3BCCJ

Stigmatellin and antimycin bound cytochrome bc1 complex from chicken
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
59
structure length
59
Chain Sequence
TLTARLYSLLFRRTSTFALTIVVGALLFERAFDQGADAIYEHINEGKLWKHIKHKYENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
molecule tags Oxidoreductase
total genus 20
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 3bccJ00
1KYOI 3L75J 1SQXJ 1BCCJ 3L70J 4U3FJ 3H1HJ 1PP9J 1KB9I 1NU1J 1L0LJ 2FYUJ 3L72J 3H1LJ 1EZVI 2IBZI 3CX5I 4PD4I 3H1JJ 1SQBJ 1BE3J 3CWBJ 5KLVJ 3H1KJ 1SQQJ 3CXHI 1BGYJ 1NTZJ 1P84I 1SQPJ 1L0NJ 3BCCJ 4D6TJ 3L71J 1SQVJ 1NTMJ 3L73J 3TGUJ 1NTKJ 3L74J 2BCCJ 3H1IJ
chains in the Genus database with same CATH superfamily
3H1HG 4H0LB 5C39A 3L71E 1RE3C 3VP9A 2E5TA 1LTJB 1DIPA 2ZVOB 2YIUC 4PV1B 3MUDC 1AFOA 1KILB 1URQB 1NTZK 5AW9B 2A45G 2KP8A 2O01H 3HTKB 2LKMA 4NPDA 3A3YB 5AVSB 1SQVJ 4PD4D 1LTTC 2Q3IA 1N2DC 1HJ0A 2QM7A 3U1CA 3RK3C 2SPZA 2OTLP 1OWAA 2H89C 5KLVJ 1E79H 1RF0C 1FZFA 1KQLA 1JOCA 4D6TJ 5KJ7D 1CW5A 3W68A 2PFXA 5CJ0A 4N3YB 2WSEH 2E74B 3L72J 2C0WA 2Q6QA 3HRNA 1KB9E 3HD7B 4ASVA 4H0LC 1ZV8A 4JBZA 3GHGB 1S3JA 1N73B 4XFJA 4PV1C 1GL2B 1KILC 1URQC 1P84D 1IK9A 3P8CE 2HYNA 1OW8A 4GT1A 1H0TA 2R44A 2XNDH 2Q3EA 3BCCG 5AW5B 1OVVA 2ZT9B 2B9BA 4L74A 1S72P 1NTMJ 3CL3D 2HFED 2UWJE 1KN7A 1M1KQ 1RQVA 1LTAC 1OW7A 2I8DA 2V4HA 1EZVI 2D2CC 3AE5C 3CCEP 1EXIA 3LIEA 4JF7A 1EDIA 1AQ5A 2GA1A 3V4QA 3KXDA 4IFDK 2W8ZA 2QJPB 4U3FG 2FY8A 1EZVG 3HD7C 3RBZA 1SQBG 3GHGC 1N73C 4R4LA 3SFDC 3F89A 1LJ2A 3AE6C 1FJKA 1JY2N 1VF5C 2FFDC 3TF5A 2J5UA 2HR3A 1Y8AA 1NH4A 3CI9A 3CWBE 3MD0A 3I56P 2QA4P 1KYOI 5E79E 1OXZA 4OGQB 1YI2P 2NPSB 3H1KG 1H0TB 1BCCD 3HE4A 3AECC 2R5DA 1PV3A 1J1DC 1YYCA 3NFQA 3BASA 1G1JA 3E7KA 3WUVA 1T2KD 4HH2A 2MKVA 1KC8Q 4I6MC 2OYHA 5DJTB 3H1HJ 5AW8B 1WMKA 1JM0A 3B8EB 2QJPC 3H1ID 3HUSA 3EFFK 5KTBA 1PP9E 1NU1E 3KHUA 3CX5E 1KTMA 1AVYA 3RBXA 1GD2E 2AXTE 1OZHA 3V2NA 1L0NE 3MP7B 2N1TD 4H44B 5H2FE 2LR2A 1QEXA 2PP6A 4DCKA 4LC1A 2IX7C 1L0LD 5CBOA 2NPSC 1LT9A 2A06E 1JEKA 3L71D 2FXMA 1GU4A 3OAKA 3Q2YA 3A0HE 1ZW0A 3CXHE 4MN4C 2O3JA 1LT1A 3LIDA 1U7MA 5CCGC 1WT6A 2OYHB 2CK3H 1NTKG 3IAOA 4PD4H 1BE3E 3BCCJ 5APSA 2XU6A 3VYIA 3RGUA 3Q1MA 1L4AC 1QX8A 2O1JA 1KQFB 2K9JA 1J1EC 3Q5PA 3MTUE 1KB9D 1NOHA 4YXDC 1M57D 3CC2P 3PP5A 2RMZA 3L70G 1X9VA 2GUSA 5CCHC 2C0XA 3P8CD 1RE4C 1OW6A 1GK4A 3V4WA 2P67A 1JMBA 5AVUB 1SQBJ 1JTHB 2P1JA 3P8MC 2FYUD 1QL2A 1CI6B 3Q3DA 1KZUB 5AW7B 3A7OA 1W2EA 1A02J 3HE5A 1K73Q 1LWUA 1MV8A 1BGYG 2WTYA 2ZJSE 2IPPA 1IK7A 3WU2H 1NTZG 1A02F 3H1KJ 1VQ8P 2IYOA 3B4SA 5TJHA 2M8RA 1G2CA 2KZJA 2DW3A 3H1JJ 1E5WA 3V2PA 3L36A 3QH9A 4N78E 3B5NC 3PLNA 1LP1B 1SQVG 1VQMP 4HB1A 5AVRB 5BU8B 2CPSA 4KHXA 3FGAD 1PGOA 1SQQE 2YXRB 2Z5HA 1AJYA 3H1LG 1BDDA 1NTME 1Q81Q 4EI2A 2KSEA 3L74E 2YO3A 4PD4I 1RQUA 3MZWB 1EQ7A 2XKMA 4I7ZB 1VDFA 5KJ7C 3L72G 2YKQA 