3BCCE

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPNFSDYRRPPDDYSTKSSRESDPSRKGFSYLVTAVTTLGVAYAAKNVVTQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
total genus 41
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3bccE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3bccE02
5HL4A 1UUVA 4QDFA 3CXHE 3GZYA 1SQPE 1SQQE 2DE7D 3H1HE 2ZYLA 1KB9E 4P1CH 3H1IE 4QURA 1BGYE 4QUPA 3DQYA 1PP9E 4NB8D 2ZT9D 5AEUA 1O7WA 2B1XA 1SJGA 2HMLA 1O7NA 5BOKA 1EG9A 4HM5A 4D6TE 4OGQD 3L72E 1RIEA 5KLVE 1ZRTE 2FYNC 3H1KE 1G8JB 1Q90C 2HMNA 3GL0A 4U3FE 1NTZE 1O7PA 3CX5E 2HMOA 2YIUC 1UUWA 1WQLA 2YFIA 3GTSA 4HM4A 3VCPA 4AIVA 4PV1D 1SQBE 3L73E 3BCCE 2E4PA 3VMHD 4AAYB 2E4QA 3H1LE 4HM3A 3EN1A 1VCKA 4QCKA 2FYUE 2B24A 1KYOE 1L0LE 1BCCE 1L0NE 1EZVE 3D89A 3GCEA 4H13D 4QDDA 2E74D 3GB4A 3L74E 2CKFA 2JZAA 2QJKC 2YFJA 4HM0A 3L75E 2QJYC 2HMMA 4HM7A 2YVJB 4NBCD 2GBWA 4P1BH 4HM2A 3CWBE 4QUQA 5CXMA 2BMOA 1SQXE 2NWFA 4NBDD 2XSHA 4HM1A 1VM9A 3GTEA 3L71E 4H44D 3GZXA 1JM1A 2E75D 4QDCA 2I7FA 1ULIA 3VMGD 2JO6A 2NVGA 4NBHD 2XR8A 3GL2A 1NU1E 4PD4E 3FOUA 4HKVA 2QPZA 2XSOA 2NUKA 1P84E 4EMJB 2DE5D 2GBXA 2NVFA 1BE3E 1FQTA 2BMQA 3AZCA 5KKZC 1NYKA 5KLIC 1RFSA 4NBED 5AEWA 3H1JE 4HJLA 4NB9D 2DE6D 2BMRA 2IBZE 3EQQA 3L70E 3GOBA 4NBBD 3VMID 1NTME 1PPJE 3TGUE 4H0LD 2HMJA 2E76D 1ULJA 1NDOA 1O7MA 2A06E 4HM6A 1O7GA 2XRXA 2D2CD 2NUMA 4HM8A 3GKEA 1SQVE 3VCAA 4NBFD 1NTKE 2QJPC 4NBAD 4NBGD 1G8KB 2NVEA 2HMKA 2YFLA 4QDFB 3C0DA 2BCCE 2Q3WA 1VF5D 1O7HA 3N0QA
chains in the Genus database with same CATH superfamily
3Q2YA 3A0HE 4WB4A 2DE7D 2W8ZA 3H1LG 1P84I 3VMYA 2YO3A 1OWAA 2L5GB 3CMAP 2B9BA 2KP8A 2M3EA 1PP9J 2KI7B 2HPCB 2KS1A 2KOGA 2BASA 2N1TC 1IFJA 4AIVA 2OYIA 5AVXB 3VMHD 1VQLP 3G9RA 2OTLP 4QCKA 2HYNA 1BCCE 3GF7A 2YVJB 2Q5UA 4H0LC 4QMAA 1JY3N 2HLOA 3VMZA 1MV8A 2FFDA 5BVZA 1KV4A 3HUSA 2IYOA 1VQNP 2NUKA 3RBXA 2DE5D 2E42A 3HUSC 3TF5A 1BGYJ 1JOCA 5TJHA 2POHA 3CCQP 3H1KD 2V7QH 3LW5J 2A06G 1OIPA 2A45G 1ZXGA 1L4AD 2RN0A 2N1TA 3JCUE 4WY4B 4PV1B 1O7GA 1T6AA 1NYHA 2FYUG 2M5AA 3VCAA 2HODA 3SFDC 4GODA 2XNDH 3V4QA 2LKMA 5TISE 4DCKA 3N0QA 4YXWH 4QUPA 5DJTB 1N7SC 4BXLA 3FXEA 2I1JA 3C9IA 1VQMP 1D7MA 2E5YA 5CBOA 3L4FA 3A3YB 1IK7A 1PZQA 4RO0A 5AW1B 1SFCB 1MUUA 3JSVC 1KMIZ 2NZ2A 2IDBA 5B5EE 4HM3A 3EN1A 1NH4A 3WUUA 1AVYA 2FBWC 1GU4A 2GBWA 4JF7A 1LTJB 4OGQC 1AJYA 2WPRA 1OVUA 2A45H 2ZVOB 4W7ZA 3M9QA 4HKVA 4IL6H 2I1KA 1QL1A 1FQTA 1ZR4A 1NKNA 4D6TD 3L72G 1ZRTD 4HJLA 2H89C 2DE6D 3VMID 2RH0A 1SQQK 4KHXA 3B4SA 1JO5A 1GK4A 2FKWB 3TNUB 3VP9A 3BCCJ 4ASVA 3O8ZA 1HF9A 4U3FG 3VYIA 5GTIE 3L74D 1IFIA 2KNCB 3AE1C 1YITP 2N1TB 2JO1A 1NHLA 4PJ0H 2R3SA 3R2PA 4PD4I 1YTZT 1JY2P 1K8AQ 1O7WA 1N8RQ 3H1JD 3AEFC 1G8JB 3BCCG 3TGUJ 1KYOH 3KHUA 4U3FE 3CX5E 4DT0A 4IL6X 3HD7B 4DJGA 1RE3C 1JNMA 3RL0g 1JY2O 1J1DC 2E74D 2HG5D 2YXRB 2Z5IA 2QJKC 3L75E 1GW3A 3UIAA 3RK2D 2BCCD 2CPBA 3CL3D 4EOTA 1YTZI 2G8YA 2XSHA 2QVAA 1L0LG 2ZXXA 4U3FJ 2IZ1A 3M0DA 1LTBC 2K9JA 2I7FA 1SQPG 1HH0A 5AW9B 3VMGD 2NVGA 4C7NA 3V4WA 2HODB 1LTTC 1YJNP 4BRYA 4EMJB 3IF4A 2WMMA 1KB9H 4NBED 3I55P 1OFCX 5KJ7C 1NAFA 2K88A 4YTPC 5AW4B 2Z4EA 1EZVG 4HM6A 1XTCC 2WZ7A 3RL0C 2M8RA 2XNXA 3CWBD 3OJAB 1R8EA 2PGDA 3KQGA 2BCCE 1NTMK 2K9JB 1GD2E 4B86A 4GOEA 1PP9E 1BDCA 1IFPA 2OYHB 1P84D 3CCJP 2MJZA 3TSIA 1DEBA 2NRGA 2GA1A 3CXHH 3H1HG 3RK3B 1LP1A 1GMJA 3BASA 3M0DC 4O9BA 3V6IA 2YIUC 5H2FE 3CWBJ 1EZVI 3H1JJ 1SVFA 3TGUD 4TT3H 2AEMA 2KS1B 2FXOA 3B71A 4C7NB 3GB4A 3L35A 2KZIA 4JBZA 4L73A 1KILE 2WSEH 3L73J 2ITAA 3MZWB 3P8CD 1S1CX 1GZLA 2NPSB 1XTGB 1K73Q 1QX8A 1FZFA 2YMKA 4OWFA 3Q5PA 1PPJG 1PGOA 1EDIA 1P84E 2QEXP 1J1EC 1L4AA 3II6A 2KIKA 2OQQA 1IK9A 2AEJA 2NPSC 1EXIA 2WVRA 3JC22 1KC8Q 