3BCCD

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
241
structure length
241
Chain Sequence
SDLELHPPSYPWSHRGPLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSVREGLYFNPYFPGQAIGMAPPIYNDVLEFDDGTPATMSQVAKDVCTFLRWAAEPEHDHRKRMGLKMLLMMGLLVPLVYYMKRHKWSVLKSRKLAYRPPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
total genus 66
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3bccD02
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 3bccD01
1PP9D 1ZZHA 4O1QA 1E8EA 1HCMA 3ZOXA 4Y5RA 1CHHA 1NIRA 1N50A 5KKZB 2CE1A 3SJLA 1CCRA 1HH7A 1KX2A 1C7MA 2OZ1A 4H0KA 5DJQB 4GYDA 4PD4D 1W5CT 3MK7C 1CEDA 3ZOOA 1H9XA 1FI3A 1M70A 1S5LV 3WFEC 2GIWA 3TYIA 1CHIA 1LMSA 1CRCA 2DGEA 3MK7B 2JWAA 1IRVA 3CU4A 4FA1A 2B11B 3L72D 5CIHB 1I5TA 1KX7A 1CXAA 5DJQC 1IRWA 1CIGA 4WQ9A 2RMZA 1BE3D 2AIUA 3CYTI 3CXHD 1LS9A 2LIRA 3O0RC 4K3IA 4WQDA 2C1VA 1AOFA 1HRCA 3DMIA 5B6QA 5B66V 4N0KA 2N3BA 3L74D 451CA 4L1QA 1C6RA 3CXHW 3H1LD 4AAOA 3HQ8A 3RN0A 2N9IA 1GU2A 3SVWA 2PCCB 3TDKA 1SQPD 3SWSA 1CO6A 351CA 3A0BV 1DT1A 1H31A 4RSZA 4FB1A 4P4QB 3VMAA 1PPJD 4A7PA 1CRYA 3WUIA 4WQ7A 1C75A 1K3GA 3CP5A 3A9FA 5DF5A 1NMLA 1BGYD 1CC5A 1CYCA 2BPBB 2CE0A 1RZ6A 5CIFB 1RAQA 1CRGA 5CICB 1RZ5A 3O1YA 1A2SA 2N9YB 4AALA 1IO3A 1GDVA 2YCCA 1A56A 2CA4B 3FWLA 4AAMA 1EZVD 3BCCD 1KB0A 1QN2A 4U3FD 4WQBA 4WQAA 4AX3A 2XTSB 3ZBMA 2ORLA 1GIWA 1YEAA 2ZONG 2CA3B 4YE1A 1YIQA 1I55A 5IY51 1HROA 1YFCA 2YIUB 3ZOYA 2EXVA 1AKKA 2N3YA 2GB8B 2QG4A 4WQCA 3HQ7A 2YQBA 4XXLA 3ZOWA 1CYJA 2IBZD 1LC1A 1COTA 3L73D 1W2LA 1NTZD 4FAVA 1C2RA 4WQEA 4PWAA 5AURA 1U75B 5H2FV 4V2KA 2HV4A 1DIQC 3L75D 4Q5PA 2ZOOA 1FI7A 3CX5D 1NTMD 1HJ4A 2D0WA 1H32B 2MTAC 4O1WA 1OCDA 1CYIA 4J20A 3ITKA 1LC2A 3WFCC 1CSXA 2FWLA 2C9XB 2JQRA 1L0LD 1HZVA 2DVHA 1N15A 1M60A 1DVHA 1HJ3A 3M97X 3O20A 1I6DA 2V08A 1MG2D 1YTCA 1GJQA 3RN1A 4WQ8A 3ZCFA 4XYDB 1I54A 2PCBB 3C2CA 5GTHV 1SQBD 5KLIB 1H33B 4NFGB 2N18B 1CTYA 5KAFV 3KZIV 1ETPA 3RMZA 3CWBD 2BCNB 2C1DA 2FYUD 1CHJA 2KS1A 1DW1A 1QKSA 3GW6A 4GEDB 2C8SA 5C9MA 3PXTA 1AOQA 3HQ9A 1NTKD 1FCDC 2BGVX 2B10B 2N9JA 3ORVA 3WFBC 4UB6V 1K3HA 2N18C 4D6TD 2C1DB 1A8CA 4DY9A 1FOCA 1CORA 1EB7A 1KYOD 1GKSA 1L0ND 2QJPB 2ZZS1 3PXSA 2A06D 3NWVA 2VHDA 3L71D 2O3JA 2GC7D 2AI5A 1DW2A 3L4OA 3VRDA 1N9CA 2YK3A 1YCCA 4UB8V 4EICA 4EIDA 1LFMA 1AYGA 1FHBA 2B0ZB 2JTIB 3OCDB 3H1ID 4FANA 2FRCA 5B5EV 5EXQA 1SQXD 3WU2V 4LJIA 1DVVA 2AXTV 5CYTR 4FA4A 2B12B 2C1UA 3PHLA 5C0ZA 1JDLA 1HJ5A 5CIBB 2KNCB 2LITA 5CIDB 3HQ6A 1NU1D 3TF5A 2BLFB 1E29A 1I6EA 1IQCA 1U74B 2MHMA 4MU8A 2V07A 1BCCD 3JBTB 2PACA 1DW0A 2L4DA 3WFDC 1KV9A 1OAEA 3GG2A 1S6VB 1I8PA 1I8OA 1KIBA 1CIFA 1C2NA 1CRIA 5E79V 3A0HV 4L3HA 4FA5A 1E2RA 1CTZA 1CSUA 2Y0DA 4H0JA 4AANA 1YEBA 1MZ4A 3DR0A 2QJKB 4EIEA 2ZBOA 1H1OA 1YICA 1CSVA 3ZIYA 1FI9A 1QL3A 1H33A 1C6SA 5TISV 2BH5X 1H32A 1CRHA 1CCHA 1CXCA 2RN0A 1C6OA 1VYDA 1CNOA 1CRJA 2K9JB 2CXBA 2L91A 3L70D 2Y0EA 3PTZA 3KHUA 1GQ1A 3NBSA 1BL9A 3H1HD 4PJ0V 1F1CA 4RJTA 1L9BC 5KLVD 4FA9A 3SXTA 1CIHA 1B7VA 1CSWA 1CIEA 1SQVD 1QYZA 3PH2B 1J3SA 1N90A 3H1JD 3DP5A 2C2CA 4EDFA 3RLMA 155CA 1DIIC 3OA8B 4IL6V 3WC8A 1WEJF 3PLNA 4KMGA 2B4ZA 2Q3EA 3VYMA 3L4MA 1M6ZA 1YNRA 1L9JC 1WVEC 3PXWA 1KB9D 2D0SA 3SLEA 3PRJA 2Y0CA 5CIEB 3OCDA 2FYNB 1ZRTD 3X39A 2GC4D 3O5CA 1DW3A 5DFSA 1CTJA 5CIGB 1H31B 3H1KD 1NMIA 3OA8A 3VNWA 2BCCD 4L3GA 2BH4X 2ZXYA 1F1FA 1NNOA 1C52A 1P84D 5GTIV 1QL4A 4EIFA 3NBTA 1R0QA 2OZ1B 1FJ0A 4QAOA 3CX5W 1H9YA 1IZL0 3TGUD 5TJHA 4PW9B 1KYOW 1HZUA 5KAIV 2QJYB 4JCGA 1MG3D 2I8FA 1RAPA 1SQQD
chains in the Genus database with same CATH superfamily
3AE3C 1KV4A 1HCMA 3ZOXA 4Y5RA 2KNCA 1AA0A 1NIRA 3CCSP 1N50A 3CX5I 1HH7A 1QL2A 1KX2A 1C7MA 4H0KA 2OTLP 3H32B 1NYHA 5EFWB 3BRVB 2M5AA 1BCCG 3A0BE 1M70A 2GIWA 1AVYA 2D2CC 3TYIA 2J58A 2YKPA 1FC2C 3MK7B 2JWAA 3CU4A 4FA1A 3H1IJ 2OARA 4L75A 1M1JC 1K73Q 3H32A 2KLUA 1Q2NA 2P67A 4JQ0D 2AIUA 1LS9A 3QWOC 3A3YB 1Q81Q 4WQDA 2BASA 1HRCA 1RH5B 3DMIA 3CCLP 1EXIA 4PV1D 5AVWB 3ZDMA 4IL6X 1NTKE 2N3BA 3L74D 4M3LA 4L1QA 2N9BA 2HYNA 1C6RA 3H1LD 2Q3IA 2O01J 3HQ8A 1U7MA 4GOEA 1FE6A 1G1IA 3L72G 2PCCB 1ZR2A 3M0AA 1MFTA 3SWKA 1KILB 4C46A 2JEEA 2HG5D 4A7PA 3AEEC 1K3GA 1PGPA 3CMEP 4R4MA 2MKVA 3H1JE 2WTYA 3L4FA 1RZ6A 1RAQA 1NWQA 1CRGA 3L73E 5CICB 3O1YA 2H8PD 1A2SA 3TK1A 3CCJP 1IO3A 1GDVA 4Y28J 4WWIA 1A56A 1SFCC 3H1HE 4AAMA 3BCCD 1KB0A 1CI6B 2ZVOB 2R44A 4WQAA 4AX3A 1FBMA 2WSFJ 1AV1A 1GIWA 1SQBG 2E43A 3CC4P 5AW4B 2N3YA 1J1EB 1FAVA 3HD7D 3S1KA 1NTZK 5CCGC 1CSBA 1R5LA 5KLIC 4PJ0H 2OYHB 3NMDA 4XXLA 2IZ0A 1CYJA 1PFIA 1LC1A 1IZNB 1JY3P 3L73D 4WY4B 1NTZD 3V2RA 1HJBA 1C2RA 1SQBK 2KSJA 1U75B 4JYBA 4JF7A 2HV4A 2GUVA 1DIQC 3L75D 1JY3O 3P32A 1ZV8A 1FI7A 3D70A 2OYIC 1RE3C 3LW5J 4GODA 1H32B 3HE4B 2MTAC 3NXSA 2FYNC 4J20A 4OGQB 1BE3J 1VQ4P 2Z5IA 1LC2A 1M1JB 4D6TE 5AVUB 3HE4A 1CSXA 2FWLA 1DX7A 2C9XB 1PZQA 2JQRA 1SS1A 1HZVA 1M1JA 1N15A 1M60A 1DVHA 1GL2A 5AVTB 1VF5D 2V08A 5GTHH 4L74A 3AE6C 1I54A 1YI2P 1SQPE 2Q5UA 2PCBB 1S4XA 3H25A 1GZLA 5KLVE 5KLIB 1L4AC 2N18B 5CJ4A 3L36A 5E79E 1AJYA 3CWBD 1M8OB 2FFDA 2KS1A 4XE5B 1FDOA 4HKZH 2C8SA 3M91A 5C9MA 4OGQD 3JCUH 1PGJA 2Q1KA 1NTKD 1FCDC 2BGVX 2QE7H 2N9JA 3WFBC 4XFJA 2C1DB 1FOCA 4EYYQ 2E5YA 2IBZI 3AEDC 2ZZS1 3PXSA 1GW4A 1VQ5P 2E75C 3AEAC 3MHVA 4JYCA 1JMMA 1KILA 2YK3A 1VQOP 1EC5A 2Q7CA 4EICA 1AYGA 2GUSA 2K9YA 4XA4A 3H1ID 3VTPC 2LR2A 2GM4A 1D7MA 2P7JA 2Y9ZA 1LT9C 4H13B 5B5EV 1SQXD 3GHGA 1T8ZA 