3BCCE

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPNFSDYRRPPDDYSTKSSRESDPSRKGFSYLVTAVTTLGVAYAAKNVVTQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 41
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3bccE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3bccE02
2NVGA 1BCCE 3N0QA 4NBGD 4OGQD 4QDFA 2HMLA 3H1IE 3L70E 1BE3E 2QJPC 5CXMA 3VCPA 4U3FE 4HM5A 4HM2A 4PV1D 2YFLA 4EMJB 4AAYB 1ZRTE 3H1JE 3CWBE 4HM4A 4QUPA 3GZYA 4HM6A 3H1KE 3GTEA 1SJGA 1UUVA 4QDDA 2E4QA 3L72E 2E4PA 3D89A 3GL2A 1SQXE 1BGYE 4QUQA 3BCCE 3GTSA 1L0NE 3H1HE 2FYUE 4H44D 1G8KB 4NBAD 1O7NA 4HKVA 1NTME 1WQLA 2E74D 4H13D 2ZYLA 4HM7A 3VMHD 3L73E 1ULJA 4QDFB 2BMRA 1P84E 3GCEA 2HMNA 2YFJA 3GKEA 2IBZE 4HJLA 1O7WA 2CKFA 1SQBE 3DQYA 3CX5E 3H1LE 1O7GA 2QJYC 1EZVE 3EQQA 2YIUC 2NWFA 3VMID 2YFIA 1G8JB 3GOBA 2GBXA 4D6TE 4NBBD 3C0DA 1SQVE 1EG9A 4P1BH 1PPJE 2XR8A 4H0LD 2GBWA 1UUWA 1RIEA 1NTKE 3FOUA 2FYNC 4NBED 1VM9A 2HMKA 4NBCD 2BCCE 1Q90C 3L71E 4NBHD 1RFSA 4QCKA 2QPZA 3VCAA 1O7MA 4QDCA 2NVFA 2HMOA 2Q3WA 4QURA 1L0LE 1SQQE 2NVEA 2A06E 4HM0A 2XSHA 5AEUA 1VCKA 4HM3A 4AIVA 2XRXA 4HM1A 5KKZC 2E75D 4P1CH 5AEWA 4NBDD 1NYKA 1KB9E 5HL4A 2DE6D 1NTZE 2XSOA 2E76D 3TGUE 2BMOA 4NBFD 1KYOE 3CXHE 1VF5D 1O7HA 2I7FA 3GL0A 5BOKA 2BMQA 3L75E 1NDOA 2NUKA 5KLVE 2JZAA 4NB8D 2B1XA 3L74E 2NUMA 3VMGD 1FQTA 2D2CD 3GZXA 2ZT9D 5KLIC 2DE5D 1NU1E 2JO6A 1SQPE 1JM1A 2YVJB 4NB9D 2QJKC 3EN1A 1ULIA 1PP9E 1O7PA 2B24A 2DE7D 2HMMA 3AZCA 3GB4A 4HM8A 4PD4E 2HMJA
chains in the Genus database with same CATH superfamily
1DD3A 3VN0A 5GTHH 1BCCE 1SFCC 1CI6B 3HUSC 2FFDB 4GKGA 1BGYJ 1KORA 3VMZA 1LTSC 1PL5A 1VQPP 1LTJA 4HM6A 1FZCB 2M3EA 1FZAA 4I6MC 2E74D 2WPQA 3EFFK 1H88A 4UB6E 5CMZA 3M9HA 4HKZH 2Q5UA 1RE3C 1M8OB 1ZP0C 4DJGA 1J1DC 1S2EA 1SQQJ 2C0WA 1M7LA 4C46A 5AW9B 1PFIA 1VF5C 4QDCA 1VQ4P 1KTMA 3OW2O 1AFOA 4A7PA 2WZ7A 2JWAA 3V5BA 2K3RA 2NPSB 3L74J 2E5TA 1HJ0A 2I7FA 1EZVI 1NTZK 4IL6H 5K5GB 2IYPA 2Z5HA 2WPRA 5CCGC 4L76A 1NU1E 2JR8A 2WVRA 2JEEA 1SQQD 4L73A 2Q1KA 2BEZF 1QVGO 1LP1B 3B5NA 3TSIA 2QJPC 3WUTA 3C9IA 3VCPA 3AE3C 1YJNP 5APYA 1NTZG 2V4HA 3HE4A 4LLHA 4PV1D 1HUCA 2HFED 3L75D 1GL2D 3L74D 1RQVA 3L70J 3SWYA 1SQXE 4WWIA 3CXHI 3C8VA 4KT0J 1DX7A 2N1TB 1G8KB 1BDDA 3MP7B 1URQA 1KQSO 1P84E 1OIPA 1BE3G 1FU1A 2HPCA 2OTKE 2ZT9B 1VQKP 1OVVA 2K37A 3KXDA 3VYIA 4I1LA 2OQQA 4OH8B 1VQ5P 2O01H 4NBBD 1QGKB 3CD6P 1IJDB 4OGQB 3MD0A 5TISH 1L0ND 1FZEA 4LC1A 1YIJP 2NVFA 2FKWB 3B71A 2HMOA 1N8RQ 3L73G 5C39A 2PAJA 2XSHA 1AQ5A 2L5GB 4HM1A 1N73B 5KAFH 3TK1A 2N9YB 3VMXA 3TGUE 2GM4A 4N78E 1T2KC 3MTUE 2XNXA 3JCUH 3GL0A 1VQ9P 3OJAB 1IC2A 3H6PA 1FZBA 1JUNA 2JO6A 1SQPE 1JM1A 4CPGA 4UB8H 2HYNA 1NH4A 5KLVK 2KB7P 1LTBC 3CL3D 1NYHA 4L75A 2YKPA 5CCHD 4W7ZA 3TF5A 5TJHA 4PV1C 4HM4A 1BCCJ 3H1KE 5KLVG 5APUA 3I55P 2B87B 2NPSD 3G3ZA 4W80A 1N7SC 1EDLA 4H0LC 1XTGB 4RESB 2BMRA 5APXA 3BRTB 1LT1A 4U3FG 2KS1B 2Y0EA 2YFIA 3CCRP 1ZRTD 1SS1A 1LT9B 3CWBG 1PPJE 2ZVNB 3L72G 2WSFH 4C7RA 2FXOA 2JP3A 3SFEC 1PGPA 1DIPA 3HRNA 2H43A 4PD4I 5APTA 2J58A 4HJGH 4QMAA 1KV4A 2HODB 1SFCB 1OW6A 2WT7A 2N1TD 1L4AA 4RKUJ 2JO1A 3MIWA 4IOIH 5AVQB 1E5WA 2XU6A 2Q3IA 3PLNA 2ZT9D 3TNUB 2YKOA 1BE3J 2O01N 4BXLA 2HMMA 3L37A 1MKMA 2NVGA 5KJ7D 2AXTH 3KZIE 4OGQD 4QDFA 1NU1J 1NTZD 4RO0A 3A0HH 4YPCA 3GHGC 1BSNA 2FY8A 3FX0A 1KYOD 4K35A 4C7NB 1UUVA 1BGYE 3LIEA 1TU3F 3AECC 1J1DB 3AE1C 4HKVA 4M3LA 3A3YB 2AEJA 1VF5B 2NPSC 5E79H 1NAFA 3CCQP 4BRYA 1Y47A 4NPEA 5KLIB 2C0XA 1BE3D 1SQXJ 1K73Q 3Q2YA 1S3JA 4TLFA 1UUWA 4GOFA 3M0AA 3NMDA 5H2FH 1O7MA 2J5UA 1LTGC 3L73D 1KILB 1SQQE 2AEFA 2CPBA 3G71P 4GODA 1PZQA 1OX3A 3T97A 1KB9E 4WY4C 2QJPB 1Q90D 2N1TC 2Q7CA 4XA4A 3L75E 1KZUB 5BU8B 1JCCA 2JKVA 1UIXA 3L74E 2OTJP 3IFMA 2RMZA 4AUWA 2GUSA 2KZJA 1FC2C 3VOPA 5CBNA 2YVJB 1XTCC 2PP6A 4U3FJ 2M5AA 4ZKPA 1Q86Q 1IFIA 1SQPJ 4HM5A 4U7JA 5AW3B 5KLVD 1H0TA 3H1JD 1JY3N 3AEAC 3QWOC 1L0NE 1SFCD 2XZRA 3S4RA 1K04A 3UIAA 1M90Q 3HE5B 2Y9ZA 4GT1A 3GKEA 4JYCA 2R3CA 2Z5IA 3C1LA 4EDFA 1Q7YQ 3AEDC 3L75G 1YITP 2QM8A 3CWBD 1PGJA 2GBWA 2R44A 3L72D 3P7KA 1ZOYC 1NKNA 4QCKA 2C9NY 1WMKA 2V7QJ 1SQVK 2K88A 1VCKA 2N9BA 2XRXA 1RY3A 2H88C 3JC22 4NPFX 5BU5A 3PP5A 4JF7A 1IK9A 1MFTA 3PHLA 1M1JA 1KFNA 3TYYA 2ZXXA 2IZ1A 1VF5D 1SQVG 1ZLLA 3P8CE 3VP8A 4L74A 4EYYQ 2KS1A 5AVTB 3S9OA 1U7JA 3AEFC 2WPVB 1IZNB 2LR2A 3AZCA 2IX7C 1N7SB 4H0LB 1VQOP 4NBGD 2H89C 2ITAA 3M9BA 4HM2A 1ZRTE 4IFDK 1KILD 3H25A 1KB9I 5KTBA 2JWDA 3EWKA 2WSSH 1S5LE 2R3SA 3LW5J 3HUSA 4NBAD 3H32A 3PTZA 2ZYLA 1PP9G 3O6QB 1SP4A 1FBMA 1VL2A 1VDFA 1O7GA 1S9KD 4PJ0H 3VMID 2L91A 5AW8B 3SWKA 1HTLC 1SQBK 1EG9A 1J1EC 4ASVA 1RFSA 3VCAA 2KXPB 2O1KA 1RE3A 1S72P 4ASWA 1AQTA 2E43A 3CXHH 1QL2A 5KKZC 3CX5D 1SQBG 4XFJA 1LTJC 1NTZE 2XSOA 3V2NA 1KQLA 4IFFA 1KYOE 2AXCA 3GHGB 1HGZA 4I7ZC 2BMQA 4GIFA 1RF1A 1EDIA 2BCCG 3U59A 5KLIC 2NRGA 3AEGC 1IFNA 2E5YA 2HR3A 2I8DA 1LWUA 1GU4A 3L75J 3IF4A 1JMMA 1W2EA 1CSBA 5AVWB 3R4YA 1T2KD 2HMLA 1BE3E 1YQ4C 4ZMDA 2P10A 5CCGA 3NXSA 3O8ZA 2OYHA 3H1ID 2C9LY 3VMAA 1EQ7A 2K9YA 2HG5D 1KILC 3E1IA 2E4QA 2KYVA 1VQMP 3JSVC 3Q5SA 2SPZA 1EDJA 3ITKA 3L73E 3V6IA 3KQGA 3L35A 1NJIQ 3ZDMA 4WB4A 1L0NJ 3MUDA 2PFXA 2NWFA 5TISE 2HLOA 3SWFA 4WY4B 4ZKUA 3C0DA 3HD7B 2CK3H 1N7SD 4RJTA 4H0LD 3AE9C 1AVYA 3CMEP 1Y9BA 2Z4EA 2RN0A 3IN6A 4OVNF 1G1JA 2NVEA 1PGOA 4HYTB 4HM0A 1K9MQ 1WRGA 2W27A 3BRVB 3EFGA 2D2CC 3JCUE 2P2UA 2KUBA 4NBDD 2DW3A 4N3YB 1L2PA 2QVAA 3CC7P 2QM7A 4UB8E 3HE5A 1SQVD 2WQYC 1O7HA 1NDOA 5KLVE 2JZAA 1URQC 1YQ3C 1S5LX 2FYNB 1G1IA 1YTZI 2WWWA 2OYIB 2QIWA 4W7YA 1FDOA 4U3FE 3E1RA 1ZR4A 4R4MA 1G2CA 1NO4A 1K8AQ 1MUUA 4PD4H 1KQGB 1OXZA 3CWBE 4QUPA 1M56D 3L72E 1R5LA 1VQ7P 1KYOI 1JY2N 3M0DA 1SQBJ 1PP9D 3EQ2A 1DEEG 1WT6A 2W6BA 3HTKA 1GL2A 1FOSE 4KJMA 1USDA 1ZMEC 3K5BA 3H1JG 2KNCA 1JNMA 3CI9A 3FGAD 4AYCA 3V4QA 1DD4A 3H1HG 3OA7A 2ZYGA 2WSCH 3WMM0 1FOSF 1NTKK 3G4SP 5AEUA 1MZ9A 3OAKA 4HB1A 1SQBD 1QLED 2K9JB 4Y99C 3AE7C 4NBFD 1CI6A 2FFDA 1KILE 4NB8D 1NTKG 4JPZB 2BCCD 1ZN5A 1NTZJ 3L71G 2AXTE 1YBKA 1FZCA 2QJKC 1L0LD 1YHQP 3A0HE 1ULIA 4WY4D 2B24A 1RE4A 2MJZA 3HD7D 2ZAEB 1P84I 2A45I 3CCSP 1JTHB 1S9KE 3KDPB 2YFLA 2FXPA 1AJYA 5E79E 1GK6A 1Q82Q 3D89A 1T8ZA 2P58A 2R5DA 1J1EB 2IZ0A 1IFJA 5CCHA 1D7MA 2W6AA 2FYUK 3VP9A 1NTMK 1EDKA 2KP8A 1LNQA 2QJYC 3CX5E 4YTPC 5B66E 5KKZB 1LTJB 3A0BH 3L73J 1U57A 1OVUA 1LJ2A 2NPSA 2E75C 2O01J 2YKQA 4I7ZB 3USSA 1OVRA 5M1BA 2XDJA 3ABVC 2FYUG 1DEBA 1NTMG 4OWFA 2KOGA 3CMAP 1X8YA 2IBZG 2Q9IA 3AEEC 1AVOA 3H1LD 2G3AA 2POHA 1NYKA 1LP1A 1Y8AA 4DCKA 2BMOA 4D6TG 1U7MA 3MGNA 2NUMA 4IFMA 3WUUA 1KD1Q 2ZYDA 4DZOA 1OWAA 1NVOA 4B86A 2N1TA 2A06G 3FXDA 3KHUA 5KLVJ 1VQNP 3HD7C 3H1JJ 4H13C 1LTIC 3I56P 1H89A 2ZFCA 3FXEA 3WU2H 1HF9A 2M0BA 4JYBA 4AAYB 3H1HJ 1HH0A 1SJGA 2R5BA 5KJ7A 1OMIA 3VMHD 1ULJA 3B5NB 4PD4D 3CWBJ 2IYOA 3L72J 3HE4B 3H1IG 2D2CB 3AE2C 1N73A 4I2LC 2M3BA 3L71J 3A5TA 1ZR2A 3IAOA 1GDTA 1SQVE 4TT3H 2BEQD 1RIEA 3CCEP 2FYNC 1OZHA 2OYIC 2WSFJ 3H1HD 3Q1MA 1URQB 2WMMA 3RBXA 1A02J 1KB9H 2W8ZA 1FAVA 1BSHA 2HPCB 2H7HA 2Q3EA 5AEWA 1X22A 5GTIH 5B5EE 2YXQB 2XV5A 3CX5I 3CPWO 1NTKD 2FXMA 1N7LA 1HJBA 1VQLP 3L36A 3VMGD 3RK2B 3L71D 1GTWA 3GZXA 3RL0g 2B87A 2R32A 1PP9E 1RF0C 2UWJE 4HM8A 3A2AA 1S4XA 3E7KA 1EC5A 2QE7H 2MKVA 3SSUA 4EI2A 1FZFA 5KAIH 3GMAA 4EMJB 5GTHE 1HWTC 1NTMJ 3MZWB 1ZXGA 1LT9A 3NFQA 4WVZA 4QUQA 2E76B 2I1KA 3PH0A 1QX8A 1O7NA 1YYCA 4PJ0E 4HM7A 2IDBA 3RBZA 1M1JC 3A7OA 1Q2NA 4N6JA 1USEA 3DQYA 1SQBE 3CCMP 