3BCCE

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPNFSDYRRPPDDYSTKSSRESDPSRKGFSYLVTAVTTLGVAYAAKNVVTQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 41
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 3bccE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 3bccE02
3GL0A 1UUVA 4QCKA 5BOKA 1WQLA 3D89A 3L72E 3GZXA 4QUPA 1BCCE 3CWBE 4HM6A 2BCCE 1O7WA 2QJYC 3GL2A 4HM1A 3H1KE 2I7FA 3N0QA 1NYKA 1O7MA 2DE6D 2NVGA 3CX5E 2JZAA 3GTEA 4PV1D 2XR8A 2ZYLA 3TGUE 4HJLA 2XSHA 4NBHD 2BMQA 1NDOA 4QUQA 1VCKA 2NVEA 4NBCD 2B1XA 4HM7A 4NB9D 1KB9E 1ULIA 3FOUA 2HMMA 2XSOA 2XRXA 4NB8D 1FQTA 3AZCA 4QURA 1BE3E 2HMLA 1NTKE 2QJPC 3BCCE 2YIUC 2FYUE 1EG9A 2Q3WA 5CXMA 4AAYB 5HL4A 2YFLA 1L0LE 4HM4A 1VM9A 1G8KB 3EQQA 3GCEA 1RFSA 4NBED 3L73E 1SQPE 1NU1E 1NTZE 1ZRTE 4HM0A 2A06E 1O7NA 1O7GA 4H0LD 4H44D 4P1BH 5AEUA 3L75E 4HM8A 3H1JE 1ULJA 2GBWA 3GTSA 4OGQD 2DE7D 4NBFD 1SQQE 2BMOA 2YFIA 4QDCA 1L0NE 3H1HE 1G8JB 5KKZC 2YVJB 2BMRA 4P1CH 2HMNA 2HMJA 1SQBE 4PD4E 1SQVE 2QPZA 1O7HA 2D2CD 1JM1A 2NUKA 1P84E 4U3FE 4HM2A 3L71E 2ZT9D 2QJKC 2NUMA 1BGYE 2HMKA 1EZVE 4NBGD 1O7PA 2IBZE 3H1IE 1KYOE 2GBXA 4QDFA 3DQYA 3C0DA 3VMID 3VCPA 3VMGD 5KLVE 5KLIC 2E4QA 1RIEA 3L74E 1VF5D 4HKVA 3VMHD 2DE5D 4NBDD 5AEWA 3H1LE 4NBAD 3L70E 2NWFA 1PP9E 1SQXE 1Q90C 3GB4A 2NVFA 2E4PA 3CXHE 4QDDA 3GOBA 4QDFB 4H13D 1SJGA 4D6TE 3GKEA 2CKFA 4HM5A 2YFJA 4EMJB 4NBBD 2E76D 2FYNC 2JO6A 1UUWA 2E75D 1NTME 3EN1A 4HM3A 1PPJE 3GZYA 2B24A 2HMOA 2E74D 3VCAA 4AIVA
chains in the Genus database with same CATH superfamily
2CPBA 2QM8A 5KAFH 1PP9J 3QWOC 2WT7A 1E79H 2V4HA 1BGYD 5M1BA 2Q9IA 1NTKK 3B5ND 3SWFA 1LP1B 1MUUA 3CMAP 1M7LA 3EWKA 1T3UA 2WSFJ 4KJMA 3GTEA 3V2RA 1BDDA 4JBZA 5E79H 2WT7B 2R44A 1IC2A 3W67A 2W6JH 3VOPA 3E1RA 1PL5A 2YO2A 4D6TD 1GL2A 2YFLA 2NRGA 3U59A 3W68A 1VM9A 3L75J 3PJSK 1WMKA 5AVVB 2M3BA 4LC1A 1GL2B 2P2UA 2W27A 2BCCG 1SQPD 4P1CH 1ZRTD 2KSJA 1BSNA 5APTA 1VQ6P 3MZWB 3RK2D 2WPQA 4AYCA 2NPSC 4B86A 2O01H 1KQFB 4NBGD 1SQQJ 1T2KC 3B71A 2V7QJ 1IFNA 4U3FD 1K04A 1G1JA 1OWAA 3L71J 1SS1A 2JR8A 3H1LE 3AEFC 3L70E 5AW8B 1Q90C 3MGNA 4NPDA 1N7LA 3GOBA 3IF4A 1VQ4P 2KLVA 4EMJB 5KAIE 1UUWA 2P1JA 1VQLP 2HMOA 1NVOA 5BOKA 3Q2YA 1EXIA 5TISE 3UIAA 4W80A 3A0BE 1FZGA 2WTYA 2NPSA 2JZAA 2P58A 1FBMA 4XE5B 1HJ0A 3BRTB 2HPCA 1JY2N 2NPSB 1AV1A 5HL4A 3TGUJ 1HBWA 2WZ7A 2HPCB 2OQQA 4HM4A 4HM0A 3P32A 1GK6A 4RJTA 3L75E 2RKLA 2FYUD 2Q7CA 2BMOA 3AEGC 1K9MQ 1BE3J 3H1HE 1G1IA 1KQGB 1RQUA 3NFQA 4JYCA 3U1AA 5APXA 3KXDA 3H1JJ 3M0AA 2QVAA 3C0DA 5CHXA 2XNDH 2O3JA 1KQSO 3LW5H 3MTUE 1VL2A 3V2NA 3H1ID 3G6EP 1DEBA 4K3AA 5KLVD 1AFOA 1BSHA 2OYHC 3GF7A 1E5WA 5CJ4A 2FFDC 5AW5B 3KZIE 3HE4A 1WQLA 2KLUA 4KT0J 4RO0A 1PGOA 1BCCE 2M3EA 1FS0E 2ZJSE 3OA7A 1JY2O 2JP3A 3CCJP 1IFPA 3F5HA 4ZMDA 1OMIA 3BASA 3G9RA 2ZYLA 3HE4B 4HJLA 4Z1MH 5APSA 5DJUB 1VQMP 2GUSA 4C46A 2XDJA 3L70G 4IL6H 3F89A 2XSOA 4QURA 3AEDC 2C0WA 1L0LE 3ZDMA 2SPZA 2KP8A 1RFSA 2OYHA 1URQD 1Y8AA 3CLQA 2KUBA 2FFDA 5AEUA 1USEA 2GBWA 1RE3C 4QDCA 1JY3N 1MV8A 1XTGB 2UWJE 1PP9G 2QM7A 2KB7P 1NTZD 2L5GB 1FJPA 1G2CA 2OYHB 2W6AA 5KAIH 2FFDB 1LNQA 1PGPA 2E5YA 2WPSA 1L0NJ 2Q6QA 2IBZE 4PD4D 2MKVA 5AW3B 3N7NA 1G2CB 2E74C 1FZEA 1OVRA 2P10A 3IR9A 3L74E 2HYNA 1NAYA 3HUSA 1SFCD 2LXCB 3M9QA 1GW3A 2KNCA 3L75G 1EDLA 2G8YA 1JCDA 1RE3A 1SQBD 4M3LA 3FXDA 3HRNA 2KNCB 5CCGD 3MP7B 4UB8E 5CBOA 2Q1KA 4HM1A 1NYKA 2H7HA 2JKVA 3FXEA 3SFEC 4PV1D 1SQQG 3IFMA 3HD7C 1NDOA 4EI2A 1FDOA 4NBCD 2BCCJ 2RN0A 1KILD 3PLNA 2Y0EA 4IFDK 3I56P 1WRGA 5K5GB 3L71G 1SQXK 3V2PA 1L2PA 4EIJA 3A7OA 2E74B 2WSSH 3AEBC 3L73E 5GTHE 1NTMK 2A06E 1R5LA 2O1JA 4U7JA 2PAJA 3Q1MA 1YYCA 3VMAA 3L37A 1NTKJ 5CMZA 4YXDC 3VMZA 1SQVE 1Y9BA 4WY4C 