3BC9A

Alpha-amylase b in complex with acarbose
Total Genus 200
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
200
sequence length
585
structure length
585
Chain Sequence
SLFLIESEPSTGASVSKNLTEIILIFSNDINKVSQLALTDLITDSDIQGIDYNIEGNKVIINNFSLEPTCNYRLSYEVIDIYDNHLQGYIEFLVNQSNYPQIPDQEVNHTILQAFYWEMNTGEYATEHPEEANLWNLLAERAPELAEAGFTAVWLPPANKGMAGIHDVGYGTYDLWDLGEFDQKGTVRTKYGTKGELENAIDALHNNDIKVYFDAVLNHRMGADYAETVLLDENSRDKPGQYIKAWTGFNFPGRNGEYSNFTWNGQCFDGTDWDDYSKESGKYLFDEKSWDWTYNWDEDYLMGADVDYENEAVQNDVIDWGQWIINNIDFDGFRLDAVKHIDYRFIDKWMSAVQNSSNRDVFFVGEAWVEDVDDLKGFLDTVGNPDLRVFDFPLRSFFVDMLNGAYMADLRNAGLVNSPGYENRAVTFVDNHDTDRDEGSYTVSIYSRKYQAYAYILTRAEGVPTVYWKDYYIWEMKEGLDKLLTARRYYAYGPGYEVDNNDADIYSYVRSGFPDVAGDGLVLMISDGTSGNVAGKWINSRQPDTEFYDLTGHIKEHVTTDSEGYGNFKVIKSEDKGWSIWVPVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Polyextremophilic alpha-Amylase AmyB from Halothermothrix orenii: Details of a Productive Enzyme-Substrate Complex and an N Domain with a Role in Binding Raw Starch
pubmed doi rcsb
molecule keywords Alpha amylase, catalytic region
molecule tags Hydrolase
source organism Halothermothrix orenii
total genus 200
structure length 585
sequence length 585
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3bc9A03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bc9A04
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3bc9A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bc9A02
3LRMA 1HXKA 4D72A 2OWWA 4AZCA 1M04A 3KEHA 4S3JA 3RO8A 1O6TA 2YDSA 1HL9A 2CBJA 4D6FA 3M6DA 2RGLA 3AYRA 3WH9A 1LF1A 1XEUA 3VGFA 3EJUA 1HIZA 2EPOA 4AD0A 5A6AA 4MB3A 2PI6A 1IV8A 1C8XA 2XN0A 3BAWA 3D5HA 2X09A 2XFYA 3CUJA 4IISA 3T2PA 3ZIZA 1PX3A 1ZB5A 2A3CA 1E4MM 1W9DM 4MJ4A 1BYCA 1FFRA 3ZT5A 2DSZA 3VILA 1XC6A 4ZXLA 3ZR6A 5HDRA 3W25A 2WBGA 1KGWA 4UFKA 3AQUA 3CUHA 1Q6CA 3EJTA 4UQBA 3UG3A 2J77A 2J78A 2VUYA 3K8KA 4B9ZA 3F5JA 4OKDA 3BAKA 2WXDM 3ZSSA 1YHTA 3F5LA 1XSIA 3TTSA 1HL8A 3ARVA 3VMNA 1JD7A 4PUEA 4GZJA 1K9EA 1DWJM 2DEPA 3VX1A 2J7EA 3AHXA 4BQ2A 3CZJA 3N18A 5E6YA 2YFOA 3PHAA 1PAMA 3CTTA 3WNPA 5BXPA 5JBFA 2A3BA 4CN4A 3VD4A 1R46A 3VNYA 3BGAA 2AAAA 1J0HA 2DPEA 1QVBA 4HTYA 1TUXA 2UY5A 5CG0A 5AYBA 2QLYA 2E8YA 4TX6A 4JKKA 3WFLA 4P8UA 3AIUA 3AIEA 4CD6A 1V3KA 1KTBA 3AOFA 4TXEA 3DYOA 3I3BA 3WD0A 1WDQA 2C8NA 5E0FA 1TVNA 1GQJA 3SEPA 3QHMA 4FNSA 2EPLX 3CUGA 1K9DA 4GINA 3AZSA 1BQCA 3WNOA 2OW6A 2XVLA 2ZWZA 3WY2A 3IANA 3OZPA 1W3HA 4FNPA 1O6IA 1QWNA 3DHPA 1J9YA 2WBKA 3T08A 3VIIA 1QW8A 2ZUTA 1KBBA 2JFEX 4W8AA 3SURA 1LG1A 3GZAA 4HPHA 3WD4A 3MUY1 4W89A 5EB8A 4AIUA 1ZJAA 1JFXA 1TQSA 3ZJ8A 5IFTA 4KWUA 3PZVA 1E6RA 1US2A 3DYPA 4AD1A 4AEEA 4CVWA 2ZX6A 5DMYA 2BVTA 4W85A 2W5FA 2IGTA 4OJYA 3WMBA 1EHAA 1XYFA 3WF3A 1VFFA 1DWHM 2VZSA 1UG6A 4DWSB 1VRXA 4MTVA 3UG4A 1E40A 1JYXA 1V3HA 5BXRA 4GO9A 3OLGA 1X6NA 4AYSA 6A3HA 2CPUA 1GOQA 3DX4A 3MS8A 4JHZA 1Q6FA 4RL3A 1I75A 4HOWA 1KCKA 1FHLA 1BGGA 4Q7NA 3U57A 1JYVA 5E09A 3W24A 1JZ3A 4XV0A 4FNTA 4OZOA 1GOIA 1TQUA 4QAWA 3K8MA 2VCCA 5CPQA 2XPKA 3CZGA 2W91A 5I0DA 3DYMA 4H7VA 1BPLA 2YDRA 1JYNA 2XUCA 1E5NA 1B3VA 4UQEA 3ZT7A 3L2LA 4P7RA 1E71M 3HG5A 3G6LA 1W32A 4CD4A 3GH5A 4AIEA 1FOBA 3SCRA 3AROA 3LX9A 2J74A 5DF0A 3WY4A 1C90A 4AW7A 2WHJA 3A4WA 5JBDA 2DIJA 2EO7A 3EDKA 3BLBA 5I77A 4KGLA 1DEDA 1VEOA 2X2JA 1WPCA 4BQ5A 2ZUSA 1UYQA 1NOFA 2WHLA 3K4DA 2CHOA 1FH9A 2ZX7A 3HU7A 3WUFA 1KWKA 1HVXA 1QNQA 1BVZA 4DM2A 2Y24A 3FHQA 3VD5A 3AS3A 4NF7A 2XG9A 3NSMA 3SCTA 5CLWA 1EOMA 4GQRA 1ZS2A 3FXYA 1M9SA 4MB1A 1LL4A 3IJ9A 2VVNA 2FE0A 4LPCA 3AIRA 3II1A 5M3WA 4PTXA 2O92A 4LX4A 4KRUA 1MXDA 1VEMA 1B3XA 3GNPA 1DHKA 1ODZA 2WHMA 5JUVA 2PC8A 1XGZA 3NDZA 1WKYA 2D24A 1E6SM 4UQDA 5HNNA 3WIJA 3L4YA 3AI0A 5ABFB 4MNMA 3MI6A 1KFWA 4MJ2A 1BHGA 2VCAA 4W5UA 4W87A 3VSUA 1OB0A 1CZ1A 2CBIA 4MAVA 4PMVA 4PTMA 3RPMA 2WVVA 4ZEPA 5EFFA 3S5ZA 1HJVA 1JZ4A 2ZWYA 4EAMA 4WK9A 1XYZA 3GBEA 4M1RA 1ISWA 1C92A 1XSKA 3VSTA 1HKIA 4J3VA 1VJSA 1CGYA 1J0KA 2VC9A 3SUVA 4HPGA 4J7RA 4HMDA 3OLDA 2DT2A 1CXIA 3OG2A 4PMDA 3D4YA 4PBGA 1KCLA 4AMWA 3QHNA 3T0AA 4OOZA 1JL8A 5FIPA 5M5DA 3K1DA 2WW5A 3M46A 4P8VA 3CHDA 3N15A 4BQ4A 1D2KA 4LXFA 1GOWA 4H8HA 3VVGA 2YBTA 1ZL1A 2XFRA 4BQ3A 5BROA 2WMHA 4MADA 5HOSA 2DT3A 1TVPA 2X2YA 5LA2A 3VIJA 3GXFA 1A47A 4W7VA 4UNIA 1F4HA 2A3AA 4UOZA 5BCAA 1GOMA 2BV9A 1DWIM 1LL7A 3PTMA 1H09A 1MXGA 3VUPA 3IAPA 1HJUA 2D1ZA 2WMGA 3N11A 2GDUA 3BLKA 4CKQA 4U31A 3JUGA 4IPNB 4V27A 3EDDA 1CGUA 3SCVA 4ATDA 4MNKA 3LPPA 3PZUA 3KLKA 3D3AA 1EO7A 1V03A 2J25A 4WSJA 2WC4A 1E3XA 1MQQA 4BCEA 3A6OA 4M80A 1H0GA 1G01A 3AHVA 2ZUWA 1Y7VA 1MWOA 4WIWA 5DEZA 3ARSA 2D3NA 2OSXA 3VTRA 4Z2KA 4PMRA 1Z32X 3HJEA 4HOZA 2VQUA 2VRJA 1H3GA 3BZ5A 5A2CA 2EPNA 1MW1A 2X2IA 5CSUA 2OMYA 1OSEA 4JKLA 3BUPA 2OMVA 5BWFA 1L0PA 4JAWA 3OGVA 4V2XA 1V3LA 5D9MA 2DGAA 3BUBA 2FHCA 4H2CA 2XIBA 1B1YA 4CCCA 2YL8A 3FAXA 1E0VA 4C7GA 3CGTA 1V3MA 3SUWA 1QBBA 4U2ZA 1YQ2A 3OLEA 1TA3B 2X0HA 1Q6DA 1TR1A 4PSRA 5BRQA 3WN6A 4PTWA 1QI5A 1W1VA 2OMWA 2OLHA 1GHRA 3PZNA 4CU8A 4QP0A 1OGSA 3VIHA 1JXKA 1XCWA 3EDJA 3H54A 4H04A 4D6EA 2F61A 2DIEA 4L4OA 4FMVA 2BY3A 3VO0A 1RD6A 2E3ZA 3AIBA 3VD9A 2WPGA 3CHCA 2QF8A 1JIBA 3LRKA 1UZ4A 1UD3A 3WMSA 2OSYA 1NOWA 3SCNA 2WKLA 3WMCA 2FHBA 4U3AA 3AS2A 