1G8JB 1IO4A 1JB0J 2HODA 1SFCA 4Y99B 1OW7A 2XR8A 2ZYAA 1N2DC 3BCCD 2BCCE 2FYUD 2YMKA 1NTMD 4QURA 1L0LE 3TNUA 3SFDC 4EOTA 2QJKB 3U1CA 2IBZD 3MHVA 3BVHA 1QVFO 2Q6QA 2CPSA 1EZVG 3R2PA 3V2QA 3CCVP 4D6TD 3B5ND 1HBWA 1NOHA 3AE5C 1GW3A 1SLQA 2RKLA 1N86A 3RK3B 2D2CD 2I1JA 1VQ8P 4C7NA 2QEXP 1JMBA 3H1IJ 3GLMA 2A06D 2KIKA 5AW5B 4IL6E 1NWQA 1L0LK 3W67A 1NAYA 3N0QA 4H44C 2WT7B 2OARA 1FJKA 3B8EB 1L4AB 1S5LH 1IFDA 3CCLP 1URQD 4Y28J 2QJYB 1JY2P 3GZYA 2E75B 2LKMA 2E4PA 1NGMB 3GTSA 1L0LG 1H8AA 1ZV8A 3CC4P 1Q81Q 1BGYD 2O1JA 4QDFB 3RL0B 1BCCG 1KILA 1R5SA 1LTAC 1OW8A 3RK2D 3H1LE 2YO2A 5CHXA 1CW5A 3EQQA 1RF1C 3GOBA 2KSEA 4UB6H 4WBAA 4NBED 1LWUC 4XE5B 1Z56A 3CC2P 4NBCD 1AA0A 1M1KQ 3D70A 2XKMA 3P32A 4BRYB 3P8MC 2O3JA 1SQVJ 2OYHC 4AQRD 2WSEJ 1NHLA 1KYOH 1GZLA 4LGDE 1YJ9P 1PV3A 5AVSB 2E76D 4H13B 1QEXA 3U1AA 3N7NA 1KB9D 1T3JA 2NUKA 3B5NC 1RHZB 5KAFE 1FQTA 2YO3A 2WPSA 3N4XA 3TDKA 4NB9D 3EN1A 3MUDC 3GB4A 2Y0CA 3G6EP 4PD4E 3H1LG 3T97B 1NU1K 1IFPA 2ZXEB 2W83C 2E74C 1YTZT 2PRRA 3V4WA 3IR9A 3PJSK 1PP9J 4EIJA 2WITA 1LGHB 5APSA 1W5CE 3H1JE 3QH9A 3VMYA 2M5AB 1YI2P 3AE4C 1GW4A 1NU1G 3H1HE 1GU5A 5AW1B 4ZNCA 1SQXK 2P1JA 2FYZA 2YFJA 1GD2E 3L70D 5APVA 1O7WA 3RK3D 4YXWH 3PRJA 2YIUC 3RK2C 1P84H 1ZW0A 3GF3A 4Z1MH 3FWNA 2GBXA 1KC8Q 1H0TB 2A45H 5AW7B 1NTKE 3FOUA 5APWA 1VM9A 1SQXG 1JCDA 1BDCA 1L4AD 3L71E 1T6AA 3CLQA 3L4FA 5CJ4A 2J59M 2QG4A 2B9BA 1EXJA 5AVRB 4HM3A 2A45G 2E75D 2BCCJ 4IL6X 1YJWP 1N7SA 1EZVD 5HL4A 2DE6D 1L0LJ 1VPCA 1MFZA 2E76C 3M0DC 3M91A 1FDMA 1FE6A 2LXBA 1HVVA 2XNDH 3RL0D 1JEKA 3P8CD 1A02F 3V2RA 1GL2C 3GG2A 1RH5B 4HH2A 1SQPK 1KQFB 5CXMA 2K1AA 1M1JB 2QSIA 2Y0DA 1W2BO 3O6QA 4R4LA 3TGUG 3CXHD 3Q5RA 3GF7A 2KLVA 4JBZA 2WTYA 5DJUB 2ZVOB 3BCCE 3D6YA 2FYUE 1RQUA 1SQPG 3F89A 1NTME 4H13D 1WQLA 1X0TA 3A0BE 1GK4A 1FZGA 3GCEA 2HMNA 1BCCD 2OGUA 4NPDA 1JY3P 2IBZE 5AW6B 2FFDC 1E79H 1KFMA 2ZJSE 4K3AA 3RK3C 3BASA 4D6TE 1FZCC 2OTLP 4P1BH 3H1KG 1EXIA 3HUSB 1JY2O 3GHGA 3H32B 1RE4C 3H1LJ 2HMKA 2V7QH 1L4AC 2Q3WA 3Q3DA 2A06E 3KYQA 4GOEA 2YXRB 3AE6C 4AIVA 2IFMA 1JM0A 1MV8A 5AW4B 3KPEA 5H2FE 4H44B 2E42A 1KN7A 3BCCG 3AE8C 5BOKA 1PPJG 5CCHC 1M57D 3RL0C 4JQ0D 3LIDA 2H8PD 3WU2E 2HMJA 3D71A 3CCUP 5AW0B 3GW6A 3H1IE 3VTPC 2KI7B 2JDIH 1FJPA 5AVZB 2W6JH 3B4SA 4DOJA 2QRXA 1RF1B 5AVXB 3KZIH 2IPPA 4WY4A 3GTEA 4O9BA 1PGQA 3GL2A 3HD7A 3LW5H 1NU1D 1LWUB 3CX5H 5B66H 3S1KA 5L8RJ 2AEMA 2Y9YA 2VRSA 1CZQA 3M06A 1FDIA 1OFCX 5AVUB 2OYHB 2GA1A 5APQA 4GDOA 3Q5PA 5AW2B 1SQXD 1QL1A 1X79B 1VQ6P 2M8RA 1BGYG 2IFNA 4NBHD 2B88A 1T3UA 4YXDC 5GTIE 2WSCJ 1P84D 3TGUJ 2NZ2A 1NTKJ 2ZT9C 3II6A 5EFWB 4P1CH 1DH3A 2OYIA 1PIXA 1SQQK 2E74B 2IBZI 2YNYA 5KJ7C 4OGQC 2KLUA 2B1XA 1LTTC 1FS0E 2GUVA 2LXCB 2DE5D 3CCJP 1O7PA 1SQQG 5CJ0A 3NTNA 5KAIE 5CBOA 1N73C 2PGDA 3D6ZA 2B89A 3L70E 5AVYB 2BASA 5BVZA 3H1KJ 3RK3E 5AVVB 3TGUD 3F5HA 1JOCA 4N78D 4U3FD 3RGUA 3M9QA 2YIUB 1KMIZ 1RF0A 1JO5A 3BATA 4QDDA 2YMYA 3L74G 3G9RA 4KHXA 1J2JB 2P67A 1SQPD 1SVFA 1NKZB 4H44D 2KSJA 1GMJA 2JJLA 1L0NK 4HJLA 1G2CB 3BCCJ 2WSEH 2CKFA 3V2PA 2FYUJ 1EZVE 2W90A 2K9JA 1K05A 2QA4P 1HGVA 3H1KD 4MN4C 1R8EA 1Q90C 1AV1A 1L0NG 2QPZA 2KK7A 5B5EH 4PV1B 1IK7A 4D6TJ 3W68A 1X9VA 3L70G 1S1CX 3HTKB 4BWNA 1GL2B 1UIIA 2OYOA 5DJTB 1LT9C 2KNCB 2P7JA 1JY3O 1JTHA 3AEBC 3CXHE 2FBWC 1PPJD 2RH0A 5CCGD 3WUVA 2G8YA 1IFMA 4DT0A 3FWLA 2DE7D 2KZIA 3I5CA
chains in the Genus database with same CATH topology
