3BCCJ

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
59
structure length
59
Chain Sequence
TLTARLYSLLFRRTSTFALTIVVGALLFERAFDQGADAIYEHINEGKLWKHIKHKYENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 20
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3bccJ00
1EZVI 3L73J 3CXHI 3H1JJ 3H1HJ 2BCCJ 1NTMJ 1NTZJ 3L72J 1L0NJ 1SQXJ 4PD4I 3BCCJ 4D6TJ 3CWBJ 1SQVJ 1KYOI 1SQQJ 1SQBJ 1NU1J 3L70J 3L71J 1BCCJ 1BE3J 3H1LJ 3TGUJ 2FYUJ 1P84I 3H1KJ 3H1IJ 3L74J 1KB9I 4U3FJ 2IBZI 1L0LJ 1BGYJ 3CX5I 1NTKJ 5KLVJ 1PP9J 3L75J 1SQPJ
chains in the Genus database with same CATH superfamily
3R2PA 3HUSC 5KLIB 4UB8H 1W2BO 3CCMP 1AQ5A 4JYBA 3L36A 1H8AA 1N86A 1M56D 1SQVJ 2A45G 3RK2B 3L72G 3M9HA 3ITKA 5GTIH 3L72E 3CX5H 3G3ZA 3M0AA 3SSUA 2H8PD 1LP1B 1RQVA 1GD2E 3PH0A 1S5LX 2W6BA 2E5TA 1U57A 1HBWA 4TT3H 2HYNA 3KHUA 5K5GB 2IYOA 1X8YA 1LWUC 1LTGC 2IPPA 1EQ7A 1NO4A 2WSFJ 5AVYB 1J2JB 1VQ7P 2WSEJ 4U3FJ 2FYNC 1L0LJ 1MZ9A 1KYOE 2IZ0A 5KLVJ 2IBZG 2HFED 2YIUB 2KNCA 3CXHI 1VQ9P 3ZDMA 3EFGA 2IBZE 1URQC 3CLQA 2P2UA 1YITP 1ZR4A 2QJYB 4GOFA 5BVZA 5KLIC 3FXEA 3H1JJ 1S9KD 2O1KA 1NVOA 5AW8B 3D6YA 1HWTC 2KNCB 4U7JA 3HE4A 1PIXA 1KB9H 2HPCA 2FFDA 3KDPB 1FZGA 2FYZA 3VN0A 4UB6H 1HGZA 3CI9A 4AUWA 4YTPC 1P84I 1NH4A 3MZWB 2WWWA 4H44B 4IOIH 2O01N 1S2EA 2ZVNB 4PV1C 4EYYQ 4WY4A 1G1IA 4N78E 3HE4B 2R3SA 1IFJA 1OW7A 4JF7A 2HPCB 1MV8A 1Y9BA 2FFDB 3USSA 3CXHD 2QEXP 3CX5I 5DJUB 4L73A 1OW8A 1ZMEC 1EZVG 3VMAA 2KLVA 4LGDE 5TJHA 1T3JA 1N7SD 2PRRA 2V4HA 2I1KA 5CCGD 2JEEA 3H1ID 4WY4B 3H25A 1IJDB 2IFNA 2XU6A 3H1LG 1VF5D 2BCCJ 1YTZI 2QJYC 1DH3A 1RH5B 1BE3D 2Z5IA 5AVRB 1NKNA 3CXHE 2KLUA 3F5HA 1FJPA 1SQBG 3V4QA 2XKMA 4ASVA 3JCUE 3H6PA 2PP6A 3NXSA 1QX8A 4PD4I 4TLFA 2OGUA 2FXPA 3AE9C 5DJTB 1P84D 2Y0EA 4H13C 3V2QA 4JBZA 3BRVB 2IX7C 1EDKA 5APQA 2FYUK 4IL6E 2B87A 2QE7H 1KD1Q 2ZYAA 1SQXD 2B89A 4DZOA 3IF4A 3CCSP 3E1RA 3L71D 3A2AA 5AVWB 3CX5D 2HLOA 3AEEC 1KB9I 2OYIA 2FFDC 1S1CX 2C9LY 1SS1A 1L4AD 2K9JA 3H1HD 2DW3A 4YPCA 2G8YA 4OGQD 2KB7P 2B87B 3GG2A 4DCKA 3CPWO 4UB8E 1VF5B 1MFTA 3N7NA 1Q90D 2E75D 1DEBA 1BDCA 4WY4C 5APYA 4C46A 2BEZF 1OZHA 3L75G 5GTIE 3GHGA 3VOPA 2OYIB 3CX5E 1RY3A 3TGUD 1QGKB 1A02J 2K9JB 1YTZT 1JY2P 2VRSA 2L91A 3H1HE 4PD4D 1HJBA 3GMAA 2FYUG 4R4LA 1PV3A 1L0ND 1VPCA 2M0BA 4D6TJ 1QVGO 1S5LH 3C9IA 2Q1KA 2FYUE 4M3LA 5CCHD 3K5BA 1NTMG 3H1KD 4JQ0D 2O1JA 5AVZB 5AW2B 3GHGB 1GK4A 2FXMA 2O01J 1BGYG 5CBOA 1MFZA 1NTZK 2E76C 1KB9D 3PLNA 1BGYE 1EC5A 2N9YB 1NAFA 1NOHA 1K05A 3L73D 1G2CA 2YO2A 1ZRTE 2E74D 3HUSA 1XTCC 5AVXB 1X22A 2OQQA 2K37A 3L35A 1WRGA 1NTZD 1NAYA 5AW3B 2FY8A 1KB9E 1EDLA 2A45I 5L8RJ 1SP4A 2WTYA 3C8VA 2V7QH 1G2CB 1SFCC 2OYIC 4NPEA 3LW5J 1RF1A 4IFDK 1Q7YQ 4GODA 2FBWC 1URQD 1IC2A 3L70G 4UB6E 3V2PA 5AVUB 3A7OA 1VQKP 2Y9YA 1E5WA 3HUSB 4YXDC 1VQMP 1GL2D 1M1KQ 2Q3EA 1GW4A 3L70E 1FZBA 1IFNA 2KZIA 5C39A 1N2DC 1FZEA 