3BCCJ

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
59
structure length
59
Chain Sequence
TLTARLYSLLFRRTSTFALTIVVGALLFERAFDQGADAIYEHINEGKLWKHIKHKYENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
total genus 20
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3bccJ00
1EZVI 3H1HJ 1NU1J 3H1KJ 4D6TJ 1SQXJ 2BCCJ 2FYUJ 2IBZI 3CWBJ 5KLVJ 1L0LJ 1L0NJ 3H1JJ 3L70J 3H1IJ 1NTKJ 3TGUJ 3L72J 1SQBJ 3H1LJ 3L74J 1P84I 1KYOI 4U3FJ 1BGYJ 3L75J 1NTZJ 3L71J 1NTMJ 3CX5I 1SQVJ 4PD4I 1KB9I 1PP9J 1SQPJ 1BE3J 1SQQJ 3BCCJ 3L73J 1BCCJ 3CXHI
chains in the Genus database with same CATH superfamily
1JY2O 4GKGA 3CLQA 1MKMA 1PPJE 2W6AA 1JY3P 3FWNA 1KILC 2IZ1A 3C8VA 3HUSA 3PH0A 2UWJE 4L74A 3W67A 2R44A 4WY4A 1FZCB 1EDLA 3L73D 3WUUA 3Q5PA 1PP9G 5M1BA 3CCMP 1URQA 4AYCA 2OGUA 2K9JA 1EZVE 3Q1MA 1QVGO 2K1AA 3H1IJ 2Q7CA 1JO5A 1PGOA 1SLQA 2ITAA 3JC22 1AFOA 2JWAA 2ZXXA 3H1LJ 2E43A 1NTMK 1JY3N 1URQB 3VTPC 1OVRA 2O3JA 2M5AA 2JDIH 3CWBD 4XA4A 2W6JH 5KKZC 1L0ND 4DOJA 3Q3DA 2IBZD 1SQBD 1MFZA 2Q5UA 1FZCA 1D7MA 4TLFA 1NU1D 3L71E 1NTKD 2XU6A 3IAOA 1NTMJ 2ZAEB 3T97A 1SS1A 2E76C 4OH8B 1ZLLA 3G3ZA 3CCQP 1M56D 1ZRTE 2N1TB 3L73J 3L75E 1BCCJ 1FDOA 2O01H 3AEDC 3TK1A 5CCHA 1IK9A 5GTHH 4W80A 1NWQA 2H43A 1SFCC 4D6TG 1AVYA 1SQXG 3CX5H 4WVZA 2KS1A 4DZOA 1DEBA 1Z56A 2HODA 2ZT9D 4Y28J 2YIUC 5CCGD 1SQPK 3BRTB 2E74D 1BE3D 4JPZB 2R3CA 2P7JA 1L0NJ 1FAVA 5AVTB 5TJHA 1IJDB 1EZVD 1UIIA 3H1JD 1NTKJ 3HTKB 2K3RA 5AVXB 2QSIA 3VP9A 1YJWP 3F5HA 1NJIQ 1BSHA 1M1KQ 3MUDA 3Q5SA 3SWFA 1IFMA 3NTNA 3GF3A 1T3JA 1YTZI 3FXEA 2QM7A 3FWLA 5KLVG 1YJNP 2MKVA 1NTKE 5AVRB 2P58A 3A2AA 3AE2C 3AEBC 2ZT9C 2H8PD 1SQVJ 3GG2A 4ZMDA 1XTGB 1RHZB 1OFCX 1R5LA 1EDKA 2BASA 1SQXK 1ZXGA 1JCDA 1CZQA 2N9YB 3HE4B 3L75D 2A06E 3B5NA 3L4FA 1DEEG 2D2CD 2LXCB 3U1AA 2JKVA 1S5LH 1BSNA 1JMBA 1P84H 1YTZT 1SQPE 2KP8A 3V2NA 3JSVC 4GODA 2AEFA 1KFMA 1SQVK 1NU1J 1VPCA 3CXHE 1M1JA 2A45G 3HD7C 2Q3IA 1W5CE 1N8RQ 1M57D 3TDKA 3D70A 1N7SC 2KB7P 2QJYC 3HD7B 1NKNA 4JYCA 2B88A 2WSSH 2W83C 3C1LA 3AE8C 1IFPA 3RK2B 2Q1KA 1TU3F 1G1JA 5APSA 3TGUJ 3RK3B 3TYYA 3CC7P 1VF5D 2FFDC 2E74C 3ZDMA 1M90Q 3PJSK 1LWUB 1KQFB 2CPSA 2WITA 1OW6A 2QJKC 2Y0DA 1HVVA 1X9VA 1FJPA 3HE4A 2JWDA 1LNQA 3HD7D 2WZ7A 1NTME 3RL0g 2E75B 4PJ0H 3WUVA 4IFFA 4AQRD 2AXCA 5KTBA 2P67A 3CMEP 4K3AA 3VMZA 1KMIZ 1KB9H 3H32B 3P8MC 1KQSO 2FYUG 1RE4A 1N7SD 1QEXA 3FX0A 4JBZA 3CI9A 4YXDC 3G4SP 1L0LG 5C39A 5CCGA 3D71A 1QVFO 2H7HA 2C9LY 2FXPA 2BCCE 2WMMA 3L70E 3E7KA 4NPDA 1RE3A 2K88A 1FBMA 1RE3C 5CCHD 3ITKA 1K05A 5AVSB 1AVOA 3CPWO 1N2DC 1XTCC 2B87B 2HODB 1P84I 2QVAA 2YXRB 2HLOA 4ZNCA 1GDTA 2IYPA 1N86A 3M9BA 2Z4EA 1YIJP 1K73Q 3CCJP 2YKOA 1BGYJ 5KJ7A 2KOGA 4RJTA 1SQVE 1SQBK 2KUBA 5BVZA 1YI2P 1L4AA 1RF0C 1SQBG 1T8ZA 1URQD 1X79B 2P10A 2QJKB 2W8ZA 1SQQJ 2JP3A 2WSEH 4H13D 4LGDE 5AVUB 5AW0B 4C46A 4EI2A 1EDJA 4OGQD 1S9KE 