3BCDA

Alpha-amylase b in complex with maltotetraose and alpha-cyclodextrin
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
585
structure length
585
Chain Sequence
b'SLFLIESEPSTGASVSKNLTEIILIFSNDINKVSQLALTDLITDSDIQGIDYNIEGNKVIINNFSLEPTCNYRLSYEVIDIYDNHLQGYIEFLVNQSNYPQIPDQEVNHTILQAFYWEMNTGEYATEHPEEANLWNLLAERAPELAEAGFTAVWLPPANKGMAGIHDVGYGTYDLWDLGEFDQKGTVRTKYGTKGELENAIDALHNNDIKVYFDAVLNHRMGADYAETVLLDENSRDKPGQYIKAWTGFNFPGRNGEYSNFTWNGQCFDGTDWDDYSKESGKYLFDEKSWDWTYNWDEDYLMGADVDYENEAVQNDVIDWGQWIINNIDFDGFRLDAVKHIDYRFIDKWMSAVQNSSNRDVFFVGEAWVEDVDDLKGFLDTVGNPDLRVFDFPLRSFFVDMLNGAYMADLRNAGLVNSPGYENRAVTFVDNHDTDRDEGSYTVSIYSRKYQAYAYILTRAEGVPTVYWKDYYIWEMKEGLDKLLTARRYYAYGPGYEVDNNDADIYSYVRSGFPDVAGDGLVLMISDGTSGNVAGKWINSRQPDTEFYDLTGHIKEHVTTDSEGYGNFKVIKSEDKGWSIWVPVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha amylase, catalytic region
molecule tags Hydrolase
source organism Halothermothrix orenii
publication title Crystal Structure of the Polyextremophilic alpha-Amylase AmyB from Halothermothrix orenii: Details of a Productive Enzyme-Substrate Complex and an N Domain with a Role in Binding Raw Starch
pubmed doi rcsb
total genus 194
structure length 585
sequence length 585
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3bcdA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bcdA04
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3bcdA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bcdA02