3PTZA 3E7KA 1PPJE 1S4XA 2OYHC 1VQKP 3AE6C 2GM4A 2YKPA 2W6BA 2A06E 3L73D 2W27A 3T97A 3PRJA 3W67A 4HM8A 1SQVE 1SQXJ 2XKMA 3RK3C 1NTKE 2IBZI 3A7OA 1L0LK 2YFLA 1RF0C 3BATA 1UIXA 1RY3A 4Y99C 3GHGC 4NPFX 4K35A 1OXZA 2IBZG 2H7HA 1GK6A 4KJMA 1EXJA 3MD0A 1J1DB 1JTHA 3KZIH 3PJSK 1VQOP 1ZMEC 1EDKA 1S2EA 4ZKPA 2XV5A 1NU1K 2KB7P 4Y99B 1MKMA 1LWUA 1JEKA 1SQBE 4IL6E 1UIIA 2YKOA 1FZCB 1PPJD 2WSFJ 2ZFCA 3H1LE 5APWA 1KTMA 4H44B 1VCKA 3D89A 1S5LH 2H88C 2V7QJ 3LW5H 2CKFA 1OW6A 4P1BH 2N9BA 2YXQB 2AXTH 3FWNA 1SQXE 4UB8H 1N73A 1FDOA 4DZOA 4N6JA 2JWAA 1ULIA 2O01J 3GL2A 3SSUA 4AYCA 2E76C 3V2RA 3A2AA 1BE3E 3CXHI 2PAJA 2IPPA 2LXBA 2ZYAA 1GL2A 3GOBA 2A45I 1NU1J 1DD4A 2FYUD 5M1BA 1LT9A 3AE3C 3KDPB 1IC2A 3H1LD 3CX5H 1LWUC 5KJ7A 1W2EA 5KKZB 3M06A 2ZYLA 1S5LX 1SQXD 3AEDC 1T3UA 1SQXK 4ASWA 5KAFE 3GMAA 2N9YB 4YXDC 1W2BO 1SJGA 1N7SA 1FOSF 1VL2A 1IFNA 4LGDE 2FYUJ 1ZV8A 3OA7A 2WSCJ 3GL0A 3SFEC 5APSA 1EC5A 3ABVC 2UWJE 4HM4A 3LIDA 3BVHA 4I6MC 1SQPJ 2FYUE 2B89A 3CCMP 3WUTA 1LT9C 1VQPP 5GTHH 2QJYC 1HJ0A 2FY8A 4HM2A 1Y47A 3ITKA 1HVVA 3E1RA 5B5EH 2B88A 4R4MA 1S9KD 1KFNA 4HH2A 3GZXA 1Q90D 1CSBA 3H1HD 2JO6A 3H1ID 4NBHD 2W6AA 3L72D 2QPZA 2R5DA 4UB6E 1M56D 2Y9ZA 5APXA 4EI2A 3CCLP 3AZCA 1HGZA 1RFSA 5AEWA 3Q5RA 1OZHA 2IX7C 2GUSA 3QWOC 1E79H 2IYPA 4HKZH 1YJWP 1N86A 1J1EB 2E5TA 4NBAD 1FBMA 1M1JA 1BGYG 1ZLLA 2FYUK 3H1IJ 1L4AB 1URQD 3TK1A 2OYOA 3L72J 5HL4A 2WSEJ 5DJUB 5AVQB 4H0LB 3L71D 3AE5C 3ZDMA 2B1XA 2WSFH 4EYYQ 5CCGD 5E79E 2E75B 3H1KE 3I56P 2KSJA 2W90A 2QJPB 4XFJA 4H13C 2JWDA 2BEZF 2HMOA 3VCPA 3L75G 3GTSA 1ZW0A 3M9BA 3AE8C 1CI6B 1P84H 2L91A 1DX7A 2E4PA 2MKVA 1MZ9A 3QH9A 3CC7P 3F5HA 3V2QA 1L0LE 4QDDA 2K1AA 1AQ5A 2JZAA 2R32A 4A7PA 4HM7A 1DIPA 1Q86Q 3RGUA 2C0WA 2C9NY 3TGUG 2ZYGA 1RF0A 1IZNB 1BE3G 4HM1A 1Y8AA 5CCHD 5K5GB 3D70A 5CJ0A 4H44D 1VQ8P 1SQQG 1M7LA 1SP4A 3BRTB 1U7JA 1NTMG 5AW2B 1NU1E 3MUDA 5AVWB 4W7YA 1ZR2A 1KB9I 1K04A 4Y28J 2KUBA 5KLIC 1FZBA 1KQGB 1U7MA 5AW0B 4I1LA 1JUNA 1RH5B 2BMRA 4C46A 1K05A 3H32B 1NTME 1PGPA 3AEEC 1VQ9P 2WT7A 2HMJA 2E76D 1G2CB 1NDOA 1RE3A 2CPSA 2D2CD 3R4YA 3GHGB 2E75C 5AW7B 2YO2A 2FYNB 1G8KB 2HMKA 5B66E 3NMDA 4HYTB 2WPSA 3B8EB 1UUVA 3GF3A 1YBKA 1RF1B 1AVOA 5AEUA 2WQYC 2HR3A 2YMYA 2OYHA 1Q7YQ 1VQ7P 5BOKA 2WPQA 3A0BH 3A0HH 2Y0CA 3O6QB 4BWNA 3IAOA 2Q7CA 1FU1A 3MIWA 2YFIA 4WVZA 1CZQA 1LTGC 3PHLA 2P58A 1H0TA 2ZXEB 1BSHA 3N4XA 2YNYA 2O01H 3CLQA 1AA0A 2NPSD 3HUSB 3CCVP 5KLIB 3HE4B 2PFXA 5H2FH 4NBCD 2QRXA 1H89A 4JYCA 3B5NB 2JP3A 2ZAEB 2IFNA 2K37A 1KILA 2Y0DA 2QE7H 1L0NK 1NTKJ 3AECC 4PD4E 4EIJA 1OX3A 4K3AA 2GBXA 3VMAA 1NYKA 1ZN5A 1M1JC 5AW8B 3C1LA 3L36A 1FOSE 2GUVA 1AQTA 2E76B 2CK3H 3SWFA 3VOPA 2XRXA 3AEAC 2NUMA 1NAYA 3T97B 1QGKB 2ZT9C 4NBFD 2QJPC 1LT1A 2P10A 4Z1MH 1KILD 1KORA 3TYYA 1LP1B 5KLVJ 1DD3A 1FC2C 4QURA 3VN0A 3CCRP 3Q5SA 1SQVJ 1MFZA 2WWWA 1OW7A 4L74A 4U7JA 5TISH 1NTKK 3WMM0 1N2DC 1NO4A 1SQXG 1BSNA 3L70D 3HTKA 1NTZE 1JCDA 4N3YB 1M1KQ 4RKUJ 5KLVG 1BE3J 1JY2N 2WPVB 3H1KJ 2I8DA 2H8PD 3IN6A 2C9LY 2HFED 4L75A 2YFJA 4IFMA 1SQVD 5CXMA 2NWFA 3B5ND 3L74G 1PP9D 1H0TB 3V5BA 1USEA 3G3ZA 4JYBA 3H25A 1KN7A 4D6TJ 2YIUB 2XR8A 1M57D 1LTJC 4PV1C 2NVFA 2JR8A 1LTJA 3H1IG 3BCCD 3EQQA 1KYOD 3L74J 2OARA 3V2PA 1SFCD 2OGUA 3GKEA 1R5SA 1FAVA 4NBGD 2QIWA 1IO4A 3KYQA 4AQRD 1S3JA 1O7HA 3BRVB 1Z56A 1FZGA 1ZP0C 1AV1A 3AE7C 3H32A 1VQ6P 1NU1G 3IR9A 4L76A 4GOFA 1OVVA 1L4AC 4OGQD 3HTKB 3U59A 4KT0J 4GIFA 3F89A 1LJ2A 1O7PA 3P32A 1DH3A 5KAFH 1AFOA 1KQLA 2KXPB 4AAYB 4TLFA 1RHZB 3CI9A 1SQQJ 1PFIA 3TDKA 1KYOE 3USSA 1RQUA 2B87A 5AVVB 2LR2A 2B87B 2QM8A 1X9VA 3GG2A 1BDDA 5L8RJ 3CXHD 2KK7A 1FJKA 4WWIA 3PH0A 3CC4P 3FOUA 3CC2P 1NVOA 4JQ0D 3JCUH 4H44C 1JY3O 4W80A 5CCGA 1NJIQ 4BRYB 