3L72E 2XNDH 2OYOA 3L35A 1NTKK 5AW2B 2OYIC 3BRVB 2JR8A 3E1IA 1GTWA 3A3YB 3R4YA 3B71A 4UB8H 3MTUE 2OYIB 1LGHB 1IK7A 4UB6H 2BCCD 1JCCA 1GK4A 3H1JJ 1GMJA 2W27A 2E75C 5BU5A 3H1HE 5APXA 2WTYA 1GU5A 2WWWA 2GM4A 4W7YA 1IFNA 3EFFK 4H0LD 1L4AB 1MUUA 3H1KG 2FYUK 5AVYB 3LIEA 5AW5B 3TNUA 3VOPA 3WMM0 3D6YA 3PLNA 1J2JB 2O01J 5KAIE 2PGDA 1BDDA 4WWIA 3M0AA 3KYQA 2KXPB 4IOIH 4B86A 1SQVD 2L91A 5KLIC 2FY8A 4PD4H 1EQ7A 1X22A 2YMKA 2OYHA 3WU2E 1PP9J 4NPFX 2E5YA 3RL0D 4ASVA 4C7NA 4QMAA 1NHLA 2HPCB 3IFMA 1HGZA 1RF0A 4GIFA 3WU2H 5CJ0A 3L72D 3RGUA 2OQQA 4H44C 1ZR4A 2OTJP 1J1EB 2OTKE 2WSEJ 3L75G 4U3FD 3GLMA 2XKMA 2QA4P 3H1IE 3OAKA 1SQXJ 3L73E 4D6TE 4H13B 3SSUA 1N73C 1YQ3C 1NGMB 1SQXE 1J1DC 4M3LA 3UIAA 4H0LC 3WUTA 1FJKA 2FFDA 2OARA 1S1CX 5B5EH 3H1HD 1GL2D 2FBWC 1DX7A 3SWYA 1KILD 1SVFA 2QIWA 4HJGH 2E75D 4TT3H 3NMDA 5AW8B 4GOFA 1BGYG 1RE4C 1JY3O 2DW3A 2POHA 2Q3EA 3H1LE 1HWTC 1Q86Q 3R2PA 2IZ0A 2YXQB 3M9QA 1A02J 1NAFA 3TSIA 2NPSC 1OWAA 3IF4A 1U57A 1NAYA 3B4SA 1RQVA 3BVHA 2HPCA 1H0TA 4C7RA 2Y0CA 3FGAD 3MGNA 3OA7A 2FXMA 4WB4A 5APTA 2KNCA 1SFCB 5KLVK 1GZLA 3H1HJ 4ZKPA 3TGUE 4U3FE 3EQ2A 1QL2A 1M1JB 1NTZE 1WMKA 3H1ID 5AVVB 3BCCE 2PP6A 2R5DA 3P8CE 1LT1A 1SQPG 3TNUB 2RMZA 3V2RA 4EYYQ 1VQ4P 3QH9A 4DT0A 1VQ9P 2ZJSE 1L0LD 1SFCD 2IYOA 5CHXA 3T97B 2K9YA 1Y9BA 1LTJB 2Q6QA 1PGQA 1KILE 1SQBJ 1USDA 1NO4A 2VRSA 2KSJA 3AEGC 1URQC 1VL2A 3MP7B 2GA1A 2LKMA 2WPVB 4GDOA 3CCUP 2KK7A 1SQQK 2OYIA 1OIPA 1HF9A 2C9NY 1VQ6P 1KYOE 3GW6A 3II6A 3RK2D 1ZR2A 4YXWH 4R4MA 1P84D 2K9JB 3M0DC 3HE5B 3KQGA 1VQLP 1KTMA 2I1JA 2KI7B 4O9BA 1HGVA 5KAFH 5E79E 4EDFA 1EZVI 4N6JA 5DJUB 1NTZK 1PP9D 3AE5C 1JEKA 4GOEA 2YKQA 2ZVNB 3CXHD 3U59A 5BU8B 4RO0A 5AW4B 1DD4A 2BCCJ 1USEA 1NKZB 2FYUJ 3BCCD 3I55P 2P1JA 1H8AA 1Q2NA 1SQQG 1U7MA 3M91A 2KZJA 1PFIA 3PP5A 1X8YA 1L0LE 3CWBG 3OJAB 1T6AA 1L0NG 1N7SA 5KAFE 2E76B 2IBZG 3BATA 2A45H 1K8AQ 3CC4P 1NU1G 1Y8AA 1LTAC 1LTTC 3D6ZA 3V4QA 1KC8Q 3S9OA 2Q9IA 1ZW0A 3L74E 3MIWA 3VMAA 3GF7A 3H1KD 3CXHH 3H25A 1AQ5A 1MV8A 3C9IA 1P84E 2YO3A 4AUWA 2WQYC 2RH0A 1VF5C 4H0LB 3RBZA 4XE5B 1PPJG 1SP4A 1QLED 4IL6E 2JEEA 1SQVG 3V2QA 3M0DA 4IFDK 1NVOA 4PV1B 3VMXA 1BE3G 3OW2O 3AECC 4PD4D 1GL2C 1LTIC 1LWUA 1PP9E 3LW5J 3NFQA 1VQ5P 1J1EC 1VQKP 1RF1C 1RQUA 3CCSP 1HH0A 1EZVG 5AW1B 3H1JG 2Y0EA 2FXOA 1JNMA 2P2UA 3S1KA 1OW7A 3VMYA 3SFEC 3L70D 2M8RA 2KNCB 2W6BA 3GMAA 3B8EB 1T2KC 4H44D 1FZBA 2YO2A 2ZYGA 5DJTB 2XDJA 1DH3A 1KN7A 2H89C 1QL1A 1L4AD 1A02F 3L74D 3KPEA 2WSCH 3AE3C 3K5BA 3H1KE 3I5CA 2YMYA 1GW3A 5AW9B 4Z1MH 1RH5B 1BGYD 4PJ0E 1FZAA 3CX5I 4PD4I 1JMMA 5GTHE 3L71G 1ZN5A 1OX3A 5CBNA 3SWKA 1BDCA 1FDIA 3A0BE 1K04A 1KQGB 1PV3A 1NYHA 2RKLA 1E79H 2HYNA 2NZ2A 4PV1D 2FYZA 3H1KJ 4OGQB 2PFXA 3MUDC 1J1DB 2CPBA 3RL0C 1H88A 2MJZA 1KQLA 1L2PA 3CWBJ 4Y99B 1L0LJ 4HH2A 1KD1Q 4N3YB 1LTJC 5EFWB 3HTKA 2IFMA 2RN0A 2E42A 3HRNA 5AVQB 3L37A 2OYHB 