2WZ7A 2OYHA 1NTKD 4L75A 2AEJA 5AVSB 1Q86Q 1NTZE 3KZIH 3GHGC 3D70A 1LTJA 2W6AA 4HKZH 3TYYA 1RF1B 2QG4A 1VQOP 1R5SA 1QEXA 1KYOI 3BVHA 2POHA 5KAIH 2CPBA 3M0DC 4GOEA 3H1IJ 2IBZI 5AW6B 2MKVA 2WPSA 4ASWA 3Q5PA 5CJ4A 2ZYGA 3QH9A 2OYHB 2H89C 3GLMA 5APUA 3VTPC 2QVAA 4Y99C 2XDJA 1FJKA 1BE3J 4IFMA 3JC22 2FYNB 3VP9A 2P67A 1GDTA 3AEBC 3GF3A 2HODA 3AECC 3L72D 2KXPB 3B71A 4W7ZA 3SFEC 2KS1A 5CBNA 1IFIA 4RO0A 3CMAP 1PL5A 3TF5A 1PP9D 3O6QA 1DEEG 1CSBA 2R3CA 3AE7C 3BATA 3AEAC 3AE8C 1JY3N 4GIFA 1SQXJ 1GW3A 4AYCA 5E79H 3L71J 2JP3A 2HODB 4O9BA 5BU5A 2KS1B 1KYOD 4NPFX 3H1HJ 2QRXA 1PP9G 1N8RQ 1RF1C 3O6QB 1L2PA 2IBZD 2GUSA 3I56P 1EXIA 3PRJA 1PP9E 3SFDC 3NMDA 2KIKA 1IFMA 2KZJA 3NTNA 1PGJA 2P10A 3OAKA 4PV1B 2YXQB 1EZVI 3HRNA 2M8RA 3IFMA 3W68A 1VDFA 2OYHC 4H44D 3Q5SA 3HD7C 3TK1A 3P8CE 3G4SP 3TGUJ 3OW2O 1YIJP 4C7NA 1LTJC 1VQLP 2RH0A 3AE2C 5AW4B 4BRYA 1AA0A 1BSHA 1L0NJ 2RKLA 3S4RA 2W90A 2NPSC 3AE1C 4DJGA 5KAFH 1PZQA 2K1AA 1HTLC 3H1KJ 2Z4EA 2WSCJ 2WSFH 3Q2YA 5AVVB 2WSEH 1GU4A 3OA7A 1YI2P 2M5AA 3B5NC 4WY4D 3B4SA 3L37A 1SQPG 4C7NB 3E1IA 1IO4A 4N78D 1USDA 3BCCG 3AE3C 3RL0B 4BRYB 4DOJA 4EI2A 1YYCA 3BCCE 4I7ZC 5KKZC 1YBKA 1KZUB 3L73J 1X0TA 2Q6QA 1H89A 4H13B 1SQBK 4GT1A 2M5AB 1H88A 1EZVD 1NU1G 1NHLA 1QLED 1R8EA 2LXCB 1K73Q 1W2EA 3I55P 2GA1A 1EDIA 1NTZJ 1ZV8A 3H1LD 2HG5D 1Q2NA 3U1AA 3PJSK 4ZKPA 1AFOA 1IK7A 2K9YA 2WPQA 3T97A 1K04A 3U1CA 4I2LC 1SQBD 3S9OA 1T2KC 3L4FA 2YKOA 1EZVE 2E5YA 5M1BA 1T8ZA 2ZT9C 1SQQG 4PJ0H 1NTKJ 1JOCA 1HJ0A 3P32A 1M8OB 3NFQA 3L74G 4MN4C 1S3JA 1A02F 3FWNA 3GF7A 3H1LE 3L74E 1RE3C 1OXZA 4IL6X 1ZXGA 5H2FH 1NKZB 3T97B 3RL0C 3CCLP 1U7JA 5TISH 3D6ZA 1W5CE 5KAIE 1OVUA 1WMKA 1SQBE 1X79B 4ZMDA 3VMYA 1SQVK 1PPJG 1RE4A 1NWQA 2D2CB 3B8EB 1PGQA 1FE6A 2KI7B 3G71P 4OVNF 3L72J 1AVOA 2E76B 1NTMK 1FZAA 4L76A 5KJ7A 2KUBA 1ZW0A 1DD4A 1UIXA 1IFPA 3L75D 3MIWA 1SFCA 2R44A 1PP9J 4IFFA 2KSEA 4L74A 2I8DA 1SQVD 2W8ZA 4OH8B 1VQNP 2ZXEB 1M57D 2FYUD 2YMKA 1JO5A 4NPDA 4LLHA 1L0LK 5E79E 3CCUP 2PAJA 2ZAEB 1NTMD 3AEFC 1JMBA 2ITAA 1SFCB 4GDOA 3TNUA 2N1TA 1BCCD 1J1EC 3L75E 1BGYD 1SQVG 3CCVP 2NRGA 4N3YB 1FC2C 2JJLA 1PGOA 1GMJA 3M0DA 2WMMA 1SQVE 4Y28J 5APSA 4KJMA 3H32A 1TU3F 2IYPA 2JWDA 3CD6P 2Y9ZA 1ZRTD 2C0XA 1FOSF 1CI6A 3W67A 3FGAD 2D2CC 3R4YA 2BASA 5APWA 1OW6A 2Q5UA 1NTME 3TNUB 1BCCG 2N1TB 2XV5A 4WVZA 5GTHH 3FX0A 2M3EA 3P8MC 4EDFA 1BCCE 2E42A 3WU2H 3KYQA 1M90Q 2QM8A 1KMIZ 1FU1A 1EDJA 3H32B 2WSSH 3A0BH 5KAFE 4U3FG 1L0LG 2O01H 3HTKA 4RESB 1CI6B 2JDIH 1RE4C 3L70D 1ZP0C 1FAVA 4U3FE 1L0LE 4Y99B 1VQ4P 3RBXA 5APTA 1ZLLA 1LNQA 1YJ9P 1N7SC 1JMMA 2WITA 2R32A 5KJ7C 2V7QJ 2C0WA 1IFDA 3AEDC 1WT6A 2QM7A 1FS0E 2AEMA 1JM0A 1Q81Q 3HTKB 3EFFK 1KFNA 2CK3H 1FDOA 1R5LA 2R5BA 4ZNCA 3H1LJ 2QJKC 3HD7A 3LW5H 1JCCA 2R5DA 3CC4P 1CW5A 2J5UA 2N1TC 3CWBD 2OYOA 2FKWB 1SQBJ 2Q7CA 1ZOYC 1YHQP 1YQ3C 4N6JA 2NPSA 1IK9A 1AVYA 5AW0B 