2XU6A 1OW8A 3OAKA 1N73C 1OMIA 2QJYB 1M8OB 3GLMA 3D6YA 3FGAD 1HTLC 1FZCA 3TNUA 3CPWO 1YIJP 5AW6B 1QL2A 4LLHA 4QDFB 4QDFA 1G1IA 3P8CE 4P1CH 3DQYA 4NB8D 1S5LE 1SLQA 1LT9B 1VQ4P 2PRRA 3GHGA 2K3RA 4UB8E 3L72E 3MHVA 5KLVE 1A02F 1RE4C 2OYIC 3L73G 1Q90C 3M9HA 1BCCG 4IOIH 3P8MC 4N78E 1WQLA 4PD4H 3RBZA 5AVRB 2IBZD 5KTBA 1KYOI 5AVYB 1N7SD 1WMKA 4HM0A 1T3JA 1SQQD 4H13B 4RESB 1IFDA 1DEEG 1JM0A 3HE5B 2P67A 1SQBG 3A5TA 3MTUE 3B5NC 1YQ4C 1FDIA 4AUWA 4D6TG 3PP5A 4NBBD 5KAIH 1WT6A 3KPEA 2WTYA 1RQVA 5BU5A 2M0BA 4I7ZB 3AEGC 3GW6A 2KYVA 1PP9G 1VPCA 1KQSO 1BCCD 3N7NA 4I2LC 1S9KE 3FXDA 3C0DA 1VF5D 4IFDK 1O7MA 3HE5A 3RK3E 1KILC 3Q3DA 1SQQE 2Z5HA 5APQA 3VTPC 3H1HE 1QVGO 3H1IE 1GL2B 4DOJA 5GTHE 5C39A 3D6ZA 5APUA 1YYCA 1G2CA 1HJBA 3VMXA 3HE4A 4D6TE 1Q82Q 1FZEA 2O1KA 1ZOYC 1KILB 1T2KD 4WBAA 2WITA 1NKZB 1EDJA 2W83C 3EFFK 2B24A 1L0NE 4H13D 3GCEA 3WU2H 1RF1C 4XA4A 2HMMA 1MFTA 1U57A 2BMOA 1QVFO 3L71E 1L0NJ 3RK3D 2BCCJ 1CW5A 1JMBA 3SWYA 3NXSA 1JCCA 3E1IA 1TU3F 3EFGA 4U3FD 1JTHB 5KKZC 3CX5D 2M5AB 5AVSB 4ZNCA 1QEXA 3HD7D 3MUDC 1L0LJ 4H0LD 4EDFA 1NGMB 3PLNA 4ZMDA 4ZKUA 1H8AA 3P7KA 3CCEP 1NTMJ 5CJ4A 3FWLA 3L75D 4JPZB 1URQB 2BCCG 3U1CA 1L0ND 5APVA 3B5NA 1USDA 5KJ7D 1M1JB 5BU8B 1NTZK 3L37A 1K9MQ 1GDTA 1BCCJ 1N7LA 2FFDB 4MN4C 1PGJA 1PL5A 2O1JA 1O7NA 2P7JA 4PD4D 2R3CA 1E5WA 2C0XA 3CCUP 2HPCA 3S9OA 1KQFB 1NTMD 3G4SP 2OTJP 2OTKE 1CI6A 1YHQP 1LTAC 5AW5B 1L2PA 2KSEA 2V4HA 4CPGA 1LTSC 3H6PA 1LNQA 3O6QA 1RE4A 1EQ7A 2XZRA 1VF5C 4WY4C 1GU5A 4R4LA 1KB9D 2E74B 3NTNA 4WY4A 4OH8B 5EFWB 3H1JG 3SWKA 3S4RA 5B66H 3VP8A 3MGNA 2J58A 2P2UA 1LWUB 2E43A 1X0TA 3H1JE 4NB9D 3M91A 1PIXA 4NPEA 1NTKG 2R5BA 4M3LA 1EDLA 2Q6QA 3NFQA 1GTWA 3I5CA 1L0LD 4OVNF 3OW2O 1SFCA 1JMMA 3L75J 1M90Q 1KB9E 2JKVA 2ZYDA 3RK2B 2OYIB 2ZT9D 5APTA 5AVZB 2R44A 1X22A 1NU1D 2O3JA 4IFFA 1ZRTE 3D71A 1FZCC 3CCSP 3Q1MA 3H1LJ 3C8VA 3BCCE 4NPDA 2JEEA 5E79H 2AXTE 2KLUA 1RF1A 2SPZA 3L71G 1SS1A 3EQ2A 4HJGH 3L74E 1T2KC 2FXMA 1J2JB 1WRGA 1HUCA 5KAIE 2W6JH 3CWBE 1Q81Q 3G71P 1KD1Q 1SQBK 2FYZA 2JDIH 2ZVNB 2ZT9B 4QDCA 2LXCB 1KZUB 2WT7B 4GT1A 2RMZA 1URQC 2XDJA 1KFMA 1L0NG 4GDOA 2BMQA 3M0AA 2VRSA 3L71J 1SQBD 1VQ5P 5CCGC 3RK2C 5GTIH 1SQPK 2KZJA 1LTIC 3AE2C 2D2CB 4PJ0E 3WUVA 1FZAA 1W5CE 4WY4D 2YKQA 2BEQD 3H1HJ 2NVEA 1FE6A 3IFMA 1YJ9P 2PP6A 1QLED 4I7ZC 1HGVA 2IFMA 1N73B 4C7RA 3W68A 4HM5A 1RIEA 1YI2P 3V2NA 3RL0B 1GL2C 2P1JA 2FXPA 1Q2NA 1IJDB 3LIEA 1A02J 3CMEP 1PGQA 5APYA 3A0BE 3K5BA 3KXDA 4OGQB 2Q1KA 2ZJSE 1EZVE 2KNCA 2J59M 2NPSA 2Q3EA 2WSCH 5CHXA 1SQPD 2QA4P 1NTKD 5AVUB 3GTEA 2QM7A 2Y9YA 2E75D 3AEBC 2O01N 2D2CC 1R5LA 2XSOA 1YQ3C 2RKLA 1JB0J 3HD7A 2N1TD 2Y0EA 2JJLA 1PV3A 3L70E 5CMZA 1NTZD 3TGUE 4LC1A 3EWKA 5CBNA 1SQVG 1ULJA 1T8ZA 1N7SB 1IFMA 1SQBJ 3AE4C 2H43A 1EZVD 2G3AA 1VDFA 3CWBG 3CXHE 3GZYA 1SQPE 1FJPA 1SFCC 1BGYE 4RJTA 2AXCA 3H1KG 1S72P 2HMLA 1NTZJ 1EG9A 1X79B 2FYNC 4YPCA 3L70G 2HMNA 1BE3D 2KLVA 3FX0A 2QJKB 2FFDC 3U1AA 1UUWA 5AVTB 4PV1D 2A06D 3L73E 2QG4A 5CCHA 2E4QA 2IZ0A 2E74C 1NOHA 2DW3A 2M3BA 3HD7C 4XE5B 1NWQA 1FS0E 1X8YA 3CX5I 4QUQA 1Y9BA 4NBDD 1VM9A 1JM1A 3G6EP 2J5UA 3WU2E 3HRNA 4HB1A 1BGYD 1H88A 2Q3IA 1GW4A 1JY3P 1VF5B 5KLVD 2K9YA 1LGHB 1FDMA 1SQVK 2QSIA 1GL2D 4N78D 5AW3B 1HWTC 2Q9IA 2IBZE 5KLVK 1NTZG 1G1JA 3CD6P 3RL0D 1HBWA 3L70J 3S1KA 1URQA 5CCHC 2WSSH 1OVRA 3MP7B 2AEFA 4GKGA 3KZIE 2Q3WA 3AE9C 4UB6H
chains in the Genus database with same CATH topology
