3BC9A

Alpha-amylase b in complex with acarbose
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
585
structure length
585
Chain Sequence
SLFLIESEPSTGASVSKNLTEIILIFSNDINKVSQLALTDLITDSDIQGIDYNIEGNKVIINNFSLEPTCNYRLSYEVIDIYDNHLQGYIEFLVNQSNYPQIPDQEVNHTILQAFYWEMNTGEYATEHPEEANLWNLLAERAPELAEAGFTAVWLPPANKGMAGIHDVGYGTYDLWDLGEFDQKGTVRTKYGTKGELENAIDALHNNDIKVYFDAVLNHRMGADYAETVLLDENSRDKPGQYIKAWTGFNFPGRNGEYSNFTWNGQCFDGTDWDDYSKESGKYLFDEKSWDWTYNWDEDYLMGADVDYENEAVQNDVIDWGQWIINNIDFDGFRLDAVKHIDYRFIDKWMSAVQNSSNRDVFFVGEAWVEDVDDLKGFLDTVGNPDLRVFDFPLRSFFVDMLNGAYMADLRNAGLVNSPGYENRAVTFVDNHDTDRDEGSYTVSIYSRKYQAYAYILTRAEGVPTVYWKDYYIWEMKEGLDKLLTARRYYAYGPGYEVDNNDADIYSYVRSGFPDVAGDGLVLMISDGTSGNVAGKWINSRQPDTEFYDLTGHIKEHVTTDSEGYGNFKVIKSEDKGWSIWVPVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Polyextremophilic alpha-Amylase AmyB from Halothermothrix orenii: Details of a Productive Enzyme-Substrate Complex and an N Domain with a Role in Binding Raw Starch
pubmed doi rcsb
source organism Halothermothrix orenii
molecule tags Hydrolase
molecule keywords Alpha amylase, catalytic region
total genus 200
structure length 585
sequence length 585
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3bc9A03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bc9A04
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3bc9A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bc9A02
4X9YA 4CN1A 3BCFA 2ZXBA 1TE1A 2F1AA 2Y24A 5IHSA 2WNWA 3CUHA 4WLCA 2G3JA 4HOZA 3IK2A 3VVGA 5AC4A 3L4ZA 3S6TA 5HDRA 3WD4A 4PYSA 4EE9A 3ARRA 4M80A 1NP2A 3WF3A 3TA9A 1WPCA 4X0VA 1FH9A 2OMUA 4P8XA 4AISA 3D51A 4D6JA 3CHCA 2EPOA 2O9RA 2W4XA 4B16A 3WDHA 5GNXA 3RM8A 1QWNA 1TG7A 2OW7A 4PUDA 4TTGA 3KL0A 3UR7A 5D4YA 1UKPA 1FFQA 1AQHA 3A6OA 2D20A 4RE2A 3IANA 3VD4A 5E1QA 3AHVA 2GFTA 2WHLA 4KRTA 3PZIA 2F2HA 3A22A 2DPEA 2WLYA 1JYWA 2YKKA 3SCQA 1PBGA 4J27A 1OT4A 2FH6A 3VSTA 1UA3A 4TVUA 2XYLA 1E6NA 2J4GA 1KCLA 4NF7A 2W91A 2CHOA 3M46A 3NYDA 1SYTA 3FAXA 5A6LA 2WSKA 1DWHM 5JBEA 1H1NA 3RM4A 5ABEA 3CZKA 1VAHA 3VGGA 2OSYA 3N9KA 4PMUA 1XH0A 4ZXLA 3BUBA 1GJWA 1CZ1A 2WMHA 2F61A 3TOPA 1HKJA 4AIOA 1W9UA 2X2YA 1HF6A 4TVCA 5A69A 1ZBKA 2E9BA 2WCSA 1DTUA 1QX1A 2YA1A 3AYSA 4GPNA 4W85A 5A6SA 2A3HA 1B30A 1KXVA 2F7PA 1VBRA 4NXKA 2XN0A 4B15A 1V6UA 5ABHA 1JZ3A 2HVMA 5TD4A 3GNPA 4DO6A 4QAWA 1UWIA 3BVWA 1EDTA 1TVPA 1QW9A 5E09A 3VOCA 4FNRA 5A6AA 4GINA 1UR9A 7CGTA 4GKLA 1C3FA 2DSUA 3F5JA 2BY0A 1GCYA 3THDA 2J7DA 1GW1A 3GZAA 3ZR6A 4PSRA 3CHDA 2E0PA 2VX5A 1O7AA 2X2JA 1WZLA 1EQCA 1C8YA 1OIMA 1C91A 1RH9A 3RO8A 2G41A 3WL0A 5AY7A 3BZ5A 1WZKA 2WK2A 2CITA 2XVNA 4PUEA 2C0HA 4UNIA 3ALFA 3F5LA 1FH8A 2V3DA 1PS3A 5IDIA 1LLOA 2XFFA 1ITXA 3WQWA 3EJRA 5HPCA 1UZ4A 5A2BA 5JUVA 2VOTA 4H8HA 3ZOAA 3VSVA 4TX8A 1MQPA 1EQPA 1QBBA 1HXJA 3DECA 2ZUUA 4MB4A 1O6SA 2OLHA 2UWFA 4XUYA 2D1ZA 1FFRA 4DUWA 1Q6DA 3GXDA 2JF6A 3WDPP 5ABGA 4D6EA 3CGTA 4IISA 4PBGA 1YQ2A 3PZVA 3H55A 3K8LA 1WO2A 1TUXA 5F7UA 1KWKA 2VX7A 2Y8VA 1LYQA 1ZJBA 4UFJA 2FGLA 1NP0A 1CIUA 2XWDA 4TX6A 5C70A 4JAWA 2ZX5A 3L4WA 3WQ4A 4CU7A 4AD2A 4Z2JA 4L4OA 4WSKA 5ABFB 1M01A 1BVZA 1I75A 3SUUA 4HU8A 4CU6A 4AMXA 1E1EA 2VVSA 3AXXA 3KL5A 2UY5A 1HP5A 5KZ6A 6A3HA 2PWGA 1QOXA 1M03A 1QHZA 1OCQA 4QLLA 5LA1A 1ISXA 2VURA 1KGWA 3BUDA 4QCFA 3KLLA 4XZBA 4UQAA 3CO4A 3EBVA 4QDMA 5CZKA 5EFFA 2XN2A 5CPSA 1J11A 3T09A 4J3WA 3O2LA 2D0HA 3CUFA 1NOWA 4JFSA 1XSKA 2WWDA 1MW3A 3RMEA 2PF0A 2JIWA 1U30A 1BYAA 5D9MA 1J0JA 3NJ3A 4AMWA 5FIPA 2HISA 2XM1A 2E9MA 1NM9A 2BHZA 2C7FA 3RPMA 4IPNB 3N04A 3LMYA 3VIIA 1JNEA 8CGTA 3K46A 1GQLA 2OMZA 1JZ6A 2VRKA 2DGAA 4NRSA 4D6CA 4PTMA 3QOKA 3BAYA 1GQJA 1HKKA 1DP0A 3I3EA 1LL7A 4RL3A 2A3EA 1RP9A 1BYCA 1KBBA 4CCCA 1V08A 1QNOA 4EKJA 4PTXA 3TV8A 5KEZA 4M56A 1KR1A 4U2ZA 2XN1A 1JFHA 2WMIB 3T0DA 2VTFA 3ARUA 1CECA 1MXDA 1LG1A 1QNPA 2WLZA 3ZJ7A 1VBUA 3MANA 5CG0A 1WCGA 1XEUA 3GXTA 3ALGA 1XH1A 2XGBA 6CGTA 1SMDA 1WDSA 4Z2IA 1BLIA 2GJPA 3AMGA 2J75A 5CGTA 2XVLA 5A8OA 4UFLA 1CXLA 2X05A 5A8PA 4AZCB 4NX0A 4ZXOA 2XGIA 2ZICA 4QCEA 1UZ1A 1PEZA 4CVWA 1J18A 4JHZA 1CEOA 1Q6GA 3KE0A 1C7TA 1OT2A 1WAWA 3LPGA 2YFOA 3RM9A 1UD5A 4MDOA 4DWSB 4MADA 1R75A 3GBDA 1VFMA 4CD6A 2TAAA 1I1XA 4JZ5A 1VFUA 1MYRA 2YA2A 3OG2A 3N17A 3T2QA 3BMVA 4BQ3A 4D72A 3OB8A 2YLAA 4J3XA 3ZJKA 1UKQA 2WVSA 3PZ9A 2FDMA 4PMVA 4HZ6A 4WSJA 3K8KA 5AYIA 4CGTA 3CC1A 2DEPA 1BYDA 3UERA 3VINA 2ZX6A 1O7DC 2CBUA 3SUVA 2OWCA 1EHNA 2ZX9A 3MO4A 5D8ZA 3SCSA 3WH7A 2GJXA 2YL8A 2PWDA 2AAAA 3CHFA 3SCNA 3EJQA 3K4AA 3BMWA 1W1PA 1W9BM 3OGSA 3M7SA 3BAIA 1W9VA 3BC9A 3L2LA 1H3GA 4F8XA 3ZO9A 2CCRA 2OYMA 3ZJ8A 4H04A 2YLLA 3AROA 1B31A 3W53A 4P8UA 3CZLA 4FNSA 1E6XM 3ARXA 4YPJA 1FHDA 1V3KA 4AD3A 1HJVA 1NWSA 2YDSA 2FYVA 2IGTA 1B3YA 3NDYA 4C7FA 2WPGA 2C9PA 1V3LA 4PN2A 1MW0A 4CD4A 1WB0A 1UWSA 1VEMA 1G94A 3VDHA 2GVYA 4AMCA 3RIKA 5BXPA 3BAXA 4AZ7A 1NH6A 3CZJA 2WHKA 4K68A 4MJ2A 1NWRA 4UOJA 3CBWA 3N12A 4X0NA 2WKLA 1PZ2A 3GH5A 4H7VA 5BXRA 2CEQA 4R5EA 3AIWA 4GXPA 5I3DA 4W93A 2BNJA 1HJWA 3AXIA 4P7LA 3CZSA 1GNXA 3VIMA 3IAQA 1RPKA 2J77A 1GHRA 2V3EA 1FP9A 4GQQA 1OM0A 3QHOA 3H53A 1UHVA 4LXFA 2D22A 1AQMA 1H6UA 3AICA 1B90A 3DC0A 1BAGA 1HXKA 4KH2A 2OMWA 4A4AA 3LXAA 4AYSA 3PZQA 2QPSA 1XCWA 1DHKA 2BY1A 1AMYA 