3BCCD

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGPLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSVREGLYFNPYFPGQAIGMAPPIYNDVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLVPLVYYMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 66
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3bccD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3bccD01
3A0BV 2VHDA 1HCMA 1KV9A 2ZXYA 1MZ4A 3ZBMA 1H9YA 4FANA 4XXLA 1L9BC 5DJQC 3L4OA 1S6VB 2B4ZA 1KX7A 1HJ4A 4A7PA 3HQ9A 2YIUB 2DVHA 1JDLA 1CXCA 1LMSA 3L70D 4K3IA 1CRJA 5DF5A 1U74B 2C9XB 3MK7C 5CIFB 2BGVX 1I8OA 2GIWA 1CRCA 1CIFA 3TGUD 1ZRTD 1FI9A 1L9JC 1F1FA 1YNRA 1F1CA 5H2FV 1M70A 3DR0A 4QAOA 2AIUA 1MG2D 2CE1A 4PW9B 1GKSA 5C0ZA 1E2RA 2C1DA 1YCCA 1QL4A 1I55A 2C1UA 1C52A 1EB7A 1BL9A 1CSVA 2L91A 4FA9A 2C2CA 3CX5D 1YEBA 1CC5A 3VMAA 1U75B 1QN2A 4WQ9A 5CYTR 3SXTA 3CXHD 1HRCA 4P4QB 1E8EA 1SQVD 1KX2A 1RZ6A 2N9JA 1AOFA 1C75A 3A9FA 2DGEA 5GTIV 1I5TA 5EXQA 1H33A 5B5EV 2AXTV 1FOCA 3C2CA 3CYTI 1C6RA 1OAEA 2LITA 1I54A 1FHBA 1CCRA 3HQ8A 1CORA 3NBTA 2FRCA 1CTYA 2Y0EA 1NMIA 2B0ZB 1LS9A 1CHHA 4EIDA 4N0KA 1DT1A 3L72D 2FYUD 2B11B 5CIGB 4RSZA 2PACA 4WQDA 1BE3D 1H31A 3OA8B 4EDFA 2IBZD 1W5CT 5KAIV 1H33B 1I6EA 2D0SA 4FA4A 3BCCD 1NIRA 1C6SA 1FCDC 3OCDA 1C6OA 1AKKA 3ZOYA 2LIRA 3ORVA 1DW2A 5DFSA 3GG2A 2B12B 5GTHV 3PLNA 4XYDB 3MK7B 3GW6A 1CXAA 4FA1A 1SQPD 3RMZA 3WFBC 1H31B 3SLEA 3DP5A 2OZ1A 1KB0A 3PXSA 1DW1A 1CTZA 1H1OA 2V07A 3ZOXA 3VYMA 1BGYD 2C8SA 1CIGA 1YICA 3A0HV 3CU4A 4AANA 1H9XA 1M6ZA 2XTSB 4WQCA 1S5LV 4JCGA 2L4DA 1FI3A 3RN0A 1NTKD 4WQ8A 1I6DA 1IO3A 2CA4B 3WFEC 2QJKB 4GEDB 1L0ND 2BH5X 1CYJA 1PPJD 4PD4D 5CIHB 1SQXD 2OZ1B 2BCCD 1GQ1A 155CA 1QL3A 1QYZA 3L4MA 1NU1D 1EZVD 1K3HA 1HJ3A 1HROA 3O1YA 1CHJA 1YTCA 1CRGA 1NTMD 2O3JA 1W2LA 4KMGA 3H1JD 3O5CA 1CTJA 1H32A 1I8PA 3L73D 3L74D 1IRWA 1CHIA 1CSUA 1DVHA 3SJLA 2JTIB 1N9CA 2FYNB 1N50A 2V08A 5CIBB 2B10B 3CWBD 1KYOW 3RN1A 2PCCB 1PP9D 2RN0A 2BCNB 1CRIA 4WQ7A 1A8CA 1CSXA 4H0JA 2C1DB 1CYIA 4D6TD 3KZIV 2FWLA 3L75D 1B7VA 3ZOOA 2C1VA 1FI7A 2GB8B 1BCCD 1VYDA 4Q5PA 1NTZD 4EIFA 4J20A 1E29A 1CEDA 5B6QA 1GU2A 1CCHA 1H32B 5CICB 2JQRA 451CA 1IZL0 1SQQD 2CXBA 3M97X 2N3BA 1NMLA 1C2NA 5CIDB 1M60A 1YFCA 2JWAA 5C9MA 4UB8V 4WQEA 1ZZHA 3HQ7A 3ZCFA 3HQ6A 1C2RA 4DY9A 1DIQC 4FB1A 1J3SA 1CNOA 5IY51 2YK3A 1YEAA 2HV4A 1CRYA 3WFDC 2I8FA 3ITKA 2BH4X 2KS1A 2Q3EA 2ZONG 1CO6A 2BLFB 3JBTB 4NFGB 3DMIA 3CXHW 1DW0A 2N9IA 1WVEC 1LC2A 2QJYB 4H0KA 4UB6V 5KAFV 2RMZA 3NBSA 2D0WA 4MU8A 3TF5A 5KLVD 2N18C 5B66V 1DVVA 2ZOOA 1OCDA 3PXWA 4Y5RA 4O1WA 3OCDB 1CIHA 4EICA 3H1HD 2PCBB 1COTA 1A56A 2AI5A 1CSWA 2ZZS1 2A06D 2ZBOA 1AOQA 3ZIYA 1KYOD 1N90A 3CP5A 1FJ0A 1KIBA 3RLMA 2YQBA 2K9JB 3SWSA 4FA5A 3WU2V 2QJPB 5TISV 2CE0A 2BPBB 1RZ5A 2Y0DA 4FAVA 5KLIB 3O20A 2GC7D 3H1LD 3TYIA 3O0RC 1C7MA 1HZVA 3X39A 2CA3B 1RAQA 2KNCB 4L3HA 4YE1A 1CIEA 3PH2B 4PWAA 1GJQA 3VRDA 3PHLA 2GC4D 4LJIA 1IQCA 4AALA 1KB9D 3TDKA 3H1ID 3ZOWA 1CYCA 2EXVA 3WC8A 2MTAC 2MHMA 3PRJA 1GDVA 4WQAA 1DIIC 3WUIA 1CRHA 4IL6V 1A2SA 1DW3A 1AYGA 3VNWA 3KHUA 1IRVA 1NNOA 1SQBD 3WFCC 3OA8A 1P84D 2N3YA 3PTZA 1HZUA 4AAMA 5KKZB 1LFMA 3NWVA 2N9YB 1L0LD 1MG3D 2Y0CA 1HH7A 4L3GA 3PXTA 1HJ5A 4AX3A 5AURA 4AAOA 3FWLA 3SVWA 3CX5W 1LC1A 3L71D 4GYDA 2ORLA 4U3FD 4RJTA 1GIWA 1RAPA 4L1QA 4PJ0V 1K3GA 351CA 4EIEA 2YCCA 2N18B 5TJHA 1N15A 1WEJF 1YIQA 1QKSA 1R0QA 2QG4A 3H1KD 4O1QA 4WQBA 5DJQB 5CIEB 1ETPA 4V2KA 5E79V
chains in the Genus database with same CATH superfamily
3AE3C 1HCMA 4RESB 4WY4D 2ZXYA 1IZNB 1MZ4A 4ZKUA 1KORA 5DJQC 2E42A 1RF1A 1SQQE 1ZOYC 1SFCC 1PGOA 2BCCJ 1X9VA 1IK7A 1JY2O 1PZQA 2IBZG 1NU1J 3SFEC 1LMSA 3L70D 2KB7P 1JOCA 1NTMJ 3BRVB 4C7RA 2C9XB 3H1KG 2BGVX 1OFCX 1FI9A 3L73J 3L74J 2OTJP 5APSA 1KV4A 1BSHA 4WB4A 1S5LE 1M70A 1RE3A 3RK3E 3B71A 5C39A 2KI7B 1RQUA 1HJ0A 2E43A 2QJKC 2FXPA 2R32A 4XA4A 5KLVE 1AQTA 2C1DA 3RK2D 3KYQA 2FFDB 1I55A 1GW3A 3OA7A 3V4QA 4FA9A 1NHLA 1YEBA 3M9QA 1Q90D 1U75B 3CXHI 2CK3H 3M06A 3AE5C 3R2PA 3GF7A 3S9OA 1HRCA 3AEAC 4UB8H 2JEEA 3TK1A 5AW0B 1LTGC 4ZKPA 2IPPA 3HE4A 1RZ6A 5AVXB 1C75A 2PAJA 3P8MC 4I6MC 5K5GB 2ZFCA 1I5TA 2FYNC 1C6RA 1OAEA 3H1LE 1CCRA 1P84H 3NBTA 2ZT9B 4EI2A 3RBXA 4N0KA 1SFCD 3V4WA 4DJGA 5B66H 3LW5H 3I5CA 1Q81Q 1BE3D 2K88A 3A0HH 1Y47A 3H1IE 2KUBA 2D0SA 1PGJA 2OGUA 1C6SA 2R3SA 1YJ9P 2FY8A 4YPCA 1KFNA 1JY2P 1YI2P 5APWA 1LJ2A 3L72G 1DW2A 2O01N 5GTHV 4XYDB 3WUTA 3MK7B 4XE5B 2R5DA 1SQPD 2WWWA 2GM4A 2W6JH 4GIFA 3DP5A 1IC2A 1H1OA 3ZOXA 5KAFE 1S9KD 2J58A 1L0LE 4PV1B 3E1IA 2HODA 1JY2N 4N6JA 4C7NA 1M6ZA 3G6EP 4W7ZA 4U3FE 1NTKD 3SWFA 3MGNA 3GHGC 1H89A 1IO3A 3WFEC 4H44B 3II6A 3P8CE 1HH0A 2AEMA 1PPJD 4PD4D 2M5AB 1EZVI 1OWAA 1LTBC 3WU2E 2BCCD 155CA 5TISE 1FE6A 1NU1D 1VQ7P 1QGKB 1UIIA 1SQVJ 1CHJA 4K3AA 1CRGA 1NTMD 2E75C 1FDMA 5KLIC 1FDIA 5AVQB 2IFNA 1H32A 1I8PA 3L73D 3L74D 1MFTA 4EYYQ 1L0NG 1IRWA 1CHIA 3SJLA 1EXIA 2E5YA 2JTIB 4O9BA 3L70E 5CIBB 3LW5J 2C9LY 2Q5UA 5CHXA 1KN7A 1Q82Q 3CXHH 1JM0A 1EZVG 3KZIV 1M1JB 1B7VA 1OVVA 2BASA 4IL6E 2P2UA 1CEDA 5B6QA 2I1JA 5CICB 2JQRA 2XZRA 1NKZB 3H1KJ 3HTKA 3M0AA 5E79H 4RO0A 3B4SA 1VF5B 1L4AC 2J59M 3ZCFA 4DY9A 3M0DA 5EFWB 4JPZB 2WSEH 1GTWA 1GD2E 3GHGA 2OTLP 2V7QH 3IFMA 3V6IA 1YEAA 4H0LB 1QVGO 2I8FA 1LTJC 2UWJE 2WITA 4XFJA 3JBTB 3I56P 2P58A 3DMIA 3CXHW 1LC2A 4H0KA 2RMZA 3NBSA 2W8ZA 2WSFH 1SQQK 4M3LA 2N9BA 2WPVB 1QL2A 5CCHC 2E75D 2KNCA 1KYOI 3A0BE 1COTA 