3GM8A 1GUVA 5ABHA 3VU2A 4W86A 3NUKA 1G5AA 2VOTA 1JDDA 2X1IA 4MDOA 4J3TA 1E55A 1QPKA 3VIGA 2AMGA 2BHUA 3A24A 3CZSA 2OMXA 2GK1B 1AVAA 4HZ8A 4FLOA 1GQIA 3U7VA 1G9HA 3SCSA 4PMOA 2EXOA 1D3CA 4UFJA 2WSPA 1V3IA 4W84A 1CDGA 8CGTA 1EH9A 3VIKA 1V0LA 2JEPA 2HVMA 4GI8A 1IT0A 4J27A 2ZUVA 1PS3A 2WCGA 2FH6A 1W91A 3ZR5A 3KLLA 3LRLA 3LXAA 3UCQA 2GJPA 4RE3A 2J7GA 4PCTA 3IK2A 3AS1A 3D52A 3BMWA 1C7SA 1ISVA 1WCGA 4UFMA 4OBSA 1V08A 3MU7A 4CVUA 1JI1A 3SUTA 3FN9A 2WVTA 1WDRA 2OYMA 2WCSA 1BFNA 2Y8KA 1NM9A 3VMPA 1WNOA 2F7QA 4MDPA 1UR0A 4JHOA 2HISA 5A6SA 1WP6A 1CXHA 2VRKA 4TTUA 1NM4A 2D23A 3EMCA 4AZIA 1SZNA 2VQTA 3NJ3A 2YA2A 4Q22A 1EXPA 3U5UA 4D6IA 1JZ7A 2W62A 4PMUA 4U33A 4PMYA 3AMLA 1XD0A 1SMAA 2VNCA 1NARA 5D8ZA 1ZBVA 4AZ6A 3CZLA 2XGBA 3GXMA 3WDQA 3ZJKA 1UWUA 5HXMA 3L2MA 1BYBA 1UWTA 2DT1A 1LYQA 4JFVA 1EHNA 4ZENA 4ZXOA 1KQYA 1GOOA 1UR8A 1RP8A 4HMEA 3B8SA 1GOKA 3KL5A 4ZE4A 3AXIA 1V0MA 2YL9A 3CBWA 3WD2A 2F7RA 3PZTA 1LJYA 3DX0A 2YFNA 2C7FA 2F1AA 3CZKA 1KWGA 1E56A 4AZHA 5M17A 5A6KA 1XCXA 4DWSD 1O7DC 3BSGA 1VBRA 3HN3A 5GQBA 1XRVA 3B9DA 2WANA 1BYAA 3ARQA 4HOXA 3N17A 3BH4A 3A21A 1EDTA 4PUDA 5GNYA 3WQ5A 1VAHA 2C0HA 2Y2WA 3L4TA 4IM4A 1V6XA 2J79A 3WD1A 2GJXB 5HPCA 2WVSA 1QW9A 4WLCA 3GDBA 2VZOA 5C8BB 4M82A 1TCMA 2WMKA 3HMCA 3CMJA 4QDMA 3BAIA 2XSAA 5AC4A 1K6AA 2V3FA 2CITA 4GPNA 1UKOA 3WEMA 2OYLA 1B9ZA 3EJQA 3BVVA 2E8ZA 3ALGA 1UOKA 3WY1A 3MMWA 3A47A 4UFIA 4PRWA 1EDGA 2CKSA 1CGXA 4W5ZA 1JAEA 3N12A 2GVYA 7A3HA 1UH2A 3KE0A 2QHAA 2VX5A 2G3JA 1EGZA 4UQCA 2VJXA 2ZXQA 2ZX8A 4URIA 2W61A 4D6HA 2EJ1A 5ABFA 2BHZA 1NP0A 2WHKA 4EANA 4IUGA 3UERA 1QOXA 3ZJ6A 3O9NA 1R7AA 2C9QA 3E1F1 3TTOA 4D1JA 2UY3A 4F8XA 1CTNA 2BY1A 2WSKA 4M8UA 4LYRA 2WZEA 3WY3A 2YL5A 1QHPA 5C70A 2ZOXA 5A6JA 2WC7A 2JF7A 1J18A 3VGHA 1W1PA 3ZT6A 5CZKA 4NZFA 5CGMA 3EJRA 1LQ0A 5FL1A 1KGXA 3GXDA 1AMYA 2XYLA 4JFSA 3IAQA 4WF7A 1QWUA 2WMIA 4GI6A 3VKKA 4E8DA 4Z2JA 3AJ7A 2YOCA 2WMJA 1GPFA 1QI0A 4AWEA 2ZUNA 3CUFA 3UR7A 2G8ZA 2WWDA 1FFQA 3B9AA 4DUVA 3VINA 1E0XA 2CEQA 2QPUA 3SCPA 3PZIA 4CD7A 2WC3A 4NXKA 2G41A 4FLQA 4FNQA 4AYGA 3EDFA 4WJXA 1MYRA 4NZJA 5LA0A 1BG9A 1NWSA 3PZQA 4ZFMA 3MV11 3BAJA 2CIPA 1HJSA 5IXEA 2WYSA 4NI3A 2C9PA 3WUEA 3B9EA 3GTNA 1CGVA 3WDPP 2Q8XA 3TP4A 4AZ5A 2YDQA 1CWYA 4H8VA 4PSPA 1OBAA 3NSNA 3VGBA 5CGTA 2WMFA 2YL6A 4ATLA 4HA3A 1PZ2A 1JZ6A 2PB1A 1HF6A 3RDKA 2VT0A 2Z1KA 1OGGA 4DO4A 2DQXA 2PWHA 4FF5A 1O6SA 1ZBCA 1EQCA 1W3LA 1EIBA 1QNPA 4OUEA 1C3FA 1HJXA 3ZO9A 3WDHA 1MFUA 4J28A 4H8UA 5M03A 5IDIA 3MMUA 2EPMX 3KWXA 1WB0A 1E4IA 2CERA 5I79A 4TUFA 4U2YA 3T09A 3SCOA 2DDXA 3OA5A 3OBAA 4V28A 4AW4A 4D6DA 2D73A 3D51A 1TA3A 5FCZA 1PIFA 5TD4A 3AZTA 3W81A 4JL2A 2PWEA 5JBEA 4HU0A 1MW2A 1JG9A 1U30A 2VURA 3WQ4A 3T2OA 3WEZA 5AYIA 3RMEA 4GKLA 1JDCA 1QHOA 3O2LA 5D9PA 3W28A 2DSVA 1H11A 3TV8A 4JFWA 1MQRA 3OGRA 4KH2A 2ESCA 2PWFA 3WF4A 5I3DA 2W63A 1CGTA 3RCNA 1KXTA 1EO5A 3W53A 4J3XA 1HP5A 2WAGA 1MVYA 2W92A 3LPGA 3L4WA 4AMXA 2X8RA 4WSKA 2F8QA 4W7WA 4UOJA 2VX6A 1R33A 1HWWA 3KL0A 1E6XM 2Z1SA 1AQHA 2E0PA 6CGTA 1EDQA 3QGVA 1MW3A 1M42A 5CQ1A 3N9KA 1NWTA 1SMDA 1O6VA 4S3KA 4P7NA 2GK1A 3BCFA 4MPKA 3MUAA 2DSWA 5E9AA 2WCAA 3WDRA 2F18A 4B16A 1B3ZA 1GVIA 3ZQ9A 1HVQA 1CENA 1S46A 3LPOA 2J8GA 1CXLA 1D7FA 1ITXA 4TVUA 3OB8A 4KMQA 4NZCA 2NW0A 1IZKA 1PX8A 4OOUA 3VDBA 1C7TA 3M7SA 4UR9A 2O9PA 4J3UA 3ALFA 1B2YA 2PWDA 1H4PA 5LYRA 4B3LA 2XVGA 1QI4A 4AC1X 3N04A 1T0OA 1LLOA 3WH6A 2J7HA 3BCDA 1R8LA 2W67A 3WF1A 3ZM8A 1CXFA 2YLAA 1E0WA 4A3YA 6TAAA 3HG4A 1M7XA 1PZ3A 4Y7EA 3T2QA 1OGBA 3BVTA 1LWJA 1E73M 4LYQA 3VX0A 1Q6GA 2X0YA 2YBUA 5F7UA 5FD0A 3WNLA 1E4LA 1ODUA 5EMYA 1JAKA 1WZMA 3J7HA 3F4VA 5D8WA 1UKPA 1VEPA 3AHYA 3WUGA 3UEQA 1B3WA 2ZXBA 2AOSA 3SUUA 1VFUA 2F2HA 3DX3A 1PIGA 1JD9A 1HJWA 4ACZB 5BRPA 4CCDA 3POHA 4GXPA 4WKHA 4TVDA 1C93A 4D6JA 3VIFA 3EYPA 1UH4A 3MKKA 2VCBA 1W1YA 1W3JA 1HP4A 4TVCA 5A8QA 2DH3A 4W7UA 3WNKA 4YHGA 3MV01 1H6TA 1VFMA 4GO8A 2W66A 5ICUA 4TX8A 2D0HA 2C9RA 2BXYA 1HTYA 5E1QA 3TTYA 4MB4A 5CSYA 3CZ8A 3A5VA 1GHSA 4GZEA 1M01A 4OGZA 3W26A 3WF2A 2IXVA 3CHFA 4KGJA 3RJXA 1WDSA 2EPKX 3WQ8A 4XX6A 2GFTA 3A22A 2D20A 2GJXA 1UQYA 4XZBA 1KBKA 1TMQA 1BLIA 4B3KA 1E6ZA 3SIMA 4GIAA 3DX2A 3DC0A 3WQWA 5A2BA 4C7FA 4TTGA 3PN8A 4OBRA 3CUIA 4FNUA 4JZ5A 2EQDA 1GORA 5FOOA 4BF7A 3PTKA 1UD8A 4JIEA 2G3IA 5HBFA 1FP9A 2E9LA 3K4AA 4UFHA 3GXIA 3ARUA 2XFFA 2WQXA 3T0DA 2JIWA 2JIEA 2DSKA 5D4YA 5A95A 5CPTA 1KXHA 1E3ZA 4DO5A 3L4UA 4W8BA 1HKJA 1ECEA 3VM5A 1H6UA 3W27A 4R5EA 4XB3A 1VBUA 1UHVA 1PJ9A 2WQVA 3VIPA 3APGA 2ZUMA 4F66A 2WKGA 2F7OA 4QCFA 1NQ6A 2XWDA 1HKMA 5D9NA 4AISA 4LGXA 3NYDA 1AQ0A 3WDJA 5I6SA 2XN2A 3FW6A 3AIVA 5A94A 4UQAA 1E4NA 4PMNA 3AHZA 2ZICA 3RJYA 1CYGA 1QI3A 5KEZA 2J7DA 4Z2HA 3A4XA 3F5KA 3ZJ7A 2EADA 1UD5A 1M03A 1MW0A 1ZBKA 2BNJA 4PCSA 1DTUA 1NWUA 3WNNA 2F1BA 4UCFA 1OIMA 2XVNA 3WH7A 5A8MA 3GXTA 3W6LA 1J0YA 4OIFA 4ML4A 2WVVB 4AZGA 3W38A 2J62A 5BXSA 1V6YA 3GNRA 1JXJA 3AISA 3HG2A 1B3YA 1XH1A 3PZOA 2Y5QA 1SFSA 4DO6A 1NWRA 1BYDA 3PZGA 1PX4A 2XVKA 2YA1A 1DWGM 3CPUA 1H2JA 2XHYA 3W82A 1L8NA 3THCA 4CUCA 4NRRA 3BUDA 1P6WA 4B9YA 3PBGA 4PMQA 2Y5EA 1AQMA 2CYGA 3VD3A 1E43A 1N82A 5A69A 1W2PA 1JDAA 3N13A 2J4GA 1UA3A 1MFVA 2UZYA 5A8NA 3CLWA 1LG2A 4FNRA 4QLLA 4WKFA 2WZIA 4DWSA 3RILA 3ARRA 4HZ6A 1BVNP 