2A06G 2P7JA 2J58A 3CXHH 4PJ0E 4WB4A 3HD7B 1T6AA 2OARA 2PFXA 4PV1D 1JY3O 3B5NA 4Z1MH 3MHVA 1LTJB 2YNYA 3CWBG 3S1KA 4HH2A 4OGQC 1OIPA 3M9QA 3WUTA 1LTAC 3CWBE 5H2FE 3E7KA 1G1JA 2QA4P 1NGMB 2NPSB 3LIDA 5TISE 3U59A 4KT0J 2BCCG 1T2KD 1FBMA 2AXTH 3RGUA 3RK3B 1KILA 2BCCE 2ZT9D 3A0HH 3B5NB 5CMZA 2J59M 1HGVA 4BWNA 1M1JC 3Q5RA 5KTBA 5BU8B 1KN7A 4HB1A 2G3AA 3RBZA 1P84H 3P8CD 1PGPA 4C7RA 1Y47A 4I7ZB 3L75J 5KKZB 5CCHC 2QJPB 1SQPK 3RL0D 3WUUA 3MUDA 1HF9A 1ZN5A 2W27A 5CHXA 2KYVA 3KQGA 1KILB 3CC7P 1H0TA 2YKQA 5AW5B 2FYUJ 3I5CA 1KQFB 2WQYC 4DT0A 5B66H 1YQ4C 1SLQA 4H13D 3EWKA 2RN0A 3VMXA 1ZR2A 2KK7A 1OMIA 2Q3IA 1NTMJ 1QL2A 1KFMA 1JNMA 3D71A 1NU1K 4K35A 1BCCJ 2ZXXA 1D7MA 4JPZB 1SQPD 1BGYJ 1RE3A 2E74C 1H0TB 4D6TD 2AEFA 1JB0J 1RF0A 3BCCD 1K8AQ 3SWYA 1RHZB 3KXDA 1S72P 1DD3A 1Z56A 3P7KA 2ZT9B 3IAOA 1S5LE 1JEKA 2QIWA 3V5BA 5AW7B 3RK3C 1HVVA 1N7LA 4H0LB 3SWKA 4AQRD 4PD4H 1NU1D 2JWAA 5B5EH 2SPZA 1SQQK 4D6TG 1GZLA 5GTHE 1SQPE 2XNXA 1GL2C 2WPVB 1VQPP 3CCQP 4D6TE 3WU2E 3CCJP 2WSCH 2Q9IA 3VYIA 2HR3A 2QJPC 3AE5C 1LTIC 3FXDA 3A0BE 3L70J 2ZVOB 1KILC 3Q3DA 3CMEP 3RK2C 2RMZA 3TSIA 3KPEA 1XTGB 2D2CD 1NU1E 1SQQD 4XA4A 5EFWB 3L74D 1LJ2A 3OJAB 2H88C 4XFJA 2E76D 3MUDC 2M3BA 1LGHB 2FXOA 1S9KE 1HUCA 2C9NY 2ZFCA 2L5GB 5APXA 1USEA 1MKMA 3RL0g 3N4XA 3VMZA 2IFMA 2QSIA 1GU5A 1BSNA 3EQ2A 1QL1A 1PPJD 1UIIA 4CPGA 1GTWA 1SQQE 3V2NA 2YIUC 2W6JH 2IZ1A 4H0LC 3AE4C 2N9BA 3CWBJ 4RKUJ 1CZQA 5KJ7D 2CPSA 3UIAA 3KZIE 3C1LA 1J1EB 1RF0C 1U7MA 1FZCA 1SFCD 4JYCA 1JTHA 1SQXK 3ABVC 2YO3A 1FOSE 3FWLA 1BDDA 1PPJE 2O3JA 3G9RA 3H1IG 4ZKUA 2GM4A 1OVRA 2Y0CA 1SVFA 1J1DB 1KORA 2LXBA 4QMAA 1YJNP 3H1IE 1FZCB 1FDMA 1N7SA 2N1TD 1VQ8P 3BRTB 3A5TA 5CCGA 2WVRA 1JTHB 2JKVA 1BE3G 3PHLA 4H44C 4EOTA 4I6MC 2NZ2A 4WWIA 1E79H 2OTLP 2BEQD 3MP7B 2AXTE 4K3AA 3HE5A 1BE3E 2A45H 3A0HE 1N73A 4EIJA 5AW1B 1N7SB 5KLVK 2LR2A 1OWAA 3VP8A 3MGNA 3F89A 1VL2A 2JO1A 1P84E 2YMYA 1HH0A 2WT7A 1L0NK 3A3YB 1RQUA 1SQXG 2Z5HA 3AE6C 3HE5B 3L71G 3M06A 1SQXE 1DIPA 1VQ6P 2LKMA 3L71E 1N73B 5B66E 2KP8A 1K9MQ 3WMM0 1KYOH 1M7LA 1AV1A 3H1HG 2QJKB 4U3FD 1L0LD 4I1LA 5KLVD 2ZJSE 2WT7B 1SQPJ 2XNDH 2B9BA 1L4AA 2P1JA 4R4MA 2H43A 3AEGC 1KC8Q 1DX7A 3BCCJ 1QVFO 2MJZA 4W7YA 1J1DC 1FZCC 1JY3P 1LT9A 2W83C 3TGUG 3H1JD 2UWJE 1KQLA 5KLVG 5CJ0A 3TGUE 3M91A 4BXLA 2YXRB 1NU1J 2K88A 1L4AB 1L0NG 5KLVE 1KQGB 5APVA 4PD4E 1M1JA 3HD7D 2GUVA 4OGQB 5B5EE 1L0NE 3H1KG 3SWFA 2P58A 5CCGC 1LT9B 2E75B 3H1KE 5CCHA 4W80A 3H1JG 2KOGA 4RJTA 3TDKA 1VF5C 1FZFA 2NPSD 1T3UA 3H1JE 1NTKK 2AXCA 1LTTC 3M9BA 4WBAA 3QWOC 3PTZA 1MUUA 3V2RA 1M1JB 3RK3D 2IDBA 1KV4A 2B88A 1N73C 3L73G 1SQQJ 4GKGA 2A06D 3B5ND 1YJWP 1OVVA 3L73E 4YXWH 3L74J 3MD0A 3MTUE 1GK6A 1OX3A 1S4XA 4LC1A 4B86A 3LIEA 3WUVA 1JY2O 1NTZG 3V4WA 1LWUA 4A7PA 5AVTB 1EXJA 3CCEP 1KILD 1IZNB 3RK2D 3IN6A 2PGDA 3PP5A 2BCCD 3IR9A 2WPRA 2YKPA 3RK3E 3CL3D 1KTMA 3CC2P 3II6A 4HJGH 2ZYDA 2A06E 3G6EP 3CCRP 5AVQB 3JCUH 2I1JA 1LTSC 4HYTB 1L4AC 1URQA 1LTBC 2E74B 1Q82Q 1GL2A 3O8ZA 1JUNA 1LT1A 1LWUB 1NTKG 3V6IA 1JY2N 2Y0DA 4IL6H 2KSJA 3JSVC 1OFCX 1LT9C 1FDIA 2E75C 4OWFA 1NTKE 3GW6A 5AW9B 2JR8A 1NJIQ 1KILE 1AQTA 4XE5B 1PFIA 1NYHA 1KQSO 1AJYA 3Q1MA 1Y8AA 2E43A 1URQB 4H0LD 1GL2B 1X9VA 2XZRA 4KHXA 2K3RA 1JCDA 1LP1A 3BASA 2H7HA 2OTJP 1VQ5P 2OTKE