1AQTA 1OMIA 2I8DA 3CX5D 1RF1A 3CC2P 3G71P 1EC5A 1JB0J 1KYOI 1S5LE 2E76D 4N78D 1N7LA 2NPSB 4EIJA 1NTZJ 4BXLA 2A06G 1BGYE 3AE1C 2ZFCA 2N1TA 4RESB 4BRYB 5GTIE 5KLVE 1PGPA 1FOSF 1OZHA 1BE3J 4IL6H 3V6IA 1L4AC 1EDIA 2H88C 4R4LA 4ZKUA 2K37A 1CSBA 4LC1A 2WPSA 5CJ4A 2O01N 1Q90D 1FU1A 4D6TD 1IC2A 1SQXD 3Q2YA 1R5SA 4I7ZC 1G2CB 1LTJA 1G2CA 1S2EA 2PRRA 2YNYA 3A7OA 3L36A 2LR2A 1LTBC 2XNXA 2L5GB 1JY2P 3M9HA 1JY2N 3N7NA 1SQQD 3AEEC 5CCGC 3USSA 1OVUA 3CX5E 3P32A 4WY4B 1VDFA 3A0BH 2M3BA 1IZNB 2NPSD 3H1LD 1NTMG 1QX8A 2IX7C 2KZIA 3AE6C 3KHUA 4HB1A 5CCHC 3CCVP 1FZGA 3B5NC 3E1RA 5KLIB 1SFCA 4YTPC 1CI6B 1BCCG 1AA0A 1HTLC 2N9BA 2R5BA 1SQPJ 5E79H 5H2FH 5KLVD 3VP8A 3VN0A 4DJGA 3I56P 3CCRP 1VQNP 1H0TB 1AJYA 4JF7A 2QJPB 2J59M 2NPSA 1GU4A 2OYHC 3O6QA 1JTHA 3EWKA 3NXSA 5L8RJ 1VQ8P 2BCCG 1PPJD 4WBAA 1VQOP 1KYOH 5KKZB 5CBOA 2AXTH 3TGUD 5K5GB 5AW3B 1NTZD 2V7QH 1H89A 3B5NB 2IBZI 3P8CD 4I1LA 1FS0E 5APVA 3RL0B 3H32A 2Z5IA 1W2BO 1IFJA 1FC2C 1JOCA 2WSFH 2QG4A 1LT9B 3AE7C 1SQQE 1M7LA 3L70G 5TISE 1ZP0C 4IFMA 2YKPA 2C0XA 3CWBE 1MFTA 1FDMA 3A0HE 1L0NE 1LWUC 1S3JA 1NH4A 4U3FJ 2BEQD 1KYOD 5AW6B 2AEJA 1GL2A 3IR9A 2GUSA 1DD3A 1YHQP 3W68A 1N73B 3P7KA 4L75A 3LW5H 2Z5HA 3L72G 3L74G 3TF5A 3RK2C 3L72J 1R8EA 1ZRTD 4C7NB 2E74B 3KZIH 2I1KA 2J5UA 2KLVA 3RK3D 4H44B 3G6EP 1L0LK 1EXIA 2QJPC 1X0TA 3F89A 3CL3D 2KIKA 2IDBA 5KJ7D 3AE4C 3AEAC 4EOTA 3KDPB 3H1HG 1BE3E 2N1TD 5KLVJ 1OXZA 3MD0A 4NPEA 4HYTB 1HJBA 1ZMEC 3H1JE 1CI6A 3CCEP 5CMZA 2O1KA 2HR3A 2G3AA 4RKUJ 1JUNA 4PV1C 2WPQA 1N73A 1PL5A 2WSFJ 2G8YA 2M5AB 3PHLA 2KSEA 2QE7H 4WY4C 3GHGA 3AEFC 1IFIA 1KZUB 5AVZB 3JCUE 1VQ7P 4I7ZB 1MZ9A 4LLHA 3IN6A 3L71J 1Q81Q 1OW8A 4L76A 2LXBA 1LT9C 1KB9I 1S4XA 5B66E 1QGKB 1CW5A 1DIPA 1LT9A 1T3UA 1ZV8A 4IL6X 3RK3E 2A06D 3MHVA 1E5WA 3H1IG 3L73G 4KJMA 3HUSB 2ZYDA 1SQPD 4PD4E 2WVRA 3FXDA 5APYA 1WRGA 4D6TJ 2M3EA 5KAIH 3A5TA 2KYVA 3KXDA 4KT0J 2O1JA 2B87A 3EFGA 1N7SB 2NRGA 2QJYB 2D2CC 3BASA 4BRYA 2FYNC 1GD2E 4XFJA 3L70J 2OTLP 4YPCA 2CK3H 2ZYAA 2R3SA 4CPGA 2SPZA 4JQ0D 1YJ9P 1NTKG 2J58A 2WPRA 1RF1B 1LTGC 4UB6E 2KLUA 3CMAP 4W7ZA 1YITP 4Y99C 2XZRA 4BWNA 4WY4D 1K9MQ 2AEMA 1FZFA 1HBWA 4JYBA 3H1LG 1VF5B 1NTMD 1UIXA 2B9BA 1YQ4C 3HE5A 2XV5A 3B5ND 3KZIE 1S72P 3MZWB 3CCLP 3ABVC 1BCCD 1L0NK 3S4RA 1HJ0A 3BCCG 2W90A 3V2PA 1KFNA 3VYIA 3GHGB 2BEZF 3U1CA 2E5TA 5APUA 1FZCC 1Y47A 1IFDA 3CD6P 1RY3A 3A0HH 1KV4A 5B5EE 1U7JA 2C0WA 3PRJA 4U3FG 3TGUG 2GUVA 5TISH 5AW7B 1NTZG 3RBXA 3Q5RA 2D2CB 1WT6A 2IPPA 1GW4A 3L74J 2QEXP 2QM8A 2ZVOB 4KHXA 3HD7A 4K35A 1NOHA 1AV1A 1YBKA 2IFNA 3RK3C 4A7PA 4DCKA 2WT7A 2WT7B 1FOSE 4U7JA 3O8ZA 1KILA 1G1IA 2AXTE 3HUSC 4N78E 1T2KD 4I6MC 3G9RA 1KB9E 2YIUB 5B66H 1VQPP 1NU1K 1PIXA 3V5BA 4ASWA 3M06A 2N1TC 4L73A 2FYUE 2V7QJ 1LJ2A 2HG5D 5APWA 3SFDC 1JM0A 2JJLA 1GL2B 3JCUH 5H2FE 1BCCE 3CXHI 5KJ7C 1PGJA 3LIDA 4I2LC 1S9KD 2Y9YA 1FZEA 2FFDB 2QRXA 4OGQC 3GHGC 1LP1B 5AVWB 1LP1A 1Q7YQ 1Q82Q 1PZQA 2PAJA 1OVVA 1W2EA 2ZT9B 4H13C 1IO4A 4OVNF 1ZOYC 2B89A 1M8OB 3PTZA 5APQA 4UB8E 2WSCJ 2R32A 3AE9C 2FKWB 3H6PA 3V4WA 1M1JC 1GK6A 2HFED 1FE6A 2IBZE 1SQBE 1KILB 1S5LX 2KS1B 1JTHB 1NU1E 2JO1A 3L71D 1EXJA 3L75J 4OWFA 4MN4C 1LTSC 2A45I 2V4HA 3O6QB 1KB9D 3QWOC 2Y9ZA 1HUCA 2ZXEB 2FYNB 4GT1A 2FYUD 3BCCJ 5GTIH 3N4XA 2M0BA 1KORA 1VQMP 4HKZH 1YYCA