4U31A 4B9YA 1WZMA 2CBVA 1V6YA 4J28A 1B3WA 1VRXA 5HXMA 2GJRA 1WE5A 3WBEA 4IM4A 3O9NA 2OWWA 3L4UA 2BVTA 1K9DA 1X6NA 3GNRA 4EAMA 4AWEA 2WVTA 3GXPA 4QFUA 4JKLA 1W2VA 3PBGA 4FF5A 1V0NA 4BF7A 3AI0A 2B31A 3DDGA 3SCWA 4U2YA 1LWHA 3VM5A 3NCOA 3GBEA 2OW6A 1ZBCA 5D8WA 3PZOA 1K9FA 4J3UA 3DYOA 1R46A 4F79A 3HG5A 4XZWA 2BHYA 4F9DA 2FGZA 2WQVA 1V6VA 4MPKA 2GDVA 1G5AA 4AY1A 2CERA 4EK7A 2YJQA 4PTWA 3MMWA 1EOKA 3M07A 1H11A 3N1AA 1DWIM 4BS0A 2XJ7A 1JDCA 1VIWA 5FOOA 3S5ZA 1SZNA 5E6YA 3VD9A 2FHFA 1TFVA 2J25A 1H4PA 1W3KA 3MV01 2Y8KA 3H54A 3WMSA 4JKMA 1QPKA 3ARZA 3VX1A 2WYSA 4E8CA 1SR0A 4NZJA 3WH5A 1CGWA 4PMYA 4B9ZA 2CKRA 4D1IA 3WY4A 4CD5A 3OZOA 3WH9A 1QW8A 4FNTA 1UR4A 1W32A 3D4ZA 3EMQA 4LYPA 3BGAA 1KGXA 5BXSA 4HA4A 3T2PA 1VJSA 3IGUA 2DT3A 2VX4A 3EJSA 1WNOA 5BYWA 1E73M 4WIWA 3ZR5A 1BTCA 2W66A 2CHNA 4OOUA 3BUPA 2ZX8A 1H41A 1C7SA 3LX9A 1VEPA 3OLIA 1HL8A 1B1YA 4V27A 1OWQA 1NWTA 1SMAA 1CTNA 3CV5A 5ICUA 3NIYA 3WFLA 4YN5A 3ZIZA 4AZGA 3BVUA 2YFNA 4JCLA 2VCAA 3UG3A 1K9TA 1JZ5A 3WF1A 1XC6A 3WDJA 2RA1A 1C92A 1C93A 2E8ZA 3VIHA 5I79A 1R8LA 1UD6A 1DWJM 2GK1A 2D0GA 2X8RA 3FXYA 1EA9C 3PZTA 1TQWA 1OSEA 4QLKA 1ISWA 1KXHA 4UZUA 2OMTA 1UKOA 2EXOA 4V2XA 3BLBA 5JBDA 4AZ5A 1E15A 1HJSA 2EQDA 3G6LA 3A5VA 1FH7A 3N11A 2WQWA 2UZYA 2XVGA 2DSKA 1KXQA 2GDUA 3PZUA 4W8BA 4XV0A 4E4PA 2GUYA 4UTFA 3AHZA 3EMZA 3WNMA 1JDAA 3BSGA 1HN1A 2CESA 2WMFA 2F18A 3DDFA 1EXPA 2PWHA 1UKSA 1CGVA 3HMCA 3D52A 1CLXA 3AIQA 1BVNP 3KEHA 3EJUA 3MUIA 4M1RA 4TUFA 1UD2A 3WH6A 5CSUA 2VCBA 1CDGA 3AJ7A 3PZNA 4N0RA 3KWXA 3FAWA 4BA0A 4HPHA 2ZXAA 2UY3A 4OIFA 1J9YA 2W63A 4S3KA 3T0BA 5A95A 4KMQA 4W7WA 4M24A 5M3WA 3QOMA 1QNRA 5D9NA 4EANA 3IAPA 1ITCA 5ABFA 1E6SM 5CXPA 1E4NA 3WNNA 1OGSA 3IJ8A 4V28A 5DF0A 4FNPA 3SCRA 2W5FA 1E0XA 5FD0A 3FNDA 3BAKA 3VD7A 3E1F1 1B3ZA 2FHBA 4HP5A 2JE8A 3GTNA 1PPIA 4NSBA 3LXCA 1EIBA 3B9DA 3NSMA 2J7EA 3ARVA 1IX2A 1UR0A 4CVUA 1EDGA 2GSJA 4UQ9A 3WF2A 4P7NA 1V02E 3K1DA 3UEQA 1V02A 2E40A 3BUQA 2WVVB 3CMGA 3FHAA 1P6WA 1G01A 2VO5A 1N82A 1V03A 2VZUA 4W5ZA 5JBFA 1NOUA 4D6FA 3WEMA 3FY1A 4LQ1A 3CH9A 3II1A 2ZUTA 3BVVA 5BXTA 3BAWA 1R7OA 2E3ZA 1E0VA 5CGMA 1ECEA 1MQQA 1C90A 4DWSA 3ARYA 1B2YA 3GDBA 2XSAA 4WKAA 2CBIA 3WUEA 3GNOA 2D24A 1XYFA 3CPUA 3WMCA 4F66A 1W9PA 1JAEA 2WBGA 3WNPA 2WMIA 1JZ7A 3A47A 5CPQA 3VIJA 5DMYA 4NXSA 5DT7A 3AOFA 3IJ7A 3QR3A 4LPCA 2E9LA 3U57A 1BGGA 5DT5A 2WVVA 4J3SA 3WFZA 1EDQA 2ZWZA 3AFBA 4HA3A 4BCEA 1J0KA 4ZEPA 2CBJA 1JG9A 4ZE4A 3W4RA 1E6RA 3T08A 1DWGM 1OIFA 2XWEA 3F4VA 2NW0A 1H6TA 1ZBWA 3WQ6A 1EO7A 3AQUA 1HKIA 2DSWA 1W9DM 1E3ZA 1V0LA 3U5UA 3MUAA 5BROA 1XV8A 1UYQA 3THCA 3HU7A 1TVNA 1UH2A 5I24A 2O9OA 5FL0A 3PN8A 4FLRA 5A6MA 1IZJA 1LG2A 1NOFA 4MNLA 4DUVA 2JALA 3AHTA 4QLJA 1O6VA 5HNNA 4A3YA 2XM2A 3VILA 2EJ1A 2DT2A 3I3DA 1IZKA 2NT0A 4AC1X 1XYZA 3A4XA 3W27A 4QP0A 3A4WA 4MNJA 5DEZA 3VIOA 1ISYA 2Z1SA 1LF1A 1E72M 4JL1A 3WD2A 4DO5A 4KRUA 1WZAA 2OSXA 1ZU8A 4PMQA 3VDAA 3NSXA 3OLGA 2X0HA 4OOZA 3DHUA 1PX8A 4PMRA 2PBGA 4AZ6A 1E55A 3I3BA 4C7DA 5A8MA 4MJ4A 3DYPA 4DO4A 4H41A 3MUY1 2YOCA 1OGGA 3WUGA 2EACA 1OD0A 1Q6FA 3OBAA 1H0GA 4JCMA 5DO8A 5CSYA 3PZMA 5M5DA 1OBAA 3WY1A 3B9AA 2J8FA 5IXEA 2G8ZA 1D7FA 4HMEA 2EPLX 3PTQA 3J7HA 4HA1A 1V0KA 3WD0A 5BCAA 3VGBA 2J7HA 2EBNA 2VVNA 4W7UA 1TMQA 1CPUA 4NRRA 5CJ5A 1JDDA 4N42A 1WDRA 2VZOA 4OUEA 1W1VA 3LXBA 4GZIA 2RGMA 3RDKA 2XVPA 4AZBA 2EEXA 5EMYA 3RJXA 5A6BD 4H8VA 2Z1KA 4XX6A 3OIHA 1A3HA 4OJYA 1E6PA 1XCXA 5I77A 3VNZA 1C8XA 1E56A 2OMYA 3K4DA 2J8GA 4E8DA 2DIEA 1B3VA 4AIEA 5D9PA 1E4LA 3WUBA 1XD0A 3WDQA 5JIWA 2ZUSA 2QLYA 3AS3A 5BRQA 2AMGA 4HU0A 1CGXA 1OINA 2J79A 1E9LA 4DM2A 2EPNA 4WKFA 1PIFA 4MB3A 4MTVA 3W29A 1JD7A 4JFVA 1JYVA 1CENA 1V0MA 2D23A 5A1AA 3EYPA 4B3LA 4W7VA 1XRVA 4D1JA 1TR1A 2BV9A 3UESA 1EO5A 4ATDA 4CN6A 4UQBA 3W26A 1F4HA 2YL9A 3VIGA 5E9AA 1V6WA 5A2CA 4P7OA 4FNQA 1VFOA 3L4XA 2VL4A 5A8NA 2EAEA 4GZEA 3VX0A 1JXJA 4P8WA 4W8AA 4ACZA 3HG4A 1HWWA 1UWQA 4HMDA 3LRKA 3GXMA 4ACYA 3U7VA 3ZSTA 4J7RA 3SCTA 2EO7A 3JUGA 3WDRA 3OLEA 4AXNA 1ESWA 3DHPA 1FOBA 4DWSC 3CLWA 3ZMRA 1Z32X 3OA5A 1FP8A 1CWYA 3EDDA 1U2YA 4J3TA 3WNLA 4WJXA 1KB3A 2D73A 3AIBA 4MB5A 3DX3A 1PX3A 1WP6A 2ZIDA 1BPLB 2WB5A 3W6LA 5E0CA 2QPUA 1GJUA 2XHYA 1XSJA 4URIA 4MNKA 2J74A 2EPMX 3D4YA 2BY3A 5AYBA 1MXGA 3UG4A 3POHA 2XPKA 2X2HA 2J7BA 3GH7A 1HX0A 2F7QA 2VJXA 7A3HA 4AD5A 1ISZA 2CKSA 3WL1A 3K8MA 5LYRA 3AMCA 4ACZB 1GVYA 4W84A 1UWRA 1LJYA 1W91A 1J10A 3PTMA 3OLDA 4M82A 3CTTA 4WKHA 3BH4A 2WVUA 4MDPA 1JZ4A 3WIJA 3POCA 1OGBA 2WMJA 4PMZA 1PIGA 3L4TA 1E4IA 1TQSA 4OBSA 2DT1A 4M81A 2WM0A 1UG6A 4JFWA 2WZIA 2WXDM 2EADA 1GUVA 3GM8A 1HL9A 4ML4A 2UY4A 3NUKA 4PTVA 3VO0A 5C8BB 1KWGA 3RCNA 4UOZA 4BQ4A 4P7QA 1QNQA 3ARQA 1UQZA 3AHYA 4HZ7A 5GQBA 3F5KA 5CLWA 4M8UA 2VX6A 2UY2A 3AZTA 2J62A 2WCAA 1UD8A 1QHOA 4ATLA 1EOMA 4UFMA 3PHAA 3EDEA 2OYLA 2J7CA 4H2CA 1JGIA 2V38A 3CHEA 3D5HA 4TXEA 3HG3A 1KTCA 3MMUA 1EGZA 3AMKA 2C9QA 3WBAA 3WF0A 1JD9A 2VR5A 2XIBA 2WMGA 1UH4A 4UQEA 4UZSA 2QV4A 3WQ5A 1OB0A 1UASA 2ESCA 2OMVA 3D50A 3QGVA 1QI3A 1PJ9A 2W67A 2WC3A 4PMDA 1BF2A 1J0YA 2YBUA 1B0IA 3KZSA 3A4AA 1QI0A 1JI1A 1CGYA 1BG4A 6TAAA 1O6TA 1BQCA 1UWTA 1GOWA 4AD4A 1GOIA 4UFIA 3VDCA 1W1YA 2XFRA 1V3IA 1CXKA 3CZ8A 4Z2KA 4RE4A 1H49A 3TTOA 3W25A 2OWXA 1BG9A 2ZUVA 2XIIA 2DDXA 