2F2HA 4AIOA 3LXBA 5ABHA 1MVYA 2CPUA 6A3HA 1ZL1A 3EMZA 2RA1A 4ZXOA 1WDSA 1QHPA 4J28A 2XGIA 1NP2A 2W4XA 3WEMA 3L4WA 3AS2A 3ARUA 4IPLA 2QV4A 5I6SA 3AJ7A 2WMFA 1M7XA 4W88A 4ATLA 3WNLA 1G9HA 4UTFA 3UEQA 3MS8A 2QHAA 1DWHM 4HZ8A 1CXIA 2OMYA 3W38A 2X2IA 2E40A 5LA2A 1V3MA 5HBFA 4DM2A 5A3HA 1NP0A 4D6HA 3VDAA 1TE1A 4Q22A 4CVWA 2HISA 3AQUA 1EQPA 1E43A 2DH2A 3EJUA 1JYVA 2NSXA 3SCVA 4AZCB 1BAGA 4Z2IA 3NCOA 1LL6A 1XHGA 3MSDA 4QCEA 3K8KA 4F79A 3WH6A 1I1XA 3LPOA 1IZKA 1UUQA 4C7GA 3TTYA 1XEUA 1HN1A 3VINA 3PZ9A 3WD3A 1KFWA 1TA3A 3BSGA 2XFRA 3BSHA 1QBBA 2C9PA 1DWGM 1JI1A 2MANA 4W87A 4XB3A 3ARSA 1UD6A 1AVAA 1JDCA 2ZX8A 2JF7A 4D6JA 4B16A 3ZJ7A 3MUIA 3AYRA 3AI0A 1TG7A 3A4WA 2EBNA 4DO5A 2DSVA 3FHAA 3WDHA 4D6CA 4WKFA 4YHGA 1EA9C 1R75A 2Y4SA 3VUPA 5FOOA 2XVGA 4TVCA 3WUFA 1JI2A 3GXNA 5A2AA 5A6SA 4PYSA 3SCRA 2X0HA 1R85A 4V2XA 3DHUA 4NZJA 2ESCA 1QVBA 4HA3A 2VQUA 1E56A 5A6LA 4EE9A 5I3DA 3T0DA 2YLAA 4WK9A 1LF1A 2DT2A 4ZEPA 1PBGA 1ZS2A 4CN1A 4JFSA 2FHBA 3MMWA 4JZ5A 3MKKA 1JYNA 1SYTA 1E6NA 2XSBA 3EJTA 3CZJA 2IXVA 5BRPA 1E4LA 3ZT6A 1PZ2A 4XUYA 1XH1A 2J74A 4HZ6A 3SCNA 3ARYA 1DWFM 2ZXDA 1DWJM 4DWSD 4OOZA 1UWTA 1J0IA 4QAWA 7A3HA 4PTMA 1J12A 2DH3A 5DFAA 3MV01 4ACYA 3CHEA 3GXIA 4XV0A 5M17A 5CLWA 3PTQA 4NRRA 4GI8A 4U33A 1D3CA 1AMYA 2DT0A 4LGXA 3CC1A 1GOMA 1M9SA 3U7BA 3PZGA 3CMJA 3D4YA 1J0JA 3S5ZA 3VMOA 5CJ5A 1ZJAA 4H7VA 3L4TA 1W9PA 5BXTA 2YOCA 4HP5A 1H0GA 4P7RA 3CZLA 3LRKA 2X8RA 3GH7A 4C7FA 3L4UA 2DGAA 3QR3A 2XUCA 2DQXA 1Q6EA 2D0FA 2ZX7A 4MDOA 1ISVA 4P7NA 1CTNA 2Y2WA 3OG2A 4DO6A 3DDFA 2VX7A 1J11A 3ARXA 7CGTA 1W91A 1CLXA 1PX8A 3WF4A 1EDQA 1Q6CA 1J0KA 2J7FA 4RE2A 1VFMA 1TZ7A 3SUTA 4AD5A 4H41A 5E6YA 4MNKA 1XCWA 1JF6A 3PZOA 3WDRA 1V3JA 3WELA 1FFRA 3RMEA 3D50A 2Z1KA 4S3KA 3WNPA 3RILA 2X1IA 1Q4NX 1VRXA 1M01A 3KEHA 3AFBA 4ZXLA 2XPKA 1FHLA 5GNXA 3AXIA 3AS3A 3OLIA 2XVLA 1GOQA 5LYRA 1E73M 2TAAA 3D52A 3CZNA 2WVTA 2CBJA 1U2YA 1HNYA 3HN3A 1V08A 2E4TA 1M03A 3O6AA 4AIEA 2WQVA 4IM4A 4PMDA 1VBUA 4D1JA 5A8NA 1WZLA 2OMTA 3CZ8A 1JF5A 