2NVGA 1BCCE 3N0QA 4NBGD 4OGQD 4QDFA 2HMLA 3H1IE 3L70E 1BE3E 2QJPC 5CXMA 3VCPA 4U3FE 4HM5A 4HM2A 4PV1D 2YFLA 4EMJB 4AAYB 1ZRTE 3H1JE 3CWBE 4HM4A 4QUPA 3GZYA 4HM6A 3H1KE 3GTEA 1SJGA 1UUVA 4QDDA 2E4QA 3L72E 2E4PA 3D89A 3GL2A 1SQXE 1BGYE 4QUQA 3BCCE 3GTSA 1L0NE 3H1HE 2FYUE 4H44D 1G8KB 4NBAD 1O7NA 4HKVA 1NTME 1WQLA 2E74D 4H13D 2ZYLA 4HM7A 3VMHD 3L73E 1ULJA 4QDFB 2BMRA 1P84E 3GCEA 2HMNA 2YFJA 3GKEA 2IBZE 4HJLA 1O7WA 2CKFA 1SQBE 3DQYA 3CX5E 3H1LE 1O7GA 2QJYC 1EZVE 3EQQA 2YIUC 2NWFA 3VMID 2YFIA 1G8JB 3GOBA 2GBXA 4D6TE 4NBBD 3C0DA 1SQVE 1EG9A 4P1BH 1PPJE 2XR8A 4H0LD 2GBWA 1UUWA 1RIEA 1NTKE 3FOUA 2FYNC 4NBED 1VM9A 2HMKA 4NBCD 2BCCE 1Q90C 3L71E 4NBHD 1RFSA 4QCKA 2QPZA 3VCAA 1O7MA 4QDCA 2NVFA 2HMOA 2Q3WA 4QURA 1L0LE 1SQQE 2NVEA 2A06E 4HM0A 2XSHA 5AEUA 1VCKA 4HM3A 4AIVA 2XRXA 4HM1A 5KKZC 2E75D 4P1CH 5AEWA 4NBDD 1NYKA 1KB9E 5HL4A 2DE6D 1NTZE 2XSOA 2E76D 3TGUE 2BMOA 4NBFD 1KYOE 3CXHE 1VF5D 1O7HA 2I7FA 3GL0A 5BOKA 2BMQA 3L75E 1NDOA 2NUKA 5KLVE 2JZAA 4NB8D 2B1XA 3L74E 2NUMA 3VMGD 1FQTA 2D2CD 3GZXA 2ZT9D 5KLIC 2DE5D 1NU1E 2JO6A 1SQPE 1JM1A 2YVJB 4NB9D 2QJKC 3EN1A 1ULIA 1PP9E 1O7PA 2B24A 2DE7D 2HMMA 3AZCA 3GB4A 4HM8A 4PD4E 2HMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVG A;  1BCC E;  3N0Q A;  4NBG D;  4OGQ D;  4QDF A;  2HML A;  3H1I E;  3L70 E;  1BE3 E;  2QJP C;  5CXM A;  3VCP A;  4U3F E;  4HM5 A;  4HM2 A;  4PV1 D;  2YFL A;  4EMJ B;  4AAY B;  1ZRT E;  3H1J E;  3CWB E;  4HM4 A;  4QUP A;  3GZY A;  4HM6 A;  3H1K E;  3GTE A;  1SJG A;  1UUV A;  4QDD A;  2E4Q A;  3L72 E;  2E4P A;  3D89 A;  3GL2 A;  1SQX E;  1BGY E;  4QUQ A;  3BCC E;  3GTS A;  1L0N E;  3H1H E;  2FYU E;  4H44 D;  1G8K B;  4NBA D;  1O7N A;  4HKV A;  1NTM E;  1WQL A;  2E74 D;  4H13 D;  2ZYL A;  4HM7 A;  3VMH D;  3L73 E;  1ULJ A;  4QDF B;  2BMR A;  1P84 E;  3GCE A;  2HMN A;  2YFJ A;  3GKE A;  2IBZ E;  4HJL A;  1O7W A;  2CKF A;  1SQB E;  3DQY A;  3CX5 E;  3H1L E;  1O7G A;  2QJY C;  1EZV E;  3EQQ A;  2YIU C;  2NWF A;  3VMI D;  2YFI A;  1G8J B;  3GOB A;  2GBX A;  4D6T E;  4NBB D;  3C0D A;  1SQV E;  1EG9 A;  4P1B H;  1PPJ E;  2XR8 A;  4H0L D;  2GBW A;  1UUW A;  1RIE A;  1NTK E;  3FOU A;  2FYN C;  4NBE D;  1VM9 A;  2HMK A;  4NBC D;  2BCC E;  1Q90 C;  3L71 E;  4NBH D;  1RFS A;  4QCK A;  2QPZ A;  3VCA A;  1O7M A;  4QDC A;  2NVF A;  2HMO A;  2Q3W A;  4QUR A;  1L0L E;  1SQQ E;  2NVE A;  2A06 E;  4HM0 A;  2XSH A;  5AEU A;  1VCK A;  4HM3 A;  4AIV A;  2XRX A;  4HM1 A;  5KKZ C;  2E75 D;  4P1C H;  5AEW A;  4NBD D;  1NYK A;  1KB9 E;  5HL4 A;  2DE6 D;  1NTZ E;  2XSO A;  2E76 D;  3TGU E;  2BMO A;  4NBF D;  1KYO E;  3CXH E;  1VF5 D;  1O7H A;  2I7F A;  3GL0 A;  5BOK A;  2BMQ A;  3L75 E;  1NDO A;  2NUK A;  5KLV E;  2JZA A;  4NB8 D;  2B1X A;  3L74 E;  2NUM A;  3VMG D;  1FQT A;  2D2C D;  3GZX A;  2ZT9 D;  5KLI C;  2DE5 D;  1NU1 E;  2JO6 A;  1SQP E;  1JM1 A;  2YVJ B;  4NB9 D;  2QJK C;  3EN1 A;  1ULI A;  1PP9 E;  1O7P A;  2B24 A;  2DE7 D;  2HMM A;  3AZC A;  3GB4 A;  4HM8 A;  4PD4 E;  2HMJ A; 
#chains in the Genus database with same CATH topology
 1DD3 A;  3VN0 A;  5GTH H;  1BCC E;  1SFC C;  1CI6 B;  3HUS C;  2FFD B;  4GKG A;  1BGY J;  1KOR A;  3VMZ A;  1LTS C;  1PL5 A;  1VQP P;  1LTJ A;  4HM6 A;  1FZC B;  2M3E A;  1FZA A;  4I6M C;  2E74 D;  2WPQ A;  3EFF K;  1H88 A;  4UB6 E;  5CMZ A;  3M9H A;  4HKZ H;  2Q5U A;  1RE3 C;  1M8O B;  1ZP0 C;  4DJG A;  1J1D C;  1S2E A;  1SQQ J;  2C0W A;  1M7L A;  4C46 A;  5AW9 B;  1PFI A;  1VF5 C;  4QDC A;  1VQ4 P;  1KTM A;  3OW2 O;  1AFO A;  4A7P A;  2WZ7 A;  2JWA A;  3V5B A;  2K3R A;  2NPS B;  3L74 J;  2E5T A;  1HJ0 A;  2I7F A;  1EZV I;  1NTZ K;  4IL6 H;  5K5G B;  2IYP A;  2Z5H A;  2WPR A;  5CCG C;  4L76 A;  1NU1 E;  2JR8 A;  2WVR A;  2JEE A;  1SQQ D;  4L73 A;  2Q1K A;  2BEZ F;  1QVG O;  1LP1 B;  3B5N A;  3TSI A;  2QJP C;  3WUT A;  3C9I A;  3VCP A;  3AE3 C;  1YJN P;  5APY A;  1NTZ G;  2V4H A;  3HE4 A;  4LLH A;  4PV1 D;  1HUC A;  2HFE