2WSEJ 1LTSC 1NKNA 2AXTV 2H89C 3CLQA 3A2AA 1HJ5A 5CIDB 2KB7P 3UIAA 4ZMDA 1I6EA 5AVQB 3L75E 4GDOA 1IQCA 3G3ZA 1PGQA 4QMAA 3JBTB 1X79B 4PD4I 2L4DA 2B88A 3WFDC 2LXCB 2W6BA 1I8OA 1DIPA 1KIBA 1C2NA 3RK2C 1LT9A 1CTZA 2M5AB 1KYOE 3K5BA 3VMZA 2WPQA 1KC8Q 3WU2E 1UIIA 4WY4A 3WUVA 5B5EE 3AE2C 1L0NK 3A7OA 1R8EA 3M06A 1C6SA 2A45G 5TISV 1H32A 1PP9G 1CCHA 3KXDA 1VYDA 1QGKB 1BSHA 2PP6A 2L91A 3KPEA 2Y0EA 1Q86Q 4PV1B 4TLFA 3M9QA 1BL9A 4PJ0V 1T3JA 2R3SA 1W2EA 1L4AA 3M9HA 4NPFX 1J3SA 2C2CA 3CXHE 2ITAA 4DOJA 2KLVA 4IL6V 3Q1MA 4KJMA 2AXTH 1USDA 2B4ZA 2KUBA 2P10A 2B89A 1ZN5A 1OMIA 5KTBA 1SQVE 1VQ6P 1J1EC 2B87B 2XZRA 4JBZA 1WVEC 3A0HH 1KB9D 1FZGA 3SLEA 3PRJA 3BASA 1T2KC 2Y0CA 5CIEB 1YTZT 2FYNB 3U1CA 2GC4D 3QH9A 2ZXEB 3H1JG 1KQLA 4ASWA 3TNUB 1GL2D 1CTJA 1SFCB 2OQQA 2QIWA 3VNWA 1BCCJ 2BCCD 2BH4X 1LTAC 4KHXA 1NNOA 1ZMEC 1IK9A 1JUNA 1IJDB 1QX8A 2N1TB 1OVVA 4QAOA 4IFMA 2H7HA 1S72P 3H1JJ 1VQ9P 1W2BO 1PP9D 1ZZHA 2O01H 1EZVG 3H1HJ 3VN0A 2FYUJ 4YTPC 5CCGA 2C9LY 2CE1A 2FFDC 1R5SA 3C1LA 1X22A 2NRGA 1LJ2A 1M57D 1VDFA 1CZQA 2QA4P 5DJQB 2W83C 1N7SD 1AQ5A 1CEDA 1FDIA 1FI3A 1GK4A 1LNQA 3TGUE 1LGHB 1CHIA 1N73A 3CD6P 1L0NE 2POHA 5CIHB 1I5TA 3GMAA 2XDJA 1IRWA 2E76C 2WQYC 2E75B 2RMZA 1KILC 2A06E 1BE3D 3CYTI 2N1TD 3CXHD 1QL1A 2LIRA 3O0RC 4B86A 3NTNA 4K3IA 2WSEH 1AOFA 5AVXB 5B66V 5AVZB 4GOFA 5KJ7A 451CA 3FWNA 4L73A 5KKZC 5BU8B 2XNDH 1SP4A 3RN0A 4I1LA 2ZYGA 3S9OA 1GU2A 2M8RA 1NTZJ 1FOSE 3KZIH 4DZOA 3TDKA 4DT0A 1CO6A 1CW5A 1OZHA 3H1IG 1GU4A 4MN4C 1H31A 4RSZA 3VMAA 1PPJD 1KFNA 1FOSF 2BEQD 1CRYA 3WUIA 1Z56A 3CP5A 2FKWB 1NMLA 3CC2P 1CC5A 1OIPA 2V7QJ 2BPBB 1YJ9P 1NKZB 1S5LH 1TU3F 2XU6A 1IFNA 2FXMA 4WVZA 1PV3A 3B8EB 2Q6QA 2CA4B 1AQTA 3BCCJ 2KSEA 3FWLA 4IOIH 4RESB 1EZVD 3CC7P 4HJGH 1QN2A 2WPRA 2I1JA 2WT7B 1YEAA 3A5TA 5IY51 1RE3A 1OWAA 2YIUB 2EXVA 2W90A 2GB8B 5CHXA 1NU1K 2QG4A 4DCKA 3L71G 2YQBA 1NH4A 2IBZD 1LWUC 1LP1A 3RBZA 3LIDA 1VQPP 3BVHA 1W2LA 4D6TG 4WQEA 4W80A 5AW0B 2P1JA 5APYA 2ZYDA 5AVRB 3MZWB 2W6AA 3T97B 4Q5PA 2ZOOA 2NPSC 3VMYA 3L71E 1EXJA 1NTMD 2K1AA 4O1WA 1CYIA 3ITKA 1USEA 5TISE 3H1LE 2W6JH 1L0LD 1QLED 3IAOA 1M1KQ 3I55P 2JR8A 4ZKPA 3A0HE 1I6DA 1JO5A 1MG2D 1S2EA 3L74J 2XKMA 2NPSD 3F5HA 3C2CA 5APWA 1SQBD 3TYYA 1WMKA 5AVVB 1MUUA 4NFGB 1SQQD 4UB8E 3WU2H 2GA1A 1OVRA 3CCMP 1ETPA 3FXDA 2BCNB 2C1DA 2FYUD 1QKSA 3GW6A 1RE4A 1RHZB 3PXTA 3HQ9A 3GF3A 4W7ZA 3OW2O 1KILD 3BCCG 2B10B 1SFCD 1L4AB 4DY9A 2FYUK 1CORA 1S5LE 1EB7A 2H88C 2QRXA 3IN6A 1GL2B 2A06D 1IK7A 5KLVG 2O3JA 2WSSH 3HUSA 1PL5A 2M0BA 1KZUB 2O1KA 3L70G 2K88A 3NFQA 1BGYG 4EIDA 1VQMP 2D2CB 1NTZG 4UB8H 5APUA 3FXEA 2QJPC 1VQNP 3BATA 2WSCJ 1J1DC 4ZNCA 2IYPA 2B12B 2C1UA 1N7SB 4JPZB 2KNCB 2M3EA 2LITA 4BRYB 3HTKA 2BLFB 2RH0A 2QJYC 1U74B 1L2PA 4UB6H 4MU8A 1RQUA 2PACA 3M9BA 4U3FE 1KV9A 1S6VB 2VRSA 1ZP0C 1JY2N 1BSNA 2YO2A 4HB1A 3W67A 3GHGC 3V2QA 1VQKP 2Y0DA 3AE8C 3VP8A 4H0JA 4AANA 1M56D 2W8ZA 1GMJA 3CI9A 1PGOA 2Z5HA 2FY8A 2E5TA 4EIEA 2AEJA 1GDTA 1FI9A 2HPCB 1QL3A 1H33A 1E5WA 2J59M 4K3AA 1CXCA 1NO4A 1CRJA 4AYCA 4YXDC 3AE5C 3KHUA 2ZT9D 1GQ1A 4H0LC 3H1HD 1F1CA 2A06G 4FA9A 1CIEA 1SQVD 2CPSA 1RF1C 3BRTB 1QYZA 3LIEA 3RBXA 3DP5A 1OW6A 3RL0B 1KILE 3VOPA 3USSA 1DIIC 1KQFB 1PPJE 3WC8A 5KAIH 1DH3A 3PH0A 2AXCA 3II6A 3L72E 3VYMA 1H88A 2B9BA 3HRNA 4I7ZC 1L9JC 1HF9A 2D0SA 1SQXG 1NGMB 1ZRTD 2NPSA 3X39A 1H0TA 3SFEC 3PP5A 2NPSB 3E7KA 3L73G 1URQD 2NZ2A 3KZIE 5CIGB 3H1KD 3OA8A 4L3GA 1F1FA 5APSA 1URQB 4EIFA 1R0QA 3AEGC 1NU1J 3M0DC 2WSFH 3L74G 3GHGB 1H89A 3CX5W 1L0NJ 1NTMG 1OW7A 5TJHA 3TGUD 4PD4H 4PW9B 1MFZA 3SFDC 1HZUA 5KAIV 4C7RA 2LXBA 3CXHI 1HBWA 4O9BA 1SQVJ 3E1IA 2FBWC 1E8EA 1YBKA 1CHHA 2JP3A 5KKZB 2WWWA 3SJLA 3H1KE 1X8YA 5E79H 3CCQP 4U7JA 1YJNP 3GF7A 2OZ1A 4N6JA 3RGUA 1BDDA 3MTUE 4PD4D 5AW7B 1W5CT 1L0LG 3HD7A 3HUSC 3MK7C 3RK3B 3ZOOA 3O6QB 1S5LV 3OJAB 1SVFA 3CWBG 1CRCA 1NU1G 1K9MQ 2P58A 5KAFH 1IRVA 1GTWA 1ZLLA 3L72D 2KXPB 1CXAA 2OYIA 2QM7A 4WQ9A 1VL2A 3N4XA 3EWKA 3T97A 2BCCG 3V2PA 1IFIA 2B87A 1IO4A 2C1VA 5B6QA 4I6MC 3HD7B 2A45H 4N0KA 4TT3H 2FFDB 1KORA 3HTKB 5TISH 1NAFA 2IDBA 2JO1A 3SVWA 1SQPD 3SWSA 1NTKK 351CA 3A0BV 5AW2B 1DT1A 3U1AA 2I8DA 1PIXA 4IFFA 5CCHA 1SQBE 1URQC 4IFDK 4WQ7A 3A9FA 5DF5A 5AVSB 1G2CB 1BGYD 1K04A 4PJ0E 3U59A 2Z4EA 4BXLA 3AEFC 1P84H 1KMIZ 1LTBC 3TGUG 1RZ5A 4AALA 2V7QH 3N7NA 5DJUB 2IBZG 4RKUJ 3P7KA 1H0TB 2OYOA 2HPCA 1YIJP 4U3FD 4IL6E 3C8VA 1L0LJ 1JY2P 3ZBMA 2PFXA 2ZJSE 3EFGA 2QM8A 5APTA 1FS0E 3WUTA 2IYOA 2CA3B 3MIWA 4N78D 1RY3A 3CWBJ 3JC22 5APQA 1NTZE 1AKKA 1W5CE 3FX0A 2IBZE 2JKVA 3HQ7A 1EDKA 1RF1A 3ZOWA 1JMBA 1Y47A 1SQQK 1COTA 2N1TC 5GTHE 4AUWA 4FAVA 3H1LJ 1LTJB 3V6IA 5H2FV 2OTKE 4WY4D 2QVAA 1BE3G 1N7SC 3MGNA 2C0WA 2FYUG 1LTTC 2D0WA 1OCDA 3B5NA 1NTMJ 2I1KA 3IF4A 3H1HG 3WFCC 1VF5B 3OA7A 2C9NY 2DVHA 4U3FJ 4C7NA 4Z1MH 4LLHA 2FYUE 3M97X 3O20A 2Y9YA 4WY4C 1YTCA 1IFDA 3RN1A 4WQ8A 4I2LC 3ZCFA 1KB9I 4H0LD 3WMM0 5GTHV 3RK2B 4DJGA 1H33B 1KB9E 2PRRA 2YMYA 1CTYA 1NOHA 5KAFV 3CPWO 1JTHB 3KZIV 3RMZA 3L75G 1CHJA 4N3YB 4GEDB 1Y8AA 3E1RA 1SLQA 1BGYE 4UB6V 1K3HA 4D6TD 1MKMA 1A8CA 2JJLA 2PGDA 1S9KD 1SQPG 1UIXA 2YNYA 3NWVA 1VQLP 3L71D 2QJKC 2GC7D 2H43A 2E76B 2UWJE 1DW2A 3HE5B 1BDCA 3VRDA 1N9CA 3H1LG 2AEMA 4UB8V 3TSIA 1QVGO 1EDJA 1LP1B 2WPSA 2OYHA 3L72J 2FRCA 1L0LK 2WITA 2R32A 3GLMA 2ZVNB 3TNUA 3Q5SA 1VPCA 5KJ7C 4LJIA 1DVVA 5CYTR 3PHLA 5C0ZA 1JDLA 5CIBB 2E75D 3IR9A 1LTIC 1E29A 4N78E 1N8RQ 1PP9E 1YYCA 4H13C 1SQQG 4Y99B 3BCCE 