1J0IA 1CECA 4DWSC 3BSHA 2OMTA 2UZXA 4N0RA 3BAXA 1WZKA 3WQ6A 3GXNA 5I2UA 3WH5A 1HXJA 4CU6A 5IFPA 4MAZA 2OYKA 3WDIA 1OINA 2WK2A 2V3DA 2XJ7A 1V02A 2GUYA 1ITCA 4WKAA 3WBAA 2VTFA 1TQWA 4E4PA 1XHGA 4RE2A 1EA9C 4UZUA 2WLYA 4CU7A 3D50A 5KZ6A 2VZTA 3KZSA 2IUZA 1JZ5A 1PPIA 2ZXAA 2O9TA 3WSUA 4QLJA 2ZXDA 3POCA 2NSXA 2XM2A 3SCWA 1UKSA 4ACYA 5LA1A 3VDCA 4B15A 1J0ZA 4P8XA 1SR0A 5E6ZA 2VR5A 2TAAA 2BHYA 2J8FA 3FHAA 4W88A 2JF6A 2V38A 2CHNA 3WD3A 8A3HA 1E6QM 1CLVA 3WBEA 1DP0A 1W1TA 1W9VA 5JIPA 4Z2IA 3S6TA 4JL1A 1BF2A 2GDVA 3FNDA 2J75A 1B90A 4P7QA 3VMOA 5IHSA 4DM1A 4R27A 1XH0A 4AQ1A 1W9PA 2YLLA 1OT4A 1V6WA 5AY7A 1K9FA 1ISYA 1E72M 3N1AA 3VD7A 1SYTA 5EFDA 3WKZA 3ZOAA 4NX0A 1V6UA 1UD4A 3W6MA 1QNSA 1JNDA 2CETA 1JF5A 1QNOA 1ESWA 3UESA 2CCRA 1R87A 3DHUA 4PMXA 1B31A 2D22A 4E2OA 3BVXA 1CBGA 2V3GA 3FY1A 3EDEA 3OIHA 2BVDA 4UQ9A 4JFUA 3W37A 3DDGA 4NXSA 1C8QA 1ISXA 3LPFA 2CXGA 1UWIA 2VZUA 1C91A 4U5KA 4W8LA 1V3JA 1US3A 1OM0A 1RH9A 1OWQA 4P7OA 1KTCA 4A4AA 3EMQA 1HNYA 3MUIA 1KB3A 2J7CA 5GNXA 3WELA 1BTCA 4M24A 2JALA 5I78A 3KL3A 2CBUA 3M07A 2NT1A 3QOKA 2XGIA 1TG7A 3WNMA 2XTKA 4HZ7A 1QBAA 3NIYA 1ZJBA 3ZSTA 3W0KA 2CBVA 2OWXA 2FGLA 2J7FA 3AMGA 5A2AA 3VGEA 1TQTA 1QI2A 4L4PA 4DUWA 2WLZA 4UFLA 1OIFA 2QPSA 1UR4A 2WB5A 2F7PA 1KR0A 3EBVA 2FH8A 1OD0A 4U3CA 2D3LA 4AD2A 2EACA 3TONA 1H41A 1GNXA 4P8WA 5C71A 2MANA 5JIWA 4AZBA 4HA1A 2QV4A 3GNOA 2ZX5A 1BAGA 2A3HA 1XSJA 3L4XA 3BMVA 3AMCA 2DSUA 1UKTA 1K9TA 1J01A 3TTQA 1IX2A 1G0CA 4ACZA 3GH7A 4UOQA 4JCMA 2DH2A 1M53A 2YJQA 3BC9A 3S2CA 1OCQA 4PN2A 4C7DA 4J3SA 4CILA 4AMCA 5A6LA 1JNEA 4ZE5A 2UWFA 3GBDA 1GZJA 2BVYA 1U2YA 3VOCA 1WAWA 2D2OA 4CC4A 4FLSA 4UTFA 3W29A 3CZNA 1CLXA 4CC4C 3GH4A 2V5CA 4X9YA 1V0KA 1WDPA 1GCYA 1PBGA 4AY1A 1GJUA 2Y8VA 5FKYA 4CN1A 4JCLA 4AD3A 2BY0A 2DT0A 3PTQA 2VRQA 1JF6A 7TAAA 2EAEA 3S5YA 1JYWA 3ARTA 3EJSA 2BS9A 2A3EA 2FYVA 3DDFA 1A3HA 1UZ1A 5AC5A 1KR1A 1B30A 7CGTA 3RM8A 1UR9A 4HP5A 2ZIDA 1BGAA 1UWRA 4AD4A 3I3EA 3L4VA 1UR1A 4AZCB 2J7BA 3D4ZA 1BG4A 4P7LA 1R7OA 4A3HA 1NP2A 2E4TA 1F4AA 1C8YA 2OMUA 3VSVA 5BYWA 2VX4A 2ZE0A 3ARZA 1CIUA 5IHRA 4F9JA 4AD5A 3VGDA 1GVYA 3VGGA 4PYSA 3UETA 1OT2A 1GQLA 3L4ZA 3UR8A 5GNZA 3WENA 4CCEA 1EQPA 4PTVA 3TA9A 2G4FA 4IPLA 5HPOA 2E9MA 4HU8A 4M81A 5CJ5A 3BVWA 3IJ8A 1WE5A 1OT1A 2VZVA 1GONA 1PEZA 3VPLA 2PBOA 1CGWA 1HN1A 3A23A 2X05A 1G94A 5A6MA 2WVUA 2Y4SA 1VB9A 2PWGA 1VJZA 5DO8A 1QHZA 4GI9A 3OGSA 1J0JA 1GJWA 1E6NA 2NT0A 2EBNA 1QX1A 2PF0A 2E9BA 3ECQA 3WFZA 3AICA 2YIHA 5D9OA 1CXKA 3QR3A 2GSJA 1UD2A 4NSBA 4M56A 1UR2A 4JKMA 1RP9A 1H5VA 3O6AA 1GW1A 1TQVA 5DT5A 1VFOA 4F9DA 3MMDA 1VIWA 1R34A 2ZUUA 3AMKA 1J10A 9CGTA 3I3DA 2O9OA 1EOKA 3A3HA 3AS0A 3G6MA 1G1YA 1J11A 3LXBA 3HG3A 2WQWA 2VX7A 2WMIB 2V3EA 1I1XA 1JZ8A 2ZX9A 3QOMA 4J3WA 5BXTA 3RM4A 3WQVA 2IXUA 1CEOA 4AIOA 3CO4A 3K46A 1Q6EA 4YHEA 2FGZA 2BY2A 4D1IA 1HX0A 2JE8A 3NSXA 3ARWA 1H49A 1UD6A 1TFVA 4GZIA 1O7AA 1H1NA 1ZU8A 2VI0A 1KXVA 1W2VA 1R47A 5A3HA 3AMDA 3VM7A 5CXPA 4XUYA 4EE9A 3LMYA 2JEQA 1KQZA 3AYSA 1V6VA 2VVSA 3VNZA 5DT7A 3VIOA 2OMZA 2V5DA 4YN5A 2XM1A 2W4XA 4EK7A 2VO5A 3W4RA 2WWCA 2OW7A 3BUIA 4YPJA 5DFAA 3WUBA 3AZRA 3MUZ1 3CMGA 1R86A 5E0CA 5E70A 3U5YA 3H55A 1BSIA 1X6LA 2VR4A 3WH8A 2YA0A 4RE4A 1XD1A 1B0IA 2YKKA 3MSGA 1JZ2A 2XN1A 4W93A 5CLTA 1CXEA 3CC1A 2RA1A 3LXCA 3FAWA 1BPLB 2BFGA 4NRSA 1E9LA 4MB5A 1UKQA 2D0GA 4UZSA 5FL0A 1UWSA 4Z2LA 3CH9A 5ABGA 4N42A 2EABA 2XIIA 2CESA 3WEOA 1W9UA 2FDMA 5I5RA 3ARPA 4DUXA 5ABEA 2G3NA 2E40A 1UASA 1LWHA 1Q4NX 3CIVA 2CNCA 3BAYA 4GQQA 1RPKA 3CZEA 1NOUA 1UA7A 4MNLA 1UUQA 3IJ7A 2OWCA 2D0FA 1FP8A 1E70M 3BUQA 3BVUA 3T0BA 1WO2A 3EMZA 1IZJA 4AEFA 3ZMRA 1JI2A 1CPUA 2QMJA 1QNRA 3A4AA 4Z2GA 2J47A 1TE1A 1HT6A 4E8CA 4AZ7A 2O9RA 2XWEA 2RGMA 1XH2A 3H53A 3ARXA 2VL4A 3GYCA 4D6CA 2EEXA 3QHOA 3TOPA 2BXZA 3AIWA 5EBAA 5A8OA 1VENA 3GXPA 3SCUA 1X1NA 3RIKA 4F79A 3UG5A 4BS0A 1WZAA 1J12A 4PMZA 2PBGA 1E6PA 5ECUA 2GJRA 1E5JA 3AXXA 1HKKA 4M29A 1H0IA 1UWQA 1FH7A 1TZ7A 1NH6A 4CGTA 4LYPA 1DWFM 4KRTA 3PZMA 1OD8A 4HMCA 5I23A 1E1FA 1KXQA 2WNWA 3DX1A 3AFBA 1LL6A 4D71A 4CD5A 2WQUA 2QMKA 4D6GA 1WZLA 3NDYA 1ZBWA 1W9XA 3WL0A 1R85A 3BXWA 3K8LA 3SCQA 5CPSA 2XSBA 3CV5A 1DWAM 3SUSA 3AHTA 3THDA 1E1EA 1FH8A 3OLIA 4QFUA 3MO4A 4X0VA 3U7BA 2WM0A 1JGIA 1KGUA 2VMFA 1W9BM 1U33A 4K68A 4TOQA 3VDHA 5A1AA 3AIQA 5A6BA 2G3MA 1JFHA 4XZWA 4JFTA 1ISZA 1I1WA 5A8PA 4BA0A 3EJPA 3OZOA 3BLPX 2OSWA 4HA4A 4FLRA 4X0NA 5I24A 1UQZA 5GPRA 2UY2A 2FHFA 4EKJA 3AXHA 4MNJA 1E15A 4H41A 3ARYA 3CHEA 1FHDA 4CD8A 1UH3A 4CN6A 3IGUA 2XVPA 3VDAA 4QCEA 4FK9A 4QLKA 1CNVA 1R75A 3NCOA 3PZ9A 2UY4A 1W3KA 2X2HA 1FA2A 2ALWA 3HZ3A 1HJQA 4AXNA 4ATWA 3RM9A 1V0NA 4BZYA 5A6BD 3WL1A 2B31A 3WF0A 1XV8A 3DECA 2CKRA 1MQPA 4LQ1A 1V02E 4PEEA 1GQKA 3MSDA 3VIMA 4U5IA 1VF8A 2WZHA 3MANA
chains in the Genus database with same CATH superfamily
