 4X6CB 5EMUA 1SYSA 3K5XA 4RKAA 3HS9A 2X09A 2X4QA 2QSVA 1J93A 1SPQA 4RGMB 4NFCA 2WAGA 1IEHA 1BQRA 2HROA 4AC1X 3H53A 5T9CE 3G6JF 4YHNA 2NXYD 2Z1XA 4E5XG 3U2CA 5JW4M 1XIHA 3PZIA 1KY7A 1VLWA 3P5ZA 2CO6A 1E6SM 1W37A 5EOCH 4OCYL 3PBWA 1U0QA 4EZMA 4LCWB 7TIMA 4X5RA 5IBUG 3GIVA 3HLKA 4MB1A 1LL7A 3H3BC 4HS3B 1AMOA 4A37A 1O9VA 2YBUA 4IIDA 3SCTA 5FUOL 1A5CA 4HWBA 2HJLB 1R3JB 1XDTT 2BNRE 4CCCA 4YE0A 4B3VA 4HPYL 3S88L 1Z66A 1PY9A 2BNUB 5J6SA 1QAWA 1KXQA 2X6VA 1FQ0A 2A9BA 5EFIA 3UQNA 3X3FH 4Y1AD 2BRRH 4L6DA 2JJ2A 4EANA 4TUOB 1N0XL 4F20A 2HKFH 5KTEH 2XTJC 4B6ZA 4Y9GA 3QFGA 3QFTA 4A7GA 2NNFA 2AOSA 3TV3H 5DC4B 4KK9D 4IIHA 5DBUA 4KCTA 2BM0A 2GJRA 1VLOA 4Z78A 3BKJL 2RFXB 2GREA 5KJRH 1GW0A 3CLFH 3B8SA 5A6KA 3LZ3A 4NCDA 1XIWD 4RE2A 2OBRA 3DX2A 4Z7IA 4C54A 1OX6A 2ZTBA 3MLZL 3GDBA 3E0IA 4OZGA 1BVNT 1SY6L 4H01A 3OKNB 4PJXF 1Z9OA 4OLYH 3AICA 4K3GA 3BVVA 4JQVA 3MOAH 4IMAA 3UACA 5IYPA 3KRSA 4BQ9A 1U83A 1BRLB 1K3IA 4OF8A 3P62A 3MRRB 1I7TB 3QIWA 2NQCA 5J3HC 4B53A 4P2NA 1OWQA 3G1DA 3BZEB 4AQLA 3MROB 3FAWA 1BQLH 4K94C 1E6PA 3WXVH 4BWWA 2W9EH 3ECBB 3BT0A 4WEBH 4MMZA 3GI8L 3L5WB 3MUHL 1VZWA 2KDYA 4G1NA 1S7SB 3FHEA 1HI6A 1AD1A 1AW1A 3F7VA 3U7WL 3GLDA 4OJFL 5DVMA 1QXLA 1YCSA 2ON3A 1DBBL 1P5VB 2B16A 2FUQA 1ZCRA 2DI7A 3DFHA 3GXNA 1XO8A 4XMVA 3WY3A 3CLMA 2FRGP 3MNDA 4IBZA 6FABL 4ONGH 3QEHB 3PBGA 1F2QA 4M93B 1IT8A 3P40A 2NR6D 3L3GA 4LLQB 5DSCB 3MLTA 1INDH 2AQNA 3EZ4A 3D0LB 2YQ2A 1LDPL 2X4UA 1V0MA 4PGLA 4IMCA 3SJVB 4X6CE 4Y4HD 4OAWA 5LKNA 1PKQA 1CDHA 1Z3NA 3TVAA 2N56A 1F07A 3RWFA 3BUVA 1N5AB 4HUUB 3TNNB 1RJYA 1I8IA 2YGQA 3ZZ0A 1EAQA 4WGKA 4EDWL 4CN6A 4IJ3B 1NIAA 3IK4A 2R2CA 5I5RA 1TMQA 4EI5A 4O2CA 3RGVA 3H3PH 4LCWE 4M6ML 1G9EA 3V8CA 3PG9A 4MDOA 2ZX7A 5C0BB 3F01A 5DHVH 4L4VA 5C7VA 1UWSA 2VJ8A 4S3FA 4ZR8A 4UZFA 4ZO7A 3GY1A 2FQDA 3WIHL 4LF2A 5HYJD 3JTSB 5CBAA 1BLNA 2AXHA 1Q9WA 5C0ND 4RD4A 5H8MA 5GRJH 4GKZB 1AZ1A 2CLOA 3RU8X 5JNYB 1WAWA 4S3JA 3RIAF 3FHAA 2F1AA 4NAFB 2V2WA 2O61A 4E6MA 5EOTA 1LRNA 2B1HL 4GYPC 4AEOA 1EO7A 2W6RA 4DPPA 4JE0A 4FQ2H 4LS0A 1GYLA 3CWNA 4NZ1A 3IIZA 3OOQA 1HL9A 5JHMA 4M80A 5JOEA 1RALA 5AW2B 2V5MA 2H3NB 4UQAA 4JYEA 4WSGA 4LLAA 3IJ7A 1D9KC 3EA1A 4IBUA 4FAAB 1R5OA 1TPC1 4FXKB 4MD0A 3P9MA 3DVIA 2P1YA 3MLXH 1TO5A 3FHQA 3MPGA 3ULAB 3E74A 1M7XA 3ZMNA 2WXIA 3O4LB 1M7DB 4M7ZB 2PKDA 4HSQA 4J3OC 5AECA 1MCEA 4GVHA 2BIOA 3M7WA 4PODA 1RUQL 2VM8A 4BQ8A 4FO4A 1WZAA 