4OH8B 2KNCA 3HE5B 3A0BE 3WMM0 4ASWA 4AQRD 1SQPK 4PJ0H 1PP9D 1NU1D 4GKGA 1YHQP 3CX5D 2QRXA 1DX7A 1JY2O 5B5EE 5KAIE 2WSCJ 4A7PA 2K88A 1AVOA 1AQTA 5AW2B 1M1JA 2QJYC 1NTKJ 1HTLC 3C8VA 5GTHH 2A06D 3TGUE 2KS1B 3L4FA 2I1JA 3H1HE 1LTBC 4C46A 1HH0A 3GW6A 1OMIA 3CXHD 1IFNA 1NU1K 1SLQA 3L70J 3IR9A 3NXSA 1FZCB 2VRSA 4JPZB 4N6JA 1SFCC 1YQ4C 4C7RA 1IC2A 1L0NK 4BWNA 3CMEP 1Z56A 3ITKA 3JC22 5CBNA 2H8PD 1BE3D 5M1BA 4QMAA 2AEMA 2BCCJ 3P32A 1X79B 2N1TB 3FWLA 4BXLA 3IF4A 2ZVNB 4KT0J 2JDIH 1ZOYC 2RN0A 3AEDC 1R5LA 2E75D 2JR8A 2M3BA 1FE6A 2ZYAA 1BGYJ 3CC4P 1RF1C 1NTZJ 5AVQB 3T97B 2WQYC 5KLIC 2CPBA 3O6QA 4IFFA 3SFEC 1EDLA 4WY4A 3UIAA 1T2KC 1M90Q 3AE7C 5CHXA 5KAFE 3B71A 1RHZB 1FZCC 1R8EA 3NTNA 3F5HA 4GODA 4ZKUA 3BCCE 4D6TD 1OX3A 1VQPP 1XTCC 4I2LC 3H1LJ 3RK2D 1FOSE 1KYOH 1SQXE 4CPGA 3LW5H 1N7LA 3SSUA 1FS0E 2N1TC 2XZRA 1JNMA 4EOTA 2K9YA 4WBAA 4BRYB 2I1KA 3G3ZA 2ZAEB 1W2BO 4Y99B 2ZFCA 2K1AA 3G71P 1MFZA 4U3FE 2OYIA 4N78D 3EFGA 1HVVA 1LTJC 4NPEA 1SQQD 1GW4A 3O6QB 2J59M 1NTMD 2KUBA 2G8YA 2O1KA 3L74D 1Y47A 2PRRA 3G9RA 2FYUE 5AW0B 5APTA 1Q82Q 1DD3A 2JO1A 3H1KE 1FDIA 1YTZT 1MUUA 1WRGA 1UIIA 2PAJA 1LGHB 5AW6B 1PGQA 2Y0DA 3MGNA 3M9BA 3VMXA 2WSCH 1NAFA 2M5AA 1EC5A 3L75G 2E74C 5AVZB 2E76D 3M0DA 3OA7A 1XTGB 5L8RJ 3U59A 3VMYA 1KB9I 2P2UA 1SQQK 2Q7CA 5CCGA 3GF3A 1GL2C 2YXQB 3CCQP 1ZP0C 3H25A 2H43A 3IN6A 4R4MA 4GOEA 3N4XA 4W80A 2KI7B 5TISH 2ZT9C 3TGUD 3H32A 2L91A 1U57A 1GTWA 3H1HD 3L73G 1GW3A 3VMAA 4IOIH 3RL0D 2OQQA 3D6YA 2WVRA 2B88A 2Y0CA 3EWKA 1S4XA 3H1JG 3PJSK 2FBWC 1FZAA 1IZNB 1H88A 3O8ZA 2AXCA 1VQLP 2HODA 2KB7P 3P7KA 1PIXA 2BEQD 3AE8C 2HPCA 2LXBA 4IL6H 2QSIA 1NTKE 1S5LH 2PGDA 2LXCB 3C9IA 1SQPG 1Y9BA 2YKOA 2QIWA 4H13D 4OWFA 4OGQC 1FBMA 2FXOA 2P7JA 2QJKB 2WSSH 1ZR4A 3S4RA 3BVHA 4K3AA 2KYVA 3V5BA 2OTKE 3CWBG 2K37A 1GZLA 4YXWH 4Y28J 4ZNCA 3HE4B 3R4YA 2V7QJ 2XNXA 4C7NA 4IL6X 1LTIC 3BCCD 5AW1B 3CCLP 2Y0EA 1S5LX 1NJIQ 5APQA 1QGKB 3CX5I 1JY3P 1SQXD 1Q90D 3E1IA 2KIKA 3HUSB 1YJNP 3L71J 3VOPA 4H44C 1L0LK 1NU1G 1FC2C 1SS1A 2ITAA 4OVNF 2E75B 1Q86Q 4HJGH 1N7SA 3D71A 2W83C 1L0NG 4U3FD 1QLED 3BRVB 3IFMA 1AV1A 4UB8H 3JSVC 1SQBD 3CCRP 2D2CD 3L75J 2KK7A 2KLUA 3G4SP 1SQVE 1LT9B 1YQ3C 3CCJP 4GDOA 4GIFA 2YKPA 3CCMP 2IDBA 3BATA 3H1LE 2R32A 4WY4D 5AVYB 1EDJA 1SQXK 2BCCG 5KLVE 3H1KD 4YPCA 2OYHC 1P84H 2YNYA 3TDKA 4D6TE 3RK2B 1DEEG 1VF5D 2GM4A 3HUSC 1KFMA 1ZR2A 3L72E 3W67A 4DOJA 3L73J 5EFWB 1EXJA 3LW5J 1BDCA 5GTIH 1GK6A 2IBZI 3CC7P 1SFCA 1FU1A 1ZLLA 3VMZA 2K9JB 2R3SA 4M3LA 3AE4C 2FYUK 1PGJA 1X22A 3S9OA 2IBZG 2JWDA 1USDA 2WWWA 2HG5D 2AEJA 1ZRTE 3JCUH 1IFMA 5AW3B 4WB4A 2B87A 3RK2C 4UB6H 1K04A 1SQPJ 1PL5A 3A2AA 3GLMA 1K8AQ 2KOGA 1PPJE 3SWYA 4LGDE 1J2JB 2FYNB 1FDOA 3GMAA 1RE3A 2M0BA 3WU2E 1LWUB 1SP4A 2FKWB 3CWBJ 3MUDA 1USEA 3VTPC 2E76B 3KZIH 3V2QA 2E42A 3AE1C 1AA0A 3OJAB 5APYA 1G1IA 4DJGA 1G2CB 1NTKD 2Q5UA 3AEFC 1KFNA 3FXEA 