3SWKA 1N73C 1BGYE 2LKMA 2ZVNB 3JCUH 2C0XA 1VQPP 2ZXEB 1L0LG 5E79E 2PRRA 3VMHD 4BWNA 1EZVD 2JJLA 2I1KA 2JDIH 3TGUG 5AVUB 3TDKA 1EDKA 2IPPA 2YO3A 5APUA 4D6TE 2QEXP 3T97A 1OZHA 3TNUA 2R5BA 3BATA 3HE5A 4I2LC 1BE3G 5BVZA 1N7SD 2OTJP 3T97B 4WY4A 3TNUB 1N73A 2XR8A 2R5DA 3HE5B 3M06A 3VTPC 2Q5UA 4H44C 2VRSA 3AE2C 2JO1A 4WY4B 3RK3E 1QGKB 1T6AA 3CX5D 1RY3A 1N73B 1HGZA 3FWLA 2DW3A 1M1JC 1IFMA 3LW5J 1SQVK 1PPJD 2QSIA 5AVRB 1FZCA 3GCEA 1J2JB 3P7KA 1NU1E 4H0LD 3HTKA 4JPZB 4JYBA 4UB6H 3RL0g 4NBFD 4GOEA 3A0HE 1FZCB 4ZKPA 3P8MC 2D2CD 3D6ZA 3HTKB 3H1JD 3M9HA 4HH2A 1IFDA 1FDIA 3B4SA 3GW6A 4MN4C 2ZAEB 1KB9H 3E7KA 1AVOA 4IFFA 4Y28J 2GBXA 4UB8H 2OGUA 4EOTA 2JEEA 2E4QA 3CCUP 1M1JA 3L73G 3TYYA 4H44B 2H43A 1VQ8P 1SQPK 1YQ4C 4XA4A 2YFJA 2E76D 3JC22 1M1JB 3NMDA 1YI2P 4OVNF 1LTBC 1M57D 1X8YA 3H1LJ 5H2FE 4DCKA 3L70J 2FXPA 1RH5B 3I5CA 4HJGH 3N0QA 2B89A 3RK3C 3CCQP 2FXMA 2P7JA 1KQLA 1L0NG 3RL0C 4OGQC 2PGDA 4QUQA 1NKNA 5AW6B 3AZCA 1S9KD 2YIUC 4TLFA 3BCCE 4YPCA 1YJ9P 3Q3DA 5BU5A 3GLMA 2QA4P 1FU1A 1QEXA 3PP5A 1PV3A 4R4MA 1T3JA 1HF9A 1ULJA 3SFDC 1JO5A 3EFFK 4N78E 1SLQA 4XFJA 2OYIC 1NKZB 1ZV8A 2E42A 3CCEP 3P8CD 4HM2A 3CCSP 1QL1A 1FJKA 1YJNP 1RHZB 2C9NY 4DJGA 3H1HJ 2H89C 4GOFA 4LGDE 3VMID 2GUVA 1P84D 1NO4A 3RK3B 2FYUK 1NU1G 1RQVA 3RL0B 1YBKA 4OGQB 4IL6E 1J1EB 1LTJC 2AXTE 4HM3A 5APQA 5TJHA 2YIUB 1EXJA 2B24A 2IX7C 1VQ5P 1Y47A 1KFNA 3L72E 4HYTB 2OYIA 1NTKG 1L4AC 2L91A 1ZOYC 1GL2D 5AW4B 1KV4A 2YKQA 3M91A 3V4QA 3A0HH 2XSHA 2OYIB 5APVA 4NBHD 4DZOA 2BCCD 5DJTB 1BCCJ 5KLVK 3RBXA 2WSCJ 4HM7A 1YJWP 2KXPB 2XKMA 1JM0A 2QRXA 1LTJA 1AVYA 3VP8A 2GM4A 1FZBA 2O1KA 1H89A 3GTSA 2OYOA 1L4AA 2OARA 2Q3IA 1LTJB 1L0LJ 4KHXA 1SQBE 1Q7YQ 3ABVC 1JNMA 5CCHC 2HFED 1K73Q 1L4AB 2HMKA 1Z56A 5H2FH 1AA0A 3CCRP 1PIXA 2MJZA 3MD0A 2QG4A 3BCCG 1SQXJ 1RIEA 1SVFA 4WVZA 1QLED 2WSEH 1NTMJ 2J5UA 2E4PA 2YXQB 1S5LE 3G71P 1OIPA 2NPSD 1NTZK 1CI6A 1URQC 1D7MA 1T2KD 2IZ0A 1S72P 3L74J 3CI9A 3GL0A 2YKPA 3H1KJ 1QVGO 4QUPA 3KHUA 2FYZA 1GMJA 1CI6B 3V6IA 1O7WA 1Q90D 1XTCC 5CCHA 1S3JA 4I1LA 5AVYB 4OH8B 1T8ZA 3LIDA 2POHA 2BEZF 1H88A 3JCUE 1SQBK 5EFWB 2I8DA 2RMZA 4AAYB 2I1JA 5KJ7C 1JTHA 2ZT9C 1URQA 2WPVB 2FXOA 3AE4C 4EYYQ 1O7NA 3L72G 2WPRA 4Y99C 4W7ZA 2IDBA 2KS1A 1IFIA 3H1LG 4PJ0H 1JTHB 1URQB 2M8RA 3CCVP 3L73J 4N3YB 2AXTH 3HUSC 2E43A 2LR2A 1YHQP 2AEJA 4AUWA 4PV1C 2KS1B 1VPCA 4IOIH 2G3AA 1EC5A 3AEAC 3WU2E 1SQVJ 1SFCA 4NBAD 5KJ7A 1SQXE 3GB4A 1DD4A 1BGYJ 2R32A 4QDDA 4L76A 2A45I 2CKFA 2KIKA 1NTME 1PPJE 3OJAB 1SFCB 2ZFCA 3H25A 1LTAC 4BXLA 5CCGA 2ZT9B 3V4WA 3CWBE 3ITKA 4UB6E 4D6TJ 3H1KE 5AVSB 4Y99B 3B8EB 2AEFA 3BVHA 3M0DC 4CPGA 2XNXA 3AE5C 1GU5A 1FDMA 3H1HG 3HUSB 1PP9D 4OWFA 4PV1B 1KB9E 1LT1A 1KZUB 1M90Q 1SQPJ 2XV5A 2Q3WA 1G8KB 3EQQA 1FE6A 1O7GA 1JEKA 3FX0A 1JCCA 2O01J 1SP4A 2DE7D 2Z4EA 2AXCA 1PGJA 3VMXA 3EQ2A 1N7SC 1S5LH 2HG5D 3M9BA 2HMNA 3IN6A 2KZJA 2N1TC 1NU1J 3L75D 2B87A 2K9JA 3GG2A 3M0DA 4H13C 2A45H 3EFGA 1VQOP 5GTIE 1KYOE 1JMMA 1BCCG 1GW4A 2B87B 2K9JB 2YNYA 3WMM0 4HKVA 3WUUA 5AEWA 1OX3A 1ZR2A 2NWFA 5AW1B 2IBZI 4L75A 3S1KA 1SQQD 1NOHA 4LLHA 5CBNA 2E74D 4IL6X 5C39A 1N7SA 3L71D 2N1TA 4RKUJ 2QJYC 5L8RJ 2DE6D 2ITAA 1FZCC 1ZXGA 2YKOA 1N7SB 1KB9I 3P8CE 1OXZA 2WQYC 2N1TB 2NZ2A 1H8AA 1VCKA 2CK3H 5AVZB 3CXHD 4H13B 1RF0A 3C1LA 1SQXG 3GHGC 1JOCA 1ZW0A 5CXMA 5AVQB 5KTBA 2WMMA 1NTMG 3WU2H 2WSEJ 1SQPE 2IBZG 2Z5HA 1ZRTE 5AW9B 1JB0J 1MFTA 3HD7D 1S2EA 1FAVA 1KTMA 1Q86Q 2KZIA 3L74G 1L0LD 3CWBG 1ZLLA 1GU4A 3BCCJ 3H1KG 5KKZC 4DT0A 2BMRA 2W90A 3CC2P 1YIJP 3TGUD 2HMJA 5CJ0A 1JUNA 1KC8Q 3VP9A 1JM1A 1KYOI 4U3FE 1KD1Q 2N9YB 3R4YA 5AW2B 2NUMA 2ZYDA 2E75C 2QJYB 3WUVA 2D2CB 4QDFA 1BE3D 3DQYA 1JY3P 3VCPA 3VMGD 3GHGA 4R4LA 2E5TA 3GF3A 3B5NC 