5HL4A 1UUVA 4QDFA 3CXHE 3GZYA 1SQPE 1SQQE 2DE7D 3H1HE 2ZYLA 1KB9E 4P1CH 3H1IE 4QURA 1BGYE 4QUPA 3DQYA 1PP9E 4NB8D 2ZT9D 5AEUA 1O7WA 2B1XA 1SJGA 2HMLA 1O7NA 5BOKA 1EG9A 4HM5A 4D6TE 4OGQD 3L72E 1RIEA 5KLVE 1ZRTE 2FYNC 3H1KE 1G8JB 1Q90C 2HMNA 3GL0A 4U3FE 1NTZE 1O7PA 3CX5E 2HMOA 2YIUC 1UUWA 1WQLA 2YFIA 3GTSA 4HM4A 3VCPA 4AIVA 4PV1D 1SQBE 3L73E 3BCCE 2E4PA 3VMHD 4AAYB 2E4QA 3H1LE 4HM3A 3EN1A 1VCKA 4QCKA 2FYUE 2B24A 1KYOE 1L0LE 1BCCE 1L0NE 1EZVE 3D89A 3GCEA 4H13D 4QDDA 2E74D 3GB4A 3L74E 2CKFA 2JZAA 2QJKC 2YFJA 4HM0A 3L75E 2QJYC 2HMMA 4HM7A 2YVJB 4NBCD 2GBWA 4P1BH 4HM2A 3CWBE 4QUQA 5CXMA 2BMOA 1SQXE 2NWFA 4NBDD 2XSHA 4HM1A 1VM9A 3GTEA 3L71E 4H44D 3GZXA 1JM1A 2E75D 4QDCA 2I7FA 1ULIA 3VMGD 2JO6A 2NVGA 4NBHD 2XR8A 3GL2A 1NU1E 4PD4E 3FOUA 4HKVA 2QPZA 2XSOA 2NUKA 1P84E 4EMJB 2DE5D 2GBXA 2NVFA 1BE3E 1FQTA 2BMQA 3AZCA 5KKZC 1NYKA 5KLIC 1RFSA 4NBED 5AEWA 3H1JE 4HJLA 4NB9D 2DE6D 2BMRA 2IBZE 3EQQA 3L70E 3GOBA 4NBBD 3VMID 1NTME 1PPJE 3TGUE 4H0LD 2HMJA 2E76D 1ULJA 1NDOA 1O7MA 2A06E 4HM6A 1O7GA 2XRXA 2D2CD 2NUMA 4HM8A 3GKEA 1SQVE 3VCAA 4NBFD 1NTKE 2QJPC 4NBAD 4NBGD 1G8KB 2NVEA 2HMKA 2YFLA 4QDFB 3C0DA 2BCCE 2Q3WA 1VF5D 1O7HA 3N0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HL4 A;  1UUV A;  4QDF A;  3CXH E;  3GZY A;  1SQP E;  1SQQ E;  2DE7 D;  3H1H E;  2ZYL A;  1KB9 E;  4P1C H;  3H1I E;  4QUR A;  1BGY E;  4QUP A;  3DQY A;  1PP9 E;  4NB8 D;  2ZT9 D;  5AEU A;  1O7W A;  2B1X A;  1SJG A;  2HML A;  1O7N A;  5BOK A;  1EG9 A;  4HM5 A;  4D6T E;  4OGQ D;  3L72 E;  1RIE A;  5KLV E;  1ZRT E;  2FYN C;  3H1K E;  1G8J B;  1Q90 C;  2HMN A;  3GL0 A;  4U3F E;  1NTZ E;  1O7P A;  3CX5 E;  2HMO A;  2YIU C;  1UUW A;  1WQL A;  2YFI A;  3GTS A;  4HM4 A;  3VCP A;  4AIV A;  4PV1 D;  1SQB E;  3L73 E;  3BCC E;  2E4P A;  3VMH D;  4AAY B;  2E4Q A;  3H1L E;  4HM3 A;  3EN1 A;  1VCK A;  4QCK A;  2FYU E;  2B24 A;  1KYO E;  1L0L E;  1BCC E;  1L0N E;  1EZV E;  3D89 A;  3GCE A;  4H13 D;  4QDD A;  2E74 D;  3GB4 A;  3L74 E;  2CKF A;  2JZA A;  2QJK C;  2YFJ A;  4HM0 A;  3L75 E;  2QJY C;  2HMM A;  4HM7 A;  2YVJ B;  4NBC D;  2GBW A;  4P1B H;  4HM2 A;  3CWB E;  4QUQ A;  5CXM A;  2BMO A;  1SQX E;  2NWF A;  4NBD D;  2XSH A;  4HM1 A;  1VM9 A;  3GTE A;  3L71 E;  4H44 D;  3GZX A;  1JM1 A;  2E75 D;  4QDC A;  2I7F A;  1ULI A;  3VMG D;  2JO6 A;  2NVG A;  4NBH D;  2XR8 A;  3GL2 A;  1NU1 E;  4PD4 E;  3FOU A;  4HKV A;  2QPZ A;  2XSO A;  2NUK A;  1P84 E;  4EMJ B;  2DE5 D;  2GBX A;  2NVF A;  1BE3 E;  1FQT A;  2BMQ A;  3AZC A;  5KKZ C;  1NYK A;  5KLI C;  1RFS A;  4NBE D;  5AEW A;  3H1J E;  4HJL A;  4NB9 D;  2DE6 D;  2BMR A;  2IBZ E;  3EQQ A;  3L70 E;  3GOB A;  4NBB D;  3VMI D;  1NTM E;  1PPJ E;  3TGU E;  4H0L D;  2HMJ A;  2E76 D;  1ULJ A;  1NDO A;  1O7M A;  2A06 E;  4HM6 A;  1O7G A;  2XRX A;  2D2C D;  2NUM A;  4HM8 A;  3GKE A;  1SQV E;  3VCA A;  4NBF D;  1NTK E;  2QJP C;  4NBA D;  4NBG D;  1G8K B;  2NVE A;  2HMK A;  2YFL A;  4QDF B;  3C0D A;  2BCC E;  2Q3W A;  1VF5 D;  1O7H A;  3N0Q A; 
#chains in the Genus database with same CATH topology
 3Q2Y A;  3A0H E;  4WB4 A;  2DE7 D;  2W8Z A;  3H1L G;  1P84 I;  3VMY A;  2YO3 A;  1OWA A;  2L5G B;  3CMA P;  2B9B A;  2KP8 A;  2M3E A;  1PP9 J;  2KI7 B;  2HPC B;  2KS1 A;  2KOG A;  2BAS A;  2N1T C;  1IFJ A;  4AIV A;  2OYI A;  5AVX B;  3VMH D;  1VQL P;  3G9R A;  2OTL P;  4QCK A;  2HYN A;  1BCC E;  3GF7 A;  2YVJ B;  2Q5U A;  4H0L C;  4QMA A;  1JY3 N;  2HLO A;  3VMZ A;  1MV8 A;  2FFD A;  5BVZ A;  1KV4 A;  3HUS A;  2IYO A;  1VQN P;  2NUK A;  3RBX A;  2DE5 D;  2E42 A;  3HUS C;  3TF5 A;  1BGY J;  1JOC A;  5TJH A;  2POH A;  3CCQ P;  3H1K D;  2V7Q H;  3LW5 J;  2A06 G;  1OIP A;  2A45 G;  1ZXG A;  1L4A D;  2RN0 A;  2N1T A;  3JCU E;  4WY4 B;  4PV1 B;  1O7G A;  1T6A A;  1NYH A;  2FYU G;  2M5A A;  3VCA A;  2HOD A;  3SFD C;  4GOD A;  2XND H;  3V4Q A;  2LKM A;  5TIS E;  4DCK A;  3N0Q A;  4YXW H;  4QUP A;  5DJT B;  1N7S C;  4BXL