1VL2A 2RH0A 1FAVA 3VYIA 3V2PA 2KS1B 1AOQA 1FZFA 3RL0B 1BE3E 1KIBA 1SP4A 2Q1KA 1FJPA 4FA5A 1KILC 2WTYA 2CE0A 5AW2B 1RZ5A 4FAVA 1AV1A 1N2DC 3IR9A 1K9MQ 3RBZA 3O0RC 1C7MA 1HZVA 1ZV8A 1IK9A 4YE1A 3L35A 4YTPC 4BRYB 5KLVK 1CIEA 3VRDA 1GDTA 3CMAP 5H2FE 1RHZB 3PHLA 3Q5PA 2GC4D 4AALA 4N3YB 1T2KC 1SQPE 1EXJA 1FZCC 3IF4A 1YTZT 2LR2A 3TDKA 2HLOA 1S9KE 4K35A 2Z5HA 1L4AD 3C9IA 4IOIH 2YXQB 1LTJA 2POHA 3WUIA 4AUWA 3OW2O 2XV5A 3MZWB 4OH8B 1LTSC 3C1LA 1PL5A 3L72J 2FXOA 4PJ0H 2V7QJ 3HE5A 1AYGA 1NTKE 3KHUA 1IO4A 5CMZA 2CPBA 1EDJA 4Y28J 3WFCC 4H0LD 1A02J 1PPJE 3OA8A 2ZYDA 1P84D 3BCCJ 1HZUA 4AAMA 5KKZB 5CCHA 5GTIE 2BCCE 1U57A 1NU1E 2WSFJ 4L3GA 2KLVA 1NTME 4OGQB 3SVWA 3UIAA 3L73E 2YO3A 3L74E 1XTCC 1IFMA 1KILA 2P7JA 2Y9YA 2YCCA 4OGQC 5CBNA 2KIKA 1PV3A 1N15A 2E74C 2N1TA 1QKSA 3Q5SA 3PH0A 3H1KD 4O1QA 3RL0D 4V2KA 1VQ8P 1R5LA 1L0NJ 1G1IA 2QVAA 1Y8AA 3ZBMA 1H9YA 2FYUG 1RH5B 3PJSK 3QWOC 1FZCA 3H32A 1YIJP 1KX7A 3HQ9A 3HRNA 3SFDC 1LT9B 1FC2C 2H8PD 1VQ5P 5DF5A 1Q2NA 4JBZA 3AEBC 2GUVA 5CIFB 5AW6B 2OYIB 3MUDC 3H1JJ 3O8ZA 1KYOH 3FXDA 3TNUA 3VOPA 1NWQA 1Q86Q 1N86A 3HD7C 3FWNA 1OXZA 4R4LA 1F1FA 1YNRA 2K3RA 4PD4H 2K9YA 5CCGC 1RF1B 2AIUA 5B5EH 1G2CA 2B9BA 4PW9B 2R3CA 2I8DA 3B8EB 3CX5I 1Z56A 2Q7CA 2ITAA 1CSVA 2AEFA 2FXMA 2K37A 4L76A 1MKMA 3CPWO 2CPSA 3BASA 3SXTA 4IFMA 2OYHB 3CXHD 2QM8A 4P4QB 1NAYA 4DOJA 4B86A 4OGQD 4ZNCA 1KC8Q 2DGEA 1ZR4A 1FZEA 3RGUA 1H33A 2AXTV 1H88A 1FOCA 3C2CA 3CYTI 1GK4A 1HGVA 1GZLA 4N78D 5AW3B 1JY3O 3HQ8A 1CORA 2FRCA 1CTYA 1IFPA 2IZ1A 2IYPA 1NMIA 2I1KA 2W6BA 4UB6H 2O01J 5AVRB 3L72D 5CIGB 1PP9G 3MUDA 1BDDA 2IBZI 3HE4B 1AFOA 1H31A 2C0XA 1CI6A 3HD7A 2QSIA 5KAIV 4FA4A 3BCCD 5AVVB 1KFMA 4UB8E 4AYCA 3OCDA 1C6OA 1SQBK 5CCGA 1NKNA 1SFCB 3L37A 1AKKA 3ZOYA 1SQQG 1ZP0C 2LIRA 3U1AA 1NTZE 1M90Q 1DH3A 2B12B 5APTA 2WQYC 1GU5A 1P84E 4FA1A 1YBKA 4Y99B 3WFBC 5CJ4A 2NRGA 4C46A 3SLEA 1DW1A 1QL1A 3FXEA 3VYMA 2QJYC 1W5CE 2OTKE 3D70A 5B66E 4Y99C 3A0HV 2Y9ZA 1RQVA 1S5LV 2A45I 1JCCA 2IYOA 3A0HE 2KZJA 2QEXP 2L4DA 1FI3A 2PGDA 4GT1A 3U1CA 4WQ8A 2NZ2A 2QJKB 1N7SC 1T8ZA 3V2QA 4DCKA 4GODA 1L0ND 1YQ4C 1YTZI 5KLVG 1FS0E 4OVNF 1BGYG 3H1KE 1LNQA 4ZMDA 3A5TA 2YMYA 1ZR2A 3CCJP 1DEEG 1EZVD 4MN4C 5BU8B 1HJ3A 2HODB 1HROA 3OJAB 1AVYA 3O1YA 3T97A 4C7NB 1W2LA 3Q1MA 3H1JD 2A45G 3O5CA 1PFIA 3CX5H 1IFJA 3MIWA 2FYNB 1N50A 1G1JA 3WMM0 1JY3P 2RN0A 1CRIA 1NTKK 1LTIC 1SLQA 1J1EC 3H1LG 3CC7P 1MUUA 1PGPA 1VQNP 2FWLA 1AA0A 2GB8B 2JDIH 2KSJA 1WRGA 2WSSH 1U7JA 1E29A 3AEFC 1CCHA 1H32B 5AW5B 4LGDE 3H1IG 2ZAEB 1JY3N 1NMLA 5AVWB 1YFCA 2KK7A 1ZZHA 1FZBA 1DIQC 1J3SA 3O6QA 5IY51 1BCCG 2YK3A 1N7SA 3JSVC 4R4MA 2KYVA 1CRYA 3WFDC 4HYTB 1W2EA 3ITKA 2BH4X 3CXHE 1EDKA 1TU3F 1DW0A 2N9IA 3TGUJ 1WVEC 2WSCH 1X79B 2K9JA 4JYCA 5KAFV 2D0WA 4AQRD 3D0WA 2WPRA 3VP8A 1GU4A 4Y5RA 3L36A 3GHGB 2QIWA 3I55P 2FKWB 2FYUK 3R4YA 5E79E 5AW8B 1EQ7A 1JEKA 1A56A 3CCSP 1KD1Q 2ZBOA 3L71E 3M0DC 1JO5A 1KYOD 3L72E 2P1JA 3CP5A 4BXLA 2OARA 1OVRA 3V5BA 3P7KA 2YIUC 2H7HA 3WU2V 1EDLA 5TISV 4KT0J 2E75B 2A45H 1CZQA 3A7OA 5KJ7C 5KLIB 3BCCE 3O20A 3H25A 1GW4A 2LXCB 3H1HG 3N7NA 3X39A 2A06G 2KNCB 4L3HA 1CW5A 3PH2B 4PWAA 3USSA 1KB9I 4LJIA 1J1DC 2R5BA 4TLFA 3MD0A 2ZVOB 4H13C 3ABVC 2MHMA 2YKQA 4WQAA 1SQQJ 3Q2YA 1X22A 4IL6V 1HVVA 1YJWP 1IRVA 1SQXK 3V2RA 1N73C 1L0NE 1L4AB 4GOFA 2N3YA 3PTZA 3JCUH 3NWVA 2WSCJ 1GL2C 1MZ9A 3B5NC 4OWFA 2YNYA 1LTJB 1VQ6P 1EZVE 1HH7A 2Q6QA 3WUVA 5GTHH 1JCDA 4AX3A 2V4HA 3FWLA 3HE5B 1JTHA 1M57D 3H1JE 1FDOA 2B88A 4GYDA 1OZHA 2GA1A 1GIWA 4RJTA 5KLVJ 1RAPA 1SQBG 4PJ0V 1BGYJ 5KJ7A 5TJHA 4PJ0E 2PP6A 1IFDA 4IL6X 3TYYA 1WEJF 1YIQA 1NTZK 2QG4A 2HFED 4GKGA 1ETPA 2SPZA 3D6ZA 3A0BV 2MKVA 2VHDA 1KV9A 4FANA 3M9HA 4XXLA 2JKVA 3L4OA 2RKLA 1S6VB 2B4ZA 1BE3G 1W2BO 1EC5A 1KILB 1LTTC 2IFMA 3E7KA 4K3IA 1K73Q 1U74B 2R44A 2AEJA 3E1RA 1I8OA 1CIFA 3TGUD 1JMMA 1ZRTD 1JUNA 1WT6A 1L9JC 1HF9A 2WT7A 4L73A 2N1TC 2KSEA 2W90A 1N73A 2MJZA 2HYNA 3RK3C 5H2FV 1FZCB 4QAOA 3H32B 1M56D 2ZYGA 1GL2A 1Q7YQ 2GUSA 1CSBA 3KZIH 2QRXA 2CE1A 3B5NA 2Z4EA 1GKSA 3VTPC 1FJKA 3VP9A 4KHXA 1BCCJ 5CBOA 1KQSO 5AVSB 1QL4A 3AE9C 4DZOA 1EB7A 1BL9A 2L91A 3B5ND 4HJGH 2C2CA 1NVOA 3TNUB 3CX5D 1URQA 3EQ2A 1NTKG 3VMAA 1KB9H 1SS1A 3VMYA 1QN2A 5CYTR 1NGMB 1KYOE 2PRRA 1SQVD 1KX2A 4LC1A 1G2CB 1EDIA 3NXSA 2J5UA 2BCCG 4PD4E 5GTIV 1BSNA 3A3YB 2E76B 5B5EV 2W6AA 5B5EE 2PFXA 3EWKA 1I54A 1FHBA 4U7JA 3Q3DA 1AVOA 3AEDC 1FBMA 2E76C 3AE8C 5CCHD 2Y0EA 1MFZA 1CHHA 2E74B 1DT1A 4W7YA 1T3UA 4RSZA 4JF7A 4WQDA 1KTMA 5AW9B 2IBZD 3H1HJ 1H33B 1KILD 1NIRA 1FCDC 1USEA 1USDA 2N1TD 1JB0J 3NMDA 4CPGA 2IZ0A 3WUUA 2O01H 1H8AA 1VQ4P 3ORVA 1FZAA 3GG2A 2NPSC 1L0LK 3PLNA 3CCEP 3GW6A 5APQA 3RMZA 1H31B 1CI6B 1T2KD 3W68A 3KQGA 2OZ1A 3PXSA 3HD7B 1CTZA 2O1JA 4UB6E 3CCRP 1BGYD 2ZJSE 1QEXA 3BVHA 1L2PA 1YICA 2AXCA 3CU4A 1H9XA 2XTSB 4WQCA 4JCGA 3BATA 1I6DA 1LWUC 2B87A 4YXDC 4GEDB 2O1KA 1J2JB 2IX7C 1CYJA 2WMMA 1DD4A 3MHVA 1GQ1A 3G71P 1QL3A 2JWDA 1M8OB 1K3HA 4WY4C 2P67A 2QJPC 3CCUP 1SQBJ 1NAFA 2O3JA 2E76D 3L4FA 1CTJA 1PGQA 3AEEC 1HJBA 3AE1C 1AQ5A 1DVHA 2XNDH 3D71A 5L8RJ 1A02F 2V08A 1SQXG 2B10B 2ZXEB 1OW7A 1KYOW 3RN1A 1RY3A 2QA4P 1DX7A 1ZMEC 1A8CA 1S3JA 2E74D 2H89C 3HUSC 5DJUB 2XKMA 1CSXA 3TGUE 1KMIZ 1S4XA 1ZRTE 2IDBA 2C1DB 4ASVA 4QMAA 1FI7A 3T97B 1BCCD 1RE4A 1VYDA 2NPSA 1QX8A 4EIFA 1T3JA 1IZL0 3AECC 2KP8A 3M97X 3CWBG 4WBAA 2N3BA 2WPQA 5CIDB 1M60A 1LP1A 2H88C 1X0TA 1YYCA 4UB8V 1SVFA 4D6TG 3HQ7A 3L75G 