2ZUUA 3QHNA 4B3LA 4YPJA 4GQRA 1UWRA 2WLZA 1B3XA 2G3NA 1V0LA 5AYIA 3WY3A 4DUWA 4P8WA 3WH8A 2BHZA 2WMKA 2EO7A 2XN2A 1E3ZA 1BGAA 4RE3A 4GQQA 2XG9A 3AIVA 1UD2A 2F7RA 5A95A 1EXPA 3RPMA 2AAAA 1XYFA 2WKLA 2VJXA 4CKQA 2YL9A 1H09A 3ZIZA 2BHYA 2YA0A 4HA4A 3WUBA 2QLYA 3AHZA 2V5DA 3ZSTA 3PHAA 3RIKA 1RP9A 1MW2A 3VIOA 2GJRA 3WD2A 4LQ1A 3LPFA 1OM0A 3I3DA 3VSUA 3EDJA 4GINA 4AD3A 3VNZA 4UFHA 4D6EA 1GUVA 3SUUA 3GBDA 1KGUA 4CCDA 2CETA 4EAMA 3OLDA 2WHJA 4FNQA 1CENA 2OSXA 3D4ZA 2ZICA 5JIWA 4BS0A 3T09A 1UH2A 1FOBA 3SUWA 2YL6A 3BC9A 3AIWA 1D7FA 3BAYA 2PWHA 5EBAA 1UA3A 2FYVA 1JZ2A 1UYQA 4XZWA 1HL9A 3UETA 4MAVA 2JIWA 3HG2A 3W82A 4AZ5A 1UD8A 3AMKA 4F8XA 1V3LA 1GONA 1E6ZA 3OIHA 4E8DA 3BUIA 2VX4A 4NXSA 3ZR5A 4MTVA 4M82A 1E5JA 3FAXA 4FF5A 1UWUA 1JZ3A 8CGTA 4UFIA 1NWRA 4W93A 1UH3A 2WSPA 4TVUA 3MMDA 3DX4A 3WN6A 1KB3A 1UR0A 2PWDA 4PTXA 3VD9A 2ZX5A 3IANA 4FNPA 4LYPA 2GK1A 2J7CA 2ZX6A 4PCTA 3TOPA 4UQDA 4PRWA 1QI5A 3W26A 1CGYA 3PZUA 3U57A 5I24A 3VDBA 3AMDA 4D72A 3VGDA 1HT6A 3SCSA 1LG2A 4W86A 5BXPA 4FMVA 1H2JA 3VSVA 1E1FA 1OGGA 1HJVA 2ZUMA 3U5YA 5M03A 2CHOA 1VB9A 2BFGA 2VTFA 1O6TA 5A6AA 4ZENA 4AD1A 3SCPA 1UKSA 3MUAA 1B3YA 1JAKA 2W66A 3A6OA 1UR4A 2UY2A 1EH9A 2AMGA 1P6WA 2VRKA 2WCAA 2W61A 2EJ1A 3GYCA 3QHMA 5CPTA 4M56A 1V6VA 1XCXA 2YLLA 3LRMA 4MB4A 4U3AA 1HJQA 2VT0A 4UCFA 1QI3A 5C71A 4JCLA 3WH9A 1V6XA 3VU2A 4GZIA 2XHYA 5C70A 1TFVA 2WVUA 1E70M 3CUJA 1TQUA 4M29A 2ZUSA 5IHRA 1UR8A 1UZ1A 2V38A 3VIFA 3CO4A 2EPNA 3MUZ1 3HMCA 3WFZA 4KRUA 4QLLA 1B90A 3FY1A 4HTYA 4AMCA 5BXSA 2WZEA 3WNOA 4V28A 2JFEX 3BVTA 3L2MA 1J0ZA 1J01A 4NI3A 2O9PA 3MO4A 2F1AA 1BG4A 3BVVA 1EDTA 4AWEA 2ZXBA 3ARVA 2WWDA 1WKYA 1YHTA 1BF2A 3GDBA 3IK2A 3I3EA 4J7RA 1MXDA 1W9BM 2X2YA 2CXGA 4GXPA 1MXGA 2F7OA 5FL1A 2ZUNA 