A;  3FXE A;  2I1J A;  3C9I A;  1VQM P;  1D7M A;  2E5Y A;  5CBO A;  3L4F A;  3A3Y B;  1IK7 A;  1PZQ A;  4RO0 A;  5AW1 B;  1SFC B;  1MUU A;  3JSV C;  1KMI Z;  2NZ2 A;  2IDB A;  5B5E E;  4HM3 A;  3EN1 A;  1NH4 A;  3WUU A;  1AVY A;  2FBW C;  1GU4 A;  2GBW A;  4JF7 A;  1LTJ B;  4OGQ C;  1AJY A;  2WPR A;  1OVU A;  2A45 H;  2ZVO B;  4W7Z A;  3M9Q A;  4HKV A;  4IL6 H;  2I1K A;  1QL1 A;  1FQT A;  1ZR4 A;  1NKN A;  4D6T D;  3L72 G;  1ZRT D;  4HJL A;  2H89 C;  2DE6 D;  3VMI D;  2RH0 A;  1SQQ K;  4KHX A;  3B4S A;  1JO5 A;  1GK4 A;  2FKW B;  3TNU B;  3VP9 A;  3BCC J;  4ASV A;  3O8Z A;  1HF9 A;  4U3F G;  3VYI A;  5GTI E;  3L74 D;  1IFI A;  2KNC B;  3AE1 C;  1YIT P;  2N1T B;  2JO1 A;  1NHL A;  4PJ0 H;  2R3S A;  3R2P A;  4PD4 I;  1YTZ T;  1JY2 P;  1K8A Q;  1O7W A;  1N8R Q;  3H1J D;  3AEF C;  1G8J B;  3BCC G;  3TGU J;  1KYO H;  3KHU A;  4U3F E;  3CX5 E;  4DT0 A;  4IL6 X;  3HD7 B;  4DJG A;  1RE3 C;  1JNM A;  3RL0 g;  1JY2 O;  1J1D C;  2E74 D;  2HG5 D;  2YXR B;  2Z5I A;  2QJK C;  3L75 E;  1GW3 A;  3UIA A;  3RK2 D;  2BCC D;  2CPB A;  3CL3 D;  4EOT A;  1YTZ I;  2G8Y A;  2XSH A;  2QVA A;  1L0L G;  2ZXX A;  4U3F J;  2IZ1 A;  3M0D A;  1LTB C;  2K9J A;  2I7F A;  1SQP G;  1HH0 A;  5AW9 B;  3VMG D;  2NVG A;  4C7N A;  3V4W A;  2HOD B;  1LTT C;  1YJN P;  4BRY A;  4EMJ B;  3IF4 A;  2WMM A;  1KB9 H;  4NBE D;  3I55 P;  1OFC X;  5KJ7 C;  1NAF A;  2K88 A;  4YTP C;  5AW4 B;  2Z4E A;  1EZV G;  4HM6 A;  1XTC C;  2WZ7 A;  3RL0 C;  2M8R A;  2XNX A;  3CWB D;  3OJA B;  1R8E A;  2PGD A;  3KQG A;  2BCC E;  1NTM K;  2K9J B;  1GD2 E;  4B86 A;  4GOE A;  1PP9 E;  1BDC A;  1IFP A;  2OYH B;  1P84 D;  3CCJ P;  2MJZ A;  3TSI A;  1DEB A;  2NRG A;  2GA1 A;  3CXH H;  3H1H G;  3RK3 B;  1LP1 A;  1GMJ A;  3BAS A;  3M0D C;  4O9B A;  3V6I A;  2YIU C;  5H2F E;  3CWB J;  1EZV I;  3H1J J;  1SVF A;  3TGU D;  4TT3 H;  2AEM A;  2KS1 B;  2FXO A;  3B71 A;  4C7N B;  3GB4 A;  3L35 A;  2KZI A;  4JBZ A;  4L73 A;  1KIL E;  2WSE H;  3L73 J;  2ITA A;  3MZW B;  3P8C D;  1S1C X;  1GZL A;  2NPS B;  1XTG B;  1K73 Q;  1QX8 A;  1FZF A;  2YMK A;  4OWF A;  3Q5P A;  1PPJ G;  1PGO A;  1EDI A;  1P84 E;  2QEX P;  1J1E C;  1L4A A;  3II6 A;  2KIK A;  2OQQ A;  1IK9 A;  2AEJ A;  2NPS C;  1EXI A;  2WVR A;  3JC2 2;  1KC8 Q;  3PTZ A;  3E7K A;  1PPJ E;  1S4X A;  2OYH C;  1VQK P;  3AE6 C;  2GM4 A;  2YKP A;  2W6B A;  2A06 E;  3L73 D;  2W27 A;  3T97 A;  3PRJ A;  3W67 A;  4HM8 A;  1SQV E;  1SQX J;  2XKM A;  3RK3 C;  1NTK E;  2IBZ I;  3A7O A;  1L0L K;  2YFL A;  1RF0 C;  3BAT A;  1UIX A;  1RY3 A;  4Y99 C;  3GHG C;  4NPF X;  4K35 A;  1OXZ A;  2IBZ G;  2H7H A;  1GK6 A;  4KJM A;  1EXJ A;  3MD0 A;  1J1D B;  1JTH A;  3KZI H;  3PJS K;  1VQO P;  1ZME C;  1EDK A;  1S2E A;  4ZKP A;  2XV5 A;  1NU1 K;  2KB7 P;  4Y99 B;  1MKM A;  1LWU A;  1JEK A;  1SQB E;  4IL6 E;  1UII A;  2YKO A;  1FZC B;  1PPJ D;  2WSF J;  2ZFC A;  3H1L E;  5APW A;  1KTM A;  4H44 B;  1VCK A;  3D89 A;  1S5L H;  2H88 C;  2V7Q J;  3LW5 H;  2CKF A;  1OW6 A;  4P1B H;  2N9B A;  2YXQ B;  2AXT H;  3FWN A;  1SQX E;  4UB8 H;  1N73 A;  1FDO A;  4DZO A;  4N6J A;  2JWA A;  1ULI A;  2O01 J;  3GL2 A;  3SSU A;  4AYC A;  2E76 C;  3V2R A;  3A2A A;  1BE3 E;  3CXH I;  2PAJ A;  2IPP A;  2LXB A;  2ZYA A;  1GL2 A;  3GOB A;  2A45 I;  1NU1 J;  1DD4 A;  2FYU D;  5M1B A;  1LT9 A;  3AE3 C;  3KDP B;  1IC2 A;  3H1L D;  3CX5 H;  1LWU C;  5KJ7 A;  1W2E A;  5KKZ B;  3M06 A;  2ZYL A;  1S5L X;  1SQX D;  3AED C;  1T3U A;  1SQX K;  4ASW A;  5KAF E;  3GMA A;  2N9Y B;  4YXD C;  1W2B O;  1SJG A;  1N7S A;  1FOS F;  1VL2 A;  1IFN A;  4LGD E;  2FYU J;  1ZV8 A;  3OA7 A;  2WSC J;  3GL0 A;  3SFE C;  