3LRLA 2W92A 2PI6A 1E1FA 4JKKA 2RGLA 1JYNA 2WANA 1I1WA 2WQUA 2VRJA 3MUZ1 5GPRA 2A3CA 1KGUA 3EDFA 1UH3A 3OZPA 4JIEA 1MW1A 1JF6A 3U5YA 3WNOA 2NSXA 3QHNA 3WF4A 5CQ1A 1XSIA 1GZJA 4C7GA 5CLTA 1V3HA 3WKZA 1BGAA 5I2UA 4XB3A 4CCEA 3WD1A 1QI2A 4WK9A 1GQIA 1KFWA 1TA3B 3AXHA 4PEEA 3WEOA 2F8QA 1BYBA 4Q22A 1VB9A 4CILA 4JHOA 4S3JA 2JEPA 3A23A 2FH8A 1NARA 1ZS2A 4W88A 3CUIA 3L4YA 2YDRA 5A6BA 3KLKA 1MW2A 2XUCA 1Q4NX 4DUXA 4ZE5A 3SCVA 2J47A 4R27A 1ODZA 3AIRA 5BWFA 3DX4A 3NDZA 2WW5A 2E8YA 4HZ8A 1R33A 1W2PA 3VKKA 4NZCA 4LYQA 4W5UA 1UOKA 5EBAA 4UFKA 4NI3A 3EJPA 3ARWA 1GOOA 2JEQA 2QHAA 2ZUNA 3W28A 4CU8A 1WKYA 1MWOA 2X2IA 3S5YA 4AYGA 4TTUA 2QMKA 4UCFA 2JF7A 3FN9A 1W3LA 2PBOA 2X0YA 2WWCA 2BY2A 1HNYA 4IPLA 4GQRA 2OYKA 3VGEA 9CGTA 3AIVA 3ARSA 2EABA 2VC9A 1H5VA 2V5DA 4CCDA 4GI9A 3ZQ9A 7TAAA 1D3CA 1A47A 4AZHA 2XG9A 2YIHA 3BXWA 3EMCA 3VIPA 1W3JA 3BVXA 3ZT7A 1R47A 3BSHA 1ZJAA 2BS9A 1GPFA 3B9EA 1JFXA 1L0PA 1MQRA 3WSUA 2C8NA 2PB1A 4UQDA 2ZOXA 3M6DA 1K6AA 4B3KA 2WSPA 1KQYA 3SUTA 3VIFA 3AYRA 4JL2A 2E4TA 3B8SA 3A3HA 4D6IA 5C71A 3MU7A 1HVXA 1CGUA 3AHXA 2O9PA 4U33A 2ZUMA 1E0WA 1W9XA 2NT1A 2WHMA 4UFHA 3HG2A 1MFVA 2X09A 3T2OA 3RJYA 3WDIA 4D6GA 1FA2A 1QBAA 5M17A 3AIEA 1M53A 3MI6A 3AMLA 1G0CA 5HBFA 3CZEA 4H8UA 2XVKA 2W61A 4CN4A 2D3LA 1CBGA 4CUCA 4U3CA 4LYRA 1J0IA 3UG5A 4PMOA 2V3FA 4ZENA 3ARPA 1UR1A 1SFSA 3VGDA 2ZWYA 1TA3A 1UD4A 3MS8A 1HIZA 3WH8A 3VD5A 3FW6A 4Z2LA 3SUSA 1E5NA 3DYMA 2F7OA 4AW7A 2WC7A 3VNYA 1GOQA 1QWUA 2BXYA 1KTBA 3WQ8A 3W38A 3HN3A 1HJQA 4GIAA 3VMOA 2CYGA 4OZOA 2WKGA 2Y5EA 1HJXA 3CUJA 5HOSA 5IFTA 1UD3A 3O6AA 3MSDA 3W24A 2IXVA 1ODUA 4MB1A 3GXFA 1UR8A 3VIKA 4AD1A 4U5IA 2QF8A 5FCZA 2ZUWA 5I23A 1CNVA 1R87A 3OGRA 3ZT6A 1UA7A 1CXHA 5M03A 1X6LA 1YHTA 4UR9A 3PTKA 4AD0A 2WQXA 2WAGA 1HT6A 2ALWA 4KGJA 2VCCA 3WMBA 4NZFA 5A8QA 2BVYA 1BFNA 1GOKA 2DH2A 3T0AA 2YL6A 2WBKA 2ZXDA 5A94A 4UQCA 1RD6A 1MFUA 3VU2A 1TZ7A 4A3HA 1LL4A 2VR4A 1E6ZA 1WDQA 3OGVA 4P7RA 3WY3A 1ISVA 1F4AA 4Z2GA 1HKMA 1Q6CA 1KBKA 2EPKX 1V3JA 1OD8A 4RE3A 1DWFM 2G3NA 3AS0A 1XD1A 1E43A 3LPFA 4FLOA 4PCTA 2VUYA 1TQTA 1ZBVA 3UR8A 4E2OA 3NSNA 1W1TA 4PSPA 1JZ8A 4AZIA 3BAJA 3W6MA 2G3MA 1W3HA 3LPOA 1VF8A 5E6ZA 2IUZA 3VGFA 4HOXA 2ZXQA 3AZRA 4LGXA 1DWAM 4JFTA 4CKQA 2WC4A 5A6JA 4D71A 2WZEA 4HTYA 2DT0A 4Q7NA 2WCGA 5BRPA 4L4PA 2X1IA 3DX0A 4ZFMA 1JYXA 1XH2A 5LA2A 5LA0A 2WMKA 1D2KA 1VJZA 3DX1A 1BSIA 1J01A 1E6QM 4U5KA 3AS1A 2W62A 1UKTA 2F7RA 1Q6EA 2V5CA 4CD7A 1QVBA 3BLPX 3WNKA 4AEEA 3A21A 1R86A 1E71M 1AQ0A 1K9EA 1JXKA 3VTRA 2D3NA 1WDPA 1J0HA 1CXFA 2DSVA 2Q8XA 3HJEA 1EHAA 3VSUA 4ATWA 1JAKA 2ZX7A 2YDQA 5JIPA 3CIVA 1E5JA 4YHEA 3VMPA 2VRQA 3ZSSA 2DSZA 2VZSA 3GXIA 3WUFA 1US2A 1KXTA 5EB8A 1GQKA 1UR2A 2O92A 1PX4A 2C9RA 1UQYA 2J7FA 3D3AA 4W8LA 3ARTA 4HMCA 1NM4A 1H2JA 4OKDA 1H0IA 4FMVA 4GI6A 4W86A 2VNCA 2FHCA 3AIUA 1QI4A 2DH3A 4CC4C 4FLSA 3WEZA 1L8NA 2JFEX 3VPLA 3N15A 1RP8A 1LL6A 1IT0A 3BUIA 1GOMA 4PRWA 5CPTA 5D9OA 1QI5A 3EJTA 4AW4A 2J7GA 4TVDA 2VZTA 1US3A 3AMDA 4AQ1A 3ZJ6A 1BHGA 3QHMA 5AC5A 3N13A 2D2OA 4GO8A 2A3AA 1TQUA 1AVAA 4U3AA 1LWJA 3IJ9A 4D6DA 1NQ6A 4YHGA 2XTKA 3AS2A 3VGHA 3AISA 5I6SA 3APGA 5A2AA 8A3HA 4MAZA 3W81A 5I5RA 5IHRA 1E40A 1JNDA 2BVDA 1NWUA 2G3IA 2VI0A 5E0FA 3GYCA 4UOQA 3TTYA 3ZT5A 1M9SA 1DEDA 2BHUA 2QMJA 3U7BA 2JIEA 4BZYA 4MNMA 2VT0A 5HPOA 1KCKA 5GNZA 2O9TA 1LQ0A 3UCQA 1CYGA 3G6MA 2Y5QA 4JFUA 1O6IA 3SUWA 4D6HA 3VDBA 2PWFA 2VQTA 1VFFA 1OT1A 4FNUA 3TTSA 5FKYA 4HOWA 1U33A 3PZGA 2MANA 3MV11 4Y7EA 3CMJA 5E70A 4TOQA 1E70M 2XFYA 2CNCA 2BXZA 3MMDA 1EH9A 1MVYA 1R85A 3CZNA 2FE0A 1J0ZA 3W37A 4PMXA 1HVQA 1UUQA 1J12A 2GJXB 4CC4A 1GONA 1BPLA 2WHJA 3UETA 3GH4A 5A3HA 1Y7VA 3FHQA 3SIMA 1R34A 1IV8A 2OSWA 2ZE0A 4MAVA 1GVIA 3BVTA 1JIBA 3KL3A 4AEFA 1G9HA 4BQ5A 1R7AA 2BFGA 4FK9A 3SURA 4J3VA 4GI8A 1CLVA 4PCSA 1M7XA 1HP4A 1ZL1A 3SEPA 5FL1A 1PZ3A 1V3MA 3VUPA 2CPUA 2Y2WA 3RILA 1UWUA 3L4VA 3VD3A 4DWSD 1VENA 2WZHA 3GXNA 1GHSA 1VEOA 2GK1B 3VMNA 2A3BA 3AZSA 1ZB5A 1B3XA 1B9ZA 4P8VA 1JZ2A 2VQUA 2YL5A 3MSGA 3BLKA 5I0DA 2D0FA 4F9JA 2XSBA 1HTYA 3SCOA 3W82A 4DM1A 3DX2A 4LX4A 5GNYA 3TTQA 4CD8A 3WENA 4OGZA 1T0OA 3N18A 3LPPA 1QHPA 3WN6A 1M04A 2OMXA 1H09A 1JF5A 4HPGA 2V3GA 4Z2HA 3WQVA 3L2MA 1GORA 2G4FA 2CETA 2J78A 4PMNA 3CUGA 3EDJA 5IFPA 1JI2A 5EFDA 2DIJA 4GO9A 3CZGA 3TP4A 1XHGA 2YBTA 4IUGA 1S46A 3HZ3A 3WD3A 3BCDA 4KWUA 5ECUA 1V6XA 4M29A 3SCUA 2VZVA 3SCPA 3TONA 1QNSA 1JL8A 3MKKA 2CIPA 1TCMA 4BQ2A 1HJUA 3S2CA 3W0KA 1E4MM 3EDKA 2PWEA 3VM7A 3A24A 1TQVA 5DFAA 4KGLA 1X1NA 2F1BA 2DQXA 5I78A 1KQZA 2PC8A 4W87A 2YA0A 1CGTA 3ZM8A 1FHLA 4FLQA 2AOSA 2VMFA 1CXEA 3LRMA 4W89A 1CXIA 3WY2A 2UZXA 2IXUA 5A6KA 1M42A 2CXGA 3WELA 1KR0A 4WF7A 4AIUA 4OBRA 1C8QA 3ECQA 1XGZA 4GZJA 1G1YA 1E3XA 1PAMA 2Y4SA 4AZCA
chains in the Genus database with same CATH superfamily