2EPMX 3S5YA 1W9XA 4DO4A 3IJ8A 4UFLA 4HU0A 3LX9A 4MJ2A 2WK2A 1GPFA 1B3WA 3APGA 3FHQA 3PZNA 1B9ZA 2WKGA 2CIPA 3AHYA 1SZNA 2D73A 1E40A 1HJSA 5LA0A 2EXOA 1H6UA 2J7DA 3A4XA 4DWSC 3F5JA 6TAAA 4E2OA 1V03A 1NM9A 1VEOA 1E0VA 3VM7A 4AYGA 1CEOA 1BSIA 2RGMA 1V6WA 4D71A 4UFKA 2YDSA 2ZWZA 3IAPA 1V3HA 2Z1SA 4FLRA 5BRQA 5A6MA 2CYGA 4WSJA 3FAWA 1BFNA 3D51A 2CITA 1GCYA 4AD0A 3QGVA 1OINA 1E6RA 1E0WA 3SEPA 1O6VA 4TXEA 2BVTA 4TVDA 1ZJBA 2OLHA 3WMCA 4W5ZA 2BNJA 3DYOA 3ZOAA 4AZ7A 2XFYA 2VR5A 3VIGA 2WC4A 3ZM8A 3WDJA 1HKIA 2GSJA 5I5RA 1EIBA 3DC0A 1Q6FA 2YKKA 3LXCA 1OGSA 3GM8A 3SCQA 1GQJA 2O9TA 3AMCA 3KE0A 3W27A 1ZBVA 5CQ1A 1CXKA 4PMVA 1WDQA 3BAJA 4AXNA 1A3HA 1B2YA 1OBAA 4M80A 1CYGA 5DF0A 1GJUA 3UESA 4JAWA 4W89A 4CGTA 3OBAA 2DSZA 4HZ7A 5CPSA 2OWWA 5D9OA 3W81A 1HL8A 4GO9A 3LMYA 4BCEA 1W9UA 4PMQA 1BHGA 5FIPA 3UCQA 1RH9A 1W1VA 3H55A 1B0IA 2D2OA 1VAHA 3AHXA 3N15A 2GFTA 3ZO9A 1WE5A 4CU6A 3A5VA 4FLSA 3SUVA 3VOCA 3E1F1 3BMWA 3EJPA 3EYPA 4R27A 3BH4A 3GNRA 1NQ6A 2DSWA 4LYQA 1VFFA 2BY3A 4W8LA 4ACZB 4AYSA 3K8LA 1JD7A 4UQCA 1UG6A 2YA2A 3LPGA 5FD0A 4AZ6A 3NSXA 1ECEA 1RPKA 3U7VA 1LWHA 1D2KA 1DTUA 2RGLA 1NOWA 5A94A 2C9RA 2WYSA 5D9MA 3BCDA 4W7UA 3BGAA 1C8QA 5I0DA 1XSIA 3WDPP 5JUVA 4CCEA 3GXDA 1J0YA 1QHZA 3RDKA 3ZJKA 2WANA 4DWSB 3ARPA 1V6UA 1JZ6A 1V3IA 3VIKA 4CD4A 2WAGA 2NW0A 1SR0A 3RJXA 1UD3A 5M5DA 4HMEA 1KTBA 3MV11 5D8ZA 4AC1X 4BQ3A 1PX4A 4E8CA 3BVXA 1CDGA 2WM0A 3VD5A 4FNTA 4CD8A 5DMYA 3EMCA 3OZOA 1C90A 2VC9A 3TONA 4JFVA 1TMQA 3L4VA 1HTYA 4AZBA 4JCMA 4HOXA 2UY5A 2Y8KA 2V5CA 2VX6A 3D5HA 1UKPA 5ABEA 2XJ7A 3BLKA 4QFUA 4WJXA 1K9FA 2O92A 1OSEA 3KL5A 2OWCA 4PMOA 1C93A 1EQCA 1XD0A 1PZ3A 4NXKA 3SCWA 4TTGA 3BAKA 1QW8A 4MADA 2OMZA 2NT1A 1RD6A 4WSKA 1E4NA 1X6LA 1X6NA 4MJ4A 4JL2A 2DEPA 