2OG9A 4JR9L 2PE3A 4AZCA 3AWGA 3UCCA 1LO0H 2QZQA 5ABAA 5AHLA 2XY2A 5E08H 3ETTA 3MACL 2E7MA 1M2VB 2A3CA 2V5BA 4MD0A 1XC6A 5LBSH 3GQBA 4I9XA 4HFUH 1TUPA 2VDKH 3VXRA 2GBVA 2WXDM 1ZWIB 5I66B 3VSQA 3HRZC 3UWZA 5CEXA 4D94A 3D0AA 5IBTL 4PWEA 3M7WA 4G8IA 3N44B 3RF9A 2A3BA 3RUGB 3MP4A 3EBAA 1ZANH 4PLOB 1RK5A 4WD0A 5AWNL 2UY5A 2Y2TA 3WTUA 4MD5B 2QLYA 2QCFA 3AIUA 4DYJA 3L5LA 2VLJE 1F3RB 3BG9A 2PDBA 2CR6A 5AAWC 3BANA 4JNYA 4ACBA 1UZ6F 1W3HA 4I90A 3W39B 4ADGA 4JRYE 1KBBA 2CNDA 4XHJC 3CFMA 4ZMTA 3J8F7 4AB4A 1CB7B 5TAOA 1XCQA 1E6RA 2Q7NA 3O6LL 3T4YB 2WXMA 5IEHB 1QWKA 1XYFA 2XZ7A 1GGCH 2IPJA 2DU2A 2AQ1A 3HMWL 5K5YA 3KPPB 4Q9BA 3IIXA 3FCSA 5DMJB 1WORA 1PHWA 1TWZA 4FJZA 1E5BA 4KDTC 3QH2A 1XIBA 3AWFA 1JK9A 4YQXH 1P5VB 1MFEH 4H4NA 1SHWA 2W91A 3UQNA 4H7VA 5KZMA 3VI3E 2CF4A 1U1UA 4KKBC 3ZT7A 4XBEH 4TSBL 5CZXD 3RGTA 5MI0C 4ZO7A 1I82A 4ZSTA 4NP7A 4Q58C 1DEDA 4PTDA 4ZQNA 1KUMA 4FN0A 4IOSD 1RQPA 4XPGL 4Y1SA 2EEAA 3HU7A 1R5VA 3SBRA 3ABSA 1E6JH 4FWTA 1AHWA 5LJYH 3NRQA 3W5VA 1PS9A 2VHLA 2YGOA 3H2MA 1UB5B 3NFNA 4Q7JB 2VE6B 5CZVH 3EYSL 1T5XB 1ZLWH 1E4KA 2OJPA 1NANH 3MRCA 4W87A 4FE9A 3I56B 4AIZB 3VRJA 1CZ1A 2WVVA 1ZV2A 5C0IA 5D1XE 3P54A 4EAMA 2OODA 1SPDA 1U8LA 1BBDH 2H90A 3FS9A 3A67H 3FO2A 2P5NA 5GS3A 3Q6FA 3GU9A 3FYOA 1XL6A 4NN7C 4X7FC 4R96A 5D33A 2HTMA 4YWGL 3V6OE 4DRSA 4P9HH 3D39A 3CSFA 3CU7A 1XHHA 2R9VA 2GAZA 1GOMA 2AL2B 3BZFB 1O5KA 3T1GA 4E0CA 3KOFA 3VFRB 4BFNA 5HR7A 1J9CT 4P3IA 4J39A 1DQJA 4IPNB 3EDDA 2A7NA 3WO3B 3B83A 5J6HB 1A4LA 4WWPA 2OMNA 3DBSA 1MQQA 2OPCA 3ZZUA 4QGTA 3VE0B 5HP5A 2YCLA 1GW9A 5DFVC 3BZGA 3KWWB 1IIGA 1JQVA 3OQ3B 2GVEA 5DANA 3S3BB 4PUKA 5E9DE 3R1GL 1OSEA 3W7LA 4P2QD 1DQDH 1DBAH 5LDSA 5I28A 3HNVL 4FQLL 1SDDA 2XIBA 4C7GA 4GIOA 3BQUC 1JULA 1F74A 3CMEB 3E9UA 4TNVF 2FEDC 1BIHA 4UTWA 3FO1A 2JCWA 4JTJA 4D9RD 2VKZG 1XCWA 3WYZA 3GTHA 3GJFA 3KLHC 3RAJL 1BKHA 2DIEA 3SO3B 4TQTA 2XX1A 2X5PA 4FJYA 4RJLA 4O1FA 2VNIA 4LV4A 1VERA 1MDTA 3SADA 4FQXA 1SO6A 2VOTA 1TYJA 4MDOA 1E55A 4M4RB 1ICPA 3CV1A 2BHUA 4M48L 3IDIB 4V1YA 2PP7A 2YUVA 4Q6YA 3QZEA 1LUCA 2ACQA 4MLJA 1EX0A 4Y16B 1IMHC 2HVMA 3G5VB 4J27A 5SWQB 4C6CA 5E5MA 2YXMA 4O2CA 1G6VK 4ELME 2FPYA 1FJ1A 3VA2C 4QBXA 2O4EA 4C54A 2OVLA 1GTEA 2VFIA 4OBSA 3MU7A 1P5UC 2PPDA 5D38A 3V4PH 3FC8A 3QY8A 2ZRYA 2DZTA 3ZX1A 3O2DL 2DRUA 1C9SA 3CHSA 2LVCA 1ZTVA 1P4CA 1QSFD 1GAWA 1KQSB 4E9QA 3EMCA 4XX5A 5MEOB 1IXQA 4N20A 5F3BA 4LVHB 3A6CH 3V0AC 4KK8C 5DMKB 4ERIA 4QNEA 1ZBVA 5CC6A 5B38A 1QYGH 4DYKA 2JLLA 1RJLB 4BE6A 1ZGLM 4ZENA 4EAEA 4GG6A 2ZRXA 2COVD 4OCXH 1GC1C 4GXVL 4AOFA 3O3DA 3DX0A 5M17A 2CE6A 5FS5A 1K4HA 3F12A 4EDWH 4XWUA 3WK3A 4DJFA 1NJ9B 5KVDE 2NQDA 1A5CA 5FCSH 1NDGA 4UMAA 4U7SA 3S46A 5DEGB 5AYYA 1F3DJ 5C8BB 4KKUA 2OZ0A 3SFWA 4HK6A 4POCA 4YCOA 1U83A 3QNYA 5KSBB 3H7RA 4JTEA 4W5ZA 4LESA 4Z1DA 4UTUA 4MJ6A 2VDNL 4OAWB 2G3JA 4WI7A 5AHFA 3LY6A 4RWHA 1INDH 4LAKA 3THAA 4ALAL 3AUWB 3CVHB 3GIYA 2NXZD 3OO2A 1REQA 4M8UA 2OR9L 35C8H 1QFEA 2V63A 4PJIB 3RWGB 3VGHA 4GW4B 2DLFL 2C3HA 4H1LA 3UPMA 1QWUA 1A9BA 3E7JA 4P1VA 5IW1B 3CUFA 1NFDB 2YXVA 1M65A 2WY3B 5J5DA 3VINA 3MRFB 3BIKA 1G7MB 1BLNA 5B7ZA 3KYMB 3D3VE 4JZJB 2WUBH 5E6IC 3NQEA 3M64A 3S4SG 4UT9L 2I9EA 4JGUA 2E09A 4MD4A 3D2UA 2UZYB 2P80A 4PJFF 3NJFA 1CFSA 2YDQA 5E0KA 4TL4A 4X22A 2WO4A 2EE6A 1IUZA 1A6WH 3KPQB 1D2EA 3VXSB 3HE7B 2NQJA 3RZCB 2HMAA 3VWKC 4LP8A 4G6FB 3DSNB 4DO4A 3V0FA 1J9QA 4X06A 4RETB 4AC2A 2PDXA 3BVDB 4PC8A 3QDHA 2VN4A 1T89A 5F3HB 4XE0A 3SDXA 1R5BA 2OJ1A 4KX8A 2CERA 2IPFA 2JNZA 4ZTYA 2DDXA 2CWNA 3OR7A 5D6DC 3EOTL 3QPYA 5L8KB 4GUHA 1LDPL 4NZ4A 4KJPD 1RLBA 3RPBA 2V5RA 2CWRA 5C07E 1M56B 2WNXA 2NY6D 2UZ9A 3H6AA 1VKXB 4NHVA 1VBGA 5HATA 6XIMA 5K59F 3GSWA 1XGEA 3TYFB 3KWUA 4MNGA 3QA3B 1ZRQA 1GKQA 1U8CB 4CSSA 5JLZB 4UOJA 1R33A 1XAKA 5D2NB 1TRIA 4OLYH 4LLQB 3QUYB 5CHNB 3CFBB 3KYOA 4HYWA 4KJYA 5I19H 3GU1A 2K70A 4WSHA 1Y1DA 1S78C 3EOBB 4HWBL 1MRAA 5J13C 1N6UA 1T0OA 3TSMA 5D1QB 1R3HB 3UMTA 3FO0L 5FYLD 5EFIB 3ZM8A 1Q82D 4ZCWA 4MFEA 4OZFA 1I2NA 2WYZA 3RUGF 4I7WA 5IYNA 4LYQA 2DM3A 5EMYA 1EGMA 5IKCA 2DQTH 3NCWA 2MPAH 3BESR 3AHYA 3RL2A 2JGQA 1E9ZB 3DX3A 1KRMA 1EMTL 1MUWA 4PJ8D 2F19H 1K7XA 5IW6A 5CCJA 1W72H 4MRCA 4DY1A 1W1YA 1RUKL 1W3JA 2Q8AL 3FUEA 4XN1A 1U2HA 5T8GA 2VGIA 4JREC 3O41B 1IGYA 4P2QE 4GO8A 1C5CH 1ZT4A 2BXYA 3RKDD 3TTYA 1LE9A 5REQA 1WBYA 5HTSA 1YN7B 5FV2A 5CIPA 2GFTA 5SWSD 3GLDA 1D8TA 1OXYA 4D9RE 1UEMA 4YAUA 5DJXB 3DX2A 3WE1A 3HNTH 1X5MA 1E65A 3SE8L 2YPLA 3KBFA 4P4KD 3UP1A 2EHHA 4PB5A 3N40F 4JIEA 4GAYB 2PF6A 3SYPA 1H3PL 4W4NA 4AL8L 3AVWA 5CEZD 1D6EA 4YNGA 3H9ZA 3OKMB 4XB3A 1UHVA 1N8RD 3V5OA 3L6FB 4RAUA 4N28A 5DQPA 1V8HA 3ISIX 3L48A 4UAHA 1S7SB 2IQ9H 4PMNA 4O4YL 1PKYA 4HF5L 3FXIC 3A4XA 4YDMA 2EADA 1KN2H 3GG8A 4IKIA 5E5UB 4M7ZC 1MUJA 3WH7A 4WNSA 3M9YA 1KF9B 2WLIB 4M9PA 1HS6A 1OWRM 2OCFD 1SDYA 4DQAA 1I1CA 4YHLL 1QVFB 2G95A 4NQVB 4NO0D 1NWRA 3CN2A 1BYDA 3M47A 1QSFE 2A3LA 4LVAA 3NDYE 5AN7A 1QOKA 1P7KA 3BP4A 2NPFA 2IDSA 2PDLA 5T9CE 4DK6A 2E4FA 4A7SA 2BCMA 3SYCA 4B3XA 3QDGB 1VCAA 3WE6A 4G7FA 1AH4A 3KPSA 2OX1A 1RV6X 2CC0A 3EFOB 2Y07L 5HUOA 1SM3L 1KTRL 1RLWA 1B57A 3GXNA 1I9RH 4YSQA 1HXJA 1EVTC 3W2KA 1ZLPA 1ZY9A 1OY0A 5IB5A 2Z2UA 5HYSA 3PUGA 3JWDH 5E0QA 2H26B 4PR5B 1UWGH 4PC2A 1JZ5A 2O9TA 5C0BD 3SCWA 3MC0A 4XK2A 3VCRA 1NCDH 4P3CL 3GVWA 1WWCA 3CYVA 1H50A 3SJVA 4WI0B 5BQDA 2XFXA 3OTTA 5FGCE 3W0WE 2J75A 4J6RL 4AQ1A 3WIIH 1LP6A 3N19B 4GX8A 1JPSL 2VXQH 3TBTB 2V5MA 1WEJH 1UCBH 4RWYH 3DOSA 4L4VA 3WKMH 4HLEA 5ABDE 1QNOA 3EDEA 3FSZA 4E36A 4OF6A 2ORBH 4IRZL 3FH8A 4EP8C 5IHUL 1LROA 2JJ1A 4L3FA 4LAJH 4HC1L 4V1DB 4P6YA 4E8GA 4MSSA 4WU7B 1JNLL 3XISA 2AJVL 2J1WA 3UTTB 3UZJA 2UX7A 4JM2F 4IQHA 1A49A 