1LTGC 1JB0J 4HH2A 3RK3D 2K37A 2WZ7A 1CRIA 5E79V 1RF0C 1E79H 3B5ND 1E2RA 2E74D 3Q2YA 3AE9C 1YEBA 2XNXA 3L37A 1N73B 3DR0A 2E76D 2FXOA 2ZYAA 1JNMA 2QJKB 2ZBOA 1AVOA 2SPZA 1YHQP 3L70J 1SQQE 2A45I 1ZR4A 1LTJA 4H13D 2BH5X 1CRHA 2LKMA 3JCUE 1C6OA 3D0WA 1CNOA 2K9JB 2CXBA 3L70D 1ZW0A 2KYVA 3PTZA 3AE1C 3H1KJ 5K5GB 1GK6A 2R5DA 1JY2O 2KP8A 3SSUA 5KLVD 2D2CD 2C0XA 2YO3A 1CSWA 2IZ1A 2ZFCA 4H44D 1GW3A 3M0DA 1FJKA 3PH2B 4EIJA 3H1JD 1HTLC 1HWTC 4IL6H 4EDFA 5B5EH 3EFFK 3RLMA 155CA 4U3FG 5BU5A 1WEJF 1IFJA 1X9VA 3HE5A 2BCCJ 2AEFA 1M6ZA 1YNRA 3KQGA 1T6AA 1OFCX 2KZJA 2HR3A 3L74E 1KQSO 4H44C 1G1JA 1HGVA 1N7SA 3O5CA 3CXHH 1DW3A 5DFSA 2WT7A 5GTIE 4GKGA 3JSVC 3F89A 3RK2D 1JCCA 3A0BH 5CBOA 4I7ZB 5CJ0A 3V2NA 1C52A 1P84D 1N73C 4ZKUA 5B66E 4C7NB 3W68A 1QL4A 3CCEP 1FJ0A 4GT1A 5BVZA 1VQ8P 2Q9IA 3RL0C 1FJPA 1WRGA 1H9YA 3CL3D 5C39A 1HH0A 4D6TJ 3MUDA 1RF1B 2HFED 1MG3D 2YXQB 1RF0A 2I8FA 3G9RA 4O1QA 2WPVB 3VP9A 1CI6A 2E74B 1FZBA 1IFMA 1U57A 3WUUA 1PPJG 2RKLA 4K35A 1NU1E 4AQRD 4CPGA 1G2CA 1P84I 1CCRA 3AE4C 2G3AA 3P8CD 1N86A 4GYDA 1SQXE 1NTMK 3O8ZA 3KYQA 2IX7C 4W7YA 1H9XA 1IC2A 3B71A 3WFEC 3LW5H 1LMSA 5DJTB 1FZCA 1FU1A 2DGEA 1KQGB 1XTCC 2B11B 1RQVA 1DD4A 1KX7A 3O6QA 3Q3DA 1JY3N 5DJQC 1FZFA 1CIGA 1Q82Q 3KDPB 3AE7C 1LT1A 1YQ3C 3RK3C 3D6ZA 3H1KG 4H44B 1N2DC 1NJIQ 1SQBJ 1FZAA 2R3CA 2ZT9B 4GIFA 3CXHW 4AAOA 2L5GB 3MD0A 5AW1B 1T2KD 2N9IA 3CWBE 4OWFA 3P8MC 1NAYA 1EZVI 5AVYB 1LWUB 4FB1A 4P4QB 2YXRB 2W27A 1FZEA 1C75A 2ZXXA 1NTKG 3CCVP 1L0LE 5CBNA 3C9IA 1CYCA 1RE4C 1VF5C 2CE0A 5CIFB 1JTHA 3V4WA 2N1TA 2N9YB 1LWUA 2DW3A 2YCCA 3AEBC 1YITP 3RK3E 1KB9H 4NPDA 3R2PA 4KT0J 4WQBA 2YKQA 2M3BA 1KYOI 2XTSB 1NTKJ 2ORLA 1QVFO 3G71P 1LTJC 2OYIB 2ZONG 1URQA 1JM0A 4YE1A 1YIQA 1I55A 1JCDA 1HROA 1DD3A 1YFCA 3ZOYA 2V4HA 3MP7B 2O1JA 2QSIA 1OVUA 1M7LA 4PD4E 1EZVE 1YJWP 1MV8A 4WQCA 2OYHC 3CCRP 1JOCA 5CCHC 1WT6A 1SQPJ 3H1IE 1J2JB 3I5CA 2WVRA 3L73J 2CK3H 4PV1C 2P2UA 1T3UA 1FZCC 4PWAA 5AURA 3B5NB 1SQPK 3CMAP 4V2KA 1YQ4C 3R4YA 1YTZI 1DEEG 3CX5D 1HJ4A 1BGYJ 1L4AD 2YMKA 3ABVC 1HJ0A 4WB4A 3L75J 2KZIA 4UB6E 3L35A 3SWYA 1HJ3A 4HYTB 2HLOA 1GJQA 4Y99C 3I56P 1OX3A 4OH8B 1S3JA 1SQVK 1BE3E 4XYDB 2KIKA 5KAFE 1ZRTE 1IFPA 1GU5A 5H2FE 3EQ2A 2XV5A 2CPBA 5H2FH 3G6EP 3L70E 1HGZA 2YIUC 1FDMA 1SQXK 1DW1A 3D71A 2OGUA 1VQ7P 5AW3B 1X0TA 1H8AA 1AOQA 3V4QA 1LT9B 2IFNA 3V5BA 2MJZA 5M1BA 3HD7C 3ORVA 1M90Q 2N18C 3VYIA 1KYOD 1S5LX 1GKSA 1L0ND 2QJPB 1NHLA 1OXZA 2VHDA 2AI5A 4LC1A 3L4OA 1QEXA 1SFCA 1YCCA 5AW6B 3HUSB 2O01N 2HODA 2R5BA 5B66H 1LFMA 1FHBA 4R4LA 2B0ZB 2JTIB 1KD1Q 1A02F 3P8CE 3OCDB 4FANA 4ASVA 1PP9J 5EXQA 3FGAD 3WU2V 1KYOH 1JEKA 1AFOA 4NPEA 4FA4A 5L8RJ 3TGUJ 1XTGB 4YXWH 2ZT9C 1NTME 3HQ6A 2OTJP 1NU1D 3TF5A 2E42A 1Q7YQ 2AXTE 1Y9BA 3Q5PA 1J1DB 4WBAA 2MHMA 1EDLA 2V07A 1BCCD 1DW0A 2G8YA 1OAEA 1A02J 3GG2A 2KS1B 1I8PA 1CIFA 3A0HV 4L3HA 4FA5A 2IPPA 1CSUA 1DEBA 5KLVJ 5AW8B 1S9KE 1MZ4A 1K8AQ 5KAIE 2WMMA 5AW5B 4BRYA 1H1OA 3IFMA 4OGQC 1GL2C 1YICA 1CSVA 3ZIYA 1HVVA 2IFMA 3H6PA 1ZOYC 2KI7B 2RN0A 2KOGA 3NBSA 2K3RA 5CMZA 3CX5H 2E74C 5AW9B 4RJTA 1P84E 1L9BC 2YKOA 3SXTA 1CIHA 1B7VA 1EDIA 1SQQJ 2BCCE 1FZCB 5KJ7D 3S4RA 1U7JA 3B4SA 4EOTA 1N90A 3SWFA 3RL0g 3OA8B 3PLNA 4KMGA 1RAPA 1KFMA 1S1CX 4H0LB 4LGDE 2Q3EA 2JDIH 4BWNA 3VMXA 3L4MA 2FYZA 3PXWA 3RL0D 3AECC 4L76A 3PJSK 5GTIH 1NVOA 2K9JA 4OVNF 1Q90D 3OCDA 3MUDC 3CCUP 2ZAEB 2J5UA 1N7LA 1ZXGA 2WSCH 1EQ7A 5CCHD 3OAKA 1H31B 5APVA 1MZ9A 2PAJA 1NMIA 1KN7A 1KTMA 1SQVG 3B5NC 1L0NG 3Q5RA 4RO0A 2ZXYA 5CCGD 5GTIV 2JWDA 1GD2E 3NBTA 2HODB 2OZ1B 3L71J 2BEZF 1K05A 5APXA 2QEXP 1IZL0 3CX5E 3G4SP 2KK7A 1KYOW 4YPCA 2QJYB 1OW8A 4JCGA 5KLVK 1SQXJ 1HUCA 3D6YA 1BCCE 2FXPA 4EI2A
chains in the Genus database with same CATH topology
1PP9D 1ZZHA 4O1QA 1E8EA 1HCMA 3ZOXA 4Y5RA 1CHHA 1NIRA 1N50A 5KKZB 2CE1A 3SJLA 1CCRA 1HH7A 1KX2A 1C7MA 2OZ1A 4H0KA 5DJQB 4GYDA 4PD4D 1W5CT 3MK7C 1CEDA 3ZOOA 1H9XA 1FI3A 1M70A 1S5LV 3WFEC 2GIWA 3TYIA 1CHIA 1LMSA 1CRCA 2DGEA 3MK7B 2JWAA 1IRVA 3CU4A 4FA1A 2B11B 3L72D 5CIHB 1I5TA 1KX7A 1CXAA 5DJQC 1IRWA 1CIGA 4WQ9A 2RMZA 1BE3D 2AIUA 3CYTI 3CXHD 1LS9A 2LIRA 3O0RC 4K3IA 4WQDA 2C1VA 1AOFA 1HRCA 3DMIA 5B6QA 5B66V 4N0KA 2N3BA 3L74D 451CA 4L1QA 1C6RA 3CXHW 3H1LD 4AAOA 3HQ8A 3RN0A 2N9IA 1GU2A 3SVWA 2PCCB 3TDKA 1SQPD 3SWSA 1CO6A 351CA 3A0BV 1DT1A 1H31A 4RSZA 4FB1A 4P4QB 3VMAA 1PPJD 4A7PA 1CRYA 3WUIA 4WQ7A 1C75A 1K3GA 3CP5A 3A9FA 5DF5A 1NMLA 1BGYD 1CC5A 1CYCA 2BPBB 2CE0A 1RZ6A 5CIFB 1RAQA 1CRGA 5CICB 1RZ5A 3O1YA 1A2SA 2N9YB 4AALA 1IO3A 1GDVA 2YCCA 1A56A 2CA4B 3FWLA 4AAMA 1EZVD 3BCCD 1KB0A 1QN2A 4U3FD 4WQBA 4WQAA 4AX3A 2XTSB 3ZBMA 2ORLA 1GIWA 1YEAA 2ZONG 2CA3B 4YE1A 1YIQA 1I55A 5IY51 1HROA 1YFCA 2YIUB 3ZOYA 2EXVA 1AKKA 2N3YA 2GB8B 2QG4A 4WQCA 3HQ7A 2YQBA 4XXLA 3ZOWA 1CYJA 2IBZD 1LC1A 1COTA 3L73D 1W2LA 1NTZD 4FAVA 1C2RA 4WQEA 4PWAA 5AURA 1U75B 5H2FV 4V2KA 2HV4A 1DIQC 3L75D 4Q5PA 2ZOOA 1FI7A 3CX5D 1NTMD 1HJ4A 2D0WA 1H32B 2MTAC 4O1WA 1OCDA 1CYIA 4J20A 3ITKA 1LC2A 3WFCC 1CSXA 2FWLA 2C9XB 2JQRA 1L0LD 1HZVA 2DVHA 1N15A 1M60A 1DVHA 1HJ3A 3M97X 3O20A 1I6DA 2V08A 1MG2D 1YTCA 1GJQA 3RN1A 4WQ8A 3ZCFA 4XYDB 1I54A 2PCBB 3C2CA 5GTHV 1SQBD 5KLIB 1H33B 4NFGB 2N18B 1CTYA 5KAFV 3KZIV 1ETPA 3RMZA 3CWBD 2BCNB 2C1DA 2FYUD 1CHJA 2KS1A 1DW1A 1QKSA 3GW6A 4GEDB 2C8SA 5C9MA 3PXTA 1AOQA 3HQ9A 1NTKD 1FCDC 2BGVX 2B10B 2N9JA 3ORVA 3WFBC 4UB6V 1K3HA 2N18C 4D6TD 2C1DB 1A8CA 4DY9A 1FOCA 1CORA 1EB7A 