chains in the Genus database with same CATH topology
1EZVI 3L73J 3CXHI 3H1JJ 3H1HJ 2BCCJ 1NTMJ 1NTZJ 3L72J 1L0NJ 1SQXJ 4PD4I 3BCCJ 4D6TJ 3CWBJ 1SQVJ 1KYOI 1SQQJ 1SQBJ 1NU1J 3L70J 3L71J 1BCCJ 1BE3J 3H1LJ 3TGUJ 2FYUJ 1P84I 3H1KJ 3H1IJ 3L74J 1KB9I 4U3FJ 2IBZI 1L0LJ 1BGYJ 3CX5I 1NTKJ 5KLVJ 1PP9J 3L75J 1SQPJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZV I;  3L73 J;  3CXH I;  3H1J J;  3H1H J;  2BCC J;  1NTM J;  1NTZ J;  3L72 J;  1L0N J;  1SQX J;  4PD4 I;  3BCC J;  4D6T J;  3CWB J;  1SQV J;  1KYO I;  1SQQ J;  1SQB J;  1NU1 J;  3L70 J;  3L71 J;  1BCC J;  1BE3 J;  3H1L J;  3TGU J;  2FYU J;  1P84 I;  3H1K J;  3H1I J;  3L74 J;  1KB9 I;  4U3F J;  2IBZ I;  1L0L J;  1BGY J;  3CX5 I;  1NTK J;  5KLV J;  1PP9 J;  3L75 J;  1SQP J; 
#chains in the Genus database with same CATH topology
 3R2P A;  3HUS C;  5KLI B;  4UB8 H;  1W2B O;  3CCM P;  1AQ5 A;  4JYB A;  3L36 A;  1H8A A;  1N86 A;  1M56 D;  1SQV J;  2A45 G;  3RK2 B;  3L72 G;  3M9H A;  3ITK A;  5GTI H;  3L72 E;  3CX5 H;  3G3Z A;  3M0A A;  3SSU A;  2H8P D;  1LP1 B;  1RQV A;  1GD2 E;  3PH0 A;  1S5L X;  2W6B A;  2E5T A;  1U57 A;  1HBW A;  4TT3 H;  2HYN A;  3KHU A;  5K5G B;  2IYO A;  1X8Y A;  1LWU C;  1LTG C;  2IPP A;  1EQ7 A;  1NO4 A;  2WSF J;  5AVY B;  1J2J B;  1VQ7 P;  2WSE J;  4U3F J;  2FYN C;  1L0L J;  1MZ9 A;  1KYO E;  2IZ0 A;  5KLV J;  2IBZ G;  2HFE D;  2YIU B;  2KNC A;  3CXH I;  1VQ9 P;  3ZDM A;  3EFG A;  2IBZ E;  1URQ C;  3CLQ A;  2P2U A;  1YIT P;  1ZR4 A;  2QJY B;  4GOF A;  5BVZ A;  5KLI C;  3FXE A;  3H1J J;  1S9K D;  2O1K A;  1NVO A;  5AW8 B;  3D6Y A;  1HWT C;  2KNC B;  4U7J A;  3HE4 A;  1PIX A;  1KB9 H;  2HPC A;  2FFD A;  3KDP B;  1FZG A;  2FYZ A;  3VN0 A;  4UB6 H;  1HGZ A;  3CI9 A;  4AUW A;  4YTP C;  1P84 I;  1NH4 A;  3MZW B;  2WWW A;  4H44 B;  4IOI H;  2O01 N;  1S2E A;  2ZVN B;  4PV1 C;  4EYY Q;  4WY4 A;  1G1I A;  4N78 E;  3HE4 B;  2R3S A;  1IFJ A;  1OW7 A;  4JF7 A;  2HPC B;  1MV8 A;  1Y9B A;  2FFD B;  3USS A;  3CXH D;  2QEX P;  3CX5 I;  5DJU B;  4L73 A;  1OW8 A;  1ZME C;  1EZV G;  3VMA A;  2KLV A;  4LGD E;  5TJH A;  1T3J A;  1N7S D;  2PRR A;  2V4H A;  2I1K A;  5CCG D;  2JEE A;  3H1I D;  4WY4 B;  3H25 A;  1IJD B;  2IFN A;  2XU6 A;  3H1L G;  1VF5 D;  2BCC J;  1YTZ I;  2QJY C;  1DH3 A;  1RH5 B;  1BE3 D;  2Z5I A;  5AVR B;  1NKN A;  3CXH E;  2KLU A;  3F5H A;  1FJP A;  1SQB G;  3V4Q A;  2XKM A;  4ASV A;  3JCU E;  3H6P A;  2PP6 