3B9NA 4NYLA 1BYOA 5IJVA 4GACA 3BTNA 3MRHA 1XISA 3QRBA 1E4WL 2IALB 4DBEA 3BCFA 3Q6GH 1TE1A 3CXHK 4UTWC 2F1AA 4MASA 1Q38A 4F8LA 2CLEA 1VQ6B 4GBXC 3LTPA 3C6LB 1RCYA 5IB4A 4XP4H 4WLCA 4F7EB 3EJZD 3GSRB 4NNPH 2QQKL 1RULL 1CB4A 5HHPB 1BXCA 1JCLA 5AC4A 4HT3A 4DN1A 1N59B 1E4WH 4KI5C 4WNSA 4GBDA 3IDGA 3L4ZA 3S6TA 4O12A 5HDRA 1WOBA 5C9WA 3URNA 5EG6C 4C54A 4OPSA 3VK5A 4F7PB 3S4TA 1N5AA 4RISL 1YQVH 3F04A 1VZWA 5I1LB 4EE9A 1XL6A 3ARRA 4XZUA 2PLCA 1T5XB 3ITGA 1F6LL 3P3UA 3I10A 3VFPA 4ODBD 1KJMA 3RDTB 1CG9B 1UEYA 4X0VA 4D6JA 3QDGE 2X4PA 3GZQA 3D51A 1HEZB 3W2HA 3FDGA 3GGWA 2QJMA 1NFBA 4FPSA 4N86A 2EPOA 2O9RA 2W4XA 2GIMA 1UC6A 2X4PB 3MKCA 4GMSL 4YMZA 3EGSA 3SJVD 3P2DA 4UANA 2OW7A 2D9QB 3WYZA 2XNCA 2O5YH 1FLTX 1WICA 4XB8A 1A53A 5HXBA 2XH4A 4PUDA 3SDDA 3KL0A 1C9WA 2WYRA 3O8XD 4HXBL 5D4YA 2VXTH 1FFQA 2GQHA 5DRNB 3UR7A 3IXAB 1HXMA 3L3HB 3OKKA 4G8FA 3VXMD 2FX9L 1ZAIA 3A6OA 2VUOA 4Z7VF 1OP5H 2D20A 3LO8A 3BAEL 3IANA 1F45A 3ATDA 3LH9A 3APMA 5EEXA 3W02A 5T5FA 3PJUA 2J55A 3OG4B 2GFTA 1A4LA 3QUHA 4OZGF 2VITA 3HS0B 3RFZC 3FGCA 3ZDWA 1FO0A 4RGOH 1FWDC 3O45A 2IPKB 2ITFA 4CRPA 4MYPA 4Z0SA 2F2HA 5DSCB 1SQ7A 1NDWA 1FNMA 1A4KB 4P9ML 3QT2A 4AEHH 4ZMLA 2XIOA 3JZUA 4XZHA 3MA7B 1OF6A 1RK1A 4EVZA 1TPB1 2DB8A 4IGBC 2V4LA 5K93A 2IV8A 5BMFH 4I0PA 3VFCA 4G1MA 2WLYA 4NC0B 3RL1A 1JYWA 3V1HA 2YKKA 3T6WA 3RU8H 3L7EB 4E5XG 1HZHH 4Z17A 4RCZA 1LP9A 3QSKB 4P2RA 1W87A 1NEZB 2H6PA 5AW9B 4EOUA 1JZEA 3YPIA 3LEYH 2NZIA 2J4GA 2ZWNA 4KOBA 1FG2B 3Q1SL 4Y7CA 4LEFA 2CHOA 1EZVY 2OCJA 5DLCA 2NNXA 5A3ID 2BM0A 3V5DB 1SYTA 3TYAA 3BW3A 2WSKA 1JNLH 4GXUN 5THXA 3STFA 3M0IA 1XB6A 1ZM9A 1VAHA 3VGGA 2EDNA 2OSYA 4I48B 4MMZC 5DFWH 2NUYA 4LRNH 3ZBTA 3V4UH 3IMSA 1Y6MR 4PMUA 2PTUA 1BBDL 3AU1A 1JCXA 1JUEA 1IBGL 1R3IL 2JJTC 4JY5H 5C0NC 1JNLL 2DWXA 1CZ1A 4XE5B 3BOXA 4BK9A 2F61A 1ZPUA 3HKFA 3KXFB 4H5SA 4UT6H 4ZPVB 1MJ7L 3DV4A 1DFBH 1KENH 1WS7A 3OVUB 2Q6OA 2YPKA 3TOPA 2GB2A 4FFZA 1HKJA 4NAEA 4PFMA 2A6JA 2CDEA 2HJLB 3DPDA 1F0LA 4JM4H 3HLAA 4TVCA 3E8VA 2AZAA 5DJZB 2VABA 5BV7H 5KVDH 3LCXA 4C1NB 4P4RA 3SBWC 1A0DA 5IK2A 1ZBKA 4Z7QF 4W9EC 5E2WL 2F6KA 2H3DA 4Q8OA 1SZEA 4MVAA 3D4CA 2C1OB 2C4UA 1M7DB 3SJPA 4I4WA 5ALBH 2PDQA 1AR1B 1RJLB 2YA1A 1KZYA 4QG8A 4C8XA 3VW3H 1Q8AA 4ROQA 3ULVE 3GS7A 1R2RA 4D8LA 2OXHA 5L0QB 1NAMB 3I6LD 5F93C 4QXTA 1TWSA 2F7PA 1OTUD 1WF5A 2DLIA 2E6PA 4IGBB 3GBMH 3DJ9A 4BFOA 3C2RA 1NAMA 2E7BA 4PR5B 3QIBA 3JVAA 3MCMA 4EWJA 3VA2C 3DCPA 4HCRA 1SJHB 2CLRA 3VD1A 1V6UA 3KBVA 4ZFOL 5FCUL 2HLDA 1I9EA 1M1XB 4AC9A 3IXAA 5E4OA 1YTKA 3VI3E 5A2LH 4F8XA 3L7FA 3X3GH 1XJBA 4XVUC 4B3XA 1LQBC 2MHAB 3KPRA 3P3TA 4MJ6B 1TJHH 1YYCA 2W9MA 1NLDH 1IAOB 3RZCB 4D0BB 4Y1AE 1EJ6A 3DROB 4K5OA 3N29A 4DNTB 1YI2B 3T8MA 1TVPA 3U9PL 5AC6A 1T7WA 2Q01A 1BWVA 5A6TC 1WK0A 3VRIA 2ZNWA 4LMQI 4MKMA 3V8OA 1FHGA 1QTWA 3MTWA 4GINA 4ODVL 3IJYA 5IOPB 2Z92B 2HVKA 4YL4A 1IEVA 5CCGE 4P9HL 1AUSL 4GP5B 5E4IA 1M05A 1WBZA 2WO2B 1GCYA 2ZOUA 1MF2H 4MAYC 1ZT1B 2JQXA 1IQ8A 1XUZA 2PDJA 4RLZA 3RLUA 5HGBA 2VLJB 2ZKXA 4IBYA 3DUUA 3CXDL 5MF5A 3G4SB 4P5TC 1XMWA 4TUOB 3DX5A 3RWCA 3KS6A 3K81A 4LC6A 1RH9A 3P7YA 4NIRA 4XLAA 2XBDA 3NCYS 3QEQE 1BWKA 1TELA 2XU2A 4YDKL 1ZGDA 1IF2A 1AJ7H 3OYZA 2B7BA 4WV1C 3JU4A 3JWOH 3LRSA 4J1UB 5LGJB 4AWUA 2ZTNA 5FWQA 1GJRA 1HS6A 2DWTA 4R2GB 3GVQA 5HNTA 5MKGA 3F5LA 4ZOAA 4B9FA 1TWIA 3WK1A 3VWJD 1RD5A 1RK5A 2OTWB 3NJXA 3T1FB 2R1YA 3REQB 4S1QH 1F3JB 4C6MA 4Q8QA 1HXYA 4NUGH 4JTJA 5T9BG 4OJFL 2VNKA 5DRCA 1AG1O 2Z4GA 2F74B 4GBXB 3DOSB 3QEQB 5JHDD 2XFFA 4IIEA 4NT0A 5A2BA 5HPCA 2Q3OA 1C12B 4Z3GA 4MDJA 5LXXA 4ACPA 4U1NB 4GWEA 3G5EA 2VLJE 4OCSL 1TREA 3HZYB 1LE5A 3ZQWA 3MJ7A 3NCMA 1YTEA 2QE7A 1CE6B 4MDJB 1YX1A 3G71B 43CAB 2VENA 1EF3A 4WEUD 4KI5F 3QPXH 2HE8A 4IFKA 1EQPA 5CUSH 3OR6A 1IU1A 2HT4C 4Y5YB 2H3XC 3DECA 2I60L 2YEVB 3MXWL 4MB4A 4ZFFA 4ZS6C 1A0QL 1IKFL 2OXGB 4OLYH 4FTVE 4G8EA 3TA3C 5BO0D 4S3EA 2D1ZA 3VFNA 3W2KA 4DUWA 1NBVH 1W0YT 2EDMA 1QASA 5E0KA 5CG7A 5ES4B 3GXDA 3AT9A 3CHVA 2BVPA 4LL9A 2PYEE 5C9UA 3OG6B 4Y0GA 4XO4A 5ABGA 4D6EA 5HYFA 2GWGA 2P10A 3SY1A 4IRZH 1R5VB 3GIVB 2ZXEB 5ABZA 8TIMA 4Y19A 1FL3B 3EEZA 1BWLA 4WHCA 3B7RL 3ARDB 3C86A 3EUUA 5AB9A 1G4RA 1KWKA 2VX7A 1LYQA 2OO0A 1KBVA 4S3FA 1GPOH 3MTXA 3UADA 4HCIA 1EAOA 1G0XA 3KWWB 5ISZD 4RX4A 4Q3MA 4AQAA 2V2TA 2HROA 3MBEC 3E02A 1K1DA 2DQGL 2NXZD 2DLTA 2N7AA 3C3NA 2DMKA 3TBCA 1OARL 4RZ4A 1LMIA 3UW6A 3WQ4A 2W9LA 3KJ4B 4JGNA 4LAJH 1R5IB 4FG4A 2VDLL 2ZC8A 5HWNA 4I7WA 3SE8L 4WSKA 3E6HB 1M01A 5IMLA 1A4JB 4J1OA 3LSOA 3ZXAC 1TPH1 1A7OL 1JCNA 3C52A 3LCHA 1E1EA 3SRHA 1P84K 1TJGH 1O1HA 4O5LL 4RDLA 1YEFL 1BZ9B 2IDFA 3KL5A 1R2TA 1E5BA 4GW1A 3S3DB 2CLFA 1HP5A 4W70A 3FQ1A 1NELA 5L46A 4Q9QH 3MGTA 3IBOA 3PPEA 5D7JB 1G69A 3SGUA 4TN9A 3HTLX 1M65A 5AWNL 3ZZ1A 1MQKL 5CR1A 2QZQA 1HA3A 2VURA 4MLIA 3C60B 1O5DT 2FZNA 3I65A 4QCFA 4NQEE 5D37A 3ZXWA 1BBJB 1Q1JH 3IDNA 5IB5B 1OG0A 2AKZA 1F3JA 4KK8D 2P24A 4DXKA 3BWUF 1PV8A 4DFHA 15C8L 4ZQTA 1F4WH 5AB2A 3BH8B 1DHPA 4IZGA 1W0VB 4O2FA 3UXLA 5DHVA 2DOCA 4JTUA 4B3ZA 1S9VB 5IJDC 2XN2A 1R5YA 3QY6A 1Q0XH 2P5EA 5CPSA 4ASTA 2F5AH 3L3KA 1AC0A 1QD0A 3O15A 1DANU 1GG1A 2A1YA 3FJNA 1K5NA 3A9IA 3HHRB 5JO5A 4JFSA 4AYMC 5KYWA 2A4AA 4KCTA 1ZHKB 3GRIA 4M7SA 4OFIA 3QIUC 2ATPB 3UAEA 4DP4X 2JQZA 2JIWA 3ZRFC 3WU1A 4WCYL 4IJ3B 5F89B 4I9WD 1U41A 1YAIA 1WKEA 4CNTA 3NJ3A 5HZAA 3I6GB 5I1JH 2H6OA 3DAQA 5FIPA 1SFHA 3NSYA 3SBRA 1AO7B 2XBTA 3L0GA 5DO2C 1EZLA 1WFTA 1FWSA 1YLOA 1NM9A 3RPMA 1KN2H 4NEHB 1JNEA 1V10A 2EIMB 3VIIA 1CTMA 3S4SA 3CU2A 3UZVB 4L29B 3FIGA 1JZ6A 2DGAA 2R56L 5KANG 3HZKB 4S0SD 1A5OC 5BS0D 1HYSC 2Q8ZA 3QOKA 2MPVA 1S0UA 4X3ZA 3STCA 4RD1A 1DJZA 1P69B 5AFDA 3A4EA 3SPHA 1KZQA 4XXDB 1AIZA 1ERNA 1TSHA 4RH4A 3VWJC 