3CMAP 1KD1Q 1VL2A 2YO2A 2QE7H 2WT7A 2JKVA 1P84I 1OIPA 1RH5B 1RF0A 2JP3A 3AE3C 5KKZB 5CCGD 4AUWA 2Q9IA 3PTZA 3K5BA 1PP9J 1NU1J 1JO5A 1IJDB 2V7QH 1SQQG 1K9MQ 1EDKA 2WPSA 4JYBA 3CLQA 4I7ZC 2QM8A 1R5SA 3RL0B 1NWQA 5AW4B 1L0NJ 1PFIA 1L4AD 2B87B 2AEFA 5B66H 2K3RA 4L76A 2L5GB 1S2EA 1KILA 1URQA 1FAVA 2WSFJ 2E76C 1LTSC 3HTKA 2KNCB 3MIWA 3SWKA 2XV5A 4PJ0E 2WZ7A 4HYTB 5CCHD 1NAYA 3CPWO 2FYZA 2YIUB 2OYOA 2MJZA 1D7MA 1NHLA 1S1CX 4KJMA 1VQ7P 1ZMEC 3Q5SA 2B89A 2W6BA 2ZYGA 4H13B 5APUA 3V2RA 2RKLA 1VQ6P 3RK3E 3TNUA 1JMMA 1KMIZ 1NYHA 4HKZH 4O9BA 1M1JB 3M06A 2JJLA 5GTHE 2ZXXA 1SVFA 2W6JH 3AEBC 1SQVD 3HD7A 1NO4A 2BASA 3GHGA 1UIXA 2W90A 1N73A 2C9LY 1KB9H 1KORA 3H1LD 1GL2A 4W7YA 3H6PA 2A45I 2FFDA 2HLOA 1BCCG 1JY3N 2XDJA 5KLVD 1VQKP 3CCUP 3B5ND 5AVVB 4XE5B 1YBKA 1IFPA 4ZKPA 1KILE 3WUUA 1HGZA 3L72D 3H1IG 4I1LA 2Y9ZA 1VQNP 2QEXP 4H13C 1H8AA 1NKNA 3L75E 1N86A 1VPCA 3D6ZA 1M1JC 3G6EP 1SQVK 1EZVE 1S9KE 2KSJA 2D2CB 2N9BA 1SQBE 3R2PA 1N7SD 3TNUB 1MZ9A 1L0LG 4U7JA 3KYQA 5KLVK 1BSHA 2OGUA 4WY4B 1ZRTD 3L71G 1HWTC 1QL1A 4JYCA 2NPSA 4DT0A 1VF5B 1X8YA 2FFDB 2JWAA 5E79H 3L73E 2POHA 4XA4A 1PPJD 1H89A 1U7JA 1KYOE 1NVOA 3PRJA 1SQQJ 3E1RA 4RJTA 1PGPA 3H1JE 1SQXG 4Y99C 1PZQA 3L74J 1J1DB 1QVGO 3SWFA 3EQ2A 3KPEA 4EDFA 1M7LA 5AVWB 3OW2O 3I55P 3RL0g 4TLFA 1NTMK 5BU5A 4EYYQ 3CX5H 2OARA 3M9QA 1SFCD 2OYIB 2AXTH 1SQPE 4WY4C 3TYYA 1RY3A 4WVZA 2IZ1A 3TSIA 3GG2A 1YIJP 1L4AA 1JUNA 3TK1A 2P10A 3Q5RA 5H2FH 2WSFH 3U1AA 3PH0A 3AE2C 2O01N 2KLVA 1IFDA 1HBWA 1NGMB 1KQGB 2KZIA 2OTJP 2FYUG 2W27A 2E43A 1GU5A 4Z1MH 3WUTA 5CCHA 1QVFO 1RE4A 2GUVA 2YMYA 3A0HH 3TGUJ 1W5CE 4K35A 3CXHH 2M5AB 1BCCJ 2ZYDA 4EIJA 2QG4A 1KQSO 3FX0A 1YITP 1MFTA 4LLHA 2JEEA 2OYIC 3N7NA 3V6IA 3RK3D 2P58A 3NMDA 3II6A 3H1IJ 3L35A 5TISE 1NKZB 1LNQA 2FXPA 2E5YA 3CD6P 3L70E 1L4AB 3H32B 1K05A 1T8ZA 3B5NA 1JCCA 2R3CA 1J1EB 4RKUJ 2IFNA 2Q1KA 3FXDA 1JTHA 4AYCA 1N8RQ 1L0LJ 1T6AA 4B86A 4H0LD 1FJPA 2BCCE 1CI6A 3ABVC 2M3EA 3VN0A 3M9HA 1KV4A 4PV1D 1YTZI 1KILD 1URQD 1OVUA 3M0DC 3AEGC 4IL6E 1BGYE 1DH3A 2WITA 1Q2NA 1NTZE 2NZ2A 1PP9G 2HODB 5AVTB 1IFJA 1S5LE 5KJ7A 2HPCB 2J58A 3S1KA 3L75D 2QJKC 2RH0A 3FWNA 1EZVD 2ZXEB 1S9KD 3KQGA 4NPFX 1SQXJ 1JCDA 1OVRA 1JY3O 1LP1A 2C9NY 2E74D 1FOSF 2A06G 3CXHI 2IBZE 3HD7D 2R5BA 3BRTB 1OFCX 3B5NB 3I5CA 5AVXB 4U3FJ 1M56D 1GL2D 3L73D 4C7NB 1VQ5P 1KYOD 2KXPB 2Z4EA 5CMZA 4L75A 4PD4E 1X0TA 2ZT9D 3H1JD 2E75C 4RESB 3MHVA 2O01J 1SQBK 1BE3G 2FYUJ 3A0BH 4WWIA 1DEBA 2IYPA 1YJWP 4UB8E 1N7SB 2IFMA 1MKMA 1LT9C 5BVZA 3CCVP 5B5EH 1SQPD 5KAIH 3AEEC 1FDMA 5APVA 3USSA 1CSBA 4L73A 1FZBA 1JB0J 1HJBA 1M8OB 4TT3H 3KDPB 2WSEJ 4DZOA 2NRGA 1RF1A 2H88C 3CWBD 2KS1A 1P84E 3VP8A 1L2PA 1VQ4P 1JY2P 1FZEA 2QJYB 5KLVG 1T3UA 4OGQD 2N9YB 2NPSD 4D6TG 3GF7A 5CJ4A 1LTGC 1GDTA 3C1LA 1FZCA 2IZ0A 1GMJA 5GTIE 4RO0A 2A45H 5K5GB 1N7SC 1VQ9P 3M91A 1SFCB 2N1TA 2WPQA 1Q7YQ 1FZGA 1L0ND 