3BCCD

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
241
structure length
241
Chain Sequence
b'SDLELHPPSYPWSHRGPLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSVREGLYFNPYFPGQAIGMAPPIYNDVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLVPLVYYMKRHKWSVLKSRKLAYRPPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 66
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3bccD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3bccD01
2JWAA 2YCCA 5CIBB 4UB8V 1NU1D 2BLFB 155CA 4EDFA 1YFCA 5CIEB 3BCCD 5E79V 1BCCD 1C2RA 2BH4X 1JDLA 1GDVA 3C2CA 4XYDB 2C8SA 1CORA 1YNRA 2N3YA 4AX3A 3OA8A 5B5EV 1MG2D 3H1JD 4FANA 3WFBC 4Q5PA 1A8CA 1C75A 2YIUB 4L3HA 3L75D 4V2KA 5CIDB 3PXTA 2K9JB 1H9XA 4U3FD 2CA3B 2FWLA 4EICA 4WQAA 3H1LD 2IBZD 1CRJA 1QN2A 2HV4A 2MHMA 3WFEC 5TJHA 3SLEA 1L9JC 1SQXD 5DF5A 2PCBB 1E8EA 2ZZS1 1KV9A 4IL6V 2O3JA 2V08A 4AAMA 5KAIV 1FHBA 1ETPA 5GTHV 2CE1A 3ITKA 1COTA 1RAPA 1CIHA 3DP5A 1NMLA 4NFGB 3VRDA 3HQ9A 3ZOWA 3CU4A 1F1FA 2B0ZB 1I55A 3HQ6A 2MTAC 4WQ8A 4FA9A 3RN0A 3PXWA 3SVWA 1CXCA 2CXBA 1DVHA 2QJKB 1GQ1A 3RN1A 1FCDC 1FI7A 1IO3A 1HCMA 1H1OA 3L72D 4YE1A 1U74B 3SWSA 1CTJA 5KLIB 1AOFA 451CA 1CHJA 3CWBD 5DJQB 4J20A 4WQ9A 5CIHB 1H9YA 1KB9D 1KYOD 1W2LA 4PD4D 1CO6A 1ZZHA 2B11B 1L9BC 1GKSA 1NTZD 3JBTB 5CIFB 1LMSA 1LFMA 2RN0A 3ZOOA 2ZONG 4GEDB 1M6ZA 2ORLA 1CNOA 2ZBOA 2Y0DA 1E2RA 2FYNB 5B66V 5GTIV 2YK3A 2C1DA 1FJ0A 4RJTA 3MK7C 1KIBA 2QG4A 2A06D 3RMZA 1CSVA 5CIGB 3M97X 1CCHA 1NIRA 1SQBD 1IQCA 2CA4B 2DGEA 1BL9A 5CYTR 4DY9A 4PJ0V 1E29A 3KZIV 3TF5A 3H1KD 1HRCA 1I8PA 1WEJF 1ZRTD 3WU2V 2Y0CA 3GW6A 2JQRA 2D0SA 2N18C 1GIWA 2C1VA 2BCNB 1H31B 5B6QA 3O20A 3SXTA 5IY51 1VYDA 2YQBA 3A0BV 2KS1A 4H0KA 2BH5X 1RZ6A 4FA5A 5C9MA 1FOCA 1KYOW 1N15A 2B10B 2RMZA 2BGVX 1HH7A 3GG2A 3OCDB 1CEDA 3TDKA 1EB7A 4LJIA 1H31A 1GJQA 2N9YB 1CYCA 3NBTA 2C1UA 1N9CA 1GU2A 1I6DA 1H33B 351CA 1YICA 4WQ7A 5CICB 2AI5A 1LC2A 3CP5A 1S5LV 4L3GA 3RLMA 2FRCA 1CRYA 1N50A 2JTIB 1L0LD 3CXHW 1DW1A 2Q3EA 4L1QA 1HJ3A 4A7PA 4GYDA 3WFCC 1H33A 5DFSA 1C7MA 1SQVD 3X39A 1DIIC 3CX5D 4O1QA 3O1YA 1HJ5A 1NTKD 1CTYA 4RSZA 1F1CA 4WQCA 1B7VA 2XTSB 3WFDC 3O5CA 1SQQD 1YTCA 4WQBA 1IZL0 3NWVA 2L91A 2C9XB 1CXAA 1CIEA 1OCDA 3A9FA 1NTMD 1CIFA 1S6VB 1HZUA 3L70D 1KB0A 1CRHA 2EXVA 2Y0EA 4EIDA 2CE0A 3SJLA 1FI3A 1OAEA 2N9JA 1CRGA 1L0ND 4P4QB 4FAVA 1J3SA 4N0KA 3L73D 1CRCA 2I8FA 3NBSA 1C6SA 1H32B 4O1WA 1I5TA 1LS9A 1BGYD 3L71D 1IRVA 2L4DA 1C52A 4K3IA 4WQEA 3VNWA 3CXHD 5TISV 2LITA 1C6OA 2AIUA 1A56A 4EIFA 3ZIYA 1CYIA 1YEAA 4AAOA 2BPBB 4JCGA 3MK7B 1MG3D 1HZVA 3CX5W 1CRIA 1C2NA 2KNCB 1I54A 3HQ7A 3PTZA 2N9IA 4AANA 1YIQA 1SQPD 2C2CA 4D6TD 4PWAA 4PW9B 1DIQC 3OA8B 2PCCB 2DVHA 3PHLA 2N18B 1RZ5A 1NMIA 1P84D 3DMIA 3L74D 1CCRA 1QKSA 3L4MA 3O0RC 1CSUA 1HJ4A 3ZBMA 3VMAA 1AYGA 1QL3A 1RAQA 1IRWA 2GIWA 1K3HA 1YEBA 2LIRA 3ZOXA 2GB8B 3DR0A 3PH2B 3WUIA 3FWLA 4AALA 4H0JA 4KMGA 1AKKA 1FI9A 1DW3A 3OCDA 4QAOA 2VHDA 1QL4A 1U75B 5EXQA 1BE3D 3A0HV 2B4ZA 1C6RA 1HROA 4FB1A 3TGUD 1PP9D 3L4OA 3WC8A 1PPJD 4WQDA 3ZOYA 1KX7A 1A2SA 4Y5RA 1M60A 3KHUA 3HQ8A 3VYMA 2AXTV 2D0WA 1LC1A 4XXLA 1DVVA 3CYTI 3PLNA 4FA4A 2BCCD 1K3GA 1AOQA 5KLVD 1CHHA 1KX2A 2PACA 5KKZB 2QJYB 1CSWA 5AURA 2B12B 1CTZA 1CYJA 1I8OA 2GC7D 2ZOOA 1DT1A 5DJQC 1CHIA 4EIEA 2ZXYA 3PXSA 2N3BA 3PRJA 3ZCFA 1QYZA 3H1HD 2QJPB 1N90A 1DW0A 1I6EA 2OZ1B 1M70A 1R0QA 1NNOA 2GC4D 5KAFV 4FA1A 5C0ZA 3ORVA 4UB6V 1DW2A 2C1DB 1H32A 1YCCA 4MU8A 2OZ1A 1CC5A 2FYUD 1EZVD 2V07A 3TYIA 1W5CT 3H1ID 1MZ4A 1WVEC 1CIGA 5H2FV 1CSXA
chains in the Genus database with same CATH superfamily
1QVFO 1PV3A 4UB8V 2WSSH 3AEFC 4EDFA 2KNCA 1OIPA 3BCCD 3AEBC 2KUBA 1JDLA 1N2DC 3C2CA 1IJDB 1RHZB 1USDA 1OFCX 3A2AA 2WPRA 1Q81Q 3OA8A 3AECC 2YXQB 3V2RA 1BGYJ 1GL2A 3HD7A 1C75A 5CIDB 1IK9A 2AXTH 3HUSB 5KAIH 4HB1A 2K9JB 1L0LE 1W2BO 2FWLA 4EICA 1KB9I 1KYOI 3A7OA 1HVVA 3H1LD 3CX5E 3OAKA 2XDJA 1GU4A 1DH3A 1NTKE 1HUCA 4IFDK 1KQLA 4C46A 1OW8A 1SQVK 1E8EA 1SQQE 3H1IJ 1Q7YQ 1OXZA 2HYNA 1YJ9P 3VMXA 4KJMA 2KIKA 2K3RA 5GTHV 3G71P 2O1JA 3M9QA 1R5SA 1EDJA 3CD6P 1NMLA 2D2CC 5AVVB 3HQ9A 1KILE 1NTMK 3HE4B 4JPZB 3GF7A 3H1LG 1I55A 2R5DA 3HTKA 4WQ8A 1VF5C 3RN0A 3L73E 2M3BA 2CXBA 2D2CD 1FCDC 1X22A 1L0NK 1HBWA 1VF5D 4IFMA 5AVQB 2WWWA 3EWKA 3L75J 2ZYDA 2HPCB 3SSUA 1HWTC 2I1JA 1URQB 3LIEA 1JO5A 4J20A 1P84I 4WQ9A 5CIHB 4PD4D 4M3LA 1ZZHA 1LTTC 2QVAA 3V2NA 4JF7A 4OGQC 1ZRTE 4H44B 4GEDB 3M0DA 3WU2H 2CPSA 1H8AA 1CNOA 2ZBOA 1NAYA 1E2RA 3BVHA 2FYNB 4OGQD 3CPWO 2QE7H 1KIBA 2AXTE 1FZCC 3RMZA 3PP5A 3Q1MA 1CSVA 2WSCH 3MIWA 1CCHA 1NIRA 1SQPK 4H13C 1OW7A 3P8CD 1IFPA 1IQCA 1CSBA 3F89A 4H13D 4IFFA 2KYVA 1I8PA 1WEJF 1VQ7P 1J1DB 2N18C 2D0SA 3CI9A 3EFFK 5AVSB 3CWBJ 3NMDA 1H31B 2LXCB 2YO3A 3MUDC 1EXIA 3SXTA 5IY51 1VYDA 3A0BV 1JY2N 2C9LY 4GOEA 2MKVA 1HGZA 4FA5A 2GUVA 5C9MA 1PP9E 1QL2A 1PPJE 2R3SA 2B10B 1ZR2A 3GG2A 1EB7A 2FBWC 5APSA 3MGNA 1CYCA 1LP1A 2E43A 3CC2P 5DJTB 1H33B 1JY3N 1K73Q 1M7LA 1X9VA 4W7YA 3IAOA 1S5LV 1RF1C 1DW1A 3CCSP 2Q3EA 5H2FE 1N73B 1VQ5P 1T8ZA 1SQVD 3X39A 2B9BA 1AA0A 1DIIC 3LW5J 1NKNA 1HJ5A 4WB4A 2IFNA 3WU2E 2FXMA 2WMMA 3CCMP 1CXAA 2QM8A 1NTMD 2WZ7A 3L70D 1HZUA 1AVYA 1KB0A 2Y0EA 2CE0A 3RL0D 3SJLA 3L37A 3H1LJ 4B86A 4N3YB 1L0ND 1LTSC 1KILB 1SQVG 4N0KA 2WT7A 1EZVE 2HR3A 4DCKA 2I8FA 1FZAA 1H32B 4O1WA 3JSVC 1LS9A 1YIJP 3L71D 2NPSB 1JCCA 1ZLLA 1KB9H 1KYOH 2XNXA 1NTMG 1NU1E 3L70G 5KLVG 1SLQA 2P7JA 3SWFA 2LITA 2RH0A 2IYOA 