1KYOD 1GKSA 1L0ND 2QJPB 2ZZS1 3PXSA 2A06D 3NWVA 2VHDA 3L71D 2O3JA 2GC7D 2AI5A 1DW2A 3L4OA 3VRDA 1N9CA 2YK3A 1YCCA 4UB8V 4EICA 4EIDA 1LFMA 1AYGA 1FHBA 2B0ZB 2JTIB 3OCDB 3H1ID 4FANA 2FRCA 5B5EV 5EXQA 1SQXD 3WU2V 4LJIA 1DVVA 2AXTV 5CYTR 4FA4A 2B12B 2C1UA 3PHLA 5C0ZA 1JDLA 1HJ5A 5CIBB 2KNCB 2LITA 5CIDB 3HQ6A 1NU1D 3TF5A 2BLFB 1E29A 1I6EA 1IQCA 1U74B 2MHMA 4MU8A 2V07A 1BCCD 3JBTB 2PACA 1DW0A 2L4DA 3WFDC 1KV9A 1OAEA 3GG2A 1S6VB 1I8PA 1I8OA 1KIBA 1CIFA 1C2NA 1CRIA 5E79V 3A0HV 4L3HA 4FA5A 1E2RA 1CTZA 1CSUA 2Y0DA 4H0JA 4AANA 1YEBA 1MZ4A 3DR0A 2QJKB 4EIEA 2ZBOA 1H1OA 1YICA 1CSVA 3ZIYA 1FI9A 1QL3A 1H33A 1C6SA 5TISV 2BH5X 1H32A 1CRHA 1CCHA 1CXCA 2RN0A 1C6OA 1VYDA 1CNOA 1CRJA 2K9JB 2CXBA 2L91A 3L70D 2Y0EA 3PTZA 3KHUA 1GQ1A 3NBSA 1BL9A 3H1HD 4PJ0V 1F1CA 4RJTA 1L9BC 5KLVD 4FA9A 3SXTA 1CIHA 1B7VA 1CSWA 1CIEA 1SQVD 1QYZA 3PH2B 1J3SA 1N90A 3H1JD 3DP5A 2C2CA 4EDFA 3RLMA 155CA 1DIIC 3OA8B 4IL6V 3WC8A 1WEJF 3PLNA 4KMGA 2B4ZA 2Q3EA 3VYMA 3L4MA 1M6ZA 1YNRA 1L9JC 1WVEC 3PXWA 1KB9D 2D0SA 3SLEA 3PRJA 2Y0CA 5CIEB 3OCDA 2FYNB 1ZRTD 3X39A 2GC4D 3O5CA 1DW3A 5DFSA 1CTJA 5CIGB 1H31B 3H1KD 1NMIA 3OA8A 3VNWA 2BCCD 4L3GA 2BH4X 2ZXYA 1F1FA 1NNOA 1C52A 1P84D 5GTIV 1QL4A 4EIFA 3NBTA 1R0QA 2OZ1B 1FJ0A 4QAOA 3CX5W 1H9YA 1IZL0 3TGUD 5TJHA 4PW9B 1KYOW 1HZUA 5KAIV 2QJYB 4JCGA 1MG3D 2I8FA 1RAPA 1SQQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PP9 D;  1ZZH A;  4O1Q A;  1E8E A;  1HCM A;  3ZOX A;  4Y5R A;  1CHH A;  1NIR A;  1N50 A;  5KKZ B;  2CE1 A;  3SJL A;  1CCR A;  1HH7 A;  1KX2 A;  1C7M A;  2OZ1 A;  4H0K A;  5DJQ B;  4GYD A;  4PD4 D;  1W5C T;  3MK7 C;  1CED A;  3ZOO A;  1H9X A;  1FI3 A;  1M70 A;  1S5L V;  3WFE C;  2GIW A;  3TYI A;  1CHI A;  1LMS A;  1CRC A;  2DGE A;  3MK7 B;  2JWA A;  1IRV A;  3CU4 A;  4FA1 A;  2B11 B;  3L72 D;  5CIH B;  1I5T A;  1KX7 A;  1CXA A;  5DJQ C;  1IRW A;  1CIG A;  4WQ9 A;  2RMZ A;  1BE3 D;  2AIU A;  3CYT I;  3CXH D;  1LS9 A;  2LIR A;  3O0R C;  4K3I A;  4WQD A;  2C1V A;  1AOF A;  1HRC A;  3DMI A;  5B6Q A;  5B66 V;  4N0K A;  2N3B A;  3L74 D;  451C A;  4L1Q A;  1C6R A;  3CXH W;  3H1L D;  4AAO A;  3HQ8 A;  3RN0 A;  2N9I A;  1GU2 A;  3SVW A;  2PCC B;  3TDK A;  1SQP D;  3SWS A;  1CO6 A;  351C A;  3A0B V;  1DT1 A;  1H31 A;  4RSZ A;  4FB1 A;  4P4Q B;  3VMA A;  1PPJ D;  4A7P A;  1CRY A;  3WUI A;  4WQ7 A;  1C75 A;  1K3G A;  3CP5 A;  3A9F A;  5DF5 A;  1NML A;  1BGY D;  1CC5 A;  1CYC A;  2BPB B;  2CE0 A;  1RZ6 A;  5CIF B;  1RAQ A;  1CRG A;  5CIC B;  1RZ5 A;  3O1Y A;  1A2S A;  2N9Y B;  4AAL A;  1IO3 A;  1GDV A;  2YCC A;  1A56 A;  2CA4 B;  3FWL A;  4AAM A;  1EZV D;  3BCC D;  1KB0 A;  1QN2 A;  4U3F D;  4WQB A;  4WQA A;  4AX3 A;  2XTS B;  3ZBM A;  2ORL A;  1GIW A;  1YEA A;  2ZON G;  2CA3 B;  4YE1 A;  1YIQ A;  1I55 A;  5IY5 1;  1HRO A;  1YFC A;  2YIU B;  3ZOY A;  2EXV A;  1AKK A;  2N3Y A;  2GB8 B;  2QG4 A;  4WQC A;  3HQ7 A;  2YQB A;  4XXL A;  3ZOW A;  1CYJ A;  2IBZ D;  1LC1 A;  1COT A;  3L73 D;  1W2L A;  1NTZ D;  4FAV A;  1C2R A;  4WQE A;  4PWA A;  5AUR A;  1U75 B;  5H2F V;  4V2K A;  2HV4 A;  1DIQ C;  3L75 D;  4Q5P A;  2ZOO A;  1FI7 A;  3CX5 D;  1NTM D;  1HJ4 A;  2D0W A;  1H32 B;  2MTA C;  4O1W A;  1OCD A;  1CYI A;  4J20 A;  3ITK A;  1LC2 A;  3WFC C;  1CSX A;  2FWL A;  2C9X B;  2JQR A;  1L0L D;  1HZV A;  2DVH A;  1N15 A;  1M60 A;  1DVH A;  1HJ3 A;  3M97 X;  3O20 A;  1I6D A;  2V08 A;  1MG2 D;  1YTC A;  1GJQ A;  3RN1 A;  4WQ8 A;  3ZCF A;  4XYD B;  1I54 A;  2PCB B;  3C2C A;  5GTH V;  1SQB D;  5KLI B;  1H33 B;  4NFG B;  2N18 B;  1CTY A;  5KAF V;  3KZI V;  1ETP A;  3RMZ A;  3CWB D;  2BCN B;  2C1D A;  2FYU D;  1CHJ A;  2KS1 A;  1DW1 A;  1QKS A;  3GW6 A;  4GED B;  2C8S A;  5C9M A;  3PXT A;  1AOQ A;  3HQ9 A;  1NTK D;  1FCD C;  2BGV X;  2B10 B;  2N9J A;  3ORV A;  3WFB C;  4UB6 V;  1K3H A;  2N18 C;  4D6T D;  2C1D B;  1A8C A;  4DY9 A;  1FOC A;  1COR A;  1EB7 A;  1KYO D;  1GKS A;  1L0N D;  2QJP B;  2ZZS 1;  3PXS A;  2A06 D;  3NWV A;  2VHD A;  3L71 D;  2O3J A;  2GC7 D;  2AI5 A;  1DW2 A;  3L4O A;  3VRD A;  1N9C A;  2YK3 A;  1YCC A;  4UB8 V;  4EIC A;  4EID A;  1LFM A;  1AYG A;  1FHB A;  2B0Z B;  2JTI B;  3OCD B;  3H1I D;  4FAN A;  2FRC A;  5B5E V;  5EXQ A;  1SQX D;  3WU2 V;  4LJI A;  1DVV A;  2AXT V;  5CYT R;  4FA4 A;  2B12 B;  2C1U A;  3PHL A;  5C0Z A;  1JDL A;  1HJ5 A;  5CIB B;  2KNC B;  2LIT A;  5CID B;  3HQ6 A;  1NU1 D;  3TF5 A;  2BLF B;  1E29 A;  1I6E A;  1IQC A;  1U74 B;  2MHM A;  4MU8 A;  2V07 A;  1BCC D;  3JBT B;  2PAC A;  1DW0 A;  2L4D A;  3WFD C;  1KV9 A;  1OAE A;  3GG2 A;  1S6V B;  1I8P A;  1I8O A;  1KIB A;  1CIF A;  1C2N A;  1CRI A;  5E79 V;  3A0H V;  4L3H A;  4FA5 A;  1E2R A;  1CTZ A;  1CSU A;  2Y0D A;  4H0J A;  4AAN A;  1YEB A;  1MZ4 A;  3DR0 A;  2QJK B;  4EIE A;  2ZBO A;  1H1O A;  1YIC A;  1CSV A;  3ZIY A;  1FI9 A;  1QL3 A;  1H33 A;  1C6S A;  5TIS V;  2BH5 X;  1H32 A;  1CRH A;  1CCH A;  1CXC A;  2RN0 A;  1C6O A;  1VYD A;  1CNO A;  1CRJ A;  2K9J B;  2CXB A;  2L91 A;  3L70 D;  2Y0E A;  3PTZ A;  3KHU A;  1GQ1 A;  3NBS A;  1BL9 A;  3H1H D;  4PJ0 V;  1F1C A;  4RJT A;  1L9B C;  5KLV D;  4FA9 A;  3SXT A;  1CIH A;  1B7V A;  1CSW A;  1CIE A;  1SQV D;  1QYZ A;  3PH2 B;  1J3S A;  1N90 A;  3H1J D;  3DP5 A;  2C2C A;  4EDF A;  3RLM A;  155C A;  1DII C;  3OA8 B;  4IL6 V;  3WC8 A;  1WEJ F;  3PLN A;  4KMG A;  2B4Z A;  2Q3E A;  3VYM A;  3L4M A;  1M6Z A;  1YNR A;  1L9J C;  1WVE C;  3PXW A;  1KB9 D;  2D0S A;  3SLE A;  3PRJ A;  2Y0C A;  5CIE B;  3OCD A;  2FYN B;  1ZRT D;  3X39 A;  2GC4 D;  3O5C A;  1DW3 A;  5DFS A;  1CTJ A;  5CIG B;  1H31 B;  3H1K D;  1NMI A;  3OA8 A;  3VNW A;  2BCC D;  4L3G A;  2BH4 X;  2ZXY A;  1F1F A;  1NNO A;  1C52 A;  1P84 D;  5GTI V;  1QL4 A;  4EIF A;  3NBT A;  1R0Q A;  2OZ1 B;  1FJ0 A;  4QAO A;  3CX5 W;  1H9Y A;  1IZL 0;  3TGU D;  5TJH A;  4PW9 B;  1KYO W;  1HZU A;  5KAI V;  2QJY B;  4JCG A;  1MG3 D;  2I8F A;  1RAP A;  1SQQ D; 