chains in the Genus database with same CATH topology
1EZVI 3H1HJ 1NU1J 3H1KJ 4D6TJ 1SQXJ 2BCCJ 2FYUJ 2IBZI 3CWBJ 5KLVJ 1L0LJ 1L0NJ 3H1JJ 3L70J 3H1IJ 1NTKJ 3TGUJ 3L72J 1SQBJ 3H1LJ 3L74J 1P84I 1KYOI 4U3FJ 1BGYJ 3L75J 1NTZJ 3L71J 1NTMJ 3CX5I 1SQVJ 4PD4I 1KB9I 1PP9J 1SQPJ 1BE3J 1SQQJ 3BCCJ 3L73J 1BCCJ 3CXHI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZV I;  3H1H J;  1NU1 J;  3H1K J;  4D6T J;  1SQX J;  2BCC J;  2FYU J;  2IBZ I;  3CWB J;  5KLV J;  1L0L J;  1L0N J;  3H1J J;  3L70 J;  3H1I J;  1NTK J;  3TGU J;  3L72 J;  1SQB J;  3H1L J;  3L74 J;  1P84 I;  1KYO I;  4U3F J;  1BGY J;  3L75 J;  1NTZ J;  3L71 J;  1NTM J;  3CX5 I;  1SQV J;  4PD4 I;  1KB9 I;  1PP9 J;  1SQP J;  1BE3 J;  1SQQ J;  3BCC J;  3L73 J;  1BCC J;  3CXH I; 
#chains in the Genus database with same CATH topology
 1JY2 O;  4GKG A;  3CLQ A;  1MKM A;  1PPJ E;  2W6A A;  1JY3 P;  3FWN A;  1KIL C;  2IZ1 A;  3C8V A;  3HUS A;  3PH0 A;  2UWJ E;  4L74 A;  3W67 A;  2R44 A;  4WY4 A;  1FZC B;  1EDL A;  3L73 D;  3WUU A;  3Q5P A;  1PP9 G;  5M1B A;  3CCM P;  1URQ A;  4AYC A;  2OGU A;  2K9J A;  1EZV E;  3Q1M A;  1QVG O;  2K1A A;  3H1I J;  2Q7C A;  1JO5 A;  1PGO A;  1SLQ A;  2ITA A;  3JC2 2;  1AFO A;  2JWA A;  2ZXX A;  3H1L J;  2E43 A;  1NTM K;  1JY3 N;  1URQ B;  3VTP C;  1OVR A;  2O3J A;  2M5A A;  2JDI H;  3CWB D;  4XA4 A;  2W6J H;  5KKZ C;  1L0N D;  4DOJ A;  3Q3D A;  2IBZ D;  1SQB D;  1MFZ A;  2Q5U A;  1FZC A;  1D7M A;  4TLF A;  1NU1 D;  3L71 E;  1NTK D;  2XU6 A;  3IAO A;  1NTM J;  2ZAE B;  3T97 A;  1SS1 A;  2E76 C;  4OH8 B;  1ZLL A;  3G3Z A;  3CCQ P;  1M56 D;  1ZRT E;  2N1T B;  3L73 J;  3L75 E;  1BCC J;  1FDO A;  2O01 H;  3AED C;  3TK1 A;  5CCH A;  1IK9 A;  5GTH H;  4W80 A;  1NWQ A;  2H43 A;  1SFC C;  4D6T G;  1AVY A;  1SQX G;  3CX5 H;  4WVZ A;  2KS1 A;  4DZO A;  1DEB A;  1Z56 A;  2HOD A;  2ZT9 D;  4Y28 J;  2YIU C;  5CCG D;  1SQP K;  3BRT B;  2E74 D;  1BE3 D;  4JPZ B;  2R3C A;  2P7J A;  1L0N J;  1FAV A;  5AVT B;  5TJH A;  1IJD B;  1EZV D;  1UII A;  3H1J D;  1NTK J;  3HTK B;  2K3R A;  5AVX B;  2QSI A;  3VP9 A;  1YJW P;  3F5H A;  1NJI Q;  1BSH A;  1M1K Q;  3MUD A;  3Q5S A;  3SWF A;  1IFM A;  3NTN A;  3GF3 A;  1T3J A;  1YTZ I;  3FXE A;  2QM7 A;  3FWL A;  5KLV G;  1YJN P;  2MKV A;  1NTK E;  5AVR B;  2P58 A;  3A2A A;  3AE2 C;  3AEB C;  2ZT9 C;  2H8P D;  1SQV J;  3GG2 A;  4ZMD A;  1XTG B;  1RHZ B;  1OFC X;  1R5L A;  1EDK A;  