5DJUB 2Y9YA 3JCUE 1IFIA 3T97A 3PHLA 4H44D 3AEAC 1CZQA 1ZN5A 3L70D 2G3AA 1NTMG 4UB6E 2Z5IA 3AE9C 2FYNC 3L74G 3L37A 1DD4A 5APWA 1HF9A 1VQOP 2H7HA 1LWUC 1RF1B 1LTJA 3CCSP 2QVAA 3QWOC 5KLIB 4JQ0D 1BCCE 2BCCD 1PPJG 1NTKK 3KZIE 1YJ9P 3ZDMA 5KAFH 1BGYD 1NTZD 2BEZF 2W6AA 5APXA 3H1IE 1ZXGA 3A5TA 5KKZC 3RK3B 4BRYA 1IO4A 2WT7B 4YTPC 1HUCA 4ZMDA 1TU3F 2YMKA 2WMMA 3RL0C 1BSNA 1BE3J 2WPRA 1T3JA 1HGVA 3M0AA 1L0LE 4GOFA 4W7ZA 4IFMA 3TGUG 2IBZD 2WPVB 3D70A 5B66E
chains in the Genus database with same CATH topology
1KYOI 3L75J 1SQXJ 1BCCJ 3L70J 4U3FJ 3H1HJ 1PP9J 1KB9I 1NU1J 1L0LJ 2FYUJ 3L72J 3H1LJ 1EZVI 2IBZI 3CX5I 4PD4I 3H1JJ 1SQBJ 1BE3J 3CWBJ 5KLVJ 3H1KJ 1SQQJ 3CXHI 1BGYJ 1NTZJ 1P84I 1SQPJ 1L0NJ 3BCCJ 4D6TJ 3L71J 1SQVJ 1NTMJ 3L73J 3TGUJ 1NTKJ 3L74J 2BCCJ 3H1IJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYO I;  3L75 J;  1SQX J;  1BCC J;  3L70 J;  4U3F J;  3H1H J;  1PP9 J;  1KB9 I;  1NU1 J;  1L0L J;  2FYU J;  3L72 J;  3H1L J;  1EZV I;  2IBZ I;  3CX5 I;  4PD4 I;  3H1J J;  1SQB J;  1BE3 J;  3CWB J;  5KLV J;  3H1K J;  1SQQ J;  3CXH I;  1BGY J;  1NTZ J;  1P84 I;  1SQP J;  1L0N J;  3BCC J;  4D6T J;  3L71 J;  1SQV J;  1NTM J;  3L73 J;  3TGU J;  1NTK J;  3L74 J;  2BCC J;  3H1I J; 
#chains in the Genus database with same CATH topology
 3H1H G;  4H0L B;  5C39 A;  3L71 E;  1RE3 C;  3VP9 A;  2E5T A;  1LTJ B;  1DIP A;  2ZVO B;  2YIU C;  4PV1 B;  3MUD C;  1AFO A;  1KIL B;  1URQ B;  1NTZ K;  5AW9 B;  2A45 G;  2KP8 A;  2O01 H;  3HTK B;  2LKM A;  4NPD A;  3A3Y B;  5AVS B;  1SQV J;  4PD4 D;  1LTT C;  2Q3I A;  1N2D C;  1HJ0 A;  2QM7 A;  3U1C A;  3RK3 C;  2SPZ A;  2OTL P;  1OWA A;  2H89 C;  5KLV J;  1E79 H;  1RF0 C;  1FZF A;  1KQL A;  1JOC A;  4D6T J;  5KJ7 D;  1CW5 A;  3W68 A;  2PFX A;  5CJ0 A;  4N3Y B;  2WSE H;  2E74 B;  3L72 J;  2C0W A;  2Q6Q A;  3HRN A;  1KB9 E;  3HD7 B;  4ASV A;  4H0L C;  1ZV8 A;  4JBZ A;  3GHG B;  1S3J A;  1N73 B;  4XFJ A;  4PV1 C;  1GL2 B;  1KIL C;  1URQ C;  1P84 D;  1IK9 A;  3P8C E;  2HYN A;  1OW8 A;  4GT1 A;  1H0T A;  2R44 A;  2XND H;  2Q3E A;  3BCC G;  5AW5 B;  1OVV A;  2ZT9 B;  2B9B A;  4L74 A;  1S72 P;  1NTM J;  3CL3 D;  2HFE D;  2UWJ E;  1KN7 A;  1M1K Q;  1RQV A;  1LTA C;  1OW7 A;  2I8D A;  2V4H A;  1EZV I;  2D2C C;  3AE5 C;  3CCE P;  1EXI A;  3LIE A;  4JF7 A;  1EDI A;  1AQ5 A;  2GA1 A;  3V4Q A;  3KXD A;  4IFD K;  2W8Z A;  2QJP B;  4U3F G;  2FY8 A;  1EZV G;  3HD7 C;  3RBZ A;  1SQB G;  3GHG C;  1N73 C;  4R4L A;  3SFD C;  3F89 A;  1LJ2 A;  3AE6 C;  1FJK A;  1JY2 N;  1VF5 C;  2FFD C;  3TF5 A;  2J5U A;  2HR3 A;  1Y8A A;  1NH4 A;  3CI9 A;  3CWB E;  3MD0 A;  3I56 P;  2QA4 P;  1KYO I;  5E79 E;  1OXZ A;  4OGQ B;  1YI2 P;  2NPS B;  3H1K G;  1H0T B;  1BCC D;  3HE4 A;  3AEC C;  2R5D A;  1PV3 A;  1J1D C;  1YYC A;  3NFQ A;  3BAS A;  1G1J A;  3E7K A;  3WUV A;  1T2K D;  4HH2 