3HQ6A 1C2RA 4I7ZC 3CX5E 4FB1A 1CNOA 1LWUA 1E79H 2YXRB 1NTZG 3HD7D 2HV4A 3QH9A 3KPEA 1DD3A 2ZONG 2Q3EA 2BLFB 1YJNP 1SQVE 5CCGD 2QJYB 2KXPB 3F89A 4WY4A 3TF5A 2N18C 1NTKJ 4EIJA 5B66V 1DVVA 1OCDA 3O6QB 2C0WA 4JQ0D 4O1WA 1N7SB 4ASWA 3G4SP 4NPFX 4EICA 3H1HD 1S1CX 4YXWH 1CSWA 2ZZS1 3SSUA 2A06D 3LIDA 3ZIYA 1N90A 4GDOA 1FJ0A 3HUSA 2XDJA 5CJ0A 1ZXGA 3RLMA 3U59A 2K9JB 1LT1A 3SWSA 2IBZE 3AE6C 1HUCA 1X8YA 1KILE 3SWKA 1WMKA 1HBWA 3TYIA 1RAQA 2OYHA 1SQPK 1GJQA 2AXTH 1RF0C 1J1EB 1KB9D 1DEBA 1NOHA 3CD6P 3GMAA 3KXDA 1MV8A 3VMXA 3CCLP 1CYCA 2EXVA 1BGYE 1S5LX 4KJMA 1GDVA 1DIIC 5APYA 2WVRA 2HPCA 2FYUJ 2FFDC 1DW3A 3V2NA 3VNWA 2G8YA 2DW3A 1H0TA 1FOSE 1NNOA 1SQBD 5KAIH 2W27A 4I1LA 1NU1K 5AVTB 1NTMK 2VRSA 2N9YB 3CL3D 2Y0CA 2KLUA 1FU1A 1SFCA 3GLMA 1HJ5A 5AURA 5BVZA 1VQKP 3CX5W 3H6PA 2M0BA 1K3GA 351CA 4EIEA 2ZT9C 1N7SD 1DIPA 3FGAD 3HTKB 1S5LH 1VQLP 1L0LG 4NPDA 2Q9IA 5AVUB 1VQPP 2QM7A 4WQBA 5CIEB 5E79V 4N78E 1BCCE 1KZUB 3JCUE 3L71G 4U3FG 1QLED 1RF0A 1JTHB 1NO4A 1L9BC 1SQXJ 2ZXXA 1HJ4A 4A7PA 2YIUB 3OAKA 1VQMP 2DVHA 5GTHE 1JDLA 1CXCA 1UIXA 3D6YA 1IJDB 1CRJA 2LKMA 3BCCG 3MK7C 4JYBA 2FFDA 2GIWA 1CRCA 3CMEP 1M1KQ 1N7LA 3N4XA 1HWTC 1VQOP 2B89A 4PV1C 1J1DB 1F1CA 3CWBJ 3DR0A 1PP9J 2W83C 3AE2C 4H13B 1YHQP 2LXBA 3NTNA 1MG2D 3L70G 4D6TJ 3L75J 1OVUA 4HH2A 3VMZA 5C0ZA 4H44C 3C8VA 1R8EA 1XTGB 1E2RA 3PP5A 1YCCA 5APXA 2C1UA 1NTZJ 2E5TA 1C52A 4L75A 1CC5A 2P10A 1K8AQ 2WT7B 3H1HE 1N73B 4WQ9A 2A06E 4L74A 2QE7H 5AW1B 1E8EA 3A2AA 5AW4B 2ZT9D 1GL2B 2N9JA 1ZN5A 1AOFA 3B5NB 3A9FA 3IAOA 1QVFO 5EXQA 3M9BA 1FZGA 2LITA 1URQB 3H1JG 3KZIE 1LGHB 3MTUE 3CC2P 1M1JC 4RKUJ 3GF3A 2HG5D 5KAFH 2B0ZB 1LS9A 4EIDA 1URQC 2FYUD 2B11B 1PIXA 1VDFA 3AEGC 1KB9E 2PACA 4DT0A 3OA8B 4EDFA 2KOGA 1W5CT 1JMBA 1I6EA 3Q5RA 1ZW0A 5KJ7D 1SQVK 3VN0A 1VF5C 4BWNA 2YKPA 1HGZA 4PV1D 5KTBA 2WZ7A 3WU2H 2FBWC 4H0LC 1SQBE 5DFSA 1S2EA 5TISH 1LTAC 1U7MA 1CXAA 4WWIA 2M8RA 2M5AA 3H1LJ 5AVYB 1OW6A 1KB0A 4H44D 2ZVNB 2V07A 2OYOA 1NYHA 4H13D 2N1TB 1D7MA 2C8SA 1KQGB 1CIGA 4GOEA 3RK3B 3SWYA 4I2LC 4AANA 3CC4P 1JNMA 3RN0A 2CA4B 2JO1A 3H1IJ 1IFNA 4PD4I 4W80A 1SQPG 2BH5X 3CCQP 3CCVP 2BEQD 4IL6H 5CIHB 1SQXD 3CCMP 2OZ1B 3RL0C 4NPEA 1GL2D 1QYZA 3L4MA 1M1JA 2YKOA 1YTCA 1OW8A 2Q3IA 4KMGA 2L5GB 3IN6A 1CSUA 1L4AA 2B87B 1URQD 1PPJG 2JJLA 3FX0A 1L0LJ 2OQQA 1N9CA 3CWBD 2PCCB 1PP9D 5AVZB 2BCNB 4WQ7A 4IFDK 1NU1G 3L71J 3TSIA 4H0JA 4U3FJ 1CYIA 4D6TD 3L75D 1NTMG 3ZOOA 2C1VA 2WSEJ 3CLQA 1NH4A 1VF5D 3NFQA 3EFGA 4Q5PA 1NTZD 3L73G 2ZYAA 3L74G 4J20A 3P32A 1KQLA 1GU2A 451CA 1SQQD 2CXBA 3K5BA 3BRTB 4EOTA 1C2NA 3A0BH 4HB1A 2JWAA 5C9MA 3S1KA 5M1BA 4WQEA 2YO2A 2YMKA 3W67A 1NJIQ 3M91A 5KKZC 1K04A 2C9NY 1FOSF 2NPSB 4WVZA 3L70J 2KS1A 5DJTB 1CO6A 1ZLLA 1HTLC 5APVA 3RK3D 4NFGB 1K05A 1BDCA 1RE4C 1OIPA 2D2CB 4UB6V 2G3AA 4MU8A 5KLVD 2FYZA 1LP1B 2HR3A 1GMJA 5BU5A 2ZOOA 3AE7C 5H2FH 2D2CC 3PXWA 1LWUB 3KDPB 4TT3H 3OCDB 1CIHA 2PCBB 4BRYA 1Y9BA 2H43A 2AI5A 2FYUE 1R5SA 1S72P 2YQBA 1YQ3C 4WY4B 1T6AA 2QJPB 2BPBB 2Y0DA 3RL0g 1LT9C 2GC7D 2KZIA 2XNXA 3H1LD 3LIEA 2OYIC 1E5WA 4HKZH 2CA3B 2WPSA 2M3BA 5GTIH 1OMIA 3AE4C 2M3EA 3CI9A 1IQCA 1IFIA 1VPCA 3G3ZA 3HUSB 2JP3A 1RF1C 3TGUG 3H1ID 3ZOWA 1N8RQ 3WC8A 1VQ9P 2MTAC 4Z1MH 3PRJA 2K1AA 1AJYA 1CRHA 2JR8A 1KQFB 1L0NK 1A2SA 1M7LA 1BE3J 1P84I 3RK2B 2Z5IA 5AW7B 3MP7B 3ZDMA 2OYHC 2NPSD 4I7ZB 1YITP 1RE3C 2BEZF 1LFMA 1SQXE 3RK2C 1L0LD 1MG3D 4IFFA 2AXTE 2D2CD 1OX3A 5APUA 2HPCB 3PXTA 4AAOA 1GK6A 1LC1A 3L71D 1SQPJ 2ORLA 4U3FD 1SQVG 1H0TB 4L1QA 3P8CD 2N18B 3S4RA 1LT9A 3EFFK 2XU6A 3CWBE 3G9RA 1PP9E 4LLHA 2OYIA 3F5HA 1R0QA 5KAIE 4D6TE 3L75E 5DJQB 3JC22
chains in the Genus database with same CATH topology
3A0BV 2VHDA 1HCMA 1KV9A 2ZXYA 1MZ4A 3ZBMA 1H9YA 4FANA 4XXLA 1L9BC 5DJQC 3L4OA 1S6VB 2B4ZA 1KX7A 1HJ4A 4A7PA 3HQ9A 2YIUB 2DVHA 1JDLA 1CXCA 1LMSA 3L70D 4K3IA 1CRJA 5DF5A 1U74B 2C9XB 3MK7C 5CIFB 2BGVX 1I8OA 2GIWA 1CRCA 1CIFA 3TGUD 1ZRTD 1FI9A 1L9JC 1F1FA 1YNRA 1F1CA 5H2FV 1M70A 3DR0A 4QAOA 2AIUA 1MG2D 2CE1A 4PW9B 1GKSA 5C0ZA 1E2RA 2C1DA 1YCCA 1QL4A 1I55A 2C1UA 1C52A 1EB7A 1BL9A 1CSVA 2L91A 4FA9A 2C2CA 3CX5D 1YEBA 1CC5A 3VMAA 1U75B 1QN2A 4WQ9A 5CYTR 3SXTA 3CXHD 1HRCA 4P4QB 1E8EA 1SQVD 1KX2A 1RZ6A 2N9JA 1AOFA 1C75A 3A9FA 2DGEA 5GTIV 1I5TA 5EXQA 1H33A 5B5EV 2AXTV 1FOCA 3C2CA 3CYTI 1C6RA 1OAEA 2LITA 1I54A 1FHBA 1CCRA 3HQ8A 1CORA 3NBTA 2FRCA 1CTYA 2Y0EA 1NMIA 2B0ZB 1LS9A 1CHHA 4EIDA 4N0KA 1DT1A 3L72D 2FYUD 2B11B 5CIGB 4RSZA 2PACA 4WQDA 1BE3D 1H31A 3OA8B 4EDFA 2IBZD 1W5CT 5KAIV 1H33B 1I6EA 2D0SA 4FA4A 3BCCD 1NIRA 1C6SA 1FCDC 3OCDA 1C6OA 1AKKA 3ZOYA 2LIRA 3ORVA 1DW2A 5DFSA 3GG2A 2B12B 5GTHV 3PLNA 4XYDB 3MK7B 3GW6A 1CXAA 4FA1A 1SQPD 3RMZA 3WFBC 1H31B 3SLEA 3DP5A 2OZ1A 1KB0A 3PXSA 1DW1A 1CTZA 1H1OA 2V07A 3ZOXA 3VYMA 1BGYD 2C8SA 1CIGA 1YICA 3A0HV 3CU4A 4AANA 1H9XA 1M6ZA 2XTSB 4WQCA 1S5LV 4JCGA 2L4DA 1FI3A 3RN0A 1NTKD 4WQ8A 1I6DA 1IO3A 2CA4B 3WFEC 2QJKB 4GEDB 1L0ND 2BH5X 1CYJA 1PPJD 4PD4D 5CIHB 1SQXD 2OZ1B 2BCCD 1GQ1A 155CA 1QL3A 1QYZA 3L4MA 1NU1D 1EZVD 1K3HA 1HJ3A 1HROA 3O1YA 1CHJA 1YTCA 1CRGA 1NTMD 2O3JA 1W2LA 4KMGA 3H1JD 3O5CA 1CTJA 1H32A 1I8PA 3L73D 3L74D 1IRWA 1CHIA 1CSUA 1DVHA 3SJLA 2JTIB 1N9CA 2FYNB 1N50A 2V08A 5CIBB 2B10B 3CWBD 1KYOW 3RN1A 2PCCB 1PP9D 2RN0A 2BCNB 1CRIA 4WQ7A 1A8CA 1CSXA 4H0JA 2C1DB 1CYIA 4D6TD 3KZIV 2FWLA 3L75D 1B7VA 3ZOOA 2C1VA 1FI7A 2GB8B 1BCCD 1VYDA 4Q5PA 1NTZD 4EIFA 4J20A 1E29A 1CEDA 5B6QA 