#chains in the Genus database with same CATH topology
 3AE3 C;  1KV4 A;  1HCM A;  3ZOX A;  4Y5R A;  2KNC A;  1AA0 A;  1NIR A;  3CCS P;  1N50 A;  3CX5 I;  1HH7 A;  1QL2 A;  1KX2 A;  1C7M A;  4H0K A;  2OTL P;  3H32 B;  1NYH A;  5EFW B;  3BRV B;  2M5A A;  1BCC G;  3A0B E;  1M70 A;  2GIW A;  1AVY A;  2D2C C;  3TYI A;  2J58 A;  2YKP A;  1FC2 C;  3MK7 B;  2JWA A;  3CU4 A;  4FA1 A;  3H1I J;  2OAR A;  4L75 A;  1M1J C;  1K73 Q;  3H32 A;  2KLU A;  1Q2N A;  2P67 A;  4JQ0 D;  2AIU A;  1LS9 A;  3QWO C;  3A3Y B;  1Q81 Q;  4WQD A;  2BAS A;  1HRC A;  1RH5 B;  3DMI A;  3CCL P;  1EXI A;  4PV1 D;  5AVW B;  3ZDM A;  4IL6 X;  1NTK E;  2N3B A;  3L74 D;  4M3L A;  4L1Q A;  2N9B A;  2HYN A;  1C6R A;  3H1L D;  2Q3I A;  2O01 J;  3HQ8 A;  1U7M A;  4GOE A;  1FE6 A;  1G1I A;  3L72 G;  2PCC B;  1ZR2 A;  3M0A A;  1MFT A;  3SWK A;  1KIL B;  4C46 A;  2JEE A;  2HG5 D;  4A7P A;  3AEE C;  1K3G A;  1PGP A;  3CME P;  4R4M A;  2MKV A;  3H1J E;  2WTY A;  3L4F A;  1RZ6 A;  1RAQ A;  1NWQ A;  1CRG A;  3L73 E;  5CIC B;  3O1Y A;  2H8P D;  1A2S A;  3TK1 A;  3CCJ P;  1IO3 A;  1GDV A;  4Y28 J;  4WWI A;  1A56 A;  1SFC C;  3H1H E;  4AAM A;  3BCC D;  1KB0 A;  1CI6 B;  2ZVO B;  2R44 A;  4WQA A;  4AX3 A;  1FBM A;  2WSF J;  1AV1 A;  1GIW A;  1SQB G;  2E43 A;  3CC4 P;  5AW4 B;  2N3Y A;  1J1E B;  1FAV A;  3HD7 D;  3S1K A;  1NTZ K;  5CCG C;  1CSB A;  1R5L A;  5KLI C;  4PJ0 H;  2OYH B;  3NMD A;  4XXL A;  2IZ0 A;  1CYJ A;  1PFI A;  1LC1 A;  1IZN B;  1JY3 P;  3L73 D;  4WY4 B;  1NTZ D;  3V2R A;  1HJB A;  1C2R A;  1SQB K;  2KSJ A;  1U75 B;  4JYB A;  4JF7 A;  2HV4 A;  2GUV A;  1DIQ C;  3L75 D;  1JY3 O;  3P32 A;  1ZV8 A;  1FI7 A;  3D70 A;  2OYI C;  1RE3 C;  3LW5 J;  4GOD A;  1H32 B;  3HE4 B;  2MTA C;  3NXS A;  2FYN C;  4J20 A;  4OGQ B;  1BE3 J;  1VQ4 P;  2Z5I A;  1LC2 A;  1M1J B;  4D6T E;  5AVU B;  3HE4 A;  1CSX A;  2FWL A;  1DX7 A;  2C9X B;  1PZQ A;  2JQR A;  1SS1 A;  1HZV A;  1M1J A;  1N15 A;  1M60 A;  1DVH A;  1GL2 A;  5AVT B;  1VF5 D;  2V08 A;  5GTH H;  4L74 A;  3AE6 C;  1I54 A;  1YI2 P;  1SQP E;  2Q5U A;  2PCB B;  1S4X A;  3H25 A;  1GZL A;  5KLV E;  5KLI B;  1L4A C;  2N18 B;  5CJ4 A;  3L36 A;  5E79 E;  1AJY A;  3CWB D;  1M8O B;  2FFD A;  2KS1 A;  4XE5 B;  1FDO A;  4HKZ H;  2C8S A;  3M91 A;  5C9M A;  4OGQ D;  3JCU H;  1PGJ A;  2Q1K A;  1NTK D;  1FCD C;  2BGV X;  2QE7 H;  2N9J A;  3WFB C;  4XFJ A;  2C1D B;  1FOC A;  4EYY Q;  2E5Y A;  2IBZ I;  3AED C;  2ZZS 1;  3PXS A;  1GW4 A;  1VQ5 P;  2E75 C;  3AEA C;  3MHV A;  4JYC A;  1JMM A;  1KIL A;  2YK3 A;  1VQO P;  1EC5 A;  2Q7C A;  4EIC A;  1AYG A;  2GUS A;  2K9Y A;  4XA4 A;  3H1I D;  3VTP C;  2LR2 A;  2GM4 A;  1D7M A;  2P7J A;  2Y9Z A;  1LT9 C;  4H13 B;  5B5E V;  1SQX D;  3GHG A;  1T8Z A;  2WSE J;  1LTS C;  1NKN A;  2AXT V;  2H89 C;  3CLQ A;  3A2A A;  1HJ5 A;  5CID B;  2KB7 P;  3UIA A;  4ZMD A;  1I6E A;  5AVQ B;  3L75 E;  4GDO A;  1IQC A;  3G3Z A;  1PGQ A;  4QMA A;  3JBT B;  1X79 B;  4PD4 I;  2L4D A;  2B88 A;  3WFD C;  2LXC B;  2W6B A;  1I8O A;  1DIP A;  1KIB A;  1C2N A;  3RK2 C;  1LT9 A;  1CTZ A;  2M5A B;  1KYO E;  3K5B A;  3VMZ A;  2WPQ A;  1KC8 Q;  3WU2 E;  1UII A;  4WY4 A;  3WUV A;  5B5E E;  3AE2 C;  1L0N K;  3A7O A;  1R8E A;  3M06 A;  1C6S A;  2A45 G;  5TIS V;  1H32 A;  1PP9 G;  1CCH A;  3KXD A;  1VYD A;  1QGK B;  1BSH A;  2PP6 A;  2L91 A;  3KPE A;  2Y0E A;  1Q86 Q;  4PV1 B;  4TLF A;  3M9Q A;  1BL9 A;  4PJ0 V;  1T3J A;  2R3S A;  1W2E A;  1L4A A;  3M9H A;  4NPF X;  1J3S A;  2C2C A;  3CXH E;  2ITA A;  4DOJ A;  2KLV A;  4IL6 V;  3Q1M A;  4KJM A;  2AXT H;  1USD A;  2B4Z A;  2KUB A;  2P10 A;  2B89 A;  1ZN5 A;  1OMI A;  5KTB A;  1SQV E;  1VQ6 P;  1J1E C;  2B87 B;  2XZR A;  4JBZ A;  1WVE C;  3A0H H;  1KB9 D;  1FZG A;  3SLE A;  3PRJ A;  3BAS A;  1T2K C;  2Y0C A;  5CIE B;  1YTZ T;  2FYN B;  3U1C A;  2GC4 D;  3QH9 A;  2ZXE B;  3H1J G;  1KQL A;  4ASW A;  3TNU B;  1GL2 D;  1CTJ A;  1SFC B;  2OQQ A;  2QIW A;  3VNW A;  1BCC J;  2BCC D;  2BH4 X;  1LTA C;  4KHX A;  1NNO A;  1ZME C;  1IK9 A;  1JUN A;  1IJD B;  1QX8 A;  2N1T B;  1OVV A;  4QAO A;  4IFM A;  2H7H A;  1S72 P;  3H1J J;  1VQ9 P;  1W2B O;  1PP9 D;  1ZZH A;  2O01 H;  1EZV G;  3H1H J;  3VN0 A;  2FYU J;  4YTP C;  5CCG A;  2C9L Y;  2CE1 A;  2FFD C;  1R5S A;  3C1L A;  1X22 A;  2NRG A;  1LJ2 A;  1M57 D;  1VDF A;  1CZQ A;  2QA4 P;  5DJQ B;  2W83 C;  1N7S D;  1AQ5 A;  1CED A;  1FDI A;  1FI3 A;  1GK4 A;  1LNQ A;  3TGU E;  1LGH B;  1CHI A;  1N73 A;  3CD6 P;  1L0N E;  2POH A;  5CIH B;  1I5T A;  3GMA A;  2XDJ A;  1IRW A;  2E76 C;  2WQY C;  2E75 B;  2RMZ A;  1KIL C;  2A06 E;  1BE3 D;  3CYT I;  2N1T D;  3CXH D;  1QL1 A;  2LIR A;  3O0R C;  4B86 A;  3NTN A;  4K3I A;  2WSE H;  1AOF A;  5AVX B;  5B66 V;  5AVZ B;  4GOF A;  5KJ7 A;  451C A;  3FWN A;  4L73 A;  5KKZ C;  5BU8 B;  2XND H;  1SP4 A;  3RN0 A;  4I1L A;  2ZYG A;  3S9O A;  1GU2 A;  2M8R A;  1NTZ J;  1FOS E;  3KZI H;  4DZO A;  3TDK A;  4DT0 A;  1CO6 A;  1CW5 A;  1OZH A;  3H1I G;  1GU4 A;  4MN4 C;  1H31 A;  4RSZ A;  3VMA A;  1PPJ D;  1KFN A;  1FOS F;  2BEQ D;  1CRY A;  3WUI A;  1Z56 A;  3CP5 A;  2FKW B;  1NML A;  3CC2 P;  1CC5 A;  1OIP A;  2V7Q J;  2BPB B;  1YJ9 P;  1NKZ B;  1S5L H;  1TU3 F;  2XU6 A;  1IFN A;  2FXM A;  4WVZ A;  1PV3 A;  3B8E B;  2Q6Q A;  2CA4 B;  1AQT A;  3BCC J;  2KSE A;  3FWL A;  4IOI H;  4RES B;  1EZV D;  3CC7 P;  4HJG H;  1QN2 A;  2WPR A;  2I1J A;  2WT7 B;  1YEA A;  3A5T A;  5IY5 1;  1RE3 A;  1OWA A;  2YIU B;  2EXV A;  2W90 A;  2GB8 B;  5CHX A;  1NU1 K;  2QG4 A;  4DCK A;  3L71 G;  2YQB A;  1NH4 A;  2IBZ D;  1LWU C;  1LP1 A;  3RBZ A;  3LID A;  1VQP P;  3BVH A;  1W2L A;  4D6T G;  4WQE A;  4W80 A;  5AW0 B;  2P1J A;  5APY A;  2ZYD A;  5AVR B;  3MZW B;  2W6A A;  3T97 B;  4Q5P A;  2ZOO A;  2NPS C;  3VMY A;  3L71 E;  1EXJ A;  1NTM D;  2K1A A;  4O1W A;  1CYI A;  3ITK A;  1USE A;  5TIS E;  3H1L E;  2W6J H;  1L0L D;  1QLE D;  3IAO A;  1M1K Q;  3I55 P;  2JR8 A;  4ZKP A;  3A0H E;  1I6D A;  1JO5 A;  1MG2 D;  1S2E A;  3L74 J;  2XKM A;  2NPS D;  3F5H A;  3C2C A;  5APW A;  1SQB D;  3TYY A;  1WMK A;  5AVV B;  1MUU A;  4NFG B;  1SQQ D;  4UB8 E;  3WU2 H;  2GA1 A;  1OVR A;  3CCM P;  1ETP A;  3FXD A;  2BCN B;  2C1D A;  2FYU D;  1QKS A;  3GW6 A;  1RE4 A;  1RHZ B;  3PXT A;  3HQ9 A;  3GF3 A;  4W7Z A;  3OW2 O;  1KIL D;  3BCC G;  2B10 B;  1SFC D;  1L4A B;  4DY9 A;  2FYU K;  1COR A;  1S5L E;  1EB7 A;  2H88 C;  2QRX A;  3IN6 A;  1GL2 B;  2A06 D;  1IK7 A;  5KLV G;  2O3J A;  2WSS H;  3HUS A;  1PL5 A;  2M0B A;  1KZU B;  2O1K A;  3L70 G;  2K88 A;  3NFQ A;  1BGY G;  4EID A;  1VQM P;  2D2C B;  1NTZ G;  4UB8 H;  5APU A;  3FXE A;  2QJP C;  1VQN P;  3BAT A;  2WSC J;  1J1D C;  4ZNC A;  2IYP A;  2B12 B;  2C1U A;  1N7S B;  4JPZ B;  2KNC B;  2M3E A;  2LIT A;  4BRY B;  3HTK A;  2BLF B;  2RH0 A;  2QJY C;  1U74 B;  1L2P A;  4UB6 H;  4MU8 A;  1RQU A;  2PAC A;  3M9B A;  4U3F E;  1KV9 A;  1S6V B;  2VRS A;  1ZP0 C;  1JY2 N;  1BSN A;  2YO2 A;  4HB1 A;  3W67 A;  3GHG C;  3V2Q A;  1VQK P;  2Y0D A;  3AE8 C;  3VP8 A;  4H0J A;  4AAN A;  1M56 D;  2W8Z A;  1GMJ A;  3CI9 A;  1PGO A;  2Z5H A;  2FY8 A;  2E5T A;  4EIE A;  2AEJ A;  1GDT A;  1FI9 A;  2HPC B;  1QL3 A;  1H33 A;  1E5W A;  2J59 M;  4K3A A;  1CXC A;  1NO4 A;  1CRJ A;  4AYC A;  4YXD C;  3AE5 C;  3KHU A;  2ZT9 D;  1GQ1 A;  4H0L C;  3H1H D;  1F1C A;  2A06 G;  4FA9 A;  1CIE A;  1SQV D;  2CPS A;  1RF1 C;  3BRT B;  1QYZ A;  3LIE A;  3RBX A;  3DP5 A;  1OW6 A;  3RL0 B;  1KIL E;  3VOP A;  3USS A;  1DII C;  1KQF B;  1PPJ E;  3WC8 A;  5KAI H;  1DH3 A;  3PH0 A;  2AXC A;  3II6 A;  3L72 E;  3VYM A;  1H88 A;  2B9B A;  3HRN A;  4I7Z C;  1L9J C;  1HF9 A;  2D0S A;  1SQX G;  1NGM B;  1ZRT D;  2NPS A;  3X39 A;  1H0T A;  3SFE C;  3PP5 A;  2NPS B;  3E7K A;  3L73 G;  1URQ D;  2NZ2 A;  3KZI E;  5CIG B;  3H1K D;  3OA8 A;  4L3G A;  1F1F A;  5APS A;  1URQ B;  4EIF A;  1R0Q A;  3AEG C;  1NU1 J;  3M0D C;  2WSF H;  3L74 G;  3GHG B;  1H89 A;  3CX5 W;  1L0N J;  1NTM G;  1OW7 A;  5TJH A;  3TGU D;  4PD4 H;  4PW9 B;  1MFZ A;  3SFD C;  1HZU A;  5KAI V;  4C7R A;  2LXB A;  3CXH I;  1HBW A;  4O9B A;  1SQV J;  3E1I A;  2FBW C;  1E8E A;  1YBK A;  1CHH A;  2JP3 A;  5KKZ B;  2WWW A;  3SJL A;  3H1K E;  1X8Y A;  5E79 H;  3CCQ P;  4U7J A;  1YJN P;  3GF7 A;  2OZ1 A;  4N6J A;  3RGU A;  1BDD A;  3MTU E;  4PD4 D;  5AW7 B;  1W5C T;  1L0L G;  3HD7 A;  3HUS C;  3MK7 C;  3RK3 B;  3ZOO A;  3O6Q B;  1S5L V;  3OJA B;  1SVF A;  3CWB G;  1CRC A;  1NU1 G;  1K9M Q;  2P58 A;  5KAF H;  1IRV A;  1GTW A;  1ZLL A;  3L72 D;  2KXP B;  1CXA A;  2OYI A;  2QM7 A;  4WQ9 A;  1VL2 A;  3N4X A;  3EWK A;  3T97 A;  2BCC G;  3V2P A;  1IFI A;  2B87 A;  1IO4 A;  2C1V A;  5B6Q A;  4I6M C;  3HD7 B;  2A45 H;  4N0K A;  4TT3 H;  2FFD B;  1KOR A;  3HTK B;  5TIS H;  1NAF A;  2IDB A;  2JO1 A;  3SVW A;  1SQP D;  3SWS A;  1NTK K;  351C A;  3A0B V;  5AW2 B;  1DT1 A;  3U1A A;  2I8D A;  1PIX A;  4IFF A;  5CCH A;  1SQB E;  1URQ C;  4IFD K;  4WQ7 A;  3A9F A;  5DF5 A;  5AVS B;  1G2C B;  1BGY D;  1K04 A;  4PJ0 E;  3U59 A;  2Z4E A;  4BXL A;  3AEF C;  1P84 H;  1KMI Z;  1LTB C;  3TGU G;  1RZ5 A;  4AAL A;  2V7Q H;  3N7N A;  5DJU B;  2IBZ G;  4RKU J;  3P7K A;  1H0T B;  2OYO A;  2HPC A;  1YIJ P;  4U3F D;  4IL6 E;  3C8V A;  1L0L J;  1JY2 P;  3ZBM A;  2PFX A;  2ZJS E;  3EFG A;  2QM8 A;  5APT A;  1FS0 E;  3WUT A;  2IYO A;  2CA3 B;  3MIW A;  4N78 D;  1RY3 A;  3CWB J;  3JC2 2;  5APQ A;  1NTZ E;  1AKK A;  1W5C E;  3FX0 A;  2IBZ E;  2JKV A;  3HQ7 A;  1EDK A;  1RF1 A;  3ZOW A;  1JMB A;  1Y47 A;  1SQQ K;  1COT A;  2N1T C;  5GTH E;  4AUW A;  4FAV A;  3H1L J;  1LTJ B;  3V6I A;  5H2F V;  2OTK E;  4WY4 D;  2QVA A;  1BE3 G;  1N7S C;  3MGN A;  2C0W A;  2FYU G;  1LTT C;  2D0W A;  1OCD A;  3B5N A;  1NTM J;  2I1K A;  3IF4 A;  3H1H G;  3WFC C;  1VF5 B;  3OA7 A;  2C9N Y;  2DVH A;  4U3F J;  4C7N A;  4Z1M H;  4LLH A;  2FYU E;  3M97 X;  3O20 A;  2Y9Y A;  4WY4 C;  1YTC A;  1IFD A;  3RN1 A;  4WQ8 A;  4I2L C;  3ZCF A;  1KB9 I;  4H0L D;  3WMM 0;  5GTH V;  3RK2 B;  4DJG A;  1H33 B;  1KB9 E;  2PRR A;  2YMY A;  1CTY A;  1NOH A;  5KAF V;  3CPW O;  1JTH B;  3KZI V;  3RMZ A;  3L75 G;  1CHJ A;  4N3Y B;  4GED