A;  2MKV A;  1KC8 Q;  4I6M C;  2OYH A;  5DJT B;  3H1H J;  5AW8 B;  1WMK A;  1JM0 A;  3B8E B;  2QJP C;  3H1I D;  3HUS A;  3EFF K;  5KTB A;  1PP9 E;  1NU1 E;  3KHU A;  3CX5 E;  1KTM A;  1AVY A;  3RBX A;  1GD2 E;  2AXT E;  1OZH A;  3V2N A;  1L0N E;  3MP7 B;  2N1T D;  4H44 B;  5H2F E;  2LR2 A;  1QEX A;  2PP6 A;  4DCK A;  4LC1 A;  2IX7 C;  1L0L D;  5CBO A;  2NPS C;  1LT9 A;  2A06 E;  1JEK A;  3L71 D;  2FXM A;  1GU4 A;  3OAK A;  3Q2Y A;  3A0H E;  1ZW0 A;  3CXH E;  4MN4 C;  2O3J A;  1LT1 A;  3LID A;  1U7M A;  5CCG C;  1WT6 A;  2OYH B;  2CK3 H;  1NTK G;  3IAO A;  4PD4 H;  1BE3 E;  3BCC J;  5APS A;  2XU6 A;  3VYI A;  3RGU A;  3Q1M A;  1L4A C;  1QX8 A;  2O1J A;  1KQF B;  2K9J A;  1J1E C;  3Q5P A;  3MTU E;  1KB9 D;  1NOH A;  4YXD C;  1M57 D;  3CC2 P;  3PP5 A;  2RMZ A;  3L70 G;  1X9V A;  2GUS A;  5CCH C;  2C0X A;  3P8C D;  1RE4 C;  1OW6 A;  1GK4 A;  3V4W A;  2P67 A;  1JMB A;  5AVU B;  1SQB J;  1JTH B;  2P1J A;  3P8M C;  2FYU D;  1QL2 A;  1CI6 B;  3Q3D A;  1KZU B;  5AW7 B;  3A7O A;  1W2E A;  1A02 J;  3HE5 A;  1K73 Q;  1LWU A;  1MV8 A;  1BGY G;  2WTY A;  2ZJS E;  2IPP A;  1IK7 A;  3WU2 H;  1NTZ G;  1A02 F;  3H1K J;  1VQ8 P;  2IYO A;  3B4S A;  5TJH A;  2M8R A;  1G2C A;  2KZJ A;  2DW3 A;  3H1J J;  1E5W A;  3V2P A;  3L36 A;  3QH9 A;  4N78 E;  3B5N C;  3PLN A;  1LP1 B;  1SQV G;  1VQM P;  4HB1 A;  5AVR B;  5BU8 B;  2CPS A;  4KHX A;  3FGA D;  1PGO A;  1SQQ E;  2YXR B;  2Z5H A;  1AJY A;  3H1L G;  1BDD A;  1NTM E;  1Q81 Q;  4EI2 A;  2KSE A;  3L74 E;  2YO3 A;  4PD4 I;  1RQU A;  3MZW B;  1EQ7 A;  2XKM A;  4I7Z B;  1VDF A;  5KJ7 C;  3L72 G;  2YKQ A;  4OH8 B;  2KNC A;  3HE5 B;  3A0B E;  3WMM 0;  4ASW A;  4AQR D;  1SQP K;  4PJ0 H;  1PP9 D;  1NU1 D;  4GKG A;  1YHQ P;  3CX5 D;  2QRX A;  1DX7 A;  1JY2 O;  5B5E E;  5KAI E;  2WSC J;  4A7P A;  2K88 A;  1AVO A;  1AQT A;  5AW2 B;  1M1J A;  2QJY C;  1NTK J;  1HTL C;  3C8V A;  5GTH H;  2A06 D;  3TGU E;  2KS1 B;  3L4F A;  2I1J A;  3H1H E;  1LTB C;  4C46 A;  1HH0 A;  3GW6 A;  1OMI A;  3CXH D;  1IFN A;  1NU1 K;  1SLQ A;  3L70 J;  3IR9 A;  3NXS A;  1FZC B;  2VRS A;  4JPZ B;  4N6J A;  1SFC C;  1YQ4 C;  4C7R A;  1IC2 A;  1L0N K;  4BWN A;  3CME P;  1Z56 A;  3ITK A;  3JC2 2;  5CBN A;  2H8P D;  1BE3 D;  5M1B A;  4QMA A;  2AEM A;  2BCC J;  3P32 A;  1X79 B;  2N1T B;  3FWL A;  4BXL A;  3IF4 A;  2ZVN B;  4KT0 J;  2JDI H;  1ZOY C;  2RN0 A;  3AED C;  1R5L A;  2E75 D;  2JR8 A;  2M3B A;  1FE6 A;  2ZYA A;  1BGY J;  3CC4 P;  1RF1 C;  1NTZ J;  5AVQ B;  3T97 B;  2WQY C;  5KLI C;  2CPB A;  3O6Q A;  4IFF A;  3SFE C;  1EDL A;  4WY4 A;  3UIA A;  1T2K C;  1M90 Q;  3AE7 C;  5CHX A;  5KAF E;  3B71 A;  1RHZ B;  1FZC C;  1R8E A;  3NTN A;  3F5H A;  4GOD A;  4ZKU A;  3BCC E;  4D6T D;  1OX3 A;  1VQP P;  1XTC C;  4I2L C;  3H1L J;  3RK2 D;  1FOS E;  1KYO H;  1SQX E;  4CPG A;  3LW5 