3MI6A 5EB8A 1O6SA 5BYWA 1BG9A 4OZOA 1VFUA 3RCNA 4W8AA 3KL3A 1ISWA 1B30A 1VF8A 1V3KA 1GHSA 3T2OA 2OYLA 3WDIA 1V0MA 4Y7EA 1US3A 4AZCA 1MQRA 3VIIA 3WBEA 1GQIA 3VGHA 3A4AA 3MMUA 1FP9A 2Y5EA 2Q8XA 4FLOA 3W24A 1UKTA 4FNSA 1G94A 3N9KA 3AS0A 4R5EA 2ZIDA 1MYRA 1H6TA 1EO5A 3SCUA 2EADA 5A1AA 4GI9A 1QWNA 4FK9A 1FFQA 2FH6A 3QOKA 3WQ5A 1R7AA 3L4XA 3KL0A 2ZUTA 4CD7A 1R34A 4EANA 3UR8A 3BUPA 3W4RA 3TTOA 3HG4A 1HX0A 5ABFA 2DSKA 2CBVA 1E71M 5IDIA 2X09A 4D1IA 2VUYA 4YN5A 1M53A 3A22A 1XH2A 2WZHA 1QOXA 5BXRA 1QWUA 1K9EA 4UQAA 3OGRA 4P7QA 2E8YA 4ML4A 3AHVA 3QOMA 1E0XA 2G8ZA 3H54A 1AQMA 1F4HA 1JXJA 1K6AA 1LG1A 4Z2HA 1NOFA 1R33A 3WF1A 1NWTA 4TOQA 1C8YA 2GJXB 3AS1A 3VD4A 1O7AA 3VGBA 1GHRA 5I79A 1TQVA 1PPIA 1H41A 3ARZA 3BAXA 1JYXA 4M24A 3VIPA 3VDCA 1GVIA 2WW5A 3WL0A 4N42A 4PBGA 2JE8A 4OBSA 5CGTA 2J47A 3VGEA 3QHOA 2D3LA 1QNPA 1AQHA 2XVNA 2WSKA 2XSAA 1CNVA 4OJYA 3AXHA 4J3SA 5A8OA 4MPKA 2QMJA 4AZIA 5A6JA 3OGSA 1V0NA 1MWOA 4PMYA 4NZFA 3NDZA 1KR0A 3CH9A 1G5AA 2FGZA 1ZU8A 1HXKA 4P8XA 1C92A 1RP8A 1J0HA 1EOMA 3WY1A 2EQDA 2UWFA 2WLYA 4D6FA 2UY4A 3PZIA 1FH8A 4J27A 5LA1A 4PSRA 4W7VA 4CD6A 2YFNA 1R46A 1HVQA 1W3JA 1H5VA 5GPRA 3WIJA 3ZMRA 2VZUA 1Z32X 3A24A 1W3KA 3CHFA 1NM4A 1IX2A 4NRSA 5AY7A 2WXDM 3OZPA 2DT3A 2QF8A 3TTSA 3CBWA 1GORA 2WHLA 7TAAA 1H11A 3AMLA 1G0CA 3TP4A 1OIMA 5DEZA 2DDXA 2YIHA 3OLGA 1V0KA 1HJUA 3W28A 2PWFA 4HOWA 3BCFA 1J18A 1CGVA 4P7LA 2X05A 2CNCA 2WCGA 1JIBA 1DP0A 2Y24A 3WF2A 1HJWA 2J7HA 3VMNA 2VO5A 1HWWA 1BPLB 2ZUWA 3K4DA 3NIYA 3O2LA 1V02A 1UH4A 3WMBA 1EHNA 2ZX9A 1MW3A 2BS9A 4CC4C 2E9LA 2VNCA 1H49A 3WF0A 1LLOA 5CLTA 3RJYA 1E1EA 3OGVA 1IV8A 3EJRA 3SURA 1TVNA 4UZSA 4AQ1A 1I75A 1CIUA 5E0FA 1ODZA 5BROA 3F4VA 1PX3A 2W91A 2YDQA 2O9RA 4PMZA 5CZKA 1H3GA 3W0KA 1NARA 1CPUA 