1NQBA 1E4XH 4RL3A 1RP9A 4ZSOA 4ZDHA 2D7TH 4WGKA 5CD5D 3VNDA 2DF3A 2OBGA 4O0QA 3O45B 3TV8A 4PTXA 2BOLA 3SO3B 4GFTB 4FKEA 4KITB 1JFHA 1U92B 3SO7A 3M6YA 4PP2A 3K2KA 1G43A 4A37A 4N1CA 5AL0A 3TA6A 5BRZA 2CZNA 2VTFA 2FK9A 5FFGA 3WEBA 1MH5A 4ABUA 4JY8A 3NOIA 4DJED 5CBBA 1PMYA 2LLEA 2N59A 4EZLA 3CK0H 4LPUA 1MXDA 5F72S 3SBWA 5I73B 5CEZL 1LG1A 4L61A 2QCDB 3MANA 3BDXA 3NN8A 1WCGA 2AQNA 2VDQB 5CZSA 4HWZA 1AZVA 4ZPTA 8PAZA 2XXGA 4GB9A 1U4EA 4HIJB 4IS6A 3WTUA 6CGTA 1KUMA 1SJEB 2MTAA 3EWBX 4X7FC 4KRPB 4LVNB 4HK3J 1BLIA 2HAZA 4QHUA 4YDNA 1WBHA 3CIXA 5IWLC 1SHXA 3C6LA 1MRZA 5E1AA 2XVLA 3REVA 4NQVB 3TJPA 5B3SB 1CO1A 4JTSA 1ZHLB 5DUJA 2ADGB 2W07A 3RGVB 5FO7A 4X4YA 3HF3A 4R85A 4LY4A 4PRHB 1IE4A 1MFEH 1BCIA 2PR4H 3D85B 5D2NC 4EI5D 3P11H 5JOFA 1AL8A 1RHCA 4OU1A 4OFYD 4GQ9H 1PVHA 5F3HA 1UZ1A 2CGRH 5D1ZA 4MXWL 4X0KA 1J9CT 4ZW7A 1CEOA 4YVXA 1ZGLP 9XIAA 3N4AA 3P74A 1G7JB 4IF2A 1SHSA 2KZWA 3QJQB 1A3RH 1QSFD 3H9SB 4TNWK 3BPCB 3RM9A 4P4KB 4DWSB 4MDOA 3WJWA 3QUZB 5E9DA 4LHJB 1K6WA 4M51A 3EYUH 1SRDA 4L3EA 2TAAA 4A2EA 1I1XA 3G0UA 1ZHNA 4JZ5A 4GLRH 2CIKB 4XXWA 4DKEH 4JQ1A 1TJMA 3W2JA 3AWFA 4X5WA 1YITB 2IH3A 2YA2A 4LB8A 3SDDD 3U0TB 3VXSE 1MZRA 2NWRA 2Z6IA 1IM3D 2ESVB 1X5GA 2TSAA 3CDFA 4JFZL 2XG5A 3BMVA 4DVRH 1QI0A 4O18A 2G2PA 3BP7B 4WNJA 5SX4H 3W6YA 4WNQA 1H5BC 5C2UB 4K7VA 3ABMB 2R39A 1GAQA 4PCKA 5LDSA 4J3XA 4YYFA 1DBBH 3QC0A 3HR5B 1GGYA 1KJVB 3GD6A 3SE9H 1ZLVH 3GTFA 3TZVC 1NWPA 4H25B 2CH8A 3PZ9A 1RZMA 3CPRA 5D2NB 3PXLA 1GJPA 4OKVA 3JTSA 4Z0XB 5CC5A 2HPMA 1ETZB 1AH0A 2HVKB 1GKRA 3BGFB 4HZ6A 1A7PL 4BH8A 5F8RC 3INUH 1OZTG 1ET7A 1B0GB 4ETQA 1YUHA 4CGTA 2DEPA 4E0RA 1BYDA 3UERA 4KEVA 3SDXB 4GYKA 3VINA 5HZBA 5B1JA 5KSVB 1Q7QA 2F58H 4AENB 3EYQC 1USQA 3V0EA 5CU5A 5EN2B 4N4YB 3CPXA 2XI9A 4N1EA 3R0MA 4D0CB 4UMGA 5C6WH 1TPWA 2YL8A 3CHFA 3VOFA 2FVNA 3EJQA 3K4AA 5T3XD 2ISDA 5IF0A 1CL7H 3CAWA 4JD4A 3T9PA 3CLMA 3M7SA 4QXIA 3WJSA 1GMIA 1OK4A 1BX2B 5F7BA 1A7RH 1DO5A 4G59C 3BC9A 3WUWG 1ZWIA 1H3GA 1AJ2A 1W9VA 3FYYA 4XBKA 1MCOL 1URLA 4FNLL 1G6RL 1RURH 5DUML 4NKCA 4BI6A 4OQTH 2ZG3A 2F74A 3V6FA 2BP8A 2JJSA 2YS4A 4P46B 1BZOA 4E5XB 5IHZA 2VXNA 2YLLA 3FJ4A 1FGNH 2N1KA 4LEBA 5I5MA 1ADSA 1B31A 5B8CA 4POCA 1SLUA 3G05A 3T6ZA 1NSJA 1VS1A 4P8UA 2YGVA 4TMWA 3M5ZA 3REQA 4YZFF 4AZUA 1VA9A 4FNSA 3ARXA 4IKLA 3RY6C 1JGDA 2CF4A 5B7YA 1HHIB 1V3KA 5IQ7L 2KZ1B 1NWSA 2BOGX 2YDSA 2FYVA 4TNWF 3WHE0 5LGJA 4NQUA 4YSPA 4C7FA 5CDFA 2UXGA 1I1YA 3B3BA 4G7SB 4OCXL 3W9EB 4C59B 1IT7A 4F1SA 1S9XB 2FX7H 3I9GL 1MW0A 4GA8A 4N2GA 3UPMA 4YXHL 3T6VA 4LSPL 4S1DC 1A6ZA 4UTMA 2YBRA 4MJIE 1YBQA 1ZUAX 3H7UA 4RZ5A 2BHFA 4WWKB 4IIDA 3HI6H 4MOZA 2VDMH 5B4MD 1YNYA 3H2MA 1KV8A 2K8QA 4X8JB 5C0CB 2C3VA 2Z4QA 5DXXA 2NTFA 4EMZA 2Y7OA 5GGQH 2X44D 2J1WA 3DMMB 3CZJA 3CX2A 4HEMA 1QNVA 2ZA2A 3K30A 4K68A 3QEHA 4Z1DA 3MLRL 4OZHE 1XZWA 3WKZA 3EOEA 2YMXH 3F3HA 3QORB 4UOJA 4Y9OA 5AD0B 5G1YA 4X4ME 1TJGL 1EX5A 2DCUA 3NNTA 2YLKA 3PF2A 3SAZA 3QCTH 1NCDH 3H24A 3VI3A 3GW3A 3UZXA 5BXRA 4R5EA 4L8SC 3AIWA 3QUXB 3RWDA 4GOAA 4APQB 3PJXA 4OKVB 4C6EA 4AVHA 3LKSA 5CPLA 4UM9A 1MFDH 3UDWC 3VNMA 1Z44A 4P7LA 2F53D 4X9GA 5T1DL 1SEBB 3QE2A 3E6HA 5LNSA 2J9ZA 1K8AD 2BK8A 4FQ2L 1GHRA 4ZFZB 4PS4L 3N34A 4J3OC 3VXUE 2P5WE 4GQQA 1BREA 2B2XH 3G9AB 5BW7C 5KSAB 1UT1A 1HIML 4AL8H 1X98A 1UHVA 2ZBVA 4LXFA 1T1XB 2BV3A 5IUSA 1KLGB 4MY8A 1UA6H 4KUZH 1IRAY 2FUTA 3C09C 3GSNH 3S8WA 4JTQA 2VL5A 5AHMA 4KNUA 1FORL 1U9KA 1L5GA 2CRMA 3N6YA 2JVUA 4HPOL 5LB1A 1FXPA 2YN5A 3W1XA 4BINA 2RD0A 5A2JH 3DK2A 3RL2B 3W7OA 4GLEA 2CC2A 5D1XB 3SJZA 5JIHA 4Z1BA 1UROA 3M47A 4P07A 2G75A 1OTSC 1U4FA 1Q85A 2H3BA 5EF1A 3IFLH 1DHKA 4ZO8A 3VRJB 4U31A 4WDWA 1QFEA 4YFDB 4UM8B 3D12B 3BIKB 1KG0B 2CBVA 3A6CL 4G6AD 1N2VA 1B3WA 1I1AC 2CKBL 1EO8H 2QADD 3B9KC 3Q8AA 4HWUA 3MCAA 2WO3B 2GJRA 2R1XA 1O94A 3U82B 2Q3RA 3L4UA 1OAUL 4AMAA 1M56B 3HCVB 4RGND 2FSEB 2P3ZA 2R24A 4NUGL 3T77B 2DZSA 4IQJA 3HVNA 4G8GB 1RZ7H 2IEPA 4I85A 5REQA 5KSBE 2ZXIA 1ZE3H 1NGXA 2XH0A 3N3TA 3DOHA 4JKLA 1W2VA 1TQCB 3DFHA 3PBGA 5D2TA 3ZVIA 2QQ6A 3O6CA 4WHTA 2VH5H 4U2YA 5DCEA 1UGKA 4Z3TA 3PWJA 3B4YA 4O19A 5D1QE 1AJ7L 3OKOB 3NZSA 2BSTA 5AHNA 4DF2A 3D2UB 3QZWB 3PZOA 2OXNA 1TU2A 5GIRA 1HH6B 5GGRB 3T4YB 1OSYA 4HJGA 2QUTA 3CC4B 1RQBA 2HG0A 1VLYA 1OD7A 2BVQA 3P9MA 4GRWF 5J0BA 1GYLA 1MF2L 1S7WB 5D7LD 1NAKH 2WQVA 3DVGB 3NCXA 4KRNA 1GZ1A 1XCFA 4KO7A 1NMBL 2V2TB 1JK8A 1G5AA 2VDRH 3OC8A 5IMMB 3HNVL 5IK3B 4ODVH 1X4ZA 1MQ8A 1QW7A 4OUIA 4B4FA 1ICPA 2BM1A 2C1PB 2BGSA 3M07A 4CQDA 4D9PA 3WJYA 2IBBA 1B4EA 1BYPA 3NZUA 2IGFL 1DWIM 1D5XB 4BS0A 1AAJA 4I77L 2XJ7A 3SGDH 2H3NB 2VLLB 1FBAA 4NS0A 1HE8A 3S5ZA 1G1CA 3N55A 4L1LA 4GUHA 1ZANH 4TUKH 1TFVA 1MEIA 3NTCH 3V6OE 2X1QA 4MLSA 5HHNB 1W3KA 3ESMA 1U8NB 4LSVL 4NLAA 1K5WA 2JI1A 3V75A 2DQCH 3WMSA 3UNDA 4KVPA 3MRIA 4QKTA 4TNEA 1QPKA 3UAJA 1I1AA 3VI4B 5CBEB 1OHZA 2BSAA 3BD4A 3VX1A 5TRDA 3RCMA 3TYEA 4R3SA 1EYWA 1TFHA 3BGJA 2ZKHL 4KXDA 3GBML 3TO4A 4E9VA 2A99A 3I6EA 2NQLA 2B7QA 3APCA 4FQXB 4PTUB 4CD5A 5DUBA 1YEEL 1XYAA 3D4GA 1UR4A 2A9MH 3KVPA 1V93A 1W32A 1OLZA 4XNXL 1SJMA 1ULVA 2UY7B 3AY2A 5GV7A 3QHTC 3EMQA 1ZTVA 3BGAA 5BXSA 4YAUA 4ZXBC 2VDKL 3GSUA 3DMMC 3LQZA 4A2DA 2INFA 1UCWA 4DEUA 4JFDE 3EF7A 1VJSA 2DD8L 2X85A 4KZEL 4JVUA 1DQUA 2DT3A 