3X1NA 1XMWA 4MIMA 3FO1A 3UC0H 4C6DA 2VZ1A 1F3DH 1X5MA 1XS2A 3T53B 2ZP0T 3UTZB 2J1XA 2FBRA 1S2UA 4JYDA 1OHZA 4MQ7A 3PVDA 2PUQT 3ZUCA 1V5XA 1FNGB 4J9JA 3ZLGA 5KTLA 2HFFB 2X1PA 4UILH 2A0LC 1H7OA 5EEZA 3HE6B 3WMBA 1KTLA 4NQVB 4X6EB 1N67A 3HMWH 5SWZB 4N87A 5KYNA 3WSQH 3EOSA 1AD0B 2Q6WB 3EGSA 1TPXC 1C5BH 4G7VL 4HPOH 1QHOA 3PUNA 4TQEL 4KY1L 5DC9B 2E09A 4QRBA 1YTKA 4X8IA 1CFQA 4MFHA 5D05A 1KRBC 2ODHA 4MHBA 1MQ8A 1U92B 4UM9A 3H8NA 1WOPA 4KX9A 1RLBA 2ZWSA 2PTVA 4DGWC 5J3HD 4LX4A 2C14A 2XQYG 2XIJA 3SJVE 5FEZA 5D4JA 1E50A 1FLRH 4HJSA 3EOTL 5DCDA 3FB5A 3QS2A 4U6VL 4F15C 2A3LA 1EXPA 1FSKB 5FNZA 1VZIA 1TFVA 4HIHA 1E43A 3F4VA 4WTXA 5E56A 2O9TA 3N13A 1ETA1 3QJQB 5FGCB 4MBRA 4RL3A 3GHUA 4QGCA 3H7LA 2A5UA 3PABB 2ERJB 1VCBC 3H4HA 4XCCH 3ZKXC 1KYOK 4G56A 4AC2A 1A7RH 4XO5A 4BSWB 1BF2A 5C0BE 3OYXA 2D03H 4WO0A 3U36B 2J13A 5D8WA 1Y7VA 1IR1A 3NJLA 1CFSB 2ISFA 4BS0A 1J8SA 3T8XA 3X12B 3E2HB 4HBCH 2X1OA 5M94B 2ABAA 1FV1A 1MY7A 4JE4B 2BSAA 2NZ9C 4GO8A 1PEZA 2BSRB 1MCPL 5H37A 1EBPA 2DSVA 2XIBA 3BL3A 5E2VL 1W0KA 3ZDWA 4GSXA 4ZMTA 3WNMA 2CHNA 2CRVA 3OLGA 1TZOA 1CTMA 3G1HA 3CDCA 2Y2TA 2VZOA 2EDEA 3AG1B 5C9RA 3HE7C 2QGDA 1IBBA 5ABAA 1J1XH 1Q9KB 3C2SA 1H3XA 2F6UA 1O7DE 1V3JA 4HHAA 1EJRC 3UA3A 4DK3A 2JF6A 3OZVA 2QPSA 3NFNB 1FRGL 1MI5A 4HIPA 4FKKA 4K37A 4M61A 5AC6A 1JQXA 3G6AA 1A8PA 2M83A 3HGOA 4PCPA 4IBTA 3QCVH 3TH4T 4QHKI 1D5ZB 2OR9L 2ZKWA 2W80C 5EIIG 3VFTA 5A2FA 4MY8A 3O4LE 2R1WA 5JYMA 1RK6A 4G8EA 5KS9A 4IZGA 4IJTA 1U30A 3UWEA 3DGRA 5DHVB 1MRCL 1HEJC 4C6BA 4I4WB 2VR3A 1NSNH 1WBYA 5E2TL 4YHKL 2EAEA 4YIQA 2Y61A 1AP2B 3CV7A 1VAHA 4O18A 1SMAA 4DX3A 1FAKT 1HK6A 5KSAA 4O51A 3DGDA 3I6SA 3TIEB 1KRMA 3SQRA 3EFOA 4IW4C 1TKWB 3SBRA 1SMOA 4Q2ZB 3KRUA 1MCRA 4GUPB 5I3JA 1E1RA 1QMUA 2ZRZA 2VXNA 5SWZE 5FFGA 1UJ3C 1BIIB 1D1NA 1QR1B 2R51A 2VVSA 1RJZB 3UG4A 3UO8B 2QR6A 3ZZLA 1D9KD 1IBGH 5I19H 4EOUA 4LCQA 2HTMA 5GS2D 1E4HA 4Q33A 2XN2A 5CM1A 5DYOA 5F7YC 3OXRA 2HV5A 2XA8L 4L4JA 2J1YA 1PZUB 1PEWA 3ZUNC 3JTBA 1DWFM 1QRQA 4J3OD 4EEEA 5D8JH 4FZ8L 1Z9SB 5TFSH 4US6A 1U8HA 5IHBA 4WDIB 2VLJD 3D50A 4MKSA 3Q2LA 3MOBL 2VZSA 4EF8A 1F00I 3E8UH 2ZZ1A 3NQMA 1YBQA 3PIQA 3W1PA 3FJTA 4CC4C 2Y88A 2BWIA 3VFVB 5HBBA 4XPGH 5BS0D 4KKSA 2YXVA 5FGCE 3R12A 3O6KL 2E1WA 4GRWH 2A4EA 5G4EA 1CT8A 3CU1A 4ADSA 1F60A 4O53A 2X4NB 2A0LD 4LGPB 2C9XA 1Q6GA 1HNYA 4UNVA 2VE6B 3HBZA 3BG5A 1BVLA 3G6JB 5E00B 1WG3A 3CN0A 