1KQSO 4AAOA 4BWNA 3H32B 3SWKA 3VYIA 4YXDC 2ZYGA 2LR2A 3H1HG 2LXBA 5AVWB 1G2CB 4AANA 1SQPD 4PW9B 4XFJA 2PCCB 1FZCA 5C39A 1P84D 2ZYAA 3A0HH 4XE5B 2VRSA 3Q3DA 1M1JB 1U7MA 4YXWH 4Y99B 3HUSC 2YKPA 1AYGA 3CCEP 4LLHA 1S9KD 1T3JA 3HRNA 1JUNA 4H0JA 1P84H 3MUDA 4GKGA 1K8AQ 1TU3F 5EXQA 1DIPA 4FB1A 3TGUD 1K05A 3L4OA 1BSHA 4I2LC 2OTKE 4KHXA 4DOJA 2BASA 2YXRB 4OH8B 1OWAA 2P58A 1MKMA 2K88A 4JYBA 2D0WA 2C9NY 1DVVA 3AEAC 2OTJP 5KKZC 3P8MC 4FA4A 3GF3A 2BCCD 4UB6H 3M91A 1AOQA 3O8ZA 2A45G 1YQ3C 3CCRP 1CHHA 1KX2A 3B4SA 2PACA 2QJYB 3TGUG 2B12B 1CTZA 3CCLP 4OVNF 1ZXGA 5EFWB 2IZ0A 1URQC 4I7ZB 3CC7P 1KV4A 4C7NB 3C1LA 2ZXYA 1SFCB 1ZOYC 1LWUB 3AE3C 1URQD 2Q6QA 1N90A 1CZQA 1GTWA 2OYOA 3U1CA 1N7LA 1Q90D 1SQBE 1YITP 2KP8A 3VP8A 1SQVJ 1H0TB 2FYNC 3O6QA 3H1KE 2V7QJ 1QEXA 2R44A 1NGMB 1W5CT 5CBNA 3H1ID 1MZ4A 1WVEC 1CIGA 1PGPA 3L70J 5KLVJ 3TNUA 3H6PA 1KQFB 2DW3A 1E5WA 1YFCA 1C2RA 1YYCA 3ABVC 3WUTA 1FDIA 1CORA 2Z5IA 1YNRA 4AX3A 5AVYB 3H1HJ 1MG2D 1N8RQ 4FANA 3H1IG 2YIUB 4AYCA 2Q5UA 2WSEJ 3L75D 1GZLA 1VQPP 5GTHH 3L36A 3KDPB 2CK3H 4UB6E 2PP6A 3KQGA 4JBZA 4KT0J 1CRJA 3JCUH 2MHMA 2OYHB 3WFEC 1VDFA 2I8DA 2FYUJ 5DF5A 3E1IA 2XV5A 1KV9A 2W6JH 4IL6V 1N73C 3L75G 1FHBA 1VQ6P 1S4XA 2CE1A 1COTA 3RK3B 1RAPA 2AXCA 1FAVA 3RBZA 5AW2B 1VQLP 1YI2P 2IYPA 3IR9A 3HQ6A 4FA9A 2QJKB 4XA4A 1HCMA 1IFNA 1H1OA 1VQ8P 2YMYA 1BGYE 1U74B 3HE4A 1EDIA 2ZVOB 1CTJA 1AOFA 5AW9B 1KILC 2IDBA 4H0LD 3CWBD 1L0LG 3CXHE 1RF0C 2Q9IA 2L5GB 2JKVA 3E7KA 1LTBC 1S1CX 1W2LA 5AW5B 1QVGO 1IFDA 3C8VA 3TGUJ 1CO6A 1GKSA 1L9BC 1U57A 3JBTB 2LKMA 1URQA 2BEQD 2FXPA 1SQXJ 4GT1A 3MZWB 3V2QA 1Y9BA 3PH0A 1SQQG 1M6ZA 2H7HA 5APVA 1FZEA 5AVRB 5B5EH 4D6TE 5B66V 5GTIV 1YTZT 2KSJA 2C1DA 3T97B 1FJ0A 3B5NB 2QG4A 5GTHE 2A06D 3A0BH 3R4YA 2FKWB 4DY9A 5CYTR 2IX7C 4PJ0V 1E29A 3JCUE 3KZIV 1T2KC 3N7NA 1D7MA 3K5BA 1ZRTD 2Y0CA 2E75B 3CLQA 1T2KD 3C9IA 1VQNP 2B87B 3OW2O 3Q2YA 1M1JC 3B71A 4Y99C 3G4SP 2YQBA 1BE3E 2KS1A 2A06G 1RZ6A 1JY2O 3LW5H 5KAFE 2RMZA 2W27A 1SVFA 1HH7A 2W6AA 3TDKA 1CEDA 5CCHC 4LJIA 1H31A 4I6MC 1NOHA 2JJLA 5CCHD 1N9CA 1GU2A 1L4AB 3II6A 1N86A 2O01J 351CA 1A02F 4WQ7A 4BXLA 5M1BA 3CP5A 1LT9B 4L3GA 1JY3O 1HJBA 1N50A 2JTIB 4JYCA 1SP4A 4L1QA 1H88A 4A7PA 4GYDA 1H33A 5DFSA 3FX0A 5KLVK 1JMBA 1GD2E 5E79E 4WQCA 1B7VA 2XTSB 3WFDC 2QIWA 2HFED 4YPCA 3PJSK 1N73A 1YTCA 1YTZI 2QJYC 4N78E 2C9XB 1GK4A 5B5EE 4ASWA 5APTA 1CIEA 3D71A 2O01N 1S2EA 4I7ZC 4AUWA 1OVVA 1VQ4P 2POHA 2EXVA 2OARA 1RE4A 1MUUA 4EIDA 1SFCC 3R2PA 5AW6B 3P7KA 1LWUC 3TYYA 2N9BA 3B8EB 3U1AA 2FXOA 1SFCD 1CRCA 4RKUJ 4WY4B 1KTMA 3CMAP 1VPCA 5APYA 1KORA 2FYUK 1L0LJ 3RL0g 4L75A 1C52A 4WQEA 4PD4H 2A45I 2RKLA 5KAIE 3BCCE 2W8ZA 1A56A 4EIFA 3ZIYA 4JCGA 3MHVA 1FC2C 1MG3D 1HZVA 1CRIA 2KNCB 1Q86Q 1X8YA 1SQQJ 2YMKA 1I54A 3HQ7A 3QWOC 1BDDA 1LTJA 1QX8A 1DIQC 3OA8B 3PHLA 1OZHA 3HD7B 1OMIA 2E76B 1RZ5A 1NMIA 1FZFA 1G2CA 3DMIA 3L74D 1KC8Q 1NKZB 2BEZF 1CW5A 4PV1B 2J59M 3L73J 1R8EA 2YIUC 3L4MA 2AEFA 3ZBMA 2YNYA 1QL3A 2ZXEB 2KI7B 1LTIC 1ZP0C 1AQTA 1DD3A 2E42A 5L8RJ 1YEBA 2LIRA 2KXPB 4L73A 2GB8B 3SFEC 2O1KA 1M1JA 1OX3A 1SQXK 3FWLA 1AKKA 1FI9A 2OYHC 3OCDA 1NU1G 4QAOA 1QL4A 2WSFJ 4U7JA 1KQGB 2B4ZA 3L74G 2M5AB 2QEXP 1A2SA 4HKZH 1JY2P 3RK3C 5AW3B 2YKOA 1X79B 2Z5HA 1QGKB 3VYMA 3AE9C 1N7SC 1XTCC 2AXTV 1Y8AA 2FYZA 1LC1A 3RK3D 4XXLA 3V2PA 4DZOA 4DJGA 5KJ7C 3AEEC 2QJKC 1JTHB 1N7SD 5KLVD 4PD4E 1S5LX 2SPZA 2JR8A 2HODA 2V7QH 5KJ7D 5TISH 3VN0A 5AURA 4LGDE 3D6YA 5DJUB 2B89A 2QJPC 1LGHB 3AE1C 4TT3H 3WUVA 1NTZK 3FWNA 1YQ4C 4CPGA 1J2JB 1QYZA 3H1HD 4GOFA 1I6EA 2M3EA 1JEKA 2OZ1B 1M70A 4YTPC 3ORVA 1OVRA 3W67A 4C7NA 3N4XA 3P8CE 1SFCA 2HG5D 1LWUA 3EQ2A 3FXDA 3VTPC 3WUUA 3A5TA 1CC5A 2FYUD 2AEJA 2WSEH 2K9YA 3MP7B 2H8PD 2ZT9B 5H2FV 2JEEA 2JWAA 2YCCA 1EXJA 2WPVB 2BLFB 2N1TB 2R3CA 3I5CA 1Z56A 3I55P 3CL3D 2E75C 1MFZA 1GU5A 5CIEB 1BCCD 2BH4X 2C8SA 2E75D 4GDOA 2N3YA 4EI2A 3BASA 2FYUG 3H1JD 1JM0A 1MFTA 3GHGB 1WMKA 5APUA 1Y47A 4Q5PA 4IL6H 4L3HA 3PXTA 3H25A 1LP1B 2KOGA 2ZJSE 4BRYB 4U3FD 2CA3B 2IZ1A 1L4AC 5APWA 1SQVE 1BCCG 2IBZD 3S9OA 1L0LK 5TISE 1YJWP 3JC22 1PGOA 1LT9C 1J1EB 1L9JC 1SQXD 3H1JG 1NTKK 2O3JA 2V08A 2OGUA 1NTME 2A45H 3ITKA 1NU1J 1SQQK 1CIHA 4U3FG 3DP5A 3VMZA 2GUSA 2ZXXA 3VRDA 1KB9E 1KYOE 1RF1A 1WT6A 3ZOWA 1L0NE 3L74J 2E74B 4W7ZA 2B0ZB 2IBZG 1K04A 3G6EP 3PXWA 4GIFA 3P32A 1DVHA 2D2CB 1GQ1A 1JMMA 1FI7A 2WPSA 3USSA 3L72D 4YE1A 1SQXG 2ITAA 3L71E 1N7SA 2P67A 3AEGC 1DX7A 3FXEA 451CA 5GTIH 5KJ7A 1CHJA 5DJQB 1UIIA 1H9YA 4WY4C 3TK1A 4H44C 4UB8H 2Z4EA 3HE5A 5CCGC 2B11B 1NTZD 4WBAA 3IF4A 4PJ0H 1T3UA 5CIFB 3A0HE 4WY4D 1LMSA 1LFMA 4H44D 1FE6A 1E79H 3VP9A 2ZONG 3L72G 1OW6A 2ORLA 2Y0DA 1SQPE 2ZFCA 4ZKPA 2YK3A 1VL2A 2KK7A 5CMZA 4RJTA 2PAJA 3AE2C 2K1AA 2QRXA 1P84E 5CIGB 2Q1KA 3M97X 4AQRD 3QH9A 1H89A 1J1DC 2DGEA 1NTZG 1S9KE 3TF5A 3W68A 1HRCA 3I56P 4EOTA 1FS0E 2E76C 3L4FA 5APXA 1GIWA 4PV1C 2C1VA 2BCNB 2OYIB 1NH4A 1NHLA 3O20A 2BH5X 3AE6C 2V4HA 1S3JA 4PV1D 1R5LA 3TGUE 1FOCA 1LT1A 2GA1A 1N15A 2IFMA 2BGVX 4ZNCA 1ZW0A 4EIJA 2FFDB 2H88C 1QL1A 1KN7A 2OTLP 3HUSA 2K9JA 3NBTA 2C1UA 2YO2A 4HJGH 1I6DA 1YICA 1LTGC 1EQ7A 5BU8B 2BCCE 1LC2A 1Q2NA 5GTIE 3RLMA 2FRCA 5CHXA 1FDMA 1CRYA 3CC4P 1L0LD 3CXHW 3RBXA 1HJ3A 1CI6B 1BCCJ 3D70A 3WFCC 4MN4C 2CPBA 4UB8E 3CX5D 2PRRA 1FDOA 3O1YA 1LT9A 1EZVI 2JDIH 4PJ0E 1NTKD 4RSZA 1F1CA 1X0TA 1VQOP 2B88A 3H1JJ 3IFMA 1SQQD 3MD0A 4WQBA 2L91A 4IL6X 1CIFA 1DEEG 1S6VB 4U3FJ 1BE3G 1FJPA 2P1JA 3RL0B 