2BAS A;  1SQX K;  1ZXG A;  1JCD A;  1CZQ A;  2N9Y B;  3HE4 B;  3L75 D;  2A06 E;  3B5N A;  3L4F A;  1DEE G;  2D2C D;  2LXC B;  3U1A A;  2JKV A;  1S5L H;  1BSN A;  1JMB A;  1P84 H;  1YTZ T;  1SQP E;  2KP8 A;  3V2N A;  3JSV C;  4GOD A;  2AEF A;  1KFM A;  1SQV K;  1NU1 J;  1VPC A;  3CXH E;  1M1J A;  2A45 G;  3HD7 C;  2Q3I A;  1W5C E;  1N8R Q;  1M57 D;  3TDK A;  3D70 A;  1N7S C;  2KB7 P;  2QJY C;  3HD7 B;  1NKN A;  4JYC A;  2B88 A;  2WSS H;  2W83 C;  3C1L A;  3AE8 C;  1IFP A;  3RK2 B;  2Q1K A;  1TU3 F;  1G1J A;  5APS A;  3TGU J;  3RK3 B;  3TYY A;  3CC7 P;  1VF5 D;  2FFD C;  2E74 C;  3ZDM A;  1M90 Q;  3PJS K;  1LWU B;  1KQF B;  2CPS A;  2WIT A;  1OW6 A;  2QJK C;  2Y0D A;  1HVV A;  1X9V A;  1FJP A;  3HE4 A;  2JWD A;  1LNQ A;  3HD7 D;  2WZ7 A;  1NTM E;  3RL0 g;  2E75 B;  4PJ0 H;  3WUV A;  4IFF A;  4AQR D;  2AXC A;  5KTB A;  2P67 A;  3CME P;  4K3A A;  3VMZ A;  1KMI Z;  1KB9 H;  3H32 B;  3P8M C;  1KQS O;  2FYU G;  1RE4 A;  1N7S D;  1QEX A;  3FX0 A;  4JBZ A;  3CI9 A;  4YXD C;  3G4S P;  1L0L G;  5C39 A;  5CCG A;  3D71 A;  1QVF O;  2H7H A;  2C9L Y;  2FXP A;  2BCC E;  2WMM A;  3L70 E;  3E7K A;  4NPD A;  1RE3 A;  2K88 A;  1FBM A;  1RE3 C;  5CCH D;  3ITK A;  1K05 A;  5AVS B;  1AVO A;  3CPW O;  1N2D C;  1XTC C;  2B87 B;  2HOD B;  1P84 I;  2QVA A;  2YXR B;  2HLO A;  4ZNC A;  1GDT A;  2IYP A;  1N86 A;  3M9B A;  2Z4E A;  1YIJ P;  1K73 Q;  3CCJ P;  2YKO A;  1BGY J;  5KJ7 A;  2KOG A;  4RJT A;  1SQV E;  1SQB K;  2KUB A;  5BVZ A;  1YI2 P;  1L4A A;  1RF0 C;  1SQB G;  1T8Z A;  1URQ D;  1X79 B;  2P10 A;  2QJK B;  2W8Z A;  1SQQ J;  2JP3 A;  2WSE H;  4H13 D;  4LGD E;  5AVU B;  5AW0 B;  4C46 A;  4EI2 A;  1EDJ A;  4OGQ D;  1S9K E;  3L72 E;  2XND H;  2OYO A;  3L35 A;  1NTK K;  5AW2 B;  2OYI C;  3BRV B;  2JR8 A;  3E1I A;  1GTW A;  3A3Y B;  3R4Y A;  3B71 A;  4UB8 H;  3MTU E;  2OYI B;  1LGH B;  1IK7 A;  4UB6 H;  2BCC D;  1JCC A;  1GK4 A;  3H1J J;  1GMJ A;  2W27 A;  2E75 C;  5BU5 A;  3H1H E;  5APX A;  2WTY A;  1GU5 A;  2WWW A;  2GM4 A;  4W7Y A;  1IFN A;  3EFF K;  4H0L D;  1L4A B;  1MUU A;  3H1K G;  2FYU K;  5AVY B;  3LIE A;  5AW5 B;  3TNU A;  3VOP A;  3WMM 0;  3D6Y A;  3PLN A;  1J2J B;  2O01 J;  5KAI E;  2PGD A;  1BDD A;  4WWI A;  3M0A A;  3KYQ A;  2KXP B;  4IOI H;  4B86 A;  1SQV D;  2L91 A;  5KLI C;  2FY8 A;  4PD4 H;  1EQ7 A;  1X22 A;  2YMK A;  2OYH A;  3WU2 E;  1PP9 J;  4NPF X;  2E5Y A;  3RL0 D;  4ASV A;  4C7N A;  4QMA A;  1NHL A;  2HPC B;  3IFM A;  1HGZ A;  1RF0 A;  4GIF A;  3WU2 H;  5CJ0 A;  3L72 D;  3RGU A;  2OQQ A;  4H44 C;  1ZR4 A;  2OTJ P;  1J1E B;  2OTK E;  2WSE J;  3L75 G;  4U3F D;  3GLM A;  2XKM A;  2QA4 P;  3H1I E;  3OAK A;  1SQX J;  3L73 E;  4D6T E;  4H13 B;  3SSU A;  1N73 C;  1YQ3 C;  1NGM B;  1SQX E;  1J1D C;  4M3L A;  3UIA A;  4H0L C;  3WUT A;  1FJK A;  2FFD A;  2OAR