1GU2A 1CCHA 1H32B 5CICB 2JQRA 451CA 1IZL0 1SQQD 2CXBA 3M97X 2N3BA 1NMLA 1C2NA 5CIDB 1M60A 1YFCA 2JWAA 5C9MA 4UB8V 4WQEA 1ZZHA 3HQ7A 3ZCFA 3HQ6A 1C2RA 4DY9A 1DIQC 4FB1A 1J3SA 1CNOA 5IY51 2YK3A 1YEAA 2HV4A 1CRYA 3WFDC 2I8FA 3ITKA 2BH4X 2KS1A 2Q3EA 2ZONG 1CO6A 2BLFB 3JBTB 4NFGB 3DMIA 3CXHW 1DW0A 2N9IA 1WVEC 1LC2A 2QJYB 4H0KA 4UB6V 5KAFV 2RMZA 3NBSA 2D0WA 4MU8A 3TF5A 5KLVD 2N18C 5B66V 1DVVA 2ZOOA 1OCDA 3PXWA 4Y5RA 4O1WA 3OCDB 1CIHA 4EICA 3H1HD 2PCBB 1COTA 1A56A 2AI5A 1CSWA 2ZZS1 2A06D 2ZBOA 1AOQA 3ZIYA 1KYOD 1N90A 3CP5A 1FJ0A 1KIBA 3RLMA 2YQBA 2K9JB 3SWSA 4FA5A 3WU2V 2QJPB 5TISV 2CE0A 2BPBB 1RZ5A 2Y0DA 4FAVA 5KLIB 3O20A 2GC7D 3H1LD 3TYIA 3O0RC 1C7MA 1HZVA 3X39A 2CA3B 1RAQA 2KNCB 4L3HA 4YE1A 1CIEA 3PH2B 4PWAA 1GJQA 3VRDA 3PHLA 2GC4D 4LJIA 1IQCA 4AALA 1KB9D 3TDKA 3H1ID 3ZOWA 1CYCA 2EXVA 3WC8A 2MTAC 2MHMA 3PRJA 1GDVA 4WQAA 1DIIC 3WUIA 1CRHA 4IL6V 1A2SA 1DW3A 1AYGA 3VNWA 3KHUA 1IRVA 1NNOA 1SQBD 3WFCC 3OA8A 1P84D 2N3YA 3PTZA 1HZUA 4AAMA 5KKZB 1LFMA 3NWVA 2N9YB 1L0LD 1MG3D 2Y0CA 1HH7A 4L3GA 3PXTA 1HJ5A 4AX3A 5AURA 4AAOA 3FWLA 3SVWA 3CX5W 1LC1A 3L71D 4GYDA 2ORLA 4U3FD 4RJTA 1GIWA 1RAPA 4L1QA 4PJ0V 1K3GA 351CA 4EIEA 2YCCA 2N18B 5TJHA 1N15A 1WEJF 1YIQA 1QKSA 1R0QA 2QG4A 3H1KD 4O1QA 4WQBA 5DJQB 5CIEB 1ETPA 4V2KA 5E79V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0B V;  2VHD A;  1HCM A;  1KV9 A;  2ZXY A;  1MZ4 A;  3ZBM A;  1H9Y A;  4FAN A;  4XXL A;  1L9B C;  5DJQ C;  3L4O A;  1S6V B;  2B4Z A;  1KX7 A;  1HJ4 A;  4A7P A;  3HQ9 A;  2YIU B;  2DVH A;  1JDL A;  1CXC A;  1LMS A;  3L70 D;  4K3I A;  1CRJ A;  5DF5 A;  1U74 B;  2C9X B;  3MK7 C;  5CIF B;  2BGV X;  1I8O A;  2GIW A;  1CRC A;  1CIF A;  3TGU D;  1ZRT D;  1FI9 A;  1L9J C;  1F1F A;  1YNR A;  1F1C A;  5H2F V;  1M70 A;  3DR0 A;  4QAO A;  2AIU A;  1MG2 D;  2CE1 A;  4PW9 B;  1GKS A;  5C0Z A;  1E2R A;  2C1D A;  1YCC A;  1QL4 A;  1I55 A;  2C1U A;  1C52 A;  1EB7 A;  1BL9 A;  1CSV A;  2L91 A;  4FA9 A;  2C2C A;  3CX5 D;  1YEB A;  1CC5 A;  3VMA A;  1U75 B;  1QN2 A;  4WQ9 A;  5CYT R;  3SXT A;  3CXH D;  1HRC A;  4P4Q B;  1E8E A;  1SQV D;  1KX2 A;  1RZ6 A;  2N9J A;  1AOF A;  1C75 A;  3A9F A;  2DGE A;  5GTI V;  1I5T A;  5EXQ A;  1H33 A;  5B5E V;  2AXT V;  1FOC A;  3C2C A;  3CYT I;  1C6R A;  1OAE A;  2LIT A;  1I54 A;  1FHB A;  1CCR A;  3HQ8 A;  1COR A;  3NBT A;  2FRC A;  1CTY A;  2Y0E A;  1NMI A;  2B0Z B;  1LS9 A;  1CHH A;  4EID A;  4N0K A;  1DT1 A;  3L72 D;  2FYU D;  2B11 B;  5CIG B;  4RSZ A;  2PAC A;  4WQD A;  1BE3 D;  1H31 A;  3OA8 B;  4EDF A;  2IBZ D;  1W5C T;  5KAI V;  1H33 B;  1I6E A;  2D0S A;  4FA4 A;  3BCC D;  1NIR A;  1C6S A;  1FCD C;  3OCD A;  1C6O A;  1AKK A;  3ZOY A;  2LIR A;  3ORV A;  1DW2 A;  5DFS A;  3GG2 A;  2B12 B;  5GTH V;  3PLN A;  4XYD B;  3MK7 B;  3GW6 A;  1CXA A;  4FA1 A;  1SQP D;  3RMZ A;  3WFB C;  1H31 B;  3SLE A;  3DP5 A;  2OZ1 A;  1KB0 A;  3PXS A;  1DW1 A;  1CTZ A;  1H1O A;  2V07 A;  3ZOX A;  3VYM A;  1BGY D;  2C8S A;  1CIG A;  1YIC A;  3A0H V;  3CU4 A;  4AAN A;  1H9X A;  1M6Z A;  2XTS B;  4WQC A;  1S5L V;  4JCG A;  2L4D A;  1FI3 A;  3RN0 A;  1NTK D;  4WQ8 A;  1I6D A;  1IO3 A;  2CA4 B;  3WFE C;  2QJK B;  4GED B;  1L0N D;  2BH5 X;  1CYJ A;  1PPJ D;  4PD4 D;  5CIH B;  1SQX D;  2OZ1 B;  2BCC D;  1GQ1 A;  155C A;  1QL3 A;  1QYZ A;  3L4M A;  1NU1 D;  1EZV D;  1K3H A;  1HJ3 A;  1HRO A;  3O1Y A;  1CHJ A;  1YTC A;  1CRG A;  1NTM D;  2O3J A;  1W2L A;  4KMG A;  3H1J D;  3O5C A;  1CTJ A;  1H32 A;  1I8P A;  3L73 D;  3L74 D;  1IRW A;  1CHI A;  1CSU A;  1DVH A;  3SJL A;  2JTI B;  1N9C A;  2FYN B;  1N50 A;  2V08 A;  5CIB B;  2B10 B;  3CWB D;  1KYO W;  3RN1 A;  2PCC B;  1PP9 D;  2RN0 A;  2BCN B;  1CRI A;  4WQ7 A;  1A8C A;  1CSX A;  4H0J A;  2C1D B;  1CYI A;  4D6T D;  3KZI V;  2FWL A;  3L75 D;  1B7V A;  3ZOO A;  2C1V A;  1FI7 A;  2GB8 B;  1BCC D;  1VYD A;  4Q5P A;  1NTZ D;  4EIF A;  4J20 A;  1E29 A;  1CED A;  5B6Q A;  1GU2 A;  1CCH A;  1H32 B;  5CIC B;  2JQR A;  451C A;  1IZL 0;  1SQQ D;  2CXB A;  3M97 X;  2N3B A;  1NML A;  1C2N A;  5CID B;  1M60 A;  1YFC A;  2JWA A;  5C9M A;  4UB8 V;  4WQE A;  1ZZH A;  3HQ7 A;  3ZCF A;  3HQ6 A;  1C2R A;  4DY9 A;  1DIQ C;  4FB1 A;  1J3S A;  1CNO A;  5IY5 1;  2YK3 A;  1YEA A;  2HV4 A;  1CRY A;  3WFD C;  2I8F A;  3ITK A;  2BH4 X;  2KS1 A;  2Q3E A;  2ZON G;  1CO6 A;  2BLF B;  3JBT B;  4NFG B;  3DMI A;  3CXH W;  1DW0 A;  2N9I A;  1WVE C;  1LC2 A;  2QJY B;  4H0K A;  4UB6 V;  5KAF V;  2RMZ A;  3NBS A;  2D0W A;  4MU8 A;  3TF5 A;  5KLV D;  2N18 C;  5B66 V;  1DVV A;  2ZOO A;  1OCD A;  3PXW A;  4Y5R A;  4O1W A;  3OCD B;  1CIH A;  4EIC A;  3H1H D;  2PCB B;  1COT A;  1A56 A;  2AI5 A;  1CSW A;  2ZZS 1;  2A06 D;  2ZBO A;  1AOQ A;  3ZIY A;  1KYO D;  1N90 A;  3CP5 A;  1FJ0 A;  1KIB A;  3RLM A;  2YQB A;  2K9J B;  3SWS A;  4FA5 A;  3WU2 V;  2QJP B;  5TIS V;  2CE0 A;  2BPB B;  1RZ5 A;  2Y0D A;  4FAV A;  5KLI B;  3O20 A;  2GC7 D;  3H1L D;  3TYI A;  3O0R C;  1C7M A;  1HZV A;  3X39 A;  2CA3 B;  1RAQ A;  2KNC B;  4L3H A;  4YE1 A;  1CIE A;  3PH2 B;  4PWA A;  1GJQ A;  3VRD A;  3PHL A;  2GC4 D;  4LJI A;  1IQC A;  4AAL A;  1KB9 D;  3TDK A;  3H1I D;  3ZOW A;  1CYC A;  2EXV A;  3WC8 A;  2MTA C;  2MHM A;  3PRJ A;  1GDV A;  4WQA A;  1DII C;  3WUI A;  1CRH A;  4IL6 V;  1A2S A;  1DW3 A;  1AYG A;  3VNW A;  3KHU A;  1IRV A;  1NNO A;  1SQB D;  3WFC C;  3OA8 A;  1P84 D;  2N3Y A;  3PTZ A;  1HZU A;  4AAM A;  5KKZ B;  1LFM A;  3NWV A;  2N9Y B;  1L0L D;  1MG3 D;  2Y0C A;  1HH7 A;  4L3G A;  3PXT A;  1HJ5 A;  4AX3 A;  5AUR A;  4AAO A;  3FWL A;  3SVW A;  3CX5 W;  1LC1 A;  3L71 D;  4GYD A;  2ORL A;  4U3F D;  4RJT A;  1GIW A;  1RAP A;  4L1Q A;  4PJ0 V;  1K3G A;  351C A;  4EIE A;  2YCC A;  2N18 B;  5TJH A;  1N15 A;  1WEJ F;  1YIQ A;  1QKS A;  1R0Q A;  2QG4 A;  3H1K D;  4O1Q A;  4WQB A;  5DJQ B;  5CIE B;  1ETP A;  4V2K A;  5E79 V; 