1FI3A 1OAEA 1KILD 3WMM0 4P4QB 1J3SA 2HPCA 3L73D 1IK7A 3V4WA 1NTKG 2NPSC 3M0DC 1W2EA 1IO4A 2ZAEB 1GMJA 3H1IE 3BRVB 1IRVA 2NPSD 2L4DA 4HH2A 1FZBA 1C6OA 1YEAA 1NU1K 2ZT9C 3UIAA 2BPBB 3TNUB 3L73G 3MK7B 3CX5W 3L72J 1M1KQ 1PL5A 2N1TC 2ZT9D 3ZDMA 3PTZA 3L75E 2N9IA 2ZVNB 1YIQA 2C2CA 4PWAA 1EDKA 2N1TD 2P2UA 1RQUA 2R5BA 1BDCA 1JOCA 1RH5B 1S5LH 3GHGC 2W83C 1HF9A 1CCRA 1NTZJ 2QSIA 1QKSA 2QM7A 3O0RC 5CBOA 1CSUA 1HJ4A 3VMAA 1KD1Q 1RAQA 1IRWA 1FU1A 2GIWA 1K3HA 1QLED 3ZOXA 3DR0A 3PH2B 3WUIA 1DD4A 4AALA 4W80A 4N6JA 1DW3A 2C0XA 2VHDA 1U75B 4RESB 1FJKA 4ZKUA 1J1EC 2NZ2A 3BCCG 1C6RA 3G9RA 4TLFA 1PP9D 1DEBA 1PPJD 4WQDA 1KX7A 1YJNP 3S4RA 1M60A 3KHUA 4K3AA 2G3AA 2Y9YA 1AJYA 3GLMA 4D6TJ 2E74C 4I1LA 2M5AA 3CWBE 2WQYC 3CYTI 1S72P 3PLNA 2J58A 3M06A 3D0WA 2E74D 3IN6A 1IFIA 3A3YB 5KKZB 2OQQA 3V5BA 3A0BE 4NPEA 1PP9G 1AQ5A 1PPJG 1CYJA 1I8OA 1PGJA 5DJQC 1DT1A 1JTHA 1CHIA 4C7RA 4EIEA 3PXSA 3ZCFA 1OVUA 5AVXB 1NJIQ 5APQA 3U59A 1FZGA 2GC4D 5KAFV 1KILA 2A06E 4FA1A 5H2FH 2WTYA 1BE3J 2Q7CA 1RF0A 1NWQA 1DW2A 3LIDA 1NO4A 2IBZI 5AVUB 1S5LE 1XTGB 2C1DB 1H32A 2MJZA 1YCCA 1USEA 3S1KA 2OZ1A 2C0WA 4ASVA 1SQBK 1NTKJ 2NPSA 5AW0B 1MZ9A 2HLOA 1KMIZ 1EZVD 2V07A 3CCQP 1NAFA 3H32A 5CIBB 1NU1D 155CA 1GL2B 5E79V 3H1LE 4RO0A 1GDVA 1GK6A 3D6ZA 2KS1B 4XYDB 3Q5PA 2OYIC 4HYTB 3AEDC 3BATA 1LTAC 5B5EV 1EZVG 2N1TA 1FOSE 2IPPA 3WFBC 2FY8A 1AVOA 1A8CA 4R4LA 4V2KA 1GW3A 4QMAA 2FFDC 1H9XA 1RE3C 3GHGA 4WQAA 3VMYA 4ZMDA 1QN2A 2HV4A 5TJHA 3E1RA 3EFGA 3SLEA 5CCHA 3F5HA 4L76A 4BRYA 2PCBB 2ZZS1 1M90Q 2E5YA 3HTKB 1PGQA 4AAMA 5KAIV 4NPDA 1ETPA 3CXHI 1PIXA 4R4MA 4JQ0D 4NFGB 1HGVA 3BCCJ 3CU4A 1F1FA 3Q5SA 2MTAC 1GDTA 3SVWA 1CXCA 4IOIH 1JY3P 1M57D 3RN1A 1AV1A 2KZJA 2K37A 1IO3A 1LNQA 3G3ZA 5AW8B 3SWSA 3RL0C 2W6BA 5KLIB 1BSNA 4H0LB 2XU6A 1G1IA 1KB9D 1KYOD 2QA4P 3RK2B 2E5TA 1PP9J 3RGUA 2RN0A 3ZOOA 3NTNA 3B5NC 1T6AA 1W5CE 5BVZA 1PFIA 1NVOA 4OWFA 3B5ND 1VQKP 2JP3A 1H0TA 3MK7C 2PGDA 3L74E 5KTBA 1SQBD 1L0NG 1VQMP 1LTJB 2CA4B 1BL9A 5BU5A 3CX5I 1ZR4A 3CCVP 3GMAA 4K35A 1YHQP 3H1KD 3KYQA 3WU2V 1M56D 1HJ0A 3GW6A 2JQRA 3L71G 2XNDH 3NXSA 3AE7C 1VQ9P 2KZIA 5B6QA 5AW1B 1JB0J 3FGAD 5CJ4A 4H0KA 3KXDA 1SQBG 1KYOW 4Y28J 1SS1A 2WSCJ 3OCDB 2OYIA 5CJ0A 2M0BA 1GJQA 3H1KG 1IFMA 2N9YB 3SWYA 1L4AD 3RK3E 3CCJP 1SQPG 1YBKA 5CICB 2AI5A 2FFDA 2NRGA 3L70E 5KLVE 2OYHA 1NYHA 1RE3A 1EDLA 2I1KA 1C7MA 1ZN5A 4O1QA 3CMEP 5K5GB 1CTYA 3V6IA 2AEMA 2HODB 3H1HE 1MV8A 1PZQA 3Q5RA 3O5CA 1CI6A 2XZRA 1VF5B 1IZL0 3NWVA 1OCDA 2WT7B 3A9FA 2G8YA 5B66H 1RQVA 1CRHA 4WWIA 2N9JA 1CRGA 1ZV8A 4FAVA 3AE8C 2KLVA 1KFNA 2KLUA 2FYUE 5AW4B 4GODA 1A02J 3KZIH 3NBSA 1C6SA 3AE5C 5CCGD 1I5TA 1BGYD 2KB7P 2BCCG 2WITA 4EYYQ 4K3IA 3VNWA 4OGQB 1JCDA 4IL6E 2Q3IA 3CXHD 5TISV 1FBMA 2R32A 1ZMEC 1BCCE 1LJ2A 2AIUA 1CYIA 1L2PA 1IFJA 4DT0A 1KFMA 1FZCB 2XKMA 3H1JE 1C2NA 3T97A 4H13B 3B5NA 5AVZB 2O01H 1BGYG 1GL2C 3HD7C 2JO1A 3CXHH 1NTMJ 4D6TD 4U3FE 2PFXA 2YKQA 2DVHA 1GL2D 3HD7D 2E76D 2H89C 2N18B 1JNMA 1L0NJ 2IBZE 3M9BA 1AFOA 4WVZA 1KZUB 1IZNB 3OJAB 2B87A 1SQXE 3M9HA 2JWDA 1U7JA 3L71J 2W90A 4O9BA 4LC1A 4KMGA 4D6TG 5AVTB 1FOSF 2P10A 1RY3A 4PD4I 5B66E 1BE3D 1K9MQ 2J5UA 3A0HV 1SQBJ 3NFQA 1HROA 3MTUE 2GM4A 1L4AA 3WC8A 3ZOYA 2KSEA 4Y5RA 3OA7A 3L72E 3H1KJ 1RF1B 3HQ8A 4Z1MH 1HTLC 1G1JA 3KZIE 2H43A 1SQPJ 5AW7B 5KAFH 1RE4C 3L35A 1K3GA 1N7SB 1EC5A 3CX5H 1NTZE 1CSWA 5KLIC 2GC7D 2ZOOA 4H0LC 3PRJA 2N3BA 3HE5B 2UWJE 3RK2C 2QJPB 4L74A 1DW0A 1GW4A 3O6QB 1UIXA 1M8OB 4N78D 1WRGA 1R0QA 3BRTB 1NNOA 3M0AA 3VOPA 2Y9ZA 3RK2D 5C0ZA 4UB6V 1IC2A 4WY4A 5E79H 1Q82Q 4MU8A 3AE4C 5CCGA 2WPQA 3V4QA 4NPFX 2M8RA 1HH0A 3TYIA 3TSIA 3CCUP 1LTJC 3CWBG 2WVRA 3SFDC 2BCCJ 3KPEA 2WSFH 1CSXA
chains in the Genus database with same CATH topology
2JWAA 2YCCA 5CIBB 4UB8V 1NU1D 2BLFB 155CA 4EDFA 1YFCA 5CIEB 3BCCD 5E79V 1BCCD 1C2RA 2BH4X 1JDLA 1GDVA 3C2CA 4XYDB 2C8SA 1CORA 1YNRA 2N3YA 4AX3A 3OA8A 5B5EV 1MG2D 3H1JD 4FANA 3WFBC 4Q5PA 1A8CA 1C75A 2YIUB 4L3HA 3L75D 4V2KA 5CIDB 3PXTA 2K9JB 1H9XA 4U3FD 2CA3B 2FWLA 4EICA 4WQAA 3H1LD 2IBZD 1CRJA 1QN2A 2HV4A 2MHMA 3WFEC 5TJHA 3SLEA 1L9JC 1SQXD 5DF5A 2PCBB 1E8EA 2ZZS1 1KV9A 4IL6V 2O3JA 2V08A 4AAMA 5KAIV 1FHBA 1ETPA 5GTHV 2CE1A 3ITKA 1COTA 1RAPA 1CIHA 3DP5A 1NMLA 4NFGB 3VRDA 3HQ9A 3ZOWA 3CU4A 1F1FA 2B0ZB 1I55A 3HQ6A 2MTAC 4WQ8A 4FA9A 3RN0A 3PXWA 3SVWA 1CXCA 2CXBA 1DVHA 2QJKB 1GQ1A 3RN1A 1FCDC 1FI7A 1IO3A 1HCMA 1H1OA 3L72D 4YE1A 1U74B 3SWSA 1CTJA 5KLIB 1AOFA 451CA 1CHJA 3CWBD 5DJQB 4J20A 4WQ9A 5CIHB 1H9YA 1KB9D 1KYOD 1W2LA 4PD4D 1CO6A 1ZZHA 2B11B 1L9BC 1GKSA 1NTZD 3JBTB 5CIFB 1LMSA 1LFMA 2RN0A 3ZOOA 2ZONG 4GEDB 1M6ZA 2ORLA 1CNOA 2ZBOA 2Y0DA 1E2RA 2FYNB 5B66V 5GTIV 2YK3A 2C1DA 1FJ0A 4RJTA 3MK7C 1KIBA 2QG4A 2A06D 3RMZA 1CSVA 5CIGB 3M97X 1CCHA 1NIRA 1SQBD 1IQCA 2CA4B 2DGEA 1BL9A 5CYTR 4DY9A 4PJ0V 1E29A 3KZIV 3TF5A 3H1KD 1HRCA 1I8PA 1WEJF 1ZRTD 3WU2V 2Y0CA 3GW6A 2JQRA 2D0SA 2N18C 1GIWA 2C1VA 2BCNB 1H31B 5B6QA 3O20A 3SXTA 5IY51 1VYDA 2YQBA 3A0BV 2KS1A 4H0KA 2BH5X 1RZ6A 4FA5A 5C9MA 1FOCA 1KYOW 1N15A 2B10B 2RMZA 2BGVX 1HH7A 3GG2A 3OCDB 1CEDA 3TDKA 1EB7A 4LJIA 1H31A 1GJQA 2N9YB 1CYCA 3NBTA 2C1UA 1N9CA 1GU2A 1I6DA 1H33B 351CA 1YICA 4WQ7A 5CICB 2AI5A 1LC2A 3CP5A 1S5LV 4L3GA 3RLMA 2FRCA 1CRYA 1N50A 2JTIB 1L0LD 3CXHW 1DW1A 2Q3EA 4L1QA 1HJ3A 4A7PA 4GYDA 3WFCC 1H33A 5DFSA 1C7MA 1SQVD 3X39A 1DIIC 3CX5D 4O1QA 3O1YA 1HJ5A 1NTKD 1CTYA 4RSZA 1F1CA 4WQCA 1B7VA 2XTSB 3WFDC 3O5CA 1SQQD 