H;  1N7L A;  3SSU A;  1FS0 E;  2N1T C;  2XZR A;  1JNM A;  4EOT A;  2K9Y A;  4WBA A;  4BRY B;  2I1K A;  3G3Z A;  2ZAE B;  1W2B O;  4Y99 B;  2ZFC A;  2K1A A;  3G71 P;  1MFZ A;  4U3F E;  2OYI A;  4N78 D;  3EFG A;  1HVV A;  1LTJ C;  4NPE A;  1SQQ D;  1GW4 A;  3O6Q B;  2J59 M;  1NTM D;  2KUB A;  2G8Y A;  2O1K A;  3L74 D;  1Y47 A;  2PRR A;  3G9R A;  2FYU E;  5AW0 B;  5APT A;  1Q82 Q;  1DD3 A;  2JO1 A;  3H1K E;  1FDI A;  1YTZ T;  1MUU A;  1WRG A;  1UII A;  2PAJ A;  1LGH B;  5AW6 B;  1PGQ A;  2Y0D A;  3MGN A;  3M9B A;  3VMX A;  2WSC H;  1NAF A;  2M5A A;  1EC5 A;  3L75 G;  2E74 C;  5AVZ B;  2E76 D;  3M0D A;  3OA7 A;  1XTG B;  5L8R J;  3U59 A;  3VMY A;  1KB9 I;  2P2U A;  1SQQ K;  2Q7C A;  5CCG A;  3GF3 A;  1GL2 C;  2YXQ B;  3CCQ P;  1ZP0 C;  3H25 A;  2H43 A;  3IN6 A;  4R4M A;  4GOE A;  3N4X A;  4W80 A;  2KI7 B;  5TIS H;  2ZT9 C;  3TGU D;  3H32 A;  2L91 A;  1U57 A;  1GTW A;  3H1H D;  3L73 G;  1GW3 A;  3VMA A;  4IOI H;  3RL0 D;  2OQQ A;  3D6Y A;  2WVR A;  2B88 A;  2Y0C A;  3EWK A;  1S4X A;  3H1J G;  3PJS K;  2FBW C;  1FZA A;  1IZN B;  1H88 A;  3O8Z A;  2AXC A;  1VQL P;  2HOD A;  2KB7 P;  3P7K A;  1PIX A;  2BEQ D;  3AE8 C;  2HPC A;  2LXB A;  4IL6 H;  2QSI A;  1NTK E;  1S5L H;  2PGD A;  2LXC B;  3C9I A;  1SQP G;  1Y9B A;  2YKO A;  2QIW A;  4H13 D;  4OWF A;  4OGQ C;  1FBM A;  2FXO A;  2P7J A;  2QJK B;  2WSS H;  1ZR4 A;  3S4R A;  3BVH A;  4K3A A;  2KYV A;  3V5B A;  2OTK E;  3CWB G;  2K37 A;  1GZL A;  4YXW H;  4Y28 J;  4ZNC A;  3HE4 B;  3R4Y A;  2V7Q J;  2XNX A;  4C7N A;  4IL6 X;  1LTI C;  3BCC D;  5AW1 B;  3CCL P;  2Y0E A;  1S5L X;  1NJI Q;  5APQ A;  1QGK B;  3CX5 I;  1JY3 P;  1SQX D;  1Q90 D;  3E1I A;  2KIK A;  3HUS B;  1YJN P;  3L71 J;  3VOP A;  4H44 C;  1L0L K;  1NU1 G;  1FC2 C;  1SS1 A;  2ITA A;  4OVN F;  2E75 B;  1Q86 Q;  4HJG H;  1N7S A;  3D71 A;  2W83 C;  1L0N G;  4U3F D;  1QLE D;  3BRV B;  3IFM A;  1AV1 A;  4UB8 H;  3JSV C;  1SQB D;  3CCR P;  2D2C D;  3L75 J;  2KK7 A;  2KLU A;  3G4S P;  1SQV E;  1LT9 B;  1YQ3 C;  3CCJ P;  4GDO A;  4GIF A;  2YKP A;  3CCM P;  2IDB A;  3BAT A;  3H1L E;  2R32 A;  4WY4 D;  5AVY B;  1EDJ A;  1SQX K;  2BCC G;  5KLV E;  3H1K D;  4YPC A;  2OYH C;  1P84 H;  2YNY A;  3TDK A;  4D6T E;  3RK2 B;  1DEE G;  1VF5 D;  2GM4 A;  3HUS C;  1KFM A;  1ZR2 A;  3L72 E;  3W67 A;  4DOJ A;  3L73 J;  5EFW B;  1EXJ A;  3LW5 J;  1BDC A;  5GTI H;  1GK6 A;  2IBZ I;  3CC7 P;  1SFC A;  1FU1 A;  1ZLL A;  3VMZ A;  2K9J B;  2R3S A;  4M3L A;  3AE4 C;  2FYU K;  1PGJ A;  1X22 A;  3S9O A;  2IBZ G;  2JWD A;  1USD A;  2WWW A;  2HG5 D;  2AEJ A;  1ZRT E;  3JCU H;  1IFM A;  5AW3 B;  4WB4 A;  2B87 A;  3RK2 C;  4UB6 H;  1K04 A;  1SQP J;  1PL5 A;  3A2A A;  3GLM A;  1K8A Q;  2KOG A;  1PPJ E;  3SWY A;  4LGD E;  1J2J B;  2FYN B;  1FDO A;  3GMA A;  1RE3 A;  2M0B A;  3WU2 E;  1LWU B;  