3N11A 1EO7A 2GVYA 2XVKA 4BZYA 5A2BA 3KZSA 2XIIA 1E9LA 5D9PA 1GQLA 3WKZA 2PF0A 3GXFA 2WHMA 1VENA 1KCKA 5HXMA 4PTVA 1OD8A 5D4YA 3HG3A 1XGZA 5EFDA 2YDRA 3ZQ9A 4JKMA 4WLCA 3W6LA 1WPCA 4TUFA 4ZFMA 2JIEA 1OT1A 3WQ4A 4HPGA 1PIFA 2D24A 5GNYA 4OKDA 2XWDA 1R86A 2J7BA 1EGZA 3EMQA 1XSKA 5DT5A 1PJ9A 2FE0A 2V3FA 3IGUA 3SCOA 2WMIB 3UG4A 4Z2GA 8A3HA 3WEZA 1E6QM 3B9AA 3PZQA 1BYAA 1WZAA 3WD0A 2BV9A 2EABA 3DYPA 1QI2A 3AOFA 4QLJA 4CU7A 3T0AA 3UR7A 3A3HA 3A21A 4CILA 1PS3A 9CGTA 3KLKA 4BQ2A 3ARQA 2PC8A 4CN6A 3AICA 4OOUA 5BCAA 1MW0A 4M1RA 3VKKA 2GJPA 2WVVB 1VBRA 1W1PA 4MNMA 1TQTA 4LX4A 4LYRA 3VIHA 2D22A 5JBDA 1N82A 3WH5A 3LXAA 4DUXA 1XD1A 2YJQA 2ZWYA 5CGMA 4AIUA 4EK7A 4H8UA 3L4ZA 3O9NA 4PN2A 1U33A 3AZSA 3AISA 3F5KA 3AROA 1CXEA 4KRTA 3THDA 1PIGA 2O9OA 1W3HA 3RM9A 2J8GA 1CLVA 1MFUA 2C9QA 4IUGA 1XYZA 1GQKA 4UFJA 3W25A 3ARWA 3EJSA 3WQ8A 3WF3A 3L4YA 4F9DA 1U30A 3W29A 5E6ZA 2J7GA 4DUVA 1ZBCA 1QHOA 3CZKA 2G41A 2VZOA 1KBBA 5EMYA 2EPOA 3I3BA 3T2QA 1JAEA 1E6PA 3DECA 3BUDA 2W67A 2GDUA 4PMRA 1JL8A 3W6MA 4NX0A 2J77A 4P8UA 5AC4A 2WC3A 1VJZA 4HMDA 4MAZA 2CKRA 5I23A 1E6SM 4MB3A 3RM4A 2ZXAA 1WNOA 2XN1A 3MANA 3RO8A 1V6YA 2A3AA 1WO2A 1C91A 2FHCA 1TA3B 3LRLA 2IXUA 3AIUA 4UNIA 3CUIA 1Q6DA 2D20A 1JD9A 4NF7A 1OT2A 3THCA 2E9MA 3VX0A 1GOKA 3EDKA 1FA2A 3SIMA 1XH0A 5HPCA 2VI0A 4D6DA 2WQXA 3GBEA 2V3GA 1QW9A 1K9DA 1SFSA 2VRQA 3FW6A 4H2CA 3EDFA 5IHSA 2BY2A 3CV5A 4ATWA 4UQBA 2WVSA 4J3VA 3VILA 1UZ4A 3TA9A 2G3MA 1X1NA 4LXFA 3F5LA 1R87A 2ZOXA 4QP0A 3WBAA 4CU8A 1HP4A 2D0GA 3K8MA 5IXEA 2J4GA 4MB1A 3AXXA 1E4IA 1VEMA 1TCMA 4GZJA 4JL1A 2VCBA 3EDEA 1QNRA 1WB0A 4ZE5A 3AIRA 1JDAA 1UD5A 4H8HA 2VRJA 2C0HA 4ATDA 2XYLA 4BA0A 2F61A 2GK1B 3HZ3A 3CPUA 4B9YA 1CBGA 5A6BD 4FLQA 3II1A 2HVMA 2WBKA 1R47A 5IFTA 