1YTCA 4WQBA 1IZL0 3NWVA 2L91A 2C9XB 1CXAA 1CIEA 1OCDA 3A9FA 1NTMD 1CIFA 1S6VB 1HZUA 3L70D 1KB0A 1CRHA 2EXVA 2Y0EA 4EIDA 2CE0A 3SJLA 1FI3A 1OAEA 2N9JA 1CRGA 1L0ND 4P4QB 4FAVA 1J3SA 4N0KA 3L73D 1CRCA 2I8FA 3NBSA 1C6SA 1H32B 4O1WA 1I5TA 1LS9A 1BGYD 3L71D 1IRVA 2L4DA 1C52A 4K3IA 4WQEA 3VNWA 3CXHD 5TISV 2LITA 1C6OA 2AIUA 1A56A 4EIFA 3ZIYA 1CYIA 1YEAA 4AAOA 2BPBB 4JCGA 3MK7B 1MG3D 1HZVA 3CX5W 1CRIA 1C2NA 2KNCB 1I54A 3HQ7A 3PTZA 2N9IA 4AANA 1YIQA 1SQPD 2C2CA 4D6TD 4PWAA 4PW9B 1DIQC 3OA8B 2PCCB 2DVHA 3PHLA 2N18B 1RZ5A 1NMIA 1P84D 3DMIA 3L74D 1CCRA 1QKSA 3L4MA 3O0RC 1CSUA 1HJ4A 3ZBMA 3VMAA 1AYGA 1QL3A 1RAQA 1IRWA 2GIWA 1K3HA 1YEBA 2LIRA 3ZOXA 2GB8B 3DR0A 3PH2B 3WUIA 3FWLA 4AALA 4H0JA 4KMGA 1AKKA 1FI9A 1DW3A 3OCDA 4QAOA 2VHDA 1QL4A 1U75B 5EXQA 1BE3D 3A0HV 2B4ZA 1C6RA 1HROA 4FB1A 3TGUD 1PP9D 3L4OA 3WC8A 1PPJD 4WQDA 3ZOYA 1KX7A 1A2SA 4Y5RA 1M60A 3KHUA 3HQ8A 3VYMA 2AXTV 2D0WA 1LC1A 4XXLA 1DVVA 3CYTI 3PLNA 4FA4A 2BCCD 1K3GA 1AOQA 5KLVD 1CHHA 1KX2A 2PACA 5KKZB 2QJYB 1CSWA 5AURA 2B12B 1CTZA 1CYJA 1I8OA 2GC7D 2ZOOA 1DT1A 5DJQC 1CHIA 4EIEA 2ZXYA 3PXSA 2N3BA 3PRJA 3ZCFA 1QYZA 3H1HD 2QJPB 1N90A 1DW0A 1I6EA 2OZ1B 1M70A 1R0QA 1NNOA 2GC4D 5KAFV 4FA1A 5C0ZA 3ORVA 4UB6V 1DW2A 2C1DB 1H32A 1YCCA 4MU8A 2OZ1A 1CC5A 2FYUD 1EZVD 2V07A 3TYIA 1W5CT 3H1ID 1MZ4A 1WVEC 1CIGA 5H2FV 1CSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JWA A;  2YCC A;  5CIB B;  4UB8 V;  1NU1 D;  2BLF B;  155C A;  4EDF A;  1YFC A;  5CIE B;  3BCC D;  5E79 V;  1BCC D;  1C2R A;  2BH4 X;  1JDL A;  1GDV A;  3C2C A;  4XYD B;  2C8S A;  1COR A;  1YNR A;  2N3Y A;  4AX3 A;  3OA8 A;  5B5E V;  1MG2 D;  3H1J D;  4FAN A;  3WFB C;  4Q5P A;  1A8C A;  1C75 A;  2YIU B;  4L3H A;  3L75 D;  4V2K A;  5CID B;  3PXT A;  2K9J B;  1H9X A;  4U3F D;  2CA3 B;  2FWL A;  4EIC A;  4WQA A;  3H1L D;  2IBZ D;  1CRJ A;  1QN2 A;  2HV4 A;  2MHM A;  3WFE C;  5TJH A;  3SLE A;  1L9J C;  1SQX D;  5DF5 A;  2PCB B;  1E8E A;  2ZZS 1;  1KV9 A;  4IL6 V;  2O3J A;  2V08 A;  4AAM A;  5KAI V;  1FHB A;  1ETP A;  5GTH V;  2CE1 A;  3ITK A;  1COT A;  1RAP A;  1CIH A;  3DP5 A;  1NML A;  4NFG B;  3VRD A;  3HQ9 A;  3ZOW A;  3CU4 A;  1F1F A;  2B0Z B;  1I55 A;  3HQ6 A;  2MTA C;  4WQ8 A;  4FA9 A;  3RN0 A;  3PXW A;  3SVW A;  1CXC A;  2CXB A;  1DVH A;  2QJK B;  1GQ1 A;  3RN1 A;  1FCD C;  1FI7 A;  1IO3 A;  1HCM A;  1H1O A;  3L72 D;  4YE1 A;  1U74 B;  3SWS A;  1CTJ A;  5KLI B;  1AOF A;  451C A;  1CHJ A;  3CWB D;  5DJQ B;  4J20 A;  4WQ9 A;  5CIH B;  1H9Y A;  1KB9 D;  1KYO D;  1W2L A;  4PD4 D;  1CO6 A;  1ZZH A;  2B11 B;  1L9B C;  1GKS A;  1NTZ D;  3JBT B;  5CIF B;  1LMS A;  1LFM A;  2RN0 A;  3ZOO A;  2ZON G;  4GED B;  1M6Z A;  2ORL A;  1CNO A;  2ZBO A;  2Y0D A;  1E2R A;  2FYN B;  5B66 V;  5GTI V;  2YK3 A;  2C1D A;  1FJ0 A;  4RJT A;  3MK7 C;  1KIB A;  2QG4 A;  2A06 D;  3RMZ A;  1CSV A;  5CIG B;  3M97 X;  1CCH A;  1NIR A;  1SQB D;  1IQC A;  2CA4 B;  2DGE A;  1BL9 A;  5CYT R;  4DY9 A;  4PJ0 V;  1E29 A;  3KZI V;  3TF5 A;  3H1K D;  1HRC A;  1I8P A;  1WEJ F;  1ZRT D;  3WU2 V;  2Y0C A;  3GW6 A;  2JQR A;  2D0S A;  2N18 C;  1GIW A;  2C1V A;  2BCN B;  1H31 B;  5B6Q A;  3O20 A;  3SXT A;  5IY5 1;  1VYD A;  2YQB A;  3A0B V;  2KS1 A;  4H0K A;  2BH5 X;  1RZ6 A;  4FA5 A;  5C9M A;  1FOC A;  1KYO W;  1N15 A;  2B10 B;  2RMZ A;  2BGV X;  1HH7 A;  3GG2 A;  3OCD B;  1CED A;  3TDK A;  1EB7 A;  4LJI A;  1H31 A;  1GJQ A;  2N9Y B;  1CYC A;  3NBT A;  2C1U A;  1N9C A;  1GU2 A;  1I6D A;  1H33 B;  351C A;  1YIC A;  4WQ7 A;  5CIC B;  2AI5 A;  1LC2 A;  3CP5 A;  1S5L V;  4L3G A;  3RLM A;  2FRC A;  1CRY A;  1N50 A;  2JTI B;  1L0L D;  3CXH W;  1DW1 A;  2Q3E A;  4L1Q A;  1HJ3 A;  4A7P A;  4GYD A;  3WFC C;  1H33 A;  5DFS A;  1C7M A;  1SQV D;  3X39 A;  1DII C;  3CX5 D;  4O1Q A;  3O1Y A;  1HJ5 A;  1NTK D;  1CTY A;  4RSZ A;  1F1C A;  4WQC A;  1B7V A;  2XTS B;  3WFD C;  3O5C A;  1SQQ D;  1YTC A;  4WQB A;  1IZL 0;  3NWV A;  2L91 A;  2C9X B;  1CXA A;  1CIE A;  1OCD A;  3A9F A;  1NTM D;  1CIF A;  1S6V B;  1HZU A;  3L70 D;  1KB0 A;  1CRH A;  2EXV A;  2Y0E A;  4EID A;  2CE0 A;  3SJL A;  1FI3 A;  1OAE A;  2N9J A;  1CRG A;  1L0N D;  4P4Q B;  4FAV A;  1J3S A;  4N0K A;  3L73 D;  1CRC A;  2I8F A;  3NBS A;  1C6S A;  1H32 B;  4O1W A;  1I5T A;  1LS9 A;  1BGY D;  3L71 D;  1IRV A;  2L4D A;  1C52 A;  4K3I A;  4WQE A;  3VNW A;  3CXH D;  5TIS V;  2LIT A;  1C6O A;  2AIU A;  1A56 A;  4EIF A;  3ZIY A;  1CYI A;  1YEA A;  4AAO A;  2BPB B;  4JCG A;  3MK7 B;  1MG3 D;  1HZV A;  3CX5 W;  1CRI A;  1C2N A;  2KNC B;  1I54 A;  3HQ7 A;  3PTZ A;  2N9I A;  4AAN A;  1YIQ A;  1SQP D;  2C2C A;  4D6T D;  4PWA A;  4PW9 B;  1DIQ C;  3OA8 B;  2PCC B;  2DVH A;  3PHL A;  2N18 B;  1RZ5 A;  1NMI A;  1P84 D;  3DMI A;  3L74 D;  1CCR A;  1QKS A;  3L4M A;  3O0R C;  1CSU A;  1HJ4 A;  3ZBM A;  3VMA A;  1AYG A;  1QL3 A;  1RAQ A;  1IRW A;  2GIW A;  1K3H A;  1YEB A;  2LIR A;  3ZOX A;  2GB8 B;  3DR0 A;  3PH2 B;  3WUI A;  3FWL A;  4AAL A;  4H0J A;  4KMG A;  1AKK A;  1FI9 A;  1DW3 A;  3OCD A;  4QAO A;  2VHD A;  1QL4 A;  1U75 B;  5EXQ A;  1BE3 D;  3A0H V;  2B4Z A;  1C6R A;  1HRO A;  4FB1 A;  3TGU D;  1PP9 D;  3L4O A;  3WC8 A;  1PPJ D;  4WQD A;  3ZOY A;  1KX7 A;  1A2S A;  4Y5R A;  1M60 A;  3KHU A;  3HQ8 A;  3VYM A;  2AXT V;  2D0W A;  1LC1 A;  4XXL A;  1DVV A;  3CYT I;  3PLN A;  4FA4 A;  2BCC D;  1K3G A;  1AOQ A;  5KLV D;  1CHH A;  1KX2 A;  2PAC A;  5KKZ B;  2QJY B;  1CSW A;  5AUR A;  2B12 B;  1CTZ A;  1CYJ A;  1I8O A;  2GC7 D;  2ZOO A;  1DT1 A;  5DJQ C;  1CHI A;  4EIE A;  2ZXY A;  3PXS A;  2N3B A;  3PRJ A;  3ZCF A;  1QYZ A;  3H1H D;  2QJP B;  1N90 A;  1DW0 A;  1I6E A;  2OZ1 B;  1M70 A;  1R0Q A;  1NNO A;  2GC4 D;  5KAF V;  4FA1 A;  5C0Z A;  3ORV A;  4UB6 V;  1DW2 A;  2C1D B;  1H32 A;  1YCC A;  4MU8 A;  2OZ1 A;  1CC5 A;  2FYU D;  1EZV D;  2V07 A;  3TYI A;  1W5C T;  3H1I D;  1MZ4 A;  1WVE C;  1CIG A;  5H2F V;  1CSX A; 