1SO6A 4R96B 2WW8A 3MW7A 5ADPH 2ZXWB 1WLHA 2FEJA 3XIMA 4WCYH 3NTCH 4N2MA 1NC2B 1CQXA 1G43A 4F40A 4ML9A 3BZ4A 3O6CA 2WNQA 3AIRA 3DMMC 4ROXA 1XEUA 2BOEX 1QNRA 4FCHA 2BOCA 1U58B 5D7LB 3JWOL 2QPXA 1SZFA 3O6AA 5EBAA 4U49A 3ZIAA 2V7HA 3MRLB 1FH2A 4N86A 2W94A 3BUBA 5C2BH 1L9RA 4M6PA 2KI6A 4IOSA 2WZPA 4NHUB 5HMDA 2FTPA 3P4MB 2QCMA 3LCLA 4YMPA 2OLDA 1X9QA 1PZ5A 2IDTA 3WEXB 1EFRA 4KX8A 4E42B 3FUKA 3KBHE 1KXTA 3L16A 5I8OL 4BRJA 4X50A 2FX7H 3MRFA 1FC1A 1V6TA 5AW8B 4XNUL 4FQXC 4YAFA 4IIGA 1H0GA 4AF0B 4PJXB 2A6IA 2ZG3A 1BQGA 4ADIA 2NQ9A 3BO8A 4M6OL 4XB7A 2UY5A 2G60L 1K3UA 4GUHA 2VR9A 5B7MA 2NZ9D 3QH2A 2VNJA 1HL8A 1DLFL 1CB4A 2HISA 4OOXA 4IQHA 4P3CL 3NJ3A 4P2OC 1W2BB 1BJKA 3S2LA 1FDZA 4MDIB 5T1LA 4G7EA 4TXEA 1TZGH 4PM1A 5K9QG 4OCXL 5C08B 3HE7D 1A7QH 3TBVB 4NM8L 4FK8A 1ZGDA 4IRZA 5HI4C 2IH3B 2XQBH 4NYLA 3SFWA 2V31A 4OQTA 1OCWL 3L6FB 4N8PA 3QH3B 4DKAA 1RZGB 1U1JA 3BFQG 2EH8L 1IAIM 3F04A 2D0FA 4S3AA 3LUTA 4X9FA 1K8YA 4DP0X 1U2HA 3I6EA 2HJKA 4HOZA 4NL1A 4NPYB 2VC5A 5LXVA 1T20A 4JB9H 5FYKL 1G7UA 1H41A 5DR5L 3BZGA 3DX6A 1FFPB 2FT6A 2H9AA 4QRSB 4WV1C 3U2SA 1VYPX 4L1LA 4NNYB 2FGBA 4R97B 3O2DA 4Q7NA 2NSQA 4HPJA 2AJSH 3PHSA 5JIWA 2VM4A 2BOBB 3ZL4H 3H7BA 1ZSHA 3EDKA 4MLRA 1LO4H 1YJ9B 1OGPA 1ZLUK 4ZO6A 1XR8B 2DEWX 1CC3A 5F7FA 3X1GA 3G6JE 3PJTA 5KZCD 1RZIB 1LWIA 2XWRA 3BWUF 3MN8A 3AU1B 3ESOA 1WBZB 4EIBA 1UZDA 5GISH 2UX6A 5MP6H 4LAKA 4GW5B 4YUEH 3PG2A 4OIIL 2HB0A 1G0XA 2ZRYA 2R1XB 3S5ZA 4IGHA 4GMEA 1JI2A 2EDOA 4K2UL 1LLOA 2VYQA 3MMPA 4P3YA 5EUKA 1WWBX 1TDQA 5I30L 2EEXA 2XN1A 3T9WA 3FA3A 4C56A 3UABA 1GJRA 3QPQC 5D7LE 3TF4A 1GHSA 4F8TA 4A38A 4GI9A 4ODTL 4WI8A 2UY7A 4NJ9L 4DTGL 3LHPH 3WD5H 1ZFJA 2E4TA 4P2YA 1AD9B 3TYAA 4B44A 3T2NL 3E0LA 1RKRA 1MJUH 1SXAA 4L29B 1TLMA 4XV0A 4CKQA 3WNDA 3APGA 3B9NA 4XCFH 3LQZA 4B3FX 1F76A 1RULL 5DRWA 4LCYA 4Z2JA 3TIDA 1Q4WA 5C6MA 1PDYA 1XD0A 3LKRB 2BMWA 1RU9H 4MD4B 3J7HA 1W8SA 4R85A 1W72L 4CSZA 4RDKA 2GBUA 2EABA 4X98A 3JV0A 3BH8A 1XLAA 1UQZA 4YELA 3BQUA 2IH1B 3SY0B 3WKMH 4PJXE 2FEDC 4O1BA 3ARDB 3GHEL 2HFEB 1D2KA 3AG4B 3DMMD 3UJTL 1OX4A 3QS3A 3K6DA 2Y22A 1NPUA 4JFUA 4UQ3B 5E99L 4QM1A 4D0CA 1E1CB 1FNEA 2QUTA 3F2BA 5SWSB 3KCJA 3GFYA 4O00A 4HWEH 3DHUA 4E9YA 4B27A 3WO3B 3TUUA 3VXPB 5C08E 2BY0A 4N0YH 3O9WA 4F1ZA 5FLVA 3IIOA 1OF2B 5DJ2A 2I5IA 2R4SL 4PWEA 1G7IA 3CZUB 5FYKU 5AB0A 5EMJA 3GBNL 3UJSA 4RAHA 5HJGA 2LOEA 2XWZA 1DQLH 3TYFB 32C2B 