A;  3NXS A;  1QX8 A;  4PD4 I;  4TLF A;  2OGU A;  2FXP A;  3AE9 C;  5DJT B;  1P84 D;  2Y0E A;  4H13 C;  3V2Q A;  4JBZ A;  3BRV B;  2IX7 C;  1EDK A;  5APQ A;  2FYU K;  4IL6 E;  2B87 A;  2QE7 H;  1KD1 Q;  2ZYA A;  1SQX D;  2B89 A;  4DZO A;  3IF4 A;  3CCS P;  3E1R A;  3L71 D;  3A2A A;  5AVW B;  3CX5 D;  2HLO A;  3AEE C;  1KB9 I;  2OYI A;  2FFD C;  1S1C X;  2C9L Y;  1SS1 A;  1L4A D;  2K9J A;  3H1H D;  2DW3 A;  4YPC A;  2G8Y A;  4OGQ D;  2KB7 P;  2B87 B;  3GG2 A;  4DCK A;  3CPW O;  4UB8 E;  1VF5 B;  1MFT A;  3N7N A;  1Q90 D;  2E75 D;  1DEB A;  1BDC A;  4WY4 C;  5APY A;  4C46 A;  2BEZ F;  1OZH A;  3L75 G;  5GTI E;  3GHG A;  3VOP A;  2OYI B;  3CX5 E;  1RY3 A;  3TGU D;  1QGK B;  1A02 J;  2K9J B;  1YTZ T;  1JY2 P;  2VRS A;  2L91 A;  3H1H E;  4PD4 D;  1HJB A;  3GMA A;  2FYU G;  4R4L A;  1PV3 A;  1L0N D;  1VPC A;  2M0B A;  4D6T J;  1QVG O;  1S5L H;  3C9I A;  2Q1K A;  2FYU E;  4M3L A;  5CCH D;  3K5B A;  1NTM G;  3H1K D;  4JQ0 D;  2O1J A;  5AVZ B;  5AW2 B;  3GHG B;  1GK4 A;  2FXM A;  2O01 J;  1BGY G;  5CBO A;  1MFZ A;  1NTZ K;  2E76 C;  1KB9 D;  3PLN A;  1BGY E;  1EC5 A;  2N9Y B;  1NAF A;  1NOH A;  1K05 A;  3L73 D;  1G2C A;  2YO2 A;  1ZRT E;  2E74 D;  3HUS A;  1XTC C;  5AVX B;  1X22 A;  2OQQ A;  2K37 A;  3L35 A;  1WRG A;  1NTZ D;  1NAY A;  5AW3 B;  2FY8 A;  1KB9 E;  1EDL A;  2A45 I;  5L8R J;  1SP4 A;  2WTY A;  3C8V A;  2V7Q H;  1G2C B;  1SFC C;  2OYI C;  4NPE A;  3LW5 J;  1RF1 A;  4IFD K;  1Q7Y Q;  4GOD A;  2FBW C;  1URQ D;  1IC2 A;  3L70 G;  4UB6 E;  3V2P A;  5AVU B;  3A7O A;  1VQK P;  2Y9Y A;  1E5W A;  3HUS B;  4YXD C;  1VQM P;  1GL2 D;  1M1K Q;  2Q3E A;  1GW4 A;  3L70 E;  1FZB A;  1IFN A;  2KZI A;  5C39 A;  1N2D C;  1FZE A;  2WZ7 A;  2OYH A;  1NTK D;  4L75 A;  2AEJ A;  5AVS B;  1Q86 Q;  1NTZ E;  3KZI H;  3GHG C;  3D70 A;  1LTJ A;  2W6A A;  4HKZ H;  3TYY A;  1RF1 B;  2QG4 A;  1VQO P;  1R5S A;  1QEX A;  1KYO I;  3BVH A;  2POH A;  5KAI H;  2CPB A;  3M0D C;  4GOE A;  3H1I J;  2IBZ I;  5AW6 B;  2MKV A;  2WPS A;  4ASW A;  3Q5P A;  5CJ4 A;  2ZYG A;  3QH9 A;  2OYH B;  2H89 C;  3GLM A;  5APU A;  3VTP C;  2QVA A;  4Y99 C;  2XDJ A;  1FJK A;  1BE3 J;  4IFM A;  3JC2 2;  2FYN B;  3VP9 A;  2P67 A;  1GDT A;  3AEB C;  3GF3 A;  2HOD A;  3AEC C;  3L72 D;  2KXP B;  3B71 A;  4W7Z A;  3SFE C;  2KS1 A;  5CBN A;  1IFI A;  4RO0 A;  3CMA P;  1PL5 A;  3TF5 A;  1PP9 D;  3O6Q A;  1DEE G;  1CSB A;  2R3C A;  3AE7 C;  3BAT A;  3AEA C;  3AE8 C;  1JY3 N;  4GIF A;  1SQX J;  1GW3 A;  4AYC A;  5E79 H;  3L71 J;  2JP3 A;  2HOD B;  4O9B A;  5BU5 A;  2KS1 B;  1KYO D;  4NPF X;  3H1H J;  2QRX A;  1PP9 G;  1N8R Q;  1RF1 C;  3O6Q B;  1L2P A;  2IBZ D;  2GUS A;  3I56 P;  1EXI A;  3PRJ A;  1PP9 E;  3SFD C;  3NMD A;  2KIK A;  1IFM A;  2KZJ A;  3NTN A;  1PGJ A;  2P10 A;  3OAK A;  4PV1 B;  2YXQ B;  1EZV I;  