#chains in the Genus database with same CATH topology
 1QVF O;  1PV3 A;  4UB8 V;  2WSS H;  3AEF C;  4EDF A;  2KNC A;  1OIP A;  3BCC D;  3AEB C;  2KUB A;  1JDL A;  1N2D C;  3C2C A;  1IJD B;  1RHZ B;  1USD A;  1OFC X;  3A2A A;  2WPR A;  1Q81 Q;  3OA8 A;  3AEC C;  2YXQ B;  3V2R A;  1BGY J;  1GL2 A;  3HD7 A;  1C75 A;  5CID B;  1IK9 A;  2AXT H;  3HUS B;  5KAI H;  4HB1 A;  2K9J B;  1L0L E;  1W2B O;  2FWL A;  4EIC A;  1KB9 I;  1KYO I;  3A7O A;  1HVV A;  3H1L D;  3CX5 E;  3OAK A;  2XDJ A;  1GU4 A;  1DH3 A;  1NTK E;  1HUC A;  4IFD K;  1KQL A;  4C46 A;  1OW8 A;  1SQV K;  1E8E A;  1SQQ E;  3H1I J;  1Q7Y Q;  1OXZ A;  2HYN A;  1YJ9 P;  3VMX A;  4KJM A;  2KIK A;  2K3R A;  5GTH V;  3G71 P;  2O1J A;  3M9Q A;  1R5S A;  1EDJ A;  3CD6 P;  1NML A;  2D2C C;  5AVV B;  3HQ9 A;  1KIL E;  1NTM K;  3HE4 B;  4JPZ B;  3GF7 A;  3H1L G;  1I55 A;  2R5D A;  3HTK A;  4WQ8 A;  1VF5 C;  3RN0 A;  3L73 E;  2M3B A;  2CXB A;  2D2C D;  1FCD C;  1X22 A;  1L0N K;  1HBW A;  1VF5 D;  4IFM A;  5AVQ B;  2WWW A;  3EWK A;  3L75 J;  2ZYD A;  2HPC B;  3SSU A;  1HWT C;  2I1J A;  1URQ B;  3LIE A;  1JO5 A;  4J20 A;  1P84 I;  4WQ9 A;  5CIH B;  4PD4 D;  4M3L A;  1ZZH A;  1LTT C;  2QVA A;  3V2N A;  4JF7 A;  4OGQ C;  1ZRT E;  4H44 B;  4GED B;  3M0D A;  3WU2 H;  2CPS A;  1H8A A;  1CNO A;  2ZBO A;  1NAY A;  1E2R A;  3BVH A;  2FYN B;  4OGQ D;  3CPW O;  2QE7 H;  1KIB A;  2AXT E;  1FZC C;  3RMZ A;  3PP5 A;  3Q1M A;  1CSV A;  2WSC H;  3MIW A;  1CCH A;  1NIR A;  1SQP K;  4H13 C;  1OW7 A;  3P8C D;  1IFP A;  1IQC A;  1CSB A;  3F89 A;  4H13 D;  4IFF A;  2KYV A;  1I8P A;  1WEJ F;  1VQ7 P;  1J1D B;  2N18 C;  2D0S A;  3CI9 A;  3EFF K;  5AVS B;  3CWB J;  3NMD A;  1H31 B;  2LXC B;  2YO3 A;  3MUD C;  1EXI A;  3SXT A;  5IY5 1;  1VYD A;  3A0B V;  1JY2 N;  2C9L Y;  4GOE A;  2MKV A;  1HGZ A;  4FA5 A;  2GUV A;  5C9M A;  1PP9 E;  1QL2 A;  1PPJ E;  2R3S A;  2B10 B;  1ZR2 A;  3GG2 A;  1EB7 A;  2FBW C;  5APS A;  3MGN A;  1CYC A;  1LP1 A;  2E43 A;  3CC2 P;  5DJT B;  1H33 B;  1JY3 N;  1K73 Q;  1M7L A;  1X9V A;  4W7Y A;  3IAO A;  1S5L V;  1RF1 C;  1DW1 A;  3CCS P;  2Q3E A;  5H2F E;  1N73 B;  1VQ5 P;  1T8Z A;  1SQV D;  3X39 A;  2B9B A;  1AA0 A;  1DII C;  3LW5 J;  1NKN A;  1HJ5 A;  4WB4 A;  2IFN A;  3WU2 E;  2FXM A;  2WMM A;  3CCM P;  1CXA A;  2QM8 A;  1NTM D;  2WZ7 A;  3L70 D;  1HZU A;  1AVY A;  1KB0 A;  2Y0E A;  2CE0 A;  3RL0 D;  3SJL A;  3L37 A;  3H1L J;  4B86 A;  4N3Y B;  1L0N D;  1LTS C;  1KIL B;  1SQV G;  4N0K A;  2WT7 A;  1EZV E;  2HR3 A;  4DCK A;  2I8F A;  1FZA A;  1H32 B;  4O1W A;  3JSV C;  1LS9 A;  1YIJ P;  3L71 D;  2NPS B;  1JCC A;  1ZLL A;  1KB9 H;  1KYO H;  2XNX A;  1NTM G;  1NU1 E;  3L70 G;  5KLV G;  1SLQ A;  2P7J A;  3SWF A;  2LIT A;  2RH0 A;  2IYO A;  1KQS O;  4AAO A;  4BWN A;  3H32 B;  3SWK A;  3VYI A;  4YXD C;  2ZYG A;  2LR2 A;  3H1H G;  2LXB A;  5AVW B;  1G2C B;  4AAN A;  1SQP D;  4PW9 B;  4XFJ A;  2PCC B;  1FZC A;  5C39 A;  1P84 D;  2ZYA A;  3A0H H;  4XE5 B;  2VRS A;  3Q3D A;  1M1J B;  1U7M A;  4YXW H;  4Y99 B;  3HUS C;  2YKP A;  1AYG A;  3CCE P;  4LLH A;  1S9K D;  1T3J A;  3HRN A;  1JUN A;  4H0J A;  1P84 H;  3MUD A;  4GKG A;  1K8A Q;  1TU3 F;  5EXQ A;  1DIP A;  4FB1 A;  3TGU D;  1K05 A;  3L4O A;  1BSH A;  4I2L C;  2OTK E;  4KHX A;  4DOJ A;  2BAS A;  2YXR B;  4OH8 B;  1OWA A;  2P58 A;  1MKM A;  2K88 A;  4JYB A;  2D0W A;  2C9N Y;  1DVV A;  3AEA C;  2OTJ P;  5KKZ C;  3P8M C;  4FA4 A;  3GF3 A;  2BCC D;  4UB6 H;  3M91 A;  1AOQ A;  3O8Z A;  2A45 G;  1YQ3 C;  3CCR P;  1CHH A;  1KX2 A;  3B4S A;  2PAC A;  2QJY B;  3TGU G;  2B12 B;  1CTZ A;  3CCL P;  4OVN F;  1ZXG A;  5EFW B;  2IZ0 A;  1URQ C;  4I7Z B;  3CC7 P;  1KV4 A;  4C7N B;  3C1L A;  2ZXY A;  1SFC B;  1ZOY C;  1LWU B;  3AE3 C;  1URQ D;  2Q6Q A;  1N90 A;  1CZQ A;  1GTW A;  2OYO A;  3U1C A;  1N7L A;  1Q90 D;  1SQB E;  1YIT P;  2KP8 A;  3VP8 A;  1SQV J;  1H0T B;  2FYN C;  3O6Q A;  3H1K E;  2V7Q J;  1QEX A;  2R44 A;  1NGM B;  1W5C T;  5CBN A;  3H1I D;  1MZ4 A;  1WVE C;  1CIG A;  1PGP A;  3L70 J;  5KLV J;  3TNU A;  3H6P A;  1KQF B;  2DW3 A;  1E5W A;  1YFC A;  1C2R A;  1YYC A;  3ABV C;  3WUT A;  1FDI A;  1COR A;  2Z5I A;  1YNR A;  4AX3 A;  5AVY B;  3H1H J;  1MG2 D;  1N8R Q;  4FAN A;  3H1I G;  2YIU B;  4AYC A;  2Q5U A;  2WSE J;  3L75 D;  1GZL A;  1VQP P;  5GTH H;  3L36 A;  3KDP B;  2CK3 H;  4UB6 E;  2PP6 A;  3KQG A;  4JBZ A;  4KT0 J;  1CRJ A;  3JCU H;  2MHM A;  2OYH B;  3WFE C;  1VDF A;  2I8D A;  2FYU J;  5DF5 A;  3E1I A;  2XV5 A;  1KV9 A;  2W6J H;  4IL6 V;  1N73 C;  3L75 G;  1FHB A;  1VQ6 P;  1S4X A;  2CE1 A;  1COT A;  3RK3 B;  1RAP A;  2AXC A;  1FAV A;  3RBZ A;  5AW2 B;  1VQL P;  1YI2 P;  2IYP A;  3IR9 A;  3HQ6 A;  4FA9 A;  2QJK B;  4XA4 A;  1HCM A;  1IFN A;  1H1O A;  1VQ8 P;  2YMY A;  1BGY E;  1U74 B;  