#chains in the Genus database with same CATH topology
 3AE3 C;  1HCM A;  4RES B;  4WY4 D;  2ZXY A;  1IZN B;  1MZ4 A;  4ZKU A;  1KOR A;  5DJQ C;  2E42 A;  1RF1 A;  1SQQ E;  1ZOY C;  1SFC C;  1PGO A;  2BCC J;  1X9V A;  1IK7 A;  1JY2 O;  1PZQ A;  2IBZ G;  1NU1 J;  3SFE C;  1LMS A;  3L70 D;  2KB7 P;  1JOC A;  1NTM J;  3BRV B;  4C7R A;  2C9X B;  3H1K G;  2BGV X;  1OFC X;  1FI9 A;  3L73 J;  3L74 J;  2OTJ P;  5APS A;  1KV4 A;  1BSH A;  4WB4 A;  1S5L E;  1M70 A;  1RE3 A;  3RK3 E;  3B71 A;  5C39 A;  2KI7 B;  1RQU A;  1HJ0 A;  2E43 A;  2QJK C;  2FXP A;  2R32 A;  4XA4 A;  5KLV E;  1AQT A;  2C1D A;  3RK2 D;  3KYQ A;  2FFD B;  1I55 A;  1GW3 A;  3OA7 A;  3V4Q A;  4FA9 A;  1NHL A;  1YEB A;  3M9Q A;  1Q90 D;  1U75 B;  3CXH I;  2CK3 H;  3M06 A;  3AE5 C;  3R2P A;  3GF7 A;  3S9O A;  1HRC A;  3AEA C;  4UB8 H;  2JEE A;  3TK1 A;  5AW0 B;  1LTG C;  4ZKP A;  2IPP A;  3HE4 A;  1RZ6 A;  5AVX B;  1C75 A;  2PAJ A;  3P8M C;  4I6M C;  5K5G B;  2ZFC A;  1I5T A;  2FYN C;  1C6R A;  1OAE A;  3H1L E;  1CCR A;  1P84 H;  3NBT A;  2ZT9 B;  4EI2 A;  3RBX A;  4N0K A;  1SFC D;  3V4W A;  4DJG A;  5B66 H;  3LW5 H;  3I5C A;  1Q81 Q;  1BE3 D;  2K88 A;  3A0H H;  1Y47 A;  3H1I E;  2KUB A;  2D0S A;  1PGJ A;  2OGU A;  1C6S A;  2R3S A;  1YJ9 P;  2FY8 A;  4YPC A;  1KFN A;  1JY2 P;  1YI2 P;  5APW A;  1LJ2 A;  3L72 G;  1DW2 A;  2O01 N;  5GTH V;  4XYD B;  3WUT A;  3MK7 B;  4XE5 B;  2R5D A;  1SQP D;  2WWW A;  2GM4 A;  2W6J H;  4GIF A;  3DP5 A;  1IC2 A;  1H1O A;  3ZOX A;  5KAF E;  1S9K D;  2J58 A;  1L0L E;  4PV1 B;  3E1I A;  2HOD A;  1JY2 N;  4N6J A;  4C7N A;  1M6Z A;  3G6E P;  4W7Z A;  4U3F E;  1NTK D;  3SWF A;  3MGN A;  3GHG C;  1H89 A;  1IO3 A;  3WFE C;  4H44 B;  3II6 A;  3P8C E;  1HH0 A;  2AEM A;  1PPJ D;  4PD4 D;  2M5A B;  1EZV I;  1OWA A;  1LTB C;  3WU2 E;  2BCC D;  155C A;  5TIS E;  1FE6 A;  1NU1 D;  1VQ7 P;  1QGK B;  1UII A;  1SQV J;  1CHJ A;  4K3A A;  1CRG A;  1NTM D;  2E75 C;  1FDM A;  5KLI C;  1FDI A;  5AVQ B;  2IFN A;  1H32 A;  1I8P A;  3L73 D;  3L74 D;  1MFT A;  4EYY Q;  1L0N G;  1IRW A;  1CHI A;  3SJL A;  1EXI A;  2E5Y A;  2JTI B;  4O9B A;  3L70 E;  5CIB B;  3LW5 J;  2C9L Y;  2Q5U A;  5CHX A;  1KN7 A;  1Q82 Q;  3CXH H;  1JM0 A;  1EZV G;  3KZI V;  1M1J B;  1B7V A;  1OVV A;  2BAS A;  4IL6 E;  2P2U A;  1CED A;  5B6Q A;  2I1J A;  5CIC B;  2JQR A;  2XZR A;  1NKZ B;  3H1K J;  3HTK A;  3M0A A;  5E79 H;  4RO0 A;  3B4S A;  1VF5 B;  1L4A C;  2J59 M;  3ZCF A;  4DY9 A;  3M0D A;  5EFW B;  4JPZ B;  2WSE H;  1GTW A;  1GD2 E;  3GHG A;  2OTL P;  2V7Q H;  3IFM A;  3V6I A;  1YEA A;  4H0L B;  1QVG O;  2I8F A;  1LTJ C;  2UWJ E;  2WIT A;  4XFJ A;  3JBT B;  3I56 P;  2P58 A;  3DMI A;  3CXH W;  1LC2 A;  4H0K A;  2RMZ A;  3NBS A;  2W8Z A;  2WSF H;  1SQQ K;  4M3L A;  2N9B A;  2WPV B;  1QL2 A;  5CCH C;  2E75 D;  2KNC A;  1KYO I;  3A0B E;  1COT A;  1VL2 A;  2RH0 A;  1FAV A;  3VYI A;  3V2P A;  2KS1 B;  1AOQ A;  1FZF A;  3RL0 B;  1BE3 E;  1KIB A;  1SP4 A;  2Q1K A;  1FJP A;  4FA5 A;  1KIL C;  2WTY A;  2CE0 A;  5AW2 B;  1RZ5 A;  4FAV A;  1AV1 A;  1N2D C;  3IR9 A;  1K9M Q;  3RBZ A;  3O0R C;  1C7M A;  1HZV A;  1ZV8 A;  1IK9 A;  4YE1 A;  3L35 A;  4YTP C;  4BRY B;  5KLV K;  1CIE A;  3VRD A;  1GDT A;  3CMA P;  5H2F E;  1RHZ B;  3PHL A;  3Q5P A;  2GC4 D;  4AAL A;  4N3Y B;  1T2K C;  1SQP E;  1EXJ A;  1FZC C;  3IF4 A;  1YTZ T;  2LR2 A;  3TDK A;  2HLO A;  1S9K E;  4K35 A;  2Z5H A;  1L4A D;  3C9I A;  4IOI H;  2YXQ B;  1LTJ A;  2POH A;  3WUI A;  4AUW A;  3OW2 O;  2XV5 A;  3MZW B;  4OH8 B;  1LTS C;  3C1L A;  1PL5 A;  3L72 J;  2FXO A;  4PJ0 H;  2V7Q J;  3HE5 A;  1AYG A;  1NTK E;  3KHU A;  1IO4 A;  5CMZ A;  2CPB A;  1EDJ A;  4Y28 J;  3WFC C;  4H0L D;  1A02 J;  1PPJ E;  3OA8 A;  2ZYD A;  1P84 D;  3BCC J;  1HZU A;  4AAM A;  5KKZ B;  5CCH A;  5GTI E;  2BCC E;  1U57 A;  1NU1 E;  2WSF J;  4L3G A;  2KLV A;  1NTM E;  4OGQ B;  3SVW A;  3UIA A;  3L73 E;  2YO3 A;  3L74 E;  1XTC C;  1IFM A;  1KIL A;  2P7J A;  2Y9Y A;  2YCC A;  4OGQ C;  5CBN A;  2KIK A;  1PV3 A;  1N15 A;  2E74 C;  2N1T A;  1QKS A;  3Q5S A;  3PH0 A;  3H1K D;  4O1Q A;  3RL0 D;  4V2K A;  1VQ8 P;  1R5L A;  1L0N J;  1G1I A;  2QVA A;  1Y8A A;  3ZBM A;  1H9Y A;  2FYU G;  1RH5 B;  3PJS K;  3QWO C;  1FZC A;  3H32 A;  1YIJ P;  1KX7 A;  3HQ9 A;  3HRN A;  3SFD C;  1LT9 B;  1FC2 C;  2H8P D;  1VQ5 P;  5DF5 A;  1Q2N A;  4JBZ A;  3AEB C;  2GUV A;  5CIF B;  5AW6 B;  2OYI B;  3MUD C;  3H1J J;  3O8Z A;  1KYO H;  3FXD A;  3TNU A;  3VOP A;  1NWQ A;  1Q86 Q;  1N86 A;  3HD7 C;  3FWN A;  1OXZ A;  4R4L A;  1F1F A;  1YNR A;  2K3R A;  4PD4 H;  2K9Y A;  5CCG C;  1RF1 B;  2AIU A;  5B5E H;  1G2C A;  2B9B A;  4PW9 B;  2R3C A;  2I8D A;  3B8E B;  3CX5 I;  1Z56 A;  2Q7C A;  2ITA A;  1CSV A;  2AEF A;  2FXM A;  2K37 A;  4L76 A;  1MKM A;  3CPW O;  2CPS A;  3BAS A;  3SXT A;  