D;  3L75 D;  1GL2 D;  3L74 D;  1RQV A;  3L70 J;  3SWY A;  1SQX E;  4WWI A;  3CXH I;  3C8V A;  4KT0 J;  1DX7 A;  2N1T B;  1G8K B;  1BDD A;  3MP7 B;  1URQ A;  1KQS O;  1P84 E;  1OIP A;  1BE3 G;  1FU1 A;  2HPC A;  2OTK E;  2ZT9 B;  1VQK P;  1OVV A;  2K37 A;  3KXD A;  3VYI A;  4I1L A;  2OQQ A;  4OH8 B;  1VQ5 P;  2O01 H;  4NBB D;  1QGK B;  3CD6 P;  1IJD B;  4OGQ B;  3MD0 A;  5TIS H;  1L0N D;  1FZE A;  4LC1 A;  1YIJ P;  2NVF A;  2FKW B;  3B71 A;  2HMO A;  1N8R Q;  3L73 G;  5C39 A;  2PAJ A;  2XSH A;  1AQ5 A;  2L5G B;  4HM1 A;  1N73 B;  5KAF H;  3TK1 A;  2N9Y B;  3VMX A;  3TGU E;  2GM4 A;  4N78 E;  1T2K C;  3MTU E;  2XNX A;  3JCU H;  3GL0 A;  1VQ9 P;  3OJA B;  1IC2 A;  3H6P A;  1FZB A;  1JUN A;  2JO6 A;  1SQP E;  1JM1 A;  4CPG A;  4UB8 H;  2HYN A;  1NH4 A;  5KLV K;  2KB7 P;  1LTB C;  3CL3 D;  1NYH A;  4L75 A;  2YKP A;  5CCH D;  4W7Z A;  3TF5 A;  5TJH A;  4PV1 C;  4HM4 A;  1BCC J;  3H1K E;  5KLV G;  5APU A;  3I55 P;  2B87 B;  2NPS D;  3G3Z A;  4W80 A;  1N7S C;  1EDL A;  4H0L C;  1XTG B;  4RES B;  2BMR A;  5APX A;  3BRT B;  1LT1 A;  4U3F G;  2KS1 B;  2Y0E A;  2YFI A;  3CCR P;  1ZRT D;  1SS1 A;  1LT9 B;  3CWB G;  1PPJ E;  2ZVN B;  3L72 G;  2WSF H;  4C7R A;  2FXO A;  2JP3 A;  3SFE C;  1PGP A;  1DIP A;  3HRN A;  2H43 A;  4PD4 I;  5APT A;  2J58 A;  4HJG H;  4QMA A;  1KV4 A;  2HOD B;  1SFC B;  1OW6 A;  2WT7 A;  2N1T D;  1L4A A;  4RKU J;  2JO1 A;  3MIW A;  4IOI H;  5AVQ B;  1E5W A;  2XU6 A;  2Q3I A;  3PLN A;  2ZT9 D;  3TNU B;  2YKO A;  1BE3 J;  2O01 N;  4BXL A;  2HMM A;  3L37 A;  1MKM A;  2NVG A;  5KJ7 D;  2AXT H;  3KZI E;  4OGQ D;  4QDF A;  1NU1 J;  1NTZ D;  4RO0 A;  3A0H H;  4YPC A;  3GHG C;  1BSN A;  2FY8 A;  3FX0 A;  1KYO D;  4K35 A;  4C7N B;  1UUV A;  1BGY E;  3LIE A;  1TU3 F;  3AEC C;  1J1D B;  3AE1 C;  4HKV A;  4M3L A;  3A3Y B;  2AEJ A;  1VF5 B;  2NPS C;  5E79 H;  1NAF A;  3CCQ P;  4BRY A;  1Y47 A;  4NPE A;  5KLI B;  2C0X A;  1BE3 D;  1SQX J;  1K73 Q;  3Q2Y A;  1S3J A;  4TLF A;  1UUW A;  4GOF A;  3M0A A;  3NMD A;  5H2F H;  1O7M A;  2J5U A;  1LTG C;  3L73 D;  1KIL B;  1SQQ E;  2AEF A;  2CPB A;  3G71 P;  4GOD A;  1PZQ A;  1OX3 A;  3T97 A;  1KB9 E;  4WY4 C;  2QJP B;  1Q90 D;  2N1T C;  2Q7C A;  4XA4 A;  3L75 E;  1KZU B;  5BU8 B;  1JCC A;  2JKV A;  1UIX A;  3L74 E;  2OTJ P;  3IFM A;  2RMZ A;  4AUW A;  2GUS A;  2KZJ A;  1FC2 C;  3VOP A;  5CBN A;  2YVJ B;  1XTC C;  2PP6 A;  4U3F J;  2M5A A;  4ZKP A;  1Q86 Q;  1IFI A;  1SQP J;  4HM5 A;  4U7J A;  5AW3 B;  5KLV D;  1H0T A;  3H1J D;  1JY3 N;  3AEA C;  3QWO C;  1L0N E;  1SFC D;  2XZR A;  3S4R A;  1K04 A;  3UIA A;  1M90 Q;  3HE5 B;  2Y9Z A;  4GT1 A;  3GKE A;  4JYC A;  2R3C A;  2Z5I A;  3C1L A;  4EDF A;  1Q7Y Q;  3AED C;  3L75 G;  1YIT P;  2QM8 A;  3CWB D;  1PGJ A;  2GBW A;  2R44 A;  3L72 D;  3P7K A;  1ZOY C;  1NKN A;  4QCK A;  2C9N Y;  1WMK A;  2V7Q J;  1SQV K;  2K88 A;  1VCK A;  2N9B A;  2XRX A;  1RY3 A;  2H88 C;  3JC2 2;  4NPF X;  5BU5 A;  3PP5 A;  4JF7 A;  1IK9 A;  1MFT A;  3PHL A;  1M1J A;  1KFN A;  3TYY A;  2ZXX A;  2IZ1 A;  1VF5 D;  1SQV G;  1ZLL A;  3P8C E;  3VP8 A;  4L74 A;  4EYY Q;  2KS1 A;  5AVT B;  3S9O A;  1U7J A;  3AEF C;  2WPV B;  1IZN B;  2LR2 A;  3AZC A;  2IX7 C;  1N7S B;  4H0L B;  1VQO P;  4NBG D;  2H89 C;  2ITA A;  3M9B A;  4HM2 A;  1ZRT E;  4IFD K;  1KIL D;  3H25 A;  1KB9 I;  5KTB A;  2JWD A;  3EWK A;  2WSS H;  1S5L E;  2R3S A;  3LW5 J;  3HUS A;  4NBA D;  3H32 A;  3PTZ A;  2ZYL A;  1PP9 G;  3O6Q B;  1SP4 A;  1FBM A;  1VL2 A;  1VDF A;  1O7G A;  1S9K D;  4PJ0 H;  3VMI D;  2L91 A;  5AW8 B;  3SWK A;  1HTL C;  1SQB K;  1EG9 A;  1J1E C;  4ASV A;  1RFS A;  3VCA A;  2KXP B;  