3G6MA 1BPLA 3WY4A 1QNOA 1E55A 4CN4A 4U5KA 4AEEA 1R8LA 2FGLA 4UQ9A 1QI4A 4L4PA 2XFFA 4JKLA 4OIFA 2VURA 1DWIM 2F8QA 4PEEA 3S6TA 1OT4A 4J3XA 1QNQA 2ZE0A 2WBGA 3CUHA 4V27A 2GUYA 4U5IA 3WDQA 1JG9A 4KH2A 1W2VA 1TQSA 5D8WA 3VGGA 3WH7A 4BQ4A 2YBUA 2WMHA 5A8MA 3K46A 2D1ZA 5JBEA 2GDVA 3GXPA 4HPHA 4TTUA 3BAWA 1KWKA 1UASA 3BVWA 1YQ2A 2YBTA 1UD4A 2CBIA 4HU8A 3WNNA 2JALA 1JYWA 1FH7A 3M6DA 4PUDA 4RE4A 3WQVA 2PBOA 3A47A 3DX1A 1K9TA 1CGUA 4W8BA 3ZR6A 2XM1A 4JIEA 5A6KA 4AMXA 3N04A 3K4AA 2J79A 3ZT7A 5CSYA 2F7PA 4WF7A 4UZUA 2FDMA 3AZTA 3BXWA 3WQWA 1UQZA 2J7EA 1BVZA 3SUSA 1LQ0A 1NOUA 3VVGA 3BUBA 1QPKA 5D9NA 3UG5A 4HMCA 1CXHA 3TV8A 4XZBA 2FH8A 1HVXA 4L4OA 2WPGA 4Z2LA 2VVNA 2OMVA 4LPCA 1JXKA 4A3YA 3A23A 4P7OA 2YL8A 3OLEA 3VGFA 1MFVA 3AIEA 3T08A 2CBUA 5KEZA 1OWQA 1DHKA 1KWGA 2A3HA 3VNYA 3GH4A 1J9YA 3N12A 2W92A 2QPSA 3JUGA 2VL4A 4J3UA 1E15A 3GNOA 1UWSA 1DWAM 3ARTA 4AY1A 1NWSA 5A6BA 4W85A 2FHFA 1HXJA 4JFUA 3VM5A 2BXZA 1W32A 4C7DA 3ZJ8A 1KXVA 4AMWA 3CGTA 1UKOA 2CEQA 2V3DA 3VO0A 3VD7A 4W84A 2CESA 5E70A 2WQUA 1C7TA 3CHCA 4YHEA 3BAIA 3ZSSA 1JGIA 4KMQA 1VJSA 5GNZA 1E72M 1UWQA 3EJQA 2PBGA 4WIWA 5CPQA 3K1DA 6CGTA 3AHTA 4UR9A 4U31A 3VTRA 1W1TA 3WUGA 1GOIA 3GTNA 5E9AA 2WCSA 1BTCA 1TUXA 4XX6A 2CHNA 4CUCA 1KXHA 2PWEA 3CZSA 4CCCA 1VIWA 3N17A 4X0VA 4AISA 2AOSA 2UY3A 1W3LA 5FL0A 4CVUA 1KQZA 4ZE4A 4OGZA 3VSTA 4Z2KA 4Z2JA 1ITXA 2WWCA 4AW4A 4MDPA 2EACA 3CLWA 1ITCA 1WAWA 3CTTA 4F9JA 2G4FA 3GNPA 1UWIA 1EOKA 1ZBWA 1SMAA 2D23A 4UOQA 1Q6GA 4URIA 5CG0A 2B31A 1FH9A 1Y7VA 2WB5A 1O6IA 3CUGA 3N18A 4BQ5A 2OMUA 1LYQA 4FNUA 1B3VA 1QBAA 5DO8A 3ARRA 4GPNA 4UQEA 4DWSA 2DT1A 2VX5A 4PTWA 1W9VA 2C7FA 5CSUA 3GZAA 4MNLA 3U5UA 4EKJA 3NJ3A 1B3ZA 3MSGA 4K68A 3B9EA 3DHPA 1UR9A 3AZRA 2F7QA 4HOZA 1HKJA 