4IFM A;  2OYH B;  3CXH D;  2QM8 A;  4P4Q B;  1NAY A;  4DOJ A;  4B86 A;  4OGQ D;  4ZNC A;  1KC8 Q;  2DGE A;  1ZR4 A;  1FZE A;  3RGU A;  1H33 A;  2AXT V;  1H88 A;  1FOC A;  3C2C A;  3CYT I;  1GK4 A;  1HGV A;  1GZL A;  4N78 D;  5AW3 B;  1JY3 O;  3HQ8 A;  1COR A;  2FRC A;  1CTY A;  1IFP A;  2IZ1 A;  2IYP A;  1NMI A;  2I1K A;  2W6B A;  4UB6 H;  2O01 J;  5AVR B;  3L72 D;  5CIG B;  1PP9 G;  3MUD A;  1BDD A;  2IBZ I;  3HE4 B;  1AFO A;  1H31 A;  2C0X A;  1CI6 A;  3HD7 A;  2QSI A;  5KAI V;  4FA4 A;  3BCC D;  5AVV B;  1KFM A;  4UB8 E;  4AYC A;  3OCD A;  1C6O A;  1SQB K;  5CCG A;  1NKN A;  1SFC B;  3L37 A;  1AKK A;  3ZOY A;  1SQQ G;  1ZP0 C;  2LIR A;  3U1A A;  1NTZ E;  1M90 Q;  1DH3 A;  2B12 B;  5APT A;  2WQY C;  1GU5 A;  1P84 E;  4FA1 A;  1YBK A;  4Y99 B;  3WFB C;  5CJ4 A;  2NRG A;  4C46 A;  3SLE A;  1DW1 A;  1QL1 A;  3FXE A;  3VYM A;  2QJY C;  1W5C E;  2OTK E;  3D70 A;  5B66 E;  4Y99 C;  3A0H V;  2Y9Z A;  1RQV A;  1S5L V;  2A45 I;  1JCC A;  2IYO A;  3A0H E;  2KZJ A;  2QEX P;  2L4D A;  1FI3 A;  2PGD A;  4GT1 A;  3U1C A;  4WQ8 A;  2NZ2 A;  2QJK B;  1N7S C;  1T8Z A;  3V2Q A;  4DCK A;  4GOD A;  1L0N D;  1YQ4 C;  1YTZ I;  5KLV G;  1FS0 E;  4OVN F;  1BGY G;  3H1K E;  1LNQ A;  4ZMD A;  3A5T A;  2YMY A;  1ZR2 A;  3CCJ P;  1DEE G;  1EZV D;  4MN4 C;  5BU8 B;  1HJ3 A;  2HOD B;  1HRO A;  3OJA B;  1AVY A;  3O1Y A;  3T97 A;  4C7N B;  1W2L A;  3Q1M A;  3H1J D;  2A45 G;  3O5C A;  1PFI A;  3CX5 H;  1IFJ A;  3MIW A;  2FYN B;  1N50 A;  1G1J A;  3WMM 0;  1JY3 P;  2RN0 A;  1CRI A;  1NTK K;  1LTI C;  1SLQ A;  1J1E C;  3H1L G;  3CC7 P;  1MUU A;  1PGP A;  1VQN P;  2FWL A;  1AA0 A;  2GB8 B;  2JDI H;  2KSJ A;  1WRG A;  2WSS H;  1U7J A;  1E29 A;  3AEF C;  1CCH A;  1H32 B;  5AW5 B;  4LGD E;  3H1I G;  2ZAE B;  1JY3 N;  1NML A;  5AVW B;  1YFC A;  2KK7 A;  1ZZH A;  1FZB A;  1DIQ C;  1J3S A;  3O6Q A;  5IY5 1;  1BCC G;  2YK3 A;  1N7S A;  3JSV C;  4R4M A;  2KYV A;  1CRY A;  3WFD C;  4HYT B;  1W2E A;  3ITK A;  2BH4 X;  3CXH E;  1EDK A;  1TU3 F;  1DW0 A;  2N9I A;  3TGU J;  1WVE C;  2WSC H;  1X79 B;  2K9J A;  4JYC A;  5KAF V;  2D0W A;  4AQR D;  3D0W A;  2WPR A;  3VP8 A;  1GU4 A;  4Y5R A;  3L36 A;  3GHG B;  2QIW A;  3I55 P;  2FKW B;  2FYU K;  3R4Y A;  5E79 E;  5AW8 B;  1EQ7 A;  1JEK A;  1A56 A;  3CCS P;  1KD1 Q;  2ZBO A;  3L71 E;  3M0D C;  1JO5 A;  1KYO D;  3L72 E;  2P1J A;  3CP5 A;  4BXL A;  2OAR A;  1OVR A;  3V5B A;  3P7K A;  2YIU C;  2H7H A;  3WU2 V;  1EDL A;  5TIS V;  4KT0 J;  2E75 B;  2A45 H;  1CZQ A;  3A7O A;  5KJ7 C;  5KLI B;  3BCC E;  3O20 A;  3H25 A;  1GW4 A;  2LXC B;  3H1H G;  3N7N A;  3X39 A;  2A06 G;  2KNC B;  4L3H A;  1CW5 A;  3PH2 B;  4PWA A;  3USS A;  1KB9 I;  4LJI A;  1J1D C;  2R5B A;  4TLF A;  3MD0 A;  2ZVO B;  4H13 C;  3ABV C;  2MHM A;  2YKQ A;  4WQA A;  1SQQ J;  3Q2Y A;  1X22 A;  4IL6 V;  1HVV A;  1YJW P;  1IRV A;  1SQX K;  3V2R A;  1N73 C;  1L0N E;  1L4A B;  4GOF A;  2N3Y A;  3PTZ A;  3JCU H;  3NWV A;  2WSC J;  1GL2 C;  1MZ9 A;  3B5N C;  4OWF A;  2YNY A;  1LTJ B;  1VQ6 P;  1EZV E;  1HH7 A;  2Q6Q A;  3WUV A;  5GTH H;  1JCD A;  4AX3 A;  2V4H A;  3FWL A;  3HE5 B;  1JTH A;  1M57 D;  3H1J E;  1FDO A;  2B88 A;  4GYD A;  1OZH A;  2GA1 A;  1GIW A;  4RJT A;  5KLV J;  1RAP A;  1SQB G;  4PJ0 V;  1BGY J;  5KJ7 A;  5TJH A;  4PJ0 E;  2PP6 A;  1IFD A;  4IL6 X;  3TYY A;  1WEJ F;  1YIQ A;  1NTZ K;  2QG4 A;  2HFE D;  4GKG A;  1ETP A;  2SPZ A;  3D6Z A;  3A0B V;  2MKV A;  2VHD A;  1KV9 A;  4FAN A;  3M9H A;  4XXL A;  2JKV A;  3L4O A;  2RKL A;  1S6V B;  2B4Z A;  1BE3 G;  1W2B O;  1EC5 A;  1KIL B;  1LTT C;  2IFM A;  3E7K A;  4K3I A;  1K73 Q;  1U74 B;  2R44 A;  2AEJ A;  3E1R A;  1I8O A;  1CIF A;  3TGU D;  1JMM A;  1ZRT D;  1JUN A;  1WT6 A;  1L9J C;  1HF9 A;  2WT7 A;  4L73 A;  2N1T C;  2KSE A;  2W90 A;  1N73 A;  2MJZ A;  2HYN A;  3RK3 C;  5H2F V;  1FZC B;  4QAO A;  3H32 B;  1M56 D;  2ZYG A;  1GL2 A;  1Q7Y Q;  2GUS A;  1CSB A;  3KZI H;  2QRX A;  2CE1 A;  3B5N A;  2Z4E A;  1GKS A;  3VTP C;  1FJK A;  3VP9 A;  4KHX A;  1BCC J;  5CBO A;  1KQS O;  5AVS B;  1QL4 A;  3AE9 C;  4DZO A;  1EB7 A;  1BL9 A;  2L91 A;  3B5N D;  4HJG H;  2C2C A;  1NVO A;  3TNU B;  3CX5 D;  1URQ A;  3EQ2 A;  1NTK G;  3VMA A;  1KB9 H;  1SS1 A;  3VMY A;  1QN2 A;  5CYT R;  1NGM B;  1KYO E;  2PRR A;  1SQV D;  1KX2 A;  4LC1 A;  1G2C B;  1EDI A;  3NXS A;  2J5U A;  2BCC G;  4PD4 E;  5GTI V;  1BSN A;  3A3Y B;  2E76 B;  5B5E V;  2W6A A;  5B5E E;  2PFX A;  3EWK A;  1I54 A;  1FHB A;  4U7J A;  3Q3D A;  1AVO A;  3AED C;  1FBM A;  2E76 C;  3AE8 C;  5CCH D;  2Y0E A;  1MFZ A;  1CHH A;  2E74 B;  1DT1 A;  4W7Y A;  1T3U A;  4RSZ A;  4JF7 A;  4WQD A;  1KTM A;  5AW9 B;  2IBZ D;  3H1H J;  1H33 B;  1KIL D;  1NIR A;  1FCD C;  1USE A;  1USD A;  2N1T D;  1JB0 J;  3NMD A;  4CPG A;  2IZ0 A;  3WUU A;  2O01 H;  1H8A A;  1VQ4 P;  3ORV A;  1FZA A;  3GG2 A;  2NPS C;  1L0L K;  3PLN A;  3CCE P;  3GW6 A;  5APQ A;  3RMZ A;  1H31 B;  1CI6 B;  1T2K D;  3W68 A;  3KQG A;  2OZ1 A;  3PXS A;  3HD7 B;  1CTZ A;  2O1J A;  4UB6 E;  3CCR P;  1BGY D;  2ZJS E;  1QEX A;  3BVH A;  1L2P A;  1YIC A;  2AXC A;  3CU4 A;  1H9X A;  2XTS B;  4WQC A;  4JCG A;  3BAT A;  1I6D A;  1LWU C;  2B87 A;  4YXD C;  4GED B;  2O1K A;  1J2J B;  2IX7 C;  1CYJ A;  2WMM A;  1DD4 A;  3MHV A;  1GQ1 A;  3G71 P;  1QL3 A;  2JWD A;  1M8O B;  1K3H A;  