5APS A;  1EC5 A;  3ABV C;  2UWJ E;  4HM4 A;  3LID A;  3BVH A;  4I6M C;  1SQP J;  2FYU E;  2B89 A;  3CCM P;  3WUT A;  1LT9 C;  1VQP P;  5GTH H;  2QJY C;  1HJ0 A;  2FY8 A;  4HM2 A;  1Y47 A;  3ITK A;  1HVV A;  3E1R A;  5B5E H;  2B88 A;  4R4M A;  1S9K D;  1KFN A;  4HH2 A;  3GZX A;  1Q90 D;  1CSB A;  3H1H D;  2JO6 A;  3H1I D;  4NBH D;  2W6A A;  3L72 D;  2QPZ A;  2R5D A;  4UB6 E;  1M56 D;  2Y9Z A;  5APX A;  4EI2 A;  3CCL P;  3AZC A;  1HGZ A;  1RFS A;  5AEW A;  3Q5R A;  1OZH A;  2IX7 C;  2GUS A;  3QWO C;  1E79 H;  2IYP A;  4HKZ H;  1YJW P;  1N86 A;  1J1E B;  2E5T A;  4NBA D;  1FBM A;  1M1J A;  1BGY G;  1ZLL A;  2FYU K;  3H1I J;  1L4A B;  1URQ D;  3TK1 A;  2OYO A;  3L72 J;  5HL4 A;  2WSE J;  5DJU B;  5AVQ B;  4H0L B;  3L71 D;  3AE5 C;  3ZDM A;  2B1X A;  2WSF H;  4EYY Q;  5CCG D;  5E79 E;  2E75 B;  3H1K E;  3I56 P;  2KSJ A;  2W90 A;  2QJP B;  4XFJ A;  4H13 C;  2JWD A;  2BEZ F;  2HMO A;  3VCP A;  3L75 G;  3GTS A;  1ZW0 A;  3M9B A;  3AE8 C;  1CI6 B;  1P84 H;  2L91 A;  1DX7 A;  2E4P A;  2MKV A;  1MZ9 A;  3QH9 A;  3CC7 P;  3F5H A;  3V2Q A;  1L0L E;  4QDD A;  2K1A A;  1AQ5 A;  2JZA A;  2R32 A;  4A7P A;  4HM7 A;  1DIP A;  1Q86 Q;  3RGU A;  2C0W A;  2C9N Y;  3TGU G;  2ZYG A;  1RF0 A;  1IZN B;  1BE3 G;  4HM1 A;  1Y8A A;  5CCH D;  5K5G B;  3D70 A;  5CJ0 A;  4H44 D;  1VQ8 P;  1SQQ G;  1M7L A;  1SP4 A;  3BRT B;  1U7J A;  1NTM G;  5AW2 B;  1NU1 E;  3MUD A;  5AVW B;  4W7Y A;  1ZR2 A;  1KB9 I;  1K04 A;  4Y28 J;  2KUB A;  5KLI C;  1FZB A;  1KQG B;  1U7M A;  5AW0 B;  4I1L A;  1JUN A;  1RH5 B;  2BMR A;  4C46 A;  1K05 A;  3H32 B;  1NTM E;  1PGP A;  3AEE C;  1VQ9 P;  2WT7 A;  2HMJ A;  2E76 D;  1G2C B;  1NDO A;  1RE3 A;  2CPS A;  2D2C D;  3R4Y A;  3GHG B;  2E75 C;  5AW7 B;  2YO2 A;  2FYN B;  1G8K B;  2HMK A;  5B66 E;  3NMD A;  4HYT B;  2WPS A;  3B8E B;  1UUV A;  3GF3 A;  1YBK A;  1RF1 B;  1AVO A;  5AEU A;  2WQY C;  2HR3 A;  2YMY A;  2OYH A;  1Q7Y Q;  1VQ7 P;  5BOK A;  2WPQ A;  3A0B H;  3A0H H;  2Y0C A;  3O6Q B;  4BWN A;  3IAO A;  2Q7C A;  1FU1 A;  3MIW A;  2YFI A;  4WVZ A;  1CZQ A;  1LTG C;  3PHL A;  2P58 A;  1H0T A;  2ZXE B;  1BSH A;  3N4X A;  2YNY A;  2O01 H;  3CLQ A;  1AA0 A;  2NPS D;  3HUS B;  3CCV P;  5KLI B;  3HE4 B;  2PFX A;  5H2F H;  4NBC D;  2QRX A;  1H89 A;  4JYC A;  3B5N B;  2JP3 A;  2ZAE B;  2IFN A;  2K37 A;  1KIL A;  2Y0D A;  2QE7 H;  1L0N K;  1NTK J;  3AEC C;  4PD4 E;  4EIJ A;  1OX3 A;  4K3A A;  2GBX A;  3VMA A;  1NYK A;  1ZN5 A;  1M1J C;  5AW8 B;  3C1L A;  3L36 A;  1FOS E;  2GUV A;  1AQT A;  2E76 B;  2CK3 H;  3SWF A;  3VOP A;  2XRX A;  3AEA C;  2NUM A;  1NAY A;  3T97 B;  1QGK B;  2ZT9 C;  4NBF D;  2QJP C;  1LT1 A;  2P10 A;  4Z1M H;  1KIL D;  1KOR A;  3TYY A;  1LP1 B;  5KLV J;  1DD3 A;  1FC2 C;  4QUR A;  3VN0 A;  3CCR P;  3Q5S A;  1SQV J;  1MFZ A;  2WWW A;  1OW7 A;  4L74 A;  4U7J A;  5TIS H;  1NTK K;  3WMM 0;  1N2D C;  1NO4 A;  1SQX G;  1BSN A;  3L70 D;  3HTK A;  1NTZ E;  1JCD A;  4N3Y B;  1M1K Q;  4RKU J;  5KLV G;  1BE3 J;  1JY2 N;  2WPV B;  3H1K J;  2I8D A;  2H8P D;  3IN6 A;  2C9L Y;  2HFE D;  4L75 A;  2YFJ A;  4IFM A;  1SQV D;  5CXM A;  2NWF A;  3B5N D;  3L74 G;  1PP9 D;  1H0T B;  3V5B A;  1USE A;  3G3Z A;  4JYB A;  3H25 A;  1KN7 A;  4D6T J;  2YIU B;  2XR8 A;  1M57 D;  1LTJ C;  4PV1 C;  2NVF A;  2JR8 A;  1LTJ A;  3H1I G;  3BCC D;  3EQQ A;  1KYO D;  3L74 J;  2OAR A;  3V2P A;  1SFC D;  2OGU A;  3GKE A;  1R5S A;  1FAV A;  4NBG D;  2QIW A;  1IO4 A;  3KYQ A;  4AQR D;  1S3J A;  1O7H A;  3BRV B;  1Z56 A;  1FZG A;  1ZP0 C;  1AV1 A;  3AE7 C;  3H32 A;  1VQ6 P;  1NU1 G;  3IR9 A;  4L76 A;  4GOF A;  1OVV A;  1L4A C;  4OGQ D;  3HTK B;  3U59 