1FNAA 4LBUA 2J7FA 5JHLL 3VGEA 4KCUA 3QZOA 3SKOB 3HG1A 5LIWX 4P8WA 1Q6QA 2ZYSA 4AV0A 3HS0B 2LHAA 1FP5A 1OP4A 1TV3A 3RY6C 1MDRA 4GQ9H 1VQPB 1A6PA 3V6ZB 3HCVA 3NPSB 4L8CA 1WISA 5JHMA 3N1GC 5FA6A 4A8RA 1MO0A 1N6VA 1IYXA 1K8AD 3DC8A 4AY1A 3LBOA 1MCOL 1XGPA 1DUYA 5ID0A 3TEVA 2V7HA 3QJFA 3L5MA 1E4WH 5J3OA 4JVWA 3WL9A 4Q6IA 4MASA 3K6NA 2CLRB 4US5D 1YI2B 1S3RA 1J6OA 2JLPA 3SM0A 1P4BH 2V5JA 3U9PL 1M7IA 1F4AA 5JPMA 2OMUA 3IE9A 5EU6B 2ITCB 3I9GH 2YZ8A 4U1KA 3QUZC 5CD3A 4AD5A 4MKSA 4NQDA 4PYSA 4Y19D 2FJFA 1E9QB 4XXCC 2VSMB 4DF9A 3UFIA 4G5ZL 1K85A 4KROD 4PB9H 3FO9B 3C5JA 3GWJA 3LLXA 2OK0L 3L7EA 5JIQA 2J13A 4FOUA 1AYOA 3G04B 1A3XA 2E9GA 2GSIB 1CDUA 4KHTH 1SPQA 4GJ1A 4JO3L 5I8EA 1YRKA 4M4SA 1ZVSB 3N4FA 1M3JA 1OWWA 4KMTH 2ATKB 3UPCA 3QGKC 5KSBF 4XH2A 4BQCA 1FAKT 4K5OA 4PGZA 1CLZL 2O61A 5KINA 1CXKA 3EGSA 4A6YH 1DVUA 1G7LB 5SWZE 3VRLF 4N0YH 4L65A 4RX4D 2ZUUA 4PJEA 1G87A 4RD0A 2O9OA 2WINA 5CJNA 3W22A 4Z7WA 2NDGA 1RZ7H 4Z95L 3TA3C 4AQ8C 2CO7B 4PJIF 2X2GA 3CU2A 2MTPA 2OX5B 1NGXA 1K9MD 3LS5L 2ZQ0A 2Q76A 1CEOA 4Y2DB 4AEIL 1UD6A 3ZIYA 1JV5A 4LU5H 2XDFA 1R47A 3D34A 2PR4L 3P0VL 5CKSA 5TH2B 4K5MA 1NFDF 5DI8B 2A9BA 1V6VA 3T51B 5D9SA 1CCZA 4DH2A 3FUNA 2PRMA 4YN5A 1I7TB 1Q0XH 2DLHA 3M43A 1RZIA 2WWCA 1A9EB 4XBJA 4GUOA 1KCUL 3H9NA 3AZRA 5GS1C 4OT1H 5CP3H 1R86A 3PFQA 1C16A 1RUPH 3T8LA 1KFLA 3T3MB 3EWYA 5IB3B 3U9IA 4OLXL 2XU9A 1V0FA 1DVFA 4MF4A 1RIHL 1VFBA 2A4CA 3WNBA 2LLEA 3FK3A 3NFPA 2ZZ6A 3E3QE 1FO0L 3BWAB 1R24B 5DUJA 5IFJA 4QR6A 1UASA 3VGAC 2J9ZA 5F6IB 1I45A 2CNCA 1OE1A 5CEZE 1ZS8A 3QNZB 3HUJA 4N3GA 1F00I 1FP8A 1S7VB 4KBPA 4AMAA 4KCVA 4OOXA 1JI2A 3TFBA 3A4AA 1U2RA 1FSKC 3WUWB 3MBFA 1XR8B 5KYUA 2GVGA 4G8GB 2VL4A 3I6GA 5KITA 1ZSHA 3SDAA 3G1HA 1PZUB 2XH4A 3UG5A 2PBGA 4NP4L 4GACA 5IB4A 4TV5A 4HEMA 1EJOL 5JDSB 4BUQA 1H0IA 3FSWA 3PXHA 3H70A 3FKSA 1Z3NA 4FTVB 1E1FA 1PLBA 4UTLA 5HDQH 2HRPH 4RCZA 2HFGH 4Z7AA 3FT9A 4HXAH 3KXFD 4FA7B 4Z7VE 2IANB 4LDCA 1U3JA 2BSTB 3ZZSA 2B8OT 4DGYH 5E7BA 3V5FA 3U7BA 2EDYA 4LUTA 1OAQH 4TOQA 4L8BB 1IARB 3RU8X 1YBQB 2WKJA 5F7DB 5KYXA 3JYCA 4DPAX 4JFYA 1WA3A 1Q9KB 3OWEA 3ZC3A 2D7PA 3JWOL 3CZFA 4NY2A 5AW2B 4EKJA 3AXHA 3QYCA 1FHDA 2PUQT 1HK6A 1X5FA 4JQ2A 4NOBA 3E6EA 2R1YA 5B3JF 4QIRA 2BW5A 1IJNA 5CC7A 3LZRA 7ODCA 2CKRA 1PFOA 1LYXA 3URNA 3SO7A 5T1KD 2A74A 3QB7C 4RIRB 1O6TA 3HZKA 2G3ZA 4RRPG 5KVEH 2RGLA 3WH9A 3NZ1A 3RGVC 4GKSA 4KEMA 3T6CA 1MY5A 1N0LA 4EH1A 2X4SB 3PL6D 4FQPA 1MHHB 3OOQA 1RQ5A 1BX1A 1FWBC 4XTIA 3BJ91 1IC5L 4ESKA 5HDRA 4YMPA 5BVJB 5LBVA 2J77A 2QHLA 4RDWA 4B9ZA 1XL4A 1KTJA 1T20B 4OV4A 1TO5A 3FS2A 4Q8PA 1XSIA 1OP5K 4Y1AE 3VYNA 2F53E 5EC1B 2DLIA 3CZJA 1LZOA 1A14H 1PAMA 1KRBC 4FXKA 5BXPA 2VDNB 2ZVRA 2AAAA 1IQDA 4E9SA 4AC7C 1LDCA 3L1GA 3RPIB 5FAAA 1V93A 5FI8A 1WICA 1U3YA 3TR2A 3UXDA 3HKZA 4R4ND 4GUJA 3D18A 3DYOA 4F48A 4HJJL 1CFQA 5E0FA 3SEPA 2Q8ZA 4WTZG 4WFFE 3BW4A 1K9DA 3W5HA 3IANA 4GXMA 2ZWZA 3T8VA 4XCYB 3MLVL 4YBQC 1LEIB 3O6CA 3FJOA 3B4YA 2FBRA 2Q8BH 2ZCHH 5HD8C 2E77A 3ZE2B 4W89A 5HDOA 2VKWA 2VFEA 4AD1A 4DVRH 4G11A 4OLVH 4W85A 2XG5B 1P4LA 2X1TA 1TZ8A 2QVMA 4TUOA 3TVMD 2OULB 1DIOA 4U4BA 3EUDA 2CPUA 1B54A 3IUDA 3S8GB 1OO2A 4HPJA 4HOWA 4R0LC 3DSFH 3R7MA 1IEIA 3V3WA 3W1PA 2GOKA 4GH3A 2JWYA 3REWA 1I1AD 1ORQB 4YAWA 3EHBC 1IGTB 1B3VA 1O94A 3I6EA 3L2LA 1A4BA 2H32H 1FC2D 3GH5A 3URAA 3BDBA 4U3SA 3NXLA 4OJDH 1MG3C 4Y5XA 4O0KA 5EOCJ 4JFDB 1HZLA 4BQ5A 1SJHA 4MYPA 2ZP8A 5E00B 2EXWC 4HHAB 4Q8BA 3IPEA 3P3BA 2EDQA 2ZX7A 5IGXL 1HVXA 4AJVA 3ATZA 3BKMH 4FHKA 3HBQA 5B7MA 3SKMA 2PPFA 1SSGA 3DO7A 2JELL 1BXXA 3CN0A 5B8CB 2O6CA 4GXUM 3ANUA 1MI5E 3GNPA 1VQKB 2D24A 5EUOB 4JRXA 5HGHA 5D7HA 2NR6A 1F4WL 5D7JA 1WOBA 3RHWK 4W5UA 3KOWA 2Y88A 1GC1H 3UDWA 5GIRA 4FXGA 1ISWA 3L1OH 4DNTB 2Z34A 4UM9B 2Z8WC 3SPVA 3VFMB 3GJEB 2DT2A 1CXIA 3L3HB 3NAAL 1Z7AA 2MQ0A 4O4VA 3MRLB 3P3TA 3JQRA 1N7MH 1J79A 3TYCA 4I77H 3IMUA 4P8VA 4Q8QA 4UBDC 1D9KA 1EFXA 5HOSA 5HHQB 2X2YA 4X6FB 1TVPA 3UBXG 2XXCB 3DXAD 3S8HA 3VIJA 1NC2D 2DQEH 3NK3A 3W75A 2EH7H 1S7XA 3GNNA 1ZNNA 2J1KA 3DX9B 2BJMH 5EO1A 1TZGL 3B9KC 2XFGB 4JFFD 4JMQA 4ATDA 2SEBB 3D3AA 2AXHA 4PAZA 2X3AA 3ZL1A 4FYTA 4YVVA 1U8JB 5DEZA 2EIEA 2ENPA 2EYRA 1KY7A 4OFYD 1NCAL 2QQKH 4HPOH 3HJEA 1ZEAH 1ACZA 2WZNA 4APQC 3RJDA 4E5TA 3V4VH 1IJ9A 4PW3A 1FIGL 2OMVA 1YLBB 4X0KA 4W81A 1QDSA 1QWHA 3BFQG 2FIKB 3TASA 1XUUA 2OGJA 4KO6A 1ZJHA 3SCMC 1V3MA 5DD3H 5BRQA 5LAXA 3FFCD 2OLHA 3SJNA 5TDNA 3QLDA 4GUIA 5CH9A 1KXTB 4NJJA 1Q1JL 1QTSA 2YRPA 4C1NA 2DCUA 2QF8A 1F6FB 1JIBA 1MCSA 3M0VA 4WY0A 1GVQA 1G7UA 5C0FB 4A1RA 2WQ8A 1UIPA 1WSST 1FC1A 5HI4C 4LF1A 1K72A 2E67A 5F2LA 1BQHA 4PMOA 3JTTB 3P2BA 3QQ3B 3ULSA 4NO3A 2DYPB 2H8PA 4B41A 4Y5VB 4GI8A 1J05A 3FPXA 3T0WA 4L3AA 2CO4A 3LXAA 1ZOXA 2GJPA 5CO1A 5F93C 1RHFA 1G4TA 4IRSB 5D05A 3VOIA 1VKFA 4F3FB 1U6AH 5GJTL 3B8DA 1Q90A 1QUFA 1FZOB 5I8CA 3RWCA 5AC7A 4ADJA 1WNOA 4I5XA 1Q9OA 2WXRA 3NYKA 4GVHA 2E47A 1WP6A 4NZTL 2YGVA 4LF2A 2VRKA 4FQJL 3OVUB 4CRPA 4AZIA 5B4MC 4CQ8A 3DEQA 4ES8A 4S2CA 3BY2A 1AS6A 4X7CC 5GHWL 3R0UA 4MTMA 1A4AA 2AKRB 4Z5RA 4JTTA 4WGWB 4UNLA 1WDTA 2DWSA 4MZ3A 2DWEA 3GXMA 4AC4A 3QCVH 4PH8A 4DIAA 1VRSA 1OADA 3UAJD 2A5HA 3EF4A 3PYCA 3IMVA 4BWTA 5KUKA 4M7SA 1O75A 3IV8A 1XF5B 3UNDA 2A77H 2G30A 3PL6A 3M17B 2Q1EA 3RY4A 3DJ9A 