B;  1Y8A A;  3E1R A;  1SLQ A;  1BGY E;  4UB6 V;  1K3H A;  4D6T D;  1MKM A;  1A8C A;  2JJL A;  2PGD A;  1S9K D;  1SQP G;  1UIX A;  2YNY A;  3NWV A;  1VQL P;  3L71 D;  2QJK C;  2GC7 D;  2H43 A;  2E76 B;  2UWJ E;  1DW2 A;  3HE5 B;  1BDC A;  3VRD A;  1N9C A;  3H1L G;  2AEM A;  4UB8 V;  3TSI A;  1QVG O;  1EDJ A;  1LP1 B;  2WPS A;  2OYH A;  3L72 J;  2FRC A;  1L0L K;  2WIT A;  2R32 A;  3GLM A;  2ZVN B;  3TNU A;  3Q5S A;  1VPC A;  5KJ7 C;  4LJI A;  1DVV A;  5CYT R;  3PHL A;  5C0Z A;  1JDL A;  5CIB B;  2E75 D;  3IR9 A;  1LTI C;  1E29 A;  4N78 E;  1N8R Q;  1PP9 E;  1YYC A;  4H13 C;  1SQQ G;  4Y99 B;  3BCC E;  1LTG C;  1JB0 J;  4HH2 A;  3RK3 D;  2K37 A;  2WZ7 A;  1CRI A;  5E79 V;  1RF0 C;  1E79 H;  3B5N D;  1E2R A;  2E74 D;  3Q2Y A;  3AE9 C;  1YEB A;  2XNX A;  3L37 A;  1N73 B;  3DR0 A;  2E76 D;  2FXO A;  2ZYA A;  1JNM A;  2QJK B;  2ZBO A;  1AVO A;  2SPZ A;  1YHQ P;  3L70 J;  1SQQ E;  2A45 I;  1ZR4 A;  1LTJ A;  4H13 D;  2BH5 X;  1CRH A;  2LKM A;  3JCU E;  1C6O A;  3D0W A;  1CNO A;  2K9J B;  2CXB A;  3L70 D;  1ZW0 A;  2KYV A;  3PTZ A;  3AE1 C;  3H1K J;  5K5G B;  1GK6 A;  2R5D A;  1JY2 O;  2KP8 A;  3SSU A;  5KLV D;  2D2C D;  2C0X A;  2YO3 A;  1CSW A;  2IZ1 A;  2ZFC A;  4H44 D;  1GW3 A;  3M0D A;  1FJK A;  3PH2 B;  4EIJ A;  3H1J D;  1HTL C;  1HWT C;  4IL6 H;  4EDF A;  5B5E H;  3EFF K;  3RLM A;  155C A;  4U3F G;  5BU5 A;  1WEJ F;  1IFJ A;  1X9V A;  3HE5 A;  2BCC J;  2AEF A;  1M6Z A;  1YNR A;  3KQG A;  1T6A A;  1OFC X;  2KZJ A;  2HR3 A;  3L74 E;  1KQS O;  4H44 C;  1G1J A;  1HGV A;  1N7S A;  3O5C A;  3CXH H;  1DW3 A;  5DFS A;  2WT7 A;  5GTI E;  4GKG A;  3JSV C;  3F89 A;  3RK2 D;  1JCC A;  3A0B H;  5CBO A;  4I7Z B;  5CJ0 A;  3V2N A;  1C52 A;  1P84 D;  1N73 C;  4ZKU A;  5B66 E;  4C7N B;  3W68 A;  1QL4 A;  3CCE P;  1FJ0 A;  4GT1 A;  5BVZ A;  1VQ8 P;  2Q9I A;  3RL0 C;  1FJP A;  1WRG A;  1H9Y A;  3CL3 D;  5C39 A;  1HH0 A;  4D6T J;  3MUD A;  1RF1 B;  2HFE D;  1MG3 D;  2YXQ B;  1RF0 A;  2I8F A;  3G9R A;  4O1Q A;  2WPV B;  3VP9 A;  1CI6 A;  2E74 B;  1FZB A;  1IFM A;  1U57 A;  3WUU A;  1PPJ G;  2RKL A;  4K35 A;  1NU1 E;  4AQR D;  4CPG A;  1G2C A;  1P84 I;  1CCR A;  3AE4 C;  2G3A A;  3P8C D;  1N86 A;  4GYD A;  1SQX E;  1NTM K;  3O8Z A;  3KYQ A;  2IX7 C;  4W7Y A;  1H9X A;  1IC2 A;  3B71 A;  3WFE C;  3LW5 H;  1LMS A;  5DJT B;  1FZC A;  1FU1 A;  2DGE A;  1KQG B;  1XTC C;  2B11 B;  1RQV A;  1DD4 A;  1KX7 A;  3O6Q A;  3Q3D A;  1JY3 N;  5DJQ C;  1FZF A;  1CIG A;  1Q82 Q;  3KDP B;  3AE7 C;  1LT1 A;  1YQ3 C;  3RK3 C;  3D6Z A;  3H1K G;  4H44 B;  1N2D C;  1NJI Q;  1SQB J;  1FZA A;  2R3C A;  2ZT9 B;  4GIF A;  3CXH W;  4AAO A;  2L5G B;  3MD0 A;  5AW1 B;  1T2K D;  2N9I A;  3CWB E;  4OWF A;  3P8M C;  1NAY A;  1EZV I;  5AVY B;  1LWU B;  4FB1 A;  4P4Q B;  2YXR B;  2W27 A;  1FZE A;  1C75 A;  2ZXX A;  1NTK G;  3CCV P;  1L0L E;  5CBN A;  3C9I A;  1CYC A;  1RE4 C;  1VF5 C;  2CE0 A;  5CIF B;  1JTH A;  3V4W A;  2N1T A;  2N9Y B;  1LWU A;  2DW3 A;  2YCC A;  3AEB C;  1YIT P;  3RK3 E;  1KB9 H;  4NPD A;  3R2P A;  4KT0 J;  4WQB A;  2YKQ A;  2M3B A;  1KYO I;  2XTS B;  1NTK J;  2ORL A;  1QVF O;  3G71 P;  1LTJ C;  2OYI B;  2ZON G;  1URQ A;  1JM0 A;  4YE1 A;  1YIQ A;  1I55 A;  1JCD A;  1HRO A;  1DD3 A;  1YFC A;  3ZOY A;  2V4H A;  3MP7 B;  2O1J A;  2QSI A;  1OVU A;  1M7L A;  4PD4 E;  1EZV E;  1YJW P;  1MV8 A;  4WQC A;  2OYH C;  3CCR P;  1JOC A;  5CCH C;  1WT6 A;  1SQP J;  3H1I E;  1J2J B;  3I5C A;  2WVR A;  3L73 J;  2CK3 H;  4PV1 C;  2P2U A;  1T3U A;  1FZC C;  4PWA A;  5AUR A;  3B5N B;  1SQP K;  3CMA P;  4V2K A;  1YQ4 C;  3R4Y A;  1YTZ I;  1DEE G;  3CX5 D;  1HJ4 A;  1BGY J;  1L4A D;  2YMK A;  3ABV C;  1HJ0 A;  4WB4 A;  3L75 J;  2KZI A;  4UB6 E;  3L35 A;  3SWY A;  1HJ3 A;  4HYT B;  2HLO A;  1GJQ A;  4Y99 C;  3I56 P;  1OX3 A;  4OH8 B;  1S3J A;  1SQV K;  1BE3 E;  4XYD B;  2KIK A;  5KAF E;  1ZRT E;  1IFP A;  1GU5 A;  5H2F E;  3EQ2 A;  2XV5 A;  2CPB A;  5H2F H;  3G6E P;  3L70 E;  1HGZ A;  2YIU C;  1FDM A;  1SQX K;  1DW1 A;  3D71 A;  2OGU A;  1VQ7 P;  5AW3 B;  1X0T A;  1H8A A;  1AOQ A;  3V4Q A;  1LT9 B;  2IFN A;  3V5B A;  2MJZ A;  5M1B A;  3HD7 C;  3ORV A;  1M90 Q;  2N18 C;  3VYI A;  1KYO D;  1S5L X;  1GKS A;  1L0N D;  2QJP B;  1NHL A;  1OXZ A;  2VHD A;  2AI5 A;  4LC1 A;  3L4O A;  1QEX A;  1SFC A;  1YCC A;  5AW6 B;  3HUS B;  2O01 N;  2HOD A;  2R5B A;  5B66 H;  1LFM A;  1FHB A;  4R4L A;  2B0Z B;  2JTI B;  1KD1 Q;  1A02 F;  3P8C E;  3OCD B;  4FAN A;  4ASV A;  1PP9 J;  5EXQ A;  3FGA D;  3WU2 V;  1KYO H;  1JEK A;  1AFO A;  4NPE A;  4FA4 A;  5L8R J;  3TGU J;  1XTG B;  4YXW H;  2ZT9 C;  1NTM E;  3HQ6 A;  2OTJ P;  1NU1 D;  3TF5 A;  2E42 A;  1Q7Y Q;  2AXT E;  1Y9B A;  3Q5P A;  1J1D B;  4WBA A;  2MHM A;  1EDL A;  2V07 A;  1BCC D;  1DW0 A;  2G8Y A;  1OAE A;  1A02 J;  3GG2 A;  2KS1 B;  1I8P A;  1CIF A;  3A0H V;  4L3H A;  4FA5 A;  2IPP A;  1CSU A;  1DEB A;  5KLV J;  5AW8 B;  1S9K E;  1MZ4 A;  1K8A Q;  5KAI E;  2WMM A;  5AW5 B;  4BRY A;  1H1O A;  3IFM A;  4OGQ C;  1GL2 C;  1YIC A;  1CSV A;  3ZIY A;  1HVV A;  2IFM A;  3H6P A;  1ZOY C;  2KI7 B;  2RN0 A;  2KOG A;  3NBS A;  2K3R A;  5CMZ A;  3CX5 H;  2E74 C;  5AW9 B;  4RJT A;  1P84 E;  1L9B C;  2YKO A;  3SXT A;  1CIH A;  1B7V A;  1EDI A;  1SQQ J;  2BCC E;  1FZC B;  5KJ7 D;  3S4R A;  1U7J A;  3B4S A;  4EOT A;  1N90 A;  3SWF A;  3RL0 g;  3OA8 B;  3PLN A;  4KMG A;  1RAP A;  1KFM A;  1S1C X;  4H0L B;  4LGD E;  2Q3E A;  2JDI H;  4BWN A;  3VMX A;  3L4M A;  2FYZ A;  3PXW A;  3RL0 D;  3AEC C;  4L76 A;  3PJS K;  5GTI H;  1NVO A;  2K9J A;  4OVN F;  1Q90 D;  3OCD A;  3MUD C;  3CCU P;  2ZAE B;  2J5U A;  1N7L A;  1ZXG A;  2WSC H;  1EQ7 A;  5CCH D;  3OAK A;  1H31 B;  5APV A;  1MZ9 A;  2PAJ A;  1NMI A;  1KN7 A;  1KTM A;  1SQV G;  3B5N C;  1L0N G;  3Q5R A;  4RO0 A;  2ZXY A;  5CCG D;  5GTI V;  2JWD A;  1GD2 E;  3NBT A;  2HOD B;  2OZ1 B;  3L71 J;  2BEZ F;  1K05 A;  5APX A;  2QEX P;  1IZL 0;  3CX5 E;  3G4S P;  2KK7 A;  1KYO W;  4YPC A;  2QJY B;  1OW8 A;  4JCG A;  5KLV K;  1SQX J;  1HUC A;  3D6Y A;  1BCC E;  2FXP A;  4EI2 A; 