A;  4KT0 J;  4GIF A;  3F89 A;  1LJ2 A;  1O7P A;  3P32 A;  1DH3 A;  5KAF H;  1AFO A;  1KQL A;  2KXP B;  4AAY B;  4TLF A;  1RHZ B;  3CI9 A;  1SQQ J;  1PFI A;  3TDK A;  1KYO E;  3USS A;  1RQU A;  2B87 A;  5AVV B;  2LR2 A;  2B87 B;  2QM8 A;  1X9V A;  3GG2 A;  1BDD A;  5L8R J;  3CXH D;  2KK7 A;  1FJK A;  4WWI A;  3PH0 A;  3CC4 P;  3FOU A;  3CC2 P;  1NVO A;  4JQ0 D;  3JCU H;  4H44 C;  1JY3 O;  4W80 A;  5CCG A;  1NJI Q;  4BRY B;  2XU6 A;  1OW8 A;  3OAK A;  1N73 C;  1OMI A;  2QJY B;  1M8O B;  3GLM A;  3D6Y A;  3FGA D;  1HTL C;  1FZC A;  3TNU A;  3CPW O;  1YIJ P;  5AW6 B;  1QL2 A;  4LLH A;  4QDF B;  4QDF A;  1G1I A;  3P8C E;  4P1C H;  3DQY A;  4NB8 D;  1S5L E;  1SLQ A;  1LT9 B;  1VQ4 P;  2PRR A;  3GHG A;  2K3R A;  4UB8 E;  3L72 E;  3MHV A;  5KLV E;  1A02 F;  1RE4 C;  2OYI C;  3L73 G;  1Q90 C;  3M9H A;  1BCC G;  4IOI H;  3P8M C;  4N78 E;  1WQL A;  4PD4 H;  3RBZ A;  5AVR B;  2IBZ D;  5KTB A;  1KYO I;  5AVY B;  1N7S D;  1WMK A;  4HM0 A;  1T3J A;  1SQQ D;  4H13 B;  4RES B;  1IFD A;  1DEE G;  1JM0 A;  3HE5 B;  2P67 A;  1SQB G;  3A5T A;  3MTU E;  3B5N C;  1YQ4 C;  1FDI A;  4AUW A;  4D6T G;  3PP5 A;  4NBB D;  5KAI H;  1WT6 A;  3KPE A;  2WTY A;  1RQV A;  5BU5 A;  2M0B A;  4I7Z B;  3AEG C;  3GW6 A;  2KYV A;  1PP9 G;  1VPC A;  1KQS O;  1BCC D;  3N7N A;  4I2L C;  1S9K E;  3FXD A;  3C0D A;  1VF5 D;  4IFD K;  1O7M A;  3HE5 A;  3RK3 E;  1KIL C;  3Q3D A;  1SQQ E;  2Z5H A;  5APQ A;  3VTP C;  3H1H E;  1QVG O;  3H1I E;  1GL2 B;  4DOJ A;  5GTH E;  5C39 A;  3D6Z A;  5APU A;  1YYC A;  1G2C A;  1HJB A;  3VMX A;  3HE4 A;  4D6T E;  1Q82 Q;  1FZE A;  2O1K A;  1ZOY C;  1KIL B;  1T2K D;  4WBA A;  2WIT A;  1NKZ B;  1EDJ A;  2W83 C;  3EFF K;  2B24 A;  1L0N E;  4H13 D;  3GCE A;  3WU2 H;  1RF1 C;  4XA4 A;  2HMM A;  1MFT A;  1U57 A;  2BMO A;  1QVF O;  3L71 E;  1L0N J;  3RK3 D;  2BCC J;  1CW5 A;  1JMB A;  3SWY A;  3NXS A;  1JCC A;  3E1I A;  1TU3 F;  3EFG A;  4U3F D;  1JTH B;  5KKZ C;  3CX5 D;  2M5A B;  5AVS B;  4ZNC A;  1QEX A;  3HD7 D;  3MUD C;  1L0L J;  4H0L D;  4EDF A;  1NGM B;  3PLN A;  4ZMD A;  4ZKU A;  1H8A A;  3P7K A;  3CCE P;  1NTM J;  5CJ4 A;  3FWL A;  3L75 D;  4JPZ B;  1URQ B;  2BCC G;  3U1C A;  1L0N D;  5APV A;  3B5N A;  1USD A;  5KJ7 D;  1M1J B;  5BU8 B;  1NTZ K;  3L37 A;  1K9M Q;  1GDT A;  1BCC J;  1N7L A;  2FFD B;  4MN4 C;  1PGJ A;  1PL5 A;  2O1J A;  1O7N A;  2P7J A;  4PD4 D;  2R3C A;  1E5W A;  2C0X A;  3CCU P;  2HPC A;  3S9O A;  1KQF B;  1NTM D;  3G4S P;  2OTJ P;  2OTK E;  1CI6 A;  1YHQ P;  1LTA C;  5AW5 B;  1L2P A;  2KSE A;  2V4H A;  4CPG A;  1LTS C;  3H6P A;  1LNQ A;  3O6Q A;  1RE4 A;  1EQ7 A;  2XZR A;  1VF5 C;  4WY4 C;  1GU5 A;  4R4L A;  1KB9 D;  2E74 B;  3NTN A;  4WY4 A;  4OH8 B;  5EFW B;  3H1J G;  3SWK A;  3S4R A;  5B66 H;  3VP8 A;  3MGN A;  2J58 A;  2P2U A;  1LWU B;  2E43 A;  1X0T A;  3H1J E;  4NB9 D;  3M91 A;  1PIX A;  4NPE A;  1NTK G;  2R5B A;  4M3L A;  1EDL A;  2Q6Q A;  3NFQ A;  1GTW A;  3I5C A;  1L0L D;  4OVN F;  3OW2 O;  1SFC A;  1JMM A;  3L75 J;  1M90 Q;  1KB9 E;  2JKV A;  2ZYD A;  3RK2 B;  2OYI B;  2ZT9 D;  5APT A;  5AVZ B;  2R44 A;  1X22 A;  1NU1 D;  2O3J A;  4IFF A;  1ZRT E;  3D71 A;  1FZC C;  3CCS P;  3Q1M A;  3H1L J;  3C8V A;  3BCC E;  4NPD A;  2JEE A;  5E79 H;  2AXT E;  2KLU A;  1RF1 A;  2SPZ A;  3L71 G;  1SS1 A;  3EQ2 A;  4HJG H;  3L74 E;  1T2K C;  2FXM A;  1J2J B;  1WRG A;  1HUC A;  5KAI E;  2W6J H;  3CWB E;  1Q81 Q;  3G71 P;  1KD1 Q;  1SQB K;  2FYZ A;  2JDI H;  2ZVN B;  2ZT9 B;  4QDC A;  2LXC B;  1KZU B;  2WT7 B;  4GT1 A;  2RMZ A;  1URQ C;  2XDJ A;  1KFM A;  1L0N G;  4GDO A;  2BMQ A;  3M0A A;  2VRS A;  3L71 J;  1SQB D;  