3PP3H 3WEAA 3PVFA 1V7ML 2WZ0A 2Y1AA 4CADA 4RW3A 1HSAA 2R2CA 4RJEA 1B4JL 4NCC2 3CIQA 4WW1B 2HK0A 4FCAA 3TWCL 2CLLA 4WIWA 2VUKA 5EA9A 4P99A 2CRVA 5FKAB 4I2XB 4M7ZC 2OMXB 2NQ3A 3QQWA 2W66A 4UILH 2NY2B 4DGVL 3IUDA 4OOUA 4YDIH 5I1CL 2EDOA 5GV8A 2B5OA 4CC1A 3IDIB 4F3FB 1H41A 1Q86D 5JPNA 1ZLWH 4BSJA 1CI5A 3QPYA 5C54A 5BNXD 3VXMA 2MQ0A 2IBZY 3KYKH 5HTSA 5MEQB 3I7SA 1CD9B 1Z66A 1F1DA 1FVEA 1HL8A 2QVIA 4XMLL 3FTXA 5SWZE 5HHVH 5FLVA 3ZHNA 1NWTA 4HC1L 1TRDA 3CV5A 3OSKA 4I6VA 1QLFB 1OY3B 1OAJA 5ELIA 5A2FA 4X8IA 5F70A 3WFLA 4YN5A 1FIGL 3BVUA 1BTMA 3GWQA 3G6JB 2HP4A 3NZHL 5CNHA 5JW4N 1N8FA 1WDWA 4GI4A 1HZHL 3CH1B 3HC0A 4S1DD 3QXDB 4JCLA 3BWUC 4PW4A 4XCNB 4XVUD 4ABQA 4E9TA 2B14A 3UG3A 3BG3A 2WTRB 1XC6A 3UJSA 3WF1A 2RA1A 4UMSA 2VDHA 2X1OA 5C0IB 2J43A 2VM4A 1G7IB 2BX5A 1NFKA 3MYOA 4YHYB 1XDMA 1IAOA 4P9MH 1INDL 3NQBA 2WLMA 2BP3A 3I6LE 5IQ9A 1DWJM 3KXQA 1FNCA 4GY7A 2VAJA 2VBVA 3W5HA 1NMCB 2IADB 2CUHA 3CPLB 4BFGA 2D0GA 2X8RA 3FXYA 2GQFA 4NU7A 1EA9C 1M1XA 4TQTA 2AQQA 4FA3A 1T1YB 5HJGA 1JXGA 4NQCA 3WKNA 2NPFA 1F8MA 1FSKB 5HHNA 3DGGB 4ZTPL 4O4VA 4LMQE 3EADA 5E0QA 1K8ZA 2Q86A 1E15A 1HJSA 1NB0A 3LHAA 2Y6TE 4JKWA 2ZRZA 5HMDA 6PTDA 4U1IB 3N11A 2WQWA 4NRXB 2J8OA 4OD2A 4LOEA 5DHYB 2PTXA 2XVGA 3L8QA 3JTSB 4HHAB 5HYQB 2ZRVA 4X7TA 1PIIA 2O5XL 4OFKA 4NCDA 4XMKL 5DRXA 2HCZX 1Y0LB 5GJSL 5HQLA 4XV0A 3MJWA 1ZZMA 4AG0A 1LZOA 1JPFA 4X99A 4JLRB 4HHGA 3VH8B 4OJAA 1OCWL 3PQYD 5EO1A 3ATZA 5GGVH 2GJLA 4P5TB 3D34A 4C4KT 2XQYK 2ZCGA 1YNTB 5HVHB 3R4IA 5C09B 4N8PA 2F18A 4MIMA 4RPDA 3DI2B 3I6KA 3QZLA 1EXPA 2CZDA 4X0KB 4GBUA 1WD9A 1XF1A 4GBXA 4NENA 5F7DB 4MKTA 4UV4L 4XD5A 1KGCE 1BXVA 4Z8FH 4PJBF 1BVNP 2P47B 2JJ2A 4ADUA 2RQ8A 3D7PA 4NNPL 4PD4K 3MUIA 2QEJA 4Z4RA 4P4KA 4FQJH 4M1RA 4WWKA 2EUZA 4IKJA 4AVZA 2YKLH 1GVSA 1PZUB 4OTKA 5C2XA 1AXTL 2CKNA 4L1BA 4YWGL 4G6JL 4AM0B 5I03A 2M8XA 2XPYA 3M88A 4LT9A 2DU2A 2XWTA 2ZXAA 2QJDA 2WJDA 3LB6D 3T0BA 1T7XA 1J9YA 3JZEA 3CH0A 4W7WA 4ERGA 2EO9A 3LQGA 2GUOB 2J4WL 3ARBA 1TJRA 5TE4L 2ADJB 4KK5C 1GS6X 5E2VL 4QAIA 3AT8A 3WTYA 1QNRA 5HJLA 4N2YA 3TFKC 5CXPA 5AUMA 1SEQL 5I74C 5A2IH 1E4NA 3BZDA 5SX5H 3QUYB 2NVCA 1FIEA 4IPIA 3W7HA 4X5LA 3CTLA 1F13A 1NIDA 2DEXX 5IB1B 5L0QC 5H37G 3D47A 2R59A 2V6HA 1DBAL 3FUFA 4J3OF 4PI0A 4FHJA 3SCRA 5KS9F 4ACBA 1UM4H 2A9CA 4FTVD 2PF8A 1Z48A 1NPNA 1OZMA 4G1EB 3FNDA 3S1GA 4UTAL 4WI8A 1DYSA 2I56A 4FFWC 4G7YH 4L4JA 2D7PA 1ZVSB 5D5MB 3VD7A 2Y7FA 3E1F1 4FQIL 1E30A 4IRJB 2AFNA 3DBXA 1X7FA 3CCJB 1HHHA 3WQZA 5EB9A 1MRFL 1U6AL 2PDHA 3B9DA 2Z6BD 3ZTJH 1R5OA 4UTBA 4PBWD 3ZU8A 4J2PA 1XIIA 3BFQG 3MLXL 3TR9A 5AB0A 4DHGA 3Q3GA 3C09B 2F19L 3WE6A 1NRKA 3AZUA 4G72B 2I27N 4TRPH 3TBTB 3N2TA 3W5VA 2HLFC 1TVCA 3RLSA 4BK8A 4O8RA 4L80A 3LSCA 3MRBB 2WYHA 4LCWD 1X44A 1EDYA 4W6WB 1SW7A 3KPLA 3TIEA 3HMWL 4AUBA 2WVVB 3FHAA 4XVDA 4K2UL 2UZ9A 1BZDA 2DOGA 1P6WA 5A69A 1RAKA 1LQAA 2DI7A 1AFSA 4MZ3A 1V03A 1MZYA 2AABL 2VZUA 3DURA 4K7PY 5HYJD 1Y0EA 4W5ZA 4F2EA 4NZDA 2E7DA 4Y16C 3W88A 4YHOH 1CFSB 2FD6L 4FD0A 4LCCB 2EUVA 3KYOB 1L6WA 3GUFA 4LQ1A 5JUEL 1LO3H 3D07A 2L7QA 3BVVA 3BAWA 2ZUTA 5HYJE 3T1WA 5BXTA 2QCCA 2NLIA 4PCPA 4ODHL 3Q13A 2E3ZA 1D9KC 1WEJH 3H7LA 3LH2H 1WFIA 2NY6D 5F7AA 3HNSH 4JY4A 5JDSA 4A6YL 2MNUA 1MQQA 1TVLA 4P8QA 3TOYA 1UADC 4IHOB 1B2YA 2CBXA 2JI2A 3GDBA 5C09E 2AI0L 4JN8A 4R0LB 4A8NA 5AG8A 2CBIA 1LRNA 3WUWA 4K15A 2JB6B 2R4SL 4V2BA 4F57L 2Z0BA 4H7ZA 3GDCA 3WUEA 3U9UB 2IQ0A 2IQ9H 3CPUA 1GHFL 2Y36L 4OM0H 5LO7A 1PE1A 4POYA 1N8RD 3HOGA 5AOMA 1T0MA 2XXMB 5HHOB 2WBGA 4GY0A 3GO1H 4PTTA 1CIDA 2P8LB 2DUAA 5I16A 5EEVA 1SOKA 2IBGA 1KFAH 1XIFA 4ZQCA 2VIRB 1G6VK 3ZIYA 1Z0MA 4K9EH 2IPUG 2DQUH 1U5HA 4DQOL 3AWOA 4IDJH 2NSOA 4K5LA 2ZZ5A 3E3HA 2CRZA 3Q8CA 2E9LA 1HNGA 2HJFA 5DZAA 3FYPA 1KRMA 5EIQA 4UDUB 2QCHA 2GIXA 1KBPA 1RLWA 3O2DH 4N0YL 1SY6H 2JKEA 5BZDA 5D33A 5AECA 1AIFA 5KOVC 1XGYH 3L65A 3WFZA 3WLMA 5I8KH 4JFXA 1OGTA 3T53B 3JWDH 2E1WA 5B8CC 3ARDA 3FEQA 5FESA 2OQJA 3GSQA 3LKQB 2CBJA 1ZTMA 4NB7A 3WK2A 4ZEPA 5CCZA 1JG9A 1FH5L 2A77H 4AGLA 2JKTM 4XXCA 1FNSH 4XGZB 3WE6B 1IGSA 4BHUA 1JQVA 3BW4A 1E6RA 5AZ2H 1C1EL 1FO0B 3ROLB 2XWEA 4QRTA 4KKQA 3RNKB 1NGWA 1H6TA 2XH7A 2P26A 1QA9A 3F4VA 4ZXBD 4JQ2A 3AY4C 2EDEA 3G1XA 3PPCA 4LL4A 3AQUA 4RQQB 1JMZA 4WFEE 5DVOA 3RVWD 3PFMA 2NR6A 2DSWA 4F9LC 1E3ZA 1V0LA 4L1XA 3SN0A 4GW5A 8FABA 4GX9A 4YHIB 3DEQA 3RRXA 1KIQB 4NKMB 5EORH 3S8GB 4MQTB 4F2FA 3TC6A 4QRUB 1FPTH 3EOYG 1O7DE 2O9OA 3TSDA 4XX1G 5A7EA 3IACA 3TCSA 4KY2A 5GS3A 1AHMA 4JFDA 3SPVB 3WXMA 3QM3A 5CO1A 2C5DC 4I2XE 2VJIA 4W9GC 3P3BA 2XTJB 4Z7NF 4NQTA 4LVOB 3B5GA 5CILH 3NURA 2EJ1A 3I3DA 3JV6B 5BSYA 3S6DA 1N4XL 5T1KA 4C6NA 4QVJA 2Z93A 3F12A 1R0MA 4KQNA 1GVOA 3IDNB 1CS6A 1L9QA 4EN2A 2QCLA 1IFHL 3H9SA 2L7UA 1MLBB 2VFHA 1YJ9B 4GSDL 4Z7VA 3B8TA 4RD3A 1LQSR 3HC4H 3FSUA 1TETL 4GUIA 5ENLA 5K9DA 5KYWB 3NK3A 1RCQA 3NDYE 5F1KC 1EUNA 4I0PD 1OEPA 2EG6A 2Z1SA 2AK1H 3Q2WA 1PUDA 3R12A 4XNUL 2P5EB 1GGIH 4JTGA 3P1VA 3VXRA 4OZFA 5KNLA 1ZU8A 4XCFL 4Q58C 4L05A 4NKOB 2ZTGA 1HQRA 3OLGA 2MQ3A 2X0HA 4XC1H 4GY4A 4JE4B 5CFAA 1TZZA 3IIVA 4O54A 3O3UN 4NAFA 3FSOA 1ESOA 3QFJD 4OZ4B 1OFRA 4FP8L 2A6DA 3GQYA 3M16A 1PX8A 3QBUA 1OCBA 3JV4B 4C7DA 5I0YA 3PWPE 1AG6A 3T6QC 1NU5A 3N2XA 3PAZA 5LXEA 2BSED 3DYPA 3X1BA 3QXVA 1E0OB 