4WY4D 1EQ7A 5B66E 1QX8A 2GA1A 4QDFB 3GKEA 4HM5A 3IAOA 3CC7P 1BDCA 2JO6A 1UIXA 3GHGB 2BASA 1S5LX 4HB1A 1PFIA 3D6YA 3II6A 1CW5A 3D89A 1OVUA 3VMYA 1MKMA 3CPWO 1ZN5A 5B5EH 1O7MA 3KQGA 1KORA 2A06G 3R2PA 5KKZB 1YTZI 3L72J 4GT1A 2AEMA 3PTZA 2W83C 4ZKUA 1SQVG 3B5NA 2E75B 4YXWH 2HMLA 2FYUE 1VQNP 1EG9A 1NTZJ 5GTIH 1QVFO 3L35A 1BGYG 1KYOH 2YXRB 3RK2C 2WVRA 4H44D 4HM8A 3B5NB 3Q5RA 3L73D 2J59M 1G8JB 1J1EC 1HWTC 1U7JA 2M0BA 2JWDA 2QPZA 1O7HA 4D6TG 3TK1A 1EDJA 1DIPA 2B9BA 3N4XA 3H1IE 2IFNA 3NXSA 3V2QA 5KLVE 1SQBJ 1LWUC 1VF5D 1J1DC 1SQPG 3O6QA 4L74A 1X0TA 3RGUA 1L0ND 3AE7C 2OTLP 2N9BA 1U57A 3VCAA 3O6QB 1P84H 2JWAA 4JF7A 3GZXA 3RK2B 1CZQA 3BRVB 4U3FG 1KN7A 4L73A 4HM6A 3GL2A 4ASWA 3AE1C 1IK7A 4PJ0E 3GMAA 1NJIQ 3TSIA 3CC4P 2IYOA 2BMQA 1LT9C 1LWUA 1ULIA 1FQTA 2K88A 1X79B 4NBED 3RK3D 1LWUB 1NTZE 2W8ZA 1W5CE 1J1DB 3RL0D 2ZVOB 4OGQD 1NGMB 1NAFA 2Y9ZA 3A3YB 5B66H 1NU1D 4PD4E 2QIWA 1RF1C 1DX7A 3O8ZA 4N6JA 3CL3D 4JQ0D 1Q81Q 2M5AA 1O7PA 1LT9A 1NTKD 2HODA 2FYUG 1LJ2A 2M5AB 1AQTA 1PP9E 1LT9B 1M1KQ 1K8AQ 1DH3A 2HODB 2ZYAA 2IZ1A 1PGQA 1FOSE 3TF5A 1VQ9P 1LTTC 4AIVA 1MZ9A 4YTPC 1HUCA 3AE8C 1RF1A 2ZXXA 1LGHB 1QL2A 5AVTB 4C7NA 1KILE 3H1IG 2HLOA 4K35A 3A2AA 5KLVG 2Y0DA 1RF1B 1LTIC 3CWBJ 3KDPB 1Q82Q 2NVEA 2B1XA 3S9OA 4NB9D 4C7NB 1L4AD 3Q5SA 3FOUA 3K5BA 1ZP0C 3JSVC 2H8PD 4ASVA 1LTSC 5BU8B 4PD4I 4QMAA 3BCCD 1M56D 1A02F 3WUTA 1SQQE 3OAKA 3D71A 3LIEA 3KYQA 1SFCC 3AE9C 2O01N 3L71E 3G4SP 2QJKC 1USDA 3SSUA 2KSEA 2YMKA 1EZVE 3AEEC 3PRJA 4N78D 1NWQA 3CMEP 1NYHA 1GK4A 5CCGC 4NBDD 1KFMA 3D70A 2KI7B 1NTZG 5CCHD 3CXHE 3CCMP 3S4RA 3U1CA 2CPSA 3FGAD 1R8EA 5APYA 1LTGC 1KILC 4C7RA 2K37A 1IZNB 2PFXA 1GDTA 1MFZA 3C8VA 3QH9A 1HH0A 3CX5E 3FWNA 3L72D 3TGUE 3G3ZA 3E1IA 2Y0CA 2W6BA 5APWA 3H1LD 4PD4H 3L70D 1SQQK 3H6PA 1SQBG 2QJKB 4I6MC 2PP6A 1DEEG 1NH4A 1R5SA 2HMMA 4NB8D 2XRXA 4EDFA 1BE3E 1TU3F 1FZAA 3PH0A 1VQKP 2BEQD 5TISH 3A0BH 4WWIA 3H1JE 4DOJA 2YFIA 4WBAA 1KILA 1HGVA 1DD3A 1N2DC 1EZVI 3L4FA 1AQ5A 5KJ7D 2WSFH 2ZT9D 1KILB 4RESB 2A45G 5B5EE 2C9LY 1OW8A 5AW7B 1JY2P 2FY8A 1GTWA 5KLIC 3CXHI 1FZFA 4I7ZC 3AE3C 4U3FJ 1JMBA 1A02J 2IYPA 3VYIA 1L0LK 1HJBA 1GZLA 1W2EA 3H1HD 3C9IA 2HR3A 2KYVA 3CX5I 1K05A 1IJDB 1U7MA 2IFMA 1GD2E 1RF0C 1JY3O 3AE6C 1W2BO 1EZVG 3MIWA 2RH0A 3CD6P 1S9KE 1N86A 2V7QH 1YITP 4H0LC 2B88A 2LXBA 2Y9YA 1OW6A 3NTNA 1RE4C 3OW2O 4AQRD 5KAFE 2D2CC 3A5TA 3H32A 5KLIB 3KZIH 2OTKE 4I7ZB 3HD7A 1S4XA 1BCCD 4P1BH 5AW0B 3MUDC 2WSCH 1L0NE 4O9BA 1PZQA 1S1CX 2FYUJ 1YTZT 3CXHH 3H32B 4GKGA 1CSBA 3HD7B 1UIIA 2XU6A 1P84E 2Q3EA 1OVVA 1HVVA 1PPJG 1IO4A 4ZNCA 2E76C 1ZMEC 3MHVA 1VDFA 1RE4A 4W7YA 1X22A 3RBZA 2FBWC 1FOSF 3CX5H 1OW7A 2N1TD 4H0LB 1EDIA 2KOGA 2NVFA 4H13D 1SJGA 3H1IJ 3AECC 3H1JG 4HKZH 2FYNC 4NBBD 1VQ7P 3EN1A 3VN0A 5KLVJ 3MUDA 4TT3H 3USSA 1KMIZ 1SQXD 2Z5IA 1UUVA 3V5BA 1ZR4A 4QCKA 4A7PA 3Q5PA 2WITA 2K1AA 1M8OB 1NTMD 2BCCE 2I7FA 2XZRA 1OFCX 2IBZD 2K3RA 2NVGA 4WB4A 3PHLA 4GODA 3L74D 2YMYA 3CWBD 3H1KD 2J58A 3CCLP 3SWYA 1L0NK 4NPFX 4BRYA 4GDOA 1VF5C 1HTLC 2E76B 1NTKE 2QJPC 2R3SA 1Q2NA 1KB9D 4BRYB 3KPEA 3I55P 3L36A 2R3CA 1IFJA 1P84I 4GIFA 2YVJB 2FYNB 5AVXB 1FC2C 2P67A 2NUKA 4NPEA 1H0TA 5AVWB 2K9YA 2KK7A 1NHLA 2WWWA 2FKWB 4IFMA 1H0TB 2DE5D 5GTHH 1IK9A 1GL2C 2A06D 1KYOD 2H88C 1N8RQ 1WT6A 1NU1K 1VF5B 1YQ3C 2E75D 1LP1A 3GZYA 2ZYGA 2QJPB 1AJYA 1X9VA 1SQVD 2QE7H
chains in the Genus database with same CATH topology