4WY4 C;  2P67 A;  2QJP C;  3CCU P;  1SQB J;  1NAF A;  2O3J A;  2E76 D;  3L4F A;  1CTJ A;  1PGQ A;  3AEE C;  1HJB A;  3AE1 C;  1AQ5 A;  1DVH A;  2XND H;  3D71 A;  5L8R J;  1A02 F;  2V08 A;  1SQX G;  2B10 B;  2ZXE B;  1OW7 A;  1KYO W;  3RN1 A;  1RY3 A;  2QA4 P;  1DX7 A;  1ZME C;  1A8C A;  1S3J A;  2E74 D;  2H89 C;  3HUS C;  5DJU B;  2XKM A;  1CSX A;  3TGU E;  1KMI Z;  1S4X A;  1ZRT E;  2IDB A;  2C1D B;  4ASV A;  4QMA A;  1FI7 A;  3T97 B;  1BCC D;  1RE4 A;  1VYD A;  2NPS A;  1QX8 A;  4EIF A;  1T3J A;  1IZL 0;  3AEC C;  2KP8 A;  3M97 X;  3CWB G;  4WBA A;  2N3B A;  2WPQ A;  5CID B;  1M60 A;  1LP1 A;  2H88 C;  1X0T A;  1YYC A;  4UB8 V;  1SVF A;  4D6T G;  3HQ7 A;  3L75 G;  3HQ6 A;  1C2R A;  4I7Z C;  3CX5 E;  4FB1 A;  1CNO A;  1LWU A;  1E79 H;  2YXR B;  1NTZ G;  3HD7 D;  2HV4 A;  3QH9 A;  3KPE A;  1DD3 A;  2ZON G;  2Q3E A;  2BLF B;  1YJN P;  1SQV E;  5CCG D;  2QJY B;  2KXP B;  3F89 A;  4WY4 A;  3TF5 A;  2N18 C;  1NTK J;  4EIJ A;  5B66 V;  1DVV A;  1OCD A;  3O6Q B;  2C0W A;  4JQ0 D;  4O1W A;  1N7S B;  4ASW A;  3G4S P;  4NPF X;  4EIC A;  3H1H D;  1S1C X;  4YXW H;  1CSW A;  2ZZS 1;  3SSU A;  2A06 D;  3LID A;  3ZIY A;  1N90 A;  4GDO A;  1FJ0 A;  3HUS A;  2XDJ A;  5CJ0 A;  1ZXG A;  3RLM A;  3U59 A;  2K9J B;  1LT1 A;  3SWS A;  2IBZ E;  3AE6 C;  1HUC A;  1X8Y A;  1KIL E;  3SWK A;  1WMK A;  1HBW A;  3TYI A;  1RAQ A;  2OYH A;  1SQP K;  1GJQ A;  2AXT H;  1RF0 C;  1J1E B;  1KB9 D;  1DEB A;  1NOH A;  3CD6 P;  3GMA A;  3KXD A;  1MV8 A;  3VMX A;  3CCL P;  1CYC A;  2EXV A;  1BGY E;  1S5L X;  4KJM A;  1GDV A;  1DII C;  5APY A;  2WVR A;  2HPC A;  2FYU J;  2FFD C;  1DW3 A;  3V2N A;  3VNW A;  2G8Y A;  2DW3 A;  1H0T A;  1FOS E;  1NNO A;  1SQB D;  5KAI H;  2W27 A;  4I1L A;  1NU1 K;  5AVT B;  1NTM K;  2VRS A;  2N9Y B;  3CL3 D;  2Y0C A;  2KLU A;  1FU1 A;  1SFC A;  3GLM A;  1HJ5 A;  5AUR A;  5BVZ A;  1VQK P;  3CX5 W;  3H6P A;  2M0B A;  1K3G A;  351C A;  4EIE A;  2ZT9 C;  1N7S D;  1DIP A;  3FGA D;  3HTK B;  1S5L H;  1VQL P;  1L0L G;  4NPD A;  2Q9I A;  5AVU B;  1VQP P;  2QM7 A;  4WQB A;  5CIE B;  5E79 V;  4N78 E;  1BCC E;  1KZU B;  3JCU E;  3L71 G;  4U3F G;  1QLE D;  1RF0 A;  1JTH B;  1NO4 A;  1L9B C;  1SQX J;  2ZXX A;  1HJ4 A;  4A7P A;  2YIU B;  3OAK A;  1VQM P;  2DVH A;  5GTH E;  1JDL A;  1CXC A;  1UIX A;  3D6Y A;  1IJD B;  1CRJ A;  2LKM A;  3BCC G;  3MK7 C;  4JYB A;  2FFD A;  2GIW A;  1CRC A;  3CME P;  1M1K Q;  1N7L A;  3N4X A;  1HWT C;  1VQO P;  2B89 A;  4PV1 C;  1J1D B;  1F1C A;  3CWB J;  3DR0 A;  1PP9 J;  2W83 C;  3AE2 C;  4H13 B;  1YHQ P;  2LXB A;  3NTN A;  1MG2 D;  3L70 G;  4D6T J;  3L75 J;  1OVU A;  4HH2 A;  3VMZ A;  5C0Z A;  4H44 C;  3C8V A;  1R8E A;  1XTG B;  1E2R A;  3PP5 A;  1YCC A;  5APX A;  2C1U A;  1NTZ J;  2E5T A;  1C52 A;  4L75 A;  1CC5 A;  2P10 A;  1K8A Q;  2WT7 B;  3H1H E;  1N73 B;  4WQ9 A;  2A06 E;  4L74 A;  2QE7 H;  5AW1 B;  1E8E A;  3A2A A;  5AW4 B;  2ZT9 D;  1GL2 B;  2N9J A;  1ZN5 A;  1AOF A;  3B5N B;  3A9F A;  3IAO A;  1QVF O;  5EXQ A;  3M9B A;  1FZG A;  2LIT A;  1URQ B;  3H1J G;  3KZI E;  1LGH B;  3MTU E;  3CC2 P;  1M1J C;  4RKU J;  3GF3 A;  2HG5 D;  5KAF H;  2B0Z B;  1LS9 A;  4EID A;  1URQ C;  2FYU D;  2B11 B;  1PIX A;  1VDF A;  3AEG C;  1KB9 E;  2PAC A;  4DT0 A;  3OA8 B;  4EDF A;  2KOG A;  1W5C T;  1JMB A;  1I6E A;  3Q5R A;  1ZW0 A;  5KJ7 D;  1SQV K;  3VN0 A;  1VF5 C;  4BWN A;  2YKP A;  1HGZ A;  4PV1 D;  5KTB A;  2WZ7 A;  3WU2 H;  2FBW C;  4H0L C;  1SQB E;  5DFS A;  1S2E A;  5TIS H;  1LTA C;  1U7M A;  1CXA A;  4WWI A;  2M8R A;  2M5A A;  3H1L J;  5AVY B;  1OW6 A;  1KB0 A;  4H44 D;  2ZVN B;  2V07 A;  2OYO A;  1NYH A;  4H13 D;  2N1T B;  1D7M A;  2C8S A;  1KQG B;  1CIG A;  4GOE A;  3RK3 B;  3SWY A;  4I2L C;  4AAN A;  3CC4 P;  1JNM A;  3RN0 A;  2CA4 B;  2JO1 A;  3H1I J;  1IFN A;  4PD4 I;  4W80 A;  1SQP G;  2BH5 X;  3CCQ P;  3CCV P;  2BEQ D;  4IL6 H;  5CIH B;  1SQX D;  3CCM P;  2OZ1 B;  3RL0 C;  4NPE A;  1GL2 D;  1QYZ A;  3L4M A;  1M1J A;  2YKO A;  1YTC A;  1OW8 A;  2Q3I A;  4KMG A;  2L5G B;  3IN6 A;  1CSU A;  1L4A A;  2B87 B;  1URQ D;  1PPJ G;  2JJL A;  3FX0 A;  1L0L J;  2OQQ A;  1N9C A;  3CWB D;  2PCC B;  1PP9 D;  5AVZ B;  2BCN B;  4WQ7 A;  4IFD K;  1NU1 G;  3L71 J;  3TSI A;  4H0J A;  4U3F J;  1CYI A;  4D6T D;  3L75 D;  1NTM G;  3ZOO A;  2C1V A;  2WSE J;  3CLQ A;  1NH4 A;  1VF5 D;  3NFQ A;  3EFG A;  4Q5P A;  1NTZ D;  3L73 G;  2ZYA A;  3L74 G;  4J20 A;  3P32 A;  1KQL A;  1GU2 A;  451C A;  1SQQ D;  2CXB A;  3K5B A;  3BRT B;  4EOT A;  1C2N A;  3A0B H;  4HB1 A;  2JWA A;  5C9M A;  3S1K A;  5M1B A;  4WQE A;  2YO2 A;  2YMK A;  3W67 A;  1NJI Q;  3M91 A;  5KKZ C;  1K04 A;  2C9N Y;  1FOS F;  2NPS B;  4WVZ A;  3L70 J;  2KS1 A;  5DJT B;  1CO6 A;  1ZLL A;  1HTL C;  5APV A;  3RK3 D;  4NFG B;  1K05 A;  1BDC A;  1RE4 C;  1OIP A;  2D2C B;  4UB6 V;  2G3A A;  4MU8 A;  5KLV D;  2FYZ A;  1LP1 B;  2HR3 A;  1GMJ A;  5BU5 A;  2ZOO A;  3AE7 C;  5H2F H;  2D2C C;  3PXW A;  1LWU B;  3KDP B;  4TT3 H;  3OCD B;  1CIH A;  2PCB B;  4BRY A;  1Y9B A;  2H43 A;  2AI5 A;  2FYU E;  1R5S A;  1S72 P;  2YQB A;  1YQ3 C;  4WY4 B;  1T6A A;  2QJP B;  2BPB B;  2Y0D A;  3RL0 g;  1LT9 C;  2GC7 D;  2KZI A;  2XNX A;  3H1L D;  3LIE A;  2OYI C;  1E5W A;  4HKZ H;  2CA3 B;  2WPS A;  2M3B A;  5GTI H;  1OMI A;  3AE4 C;  2M3E A;  3CI9 A;  1IQC A;  1IFI A;  1VPC A;  3G3Z A;  3HUS B;  2JP3 A;  1RF1 C;  3TGU G;  3H1I D;  3ZOW A;  1N8R Q;  3WC8 A;  1VQ9 P;  2MTA C;  4Z1M H;  3PRJ A;  2K1A A;  1AJY A;  1CRH A;  2JR8 A;  1KQF B;  1L0N K;  1A2S A;  1M7L A;  1BE3 J;  1P84 I;  3RK2 B;  2Z5I A;  5AW7 B;  3MP7 B;  3ZDM A;  2OYH C;  2NPS D;  4I7Z B;  1YIT P;  1RE3 C;  2BEZ F;  1LFM A;  1SQX E;  3RK2 C;  1L0L D;  1MG3 D;  4IFF A;  2AXT E;  2D2C D;  1OX3 A;  5APU A;  2HPC B;  3PXT A;  4AAO A;  1GK6 A;  1LC1 A;  3L71 D;  1SQP J;  2ORL A;  4U3F D;  1SQV G;  1H0T B;  4L1Q A;  3P8C D;  2N18 B;  3S4R A;  1LT9 A;  3EFF K;  2XU6 A;  3CWB E;  3G9R A;  1PP9 E;  4LLH A;  2OYI A;  3F5H A;  1R0Q A;  5KAI E;  4D6T E;  3L75 E;  5DJQ B;  3JC2 2; 