A;  1S1C X;  5B5E H;  3H1H D;  1GL2 D;  2FBW C;  1DX7 A;  3SWY A;  1KIL D;  1SVF A;  2QIW A;  4HJG H;  2E75 D;  4TT3 H;  3NMD A;  5AW8 B;  4GOF A;  1BGY G;  1RE4 C;  1JY3 O;  2DW3 A;  2POH A;  2Q3E A;  3H1L E;  1HWT C;  1Q86 Q;  3R2P A;  2IZ0 A;  2YXQ B;  3M9Q A;  1A02 J;  1NAF A;  3TSI A;  2NPS C;  1OWA A;  3IF4 A;  1U57 A;  1NAY A;  3B4S A;  1RQV A;  3BVH A;  2HPC A;  1H0T A;  4C7R A;  2Y0C A;  3FGA D;  3MGN A;  3OA7 A;  2FXM A;  4WB4 A;  5APT A;  2KNC A;  1SFC B;  5KLV K;  1GZL A;  3H1H J;  4ZKP A;  3TGU E;  4U3F E;  3EQ2 A;  1QL2 A;  1M1J B;  1NTZ E;  1WMK A;  3H1I D;  5AVV B;  3BCC E;  2PP6 A;  2R5D A;  3P8C E;  1LT1 A;  1SQP G;  3TNU B;  2RMZ A;  3V2R A;  4EYY Q;  1VQ4 P;  3QH9 A;  4DT0 A;  1VQ9 P;  2ZJS E;  1L0L D;  1SFC D;  2IYO A;  5CHX A;  3T97 B;  2K9Y A;  1Y9B A;  1LTJ B;  2Q6Q A;  1PGQ A;  1KIL E;  1SQB J;  1USD A;  1NO4 A;  2VRS A;  2KSJ A;  3AEG C;  1URQ C;  1VL2 A;  3MP7 B;  2GA1 A;  2LKM A;  2WPV B;  4GDO A;  3CCU P;  2KK7 A;  1SQQ K;  2OYI A;  1OIP A;  1HF9 A;  2C9N Y;  1VQ6 P;  1KYO E;  3GW6 A;  3II6 A;  3RK2 D;  1ZR2 A;  4YXW H;  4R4M A;  1P84 D;  2K9J B;  3M0D C;  3HE5 B;  3KQG A;  1VQL P;  1KTM A;  2I1J A;  2KI7 B;  4O9B A;  1HGV A;  5KAF H;  5E79 E;  4EDF A;  1EZV I;  4N6J A;  5DJU B;  1NTZ K;  1PP9 D;  3AE5 C;  1JEK A;  4GOE A;  2YKQ A;  2ZVN B;  3CXH D;  3U59 A;  5BU8 B;  4RO0 A;  5AW4 B;  1DD4 A;  2BCC J;  1USE A;  1NKZ B;  2FYU J;  3BCC D;  3I55 P;  2P1J A;  1H8A A;  1Q2N A;  1SQQ G;  1U7M A;  3M91 A;  2KZJ A;  1PFI A;  3PP5 A;  1X8Y A;  1L0L E;  3CWB G;  3OJA B;  1T6A A;  1L0N G;  1N7S A;  5KAF E;  2E76 B;  2IBZ G;  3BAT A;  2A45 H;  1K8A Q;  3CC4 P;  1NU1 G;  1Y8A A;  1LTA C;  1LTT C;  3D6Z A;  3V4Q A;  1KC8 Q;  3S9O A;  2Q9I A;  1ZW0 A;  3L74 E;  3MIW A;  3VMA A;  3GF7 A;  3H1K D;  3CXH H;  3H25 A;  1AQ5 A;  1MV8 A;  3C9I A;  1P84 E;  2YO3 A;  4AUW A;  2WQY C;  2RH0 A;  1VF5 C;  4H0L B;  3RBZ A;  4XE5 B;  1PPJ G;  1SP4 A;  1QLE D;  4IL6 E;  2JEE A;  1SQV G;  3V2Q A;  3M0D A;  4IFD K;  1NVO A;  4PV1 B;  3VMX A;  1BE3 G;  3OW2 O;  3AEC C;  4PD4 D;  1GL2 C;  1LTI C;  1LWU A;  1PP9 E;  3LW5 J;  3NFQ A;  1VQ5 P;  1J1E C;  1VQK P;  1RF1 C;  1RQU A;  3CCS P;  1HH0 A;  1EZV G;  5AW1 B;  3H1J G;  2Y0E A;  2FXO A;  1JNM A;  2P2U A;  3S1K A;  1OW7 A;  3VMY A;  3SFE C;  3L70 D;  2M8R A;  2KNC B;  2W6B A;  3GMA A;  3B8E B;  1T2K C;  4H44 D;  1FZB A;  2YO2 A;  2ZYG A;  5DJT B;  2XDJ A;  1DH3 A;  1KN7 A;  2H89 C;  1QL1 A;  1L4A D;  1A02 F;  3L74 D;  3KPE A;  2WSC H;  3AE3 C;  3K5B A;  3H1K E;  3I5C A;  2YMY A;  1GW3 A;  5AW9 B;  4Z1M H;  1RH5 B;  1BGY D;  4PJ0 E;  1FZA A;  3CX5 I;  4PD4 I;  1JMM A;  5GTH E;  3L71 G;  1ZN5 A;  1OX3 A;  5CBN A;  3SWK A;  1BDC A;  1FDI A;  3A0B E;  1K04 A;  1KQG B;  1PV3 A;  1NYH A;  2RKL A;  1E79 H;  