5F93C 3GAYA 1MIMH 1T1YB 3CHFA 2FQEA 2R2BA 1ZHKB 4YAQB 3V0VA 5C9ZA 4JM2A 4L5FL 3BP4A 4UXDA 1OC6A 4ORGA 5E9AA 1PKVA 2P9RA 3M86A 5DUBB 2FWUA 1F45A 1OGJA 3OQ8A 3EH1A 3ATAA 4I7ZC 1PFCA 1TU2A 2BW4A 3LHTA 1ULVA 4H88L 1T22A 1K9FA 4ECLA 3QUKA 4Z7QF 4DLMA 4F0MA 2R2HA 1LG2A 4NQED 2VDLH 3WLIA 1AQDA 4D1IA 4P2OD 1E64A 1UH2A 3PFUA 4RAUA 4PJ9B 2PDCA 2ZRXA 5DFWH 5T33H 1GRWA 3DVGA 3W84A 3UJRA 5HVHB 2WXDM 3CYJA 1W5QA 2FH8A 3ZPDA 5HI4D 1ML1A 2O55A 1JWUB 1FZOA 1KUMA 2CZ5A 1L6YA 3G1VA 4X4YA 4IM4A 4P2VA 1EOKA 2W65B 3KW7A 1S7UB 3OB0K 1K8XA 4WJEA 1GYMA 2W88A 5CJ8A 5HNUA 3GMMA 3WDQA 3ZTNH 5JXEC 1AFSA 3S2MA 3L65A 1UVQB 1JNHB 3SUTA 3L9CA 4NFDA 1N68A 4PGEA 3N04A 1G01A 1H3TA 3VI3A 1KGYE 3TA4D 3D18B 1GZPB 4NIYE 2HK0A 1KPRA 4N8CL 3MUZ1 2XY2A 4HDIB 4QE5A 5I3IA 4JO2H 4MRBA 1WC7B 3WY2A 1UM5H 2A3BA 5C2UB 5DURD 4G9PA 1W72B 4X7CA 2NNAA 4DWSB 1KRCC 5DMIH 2ZVIA 3SDXB 2NTFA 1T7ZA 4K3JH 3V4VB 4MB3A 1IAIH 1SLUA 2OK7A 4N8VG 4ODUB 4ES9A 3O3BA 2DH2A 4Y8EA 4W81A 2Z35B 5FM5M 2WP3O 4GAYA 4UTLA 4WHCA 4GIYA 1OFOA 4Q22A 3HRZB 2PDWA 4JRXA 3IVUA 2WJYA 4RDYA 2VYRE 1A5LC 2IAMC 4FKEA 1OAYL 3OR6A 1UZ8B 1NUFA 3MAWA 5DANA 3U7AA 4PZVA 2Y70A 4NQXA 5HXMA 1O68A 1TQBC 3MCMA 4ILDA 4EXPX 4XNYH 4H8HA 3QPQD 1N06A 1NWOA 3FW6A 2HCJB 2VBVA 5DEFB 2BODX 4CLMA 2XQYK 2HPOA 5SWSE 5FO7B 5CCKH 4LSRL 3FCSA 3WQFA 3FRPB 4EI6B 4ZMYA 2D23A 1DHPA 4P23A 2PTZA 3QDHA 3ARBB 4ZS7L 4M5TA 4LVGA 1P84K 1AQKL 4RXGA 4ZQNA 4G7RB 4G8GA 3GSNL 3RGBA 1W5MA 4E2OA 4WTQA 4IKLA 3QIUC 1OAUH 4F80A 5DHXB 1G9MH 4TSCL 5DZAA 4P8WA 2Y69B 3D8MA 2VW4A 3H26A 1TJGH 3QZWB 1ICSA 4X06A 2PZ0A 3W2DH 1H5YA 2DT3A 5H91A 2QXWA 1UB6A 2FEDD 3VKKA 1NJ9B 3VXUA 5KVFH 5EFFA 3B9KC 3L3KB 2X2HA 4FMVA 3T2QA 4HA1A 1ZUAX 2XM2A 3TSDA 1Q6EA 1IEBA 3SEPA 1RK0A 3QAQA 3MSDA 4UMGA 1R3RA 1HHIA 4B9PA 1F6AB 1SYVB 1FKWA 3RX2A 3TTOA 4DKEH 3K71B 4HSHA 2UWEA 3FT4A 2X1QA 3FB6B 1E5ZA 4WFGD 5I09A 3P3RA 1NCGA 1E4KC 4FXUA 5JOFA 5IMMA 1MNSA 1Q6RA 4N0CC 2EDKA 1JRCA 3II3A 3MUJA 4E0FA 1K77A 2NY4D 3MZNA 5J89A 2RDWA 1XFOA 1KIQB 2HYMA 5E8DL 2G75A 3O8XD 4DI8A 4DQLA 1IGFL 5B7FA 2PTDA 1MCBA 3HZKB 5J8OA 4B9GA 5IV2B 4MYTA 1UUSA 1VS1A 4HFWB 3P11H 1X1ZA 2VN7A 4R3SA 3U4AA 2DOGA 4XNBA 5HHNA 2V5KA 4XO8A 1B3WA 1SDDA 5AAPA 4JRYD 3IWVA 1GGBL 3O4OB 1HWWA 1PJWA 1BYBA 4YXHL 1W16A 3VZYA 1ZIBA 2PEVA 3NG3A 3M1BA 3BLKA 3QMSA 3SDXE 1Y5VA 2DY3A 3AZSA 5DD5L 2QDVA 5DELA 5DVLA 2VDLB 1KBLA 3J81k 3TN0B 4HU2A 1RH8A 