2O1K A;  1RE3 A;  1S72 P;  4ASW A;  1AQT A;  2E43 A;  3CXH H;  1QL2 A;  5KKZ C;  3CX5 D;  1SQB G;  4XFJ A;  1LTJ C;  1NTZ E;  2XSO A;  3V2N A;  1KQL A;  4IFF A;  1KYO E;  2AXC A;  3GHG B;  1HGZ A;  4I7Z C;  2BMQ A;  4GIF A;  1RF1 A;  1EDI A;  2BCC G;  3U59 A;  5KLI C;  2NRG A;  3AEG C;  1IFN A;  2E5Y A;  2HR3 A;  2I8D A;  1LWU A;  1GU4 A;  3L75 J;  3IF4 A;  1JMM A;  1W2E A;  1CSB A;  5AVW B;  3R4Y A;  1T2K D;  2HML A;  1BE3 E;  1YQ4 C;  4ZMD A;  2P10 A;  5CCG A;  3NXS A;  3O8Z A;  2OYH A;  3H1I D;  2C9L Y;  3VMA A;  1EQ7 A;  2K9Y A;  2HG5 D;  1KIL C;  3E1I A;  2E4Q A;  2KYV A;  1VQM P;  3JSV C;  3Q5S A;  2SPZ A;  1EDJ A;  3ITK A;  3L73 E;  3V6I A;  3KQG A;  3L35 A;  1NJI Q;  3ZDM A;  4WB4 A;  1L0N J;  3MUD A;  2PFX A;  2NWF A;  5TIS E;  2HLO A;  3SWF A;  4WY4 B;  4ZKU A;  3C0D A;  3HD7 B;  2CK3 H;  1N7S D;  4RJT A;  4H0L D;  3AE9 C;  1AVY A;  3CME P;  1Y9B A;  2Z4E A;  2RN0 A;  3IN6 A;  4OVN F;  1G1J A;  2NVE A;  1PGO A;  4HYT B;  4HM0 A;  1K9M Q;  1WRG A;  2W27 A;  3BRV B;  3EFG A;  2D2C C;  3JCU E;  2P2U A;  2KUB A;  4NBD D;  2DW3 A;  4N3Y B;  1L2P A;  2QVA A;  3CC7 P;  2QM7 A;  4UB8 E;  3HE5 A;  1SQV D;  2WQY C;  1O7H A;  1NDO A;  5KLV E;  2JZA A;  1URQ C;  1YQ3 C;  1S5L X;  2FYN B;  1G1I A;  1YTZ I;  2WWW A;  2OYI B;  2QIW A;  4W7Y A;  1FDO A;  4U3F E;  3E1R A;  1ZR4 A;  4R4M A;  1G2C A;  1NO4 A;  1K8A Q;  1MUU A;  4PD4 H;  1KQG B;  1OXZ A;  3CWB E;  4QUP A;  1M56 D;  3L72 E;  1R5L A;  1VQ7 P;  1KYO I;  1JY2 N;  3M0D A;  1SQB J;  1PP9 D;  3EQ2 A;  1DEE G;  1WT6 A;  2W6B A;  3HTK A;  1GL2 A;  1FOS E;  4KJM A;  1USD A;  1ZME C;  3K5B A;  3H1J G;  2KNC A;  1JNM A;  3CI9 A;  3FGA D;  4AYC A;  3V4Q A;  1DD4 A;  3H1H G;  3OA7 A;  2ZYG A;  2WSC H;  3WMM 0;  1FOS F;  1NTK K;  3G4S P;  5AEU A;  1MZ9 A;  3OAK A;  4HB1 A;  1SQB D;  1QLE D;  2K9J B;  4Y99 C;  3AE7 C;  4NBF D;  1CI6 A;  2FFD A;  1KIL E;  4NB8 D;  1NTK G;  4JPZ B;  2BCC D;  1ZN5 A;  1NTZ J;  3L71 G;  2AXT E;  1YBK A;  1FZC A;  2QJK C;  1L0L D;  1YHQ P;  3A0H E;  1ULI A;  4WY4 D;  2B24 A;  1RE4 A;  2MJZ A;  3HD7 D;  2ZAE B;  1P84 I;  2A45 I;  3CCS P;  1JTH B;  1S9K E;  3KDP B;  2YFL A;  2FXP A;  1AJY A;  5E79 E;  1GK6 A;  1Q82 Q;  3D89 A;  1T8Z A;  2P58 A;  2R5D A;  1J1E B;  2IZ0 A;  1IFJ A;  5CCH A;  1D7M A;  2W6A A;  2FYU K;  3VP9 A;  1NTM K;  1EDK A;  2KP8 A;  1LNQ A;  2QJY C;  3CX5 E;  4YTP C;  5B66 E;  5KKZ B;  1LTJ B;  3A0B H;  3L73 J;  1U57 A;  1OVU A;  1LJ2 A;  2NPS A;  2E75 C;  2O01 J;  2YKQ A;  4I7Z B;  3USS A;  1OVR A;  5M1B A;  2XDJ A;  3ABV C;  2FYU G;  1DEB A;  1NTM G;  4OWF A;  2KOG A;  3CMA P;  1X8Y A;  2IBZ G;  2Q9I A;  3AEE C;  1AVO A;  3H1L D;  2G3A A;  2POH A;  1NYK A;  1LP1 A;  1Y8A A;  4DCK A;  2BMO A;  4D6T G;  1U7M A;  3MGN A;  2NUM A;  4IFM A;  3WUU A;  1KD1 Q;  2ZYD A;  4DZO A;  1OWA A;  1NVO A;  4B86 A;  2N1T A;  2A06 G;  3FXD A;  3KHU A;  5KLV J;  1VQN P;  3HD7 C;  3H1J J;  4H13 C;  1LTI C;  3I56 P;  1H89 A;  2ZFC A;  3FXE A;  3WU2 H;  1HF9 A;  2M0B A;  4JYB A;  4AAY B;  3H1H J;  1HH0 A;  1SJG A;  2R5B A;  5KJ7 A;  1OMI A;  3VMH D;  1ULJ A;  3B5N B;  4PD4 D;  3CWB J;  2IYO A;  3L72 J;  3HE4 B;  3H1I G;  2D2C B;  3AE2 C;  1N73 A;  4I2L C;  2M3B A;  3L71 J;  3A5T A;  1ZR2 A;  3IAO A;  1GDT A;  1SQV E;  4TT3 H;  2BEQ D;  1RIE A;  3CCE P;  2FYN C;  1OZH A;  2OYI C;  2WSF J;  3H1H D;  3Q1M A;  1URQ B;  2WMM A;  3RBX A;  1A02 J;  1KB9 H;  2W8Z A;  1FAV A;  1BSH A;  2HPC B;  2H7H A;  2Q3E A;  5AEW A;  1X22 A;  5GTI H;  5B5E E;  2YXQ B;  2XV5 A;  3CX5 I;  3CPW O;  1NTK D;  2FXM A;  1N7L A;  1HJB A;  1VQL P;  3L36 A;  3VMG D;  3RK2 B;  