2FZ3A 3ZDYE 4W9TA 5C08B 4Z1CA 4MMYA 1TJ2A 4PUWA 3TLQA 1ETZA 4MZIA 3WUGA 1KBJA 4ORIA 4BKLB 1WFNA 5G4OA 1W37A 4H25A 1IXPA 3HG1D 2D2HA 1Q6FA 1FSKC 2EH7H 1GAFH 3BIAX 2MHAA 3ZX1A 1ENUA 4UOW1 1SJDA 3PZMA 4S3GA 1E4KA 1E8WA 4OD3H 1Q8JA 1RQEA 5CBJA 3GK8H 4OD2B 2PGWA 4EF3A 4UWQB 5FX3A 1I1AB 3VI4A 1IXNA 4JJ5A 4LLAA 1FC2D 1Q9WB 1MJJB 1TTIA 4XMPH 2V33A 1L7IH 5K1JA 3O2VH 2G8ZA 2XPGA 4NJ9H 2HK1A 4QOKA 2ENJA 1XDTT 1T03H 1CJYA 4HMEA 5FYJU 4HE5A 3V6OC 4PFHA 1S5IL 1HH9B 5IBUB 3S6CA 2EPLX 3HTWA 3PTQA 1EBAA 4JDTL 4PRIE 3TC3A 3J7HA 1ICTA 1FHUA 4ZX5A 3QNXB 2WN2A 3TVMC 2AXFB 2HMCA 4JTTA 1UIPA 2J7HA 3RNDA 1Q81D 1RLBA 3L3OB 4JM2C 2X4UA 4R4FH 1KJ2L 3LRHA 3ZHLA 4WRHA 6XIMA 3L81A 2KH2B 1TMQA 3GC3A 3MUXA 1E4HA 4P5KB 1YPZF 1MVUA 4N42A 1TTTA 4RR4A 1RL1A 1N5YH 3ARBC 2VZOA 4JG1H 4OUEA 4F15C 1W1VA 4L56A 2X0WA 2A73B 2IDQA 1T4WA 2V17L 2VM9A 2XTJC 2POTA 1UXWB 2XG4A 4NQDB 5DGRA 4YSSA 3D69B 1SBSL 5E2TH 4G6CA 4UMCA 2IQAB 4N2NA 4ZUWB 5T3XE 2MCPH 2DM2A 4IMLB 3E2HB 4M7JL 3LTYA 5A6BD 4PMEA 4BF5A 1BJMA 5FO8A 3KRBA 2P50A 1KC5H 2Z1KA 3Q01A 5FO2A 4FEZA 4XX6A 3OEXA 3SRKA 2DWDA 2HFEB 4Z4TA 3L54A 5C0BD 4FABL 5J12B 4K1WA 4Q4QA 3NRQA 4ZOEA 1E56A 4RDVA 4YTQA 2ADGA 1F90H 2W07B 5TDOA 5DRWA 1T3FB 3RGVA 4KW2A 1PSCA 2YBRB 4N25A 5CJXC 2VABB 4TVPE 4R7DA 4L8SB 5KYNA 1E4LA 1DXFA 2DUZA 2FVMA 1XD0A 4NUJA 3B1UA 4P2QB 43C9B 4BQ9A 3WDQA 3KHOA 4AM0A 1OP3H 1EC9A 2R27A 4LHUG 3HZYA 3ULVD 1MZHA 1TMHA 2CZ5A 1OHQA 5D1XE 2J9YA 1KGCD 1C29A 3C2EA 4XR6A 2GJ6B 2XA3A 1OFOA 4IOTA 4Y2DA 2J79A 1UP2A 3VXNA 5D93C 5CIPA 3TWBA 2NY1D 3GMRB 3QWNA 4WFFE 1IGFH 2PDGA 3MP4A 1X8CA 3U46B 4M5PA 3FFSA 4R90L 4YIQB 4XBGB 4DZIA 3GF8A 4JTAA 3PDOB 3L9YA 1JD7A 4XPBL 1JYVA 2VSKB 3GQFA 3V4PA 1O60A 2PODA 2DIKA 1FWNA 3UPRB 2WBJC 4Y19D 3BZFB 4G8TA 3U0HA 4JDEA 1BD2B 3SBQA 4YHMH 1DDHA 1FNLA 3WIIL 1EWDA 1RVGA 4JR9H 3K72B 3FRPA 4MM1A 4F4RA 4ATDA 2BNQE 5DJ6A 4CN6A 3EG9A 2R0ZL 3O6FB 4UQBA 2FQEA 4KKSA 4NUWA 3WY9A 1WWCA 3HR5A 2V9DA 3XIMA 2C3GA 1J5DA 1IBYA 2L0DA 1IJNA 5E9AA 1V6WA 1XP3A 2Z92A 3SY5A 3CP8A 1E8ZA 4OCYL 3L4XA 4HAKA 4LQFL 4TSCH 2EAEA 3GKZA 5GHWL 4PJ5D 3PNUA 3VE7A 2HRWA 4JKPH 1YY9D 5I3IA 2C9SA 3OBKA 3NOYA 1FLRH 1N7MH 1OANA 4R4ND 1UWQA 3WBYA 1QRNB 2C26A 2X1RA 4PV8A 4TL5A 3PWIA 1AD9A 4YXGA 3HFYA 2GSMB 1TUPA 4WU5A 2CK0L 3U7VA 2ZBUA 4MD0B 3ZSTA 4WEVX 3NACL 2Z91A 3SCTA 2EO7A 3CVCA 4GZ7A 3D08A 1EA0A 1UCBL 1OAKH 3OLEA 3UMNA 4O1AA 3T44A 4AXNA 4M93C 2GFBB 3H9YA 4RD2A 2ITDB 1MWAA 5EU5B 4JHAL 2OX5A 4UTUA 1A6WH 4Y4HA 3EX1A 3OA5A 2A3LA 1DVFA 4KVCL 2Q2EB 2J4WH 4HNUA 2BPOA 3F65A 3QIWD 2VXQA 1P1ZA 4KAQH 2D73A 3H0TB 3PJNA 3OKDA 3AIBA 3UD6A 5I3HA 4AGQA 1F61A 2FSEA 2I07A 2CW6A 4O14A 1NQKA 4NHUB 4UAJA 1PX3A 1NUNB 3AW5A 5E9NA 5AQ0A 3EXSA 3F5WB 1HKFA 3SCWA 3ULVH 2OTWA 3T1FA 4JDVB 5FEBA 2OKMA 4Q6IA 3IRZA 1S38A 4F2UA 5BOEA 5E0CA 4KRPC 2XC8A 4JHOA 4L5FE 7TIMA 2CHXA 2HRPL 1CFNA 3HC3H 3OX8B 4XPTH 5FYKL 4ZMAT 1K3IA 3DGCR 3HPZA 1KEGH 2ALDA 1NGXB 1BXAA 1FRGL 3B2UC 5KVDE 3BV7A 1YKWA 4WJ5B 1K5NB 3BJSA 1IEAA 2CALA 5TBOA 2B7OA 4UV4H 4ESKA 3POHA 3B2VL 5A8GA 3WLWD 2C0AA 5IB4B 1KBIA 3ZYIA 2IF7A 1HQ4A 2V9QA 2X2HA 3RRQA 3TYGL 1QRND 5EL1A 2IDSA 2J7BA 1HX0A 2F7QA 5D2XA 3EFFB 4HFWB 3BEVB 1ISZA 2H8PA 3WFHB 1CBVL 1BX0A 3OKMB 3KTSA 2QF7A 3WOVA 4ZNEE 2PW2B 4Y2OA 2YDAA 5LYRA 4ZAKA 4OI9A 5L2KD 1BF5A 3AMCA 1FYTA 4P57A 1ZM3A 4I0KA 5CEZD 1Q7ZA 3JS3A 2AMXA 1CLYL 1BZ7A 1YYLH 3QRGH 4WKHA 2AVFA 2BX7A 2O7SA 1NC2D 5L2KE 5HJXA 3BJ91 5GGTH 5C0GB 1XQLA 3U6WA 3ABKB 2W65B 4FI6A 3SKUD 1TJ0A 2QV5A 1J05B 3FFCA 4HDIB 3VO1A 3WG7B 4MDPA 1JZ4A 3UWVA 4QY8A 4JPKH 4IKKA 3WIJA 1U8HB 5A6IA 3W2EA 1WOAA 4PMZA 4HPYH 4XTRC 1TQSA 5MP6L 4Y19B 2E75C 1G7MA 1MELA 2WM0A 3CZUB 1KFKA 3GEWB 2FECL 2LW3A 4DKAA 3GR4A 2Z25A 3WQEA 3PBUA 3MRIB 3GM8A 1LDPL 1TQBC 1KIPB 1OQXA 1HL9A 4LSRH 2CXEA 6FABL 3WIHH 1XBRA 3OTRA 1BJ1H 2I26N 1QA9B 4ML4A 4AX6A 1W3IA 1IGML 1XMEB 2UY4A 3NUKA 3B1TA 3O2WL 3PA2A 3MNWB 5HATA 2O6FA 3VXSB 4ES4A 2I5YL 1AZCA 5EZPA 3H2NA 1VHCA 3RCNA 4MYXA 3MO1B 3IVKA 3W9DB 2I9EA 3PP7A 1T40A 3QCUL 3KBNA 3RTQA 3W0WA 1UR3M 1U8HA 3BDKA 4P7QA 3ARQA 2WN3A 1MUJA 2MOQA 1N68A 3RTQB 3W0WB 4TQIA 1AK5A 1L3NA 3UOAB 2EF9A 4MBOA 2UY2A 4JCWA 4IU3A 1P7HL 4DSYA 2MFNA 1QHOA 3LS9A 4F7EA 4IJBA 3VFMB 1EOMA 4QXGL 1Z9MA 3KYKL 3N2CA 2OYLA 3TAOA 3I9IA 1L6ZA 5CINH 3WH6A 5DGQA 1GW6A 2AEPL 3ZYJA 4WW1A 2OODA 3CHEA 3MWAA 1E2VA 3LI0A 1PB0A 3MMUA 3L1OL 4PJDE 2X53A 2A74C 2BW4A 3AMKA 3LLFA 3WBAA 2DMGA 3NESA 4OZFB 2BNRD 1RIHH 2ATPA 2VXQL 2VR5A 5ITBL 1H5YA 4B27A 3KW8A 3GJEA 3DXAA 2R1PA 2Y70A 1N18A 1NTHA 4CMHC 2NY2C 1QFJA 4N2OA 4NHCH 5IFAL 3X3FL 2EXYD 1TVDA 3BUTA 1KC7A 1OB0A 4YEEA 4Y5VA 1IZCA 5DQDH 3IU3A 4MVBC 4OJEH 2ESCA 2PDKA 2VC6A 3MMTA 3QC3A 3IU4L 3F58H 2VXQH 2UWEA 3H9NA 3ZL1A 1HJCA 2W67A 1XIMA 3GR8A 1JPSH 4WIQA 1AACA 1X97A 4QWWD 3KP0A 2YBUA 4KXBA 5B38G 4IEFB 4LEEA 3KZSA 1JI1A 1A1NB 2KT6A 1SVCP 4KKNA 1BG4A 3Q45A 1PWLA 4QISA 5JIQA 2A5HA 2APXA 3VKDA 5L9DH 5G2NA 1KPRA 1PLGL 1ZY9A 4CW1B 1EZVX 3MBED 4AD4A 1RA0A 5TJWK 2JIXB 3CVIL 1Y6KR 3KPQA 1IM9D 5FECA 5KVEH 4PB4A 1H3WM 3LQLA 1THAA 4K5PA 2B1OA 3IGAA 5FDWB 1H6FA 2J8FA 2EZ0C 4KF1A 3VDCA 5KZMA 1W1YA 3LDBC 2WM1A 4XP5L 5KYYA 3BZGA 3CSGA 3M64A 1CXKA 1FDLH 1QLRA 2KERA 4ILSA 4MKSA 3HG1B 2DKUA 3IJHA 3TVMA 3DBPA 1KD1D 2X4TA 