3GL0A 1UUVA 4QCKA 5BOKA 1WQLA 3D89A 3L72E 3GZXA 4QUPA 1BCCE 3CWBE 4HM6A 2BCCE 1O7WA 2QJYC 3GL2A 4HM1A 3H1KE 2I7FA 3N0QA 1NYKA 1O7MA 2DE6D 2NVGA 3CX5E 2JZAA 3GTEA 4PV1D 2XR8A 2ZYLA 3TGUE 4HJLA 2XSHA 4NBHD 2BMQA 1NDOA 4QUQA 1VCKA 2NVEA 4NBCD 2B1XA 4HM7A 4NB9D 1KB9E 1ULIA 3FOUA 2HMMA 2XSOA 2XRXA 4NB8D 1FQTA 3AZCA 4QURA 1BE3E 2HMLA 1NTKE 2QJPC 3BCCE 2YIUC 2FYUE 1EG9A 2Q3WA 5CXMA 4AAYB 5HL4A 2YFLA 1L0LE 4HM4A 1VM9A 1G8KB 3EQQA 3GCEA 1RFSA 4NBED 3L73E 1SQPE 1NU1E 1NTZE 1ZRTE 4HM0A 2A06E 1O7NA 1O7GA 4H0LD 4H44D 4P1BH 5AEUA 3L75E 4HM8A 3H1JE 1ULJA 2GBWA 3GTSA 4OGQD 2DE7D 4NBFD 1SQQE 2BMOA 2YFIA 4QDCA 1L0NE 3H1HE 1G8JB 5KKZC 2YVJB 2BMRA 4P1CH 2HMNA 2HMJA 1SQBE 4PD4E 1SQVE 2QPZA 1O7HA 2D2CD 1JM1A 2NUKA 1P84E 4U3FE 4HM2A 3L71E 2ZT9D 2QJKC 2NUMA 1BGYE 2HMKA 1EZVE 4NBGD 1O7PA 2IBZE 3H1IE 1KYOE 2GBXA 4QDFA 3DQYA 3C0DA 3VMID 3VCPA 3VMGD 5KLVE 5KLIC 2E4QA 1RIEA 3L74E 1VF5D 4HKVA 3VMHD 2DE5D 4NBDD 5AEWA 3H1LE 4NBAD 3L70E 2NWFA 1PP9E 1SQXE 1Q90C 3GB4A 2NVFA 2E4PA 3CXHE 4QDDA 3GOBA 4QDFB 4H13D 1SJGA 4D6TE 3GKEA 2CKFA 4HM5A 2YFJA 4EMJB 4NBBD 2E76D 2FYNC 2JO6A 1UUWA 2E75D 1NTME 3EN1A 4HM3A 1PPJE 3GZYA 2B24A 2HMOA 2E74D 3VCAA 4AIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GL0 A;  1UUV A;  4QCK A;  5BOK A;  1WQL A;  3D89 A;  3L72 E;  3GZX A;  4QUP A;  1BCC E;  3CWB E;  4HM6 A;  2BCC E;  1O7W A;  2QJY C;  3GL2 A;  4HM1 A;  3H1K E;  2I7F A;  3N0Q A;  1NYK A;  1O7M A;  2DE6 D;  2NVG A;  3CX5 E;  2JZA A;  3GTE A;  4PV1 D;  2XR8 A;  2ZYL A;  3TGU E;  4HJL A;  2XSH A;  4NBH D;  2BMQ A;  1NDO A;  4QUQ A;  1VCK A;  2NVE A;  4NBC D;  2B1X A;  4HM7 A;  4NB9 D;  1KB9 E;  1ULI A;  3FOU A;  2HMM A;  2XSO A;  2XRX A;  4NB8 D;  1FQT A;  3AZC A;  4QUR A;  1BE3 E;  2HML A;  1NTK E;  2QJP C;  3BCC E;  2YIU C;  2FYU E;  1EG9 A;  2Q3W A;  5CXM A;  4AAY B;  5HL4 A;  2YFL A;  1L0L E;  4HM4 A;  1VM9 A;  1G8K B;  3EQQ A;  3GCE A;  1RFS A;  4NBE D;  3L73 E;  1SQP E;  1NU1 E;  1NTZ E;  1ZRT E;  4HM0 A;  2A06 E;  1O7N A;  1O7G A;  4H0L D;  4H44 D;  4P1B H;  5AEU A;  3L75 E;  4HM8 A;  3H1J E;  1ULJ A;  2GBW A;  3GTS A;  4OGQ D;  2DE7 D;  4NBF D;  1SQQ E;  2BMO A;  2YFI A;  4QDC A;  1L0N E;  3H1H E;  1G8J B;  5KKZ C;  2YVJ B;  2BMR A;  4P1C H;  2HMN A;  2HMJ A;  1SQB E;  4PD4 E;  1SQV E;  2QPZ A;  1O7H A;  2D2C D;  1JM1 A;  2NUK A;  1P84 E;  4U3F E;  4HM2 A;  3L71 E;  2ZT9 D;  2QJK C;  2NUM A;  1BGY E;  2HMK A;  1EZV E;  4NBG D;  1O7P A;  2IBZ E;  3H1I E;  1KYO E;  2GBX A;  4QDF A;  3DQY A;  3C0D A;  3VMI D;  3VCP A;  3VMG D;  5KLV E;  5KLI C;  2E4Q A;  1RIE A;  3L74 E;  1VF5 D;  4HKV A;  3VMH D;  2DE5 D;  4NBD D;  5AEW A;  3H1L E;  4NBA D;  3L70 E;  2NWF A;  1PP9 E;  1SQX E;  1Q90 C;  3GB4 A;  2NVF A;  2E4P A;  3CXH E;  4QDD A;  3GOB A;  4QDF B;  4H13 D;  1SJG A;  4D6T E;  3GKE A;  2CKF A;  4HM5 A;  2YFJ A;  4EMJ B;  4NBB D;  2E76 D;  2FYN C;  2JO6 A;  1UUW A;  2E75 D;  1NTM E;  3EN1 A;  4HM3 A;  1PPJ E;  3GZY A;  2B24 A;  2HMO A;  2E74 D;  3VCA A;  4AIV A; 
#chains in the Genus database with same CATH topology
 2CPB A;  2QM8 A;  5KAF H;  1PP9 J;  3QWO C;  2WT7 A;  1E79 H;  2V4H A;  1BGY D;  5M1B A;  2Q9I A;  1NTK K;  3B5N D;  3SWF A;  1LP1 B;  1MUU A;  3CMA P;  1M7L A;  3EWK A;  1T3U A;  2WSF J;  4KJM A;  3GTE A;  3V2R A;  1BDD A;  4JBZ A;  5E79 H;  2WT7 B;  2R44 A;  1IC2 A;  3W67 A;  2W6J H;  3VOP A;  3E1R A;  1PL5 A;  2YO2 A;  4D6T D;  1GL2 A;  2YFL A;  2NRG A;  3U59 A;  3W68 A;  1VM9 A;  3L75 J;  3PJS K;  1WMK A;  5AVV B;  2M3B A;  4LC1 A;  1GL2 B;  2P2U A;  2W27 A;  2BCC G;  1SQP D;  4P1C H;  1ZRT D;  2KSJ A;  1BSN A;  5APT A;  1VQ6 P;  3MZW B;  3RK2 D;  2WPQ A;  4AYC A;  2NPS C;  4B86 A;  2O01 H;  1KQF B;  4NBG D;  1SQQ J;  1T2K C;  3B71 A;  2V7Q J;  1IFN A;  4U3F D;  1K04 A;  1G1J A;  1OWA A;  3L71 J;  1SS1 A;  2JR8 A;  3H1L E;  3AEF C;  3L70 E;  5AW8 B;  1Q90 C;  3MGN A;  4NPD A;  1N7L A;  3GOB A;  3IF4 A;  1VQ4 P;  2KLV