1SP4 A;  2FKW B;  3CWB J;  3MUD A;  1USE A;  3VTP C;  2E76 B;  3KZI H;  3V2Q A;  2E42 A;  3AE1 C;  1AA0 A;  3OJA B;  5APY A;  1G1I A;  4DJG A;  1G2C B;  1NTK D;  2Q5U A;  3AEF C;  1KFN A;  3FXE A;  3CMA P;  1KD1 Q;  1VL2 A;  2YO2 A;  2QE7 H;  2WT7 A;  2JKV A;  1P84 I;  1OIP A;  1RH5 B;  1RF0 A;  2JP3 A;  3AE3 C;  5KKZ B;  5CCG D;  4AUW A;  2Q9I A;  3PTZ A;  3K5B A;  1PP9 J;  1NU1 J;  1JO5 A;  1IJD B;  2V7Q H;  1SQQ G;  1K9M Q;  1EDK A;  2WPS A;  4JYB A;  3CLQ A;  4I7Z C;  2QM8 A;  1R5S A;  3RL0 B;  1NWQ A;  5AW4 B;  1L0N J;  1PFI A;  1L4A D;  2B87 B;  2AEF A;  5B66 H;  2K3R A;  4L76 A;  2L5G B;  1S2E A;  1KIL A;  1URQ A;  1FAV A;  2WSF J;  2E76 C;  1LTS C;  3HTK A;  2KNC B;  3MIW A;  3SWK A;  2XV5 A;  4PJ0 E;  2WZ7 A;  4HYT B;  5CCH D;  1NAY A;  3CPW O;  2FYZ A;  2YIU B;  2OYO A;  2MJZ A;  1D7M A;  1NHL A;  1S1C X;  4KJM A;  1VQ7 P;  1ZME C;  3Q5S A;  2B89 A;  2W6B A;  2ZYG A;  4H13 B;  5APU A;  3V2R A;  2RKL A;  1VQ6 P;  3RK3 E;  3TNU A;  1JMM A;  1KMI Z;  1NYH A;  4HKZ H;  4O9B A;  1M1J B;  3M06 A;  2JJL A;  5GTH E;  2ZXX A;  1SVF A;  2W6J H;  3AEB C;  1SQV D;  3HD7 A;  1NO4 A;  2BAS A;  3GHG A;  1UIX A;  2W90 A;  1N73 A;  2C9L Y;  1KB9 H;  1KOR A;  3H1L D;  1GL2 A;  4W7Y A;  3H6P A;  2A45 I;  2FFD A;  2HLO A;  1BCC G;  1JY3 N;  2XDJ A;  5KLV D;  1VQK P;  3CCU P;  3B5N D;  5AVV B;  4XE5 B;  1YBK A;  1IFP A;  4ZKP A;  1KIL E;  3WUU A;  1HGZ A;  3L72 D;  3H1I G;  4I1L A;  2Y9Z A;  1VQN P;  2QEX P;  4H13 C;  1H8A A;  1NKN A;  3L75 E;  1N86 A;  1VPC A;  3D6Z A;  1M1J C;  3G6E P;  1SQV K;  1EZV E;  1S9K E;  2KSJ A;  2D2C B;  2N9B A;  1SQB E;  3R2P A;  1N7S D;  3TNU B;  1MZ9 A;  1L0L G;  4U7J A;  3KYQ A;  5KLV K;  1BSH A;  2OGU A;  4WY4 B;  1ZRT D;  3L71 G;  1HWT C;  1QL1 A;  4JYC A;  2NPS A;  4DT0 A;  1VF5 B;  1X8Y A;  2FFD B;  2JWA A;  5E79 H;  3L73 E;  2POH A;  4XA4 A;  1PPJ D;  1H89 A;  1U7J A;  1KYO E;  1NVO A;  3PRJ A;  1SQQ J;  3E1R A;  4RJT A;  1PGP A;  3H1J E;  1SQX G;  4Y99 C;  1PZQ A;  3L74 J;  1J1D B;  1QVG O;  3SWF A;  3EQ2 A;  3KPE A;  4EDF A;  1M7L A;  5AVW B;  3OW2 O;  3I55 P;  3RL0 g;  4TLF A;  1NTM K;  5BU5 A;  4EYY Q;  3CX5 H;  2OAR A;  3M9Q A;  1SFC D;  2OYI B;  2AXT H;  1SQP E;  4WY4 C;  3TYY A;  1RY3 A;  4WVZ A;  2IZ1 A;  3TSI A;  3GG2 A;  1YIJ P;  1L4A A;  1JUN A;  3TK1 A;  2P10 A;  3Q5R A;  5H2F H;  2WSF H;  3U1A A;  3PH0 A;  3AE2 C;  2O01 N;  2KLV A;  1IFD A;  1HBW A;  1NGM B;  1KQG B;  2KZI A;  2OTJ P;  2FYU G;  2W27 A;  2E43 A;  1GU5 A;  4Z1M H;  3WUT A;  5CCH A;  1QVF O;  1RE4 A;  2GUV A;  2YMY A;  3A0H H;  3TGU J;  1W5C E;  4K35 A;  3CXH H;  2M5A B;  1BCC J;  2ZYD A;  4EIJ A;  2QG4 A;  1KQS O;  3FX0 A;  1YIT P;  1MFT A;  4LLH A;  2JEE A;  2OYI C;  3N7N A;  3V6I A;  3RK3 D;  2P58 A;  3NMD A;  3II6 A;  3H1I J;  3L35 A;  5TIS E;  1NKZ B;  