3HE4 A;  1EDI A;  2ZVO B;  1CTJ A;  1AOF A;  5AW9 B;  1KIL C;  2IDB A;  4H0L D;  3CWB D;  1L0L G;  3CXH E;  1RF0 C;  2Q9I A;  2L5G B;  2JKV A;  3E7K A;  1LTB C;  1S1C X;  1W2L A;  5AW5 B;  1QVG O;  1IFD A;  3C8V A;  3TGU J;  1CO6 A;  1GKS A;  1L9B C;  1U57 A;  3JBT B;  2LKM A;  1URQ A;  2BEQ D;  2FXP A;  1SQX J;  4GT1 A;  3MZW B;  3V2Q A;  1Y9B A;  3PH0 A;  1SQQ G;  1M6Z A;  2H7H A;  5APV A;  1FZE A;  5AVR B;  5B5E H;  4D6T E;  5B66 V;  5GTI V;  1YTZ T;  2KSJ A;  2C1D A;  3T97 B;  1FJ0 A;  3B5N B;  2QG4 A;  5GTH E;  2A06 D;  3A0B H;  3R4Y A;  2FKW B;  4DY9 A;  5CYT R;  2IX7 C;  4PJ0 V;  1E29 A;  3JCU E;  3KZI V;  1T2K C;  3N7N A;  1D7M A;  3K5B A;  1ZRT D;  2Y0C A;  2E75 B;  3CLQ A;  1T2K D;  3C9I A;  1VQN P;  2B87 B;  3OW2 O;  3Q2Y A;  1M1J C;  3B71 A;  4Y99 C;  3G4S P;  2YQB A;  1BE3 E;  2KS1 A;  2A06 G;  1RZ6 A;  1JY2 O;  3LW5 H;  5KAF E;  2RMZ A;  2W27 A;  1SVF A;  1HH7 A;  2W6A A;  3TDK A;  1CED A;  5CCH C;  4LJI A;  1H31 A;  4I6M C;  1NOH A;  2JJL A;  5CCH D;  1N9C A;  1GU2 A;  1L4A B;  3II6 A;  1N86 A;  2O01 J;  351C A;  1A02 F;  4WQ7 A;  4BXL A;  5M1B A;  3CP5 A;  1LT9 B;  4L3G A;  1JY3 O;  1HJB A;  1N50 A;  2JTI B;  4JYC A;  1SP4 A;  4L1Q A;  1H88 A;  4A7P A;  4GYD A;  1H33 A;  5DFS A;  3FX0 A;  5KLV K;  1JMB A;  1GD2 E;  5E79 E;  4WQC A;  1B7V A;  2XTS B;  3WFD C;  2QIW A;  2HFE D;  4YPC A;  3PJS K;  1N73 A;  1YTC A;  1YTZ I;  2QJY C;  4N78 E;  2C9X B;  1GK4 A;  5B5E E;  4ASW A;  5APT A;  1CIE A;  3D71 A;  2O01 N;  1S2E A;  4I7Z C;  4AUW A;  1OVV A;  1VQ4 P;  2POH A;  2EXV A;  2OAR A;  1RE4 A;  1MUU A;  4EID A;  1SFC C;  3R2P A;  5AW6 B;  3P7K A;  1LWU C;  3TYY A;  2N9B A;  3B8E B;  3U1A A;  2FXO A;  1SFC D;  1CRC A;  4RKU J;  4WY4 B;  1KTM A;  3CMA P;  1VPC A;  5APY A;  1KOR A;  2FYU K;  1L0L J;  3RL0 g;  4L75 A;  1C52 A;  4WQE A;  4PD4 H;  2A45 I;  2RKL A;  5KAI E;  3BCC E;  2W8Z A;  1A56 A;  4EIF A;  3ZIY A;  4JCG A;  3MHV A;  1FC2 C;  1MG3 D;  1HZV A;  1CRI A;  2KNC B;  1Q86 Q;  1X8Y A;  1SQQ J;  2YMK A;  1I54 A;  3HQ7 A;  3QWO C;  1BDD A;  1LTJ A;  1QX8 A;  1DIQ C;  3OA8 B;  3PHL A;  1OZH A;  3HD7 B;  1OMI A;  2E76 B;  1RZ5 A;  1NMI A;  1FZF A;  1G2C A;  3DMI A;  3L74 D;  1KC8 Q;  1NKZ B;  2BEZ F;  1CW5 A;  4PV1 B;  2J59 M;  3L73 J;  1R8E A;  2YIU C;  3L4M A;  2AEF A;  3ZBM A;  2YNY A;  1QL3 A;  2ZXE B;  2KI7 B;  1LTI C;  1ZP0 C;  1AQT A;  1DD3 A;  2E42 A;  5L8R J;  1YEB A;  2LIR A;  2KXP B;  4L73 A;  2GB8 B;  3SFE C;  2O1K A;  1M1J A;  1OX3 A;  1SQX K;  3FWL A;  1AKK A;  1FI9 A;  2OYH C;  3OCD A;  1NU1 G;  4QAO A;  1QL4 A;  2WSF J;  4U7J A;  1KQG B;  2B4Z A;  3L74 G;  2M5A B;  2QEX P;  1A2S A;  4HKZ H;  1JY2 P;  3RK3 C;  5AW3 B;  2YKO A;  1X79 B;  2Z5H A;  1QGK B;  3VYM A;  3AE9 C;  1N7S C;  1XTC C;  2AXT V;  1Y8A A;  2FYZ A;  1LC1 A;  3RK3 D;  4XXL A;  3V2P A;  4DZO A;  4DJG A;  5KJ7 C;  3AEE C;  2QJK C;  1JTH B;  1N7S D;  5KLV D;  4PD4 E;  1S5L X;  2SPZ A;  2JR8 A;  2HOD A;  2V7Q H;  5KJ7 D;  5TIS H;  3VN0 A;  5AUR A;  4LGD E;  3D6Y A;  5DJU B;  2B89 A;  2QJP C;  1LGH B;  3AE1 C;  4TT3 H;  3WUV A;  1NTZ K;  3FWN A;  1YQ4 C;  4CPG A;  1J2J B;  1QYZ A;  3H1H D;  4GOF A;  1I6E A;  2M3E A;  1JEK A;  2OZ1 B;  1M70 A;  4YTP C;  3ORV A;  1OVR A;  3W67 A;  4C7N A;  3N4X A;  3P8C E;  1SFC A;  2HG5 D;  1LWU A;  3EQ2 A;  3FXD A;  3VTP C;  3WUU A;  3A5T A;  1CC5 A;  2FYU D;  2AEJ A;  2WSE H;  2K9Y A;  3MP7 B;  2H8P D;  2ZT9 B;  5H2F V;  2JEE A;  2JWA A;  2YCC A;  1EXJ A;  2WPV B;  2BLF B;  2N1T B;  2R3C A;  3I5C A;  1Z56 A;  3I55 P;  3CL3 D;  2E75 C;  1MFZ A;  1GU5 A;  5CIE B;  1BCC D;  2BH4 X;  2C8S A;  2E75 D;  4GDO A;  2N3Y A;  4EI2 A;  3BAS A;  2FYU G;  3H1J D;  1JM0 A;  1MFT A;  3GHG B;  1WMK A;  5APU A;  1Y47 A;  4Q5P A;  4IL6 H;  4L3H A;  3PXT A;  3H25 A;  1LP1 B;  2KOG A;  2ZJS E;  4BRY B;  4U3F D;  2CA3 B;  2IZ1 A;  1L4A C;  5APW A;  1SQV E;  1BCC G;  2IBZ D;  3S9O A;  1L0L K;  5TIS E;  1YJW P;  3JC2 2;  1PGO A;  1LT9 C;  1J1E B;  1L9J C;  1SQX D;  3H1J G;  1NTK K;  2O3J A;  2V08 A;  2OGU A;  1NTM E;  2A45 H;  3ITK A;  1NU1 J;  1SQQ K;  1CIH A;  4U3F G;  3DP5 A;  3VMZ A;  2GUS A;  2ZXX A;  3VRD A;  1KB9 E;  1KYO E;  1RF1 A;  1WT6 A;  3ZOW A;  1L0N E;  3L74 J;  2E74 B;  4W7Z A;  2B0Z B;  2IBZ G;  1K04 A;  3G6E P;  3PXW A;  4GIF A;  3P32 A;  1DVH A;  2D2C B;  1GQ1 A;  1JMM A;  1FI7 A;  2WPS A;  3USS A;  3L72 D;  4YE1 A;  1SQX G;  2ITA A;  3L71 E;  1N7S A;  2P67 A;  3AEG C;  1DX7 A;  3FXE A;  451C A;  5GTI H;  5KJ7 A;  1CHJ A;  5DJQ B;  1UII A;  1H9Y A;  4WY4 C;  3TK1 A;  4H44 C;  4UB8 H;  2Z4E A;  3HE5 A;  5CCG C;  2B11 B;  1NTZ D;  4WBA A;  3IF4 A;  4PJ0 H;  1T3U A;  5CIF B;  3A0H E;  4WY4 D;  1LMS A;  1LFM A;  4H44 D;  1FE6 A;  1E79 H;  3VP9 A;  2ZON G;  3L72 G;  1OW6 A;  2ORL A;  2Y0D A;  1SQP E;  2ZFC A;  4ZKP A;  2YK3 A;  1VL2 A;  2KK7 A;  5CMZ A;  4RJT A;  2PAJ A;  3AE2 C;  2K1A A;  2QRX A;  1P84 E;  5CIG B;  2Q1K A;  3M97 X;  4AQR D;  3QH9 A;  1H89 A;  1J1D C;  2DGE A;  1NTZ G;  1S9K E;  3TF5 A;  3W68 A;  1HRC A;  3I56 P;  4EOT A;  1FS0 E;  2E76 C;  3L4F A;  5APX A;  1GIW A;  4PV1 C;  2C1V A;  2BCN B;  2OYI B;  1NH4 A;  1NHL A;  3O20 A;  2BH5 X;  3AE6 C;  2V4H A;  1S3J A;  4PV1 D;  1R5L A;  3TGU E;  1FOC A;  1LT1 A;  2GA1 A;  1N15 A;  2IFM A;  2BGV X;  4ZNC A;  1ZW0 A;  