3HRN A;  2M8R A;  3IFM A;  3W68 A;  1VDF A;  2OYH C;  4H44 D;  3Q5S A;  3HD7 C;  3TK1 A;  3P8C E;  3G4S P;  3TGU J;  3OW2 O;  1YIJ P;  4C7N A;  1LTJ C;  1VQL P;  2RH0 A;  3AE2 C;  5AW4 B;  4BRY A;  1AA0 A;  1BSH A;  1L0N J;  2RKL A;  3S4R A;  2W90 A;  2NPS C;  3AE1 C;  4DJG A;  5KAF H;  1PZQ A;  2K1A A;  1HTL C;  3H1K J;  2Z4E A;  2WSC J;  2WSF H;  3Q2Y A;  5AVV B;  2WSE H;  1GU4 A;  3OA7 A;  1YI2 P;  2M5A A;  3B5N C;  4WY4 D;  3B4S A;  3L37 A;  1SQP G;  4C7N B;  3E1I A;  1IO4 A;  4N78 D;  1USD A;  3BCC G;  3AE3 C;  3RL0 B;  4BRY B;  4DOJ A;  4EI2 A;  1YYC A;  3BCC E;  4I7Z C;  5KKZ C;  1YBK A;  1KZU B;  3L73 J;  1X0T A;  2Q6Q A;  1H89 A;  4H13 B;  1SQB K;  4GT1 A;  2M5A B;  1H88 A;  1EZV D;  1NU1 G;  1NHL A;  1QLE D;  1R8E A;  2LXC B;  1K73 Q;  1W2E A;  3I55 P;  2GA1 A;  1EDI A;  1NTZ J;  1ZV8 A;  3H1L D;  2HG5 D;  1Q2N A;  3U1A A;  3PJS K;  4ZKP A;  1AFO A;  1IK7 A;  2K9Y A;  2WPQ A;  3T97 A;  1K04 A;  3U1C A;  4I2L C;  1SQB D;  3S9O A;  1T2K C;  3L4F A;  2YKO A;  1EZV E;  2E5Y A;  5M1B A;  1T8Z A;  2ZT9 C;  1SQQ G;  4PJ0 H;  1NTK J;  1JOC A;  1HJ0 A;  3P32 A;  1M8O B;  3NFQ A;  3L74 G;  4MN4 C;  1S3J A;  1A02 F;  3FWN A;  3GF7 A;  3H1L E;  3L74 E;  1RE3 C;  1OXZ A;  4IL6 X;  1ZXG A;  5H2F H;  1NKZ B;  3T97 B;  3RL0 C;  3CCL P;  1U7J A;  5TIS H;  3D6Z A;  1W5C E;  5KAI E;  1OVU A;  1WMK A;  1SQB E;  1X79 B;  4ZMD A;  3VMY A;  1SQV K;  1PPJ G;  1RE4 A;  1NWQ A;  2D2C B;  3B8E B;  1PGQ A;  1FE6 A;  2KI7 B;  3G71 P;  4OVN F;  3L72 J;  1AVO A;  2E76 B;  1NTM K;  1FZA A;  4L76 A;  5KJ7 A;  2KUB A;  1ZW0 A;  1DD4 A;  1UIX A;  1IFP A;  3L75 D;  3MIW A;  1SFC A;  2R44 A;  1PP9 J;  4IFF A;  2KSE A;  4L74 A;  2I8D A;  1SQV D;  2W8Z A;  4OH8 B;  1VQN P;  2ZXE B;  1M57 D;  2FYU D;  2YMK A;  1JO5 A;  4NPD A;  4LLH A;  1L0L K;  5E79 E;  3CCU P;  2PAJ A;  2ZAE B;  1NTM D;  3AEF C;  1JMB A;  2ITA A;  1SFC B;  4GDO A;  3TNU A;  2N1T A;  1BCC D;  1J1E C;  3L75 E;  1BGY D;  1SQV G;  3CCV P;  2NRG A;  4N3Y B;  1FC2 C;  2JJL A;  1PGO A;  1GMJ A;  3M0D A;  2WMM A;  1SQV E;  4Y28 J;  5APS A;  4KJM A;  3H32 A;  1TU3 F;  2IYP A;  2JWD A;  3CD6 P;  2Y9Z A;  1ZRT D;  2C0X A;  1FOS F;  1CI6 A;  3W67 A;  3FGA D;  2D2C C;  3R4Y A;  2BAS A;  5APW A;  1OW6 A;  2Q5U A;  1NTM E;  3TNU B;  1BCC G;  2N1T B;  2XV5 A;  4WVZ A;  5GTH H;  3FX0 A;  2M3E A;  3P8M C;  4EDF A;  1BCC E;  2E42 A;  3WU2 H;  3KYQ A;  1M90 Q;  2QM8 A;  1KMI Z;  1FU1 A;  1EDJ A;  3H32 B;  2WSS H;  3A0B H;  5KAF E;  4U3F G;  1L0L G;  2O01 H;  3HTK A;  4RES B;  1CI6 B;  2JDI H;  1RE4 C;  3L70 D;  1ZP0 C;  1FAV A;  4U3F E;  1L0L E;  4Y99 B;  1VQ4 P;  3RBX A;  5APT A;  1ZLL A;  1LNQ A;  1YJ9 P;  1N7S C;  1JMM A;  2WIT A;  2R32 A;  5KJ7 C;  2V7Q J;  2C0W A;  1IFD A;  3AED C;  1WT6 A;  2QM7 A;  1FS0 E;  2AEM A;  1JM0 