1LNQ A;  2FXP A;  2E5Y A;  3CD6 P;  3L70 E;  1L4A B;  3H32 B;  1K05 A;  1T8Z A;  3B5N A;  1JCC A;  2R3C A;  1J1E B;  4RKU J;  2IFN A;  2Q1K A;  3FXD A;  1JTH A;  4AYC A;  1N8R Q;  1L0L J;  1T6A A;  4B86 A;  4H0L D;  1FJP A;  2BCC E;  1CI6 A;  3ABV C;  2M3E A;  3VN0 A;  3M9H A;  1KV4 A;  4PV1 D;  1YTZ I;  1KIL D;  1URQ D;  1OVU A;  3M0D C;  3AEG C;  4IL6 E;  1BGY E;  1DH3 A;  2WIT A;  1Q2N A;  1NTZ E;  2NZ2 A;  1PP9 G;  2HOD B;  5AVT B;  1IFJ A;  1S5L E;  5KJ7 A;  2HPC B;  2J58 A;  3S1K A;  3L75 D;  2QJK C;  2RH0 A;  3FWN A;  1EZV D;  2ZXE B;  1S9K D;  3KQG A;  4NPF X;  1SQX J;  1JCD A;  1OVR A;  1JY3 O;  1LP1 A;  2C9N Y;  2E74 D;  1FOS F;  2A06 G;  3CXH I;  2IBZ E;  3HD7 D;  2R5B A;  3BRT B;  1OFC X;  3B5N B;  3I5C A;  5AVX B;  4U3F J;  1M56 D;  1GL2 D;  3L73 D;  4C7N B;  1VQ5 P;  1KYO D;  2KXP B;  2Z4E A;  5CMZ A;  4L75 A;  4PD4 E;  1X0T A;  2ZT9 D;  3H1J D;  2E75 C;  4RES B;  3MHV A;  2O01 J;  1SQB K;  1BE3 G;  2FYU J;  3A0B H;  4WWI A;  1DEB A;  2IYP A;  1YJW P;  4UB8 E;  1N7S B;  2IFM A;  1MKM A;  1LT9 C;  5BVZ A;  3CCV P;  5B5E H;  1SQP D;  5KAI H;  3AEE C;  1FDM A;  5APV A;  3USS A;  1CSB A;  4L73 A;  1FZB A;  1JB0 J;  1HJB A;  1M8O B;  4TT3 H;  3KDP B;  2WSE J;  4DZO A;  2NRG A;  1RF1 A;  2H88 C;  3CWB D;  2KS1 A;  1P84 E;  3VP8 A;  1L2P A;  1VQ4 P;  1JY2 P;  1FZE A;  2QJY B;  5KLV G;  1T3U A;  4OGQ D;  2N9Y B;  2NPS D;  4D6T G;  3GF7 A;  5CJ4 A;  1LTG C;  1GDT A;  3C1L A;  1FZC A;  2IZ0 A;  1GMJ A;  5GTI E;  4RO0 A;  2A45 H;  5K5G B;  1N7S C;  1VQ9 P;  3M91 A;  1SFC B;  2N1T A;  2WPQ A;  1Q7Y Q;  1FZG A;  1L0N D;  5DJU B;  2Y9Y A;  3JCU E;  1IFI A;  3T97 A;  3PHL A;  4H44 D;  3AEA C;  1CZQ A;  1ZN5 A;  3L70 D;  2G3A A;  1NTM G;  4UB6 E;  2Z5I A;  3AE9 C;  2FYN C;  3L74 G;  3L37 A;  1DD4 A;  5APW A;  1HF9 A;  1VQO P;  2H7H A;  1LWU C;  1RF1 B;  1LTJ A;  3CCS P;  2QVA A;  3QWO C;  5KLI B;  4JQ0 D;  1BCC E;  2BCC D;  1PPJ G;  1NTK K;  3KZI E;  1YJ9 P;  3ZDM A;  5KAF H;  1BGY D;  1NTZ D;  2BEZ F;  2W6A A;  5APX A;  3H1I E;  1ZXG A;  3A5T A;  5KKZ C;  3RK3 B;  4BRY A;  1IO4 A;  2WT7 B;  4YTP C;  1HUC A;  4ZMD A;  1TU3 F;  2YMK A;  2WMM A;  3RL0 C;  1BSN A;  1BE3 J;  2WPR A;  1T3J A;  1HGV A;  3M0A A;  1L0L E;  4GOF A;  4W7Z A;  4IFM A;  3TGU G;  2IBZ D;  2WPV B;  3D70 A;  5B66 E; 
#chains in the Genus database with same CATH homology
 1KYO I;  3L75 J;  1SQX J;  1BCC J;  3L70 J;  4U3F J;  3H1H J;  1PP9 J;  1KB9 I;  1NU1 J;  1L0L J;  2FYU J;  3L72 J;  3H1L J;  1EZV I;  2IBZ I;  3CX5 I;  4PD4 I;  3H1J J;  1SQB J;  1BE3 J;  3CWB J;  5KLV J;  3H1K J;  1SQQ J;  3CXH I;  1BGY J;  1NTZ J;  1P84 I;  1SQP J;  1L0N J;  3BCC J;  4D6T J;  3L71 J;  1SQV J;  1NTM J;  3L73 J;  3TGU J;  1NTK J;  3L74 J;  2BCC J;  3H1I J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...