2HYN A;  2NZ2 A;  4PV1 D;  2FYZ A;  3H1K J;  4OGQ B;  2PFX A;  3MUD C;  1J1D B;  2CPB A;  3RL0 C;  1H88 A;  2MJZ A;  1KQL A;  1L2P A;  3CWB J;  4Y99 B;  1L0L J;  4HH2 A;  1KD1 Q;  4N3Y B;  1LTJ C;  5EFW B;  3HTK A;  2IFM A;  2RN0 A;  2E42 A;  3HRN A;  5AVQ B;  3L37 A;  2OYH B;  1AQT A;  1OMI A;  2I8D A;  3CX5 D;  1RF1 A;  3CC2 P;  3G71 P;  1EC5 A;  1JB0 J;  1KYO I;  1S5L E;  2E76 D;  4N78 D;  1N7L A;  2NPS B;  4EIJ A;  1NTZ J;  4BXL A;  2A06 G;  1BGY E;  3AE1 C;  2ZFC A;  2N1T A;  4RES B;  4BRY B;  5GTI E;  5KLV E;  1PGP A;  1FOS F;  1OZH A;  1BE3 J;  4IL6 H;  3V6I A;  1L4A C;  1EDI A;  2H88 C;  4R4L A;  4ZKU A;  2K37 A;  1CSB A;  4LC1 A;  2WPS A;  5CJ4 A;  2O01 N;  1Q90 D;  1FU1 A;  4D6T D;  1IC2 A;  1SQX D;  3Q2Y A;  1R5S A;  4I7Z C;  1G2C B;  1LTJ A;  1G2C A;  1S2E A;  2PRR A;  2YNY A;  3A7O A;  3L36 A;  2LR2 A;  1LTB C;  2XNX A;  2L5G B;  1JY2 P;  3M9H A;  1JY2 N;  3N7N A;  1SQQ D;  3AEE C;  5CCG C;  3USS A;  1OVU A;  3CX5 E;  3P32 A;  4WY4 B;  1VDF A;  3A0B H;  2M3B A;  1IZN B;  2NPS D;  3H1L D;  1NTM G;  1QX8 A;  2IX7 C;  2KZI A;  3AE6 C;  3KHU A;  4HB1 A;  5CCH C;  3CCV P;  1FZG A;  3B5N C;  3E1R A;  5KLI B;  1SFC A;  4YTP C;  1CI6 B;  1BCC G;  1AA0 A;  1HTL C;  2N9B A;  2R5B A;  1SQP J;  5E79 H;  5H2F H;  5KLV D;  3VP8 A;  3VN0 A;  4DJG A;  3I56 P;  3CCR P;  1VQN P;  1H0T B;  1AJY A;  4JF7 A;  2QJP B;  2J59 M;  2NPS A;  1GU4 A;  2OYH C;  3O6Q A;  1JTH A;  3EWK A;  3NXS A;  5L8R J;  1VQ8 P;  2BCC G;  1PPJ D;  4WBA A;  1VQO P;  1KYO H;  5KKZ B;  5CBO A;  2AXT H;  3TGU D;  5K5G B;  5AW3 B;  1NTZ D;  2V7Q H;  1H89 A;  3B5N B;  2IBZ I;  3P8C D;  4I1L A;  1FS0 E;  5APV A;  3RL0 B;  3H32 A;  2Z5I A;  1W2B O;  1IFJ A;  1FC2 C;  1JOC A;  2WSF H;  2QG4 A;  1LT9 B;  3AE7 C;  1SQQ E;  1M7L A;  3L70 G;  5TIS E;  1ZP0 C;  4IFM A;  2YKP A;  2C0X A;  3CWB E;  1MFT A;  1FDM A;  3A0H E;  1L0N E;  1LWU C;  1S3J A;  1NH4 A;  4U3F J;  2BEQ D;  1KYO D;  5AW6 B;  2AEJ A;  1GL2 A;  3IR9 A;  2GUS A;  1DD3 A;  1YHQ P;  3W68 A;  1N73 B;  3P7K A;  4L75 A;  3LW5 H;  2Z5H A;  3L72 G;  3L74 G;  3TF5 A;  3RK2 C;  3L72 J;  1R8E A;  1ZRT D;  4C7N B;  2E74 B;  3KZI H;  2I1K A;  2J5U A;  2KLV A;  3RK3 D;  4H44 B;  3G6E P;  1L0L K;  1EXI A;  2QJP C;  1X0T A;  3F89 A;  3CL3 D;  2KIK A;  2IDB A;  5KJ7 D;  3AE4 C;  3AEA C;  4EOT A;  3KDP B;  3H1H G;  1BE3 E;  2N1T D;  5KLV J;  1OXZ A;  3MD0 A;  4NPE A;  4HYT B;  1HJB A;  1ZME C;  3H1J E;  1CI6 A;  3CCE P;  5CMZ A;  2O1K A;  2HR3 A;  2G3A A;  4RKU J;  1JUN A;  4PV1 C;  2WPQ A;  1N73 A;  1PL5 A;  2WSF J;  2G8Y A;  2M5A B;  3PHL A;  2KSE A;  2QE7 H;  4WY4 C;  3GHG A;  3AEF C;  1IFI A;  1KZU B;  5AVZ B;  3JCU E;  1VQ7 P;  4I7Z B;  1MZ9 A;  4LLH A;  3IN6 A;  3L71 J;  1Q81 Q;  1OW8 A;  4L76 A;  2LXB A;  1LT9 C;  1KB9 I;  1S4X A;  5B66 