A;  1Q81 Q;  3HTK B;  3EFF K;  1KFN A;  2CK3 H;  1FDO A;  1R5L A;  2R5B A;  4ZNC A;  3H1L J;  2QJK C;  3HD7 A;  3LW5 H;  1JCC A;  2R5D A;  3CC4 P;  1CW5 A;  2J5U A;  2N1T C;  3CWB D;  2OYO A;  2FKW B;  1SQB J;  2Q7C A;  1ZOY C;  1YHQ P;  1YQ3 C;  4N6J A;  2NPS A;  1IK9 A;  1AVY A;  5AW0 B;  2A06 G;  2P7J A;  2J58 A;  3CXH H;  4PJ0 E;  4WB4 A;  3HD7 B;  1T6A A;  2OAR A;  2PFX A;  4PV1 D;  1JY3 O;  3B5N A;  4Z1M H;  3MHV A;  1LTJ B;  2YNY A;  3CWB G;  3S1K A;  4HH2 A;  4OGQ C;  1OIP A;  3M9Q A;  3WUT A;  1LTA C;  3CWB E;  5H2F E;  3E7K A;  1G1J A;  2QA4 P;  1NGM B;  2NPS B;  3LID A;  5TIS E;  3U59 A;  4KT0 J;  2BCC G;  1T2K D;  1FBM A;  2AXT H;  3RGU A;  3RK3 B;  1KIL A;  2BCC E;  2ZT9 D;  3A0H H;  3B5N B;  5CMZ A;  2J59 M;  1HGV A;  4BWN A;  1M1J C;  3Q5R A;  5KTB A;  5BU8 B;  1KN7 A;  4HB1 A;  2G3A A;  3RBZ A;  1P84 H;  3P8C D;  1PGP A;  4C7R A;  1Y47 A;  4I7Z B;  3L75 J;  5KKZ B;  5CCH C;  2QJP B;  1SQP K;  3RL0 D;  3WUU A;  3MUD A;  1HF9 A;  1ZN5 A;  2W27 A;  5CHX A;  2KYV A;  3KQG A;  1KIL B;  3CC7 P;  1H0T A;  2YKQ A;  5AW5 B;  2FYU J;  3I5C A;  1KQF B;  2WQY C;  4DT0 A;  5B66 H;  1YQ4 C;  1SLQ A;  4H13 D;  3EWK A;  2RN0 A;  3VMX A;  1ZR2 A;  2KK7 A;  1OMI A;  2Q3I A;  1NTM J;  1QL2 A;  1KFM A;  1JNM A;  3D71 A;  1NU1 K;  4K35 A;  1BCC J;  2ZXX A;  1D7M A;  4JPZ B;  1SQP D;  1BGY J;  1RE3 A;  2E74 C;  1H0T B;  4D6T D;  2AEF A;  1JB0 J;  1RF0 A;  3BCC D;  1K8A Q;  3SWY A;  1RHZ B;  3KXD A;  1S72 P;  1DD3 A;  1Z56 A;  3P7K A;  2ZT9 B;  3IAO A;  1S5L E;  1JEK A;  2QIW A;  3V5B A;  5AW7 B;  3RK3 C;  1HVV A;  1N7L A;  4H0L B;  3SWK A;  4AQR D;  4PD4 H;  1NU1 D;  2JWA A;  5B5E H;  2SPZ A;  1SQQ K;  4D6T G;  1GZL A;  5GTH E;  1SQP E;  2XNX A;  1GL2 C;  2WPV B;  1VQP P;  3CCQ P;  4D6T E;  3WU2 E;  3CCJ P;  2WSC H;  2Q9I A;  3VYI A;  2HR3 A;  2QJP C;  3AE5 C;  1LTI C;  3FXD A;  3A0B E;  3L70 J;  2ZVO B;  1KIL C;  3Q3D A;  3CME P;  3RK2 C;  2RMZ A;  3TSI A;  3KPE A;  1XTG B;  2D2C D;  1NU1 E;  1SQQ D;  4XA4 A;  5EFW B;  3L74 D;  1LJ2 A;  3OJA B;  2H88 C;  4XFJ A;  2E76 D;  3MUD C;  2M3B A;  1LGH B;  2FXO A;  1S9K E;  1HUC A;  2C9N Y;  2ZFC A;  2L5G B;  5APX A;  1USE A;  1MKM A;  3RL0 g;  3N4X A;  3VMZ A;  2IFM A;  2QSI A;  1GU5 A;  1BSN A;  3EQ2 A;  1QL1 A;  1PPJ D;  1UII A;  4CPG A;  1GTW A;  1SQQ E;  3V2N A;  2YIU C;  2W6J H;  2IZ1 A;  4H0L C;  3AE4 C;  2N9B A;  3CWB J;  4RKU J;  1CZQ A;  5KJ7 D;  2CPS A;  3UIA A;  3KZI E;  3C1L A;  1J1E B;  1RF0 C;  1U7M A;  1FZC A;  1SFC D;  4JYC A;  1JTH A;  1SQX K;  3ABV C;  2YO3 A;  1FOS E;  3FWL A;  1BDD A;  1PPJ E;  2O3J A;  3G9R A;  3H1I G;  4ZKU A;  2GM4 A;  1OVR A;  2Y0C A;  1SVF A;  1J1D B;  1KOR A;  2LXB A;  4QMA A;  1YJN P;  3H1I E;  1FZC B;  1FDM A;  1N7S A;  2N1T D;  1VQ8 P;  3BRT B;  3A5T A;  5CCG