3DXAD 1ZEAL 4FABL 3QNXB 3QM3A 3P02A 1J0JA 3HQPA 1ZE3H 1MG3C 4FS9A 3BLIA 1HCYA 1WTHD 4Q8UA 2OW6A 1V6WA 1MCWM 4DN4H 1MABA 1JPGA 5EN2B 4GRSA 3LV3B 2Z1KA 1HKWA 2XYLA 1XGQA 2PWGA 2ZYIA 2K7QA 3VE7A 4GZJA 1F8TH 4JY8A 1PJ5A 4BQ4A 3MYOA 3GMOA 1S4IA 5ISZA 4MFEA 2GJ6A 1JYNA 2WUCL 3HFFA 4PS4L 4ZUWA 3GRWH 2A74B 3ULUC 4R2GD 3OHXA 4LHUB 2Y7NA 2JN9A 4L5FE 3ULSB 3EWDA 4NO0D 5TD4A 3G0XA 1KACB 2FWOA 3UBXA 1W8GA 4DJEC 2FX9H 1LP9F 3BCFA 2WZTA 1JMXA 4EPDC 1MCCA 3MCYA 5DRXA 4HT1H 5DI8A 4PMVA 4NZUH 1QPQA 1T66C 2DEYX 3C5SB 2MCG1 1KFLA 3W88A 2JIZA 1FAIH 4XI5C 3R4RA 1XDLA 2IAMD 1Q9OB 3QJFA 1RXOB 1T7LA 2EXYC 1I7ZB 3IE9A 1Y0LA 3SYQA 4L18A 4GH3A 1W15A 4G9FD 2HPIA 1OSZA 2R24A 3AG2B 2GTQA 1AS8A 43C9A 2DBJA 1SFTA 5FOJA 4KRLB 3W7HA 1KJ2A 5T1KA 4E5XA 4TQ8A 3D6GA 2Q6KA 1F1AA 4HJGA 3KTSA 4ZMGA 1JFQL 2EINB 2R59A 1OV8A 3QNYA 5F9OL 2XGZA 4N9OB 5IW6A 4NT0A 4XOEA 3LRLA 4LVBA 1AGFB 4DNRB 3IE4A 3QIUD 2OYMA 2X7WA 1RD6A 5IBLC 4TNEA 2EYSB 2H3BA 5ETUB 1RQ5A 4OT1L 3W9DA 4U9UA 4F2EA 3WAKA 2BHFA 3D2UA 2OAAA 4XUYA 1BPLA 1K8DB 4GMTL 1PF3A 1WOOA 4NJIA 2DM2A 1E6JL 4KRTA 3NABL 4O19A 4LF3B 3W2FA 4G1MA 4K5LA 1K2DB 2ZNWA 2PCQA 4PMUA 2FJFA 2E5CA 5E6UB 1HP5A 2L7UA 3HZVB 4YHLL 2O6DA 4XBPB 1MFEL 3PGFH 3Q2VA 3RY6A 2RKXA 4PMJA 1DWIM 1MW0A 3C0SA 4ANKA 3P61A 5J6GB 5I00A 4FQJL 5IT2H 1QFPA 4NILA 1UOLA 1KBGH 2AJVH 1RSYA 3PGDB 4EWJA 1UOZA 4LRTA 3SE4A 3GHRA 1KK1A 4ODWB 1FGVL 3ATBA 2RA1A 4N0CD 1W8EA 3G5XB 4Z6AT 4XNQB 3P3SA 2AXFA 3HTLX 1F0LA 4GQBA 5EZOL 4XNXH 1WV7T 5F1IB 4XMLL 2CQVA 3VTRA 2B1AH 1GTFA 3U3HA 2Y5TA 1T6ZA 3S83A 3BJ91 1OFRA 1M56B 1FHNA 1T3FB 2GUOB 4IJRA 2ROYA 1YEIH 4ATTA 4DGYL 4ZX4A 1OWRM 3C9NB 2X4TB 2XUWA 1XG4A 2QLYA 4C55A 1QLRA 2ZOOA 1SEBA 3MBWB 1A9EB 1R24A 1UA7A 1NDMA 1E6RA 3MUAA 3VIMA 1T5XB 3M6DA 1SW7A 2ZZ6A 4UFLA 1K4DB 1DJHA 4LBVA 2HT3C 4W9IC 2VH5L 2OQJA 2TODA 2UXTA 3Q5YA 1QNOA 4YXKH 4XO3A 3NZ1A 1PD1A 1COWA 4QGYA 4QFUA 3AVVA 3KZPA 2HX8A 3QDMA 3PQYB 2OFJA 4HQVA 1VPXA 3CCSB 2N3JA 1A0CA 3QVAA 5HJ3A 1MLCA 2FEEI 4WXYA 5C97A 1MLBA 4UIMB 1FHLA 3PLYA 2RGLA 3BPNB 3K7UA 3RWEB 4HNUA 4OY9A 4Y4FB 4UTWA 3CPRA 1TV3A 2JK5B 4ODXA 5F1NB 1GKQA 2CRMA 5BJTB 3MO4A 3VGGA 1IFHL 3ZM8A 4Y7OC 5EMMA 4Z7QB 2AGTA 4LQFH 2RUSA 3SPJA 3ULUD 1GYNA 1UWRA 5CKSA 2PP8A 3VR6A 5CC3A 3O7UA 3FLUA 1N8ZA 3D0CA 4P57A 4DJED 4B2DA 4GUIA 4FXGB 4F9PA 3F7PC 3SKMA 1WIUA 1G6RA 1SJHB 1BPVA 5DJ8B 1Y6KR 2B1OA 1T66D 2DKMA 4XI5D 4PJ8A 