#chains in the Genus database with same CATH homology
 3A0B V;  2VHD A;  1HCM A;  1KV9 A;  2ZXY A;  1MZ4 A;  3ZBM A;  1H9Y A;  4FAN A;  4XXL A;  1L9B C;  5DJQ C;  3L4O A;  1S6V B;  2B4Z A;  1KX7 A;  1HJ4 A;  4A7P A;  3HQ9 A;  2YIU B;  2DVH A;  1JDL A;  1CXC A;  1LMS A;  3L70 D;  4K3I A;  1CRJ A;  5DF5 A;  1U74 B;  2C9X B;  3MK7 C;  5CIF B;  2BGV X;  1I8O A;  2GIW A;  1CRC A;  1CIF A;  3TGU D;  1ZRT D;  1FI9 A;  1L9J C;  1F1F A;  1YNR A;  1F1C A;  5H2F V;  1M70 A;  3DR0 A;  4QAO A;  2AIU A;  1MG2 D;  2CE1 A;  4PW9 B;  1GKS A;  5C0Z A;  1E2R A;  2C1D A;  1YCC A;  1QL4 A;  1I55 A;  2C1U A;  1C52 A;  1EB7 A;  1BL9 A;  1CSV A;  2L91 A;  4FA9 A;  2C2C A;  3CX5 D;  1YEB A;  1CC5 A;  3VMA A;  1U75 B;  1QN2 A;  4WQ9 A;  5CYT R;  3SXT A;  3CXH D;  1HRC A;  4P4Q B;  1E8E A;  1SQV D;  1KX2 A;  1RZ6 A;  2N9J A;  1AOF A;  1C75 A;  3A9F A;  2DGE A;  5GTI V;  1I5T A;  5EXQ A;  1H33 A;  5B5E V;  2AXT V;  1FOC A;  3C2C A;  3CYT I;  1C6R A;  1OAE A;  2LIT A;  1I54 A;  1FHB A;  1CCR A;  3HQ8 A;  1COR A;  3NBT A;  2FRC A;  1CTY A;  2Y0E A;  1NMI A;  2B0Z B;  1LS9 A;  1CHH A;  4EID A;  4N0K A;  1DT1 A;  3L72 D;  2FYU D;  2B11 B;  5CIG B;  4RSZ A;  2PAC A;  4WQD A;  1BE3 D;  1H31 A;  3OA8 B;  4EDF A;  2IBZ D;  1W5C T;  5KAI V;  1H33 B;  1I6E A;  2D0S A;  4FA4 A;  3BCC D;  1NIR A;  1C6S A;  1FCD C;  3OCD A;  1C6O A;  1AKK A;  3ZOY A;  2LIR A;  3ORV A;  1DW2 A;  5DFS A;  3GG2 A;  2B12 B;  5GTH V;  3PLN A;  4XYD B;  3MK7 B;  3GW6 A;  1CXA A;  4FA1 A;  1SQP D;  3RMZ A;  3WFB C;  1H31 B;  3SLE A;  3DP5 A;  2OZ1 A;  1KB0 A;  3PXS A;  1DW1 A;  1CTZ A;  1H1O A;  2V07 A;  3ZOX A;  3VYM A;  1BGY D;  2C8S A;  1CIG A;  1YIC A;  3A0H V;  3CU4 A;  4AAN A;  1H9X A;  1M6Z A;  2XTS B;  4WQC A;  1S5L V;  4JCG A;  2L4D A;  1FI3 A;  3RN0 A;  1NTK D;  4WQ8 A;  1I6D A;  1IO3 A;  2CA4 B;  3WFE C;  2QJK B;  4GED B;  1L0N D;  2BH5 X;  1CYJ A;  1PPJ D;  4PD4 D;  5CIH B;  1SQX D;  2OZ1 B;  2BCC D;  1GQ1 A;  155C A;  1QL3 A;  1QYZ A;  3L4M A;  1NU1 D;  1EZV D;  1K3H A;  1HJ3 A;  1HRO A;  3O1Y A;  1CHJ A;  1YTC A;  1CRG A;  1NTM D;  2O3J A;  1W2L A;  4KMG A;  3H1J D;  3O5C A;  1CTJ A;  1H32 A;  1I8P A;  3L73 D;  3L74 D;  1IRW A;  1CHI A;  1CSU A;  1DVH A;  3SJL A;  2JTI B;  1N9C A;  2FYN B;  1N50 A;  2V08 A;  5CIB B;  2B10 B;  3CWB D;  1KYO W;  3RN1 A;  2PCC B;  1PP9 D;  2RN0 A;  2BCN B;  1CRI A;  4WQ7 A;  1A8C A;  1CSX A;  4H0J A;  2C1D B;  1CYI A;  4D6T D;  3KZI V;  2FWL A;  3L75 D;  1B7V A;  3ZOO A;  2C1V A;  1FI7 A;  2GB8 B;  1BCC D;  1VYD A;  4Q5P A;  1NTZ D;  4EIF A;  4J20 A;  1E29 A;  1CED A;  5B6Q A;  1GU2 A;  1CCH A;  1H32 B;  5CIC B;  2JQR A;  451C A;  1IZL 0;  1SQQ D;  2CXB A;  3M97 X;  2N3B A;  1NML A;  1C2N A;  5CID B;  1M60 A;  1YFC A;  2JWA A;  5C9M A;  4UB8 V;  4WQE A;  1ZZH A;  3HQ7 A;  3ZCF A;  3HQ6 A;  1C2R A;  4DY9 A;  1DIQ C;  4FB1 A;  1J3S A;  1CNO A;  5IY5 1;  2YK3 A;  1YEA A;  2HV4 A;  1CRY A;  3WFD C;  2I8F A;  3ITK A;  2BH4 X;  2KS1 A;  2Q3E A;  2ZON G;  1CO6 A;  2BLF B;  3JBT B;  4NFG B;  3DMI A;  3CXH W;  1DW0 A;  2N9I A;  1WVE C;  1LC2 A;  2QJY B;  4H0K A;  4UB6 V;  5KAF V;  2RMZ A;  3NBS A;  2D0W A;  4MU8 A;  3TF5 A;  5KLV D;  2N18 C;  5B66 V;  1DVV A;  2ZOO A;  1OCD A;  3PXW A;  4Y5R A;  4O1W A;  3OCD B;  1CIH A;  4EIC A;  3H1H D;  2PCB B;  1COT A;  1A56 A;  2AI5 A;  1CSW A;  2ZZS 1;  2A06 D;  2ZBO A;  1AOQ A;  3ZIY A;  1KYO D;  1N90 A;  3CP5 A;  1FJ0 A;  1KIB A;  3RLM A;  2YQB A;  2K9J B;  3SWS A;  4FA5 A;  3WU2 V;  2QJP B;  5TIS V;  2CE0 A;  2BPB B;  1RZ5 A;  2Y0D A;  4FAV A;  5KLI B;  3O20 A;  2GC7 D;  3H1L D;  3TYI A;  3O0R C;  1C7M A;  1HZV A;  3X39 A;  2CA3 B;  1RAQ A;  2KNC B;  4L3H A;  4YE1 A;  1CIE A;  3PH2 B;  4PWA A;  1GJQ A;  3VRD A;  3PHL A;  2GC4 D;  4LJI A;  1IQC A;  4AAL A;  1KB9 D;  3TDK A;  3H1I D;  3ZOW A;  1CYC A;  2EXV A;  3WC8 A;  2MTA C;  2MHM A;  3PRJ A;  1GDV A;  4WQA A;  1DII C;  3WUI A;  1CRH A;  4IL6 V;  1A2S A;  1DW3 A;  1AYG A;  3VNW A;  3KHU A;  1IRV A;  1NNO A;  1SQB D;  3WFC C;  3OA8 A;  1P84 D;  2N3Y A;  3PTZ A;  1HZU A;  4AAM A;  5KKZ B;  1LFM A;  3NWV A;  2N9Y B;  1L0L D;  1MG3 D;  2Y0C A;  1HH7 A;  4L3G A;  3PXT A;  1HJ5 A;  4AX3 A;  5AUR A;  4AAO A;  3FWL A;  3SVW A;  3CX5 W;  1LC1 A;  3L71 D;  4GYD A;  2ORL A;  4U3F D;  4RJT A;  1GIW A;  1RAP A;  4L1Q A;  4PJ0 V;  1K3G A;  351C A;  4EIE A;  2YCC A;  2N18 B;  5TJH A;  1N15 A;  1WEJ F;  1YIQ A;  1QKS A;  1R0Q A;  2QG4 A;  3H1K D;  4O1Q A;  4WQB A;  5DJQ B;  5CIE B;  1ETP A;  4V2K A;  5E79 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...