3L71 D;  1GTW A;  3GZX A;  3RL0 g;  2B87 A;  2R32 A;  1PP9 E;  1RF0 C;  2UWJ E;  4HM8 A;  3A2A A;  1S4X A;  3E7K A;  1EC5 A;  2QE7 H;  2MKV A;  3SSU A;  4EI2 A;  1FZF A;  5KAI H;  3GMA A;  4EMJ B;  5GTH E;  1HWT C;  1NTM J;  3MZW B;  1ZXG A;  1LT9 A;  3NFQ A;  4WVZ A;  4QUQ A;  2E76 B;  2I1K A;  3PH0 A;  1QX8 A;  1O7N A;  1YYC A;  4PJ0 E;  4HM7 A;  2IDB A;  3RBZ A;  1M1J C;  3A7O A;  1Q2N A;  4N6J A;  1USE A;  3DQY A;  1SQB E;  3CCM P;  1G8J B;  1IO4 A;  1JB0 J;  2HOD A;  1SFC A;  4Y99 B;  1OW7 A;  2XR8 A;  2ZYA A;  1N2D C;  3BCC D;  2BCC E;  2FYU D;  2YMK A;  1NTM D;  4QUR A;  1L0L E;  3TNU A;  3SFD C;  4EOT A;  2QJK B;  3U1C A;  2IBZ D;  3MHV A;  3BVH A;  1QVF O;  2Q6Q A;  2CPS A;  1EZV G;  3R2P A;  3V2Q A;  3CCV P;  4D6T D;  3B5N D;  1HBW A;  1NOH A;  3AE5 C;  1GW3 A;  1SLQ A;  2RKL A;  1N86 A;  3RK3 B;  2D2C D;  2I1J A;  1VQ8 P;  4C7N A;  2QEX P;  1JMB A;  3H1I J;  3GLM A;  2A06 D;  2KIK A;  5AW5 B;  4IL6 E;  1NWQ A;  1L0L K;  3W67 A;  1NAY A;  3N0Q A;  4H44 C;  2WT7 B;  2OAR A;  1FJK A;  3B8E B;  1L4A B;  1S5L H;  1IFD A;  3CCL P;  1URQ D;  4Y28 J;  2QJY B;  1JY2 P;  3GZY A;  2E75 B;  2LKM A;  2E4P A;  1NGM B;  3GTS A;  1L0L G;  1H8A A;  1ZV8 A;  3CC4 P;  1Q81 Q;  1BGY D;  2O1J A;  4QDF B;  3RL0 B;  1BCC G;  1KIL A;  1R5S A;  1LTA C;  1OW8 A;  3RK2 D;  3H1L E;  2YO2 A;  5CHX A;  1CW5 A;  3EQQ A;  1RF1 C;  3GOB A;  2KSE A;  4UB6 H;  4WBA A;  4NBE D;  1LWU C;  4XE5 B;  1Z56 A;  3CC2 P;  4NBC D;  1AA0 A;  1M1K Q;  3D70 A;  2XKM A;  3P32 A;  4BRY B;  3P8M C;  2O3J A;  1SQV J;  2OYH C;  4AQR D;  2WSE J;  1NHL A;  1KYO H;  1GZL A;  4LGD E;  1YJ9 P;  1PV3 A;  5AVS B;  2E76 D;  4H13 B;  1QEX A;  3U1A A;  3N7N A;  1KB9 D;  1T3J A;  2NUK A;  3B5N C;  1RHZ B;  5KAF E;  1FQT A;  2YO3 A;  2WPS A;  3N4X A;  3TDK A;  4NB9 D;  3EN1 A;  3MUD C;  3GB4 A;  2Y0C A;  3G6E P;  4PD4 E;  3H1L G;  3T97 B;  1NU1 K;  1IFP A;  2ZXE B;  2W83 C;  2E74 C;  1YTZ T;  2PRR A;  3V4W A;  3IR9 A;  3PJS K;  1PP9 J;  4EIJ A;  2WIT A;  1LGH B;  5APS A;  1W5C E;  3H1J E;  3QH9 A;  3VMY A;  2M5A B;  1YI2 P;  3AE4 C;  1GW4 A;  1NU1 G;  3H1H E;  1GU5 A;  5AW1 B;  4ZNC A;  1SQX K;  2P1J A;  2FYZ A;  2YFJ A;  1GD2 E;  3L70 D;  5APV A;  1O7W A;  3RK3 D;  4YXW H;  3PRJ A;  2YIU C;  3RK2 C;  1P84 H;  1ZW0 A;  3GF3 A;  4Z1M H;  3FWN A;  2GBX A;  1KC8 Q;  1H0T B;  2A45 H;  5AW7 B;  1NTK E;  3FOU A;  5APW A;  1VM9 A;  1SQX G;  1JCD A;  1BDC A;  1L4A D;  3L71 E;  1T6A A;  3CLQ A;  3L4F A;  5CJ4 A;  2J59 M;  2QG4 A;  2B9B A;  1EXJ A;  5AVR B;  4HM3 A;  2A45 G;  2E75 D;  2BCC J;  4IL6 X;  1YJW P;  1N7S A;  1EZV D;  5HL4 A;  2DE6 D;  1L0L J;  1VPC A;  1MFZ A;  2E76 C;  3M0D C;  3M91 A;  1FDM A;  1FE6 A;  2LXB A;  1HVV A;  2XND H;  3RL0 D;  1JEK A;  3P8C D;  1A02 F;  3V2R A;  1GL2 C;  3GG2 A;  1RH5 B;  4HH2 A;  1SQP K;  1KQF B;  5CXM A;  2K1A A;  1M1J B;  2QSI A;  2Y0D A;  1W2B O;  3O6Q A;  4R4L A;  3TGU G;  3CXH D;  3Q5R A;  3GF7 A;  2KLV A;  4JBZ A;  2WTY A;  5DJU B;  2ZVO B;  3BCC E;  3D6Y A;  2FYU E;  1RQU A;  1SQP G;  3F89 A;  1NTM E;  4H13 D;  1WQL A;  1X0T A;  3A0B E;  1GK4 A;  1FZG A;  3GCE A;  2HMN A;  1BCC D;  2OGU A;  4NPD A;  1JY3 P;  2IBZ E;  5AW6 B;  2FFD C;  1E79 H;  1KFM A;  2ZJS E;  4K3A A;  3RK3 C;  3BAS A;  4D6T E;  1FZC C;  2OTL P;  4P1B H;  3H1K G;  1EXI A;  3HUS B;  1JY2 O;  3GHG A;  3H32 B;  1RE4 C;  3H1L J;  2HMK A;  2V7Q H;  1L4A C;  2Q3W A;  3Q3D A;  2A06 E;  3KYQ A;  4GOE A;  2YXR B;  3AE6 C;  4AIV A;  2IFM A;  1JM0 A;  1MV8 A;  5AW4 B;  3KPE A;  5H2F E;  4H44 B;  2E42 A;  1KN7 A;  3BCC G;  3AE8 C;  5BOK A;  1PPJ G;  5CCH C;  1M57 D;  3RL0 