E;  1QGK B;  1CW5 A;  1DIP A;  1LT9 A;  1T3U A;  1ZV8 A;  4IL6 X;  3RK3 E;  2A06 D;  3MHV A;  1E5W A;  3H1I G;  3L73 G;  4KJM A;  3HUS B;  2ZYD A;  1SQP D;  4PD4 E;  2WVR A;  3FXD A;  5APY A;  1WRG A;  4D6T J;  2M3E A;  5KAI H;  3A5T A;  2KYV A;  3KXD A;  4KT0 J;  2O1J A;  2B87 A;  3EFG A;  1N7S B;  2NRG A;  2QJY B;  2D2C C;  3BAS A;  4BRY A;  2FYN C;  1GD2 E;  4XFJ A;  3L70 J;  2OTL P;  4YPC A;  2CK3 H;  2ZYA A;  2R3S A;  4CPG A;  2SPZ A;  4JQ0 D;  1YJ9 P;  1NTK G;  2J58 A;  2WPR A;  1RF1 B;  1LTG C;  4UB6 E;  2KLU A;  3CMA P;  4W7Z A;  1YIT P;  4Y99 C;  2XZR A;  4BWN A;  4WY4 D;  1K9M Q;  2AEM A;  1FZF A;  1HBW A;  4JYB A;  3H1L G;  1VF5 B;  1NTM D;  1UIX A;  2B9B A;  1YQ4 C;  3HE5 A;  2XV5 A;  3B5N D;  3KZI E;  1S72 P;  3MZW B;  3CCL P;  3ABV C;  1BCC D;  1L0N K;  3S4R A;  1HJ0 A;  3BCC G;  2W90 A;  3V2P A;  1KFN A;  3VYI A;  3GHG B;  2BEZ F;  3U1C A;  2E5T A;  5APU A;  1FZC C;  1Y47 A;  1IFD A;  3CD6 P;  1RY3 A;  3A0H H;  1KV4 A;  5B5E E;  1U7J A;  2C0W A;  3PRJ A;  4U3F G;  3TGU G;  2GUV A;  5TIS H;  5AW7 B;  1NTZ G;  3RBX A;  3Q5R A;  2D2C B;  1WT6 A;  2IPP A;  1GW4 A;  3L74 J;  2QEX P;  2QM8 A;  2ZVO B;  4KHX A;  3HD7 A;  4K35 A;  1NOH A;  1AV1 A;  1YBK A;  2IFN A;  3RK3 C;  4A7P A;  4DCK A;  2WT7 A;  2WT7 B;  1FOS E;  4U7J A;  3O8Z A;  1KIL A;  1G1I A;  2AXT E;  3HUS C;  4N78 E;  1T2K D;  4I6M C;  3G9R A;  1KB9 E;  2YIU B;  5B66 H;  1VQP P;  1NU1 K;  1PIX A;  3V5B A;  4ASW A;  3M06 A;  2N1T C;  4L73 A;  2FYU E;  2V7Q J;  1LJ2 A;  2HG5 D;  5APW A;  3SFD C;  1JM0 A;  2JJL A;  1GL2 B;  3JCU H;  5H2F E;  1BCC E;  3CXH I;  5KJ7 C;  1PGJ A;  3LID A;  4I2L C;  1S9K D;  2Y9Y A;  1FZE A;  2FFD B;  2QRX A;  4OGQ C;  3GHG C;  1LP1 B;  5AVW B;  1LP1 A;  1Q7Y Q;  1Q82 Q;  1PZQ A;  2PAJ A;  1OVV A;  1W2E A;  2ZT9 B;  4H13 C;  1IO4 A;  4OVN F;  1ZOY C;  2B89 A;  1M8O B;  3PTZ A;  5APQ A;  4UB8 E;  2WSC J;  2R32 A;  3AE9 C;  2FKW B;  3H6P A;  3V4W A;  1M1J C;  1GK6 A;  2HFE D;  1FE6 A;  2IBZ E;  1SQB E;  1KIL B;  1S5L X;  2KS1 B;  1JTH B;  1NU1 E;  2JO1 A;  3L71 D;  1EXJ A;  3L75 J;  4OWF A;  4MN4 C;  1LTS C;  2A45 I;  2V4H A;  3O6Q B;  1KB9 D;  3QWO C;  2Y9Z A;  1HUC A;  2ZXE B;  2FYN B;  4GT1 A;  2FYU D;  3BCC J;  5GTI H;  3N4X A;  2M0B A;  1KOR A;  1VQM P;  4HKZ H;  1YYC A; 
#chains in the Genus database with same CATH homology
 1EZV I;  3H1H J;  1NU1 J;  3H1K J;  4D6T J;  1SQX J;  2BCC J;  2FYU J;  2IBZ I;  3CWB J;  5KLV J;  1L0L J;  1L0N J;  3H1J J;  3L70 J;  3H1I J;  1NTK J;  3TGU J;  3L72 J;  1SQB J;  3H1L J;  3L74 J;  1P84 I;  1KYO I;  4U3F J;  1BGY J;  3L75 J;  1NTZ J;  3L71 J;  1NTM J;  3CX5 I;  1SQV J;  4PD4 I;  1KB9 I;  1PP9 J;  1SQP J;  1BE3 J;  1SQQ J;  3BCC J;  3L73 J;  1BCC J;  3CXH I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...