A;  4EMJ B;  5KAI E;  1UUW A;  2P1J A;  1VQL P;  2HMO A;  1NVO A;  5BOK A;  3Q2Y A;  1EXI A;  5TIS E;  3UIA A;  4W80 A;  3A0B E;  1FZG A;  2WTY A;  2NPS A;  2JZA A;  2P58 A;  1FBM A;  4XE5 B;  1HJ0 A;  3BRT B;  2HPC A;  1JY2 N;  2NPS B;  1AV1 A;  5HL4 A;  3TGU J;  1HBW A;  2WZ7 A;  2HPC B;  2OQQ A;  4HM4 A;  4HM0 A;  3P32 A;  1GK6 A;  4RJT A;  3L75 E;  2RKL A;  2FYU D;  2Q7C A;  2BMO A;  3AEG C;  1K9M Q;  1BE3 J;  3H1H E;  1G1I A;  1KQG B;  1RQU A;  3NFQ A;  4JYC A;  3U1A A;  5APX A;  3KXD A;  3H1J J;  3M0A A;  2QVA A;  3C0D A;  5CHX A;  2XND H;  2O3J A;  1KQS O;  3LW5 H;  3MTU E;  1VL2 A;  3V2N A;  3H1I D;  3G6E P;  1DEB A;  4K3A A;  5KLV D;  1AFO A;  1BSH A;  2OYH C;  3GF7 A;  1E5W A;  5CJ4 A;  2FFD C;  5AW5 B;  3KZI E;  3HE4 A;  1WQL A;  2KLU A;  4KT0 J;  4RO0 A;  1PGO A;  1BCC E;  2M3E A;  1FS0 E;  2ZJS E;  3OA7 A;  1JY2 O;  2JP3 A;  3CCJ P;  1IFP A;  3F5H A;  4ZMD A;  1OMI A;  3BAS A;  3G9R A;  2ZYL A;  3HE4 B;  4HJL A;  4Z1M H;  5APS A;  5DJU B;  1VQM P;  2GUS A;  4C46 A;  2XDJ A;  3L70 G;  4IL6 H;  3F89 A;  2XSO A;  4QUR A;  3AED C;  2C0W A;  1L0L E;  3ZDM A;  2SPZ A;  2KP8 A;  1RFS A;  2OYH A;  1URQ D;  1Y8A A;  3CLQ A;  2KUB A;  2FFD A;  5AEU A;  1USE A;  2GBW A;  1RE3 C;  4QDC A;  1JY3 N;  1MV8 A;  1XTG B;  2UWJ E;  1PP9 G;  2QM7 A;  2KB7 P;  1NTZ D;  2L5G B;  1FJP A;  1G2C A;  2OYH B;  2W6A A;  5KAI H;  2FFD B;  1LNQ A;  1PGP A;  2E5Y A;  2WPS A;  1L0N J;  2Q6Q A;  2IBZ E;  4PD4 D;  2MKV A;  5AW3 B;  3N7N A;  1G2C B;  2E74 C;  1FZE A;  1OVR A;  2P10 A;  3IR9 A;  3L74 E;  2HYN A;  1NAY A;  3HUS A;  1SFC D;  2LXC B;  3M9Q A;  1GW3 A;  2KNC A;  3L75 G;  1EDL A;  2G8Y A;  1JCD A;  1RE3 A;  1SQB D;  4M3L A;  3FXD A;  3HRN A;  2KNC B;  5CCG D;  3MP7 B;  4UB8 E;  5CBO A;  2Q1K A;  4HM1 A;  1NYK A;  2H7H A;  2JKV A;  3FXE A;  3SFE C;  4PV1 D;  1SQQ G;  3IFM A;  3HD7 C;  1NDO A;  4EI2 A;  1FDO A;  4NBC D;  2BCC J;  2RN0 A;  1KIL D;  3PLN A;  2Y0E A;  4IFD K;  3I56 P;  1WRG A;  5K5G B;  3L71 G;  1SQX K;  3V2P A;  1L2P A;  4EIJ A;  3A7O A;  2E74 B;  2WSS H;  3AEB C;  3L73 E;  5GTH E;  1NTM K;  2A06 E;  1R5L A;  2O1J A;  4U7J A;  2PAJ A;  3Q1M A;  1YYC A;  3VMA A;  3L37 A;  1NTK J;  5CMZ A;  4YXD C;  3VMZ A;  1SQV E;  1Y9B A;  4WY4 C;  3SWK A;  1N73 C;  1BGY E;  2LKM A;  2ZVN B;  3JCU H;  2C0X A;  1VQP P;  2ZXE B;  1L0L G;  5E79 E;  2PRR A;  3VMH D;  4BWN A;  1EZV D;  2JJL A;  2I1K A;  2JDI H;  3TGU G;  5AVU B;  3TDK A;  1EDK A;  2IPP A;  2YO3 A;  5APU A;  4D6T E;  2QEX P;  3T97 A;  1OZH A;  3TNU A;  2R5B A;  3BAT A;  3HE5 A;  4I2L C;  1BE3 G;  5BVZ A;  1N7S D;  2OTJ P;  3T97 B;  4WY4 A;  3TNU B;  1N73 A;  2XR8 A;  2R5D A;  3HE5 B;  3M06 A;  3VTP C;  2Q5U A;  4H44 C;  2VRS A;  3AE2 C;  2JO1 A;  4WY4 B;  3RK3 E;  1QGK B;  1T6A A;  3CX5 D;  1RY3 A;  1N73 B;  1HGZ A;  3FWL A;  2DW3 A;  1M1J C;  1IFM A;  3LW5 J;  1SQV K;  1PPJ D;  2QSI A;  5AVR B;  1FZC A;  3GCE A;  1J2J B;  3P7K A;  1NU1 E;  4H0L D;  3HTK A;  4JPZ B;  4JYB A;  4UB6 H;  3RL0 g;  4NBF D;  4GOE A;  3A0H E;  1FZC B;  4ZKP A;  3P8M C;  2D2C D;  3D6Z A;  3HTK B;  3H1J D;  3M9H A;  4HH2 A;  1IFD A;  1FDI A;  3B4S A;  3GW6 A;  4MN4 C;  2ZAE B;  1KB9 H;  3E7K A;  1AVO A;  4IFF A;  4Y28 J;  2GBX A;  4UB8 H;  2OGU A;  4EOT A;  2JEE A;  2E4Q A;  3CCU P;  1M1J A;  3L73 G;  3TYY A;  4H44 B;  2H43 A;  1VQ8 P;  1SQP K;  1YQ4 C;  4XA4 A;  2YFJ A;  2E76 D;  3JC2 2;  1M1J B;  3NMD A;  1YI2 P;  4OVN F;  1LTB C;  1M57 D;  1X8Y A;  3H1L J;  5H2F E;  4DCK A;  3L70 J;  2FXP A;  1RH5 B;  3I5C A;  4HJG H;  3N0Q A;  2B89 A;  3RK3 C;  3CCQ P;  2FXM A;  2P7J A;  1KQL A;  1L0N