4EIJ A;  2FFD B;  2H88 C;  1QL1 A;  1KN7 A;  2OTL P;  3HUS A;  2K9J A;  3NBT A;  2C1U A;  2YO2 A;  4HJG H;  1I6D A;  1YIC A;  1LTG C;  1EQ7 A;  5BU8 B;  2BCC E;  1LC2 A;  1Q2N A;  5GTI E;  3RLM A;  2FRC A;  5CHX A;  1FDM A;  1CRY A;  3CC4 P;  1L0L D;  3CXH W;  3RBX A;  1HJ3 A;  1CI6 B;  1BCC J;  3D70 A;  3WFC C;  4MN4 C;  2CPB A;  4UB8 E;  3CX5 D;  2PRR A;  1FDO A;  3O1Y A;  1LT9 A;  1EZV I;  2JDI H;  4PJ0 E;  1NTK D;  4RSZ A;  1F1C A;  1X0T A;  1VQO P;  2B88 A;  3H1J J;  3IFM A;  1SQQ D;  3MD0 A;  4WQB A;  2L91 A;  4IL6 X;  1CIF A;  1DEE G;  1S6V B;  4U3F J;  1BE3 G;  1FJP A;  2P1J A;  3RL0 B;  1FI3 A;  1OAE A;  1KIL D;  3WMM 0;  4P4Q B;  1J3S A;  2HPC A;  3L73 D;  1IK7 A;  3V4W A;  1NTK G;  2NPS C;  3M0D C;  1W2E A;  1IO4 A;  2ZAE B;  1GMJ A;  3H1I E;  3BRV B;  1IRV A;  2NPS D;  2L4D A;  4HH2 A;  1FZB A;  1C6O A;  1YEA A;  1NU1 K;  2ZT9 C;  3UIA A;  2BPB B;  3TNU B;  3L73 G;  3MK7 B;  3CX5 W;  3L72 J;  1M1K Q;  1PL5 A;  2N1T C;  2ZT9 D;  3ZDM A;  3PTZ A;  3L75 E;  2N9I A;  2ZVN B;  1YIQ A;  2C2C A;  4PWA A;  1EDK A;  2N1T D;  2P2U A;  1RQU A;  2R5B A;  1BDC A;  1JOC A;  1RH5 B;  1S5L H;  3GHG C;  2W83 C;  1HF9 A;  1CCR A;  1NTZ J;  2QSI A;  1QKS A;  2QM7 A;  3O0R C;  5CBO A;  1CSU A;  1HJ4 A;  3VMA A;  1KD1 Q;  1RAQ A;  1IRW A;  1FU1 A;  2GIW A;  1K3H A;  1QLE D;  3ZOX A;  3DR0 A;  3PH2 B;  3WUI A;  1DD4 A;  4AAL A;  4W80 A;  4N6J A;  1DW3 A;  2C0X A;  2VHD A;  1U75 B;  4RES B;  1FJK A;  4ZKU A;  1J1E C;  2NZ2 A;  3BCC G;  1C6R A;  3G9R A;  4TLF A;  1PP9 D;  1DEB A;  1PPJ D;  4WQD A;  1KX7 A;  1YJN P;  3S4R A;  1M60 A;  3KHU A;  4K3A A;  2G3A A;  2Y9Y A;  1AJY A;  3GLM A;  4D6T J;  2E74 C;  4I1L A;  2M5A A;  3CWB E;  2WQY C;  3CYT I;  1S72 P;  3PLN A;  2J58 A;  3M06 A;  3D0W A;  2E74 D;  3IN6 A;  1IFI A;  3A3Y B;  5KKZ B;  2OQQ A;  3V5B A;  3A0B E;  4NPE A;  1PP9 G;  1AQ5 A;  1PPJ G;  1CYJ A;  1I8O A;  1PGJ A;  5DJQ C;  1DT1 A;  1JTH A;  1CHI A;  4C7R A;  4EIE A;  3PXS A;  3ZCF A;  1OVU A;  5AVX B;  1NJI Q;  5APQ A;  3U59 A;  1FZG A;  2GC4 D;  5KAF V;  1KIL A;  2A06 E;  4FA1 A;  5H2F H;  2WTY A;  1BE3 J;  2Q7C A;  1RF0 A;  1NWQ A;  1DW2 A;  3LID A;  1NO4 A;  2IBZ I;  5AVU B;  1S5L E;  1XTG B;  2C1D B;  1H32 A;  2MJZ A;  1YCC A;  1USE A;  3S1K A;  2OZ1 A;  2C0W A;  4ASV A;  1SQB K;  1NTK J;  2NPS A;  5AW0 B;  1MZ9 A;  2HLO A;  1KMI Z;  1EZV D;  2V07 A;  3CCQ P;  1NAF A;  3H32 A;  5CIB B;  1NU1 D;  155C A;  1GL2 B;  5E79 V;  3H1L E;  4RO0 A;  1GDV A;  1GK6 A;  3D6Z A;  2KS1 B;  4XYD B;  3Q5P A;  2OYI C;  4HYT B;  3AED C;  3BAT A;  1LTA C;  5B5E V;  1EZV G;  2N1T A;  1FOS E;  2IPP A;  3WFB C;  2FY8 A;  1AVO A;  1A8C A;  4R4L A;  4V2K A;  1GW3 A;  4QMA A;  2FFD C;  1H9X A;  1RE3 C;  3GHG A;  4WQA A;  3VMY A;  4ZMD A;  1QN2 A;  2HV4 A;  5TJH A;  3E1R A;  3EFG A;  3SLE A;  5CCH A;  3F5H A;  4L76 A;  4BRY A;  2PCB B;  2ZZS 1;  1M90 Q;  2E5Y A;  3HTK B;  1PGQ A;  4AAM A;  5KAI V;  4NPD A;  1ETP A;  3CXH I;  1PIX A;  4R4M A;  4JQ0 D;  4NFG B;  1HGV A;  3BCC J;  3CU4 A;  1F1F A;  3Q5S A;  2MTA C;  1GDT A;  3SVW A;  1CXC A;  4IOI H;  1JY3 P;  1M57 D;  3RN1 A;  1AV1 A;  2KZJ A;  2K37 A;  1IO3 A;  1LNQ A;  3G3Z A;  5AW8 B;  3SWS A;  3RL0 C;  2W6B A;  5KLI B;  1BSN A;  4H0L B;  2XU6 A;  1G1I A;  1KB9 D;  1KYO D;  2QA4 P;  3RK2 B;  2E5T A;  1PP9 J;  3RGU A;  2RN0 A;  3ZOO A;  3NTN A;  3B5N C;  1T6A A;  1W5C E;  5BVZ A;  1PFI A;  1NVO A;  4OWF A;  3B5N D;  1VQK P;  2JP3 A;  1H0T A;  3MK7 C;  2PGD A;  3L74 E;  5KTB A;  1SQB D;  1L0N G;  1VQM P;  1LTJ B;  2CA4 B;  1BL9 A;  5BU5 A;  3CX5 I;  1ZR4 A;  3CCV P;  3GMA A;  4K35 A;  1YHQ P;  3H1K D;  3KYQ A;  3WU2 V;  1M56 D;  1HJ0 A;  3GW6 A;  2JQR A;  3L71 G;  2XND H;  3NXS A;  3AE7 C;  1VQ9 P;  2KZI A;  5B6Q A;  5AW1 B;  1JB0 J;  3FGA D;  5CJ4 A;  4H0K A;  3KXD A;  1SQB G;  1KYO W;  4Y28 J;  1SS1 A;  2WSC J;  3OCD B;  2OYI A;  5CJ0 A;  2M0B A;  1GJQ A;  3H1K G;  1IFM A;  2N9Y B;  3SWY A;  1L4A D;  3RK3 E;  3CCJ P;  1SQP G;  1YBK A;  5CIC B;  2AI5 A;  2FFD A;  2NRG A;  3L70 E;  5KLV E;  2OYH A;  1NYH A;  1RE3 A;  1EDL A;  2I1K A;  1C7M A;  1ZN5 A;  4O1Q A;  3CME P;  5K5G B;  1CTY A;  3V6I A;  2AEM A;  2HOD B;  3H1H E;  1MV8 A;  1PZQ A;  3Q5R A;  3O5C A;  1CI6 A;  2XZR A;  1VF5 B;  1IZL 0;  3NWV A;  1OCD A;  2WT7 B;  3A9F A;  2G8Y A;  5B66 H;  1RQV A;  1CRH A;  4WWI A;  2N9J A;  1CRG A;  1ZV8 A;  4FAV A;  3AE8 C;  2KLV A;  1KFN A;  2KLU A;  2FYU E;  5AW4 B;  4GOD A;  1A02 J;  3KZI H;  3NBS A;  1C6S A;  3AE5 C;  5CCG D;  1I5T A;  1BGY D;  2KB7 P;  2BCC G;  2WIT A;  4EYY Q;  4K3I A;  3VNW A;  4OGQ B;  1JCD A;  4IL6 E;  2Q3I A;  3CXH D;  5TIS V;  1FBM A;  2R32 A;  1ZME C;  1BCC E;  1LJ2 A;  2AIU A;  1CYI A;  1L2P A;  1IFJ A;  4DT0 A;  1KFM A;  1FZC B;  2XKM A;  3H1J E;  1C2N A;  3T97 A;  4H13 B;  3B5N A;  5AVZ B;  2O01 H;  1BGY G;  1GL2 C;  3HD7 C;  2JO1 A;  3CXH H;  1NTM J;  4D6T D;  4U3F E;  2PFX A;  2YKQ A;  2DVH A;  1GL2 D;  3HD7 D;  2E76 D;  2H89 C;  2N18 B;  1JNM A;  1L0N J;  2IBZ E;  3M9B A;  1AFO A;  4WVZ A;  1KZU B;  1IZN B;  3OJA B;  2B87 A;  1SQX E;  3M9H A;  2JWD A;  1U7J A;  3L71 J;  2W90 A;  4O9B A;  4LC1 A;  4KMG A;  4D6T G;  5AVT B;  1FOS F;  2P10 A;  1RY3 A;  4PD4 I;  5B66 E;  1BE3 D;  1K9M Q;  2J5U A;  3A0H V;  1SQB J;  3NFQ A;  1HRO A;  3MTU E;  2GM4 A;  1L4A A;  3WC8 A;  3ZOY A;  2KSE A;  4Y5R A;  3OA7 A;  3L72 E;  3H1K J;  1RF1 B;  3HQ8 A;  4Z1M H;  1HTL C;  1G1J A;  3KZI E;  2H43 A;  1SQP J;  5AW7 B;  5KAF H;  1RE4 C;  3L35 A;  1K3G A;  1N7S B;  1EC5 A;  3CX5 H;  1NTZ E;  1CSW A;  5KLI C;  2GC7 D;  2ZOO A;  4H0L C;  3PRJ A;  2N3B A;  3HE5 B;  2UWJ E;  3RK2 C;  2QJP B;  4L74 A;  1DW0 A;  1GW4 A;  3O6Q B;  1UIX A;  1M8O B;  4N78 D;  1WRG A;  1R0Q A;  3BRT B;  1NNO A;  3M0A A;  3VOP A;  2Y9Z A;  3RK2 D;  5C0Z A;  4UB6 V;  1IC2 A;  4WY4 A;  5E79 H;  1Q82 Q;  4MU8 A;  3AE4 C;  5CCG A;  2WPQ A;  3V4Q A;  4NPF X;  2M8R A;  1HH0 A;  3TYI A;  3TSI A;  3CCU P;  1LTJ C;  3CWB G;  2WVR A;  3SFD C;  2BCC J;  3KPE A;  2WSF H;  1CSX A; 