#chains in the Genus database with same CATH homology
 1PP9 D;  1ZZH A;  4O1Q A;  1E8E A;  1HCM A;  3ZOX A;  4Y5R A;  1CHH A;  1NIR A;  1N50 A;  5KKZ B;  2CE1 A;  3SJL A;  1CCR A;  1HH7 A;  1KX2 A;  1C7M A;  2OZ1 A;  4H0K A;  5DJQ B;  4GYD A;  4PD4 D;  1W5C T;  3MK7 C;  1CED A;  3ZOO A;  1H9X A;  1FI3 A;  1M70 A;  1S5L V;  3WFE C;  2GIW A;  3TYI A;  1CHI A;  1LMS A;  1CRC A;  2DGE A;  3MK7 B;  2JWA A;  1IRV A;  3CU4 A;  4FA1 A;  2B11 B;  3L72 D;  5CIH B;  1I5T A;  1KX7 A;  1CXA A;  5DJQ C;  1IRW A;  1CIG A;  4WQ9 A;  2RMZ A;  1BE3 D;  2AIU A;  3CYT I;  3CXH D;  1LS9 A;  2LIR A;  3O0R C;  4K3I A;  4WQD A;  2C1V A;  1AOF A;  1HRC A;  3DMI A;  5B6Q A;  5B66 V;  4N0K A;  2N3B A;  3L74 D;  451C A;  4L1Q A;  1C6R A;  3CXH W;  3H1L D;  4AAO A;  3HQ8 A;  3RN0 A;  2N9I A;  1GU2 A;  3SVW A;  2PCC B;  3TDK A;  1SQP D;  3SWS A;  1CO6 A;  351C A;  3A0B V;  1DT1 A;  1H31 A;  4RSZ A;  4FB1 A;  4P4Q B;  3VMA A;  1PPJ D;  4A7P A;  1CRY A;  3WUI A;  4WQ7 A;  1C75 A;  1K3G A;  3CP5 A;  3A9F A;  5DF5 A;  1NML A;  1BGY D;  1CC5 A;  1CYC A;  2BPB B;  2CE0 A;  1RZ6 A;  5CIF B;  1RAQ A;  1CRG A;  5CIC B;  1RZ5 A;  3O1Y A;  1A2S A;  2N9Y B;  4AAL A;  1IO3 A;  1GDV A;  2YCC A;  1A56 A;  2CA4 B;  3FWL A;  4AAM A;  1EZV D;  3BCC D;  1KB0 A;  1QN2 A;  4U3F D;  4WQB A;  4WQA A;  4AX3 A;  2XTS B;  3ZBM A;  2ORL A;  1GIW A;  1YEA A;  2ZON G;  2CA3 B;  4YE1 A;  1YIQ A;  1I55 A;  5IY5 1;  1HRO A;  1YFC A;  2YIU B;  3ZOY A;  2EXV A;  1AKK A;  2N3Y A;  2GB8 B;  2QG4 A;  4WQC A;  3HQ7 A;  2YQB A;  4XXL A;  3ZOW A;  1CYJ A;  2IBZ D;  1LC1 A;  1COT A;  3L73 D;  1W2L A;  1NTZ D;  4FAV A;  1C2R A;  4WQE A;  4PWA A;  5AUR A;  1U75 B;  5H2F V;  4V2K A;  2HV4 A;  1DIQ C;  3L75 D;  4Q5P A;  2ZOO A;  1FI7 A;  3CX5 D;  1NTM D;  1HJ4 A;  2D0W A;  1H32 B;  2MTA C;  4O1W A;  1OCD A;  1CYI A;  4J20 A;  3ITK A;  1LC2 A;  3WFC C;  1CSX A;  2FWL A;  2C9X B;  2JQR A;  1L0L D;  1HZV A;  2DVH A;  1N15 A;  1M60 A;  1DVH A;  1HJ3 A;  3M97 X;  3O20 A;  1I6D A;  2V08 A;  1MG2 D;  1YTC A;  1GJQ A;  3RN1 A;  4WQ8 A;  3ZCF A;  4XYD B;  1I54 A;  2PCB B;  3C2C A;  5GTH V;  1SQB D;  5KLI B;  1H33 B;  4NFG B;  2N18 B;  1CTY A;  5KAF V;  3KZI V;  1ETP A;  3RMZ A;  3CWB D;  2BCN B;  2C1D A;  2FYU D;  1CHJ A;  2KS1 A;  1DW1 A;  1QKS A;  3GW6 A;  4GED B;  2C8S A;  5C9M A;  3PXT A;  1AOQ A;  3HQ9 A;  1NTK D;  1FCD C;  2BGV X;  2B10 B;  2N9J A;  3ORV A;  3WFB C;  4UB6 V;  1K3H A;  2N18 C;  4D6T D;  2C1D B;  1A8C A;  4DY9 A;  1FOC A;  1COR A;  1EB7 A;  1KYO D;  1GKS A;  1L0N D;  2QJP B;  2ZZS 1;  3PXS A;  2A06 D;  3NWV A;  2VHD A;  3L71 D;  2O3J A;  2GC7 D;  2AI5 A;  1DW2 A;  3L4O A;  3VRD A;  1N9C A;  2YK3 A;  1YCC A;  4UB8 V;  4EIC A;  4EID A;  1LFM A;  1AYG A;  1FHB A;  2B0Z B;  2JTI B;  3OCD B;  3H1I D;  4FAN A;  2FRC A;  5B5E V;  5EXQ A;  1SQX D;  3WU2 V;  4LJI A;  1DVV A;  2AXT V;  5CYT R;  4FA4 A;  2B12 B;  2C1U A;  3PHL A;  5C0Z A;  1JDL A;  1HJ5 A;  5CIB B;  2KNC B;  2LIT A;  5CID B;  3HQ6 A;  1NU1 D;  3TF5 A;  2BLF B;  1E29 A;  1I6E A;  1IQC A;  1U74 B;  2MHM A;  4MU8 A;  2V07 A;  1BCC D;  3JBT B;  2PAC A;  1DW0 A;  2L4D A;  3WFD C;  1KV9 A;  1OAE A;  3GG2 A;  1S6V B;  1I8P A;  1I8O A;  1KIB A;  1CIF A;  1C2N A;  1CRI A;  5E79 V;  3A0H V;  4L3H A;  4FA5 A;  1E2R A;  1CTZ A;  1CSU A;  2Y0D A;  4H0J A;  4AAN A;  1YEB A;  1MZ4 A;  3DR0 A;  2QJK B;  4EIE A;  2ZBO A;  1H1O A;  1YIC A;  1CSV A;  3ZIY A;  1FI9 A;  1QL3 A;  1H33 A;  1C6S A;  5TIS V;  2BH5 X;  1H32 A;  1CRH A;  1CCH A;  1CXC A;  2RN0 A;  1C6O A;  1VYD A;  1CNO A;  1CRJ A;  2K9J B;  2CXB A;  2L91 A;  3L70 D;  2Y0E A;  3PTZ A;  3KHU A;  1GQ1 A;  3NBS A;  1BL9 A;  3H1H D;  4PJ0 V;  1F1C A;  4RJT A;  1L9B C;  5KLV D;  4FA9 A;  3SXT A;  1CIH A;  1B7V A;  1CSW A;  1CIE A;  1SQV D;  1QYZ A;  3PH2 B;  1J3S A;  1N90 A;  3H1J D;  3DP5 A;  2C2C A;  4EDF A;  3RLM A;  155C A;  1DII C;  3OA8 B;  4IL6 V;  3WC8 A;  1WEJ F;  3PLN A;  4KMG A;  2B4Z A;  2Q3E A;  3VYM A;  3L4M A;  1M6Z A;  1YNR A;  1L9J C;  1WVE C;  3PXW A;  1KB9 D;  2D0S A;  3SLE A;  3PRJ A;  2Y0C A;  5CIE B;  3OCD A;  2FYN B;  1ZRT D;  3X39 A;  2GC4 D;  3O5C A;  1DW3 A;  5DFS A;  1CTJ A;  5CIG B;  1H31 B;  3H1K D;  1NMI A;  3OA8 A;  3VNW A;  2BCC D;  4L3G A;  2BH4 X;  2ZXY A;  1F1F A;  1NNO A;  1C52 A;  1P84 D;  5GTI V;  1QL4 A;  4EIF A;  3NBT A;  1R0Q A;  2OZ1 B;  1FJ0 A;  4QAO A;  3CX5 W;  1H9Y A;  1IZL 0;  3TGU D;  5TJH A;  4PW9 B;  1KYO W;  1HZU A;  5KAI V;  2QJY B;  4JCG A;  1MG3 D;  2I8F A;  1RAP A;  1SQQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...