G;  3RL0 C;  4OGQ C;  2PGD A;  4QUQ A;  1NKN A;  5AW6 B;  3AZC A;  1S9K D;  2YIU C;  4TLF A;  3BCC E;  4YPC A;  1YJ9 P;  3Q3D A;  5BU5 A;  3GLM A;  2QA4 P;  1FU1 A;  1QEX A;  3PP5 A;  1PV3 A;  4R4M A;  1T3J A;  1HF9 A;  1ULJ A;  3SFD C;  1JO5 A;  3EFF K;  4N78 E;  1SLQ A;  4XFJ A;  2OYI C;  1NKZ B;  1ZV8 A;  2E42 A;  3CCE P;  3P8C D;  4HM2 A;  3CCS P;  1QL1 A;  1FJK A;  1YJN P;  1RHZ B;  2C9N Y;  4DJG A;  3H1H J;  2H89 C;  4GOF A;  4LGD E;  3VMI D;  2GUV A;  1P84 D;  1NO4 A;  3RK3 B;  2FYU K;  1NU1 G;  1RQV A;  3RL0 B;  1YBK A;  4OGQ B;  4IL6 E;  1J1E B;  1LTJ C;  2AXT E;  4HM3 A;  5APQ A;  5TJH A;  2YIU B;  1EXJ A;  2B24 A;  2IX7 C;  1VQ5 P;  1Y47 A;  1KFN A;  3L72 E;  4HYT B;  2OYI A;  1NTK G;  1L4A C;  2L91 A;  1ZOY C;  1GL2 D;  5AW4 B;  1KV4 A;  2YKQ A;  3M91 A;  3V4Q A;  3A0H H;  2XSH A;  2OYI B;  5APV A;  4NBH D;  4DZO A;  2BCC D;  5DJT B;  1BCC J;  5KLV K;  3RBX A;  2WSC J;  4HM7 A;  1YJW P;  2KXP B;  2XKM A;  1JM0 A;  2QRX A;  1LTJ A;  1AVY A;  3VP8 A;  2GM4 A;  1FZB A;  2O1K A;  1H89 A;  3GTS A;  2OYO A;  1L4A A;  2OAR A;  2Q3I A;  1LTJ B;  1L0L J;  4KHX A;  1SQB E;  1Q7Y Q;  3ABV C;  1JNM A;  5CCH C;  2HFE D;  1K73 Q;  1L4A B;  2HMK A;  1Z56 A;  5H2F H;  1AA0 A;  3CCR P;  1PIX A;  2MJZ A;  3MD0 A;  2QG4 A;  3BCC G;  1SQX J;  1RIE A;  1SVF A;  4WVZ A;  1QLE D;  2WSE H;  1NTM J;  2J5U A;  2E4P A;  2YXQ B;  1S5L E;  3G71 P;  1OIP A;  2NPS D;  1NTZ K;  1CI6 A;  1URQ C;  1D7M A;  1T2K D;  2IZ0 A;  1S72 P;  3L74 J;  3CI9 A;  3GL0 A;  2YKP A;  3H1K J;  1QVG O;  4QUP A;  3KHU A;  2FYZ A;  1GMJ A;  1CI6 B;  3V6I A;  1O7W A;  1Q90 D;  1XTC C;  5CCH A;  1S3J A;  4I1L A;  5AVY B;  4OH8 B;  1T8Z A;  3LID A;  2POH A;  2BEZ F;  1H88 A;  3JCU E;  1SQB K;  5EFW B;  2I8D A;  2RMZ A;  4AAY B;  2I1J A;  5KJ7 C;  1JTH A;  2ZT9 C;  1URQ A;  2WPV B;  2FXO A;  3AE4 C;  4EYY Q;  1O7N A;  3L72 G;  2WPR A;  4Y99 C;  4W7Z A;  2IDB A;  2KS1 A;  1IFI A;  3H1L G;  4PJ0 H;  1JTH B;  1URQ B;  2M8R A;  3CCV P;  3L73 J;  4N3Y B;  2AXT H;  3HUS C;  2E43 A;  2LR2 A;  1YHQ P;  2AEJ A;  4AUW A;  4PV1 C;  2KS1 B;  1VPC A;  4IOI H;  2G3A A;  1EC5 A;  3AEA C;  3WU2 E;  1SQV J;  1SFC A;  4NBA D;  5KJ7 A;  1SQX E;  3GB4 A;  1DD4 A;  1BGY J;  2R32 A;  4QDD A;  4L76 A;  2A45 I;  2CKF A;  2KIK A;  1NTM E;  1PPJ E;  3OJA B;  1SFC B;  2ZFC A;  3H25 A;  1LTA C;  4BXL A;  5CCG A;  2ZT9 B;  3V4W A;  3CWB E;  3ITK A;  4UB6 E;  4D6T J;  3H1K E;  5AVS B;  4Y99 B;  3B8E B;  2AEF A;  3BVH A;  3M0D C;  4CPG A;  2XNX A;  3AE5 C;  1GU5 A;  1FDM A;  3H1H G;  3HUS B;  1PP9 D;  4OWF A;  4PV1 B;  1KB9 E;  1LT1 A;  1KZU B;  1M90 Q;  1SQP J;  2XV5 A;  2Q3W A;  1G8K B;  3EQQ A;  1FE6 A;  1O7G A;  1JEK A;  3FX0 A;  1JCC A;  2O01 J;  1SP4 A;  2DE7 D;  2Z4E A;  2AXC A;  1PGJ A;  3VMX A;  3EQ2 A;  1N7S C;  1S5L H;  2HG5 D;  3M9B A;  2HMN A;  3IN6 A;  2KZJ A;  2N1T C;  1NU1 J;  3L75 D;  2B87 A;  2K9J A;  3GG2 A;  3M0D A;  4H13 C;  2A45 H;  3EFG A;  1VQO P;  5GTI E;  1KYO E;  1JMM A;  1BCC G;  1GW4 A;  2B87 B;  2K9J B;  2YNY A;  3WMM 0;  4HKV A;  3WUU A;  5AEW A;  1OX3 A;  1ZR2 A;  2NWF A;  5AW1 B;  2IBZ I;  4L75 A;  3S1K A;  1SQQ D;  1NOH A;  4LLH A;  5CBN A;  2E74 D;  4IL6 X;  5C39 A;  1N7S A;  3L71 D;  2N1T A;  4RKU J;  2QJY C;  5L8R J;  2DE6 D;  2ITA A;  1FZC C;  1ZXG A;  2YKO A;  1N7S B;  1KB9 I;  3P8C E;  1OXZ A;  2WQY C;  2N1T B;  2NZ2 A;  1H8A A;  1VCK A;  2CK3 H;  5AVZ B;  3CXH D;  4H13 B;  1RF0 A;  3C1L A;  1SQX G;  3GHG C;  1JOC A;  1ZW0 A;  5CXM A;  5AVQ B;  5KTB A;  2WMM A;  1NTM G;  3WU2 H;  2WSE J;  1SQP E;  2IBZ G;  2Z5H A;  1ZRT E;  5AW9 B;  1JB0 J;  1MFT A;  