1MRFL 3CHEA 4OUUA 5D96C 1GQIA 3EHBB 3ZXWA 4Q4RA 3DFOA 1KCSH 4PEKA 5A8QA 3NDYE 4AG4H 2NYYC 3U79A 3MFFA 2KZHA 5ELIA 4NRSA 5CMAA 4I87A 4DZ8A 3VDHA 1FDJA 4LC0A 3I75A 2YL5A 2Y8KA 5LUMA 1T5KA 5DD6B 2X6CA 3VGAB 4Z2KA 3IFLH 1XLEA 1WCQA 1EXBA 4BZ1H 4Y96A 4AQ8A 5CPLA 1FL5A 4TR9A 4AC9A 2CDGB 1B3YA 4L9LC 4JPWH 1A64A 1AYOA 4MHHG 2OL3L 3T44A 3NJHA 4RZ4A 3FO0H 4U5IA 3L4YA 4E9SA 1LBMA 2AV7A 1IC0A 4L3EB 1KW1A 1MJ8L 2ZPKL 1GZJA 4IP7A 2FH6A 5IBLD 1XCTA 2AEIT 1WVZA 1KCLA 3GHPA 3NN8A 3PZNA 1P4BL 4LLWA 3MLWL 1UD8A 2EPOA 1D5BB 1RBLA 4DP7X 3P2BA 3GNOA 3M45A 2CBMA 4PG9A 4D3CL 1U8JB 2JGQA 5FEXA 4D8LA 1UXSA 3R4IA 4WOZA 4DUOA 2EDHA 5F8QC 1HGYA 3C56A 3LN4A 3UPRA 4QRTA 3GS0A 7TAAA 4MYWB 4H25A 4OSUH 3MRKA 5I28A 1JPFA 1QBLL 1YAIA 3I65A 1EHXA 3MC5A 1LL4A 2YMOA 4Q89A 4LF1A 4OM1L 3T4AA 2X89D 1EZWA 1PV8A 5DZLA 5TRDA 4JPQA 3Q1EA 1UB5A 1QI3A 4S1SL 2JKSA 3W1AA 1SHWA 4W93A 5B39A 5BU6A 5THXA 4HQQL 4ZMXA 3PQYE 1MAML 1MFCL 3V5HB 3ASNB 2XQYA 5EZJB 4O4WA 1EA0A 5B80A 1D5MA 1YEJH 3T0ED 4OCYH 1DCLA 5J56B 2FDBP 3S1XA 3TX4A 2C4FT 2JV6A 1CICB 4IIBA 3JU4A 5D9OA 2FLMA 2J12B 5FUOH 1Y1DA 1FWGC 3SCNA 4Z7QE 4AENA 4KWVA 4PBEA 3PRZA 1NQ6A 4PN2A 3S88H 2P7TA 5LGXA 4PW3A 3WE6A 3G6LA 1CQKA 2IPJA 2X1TA 3SQBB 1LWRA 2HNHA 1N0XH 2AEPH 1KXHA 4H4IA 4WKZA 4ICCX 3DX8A 1NINA 2EC9U 2EPMX 3UBXG 2JBMA 3TA6A 5IROA 2WLKA 3C2RA 4KEVA 3Q8EA 2HT3D 2A6KB 1N70A 3ASQA 5LNUA 1FH9A 4AEHL 4ZJ9A 1HP4A 4BCEA 4WW1B 2Z00A 2I9TB 3RVVC 4CNIA 2GTWB 3V5DB 4L4TD 4M7KL 3WK0A 3MLZH 1UYWL 1DBKL 4F33B 3W87A 2WXPA 2OMXB 5A6BA 5ENLA 5GGRY 5K4XA 1ADSA 1U95B 3PWNB 4Q4OA 3W71A 2R7EB 4U3CA 3ROLA 4QLLA 1UIPA 1MCIA 4D9LL 2XFGB 2IALA 3U7VA 1DE4B 2ZAGA 2CESA 3S3PA 4N28A 3SRDA 3N44F 4G6FD 1DCEA 4B9CA 1PHQA 1TQJA 4X6BB 1XXDC 1QD0A 1OCRB 2O1AA 2C18A 4YHOL 5I18L 5AW5B 4MADA 4L3EE 5EIIA 2XZQL 2YFNA 3UZEC 4GCXA 4XPFH 4DZHA 4L4OA 5GGRB 5DHDA 4UMAA 4JJOA 1N64H 2YARA 3GI8H 1RA5A 1A5UA 3QT2A 4MBOA 2NY3C 3UTSD 3HI1A 4N4QA 5FA4B 5FOBA 1Q8JA 4DYKA 1I1WA 5MEQB 4ZSTA 1A7PL 3G5YA 4OJFH 5H2BA 2ASHA 1DBBH 4V2XA 1RA0A 4W4QA 3VFWB 3FSZA 3I6LE 1VJSA 2Z4QA 1TT6A 2ZP9A 2GBAA 5DJCA 6FABH 1CLYL 3BV4A 1TJIL 1XEDA 1GSKA 1W3TA 2WOYA 3GJFH 3APYA 3IVKA 3IJIA 4MVAA 4HJEA 3N2XA 1J6PA 5DEGB 5CSRA 5D2LA 2DYIA 4BSVB 1LDPH 1PD6A 4CJ1A 5D4QA 1W0VB 3ASRA 4QE4A 3IAGC 3VH8B 4QMEA 2QDEA 1FH5L 2HNEA 2FO8A 1RZ7L 3EYVA 2OM5A 4MF4A 1RPUA 2PPCA 4MAYC 4O13A 5TQLA 3STGA 4Q8TA 3CFUA 