C;  4JQ0 D;  3LID A;  2H8P D;  3WU2 E;  2HMJ A;  3D71 A;  3CCU P;  5AW0 B;  3GW6 A;  3H1I E;  3VTP C;  2KI7 B;  2JDI H;  1FJP A;  5AVZ B;  2W6J H;  3B4S A;  4DOJ A;  2QRX A;  1RF1 B;  5AVX B;  3KZI H;  2IPP A;  4WY4 A;  3GTE A;  4O9B A;  1PGQ A;  3GL2 A;  3HD7 A;  3LW5 H;  1NU1 D;  1LWU B;  3CX5 H;  5B66 H;  3S1K A;  5L8R J;  2AEM A;  2Y9Y A;  2VRS A;  1CZQ A;  3M06 A;  1FDI A;  1OFC X;  5AVU B;  2OYH B;  2GA1 A;  5APQ A;  4GDO A;  3Q5P A;  5AW2 B;  1SQX D;  1QL1 A;  1X79 B;  1VQ6 P;  2M8R A;  1BGY G;  2IFN A;  4NBH D;  2B88 A;  1T3U A;  4YXD C;  5GTI E;  2WSC J;  1P84 D;  3TGU J;  2NZ2 A;  1NTK J;  2ZT9 C;  3II6 A;  5EFW B;  4P1C H;  1DH3 A;  2OYI A;  1PIX A;  1SQQ K;  2E74 B;  2IBZ I;  2YNY A;  5KJ7 C;  4OGQ C;  2KLU A;  2B1X A;  1LTT C;  1FS0 E;  2GUV A;  2LXC B;  2DE5 D;  3CCJ P;  1O7P A;  1SQQ G;  5CJ0 A;  3NTN A;  5KAI E;  5CBO A;  1N73 C;  2PGD A;  3D6Z A;  2B89 A;  3L70 E;  5AVY B;  2BAS A;  5BVZ A;  3H1K J;  3RK3 E;  5AVV B;  3TGU D;  3F5H A;  1JOC A;  4N78 D;  4U3F D;  3RGU A;  3M9Q A;  2YIU B;  1KMI Z;  1RF0 A;  1JO5 A;  3BAT A;  4QDD A;  2YMY A;  3L74 G;  3G9R A;  4KHX A;  1J2J B;  2P67 A;  1SQP D;  1SVF A;  1NKZ B;  4H44 D;  2KSJ A;  1GMJ A;  2JJL A;  1L0N K;  4HJL A;  1G2C B;  3BCC J;  2WSE H;  2CKF A;  3V2P A;  2FYU J;  1EZV E;  2W90 A;  2K9J A;  1K05 A;  2QA4 P;  1HGV A;  3H1K D;  4MN4 C;  1R8E A;  1Q90 C;  1AV1 A;  1L0N G;  2QPZ A;  2KK7 A;  5B5E H;  4PV1 B;  1IK7 A;  4D6T J;  3W68 A;  1X9V A;  3L70 G;  1S1C X;  3HTK B;  4BWN A;  1GL2 B;  1UII A;  2OYO A;  5DJT B;  1LT9 C;  2KNC B;  2P7J A;  1JY3 O;  1JTH A;  3AEB C;  3CXH E;  2FBW C;  1PPJ D;  2RH0 A;  5CCG D;  3WUV A;  2G8Y A;  1IFM A;  4DT0 A;  3FWL A;  2DE7 D;  2KZI A;  3I5C A; 
#chains in the Genus database with same CATH homology
 2NVG A;  1BCC E;  3N0Q A;  4NBG D;  4OGQ D;  4QDF A;  2HML A;  3H1I E;  3L70 E;  1BE3 E;  2QJP C;  5CXM A;  3VCP A;  4U3F E;  4HM5 A;  4HM2 A;  4PV1 D;  2YFL A;  4EMJ B;  4AAY B;  1ZRT E;  3H1J E;  3CWB E;  4HM4 A;  4QUP A;  3GZY A;  4HM6 A;  3H1K E;  3GTE A;  1SJG A;  1UUV A;  4QDD A;  2E4Q A;  3L72 E;  2E4P A;  3D89 A;  3GL2 A;  1SQX E;  1BGY E;  4QUQ A;  3BCC E;  3GTS A;  1L0N E;  3H1H E;  2FYU E;  4H44 D;  1G8K B;  4NBA D;  1O7N A;  4HKV A;  1NTM E;  1WQL A;  2E74 D;  4H13 D;  2ZYL A;  4HM7 A;  3VMH D;  3L73 E;  1ULJ A;  4QDF B;  2BMR A;  1P84 E;  3GCE A;  2HMN A;  2YFJ A;  3GKE A;  2IBZ E;  4HJL A;  1O7W A;  2CKF A;  1SQB E;  3DQY A;  3CX5 E;  3H1L E;  1O7G A;  2QJY C;  1EZV E;  3EQQ A;  2YIU C;  2NWF A;  3VMI D;  2YFI A;  1G8J B;  3GOB A;  2GBX A;  4D6T E;  4NBB D;  3C0D A;  1SQV E;  1EG9 A;  4P1B H;  1PPJ E;  2XR8 A;  4H0L D;  2GBW A;  1UUW A;  1RIE A;  1NTK E;  3FOU A;  2FYN C;  4NBE D;  1VM9 A;  2HMK A;  4NBC D;  2BCC E;  1Q90 C;  3L71 E;  4NBH D;  1RFS A;  4QCK A;  2QPZ A;  3VCA A;  1O7M A;  4QDC A;  2NVF A;  2HMO A;  2Q3W A;  4QUR A;  1L0L E;  1SQQ E;  2NVE A;  2A06 E;  4HM0 A;  2XSH A;  5AEU A;  1VCK A;  4HM3 A;  4AIV A;  2XRX A;  4HM1 A;  5KKZ C;  2E75 D;  4P1C H;  5AEW A;  4NBD D;  1NYK A;  1KB9 E;  5HL4 A;  2DE6 D;  1NTZ E;  2XSO A;  2E76 D;  3TGU E;  2BMO A;  4NBF D;  1KYO E;  3CXH E;  1VF5 D;  1O7H A;  2I7F A;  3GL0 A;  5BOK A;  2BMQ A;  3L75 E;  1NDO A;  2NUK A;  5KLV E;  2JZA A;  4NB8 D;  2B1X A;  3L74 E;  2NUM A;  3VMG D;  1FQT A;  2D2C D;  3GZX A;  2ZT9 D;  5KLI C;  2DE5 D;  1NU1 E;  2JO6 A;  1SQP E;  1JM1 A;  2YVJ B;  4NB9 D;  2QJK C;  3EN1 A;  1ULI A;  1PP9 E;  1O7P A;  2B24 A;  2DE7 D;  2HMM A;  3AZC A;  3GB4 A;  4HM8 A;  4PD4 E;  2HMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...