2XACC 1H49A 1L6FA 1UPPA 4PH6A 2OWXA 1RXLA 4FKHA 2QGCA 4MJ5B 4AVKA 4KWOA 3X13A 5DRNA 4GH3A 5C08D 2C1GA 4B5XA 4DBDA 4W68A 1ADWA 1UUNA 1IR1A 2J6XA 4UTIA 3HMJG 4P59L 5GZNA 5HDBF 4OOXA 3AQXA 3LRLA 4GIOA 3RX9A 4I3RL 3UDWA 2MQCA 1KLUA 2CU0A 2RFGA 2V5KA 4GKTA 4JKKA 3L95A 4Y2WA 3R8GA 4ZTOL 3MNWA 1OVDA 1OXYA 1DVZA 3B4NA 4BXVA 4DLMA 4PS3A 4MZYA 3T05A 1X5XA 5EOTA 3FUKA 3HGRA 1MNZA 5F2MA 3EBGA 3DI3B 4JIEA 1MW1A 4AB4A 5MHBA 3BXNB 3NCFB 3K2GA 3QHNA 1F18A 1MFCH 5I0XA 4J8RA 4OT1H 3SDAB 3OB0H 5CZVL 3TEYA 2XQBH 4RAUB 4S1RH 5BRZE 2VC2L 2Z8RA 1WGVA 4EIVA 1S7RA 3PJSA 4C7GA 2PDNA 5CLTA 4YC2C 4MDIA 1M6OB 5GGTL 35C8H 3IN0A 1BGAA 3GMLB 4X6BA 1CLYH 3UNTA 1HZYA 1H7OA 2XY1A 3MLTB 1YNLL 4FQCL 1MLBA 1KFWA 4JS3A 4RPQA 4WZTA 4EOWH 5F3HB 3RA7L 3FCPA 1EJXC 4JFQB 3B0XA 2DY1A 4PEEA 3QFDA 3LBCA 1BYBA 3K0WA 4PRHA 4CILA 2FR4B 2IALA 1TKWA 5DHVH 2TPSA 2R7EB 2G3ZA 3OQ3B 2JEPA 3OBEA 2C1OA 3DRTA 2FH8A 5FO7B 4X4YB 1Q6LA 1RVKA 1NARA 1I8KA 4HUMB 4W88A 2XFGB 4PJEB 4Y5VB 1VRSA 1BQHG 2C1HA 3MDJA 3CUIA 3FVMA 5G4EA 1EXHA 2OT0A 1S9XA 2VDQH 3WMLA 4NAEB 3OJ2C 6ALDA 1FRGH 1I9CB 4DUXA 2XUCA 1E6OH 1U8QB 1NCWH 2DQHL 3BKJH 5ESQB 5EU3A 4R27A 3SCVA 1T3FA 2P8PB 4G7WA 4HYTB 2P45B 4YSTA 2X0KA 4JRYD 4M8RA 5DUPH 5B3JF 1KPRB 2GT9A 1OW0A 1MHCA 5ESVB 3TT1L 4AV0A 4PJ7F 2WW5A 1FG9C 3F05A 5ANHA 1RCXB 3H2FA 3IEAA 4AYID 4TLUA 5CKGA 1J5OL 2VC2H 3BD5A 3VKKA 1TUFA 4L18A 4N6FA 3EOBB 3X12A 3H94A 4LYQA 4NZCA 3SKNB 3WJZA 5I19H 3LBOA 5BOPA 3NL3A 4LASH 3QW9A 4GRLB 1NIBA 4WTZA 5EBAA 3ONCA 5K9JH 2JV6A 3EJPA 2ACRA 3QGAC 3VH8G 1BYNA 8XIMA 1IGWA 3ARWA 2YPVH 1GOOA 3UWUA 3PGDA 3IJLA 2NV1A 2QHAA 1XLGA 3QULB 4LBEA 2WLNA 5SWUA 2YZ1A 4U6VH 2I7SA 4LLYA 4UM9B 4XIMA 2J2ZB 4TUJA 2ED7A 1MDRA 2VGLM 1TEYA 3V7MA 3TW7A 2XV0A 3USZA 4ZQNA 2XWBB 1Y18A 2JF7A 3W7EA 1ZV5A 3PAJA 1W3LA 4XHQA 3L4CA 3FB8A 2PFHA 2HRHA 7FABL 4XN3A 1E9PB 3Q3GB 2OYKA 2EABA 2AJUH 3SDYL 4MMXA 5L6YL 2EDLA 4OD1L 5GHWH 1H5VA 3NEHA 1SJVA 2V5DA 1HE7A 2EDQA 4CCDA 4IPJA 3OHXA 2DQTL 3ZQ9A 1CNEA 1NPUA 1D3CA 2ZKWA 4QI3A 1OF8A 3AJXA 4B91A 1LEKA 1E9IA 4L5ZA 3FYIB 4Z1MA 3LQAL 3CVIH 5F4WA 3IXTA 1Q63A 5KJ7E 3DFPA 1PLGH 4L4VD 2X4UB 3DPBB 1DQMH 3BSHA 4TULH 3VWKC 3AUVA 5JR1L 1IL1B 4WWOA 3MOQA 4JMNA 2OR7A 5KS9A 4F27A 5K7JA 2OEMA 1JPSL 4ZAKC 1RFDH 1TV8A 2VDML 1Q1PA 3A4DA 2C8NA 1B2RA 3G5WA 1BQHB 2PB1A 2YXWA 1TTPA 2ZWLT 4FFWD 3GI9H 4JY4B 3B2DC 1K6AA 2VEIA 4P5RA 2H32B 4IDLA 2DRUA 5IREA 1D6VL 2NNAB 2LR4A 4UB9A 4FQHB 5A3HA 1CTOA 3WN5C 5T5NG 2DEUA 3LK6A 3M0KA 3IMUA 5J06A 1QMUA 1W80A 2BTMA 1AMKA 3AYRA 4MJID 4KWVA 4GG6B 4PRBA 5FUCC 3D26A 3ETBF 5FHBL 4H9UA 1BBJA 2WIIA 4OT7A 2GJ6A 4D6IA 1MFAH 4WI7A 2IFFH 1HOCA 1IEAB 2Y2TA 4XBSA 3C8HA 1VCFA 3TH3T 1O5XA 4HNLA 5I1KH 2JB6A 2IOMA 1CGUA 2F4NA 1UACL 2Y7LA 2C77A 1R3HB 2ATKA 4U6HA 3FN0L 4U33A 4LCWB 2O9PA 1FGNL 2ZUMA 3H23A 1S9VA 4I0CC 4D7PA 1E0WA 1EEZB 1J5TA 4V33A 4UFHA 4WQOA 5J7CC 3OKXA 4OIIH 3HG2A 2C79A 2I9LA 4MAUH 4IIQA 4UB0L 4Y2OB 5JORA 3WMCA 2A3TA 1FCUA 2CJTA 2RBLA 3LKRB 3EHBC 3EO0B 1J8HA 1CICA 1FA2A 1QBAA 3FQWA 4D6GA 1MCIA 4QS5A 1G0CA 1WZ1H 5HI3D 1YMME 5E95B 1FWJC 1MPAL 4PC3A 3GY1A 4LYRA 4B7IA 4B3VA 2BG5A 3RFAA 3I50L 4RFOH 2YD9A 3AUJA 2XRAH 4LALA 3QMTA 3BESR 1L0YA 4A1RA 4TU1A 3PBVA 3RIAK 1J0IA 1UZ6E 4HX1A 3ZBMA 1IGMH 1W8GA 2DZVA 4WTWA 5D5MA 5KMYA 2VNHA 3ULUL 2PMQA 3MLVL 3ONYA 1KJ2H 3QNYB 5KVFE 5H59A 2ODHA 2YXMA 3QEGH 4MMZB 3LQMA 2AEQL 4ORZC 3IETB 2XDFA 3DGRA 1T7ZA 1W2BB 3VGDA 4AHOA 3PWNB 3C2YA 2LVEA 5K4XA 1TA3A 4O02L 5I1GH 2QYGA 1HIZA 1U1UA 3TJXA 1M7IA 1K8XA 2AQ2A 2YW3A 3IUIA 3QQ0A 3W1ZA 1MUWA 1X1ZA 2YYUA 1C8VA 4Z3JA 2Q6IA 4I87A 1E5NA 1EJ7L 3DYMA 2FX8L 3G5VB 3CC5B 3NCBB 2F7OA 4AYFB 2IPJA 4LAZA 4H20H 2WC7A 4TLTA 4LVEA 2GEEA 1EFZA 1QWUA 2BXYA 2K78A 2ALAA 1KTBA 5IMKA 1J9TA 4JRWA 4F9PA 3WQ8A 5IDZA 4GW5B 8FABB 3KP1A 1JZJA 2E7MA 3W76A 2IAMA 1ZSXA 1S7SA 2AJZA 3U6XS 1CD1B 4KV5E 3W2LA 1T21A 4XBEH 1A02N 1M7IB 1PD1A 3E0WA 4UUJA 4QR6A 5D9SB 2Y7GA 1S4IA 1OCOB 1U93A 5JBDA 4D8ZA 4L0PB 4U1HB 1TZHA 4YCPA 2Y5EA 4I0PC 5JW4R 1ZTXE 2XOTA 2PETA 1HJXA 1XVSA 3CUJA 1MEXL 2XT1B 4RFNB 3AB0C 3NA9H 2Q6WB 4PRPB 5FYKH 1EJVC 4KDTA 1ZHLA 5BOFA 2GUBA 3CAVA 2NW3B 4P5TD 1AY1H 4ZW8A 3LN5A 1ODUA 4G43B 3PJTA 1UR8A 4RDWA 4PB9L 3R58A 2HXTA 3RPIB 1OGAA 2BNUB 3QS3A 4U1NA 1QFUL 3IDIA 3U1SL 1F6PA 3EX6A 4EX4A 1MY7A 3SQBA 4RK8A 4FK8A 4H1LA 4HC1A 5FCZA 4IHOA 4LP4A 2VUNA 3CZFA 1XDJA 3CFKB 2X7WA 3INPA 1NCIA 4G8GA 5DQPA 3SSZA 5FECB 1XXDC 2L7EA 4TT3A 1XIJA 3MV9B 3CCMB 1GOHA 5JOEA 3VD2A 4F58H 1GS7A 2P8LA 4PHXA 3PTKA 4KTYA 1MI5D 5CJOL 1P5UA 4H8NA 4HKZB 4ZO6A 4MY1A 4WCJA 4DPPA 3N85H 4OCRH 5TDPB 1ZGLB 4WI0B 2NY4C 3CVBA 4FHKA 4QRPE 1S7VA 2Y89A 1JPGA 3NGJA 5HHQB 3GDRA 3RTLA 2NLYA 5EH1A 4QQ3A 3FUEA 4Y4HC 2E86A 4X7CA 4AXWA 1S3KL 3GT6A 4QE4A 4XRCA 1GOKA 4UNKA 3FZUD 4RNRB 2X1SA 1DJGA 4YNYA 5C9JB 4P6YA 2VDOL 1IT9L 1D3GA 2G0LA 5DD1H 2DUXA 5I18L 1XLFA 2HT3C 4I13B 3BSMA 4KQ3L 4AQ8C 4OY9A 1QKZH 2AKRA 3GSOA 1TZ7A 3VU2A 5FAJA 2CK2A 2BM3A 1LL4A 2VR4A 3VNVA 1WDQA 3CJJA 4N3NA 2Z26A 3OGVA 2VYOA 4YDVA 1PD6A 4RUBA 3LHPH 4UQIM 2K4WA 2KYIA 1A3XA 1HKMA 2N7SA 1GS8A 4G9FB 2A77L 4ES8A 4BH8B 1RZJL 1OD8A 4DNRB 2NYYD 4FQQA 1ZSDA 2DYSB 4KQ4H 1DWFM 4YLWA 4XO8A 4KPHL 1JNNH 3D0LA 1W1IE 3L3HA 3OKKB 3BOLA 3SIKA 4FXGA 1B54A 3TM6A 3H8NA