1LP9B 5FEWA 9RUBA 4EDWH 4WXZA 1KIUB 3R6JA 1EGMA 3U30C 3VUSA 3P2DA 1Q86D 5A6IA 5HYFA 1DVZA 4PMEA 1H8HA 1CXFA 1HVXA 2M2DA 3K2IA 3ZBTA 4HKZA 3CL7A 1RFDH 2ALWA 4QJ3B 2NNXA 5CGBA 3UEZA 3WIHH 3UXFA 2DZTA 1IWBA 3BPCA 3ILPA 1JPEA 3ONBA 4JL2A 3W1UA 3A4FA 5LO7A 1HN1A 2E7BA 4YTSA 4TM9A 4QEGA 4Y7EA 2O4MA 4KKCC 1BQUA 2ZADA 5HYSB 4CMMA 4M00A 3G5ZB 3SO5A 2B1HH 4DF1A 2G4FA 4M1GH 3VCLA 3IRZA 4GPNA 4L6HA 2E7HA 1J8KA 3GXUB 4J6IA 3MV8A 1F97A 4NENB 4ZQKA 3VXRA 4BEIA 2EDYA 4AXWB 1MCSA 1JF6A 1S3TC 3ZUGA 3NDZE 1HHJB 5A16B 1KTVA 4M6QA 4GGHA 4QSHA 3WLKX 1E7VA 1XYMA 5E6RB 4MG4A 3RTQC 3GQBA 2VFGA 4HU4A 4HCRL 2OO6A 2HUHA 1AIFA 4D6EA 4ZMOA 6A3HA 1J9SA 3DROA 1I45A 3GH5A 1GAFL 1NGPL 2PF0A 4JS7A 4M6AA 5HI3C 3QFJA 4FXJA 4I6KA 3GGWB 1LE5B 4JEGB 3HFYA 3LPPA 1J8HB 4OZFG 3UNTA 1ONQB 2PYEA 5CNHA 5E94A 4QJ1A 2CIKA 3AB0C 3OX8A 1RUQH 1K6QL 4XXDA 1LT7A 1BXCA 2GDVA 3MZ2A 5BXFB 1HL5A 3TBTA 1IXPA 2MHAA 6XIAA 3IIVA 2YPLB 1ITQA 5EC2A 4LBEB 2WBXA 1UT9A 2IPUG 5AG9A 3SGZA 3QUML 1N59A 5D7EA 1LQSR 3FY1A 3UWVA 1W1TA 2EDBA 1MPAH 5AVRB 4PJ7F 3KPSD 3RVVD 4QYOB 3OPZL 3UAJC 2XPGB 1UXWA 1PE1A 3AUWB 4IRJA 4HETA 4BUGA 2EIMB 1OTTC 3OC5A 4GD0A 1F58H 4G7VH 5I2IA 1NJID 1TEFA 4UQ9A 3HLAB 5KEZA 1CYXA 4TQEH 2EIZB 4AH2A 2E0PA 1J05A 2DQFB 1T6BX 1ZLEA 4P46B 4S23A 1RCOB 4BF7A 1QG3A 3GHTA 3BDYL 5C9UA 3PSVA 1U8QB 2G3NA 2VWEE 1W9BM 3M7OA 3EOTH 1JGDB 1TQSA 2X7LA 4JNZA 4NRXB 4OJCA 5DUML 1YY9C 5E9DB 5T1JA 3IBOA 1SJVA 4EQ2A 2X4RA 2X3CA 8XIAA 4US5A 3HEIB 3G22A 1LP9E 1WEJL 5FF2A 3C5XA 2C3GA 3KM2A 3B5GA 2NY3D 4I18B 4ZODA 1RZFL 3AQDA 2EUVA 1WA2X 2G2PA 3D09A 4EWND 3W74A 2V5JA 1I8AA 1QA9B 1L0QA 4HVBA 4LUTB 5LNSA 2Z64C 3SPIA 4E41B 4RZKA 3KWWB 4UV4L 2PGWA 4KI5C 1TJRA 4RNHA 2XTJD 3VRLF 4HGWA 3U0PB 4Y8DC 1DFXA 2LVEA 2F7QA 2NMSA 3B1TA 3MO7A 1D7DA 1LUCB 3VZXA 3NZPA 3GJFB 4P9ML 3XINA 1O7AA 1MCPH 4KFZC 3EWBX 2NUWA 3VE0B 4XX1E 5E2VH 2DKSA 3BANA 1SDYA 2O5NA 3WQ6A 5JMRA 3MZTA 5FAAA 4MCMA 4N1EA 4ZS6C 4AYFA 3BPLB 4FXSA 3WQCA 1FWBC 4BCYA 4F27A 3MRBB 5JVLA 4NKMA 3FCUB 1TG7A 3RPMA 4MAYD 4FE9A 2VEKA 2ARJB 4LGSB 1ALDA 2EUZA 1ZLWH 1PKYA 1E72M 1OZTG 1TVBA 1XCQA 4PPTA 4WK4B 5B39G 4WI9A 4Y6GA 5D72L 3KS0J 4ETQB 3EXTA 2POZA 4A22A 3DHMA 2DKUA 4HGKC 3CFIC 3CCHB 4X5XA 3V6BR 1IBDA 3VXMB 2UYLB 3DI0A 1GS7A 2ZZ3A 2OR9H 4V1DA 4HKXB 1J8HE 4DRSA 1MRCH 4FI8A 4IIQB 4LLDB 3S6TA 1EGJA 4N6QA 1WS7A 5E2TH 4YHKH 2D9CA 5IR1B 3OPOA 1PO9A 3PUOA 4PCYA 3EOLA 