#chains in the Genus database with same CATH homology
 2JWA A;  2YCC A;  5CIB B;  4UB8 V;  1NU1 D;  2BLF B;  155C A;  4EDF A;  1YFC A;  5CIE B;  3BCC D;  5E79 V;  1BCC D;  1C2R A;  2BH4 X;  1JDL A;  1GDV A;  3C2C A;  4XYD B;  2C8S A;  1COR A;  1YNR A;  2N3Y A;  4AX3 A;  3OA8 A;  5B5E V;  1MG2 D;  3H1J D;  4FAN A;  3WFB C;  4Q5P A;  1A8C A;  1C75 A;  2YIU B;  4L3H A;  3L75 D;  4V2K A;  5CID B;  3PXT A;  2K9J B;  1H9X A;  4U3F D;  2CA3 B;  2FWL A;  4EIC A;  4WQA A;  3H1L D;  2IBZ D;  1CRJ A;  1QN2 A;  2HV4 A;  2MHM A;  3WFE C;  5TJH A;  3SLE A;  1L9J C;  1SQX D;  5DF5 A;  2PCB B;  1E8E A;  2ZZS 1;  1KV9 A;  4IL6 V;  2O3J A;  2V08 A;  4AAM A;  5KAI V;  1FHB A;  1ETP A;  5GTH V;  2CE1 A;  3ITK A;  1COT A;  1RAP A;  1CIH A;  3DP5 A;  1NML A;  4NFG B;  3VRD A;  3HQ9 A;  3ZOW A;  3CU4 A;  1F1F A;  2B0Z B;  1I55 A;  3HQ6 A;  2MTA C;  4WQ8 A;  4FA9 A;  3RN0 A;  3PXW A;  3SVW A;  1CXC A;  2CXB A;  1DVH A;  2QJK B;  1GQ1 A;  3RN1 A;  1FCD C;  1FI7 A;  1IO3 A;  1HCM A;  1H1O A;  3L72 D;  4YE1 A;  1U74 B;  3SWS A;  1CTJ A;  5KLI B;  1AOF A;  451C A;  1CHJ A;  3CWB D;  5DJQ B;  4J20 A;  4WQ9 A;  5CIH B;  1H9Y A;  1KB9 D;  1KYO D;  1W2L A;  4PD4 D;  1CO6 A;  1ZZH A;  2B11 B;  1L9B C;  1GKS A;  1NTZ D;  3JBT B;  5CIF B;  1LMS A;  1LFM A;  2RN0 A;  3ZOO A;  2ZON G;  4GED B;  1M6Z A;  2ORL A;  1CNO A;  2ZBO A;  2Y0D A;  1E2R A;  2FYN B;  5B66 V;  5GTI V;  2YK3 A;  2C1D A;  1FJ0 A;  4RJT A;  3MK7 C;  1KIB A;  2QG4 A;  2A06 D;  3RMZ A;  1CSV A;  5CIG B;  3M97 X;  1CCH A;  1NIR A;  1SQB D;  1IQC A;  2CA4 B;  2DGE A;  1BL9 A;  5CYT R;  4DY9 A;  4PJ0 V;  1E29 A;  3KZI V;  3TF5 A;  3H1K D;  1HRC A;  1I8P A;  1WEJ F;  1ZRT D;  3WU2 V;  2Y0C A;  3GW6 A;  2JQR A;  2D0S A;  2N18 C;  1GIW A;  2C1V A;  2BCN B;  1H31 B;  5B6Q A;  3O20 A;  3SXT A;  5IY5 1;  1VYD A;  2YQB A;  3A0B V;  2KS1 A;  4H0K A;  2BH5 X;  1RZ6 A;  4FA5 A;  5C9M A;  1FOC A;  1KYO W;  1N15 A;  2B10 B;  2RMZ A;  2BGV X;  1HH7 A;  3GG2 A;  3OCD B;  1CED A;  3TDK A;  1EB7 A;  4LJI A;  1H31 A;  1GJQ A;  2N9Y B;  1CYC A;  3NBT A;  2C1U A;  1N9C A;  1GU2 A;  1I6D A;  1H33 B;  351C A;  1YIC A;  4WQ7 A;  5CIC B;  2AI5 A;  1LC2 A;  3CP5 A;  1S5L V;  4L3G A;  3RLM A;  2FRC A;  1CRY A;  1N50 A;  2JTI B;  1L0L D;  3CXH W;  1DW1 A;  2Q3E A;  4L1Q A;  1HJ3 A;  4A7P A;  4GYD A;  3WFC C;  1H33 A;  5DFS A;  1C7M A;  1SQV D;  3X39 A;  1DII C;  3CX5 D;  4O1Q A;  3O1Y A;  1HJ5 A;  1NTK D;  1CTY A;  4RSZ A;  1F1C A;  4WQC A;  1B7V A;  2XTS B;  3WFD C;  3O5C A;  1SQQ D;  1YTC A;  4WQB A;  1IZL 0;  3NWV A;  2L91 A;  2C9X B;  1CXA A;  1CIE A;  1OCD A;  3A9F A;  1NTM D;  1CIF A;  1S6V B;  1HZU A;  3L70 D;  1KB0 A;  1CRH A;  2EXV A;  2Y0E A;  4EID A;  2CE0 A;  3SJL A;  1FI3 A;  1OAE A;  2N9J A;  1CRG A;  1L0N D;  4P4Q B;  4FAV A;  1J3S A;  4N0K A;  3L73 D;  1CRC A;  2I8F A;  3NBS A;  1C6S A;  1H32 B;  4O1W A;  1I5T A;  1LS9 A;  1BGY D;  3L71 D;  1IRV A;  2L4D A;  1C52 A;  4K3I A;  4WQE A;  3VNW A;  3CXH D;  5TIS V;  2LIT A;  1C6O A;  2AIU A;  1A56 A;  4EIF A;  3ZIY A;  1CYI A;  1YEA A;  4AAO A;  2BPB B;  4JCG A;  3MK7 B;  1MG3 D;  1HZV A;  3CX5 W;  1CRI A;  1C2N A;  2KNC B;  1I54 A;  3HQ7 A;  3PTZ A;  2N9I A;  4AAN A;  1YIQ A;  1SQP D;  2C2C A;  4D6T D;  4PWA A;  4PW9 B;  1DIQ C;  3OA8 B;  2PCC B;  2DVH A;  3PHL A;  2N18 B;  1RZ5 A;  1NMI A;  1P84 D;  3DMI A;  3L74 D;  1CCR A;  1QKS A;  3L4M A;  3O0R C;  1CSU A;  1HJ4 A;  3ZBM A;  3VMA A;  1AYG A;  1QL3 A;  1RAQ A;  1IRW A;  2GIW A;  1K3H A;  1YEB A;  2LIR A;  3ZOX A;  2GB8 B;  3DR0 A;  3PH2 B;  3WUI A;  3FWL A;  4AAL A;  4H0J A;  4KMG A;  1AKK A;  1FI9 A;  1DW3 A;  3OCD A;  4QAO A;  2VHD A;  1QL4 A;  1U75 B;  5EXQ A;  1BE3 D;  3A0H V;  2B4Z A;  1C6R A;  1HRO A;  4FB1 A;  3TGU D;  1PP9 D;  3L4O A;  3WC8 A;  1PPJ D;  4WQD A;  3ZOY A;  1KX7 A;  1A2S A;  4Y5R A;  1M60 A;  3KHU A;  3HQ8 A;  3VYM A;  2AXT V;  2D0W A;  1LC1 A;  4XXL A;  1DVV A;  3CYT I;  3PLN A;  4FA4 A;  2BCC D;  1K3G A;  1AOQ A;  5KLV D;  1CHH A;  1KX2 A;  2PAC A;  5KKZ B;  2QJY B;  1CSW A;  5AUR A;  2B12 B;  1CTZ A;  1CYJ A;  1I8O A;  2GC7 D;  2ZOO A;  1DT1 A;  5DJQ C;  1CHI A;  4EIE A;  2ZXY A;  3PXS A;  2N3B A;  3PRJ A;  3ZCF A;  1QYZ A;  3H1H D;  2QJP B;  1N90 A;  1DW0 A;  1I6E A;  2OZ1 B;  1M70 A;  1R0Q A;  1NNO A;  2GC4 D;  5KAF V;  4FA1 A;  5C0Z A;  3ORV A;  4UB6 V;  1DW2 A;  2C1D B;  1H32 A;  1YCC A;  4MU8 A;  2OZ1 A;  1CC5 A;  2FYU D;  1EZV D;  2V07 A;  3TYI A;  1W5C T;  3H1I D;  1MZ4 A;  1WVE C;  1CIG A;  5H2F V;  1CSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...