1VQ5 P;  5CCG C;  3RK2 C;  5GTI H;  1SQP K;  2KZJ A;  1LTI C;  3AE2 C;  2D2C B;  4PJ0 E;  3WUV A;  1FZA A;  1W5C E;  4WY4 D;  2YKQ A;  2BEQ D;  3H1H J;  2NVE A;  1FE6 A;  3IFM A;  1YJ9 P;  2PP6 A;  1QLE D;  4I7Z C;  1HGV A;  2IFM A;  1N73 B;  4C7R A;  3W68 A;  4HM5 A;  1RIE A;  1YI2 P;  3V2N A;  3RL0 B;  1GL2 C;  2P1J A;  2FXP A;  1Q2N A;  1IJD B;  3LIE A;  1A02 J;  3CME P;  1PGQ A;  5APY A;  3A0B E;  3K5B A;  3KXD A;  4OGQ B;  2Q1K A;  2ZJS E;  1EZV E;  2KNC A;  2J59 M;  2NPS A;  2Q3E A;  2WSC H;  5CHX A;  1SQP D;  2QA4 P;  1NTK D;  5AVU B;  3GTE A;  2QM7 A;  2Y9Y A;  2E75 D;  3AEB C;  2O01 N;  2D2C C;  1R5L A;  2XSO A;  1YQ3 C;  2RKL A;  1JB0 J;  3HD7 A;  2N1T D;  2Y0E A;  2JJL A;  1PV3 A;  3L70 E;  5CMZ A;  1NTZ D;  3TGU E;  4LC1 A;  3EWK A;  5CBN A;  1SQV G;  1ULJ A;  1T8Z A;  1N7S B;  1IFM A;  1SQB J;  3AE4 C;  2H43 A;  1EZV D;  2G3A A;  1VDF A;  3CWB G;  3CXH E;  3GZY A;  1SQP E;  1FJP A;  1SFC C;  1BGY E;  4RJT A;  2AXC A;  3H1K G;  1S72 P;  2HML A;  1NTZ J;  1EG9 A;  1X79 B;  2FYN C;  4YPC A;  3L70 G;  2HMN A;  1BE3 D;  2KLV A;  3FX0 A;  2QJK B;  2FFD C;  3U1A A;  1UUW A;  5AVT B;  4PV1 D;  2A06 D;  3L73 E;  2QG4 A;  5CCH A;  2E4Q A;  2IZ0 A;  2E74 C;  1NOH A;  2DW3 A;  2M3B A;  3HD7 C;  4XE5 B;  1NWQ A;  1FS0 E;  1X8Y A;  3CX5 I;  4QUQ A;  1Y9B A;  4NBD D;  1VM9 A;  1JM1 A;  3G6E P;  2J5U A;  3WU2 E;  3HRN A;  4HB1 A;  1BGY D;  1H88 A;  2Q3I A;  1GW4 A;  1JY3 P;  1VF5 B;  5KLV D;  2K9Y A;  1LGH B;  1FDM A;  1SQV K;  2QSI A;  1GL2 D;  4N78 D;  5AW3 B;  1HWT C;  2Q9I A;  2IBZ E;  5KLV K;  1NTZ G;  1G1J A;  3CD6 P;  3RL0 D;  1HBW A;  3L70 J;  3S1K A;  1URQ A;  5CCH C;  2WSS H;  1OVR A;  3MP7 B;  2AEF A;  4GKG A;  3KZI E;  2Q3W A;  3AE9 C;  4UB6 H; 
#chains in the Genus database with same CATH homology
 5HL4 A;  1UUV A;  4QDF A;  3CXH E;  3GZY A;  1SQP E;  1SQQ E;  2DE7 D;  3H1H E;  2ZYL A;  1KB9 E;  4P1C H;  3H1I E;  4QUR A;  1BGY E;  4QUP A;  3DQY A;  1PP9 E;  4NB8 D;  2ZT9 D;  5AEU A;  1O7W A;  2B1X A;  1SJG A;  2HML A;  1O7N A;  5BOK A;  1EG9 A;  4HM5 A;  4D6T E;  4OGQ D;  3L72 E;  1RIE A;  5KLV E;  1ZRT E;  2FYN C;  3H1K E;  1G8J B;  1Q90 C;  2HMN A;  3GL0 A;  4U3F E;  1NTZ E;  1O7P A;  3CX5 E;  2HMO A;  2YIU C;  1UUW A;  1WQL A;  2YFI A;  3GTS A;  4HM4 A;  3VCP A;  4AIV A;  4PV1 D;  1SQB E;  3L73 E;  3BCC E;  2E4P A;  3VMH D;  4AAY B;  2E4Q A;  3H1L E;  4HM3 A;  3EN1 A;  1VCK A;  4QCK A;  2FYU E;  2B24 A;  1KYO E;  1L0L E;  1BCC E;  1L0N E;  1EZV E;  3D89 A;  3GCE A;  4H13 D;  4QDD A;  2E74 D;  3GB4 A;  3L74 E;  2CKF A;  2JZA A;  2QJK C;  2YFJ A;  4HM0 A;  3L75 E;  2QJY C;  2HMM A;  4HM7 A;  2YVJ B;  4NBC D;  2GBW A;  4P1B H;  4HM2 A;  3CWB E;  4QUQ A;  5CXM A;  2BMO A;  1SQX E;  2NWF A;  4NBD D;  2XSH A;  4HM1 A;  1VM9 A;  3GTE A;  3L71 E;  4H44 D;  3GZX A;  1JM1 A;  2E75 D;  4QDC A;  2I7F A;  1ULI A;  3VMG D;  2JO6 A;  2NVG A;  4NBH D;  2XR8 A;  3GL2 A;  1NU1 E;  4PD4 E;  3FOU A;  4HKV A;  2QPZ A;  2XSO A;  2NUK A;  1P84 E;  4EMJ B;  2DE5 D;  2GBX A;  2NVF A;  1BE3 E;  1FQT A;  2BMQ A;  3AZC A;  5KKZ C;  1NYK A;  5KLI C;  1RFS A;  4NBE D;  5AEW A;  3H1J E;  4HJL A;  4NB9 D;  2DE6 D;  2BMR A;  2IBZ E;  3EQQ A;  3L70 E;  3GOB A;  4NBB D;  3VMI D;  1NTM E;  1PPJ E;  3TGU E;  4H0L D;  2HMJ A;  2E76 D;  1ULJ A;  1NDO A;  1O7M A;  2A06 E;  4HM6 A;  1O7G A;  2XRX A;  2D2C D;  2NUM A;  4HM8 A;  3GKE A;  1SQV E;  3VCA A;  4NBF D;  1NTK E;  2QJP C;  4NBA D;  4NBG D;  1G8K B;  2NVE A;  2HMK A;  2YFL A;  4QDF B;  3C0D A;  2BCC E;  2Q3W A;  1VF5 D;  1O7H A;  3N0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...