A;  2WVR A;  1JTH B;  2JKV A;  1BE3 G;  3PHL A;  4H44 C;  4EOT A;  4I6M C;  2NZ2 A;  4WWI A;  1E79 H;  2OTL P;  2BEQ D;  3MP7 B;  2AXT E;  4K3A A;  3HE5 A;  1BE3 E;  2A45 H;  3A0H E;  1N73 A;  4EIJ A;  5AW1 B;  1N7S B;  5KLV K;  2LR2 A;  1OWA A;  3VP8 A;  3MGN A;  3F89 A;  1VL2 A;  2JO1 A;  1P84 E;  2YMY A;  1HH0 A;  2WT7 A;  1L0N K;  3A3Y B;  1RQU A;  1SQX G;  2Z5H A;  3AE6 C;  3HE5 B;  3L71 G;  3M06 A;  1SQX E;  1DIP A;  1VQ6 P;  2LKM A;  3L71 E;  1N73 B;  5B66 E;  2KP8 A;  1K9M Q;  3WMM 0;  1KYO H;  1M7L A;  1AV1 A;  3H1H G;  2QJK B;  4U3F D;  1L0L D;  4I1L A;  5KLV D;  2ZJS E;  2WT7 B;  1SQP J;  2XND H;  2B9B A;  1L4A A;  2P1J A;  4R4M A;  2H43 A;  3AEG C;  1KC8 Q;  1DX7 A;  3BCC J;  1QVF O;  2MJZ A;  4W7Y A;  1J1D C;  1FZC C;  1JY3 P;  1LT9 A;  2W83 C;  3TGU G;  3H1J D;  2UWJ E;  1KQL A;  5KLV G;  5CJ0 A;  3TGU E;  3M91 A;  4BXL A;  2YXR B;  1NU1 J;  2K88 A;  1L4A B;  1L0N G;  5KLV E;  1KQG B;  5APV A;  4PD4 E;  1M1J A;  3HD7 D;  2GUV A;  4OGQ B;  5B5E E;  1L0N E;  3H1K G;  3SWF A;  2P58 A;  5CCG C;  1LT9 B;  2E75 B;  3H1K E;  5CCH A;  4W80 A;  3H1J G;  2KOG A;  4RJT A;  3TDK A;  1VF5 C;  1FZF A;  2NPS D;  1T3U A;  3H1J E;  1NTK K;  2AXC A;  1LTT C;  3M9B A;  4WBA A;  3QWO C;  3PTZ A;  1MUU A;  3V2R A;  1M1J B;  3RK3 D;  2IDB A;  1KV4 A;  2B88 A;  1N73 C;  3L73 G;  1SQQ J;  4GKG A;  2A06 D;  3B5N D;  1YJW P;  1OVV A;  3L73 E;  4YXW H;  3L74 J;  3MD0 A;  3MTU E;  1GK6 A;  1OX3 A;  1S4X A;  4LC1 A;  4B86 A;  3LIE A;  3WUV A;  1JY2 O;  1NTZ G;  3V4W A;  1LWU A;  4A7P A;  5AVT B;  1EXJ A;  3CCE P;  1KIL D;  1IZN B;  3RK2 D;  3IN6 A;  2PGD A;  3PP5 A;  2BCC D;  3IR9 A;  2WPR A;  2YKP A;  3RK3 E;  3CL3 D;  1KTM A;  3CC2 P;  3II6 A;  4HJG H;  2ZYD A;  2A06 E;  3G6E P;  3CCR P;  5AVQ B;  3JCU H;  2I1J A;  1LTS C;  4HYT B;  1L4A C;  1URQ A;  1LTB C;  2E74 B;  1Q82 Q;  1GL2 A;  3O8Z A;  1JUN A;  1LT1 A;  1LWU B;  1NTK G;  3V6I A;  1JY2 N;  2Y0D A;  4IL6 H;  2KSJ A;  3JSV C;  1OFC X;  1LT9 C;  1FDI A;  2E75 C;  4OWF A;  1NTK E;  3GW6 A;  5AW9 B;  2JR8 A;  1NJI Q;  1KIL E;  1AQT A;  4XE5 B;  1PFI A;  1NYH A;  1KQS O;  1AJY A;  3Q1M A;  1Y8A A;  2E43 A;  1URQ B;  4H0L D;  1GL2 B;  1X9V A;  2XZR A;  4KHX A;  2K3R A;  1JCD A;  1LP1 A;  3BAS A;  2H7H A;  2OTJ P;  1VQ5 P;  2OTK E; 
#chains in the Genus database with same CATH homology
 1EZV I;  3L73 J;  3CXH I;  3H1J J;  3H1H J;  2BCC J;  1NTM J;  1NTZ J;  3L72 J;  1L0N J;  1SQX J;  4PD4 I;  3BCC J;  4D6T J;  3CWB J;  1SQV J;  1KYO I;  1SQQ J;  1SQB J;  1NU1 J;  3L70 J;  3L71 J;  1BCC J;  1BE3 J;  3H1L J;  3TGU J;  2FYU J;  1P84 I;  3H1K J;  3H1I J;  3L74 J;  1KB9 I;  4U3F J;  2IBZ I;  1L0L J;  1BGY J;  3CX5 I;  1NTK J;  5KLV J;  1PP9 J;  3L75 J;  1SQP J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...