4WI4A 4IQLA 4KKCD 5T5FA 5KYXA 3JV6B 1W0YT 1UQYA 3FCBA 2YPLE 3MI3A 3PE9A 2ZX8A 3V1PA 5TIMA 4LDOB 2P44B 4IXXA 2QBWA 1HQRA 4PTUB 3DUGA 4QTHA 2VEPA 1TTAA 4PVLA 4DI9A 1NEPA 2OMVB 5H2ZA 3SDCC 1I4NA 4F7CA 5D9SB 1RJCA 2AF2A 3RTQD 2HXTA 2B4CL 3AY2A 5L88L 4PUBL 1HSBA 4A6GA 1W8NA 5EPMB 2XA8H 5HI3D 3UA4A 2GITA 1KD0A 4A2EA 4G1VA 1ZTVA 3KGTA 5LHEA 3MCOA 1QSEB 3KYMA 1G5GA 5ABHA 1FDYA 5CHNB 2JQZA 1OPGH 2GK7A 3MOBH 5LBSH 3E7JA 4W9LC 2QQ6A 2VO5A 3TJLA 3PBUA 5E9DE 1C08B 3V6OE 3MB9A 4RDBA 1DIDA 2DJSA 3NJIA 2HX7A 1WUZA 3O6KH 2CNDA 1VD6A 4LWWA 1CURA 4LUIA 3VIIA 3VXNA 3SCMB 2Z31C 2P46B 4PGJA 4TVDA 4UTCA 1B31A 3NYKA 2GWNA 3EKZA 3GEWB 4QHLA 4GFIA 4GSDL 1PCKA 3WV0A 1A0QL 3UAJD 3TU6A 4LYKA 4YHZH 1JXJA 4XBEL 4E41E 1OTTD 5TGBA 5IK2A 3L3JB 2ZC8A 3MGTB 2WCSA 1JCKA 2DUAA 3TQVA 4OLUL 4PRID 2XU2A 1SBSL 1T4KB 5EO1A 1XZWA 4M7LH 3TT1L 1L9TA 2YYUA 3V0FA 4JTQA 2P50A 5C0JB 3ANUA 3S3CB 3JWOH 1ZWIB 3PHAA 5D8ZA 1AMKA 2QJDA 4YO0B 1AANA 1R19A 4RD6A 4FNTA 4HPNA 3Q3GA 5C0CA 2QSTA 5EU6A 3U48A 2AK4D 1YY9D 3LBOA 4I0PB 1W8OA 3K6FA 2C7UB 3BURA 1JPST 1O60A 2F19L 1JB9A 1ED3A 4WY7H 1EJ7L 2XI9A 4PFMA 4OJYA 5I8OH 2YL9A 4R0LC 4RFEB 3AISA 5DZVA 5HKKA 3VIGA 3AT0A 5F96L 1RJLA 1U3HA 3VXME 4QTIL 3H9SD 4XNUH 4PJGA 3KM8A 1OGTA 1OP3H 2YD1A 2PETA 1TTCA 1KLUB 3MANA 4RMVA 4U4BA 4KI5D 3N1QC 4GBXC 3BZFB 4Q0XL 5E5RB 5B8CA 4OW6A 4N8VA 3MRPB 3BPOC 2NZIA 4YDJA 3WS3B 3FKUS 2PWEA 4M6OH 5REQB 2G60H 1H15B 3MCKA 2Y06L 1TIUA 1NGYA 4L3CB 4DAGL 3QSYA 1P7QB 1KIRB 3BP6B 2XINA 3S4SB 1GTNA 4ADUA 1QUEA 4YNYA 4P05A 1MZYA 2NRDA 3REVA 3PPGA 1X5JA 4P3CH 1H5BB 4YJ5A 2PDNA 1U8NA 4ZS6D 4UNIA 4NZ3A 1CTOA 1Z48A 3QUXB 5CDFA 3N44B 1O95A 2E75C 3I56B 3S42A 5C0DA 3MGAA 3W6YA 3ZIMA 4PJHF 4NM8H 3D08A 4UTUA 5IF0B 1NOAA 1QI2A 3WY4A 1QKZL 1F5ZA 3MBEB 5D7IF 5LNGA 1OCWH 4ODSH 3NP3A 2W0KA 5IMKA 4U2ZA 1NFDA 3KHQA 4HWZB 1TYGA 5I1CL 1KYDA 2EH8H 5DVKA 4IJBA 2BIPA 4OECA 3S98A 1FWAC 1DXIA 2FB4L 3NUKA 2O56A 1QSEE 4XXCC 3G6MA 5FYKH 2YS4A 5DR5H 3VFGL 1CLXA 3MC0A 1XGPA 5KVGL 1ZLVK 1JDEA 4HLJA 1VGKA 5J11B 4F5CE 3CCUB 1FCGA 1T0PB 4TV3A 4ELDA 3MUY1 4U1SB 1NCTA 2I9EA 1CK0H 1ONEA 3KBVA 2DETA 1M05A 3HS8A 1ZENA 2WYRA 5KW9H 4EH1A 4MNQA 2QVHA 5B3JF 3PZVA 4L48A 3QUGA 3T56B 2YGYA 1M1XB 1AA1B 4AKQA 3WEMA 3SJZA 1UZGA 4QXTB 1GW9A 5ANMA 1QPPA 5ENWB 5I17B 2I5QA 1MDAA 4OU1A 4L80A 1XINA 3EEGA 3SDCD 1VFSA 4PRHD 3SPVA 4LPTA 3UZYA 4OIIH 4L8SB 5FHBL 2X40A 5JPNB 1H