5A6KA 2B4GA 4G6ML 4B5WA 5GQBA 5CBIA 3LKNB 3PG9A 4XSLA 3CUPB 3O9WA 4N22A 4RDQF 1EX5A 3ZDXB 4MJJA 1YJDL 5D32A 3I55B 4BUHA 3KHOA 4BYHA 1OZTG 1U95A 3W1MA 4HT1H 5I6KA 1DJHA 4RGMB 1PLAA 3KVQA 4IKJA 1K8DA 5KYWA 3T3MF 1XCTB 3DX6A 3LRHA 2WUCH 1XDLA 1SN2A 2E8ZA 3QCUL 3IE4A 1VQTA 3HPJA 1Q2RA 5F4XA 3UR2A 5KW9A 1OC6A 2BVNA 5F1IA 3FDKA 5EU7E 3CVHL 4FFTA 5IESH 3GD6A 3ETBF 1OP3H 5HVFB 2GW5A 2DZXA 1EGZA 1Y5VA 3N9SA 2ZCLH 4M8QB 3ARED 4PCNA 2ESVB 5JW4Q 3R8QA 3L3IA 3WLRA 4HG4K 2DPKA 3B9VA 4X6CA 3BPCB 4BELD 5E99H 5D6CB 4OOSA 4PRIA 2IKGA 3B37A 4UT6A 3G5XA 4LFYA 5LIUX 5M2FX 4WZKA 5HYJB 2RAMA 3LZFH 1KV5A 3HFML 1B2RA 1EP3B 1YA5A 4FG0A 3GHSA 2XI9A 1G4EA 4P9ML 1FFQA 1HSBB 4XNXL 3H0TA 3WO8A 3KCLA 2HFTA 4C4BA 2WC3A 5F89A 2VLJD 1K8ZA 3FNKA 3P40A 4LVFA 2X4QB 4B5VA 2F54B 4XC3H 3D30A 4ZFMA 4MMXB 3P11H 3IF1B 4A3RA 1KLFA 3GMLB 3B9EA 4JRYD 2IFFH 3HHSB 5GRWA 3ML9A 1IM3D 4GCAA 3RDTD 3SHSA 3HOGA 2FO4B 3VUSA 3VXOB 3PGCA 2XVBA 1U3HB 3GS4A 1FXQA 5DJCA 3PGDA 1TPUA 4ODWB 4YDNA 1QNPA 4QG8A 3MX0B 2NXGA 2JB6B 5CAHA 3GO1H 4OZ4B 4IG2B 2AGJL 4O1DA 4A8IA 1JNNH 2CJSA 3KPOA 2CW5A 4N9BA 3CZUB 4R2GD 3VXTB 2EDTA 1WG3A 5DK2B 1QTYT 3WF4A 3RCNA 1EO5A 1HP5A 1MVYA 5AL8A 4YGAB 2NNAB 5F8RC 2E6DA 3P93A 3KL0A 5HJYA 2DMKA 3FMGH 4KTGA 4HQQL 3KBJA 3G3MA 3IKKA 1A8PA 5E9AA 1ED3B 4FQ1L 1AC6A 2PCPB 5I3IA 2Q0ZX 3L0NA 5KBPA 1CUOA 3AQXA 4XQ6A 5AOIA 5DDHA 3DVNB 3P9LA 3KGSA 1FL5B 4I7UA 1AGEA 4IHCA 3VDBA 1NDWA 3COTA 3QDMD 3NJXA 2NQZA 4Y4KC 3K2GA 5F9WB 3MOQA 2R4SL 3BCDA 4NQCD 5CGYD 3HG4A 2WXKA 5GISL 3PWVB 4ZQRA 4F0HA 4KC3B 1L9SA 2CCWA 1KM1A 4ODXB 5ALBH 3CDZA 2R1WB 1SUHA 4URKA 5C0RL 4UAOB 2YD7A 4Z7NE 1G9EA 3P2TA 1XINA 3Q01A 1Q9LA 4CW1A 1HFUA 1GK8A 4CCDA 4MAYA 3SE3C 4YWSA 1C93A 2ZTBA 4LAOA 2VDOH 5IREA 4YMZA 3JZ7A 3FUFA 3MV01 4DK1A 4Y88A 2EVHA 2W9MA 1N3NA 4EUPA 2PDGA 4KKSA 1SGJA 3A5VA 3BD3A 2FQGA 4U1MA 2M5SA 3HGJA 1GZHC 1WHOA 1YITB 3LCYA 1WYJA 3LCXA 2J73A 4GBXC 3PREA 3FFCE 4XZBA 4B3KA 2I5IA 4XMKH 2X44D 3RXZA 1A6UL 5E9DD 3DLQR 4WHCA 2B59B 1CF8H 5IVNA 5J6SA 1UT9A 1TG8A 4JX6A 1EEUA 1YMMB 3K4AA 5H6HA 1QVOA 1RSYA 2DQMA 5G5DB 2HTLC 1WXJA 1NMAL 1YYLL 1URZA 3QWRD 1C8PA 2AHOA 1HO4A 1USZA 3KJ4B 3ABKB 3W27A 1C5DB 4R5EA 4EI5C 2F1MA 2BLEA 4TNFA 4WEBL 5DR5L 4M5TA 4PVNA 1VQOB 4ZQPA 1HOCB 1FRGL 3CXOA 1I8DA 1HL5A 4I3SH 1EAQA 5K1NA 2MSPA 1GL4B 1IFHH 3BKJL 3WNNA 5T3XL 5E2WH 1R3TA 5G4WA 4LV9A 5ICXB 3P6LA 4YHNB 1G5GA 1F1DA 2OSLA 3W38A 4NDMA 2OFQA 3UO8B 3BCJA 2E9IA 3ASRA 4FX7A 5EUOF 4I0PA 1LLAA 5IFAH 5F0JB 2FX8L 3MXVH 1ECQA 1H2JA 4KVCL 3YPIA 3BKCH 1DBJH 1KENH 5KSWB 4YGVB 1ZM9A 3NIGF 3T42A 1FLRL 1L6WA 2WXGA 1U22A 1IRAY 5EDXA 2J4GA 3R2GA 4UDTB 1AZBA 2CKBH 4QLLA 4EE2A 4FL4B 4UIKL 3LRSB 4RV3A 4NZ5A 1QWGA 2PRLA 4F8PA 4FOKA 2AS5M 1F07A 4YWIA 1N07A 4WJG3 1YEEL 3H2OA 3MW7A 3VFCA 3UCDA 4MAZA 5CJ8A 3WDIA 5H35B 4Y5YC 3SDDC 4IMKA 1J8RA 2R0KL 1R1CA 3CFJA 1MXSA 3RU8H 4QWWC 2VDIA 3LA4A 2PMQA 1OF0A 2OYNA 5FSDC 5KZ6A 1MFNA 4GUQA 5G1TA 2DORA 3CDGB 2OLAA 3RPKA 3RL1B 4QJ3B 3K81A 4D3CL 2DZAA 3XIMA 5JZ7D 4C56E 4YBHA 1TJIH 4XPBH 5FGSA 3HPAA 1QBMH 2Y1VA 1J5OL 4KIRA 4GPVA 3AT0A 4HPYL 3H4HA 1FNCA 2DBLL 4Z8FL 4Z6AT 4QFMA 5G2NA 3AY4C 2GDVA 4D8LA 3FV9A 2ZZFA 1MJUH 3ELQA 4HHMA 2YLLA 4QRPB 3PVDA 1POKA 1JGLL 3TN6A 1JHTB 5GGTH 1QPOA 1FPTL 4PRNA 5EF3A 2A9CA 1F9CA 1B31A 2NRDA 5LN4A 1Z89A 2BZDA 5I2IA 4LPTA 3P67A 1CDJA 5J1TC 2ZXCA 4NYLA 2X1RA 4J8RA 1OZQA 4EF3A 2CZDA 4B3ZA 2P5WB 2Y5SA 5GNXA 5E23A 4WOQA 4LSVL 1IT8A 4EDXB 3PIQB 3QHFH 4HZ7A 1M7OA 3GB6A 2IQAA 4YDVB 2NZ9D 3ARDC 1ONQA 4QT5B 5FK9A 5DHVH 3M5YA 2Z92B 3LY0A 2WB5A 1UG9A 1OD0A 3S5NA 5HPMA 4AD2A 1CE6B 2JXMA 3FF8A 3UC0L 3NR0A 1E5CA 5JIWA 2WMPB 1JWMA 4QM1A 3OJVC 3CJPA 2AQ2A 4PRPA 2ALRA 4OZGA 3LV3B 1K9TA 2BGJA 5EG6C 1R5YA 5M95B 2V5KA 1OCQA 3D3VD 2BOBA 2ATPB 5L2KB 1NAML 1HZEA 2DW7A 2P8LB 2ZONA 4MDIA 4MQSB 3IFOB 3PP7A 3HKFA 2GYSA 3VI3A 2YWZA 4N25A 3GMRB 3GH4A 4WUIA 3ZQWA 4P59L 5ECVA 5DN1A 2RDXA 1F76A 2FL5B 1PKQB 4LCWB 3GYRA 4Z4ZA 3OEEA 2VOMA 2VIRA 5JXEA 1S5VA 4NAEB 5FO0A 1G4PA 1PHQA 3L4VA 1YEFL 2G0LA 2EIZA 5HYIA 3RU6A 2N0KA 3QORA 4NJHA 1HIML 3VGDA 4ZAKA 3Q0HA 3C5XA 3TIEA 2VJJA 3SJ3A 1K7EA 5C0GB 3EGXA 1DXFA 4WJ8A 1NELA 3ZDXF 1Z5LA 5C07D 4BK8A 2QGYA 4G9DB 1AGFB 4ECLA 4JRWA 1PEZA 3VPLA 3QQXA 1PGRB 4V15A 3S47A 2CLFA 2WNZA 5I3KA 3MLSL 2BVWA 1VJZA 4TN9A 1F73A 5D1XA 3I6LE 4FFZL 3OGSA 1UM4L 5GS2H 4JDTH 2QIWA 4IX0A 1D2PA 3QDME 3FYEB 2XQ0A 3S8WA 1I0BA 5AALA 2EBNA 4GLEA 2NZ1A 3ASTA 3O15A 3ECQA 4NQCE 5ACZA 4GMEA 2AABH 1TFPA 3MROA 3V6OA 3IDMA 3GBNH 2FTWA 9CGTA 5LQBL 3PAUA 3WEXA 1J1PL 4JQXC 1ZHNA 1T21A 3TQVA 4UOW0 2YWYA 5HZAA 4J3WA 4LALA 1BF5A 2R2BA 2IXUA 4D1IA 3ARWA 3C8HA 2YR3A 3U0TB 2VWEE 5KVFL 2F2KA 5C0CA 4XUYA 4IBYA 1Y65A 3OAYH 3MR9B 4J35A 1T0MB 3BSZA 3LN4A 1HE8A 4O57A 1RXLA 4ZS6D 3W4RA 5E9DA 1FKXA 1B4JH 1HINL 1RZFH 4PY7A 1IEBB 1KJ3L 1KIRB 4MIMA 5E0CA 1VQLB 3I6SA 3V6FA 3ZYOA 1MNUL 5D7LB 1CXEA 1V05A 2POTA 4IRJA 4OUOA 2Z6BD 2CBTA 3RWEB 3T40A 3QEGL 4W9FC 4N42A 1IAIM 3AACA 1ZPTA 3WLSA 3ARPA 3DU0A 3O4OC 4ZSOE 4XOPA 1U42A 2B5IC 4XP5L 4G1EA 3IRSA 2PXYB 2HLDA 3W1NA 1RPKA 4ABWA 5ISZE 2IWEA 2UWEE 4MNLA 1UUQA 3RLGA 1EJWC 4HKBA 4GFXA 1MNNA 3H7LA 4I1RA 4LLUB 3UY7A 1KEML 3HG0A 1OB5A 2QDHA 1JVNA 4GSUA 3ARXA 1THFD 4WDXA 4LOFA 4JG9A 3QHOA 4ELKA 3LQZB 