3HD7 D;  1S2E A;  1FAV A;  1KTM A;  1Q86 Q;  2KZI A;  3L74 G;  1L0L D;  3CWB G;  1ZLL A;  1GU4 A;  3BCC J;  3H1K G;  5KKZ C;  4DT0 A;  2BMR A;  2W90 A;  3CC2 P;  1YIJ P;  3TGU D;  2HMJ A;  5CJ0 A;  1JUN A;  1KC8 Q;  3VP9 A;  1JM1 A;  1KYO I;  4U3F E;  1KD1 Q;  2N9Y B;  3R4Y A;  5AW2 B;  2NUM A;  2ZYD A;  2E75 C;  2QJY B;  3WUV A;  2D2C B;  4QDF A;  1BE3 D;  3DQY A;  1JY3 P;  3VCP A;  3VMG D;  3GHG A;  4R4L A;  2E5T A;  3GF3 A;  3B5N C;  4WY4 D;  1EQ7 A;  5B66 E;  1QX8 A;  2GA1 A;  4QDF B;  3GKE A;  4HM5 A;  3IAO A;  3CC7 P;  1BDC A;  2JO6 A;  1UIX A;  3GHG B;  2BAS A;  1S5L X;  4HB1 A;  1PFI A;  3D6Y A;  3II6 A;  1CW5 A;  3D89 A;  1OVU A;  3VMY A;  1MKM A;  3CPW O;  1ZN5 A;  5B5E H;  1O7M A;  3KQG A;  1KOR A;  2A06 G;  3R2P A;  5KKZ B;  1YTZ I;  3L72 J;  4GT1 A;  2AEM A;  3PTZ A;  2W83 C;  4ZKU A;  1SQV G;  3B5N A;  2E75 B;  4YXW H;  2HML A;  2FYU E;  1VQN P;  1EG9 A;  1NTZ J;  5GTI H;  1QVF O;  3L35 A;  1BGY G;  1KYO H;  2YXR B;  3RK2 C;  2WVR A;  4H44 D;  4HM8 A;  3B5N B;  3Q5R A;  3L73 D;  2J59 M;  1G8J B;  1J1E C;  1HWT C;  1U7J A;  2M0B A;  2JWD A;  2QPZ A;  1O7H A;  4D6T G;  3TK1 A;  1EDJ A;  1DIP A;  2B9B A;  3N4X A;  3H1I E;  2IFN A;  3NXS A;  3V2Q A;  5KLV E;  1SQB J;  1LWU C;  1VF5 D;  1J1D C;  1SQP G;  3O6Q A;  4L74 A;  1X0T A;  3RGU A;  1L0N D;  3AE7 C;  2OTL P;  2N9B A;  1U57 A;  3VCA A;  3O6Q B;  1P84 H;  2JWA A;  4JF7 A;  3GZX A;  3RK2 B;  1CZQ A;  3BRV B;  4U3F G;  1KN7 A;  4L73 A;  4HM6 A;  3GL2 A;  4ASW A;  3AE1 C;  1IK7 A;  4PJ0 E;  3GMA A;  1NJI Q;  3TSI A;  3CC4 P;  2IYO A;  2BMQ A;  1LT9 C;  1LWU A;  1ULI A;  1FQT A;  2K88 A;  1X79 B;  4NBE D;  3RK3 D;  1LWU B;  1NTZ E;  2W8Z A;  1W5C E;  1J1D B;  3RL0 D;  2ZVO B;  4OGQ D;  1NGM B;  1NAF A;  2Y9Z A;  3A3Y B;  5B66 H;  1NU1 D;  4PD4 E;  2QIW A;  1RF1 C;  1DX7 A;  3O8Z A;  4N6J A;  3CL3 D;  4JQ0 D;  1Q81 Q;  2M5A A;  1O7P A;  1LT9 A;  1NTK D;  2HOD A;  2FYU G;  1LJ2 A;  2M5A B;  1AQT A;  1PP9 E;  1LT9 B;  1M1K Q;  1K8A Q;  1DH3 A;  2HOD B;  2ZYA A;  2IZ1 A;  1PGQ A;  1FOS E;  3TF5 A;  1VQ9 P;  1LTT C;  4AIV A;  1MZ9 A;  4YTP C;  1HUC A;  3AE8 C;  1RF1 A;  2ZXX A;  1LGH B;  1QL2 A;  5AVT B;  4C7N A;  1KIL E;  3H1I G;  2HLO A;  4K35 A;  3A2A A;  5KLV G;  2Y0D A;  1RF1 B;  1LTI C;  3CWB J;  3KDP B;  1Q82 Q;  2NVE A;  2B1X A;  3S9O A;  4NB9 D;  4C7N B;  1L4A D;  3Q5S A;  3FOU A;  3K5B A;  1ZP0 C;  3JSV C;  2H8P D;  4ASV A;  1LTS C;  5BU8 B;  4PD4 I;  4QMA A;  3BCC D;  1M56 D;  1A02 F;  3WUT A;  1SQQ E;  3OAK A;  3D71 A;  3LIE A;  3KYQ A;  1SFC C;  3AE9 C;  2O01 N;  3L71 E;  3G4S P;  2QJK C;  1USD A;  3SSU A;  2KSE A;  2YMK A;  1EZV E;  3AEE C;  3PRJ A;  4N78 D;  1NWQ A;  3CME P;  1NYH A;  1GK4 A;  5CCG C;  4NBD D;  1KFM A;  3D70 A;  2KI7 B;  1NTZ G;  5CCH D;  3CXH E;  3CCM P;  3S4R A;  3U1C A;  2CPS A;  3FGA D;  1R8E A;  5APY A;  1LTG C;  1KIL C;  4C7R A;  2K37 A;  1IZN B;  2PFX A;  1GDT A;  1MFZ A;  3C8V A;  3QH9 A;  1HH0 A;  3CX5 E;  3FWN A;  3L72 D;  3TGU E;  3G3Z A;  3E1I A;  2Y0C A;  2W6B A;  5APW A;  3H1L D;  4PD4 H;  3L70 D;  1SQQ K;  3H6P A;  1SQB G;  2QJK B;  4I6M C;  2PP6 A;  1DEE G;  1NH4 A;  1R5S A;  2HMM A;  4NB8 D;  2XRX A;  4EDF A;  1BE3 E;  1TU3 F;  1FZA A;  3PH0 A;  1VQK P;  2BEQ D;  5TIS H;  3A0B H;  4WWI A;  3H1J E;  4DOJ A;  2YFI A;  4WBA A;  1KIL A;  1HGV A;  1DD3 A;  1N2D C;  1EZV I;  3L4F A;  1AQ5 A;  5KJ7 D;  2WSF H;  2ZT9 D;  1KIL B;  4RES B;  2A45 G;  5B5E E;  2C9L Y;  1OW8 A;  5AW7 B;  1JY2 P;  2FY8 A;  1GTW A;  5KLI C;  3CXH I;  1FZF A;  4I7Z C;  3AE3 C;  4U3F J;  1JMB A;  1A02 J;  2IYP A;  3VYI A;  1L0L K;  1HJB A;  1GZL