2OI9B 4RGOH 4XP9H 1WZAA 4PWJA 5DMMA 4PMZA 4O50A 5C0NC 4ELMA 2NWRA 3BZJA 3FFSA 1XPGA 1I4NA 1AG1O 1DEEA 4I18C 4XPTH 4LYPA 5GSVA 1XQBA 2FWOA 2NXYC 1R38A 1U58B 5IM7A 1LL6A 1ETB1 3H21A 1EGJL 3HC3H 2A0LD 3H94A 1BIIB 1DWAM 2IAMC 3SOBL 2OL3L 5T1LB 2VN7A 4LRSA 1FF5A 5A1AA 4WFHE 4QHUB 4U4IA 3FOLA 4XVJL 3OKEA 4OIIL 2OQHA 3WBXA 5AW8B 3G71B 4P12A 1R3JA 3W5NA 4KKAC 4O02H 1RBLA 1XO8A 1T1YB 4ML9A 4BK5C 4ES4A 2X4NA 4QCEA 3ATDA 4BFKA 4G3YL 4H25B 2QGGA 3ENEA 3H3BC 1OG6A 3NQIA 1ETJA 2ICES 4U0RB 3WF0A 4R8WH 2P5EE 4D8ZA 4YSSA 3CHXA 3VCCA 2GC7C 3OE7A 1OEPA 3PJWA 1EBHA 3VKBA 4FI8A 5H94B 1K28D 4OFCA 1WUFA 2VL5B 1PF3A 3TBYB 3EYVA 3GVQA 3OOCA 3GY1A 4IBWA 1X7FA 2Y8UA 2EPOA 2I9LB 3T3PE 5FV1L 2PI6A 1G9MC 5JVLA 4IISA 1YUKB 2YPVL 5K9OA 3MSPA 4C0SA 3W0WD 2YLHA 1LRTA 3UG3A 4AJYV 1VZGA 1HNGA 3TYAA 4BZ1A 4NQSB 4A7GA 1VIZA 1Z9SA 3TJ4A 5DC9B 4BQ2A 4NRXA 2NLYA 4NRYA 4PGOA 2HE8A 1E4XL 5T1DL 4OWGA 1FWEC 4W1TA 3N2XA 1B4TA 3BISA 3UTQA 2I60L 5GSRB 4JKKA 4G6IA 1MCRA 2C4TA 2AFNA 4C58B 3NZRA 3AOFA 3MBWB 3WD0A 4Y1TA 2UVEA 4HH9A 3MCKA 3ULUE 2HPMA 1TKWA 4KFZC 5E6TA 1O6IA 1GVFA 5KSUB 3R8HA 2AQQA 3AAZB 1J9YA 4CQJA 4R6UA 1I60A 2XWCA 2DWDA 2W0KA 5DRNB 3SPJA 1NAL1 4MJ5A 4U1NB 3VWJD 4H6QA 4KWUA 5L2JB 1RZQA 4JX5A 1A0DA 2I5QA 3UYOD 2J72A 2HLAB 2ZOKB 1UC6A 1OD7A 2KQNA 1CO1A 1R3KA 4ZYKB 4WO4B 3NP4A 3Q8FA 4R9XA 4G6JH 3SDYL 3G6AA 3OW7A 4DGWC 1Q6FA 2NZLA 1A2YB 5AHNA 2NZIA 4LLYB 4XV0A 2YXWA 3QO1B 4IOSA 3KS0J 5I0DA 4Z77A 4LRNL 2VDLH 4ETQB 4GYPC 4X4XA 5L7XH 2FQEA 3T55A 4NWTH 3GTIA 3B8YA 3IVUA 4HUXB 3FCGA 3EX2A 4X7TA 4KO5A 4QYOA 1CICC 3W76A 5J8OA 4Z0XA 1NUGA 3X1NA 1TETL 2ZWKA 2ZOLA 3OKLB 2ZADA 1G7PB 3K4DA 2FVMA 1L6XA 3WUFA 5I18H 3BJSA 4BFGA 3KM2A 4LOEA 3IJ9A 1DQQB 1GRWA 3ABMB 4XLCA 4AH2B 1J8HB 1B3XA 3ZTDC 3A6BL 2EE3A 1D3GA 1GTHA 4NBXB 4PWGA 1BQGA 1BOGB 3K6DA 2Q2EB 4PJ9B 3R7QA 5A16B 3OXRA 4TV6A 4LPYA 2CBIA 4MAVA 3KS5A 2ZWYA 4O5LL 2WTOA 3QIBC 4EXQA 1XBXA 3VSTA 2Z65C 1N19A 4TUJB 3C8DA 3F2CA 4S0HA 4AM0A 3OKOB 5BVPH 4NP9A 3EA3A 3MV9B 3LIZH 5ITBH 4HD9A 2XSXA 4R7OA 4ZMPA 5A7EA 5SWZD 4BKSC 2FDBP 3N44F 4BQ3A 2WMHA 4MADA 3LB6C 2XACC 1QT1A 1GYLA 1ZP4A 5KUMA 1QTPA 2BV9A 1S2AA 4ICNA 1KFAH 3QJVB 1QMLA 1UZ8B 5DTFB 1P0BA 3W56A 5D2TA 2LZJA 3UYIA 2DLTA 3DURB 2XOKA 1Q6LA 1WOPA 4P2QA 1U8NB 4E0FA 4JKNA 1G01A 3P61A 2J4WL 3AHVA 3G08B 2ZA2A 2NMSA 2XBDA 3JVAA 2E3VA 5GGVL 4HWEH 2VBTA 1P2CB 3APDA 1D6VH 1F4YH 4EVZA 4XN4A 4NKMA 2O93L 3EX3A 2ZTJA 1UP3A 5DYOA 3LHZA 4V2XA 3BYYA 4AQAB 4L18A 3NACH 3TE9A 4BI5A 1E0VA 1ADDA 4ZJ9A 2X0HA 3S3PA 4ENEC 3WN6A 4IU3A 4LSQL 2X7WA 5CC5A 3X1FA 2FZ3A 3E9AA 5DS1A 3GB7B 1E2WA 4DEPB 4YXWA 1XYCA 4JD4A 1LO2L 5LGZA 2WXHA 1OC7A 1T0NA 1IC7L 3FQNB 1N64L 2OV0A 4PV1C 4S1DC 3G24A 2EXOA 3CN4A 3MWAA 4ZMOA 3IGFA 1A7QH 1MHCB 5F96H 2MPVA 1POJA 1LD9A 3MLZH 2WCGA 3CLMA 1QR1B 1QSFA 1EFTA 2PCYA 3PJSB 4DVOA 3URBA 5EA9A 3W2FA 1CT8A 3IKCB 3WJZA 4GG8B 1HCVA 3NCJL 4ANWA 4GAFB 4FEMA 3G1RA 3SUTA 4XZHA 2X6MA 2FO8A 4YSAA 3N1PC 2FIQA 1RPXA 1WH0A 3ZTEA 4ODVL 1NM4A 2YWEA 2VC7A 5BZXA 3KLAA 2W62A 3LH8A 5BZDA 3ALPA 2WGNB 4PMJA 4PMYA 5KTEL 3GIQA 2XH2A 1KTDA 2A1WL 3JW7A 3EW3B 4KTDH 3V2AR 3KTCA 3I4EA 5GJSH 3OJXA 2R69H 3OAZK 1QUMA 3INPA 3SE6A 4GEIA 1EHNA 4NAJA 2L7EA 1TJ0A 5HGAA 3M4HA 2IBBA 3F6IA 1RP8A 4KZ0A 4QSHA 5AYUH 5ANHA 3RP1A 3QFJE 2F7FA 3LRGA 5D70L 2A6IB 2IV9A 3DIDA 2Y5TA 1FNFA 3CM4A 5F6HI 3NEOA 3M5ZA 4TMPA 1WAUA 5F1OB 3UYCA 3WX7A 3CNYA 3SE9H 4CVZB 5E8OB 3EOYG 1RERA 2CIIA 3QJHB 4OZIB 4RESB 4P5TD 2D8KA 5E8PB 4E5XG 2VQ1A 3ZR4A 1Z44A 3CC5B 4MYTA 3OMAB 2K4AA 2RD0A 4MVBC 1HHHB 3SGDI 1X5GA 3D25A 4FRWA 1SJBA 5I17A 1RSFA 1SOQA 3DARA 4PRWA 3T65A 4GQPH 1RK1B 5CBJA 2V8MA 3S34L 3S3CB 1TVDA 1IEXA 4D6HA 5ABFA 4L6DA 3LN5B 1CI1A 1EZLA 3ZJ6A 4Q4PA 1CQKA 3TTOA 4PJXA 2VR6A 4NT6A 5DJZA 3O11A 3W2EA 3VNKA 5A6JA 4D9QD 3CN3A 1BYNA 2BWQA 4Y1AD 1P0EA 2F53D 2WJEA 4O2FA 4LF3B 4N1HB 5J57B 2WHVA 2NY2D 4E8DA 3BGMB 4AKQA 4JDZB 3L54A 1KTLA 1JHLL 5HY9B 5M7QA 4DUVA 1B3IA 1Q72L 3RG1C 3EJJX 3WXWH 3B97A 1TT6A 3ASNB 4WFFD 1I8UA 3DOHA 5FYKL 4E41B 5FB8A 4ZTOH 2CDGA 4L9LB 1L7IH 2VC6A 2WYSA 3SQBA 4DF1A 3HI5H 2DM2A 5M1TA 3BO9A 2OK7A 1GEQA 1W3TA 5DBUA 4KFMA 4CADB 1LGVA 3VQ1C 3Q5OA 3NA9L 1MFBH 1W15A 2ZAHA 3CX5J 1U1JA 2Y06H 3GRGA 3ULVC 4ONGH 1D3HA 4EZJA 4AWJC 1NAMB 1IQ8A 3SGEI 3KWXA 3DX5A 1CD1B 2DYIA 5GS0L 4Z17A 2XA3A 3TCSA 3ITLA 2CMRL 3OODA 3D51A 5TF1L 4JL2A 1JGEA 2PWEA 2E7DA 2YAMA 5AYIA 2E9WA 2OM5A 4Z7IA 4KH2A 1QTWA 2WAGA 4PGBA 5BOJA 1FCUA 1A3QA 2P26A 1QFUL 3G8RA 1BEXA 2QCLA 5CQ1A 2JI1A 1EJVC 3EG9A 2F84A 3UJJL 4KY1L 4R90L 1PJWA 3EUUA 4MPKA 2X6UA 1F11B 3IIPA 4LSRL 2WCAA 1WOOA 2F18A 4P4RB 4B16A 4II2A 1A7BA 4KCWA 4WRHA 5CAKA 3P0GB 4TVUA 3WLQA 3NQCA 1MI5D 4YSCA 2BM1A 4X8XA 4H2HA 3EPNA 2O5YL 4WR3A 3TO4B 4AGNA 3VXMB 5EO9A 3P5ZA 1LLOA 3WH6A 1XIDA 4GSDL 1ZDQA 3QFSA 3IGAA 2WBWB 1BA9A 3B8UA 2VNKA 4PJ8A 4RFEB 1AR1C 3QRGH 3MGTB 1KO0A 1JS4A 4HIXH 4LHUB 3FRUA 3QUXD 2C9UA 4TOYL 1PDKB 5ID1B 2GTWB 4B60A 1UKPA 4HLJA 3E8UH 3GRWH 4Q9RL 4AHQA 3P1VA 3JV6B 4LB3A 4UQ2A 3U2EA 4X98A 2FJGB 1PZ1A 3JV4B 1UH4A 3MV7E 3EYPA 5SWSA 1RJZB 2VCBA 2DUXA 4XZUB 3IDJB 4K7PL 4X63A 2DH3A 1GOXA 4P4KA 2UV3A 4TX8A 2R1PA 3ZGIA 1P7HL 1WSVA 1LO4L 1SQMA 1WC7A 3G5ZA 4O1CA 4UILH 4P2CG 3A22A 1JHKH 1J1OL 2CCVA 4DWDA 1K5WA 3LQ6A 