A;  1W2E A;  3H1H D;  3C9I A;  2HR3 A;  2KYV A;  3CX5 I;  1K05 A;  1IJD B;  1U7M A;  2IFM A;  1GD2 E;  1RF0 C;  1JY3 O;  3AE6 C;  1W2B O;  1EZV G;  3MIW A;  2RH0 A;  3CD6 P;  1S9K E;  1N86 A;  2V7Q H;  1YIT P;  4H0L C;  2B88 A;  2LXB A;  2Y9Y A;  1OW6 A;  3NTN A;  1RE4 C;  3OW2 O;  4AQR D;  5KAF E;  2D2C C;  3A5T A;  3H32 A;  5KLI B;  3KZI H;  2OTK E;  4I7Z B;  3HD7 A;  1S4X A;  1BCC D;  4P1B H;  5AW0 B;  3MUD C;  2WSC H;  1L0N E;  4O9B A;  1PZQ A;  1S1C X;  2FYU J;  1YTZ T;  3CXH H;  3H32 B;  4GKG A;  1CSB A;  3HD7 B;  1UII A;  2XU6 A;  1P84 E;  2Q3E A;  1OVV A;  1HVV A;  1PPJ G;  1IO4 A;  4ZNC A;  2E76 C;  1ZME C;  3MHV A;  1VDF A;  1RE4 A;  4W7Y A;  1X22 A;  3RBZ A;  2FBW C;  1FOS F;  3CX5 H;  1OW7 A;  2N1T D;  4H0L B;  1EDI A;  2KOG A;  2NVF A;  4H13 D;  1SJG A;  3H1I J;  3AEC C;  3H1J G;  4HKZ H;  2FYN C;  4NBB D;  1VQ7 P;  3EN1 A;  3VN0 A;  5KLV J;  3MUD A;  4TT3 H;  3USS A;  1KMI Z;  1SQX D;  2Z5I A;  1UUV A;  3V5B A;  1ZR4 A;  4QCK A;  4A7P A;  3Q5P A;  2WIT A;  2K1A A;  1M8O B;  1NTM D;  2BCC E;  2I7F A;  2XZR A;  1OFC X;  2IBZ D;  2K3R A;  2NVG A;  4WB4 A;  3PHL A;  4GOD A;  3L74 D;  2YMY A;  3CWB D;  3H1K D;  2J58 A;  3CCL P;  3SWY A;  1L0N K;  4NPF X;  4BRY A;  4GDO A;  1VF5 C;  1HTL C;  2E76 B;  1NTK E;  2QJP C;  2R3S A;  1Q2N A;  1KB9 D;  4BRY B;  3KPE A;  3I55 P;  3L36 A;  2R3C A;  1IFJ A;  1P84 I;  4GIF A;  2YVJ B;  2FYN B;  5AVX B;  1FC2 C;  2P67 A;  2NUK A;  4NPE A;  1H0T A;  5AVW B;  2K9Y A;  2KK7 A;  1NHL A;  2WWW A;  2FKW B;  4IFM A;  1H0T B;  2DE5 D;  5GTH H;  1IK9 A;  1GL2 C;  2A06 D;  1KYO D;  2H88 C;  1N8R Q;  1WT6 A;  1NU1 K;  1VF5 B;  1YQ3 C;  2E75 D;  1LP1 A;  3GZY A;  2ZYG A;  2QJP B;  1AJY A;  1X9V A;  1SQV D;  2QE7 H; 
#chains in the Genus database with same CATH homology
 3GL0 A;  1UUV A;  4QCK A;  5BOK A;  1WQL A;  3D89 A;  3L72 E;  3GZX A;  4QUP A;  1BCC E;  3CWB E;  4HM6 A;  2BCC E;  1O7W A;  2QJY C;  3GL2 A;  4HM1 A;  3H1K E;  2I7F A;  3N0Q A;  1NYK A;  1O7M A;  2DE6 D;  2NVG A;  3CX5 E;  2JZA A;  3GTE A;  4PV1 D;  2XR8 A;  2ZYL A;  3TGU E;  4HJL A;  2XSH A;  4NBH D;  2BMQ A;  1NDO A;  4QUQ A;  1VCK A;  2NVE A;  4NBC D;  2B1X A;  4HM7 A;  4NB9 D;  1KB9 E;  1ULI A;  3FOU A;  2HMM A;  2XSO A;  2XRX A;  4NB8 D;  1FQT A;  3AZC A;  4QUR A;  1BE3 E;  2HML A;  1NTK E;  2QJP C;  3BCC E;  2YIU C;  2FYU E;  1EG9 A;  2Q3W A;  5CXM A;  4AAY B;  5HL4 A;  2YFL A;  1L0L E;  4HM4 A;  1VM9 A;  1G8K B;  3EQQ A;  3GCE A;  1RFS A;  4NBE D;  3L73 E;  1SQP E;  1NU1 E;  1NTZ E;  1ZRT E;  4HM0 A;  2A06 E;  1O7N A;  1O7G A;  4H0L D;  4H44 D;  4P1B H;  5AEU A;  3L75 E;  4HM8 A;  3H1J E;  1ULJ A;  2GBW A;  3GTS A;  4OGQ D;  2DE7 D;  4NBF D;  1SQQ E;  2BMO A;  2YFI A;  4QDC A;  1L0N E;  3H1H E;  1G8J B;  5KKZ C;  2YVJ B;  2BMR A;  4P1C H;  2HMN A;  2HMJ A;  1SQB E;  4PD4 E;  1SQV E;  2QPZ A;  1O7H A;  2D2C D;  1JM1 A;  2NUK A;  1P84 E;  4U3F E;  4HM2 A;  3L71 E;  2ZT9 D;  2QJK C;  2NUM A;  1BGY E;  2HMK A;  1EZV E;  4NBG D;  1O7P A;  2IBZ E;  3H1I E;  1KYO E;  2GBX A;  4QDF A;  3DQY A;  3C0D A;  3VMI D;  3VCP A;  3VMG D;  5KLV E;  5KLI C;  2E4Q A;  1RIE A;  3L74 E;  1VF5 D;  4HKV A;  3VMH D;  2DE5 D;  4NBD D;  5AEW A;  3H1L E;  4NBA D;  3L70 E;  2NWF A;  1PP9 E;  1SQX E;  1Q90 C;  3GB4 A;  2NVF A;  2E4P A;  3CXH E;  4QDD A;  3GOB A;  4QDF B;  4H13 D;  1SJG A;  4D6T E;  3GKE A;  2CKF A;  4HM5 A;  2YFJ A;  4EMJ B;  4NBB D;  2E76 D;  2FYN C;  2JO6 A;  1UUW A;  2E75 D;  1NTM E;  3EN1 A;  4HM3 A;  1PPJ E;  3GZY A;  2B24 A;  2HMO A;  2E74 D;  3VCA A;  4AIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...