1XBYA 4FMFA 4YHOH 4Q4SA 3LN9A 5CEYB 2O7QA 4OF5A 1JGUL 4JZ5A 5DSCB 5HVWA 1CU4H 5EHFA 4M93B 4MMWA 1S5IL 1ZHBA 3BY1A 4PG9A 4ZXBC 5MHBA 1H15B 2EDOA 5DRCA 2WQVA 3CLEL 3T8XA 2ZUMA 3LLDA 4U28A 2WKOF 3PAVA 5I1DB 4DQWA 4X5RA 3OKDA 1H8EA 4NO0A 3AHZA 1FLTX 2YZ1A 3DMMB 1ZHKB 4M3KB 3L13A 1ZUAX 4LNYA 4WNQA 1Q8AA 4X80L 2D7TH 1S8DB 4LE8A 2IWKA 4IU2A 4ZFOB 3H26A 4CL7A 5FKPA 2H3KA 4UYPA 1I1RA 1JXJA 2I85A 4NILA 3OZVA 4GLRI 1EF2A 4XGZB 1Y0LB 1PX4A 5CCHE 3L65A 1VFSA 3W82A 4Y9GA 3QTPA 5AECA 5ELIA 5C86A 2J66A 5FO9A 2PC4A 5BQ7A 4P23D 5DLCA 3S4TA 1W2PA 3M0HA 3QV6A 4LB4A 1SFLA 3B43A 1KV8A 2OL3B 5C0BA 3UGEA 2IC2A 1U8OA 3BAXA 4NQ1A 5CILL 2VENA 3OZMA 4ZMVA 1S2TA 1OARL 3W23A 1IBBA 4X99B 4NBYB 4PREA 4ZCMA 1ERNA 4L8SB 1ZE3C 2R9HD 4NAFB 4DQOL 3WO4B 1VQ5B 4JBSA 4DCQA 3R79A 4LUJA 3VI4A 3CEPA 4NC2B 5E2UH 4IXXA 4XPHH 4FG6D 3CK0L 5L46A 4E9XA 4P8XA 3NE5B 3MXWH 2WTRB 1UWXK 4MNQD 2EKSA 3U2QA 3NZ8B 2D9CA 1ZP3A 3LERA 1RZPA 2YN5A 1Z1WA 4H6EA 3H7BB 4P7QA 1MFMA 4DM1A 2DEWX 3IIOA 4F9PA 2J55A 3SGJC 3ZFHA 4JVUA 1RZ8B 3FJNA 2YYUA 4Y1AA 2CAKA 2GUBA 1CX9A 3C86A 3VYOA 3AB0C 4N87A 2BVDA 4HIPA 3AU0A 5I76A 5KYYA 1IO4C 3OHXA 4FULA 1JP5A 1C8QA 4XBPA 1C91A 4XWOD 4D9QE 2WCPA 3H9HA 4RFOH 1US3A 4YJ5A 3IDNA 2HKFH 2OZ4L 1H63A 3BH8B 2J7CA 2EH8L 2FB4H 4NNXB 4JS3A 2LU4A 4R26L 2Z93B 5EEUA 5AVWB 3NOEA 5IUSA 1I9IH 3PDOB 1OCCB 2NW2A 2HV5A 4FALA 1NGPH 4XVTH 1OAYH 3WQDA 4JEQA 1QSED 4HJGA 1H41A 5DD0H 4BSWB 5IF0A 2QV4A 3CMOL 3H6JA 3DBXA 4ZR8A 5BZWA 4N68A 5D4QA 3O7UA 1BAGA 3L4XA 3ECVA 3MPGA 4D9LL 4NPYA 2ZWLT 3HE6C 4J4KA 1B3JA 2A4EA 5ENLA 3C0JA 1T4KA 1YKWA 3S2CA 1N05A 2GK7A 1RY8A 4QDWA 4ZE5A 3VFGL 1OCWL 1T4WA 5LHFA 4US5A 1N2RB 1TPH1 3VOCA 1I7UA 3THUA 4TRPL 4UTFA 3U6KA 3CVDA 3FU3A 4I4WB 5AKQA 4BHYA 1Y6KR 3LYEA 2BIMA 2VLRE 2G5BB 4RA3A 1U8MB 4JRLA 3V8OA 3UMNA 4D0CB 1I1FB 4Y19A 2DTML 3NOYA 3U6RA 1E7VA 1IHMA 3EA2A 5AC5A 4OD3H 4NENB 1BGAA 2DLGA 5E4EC 2IWFA 5F7BA 3RX5A 2VFFA 3WN5B 2NWSA 1C8YA 4JOMA 4TR9A 5AFAA 1CIUA 1T2XA 4H88H 2HFFA 3UETA 3TLRA 5AVSB 3S5LB 4IPLA 3MTRA 4HJ0D 3PAYA 2XZPA 1GVEA 4WGHA 4KUZL 4L8DA 1UFUA 4GQ0A 3NZHL 4LCCA 1K2DA 3TYUA 1GGUA 2JBMA 4OZIF 4RX4A 1NLDL 4RM0A 3QDJB 5FOBA 3N3MA 2I7SA 4I2XB 5FDYA 4E2BA 3QUXA 2C34A 3P27A 2ARJA 4JY8A 3MY9A 1UR2A 5EDSA 5J4MA 4KKLD 4ZMQA 2A6JA 5BO1L 2AVFA 1KBJA 4RQQB 2XG4B 3MRJA 3HG3A 1U93B 3E49A 1M1SA 5BXTA 1KFEA 3AU6A 4XB8A 1VLIA 2BGNE 1Q6EA 4L4LA 1ZGLB 5K9KB 1BXAA 1G9MH 3O6FC 3KBMA 3KW7A 1XTMA 3T77B 5A3HA 3UZ5A 2WP3O 4ZTEA 3BN9C 2Q86A 2UZPA 3CSPA 5KAQF 3MRQB 3KXQA 1A7PL 2VABA 1HHJA 3E2SA 2OLDA 3WFEL 2RTTA 2R24A 2PPEA 2IH9A 2HS6A 3WLWC 4FQHA 4CLMA 4X7SL 1WFOA 2HLFD 4NAQA 3VFTB 2ICEB 4QVJA 5INDB 4UZSA 4DNRB 1A7RH 5ABGA 2W59A 2SODB 1SVCP 4B9PA 1MCHA 3AWOA 2PLTA 3FB8B 3W7IA 3GHUA 3OQEA 4NJAL 4WXYA 5DS0A 5D1ZD 2OR8A 5GRUH 1XMEB 4G8AC 2XUWA 4XCFH 2WN2A 1NFPA 6PAZA 3RRQA 4JHVA 3NL6A 4G56A 4KWSA 1TITA 4Z2GA 1TE1A 2APVA 4GKZA 3IFLH 4DKEL 3FU9A 3KHQA 3KXFA 4WEUD 3VG0L 1OGAE 4F79A 4HGKC 5AUMA 3HFFA 1E6PA 3QIWD 3VNMA 4NNAA 1HKKA 5DMGC 4GH7B 3L3JA 1TZ7A 3VFUB 1YEGL 2WZMA 3QJUB 2WNWA 5L88H 3VFNB 4PAAA 1R85A 3K8LA 2H0JA 3FN0H 2ITDB 5CPSA 3BT2H 1VGKB 1AH1A 3IFNL 4U1IB 2Q10A 2QUUA 3E8VA 4JZNB 2K6WA 2E27L 4F92B 4N2EA 1XR9B 2PYFA 1KGUA 1OVDA 3M0MA 4G7XA 1TWDA 2DEXX 5AB1A 1XIWD 2Z7WA 3NCMA 4X4MA 4DVBA 3NBNA 5LNDA 5T1KA 3T71A 2GIMA 5TFSL 5JOEA 4B7IA 3PWJB 5AW7B 1F5ZA 4BXVA 3RIAK 5JNYB 1T03H 2QDWA 1E62A 2QCEA 4P46D 3RM9A 3IJEA 4RNRB 4XVEA 1TMCB 1ILUA 4MNQE 2HSAA 3T8MA 1GQKA 1BQKA 3OMIB 3BKYH 1EEQA 2J6XA 3C3NA 4LARL 2A7BA 1H8OA 1KFKA 1GS8A 4ODUB 1BFVL 1WFMA 3W1UA 1S1PA 1M04A 4S3JA 2C6QA 2FLMA 1Z6JT 4RCXA 1M05A 1BYOA 2A73A 4AG0A 4MB3A 4JIHA 5ANMB 4C56D 1SMOA 3HMXH 5HHOB 4G7EB 3HAEB 4OJEH 2XNAB 1GHFH 3GW3A 4Q0XH 2LOEA 3HJ0A 1S7QB 3MLUL 4AG4H 3Q2WA 3CCEB 2EXYC 3DV4A 4YC2B 4M1CD 3BGFC 2WBGA 3MJ9A 1ZM2A 3AQUA 4ZDHA 5AOJA 3BZDA 2NV4A 1PDZA 3NJVA 1JD7A 1TZ9A 3CAVA 4GZJA 1K9EA 2TSYA 3AHXA 2HDJA 2P8BA 3T1WA 1YEHH 3FQRA 5ICYB 1NBMA 2C3VA 2IO5A 5HGBA 3P9MA 1TENA 3L17A 2GJZA 4DBEA 1TUXA 3RVVC 4MNHB 4JHMA 4JUSA 3KDNA 3EOUA 1HYSD 1FKWA 4I48B 1V3KA 5MENB 2O6PA 3G1AA 1PKNA 3QJZA 1QSEE 2YOAA 2ACRA 2AXWA 4JUTA 1L9WA 3TVMA 5FA3A 4F9LC 1LVEA 2FX9H 3AABA 1UBPC 3VIIA 4P2OD 3MCAA 3EGJA 5GXBB 5CZRA 3R89A 2X4TA 3PANA 3EWWA 1P43A 1US2A 4CVWA 4GXFA 3QEHA 4OOVA 1I1AA 4TTDD 3WMBA 4PJDB 3MTXA 1KIQA 1VFFA 4DWSB 43CAB 4TPRH 1RZKL 4F15C 2HPOA 2YCIX 4JHZA 5EWIH 4PJBB 2G5UA 4IOTA 1GOIA 4F2EA 1Y8BA 1K8IB 4QEEA 4Q4RA 3U8GA 1SJAA 1K3ZA 2XZQL 4P7RA 1ZA3A 3IGKA 5I1JL 4Z7OB 3DESA 5I5JA 4Z7UB 3ITCA 3STLB 5C0EA 3MLYL 2Q20A 2OJZH 2KS0A 4O0ZA 4WV1A 3CDFA 1UYQA 3E2RA 2NTFB 5FJOA 1XISA 1FY6A 2QGBA 3PQYB 3TZVB 3KGUA 3HPLB 5IQNA 3AIRA 4ZQKA 1MXDA 3VUAA 3M1BB 3HC4H 3DUSA 3TNNA 2H7WA 3WMPA 5HNNA 4CNNA 1M41A 1IKFL 1JMXA 3OQ8A 3JVGA 1EEYA 5C0DB 3Q2CA 5T8IA 4DYEA 3D4GA 4UUJB 4MQXC 1GKEA 5MKGB 3I6LD 3DXAA 3K13A 1NC2A 4XO9A 4FZEL 4LSTH 1CGYA 4K71B 2NOYA 4JFFA 2XGJA 3TYDA 4PV9A 3SYOA 1FRBA 3TNOA 4AVKA 3CD4A 4W4QA 4LEEA 5M5DA 3S36L 2WZPD 4IM8A 2DT3A 4Q4QA 4OFYA 4EIVA 3Q2LA 1PCSA 3RVXD 1H09A 1QACA 5C7ZA 1HI6A 3CAQA 4MWAB 3QNXB 4DZ8B 3BRGC 1LBFA 5TBOA 4RAVB 4ODSL 4F1ZA 5DGQA 4MA1C 1AGDA 1T3FB 1M3UA 3BDXA 4J3BA 4Z2KA 2YAOA 1C29A 1AP2B 3GJFK 3WCZA