2XN0A 5EFFA 2XVPA 2D3NA 1V02E 2BVYA 1LL7A 5A69A 2VZSA 1JZ5A 3ZJ6A 4OBRA 3DYMA 4PUEA 3L2LA 4DM1A 2E8ZA 3PN8A 4UOZA 2OYMA 3PTMA 4Q7NA 1OD0A 3CUFA 1TQWA 5FCZA 1ODUA 2V3EA 2OYKA 4AEFA 3G6LA 3VDHA 1ISXA 2DIEA 1M04A 1L8NA 5KZ6A 1T0OA 1OGBA 1BVNP 4M81A 2F1BA 1E4MM 5FKYA 2Y8VA 4PCSA 2E3ZA 4D6GA 3AIBA 1UHVA 1SMDA 1CXLA 2OSYA 2WVVA 5F7UA 1L0PA 2BVDA 1QNSA 1CWYA 4S3JA 4N0RA 3AIQA 2BHUA 3FNDA 4IPNB 2J25A 2YA1A 1JNEA 4OUEA 2VCCA 3WD1A 2DIJA 2YFOA 1JZ8A 1KGWA 3J7HA 2VQTA 4D6IA 3HJEA 3PZTA 1GZJA 1KCLA 3FN9A 2A3BA 5ABFB 2W5FA 4GZEA 3NDYA 3NSMA 4JHOA 3H53A 2J8FA 3WEOA 2VR4A 1KR1A 5E1QA 3S2CA 4J3TA 3CZGA 3GXTA 4A3HA 3NSNA 1HP5A 3OA5A 4H8VA 3FXYA 1C7SA 1GJWA 3BLBA 3DX2A 1IT0A 1XV8A 4JKKA 4WKAA 1J10A 2WQWA 3D3AA 1M42A 3MU7A 3PTKA 1UOKA 4RL3A 4P8VA 2D0HA 2X2HA 1ESWA 5CXPA 2WMJA 2ZXQA 3VD3A 1CZ1A 1OB0A 4UOJA 4AZGA 3WENA 5JBFA 5ICUA 4A4AA 5A8PA 1W2PA 1ZB5A 3WY2A 2X0YA 1UKQA 1JFXA 4B9ZA 1UQYA 5I78A 4FNRA 2OWXA 2A3CA 5HPOA 2PI6A 1UA7A 2J62A 4IISA 1W9DM 5A8QA 5HDRA 2XWEA 3ALFA 1PAMA 1E5NA 4HA1A 2C8NA 1BLIA 1GOWA 2PB1A 4NZCA 3W37A 4H04A 1WDPA 4U2ZA 1JFHA 3BZ5A 1C8XA 5I77A 3DX0A 4GKLA 1HIZA 5GQBA 1GW1A 5M3WA 1BYDA 2EAEA 1ZBKA 2WNWA 2GJXA 1VFOA 3NYDA 4W7WA 4B3KA 2PWGA 2XIBA 1MW1A 1GNXA 2XM2A 5AYBA 1WZKA 3EBVA 2Y5QA 1BYCA 4J3WA 2EEXA 2IUZA 2BY0A 4W5UA 4KWUA 1CGTA 2OW6A 1HJXA 3B9DA 3POCA 5AC5A 3ALGA 3DDGA 1LL4A 3T0BA 4QDMA 3GXMA 1JNDA 4PMXA 3UG3A 1JDDA 2X2JA 4GO8A 4M8UA 1WP6A 1G01A 1PEZA 3M07A 1GVYA 1XC6A 1MQPA 4AD2A 3CHDA 2WMGA 4QCFA 1HKKA 4KGJA 3WD4A 4UFMA 1NWUA 3CZEA 1OIFA 4JFTA 3BLPX 4B15A 2J78A 3M46A 4PMNA 3RM8A 3OB8A 3NUKA 3KWXA 1CECA 1XSJA 1BQCA 2JF6A 4E4PA 3N13A 5HOSA 3PZMA 2E0PA 4JFWA 3T2PA 1EHAA 1KXTA 3M7SA 4CD5A 3N1AA 4PMUA 4X9YA 3BMVA 2EPKX 2OW7A 1W1YA 5JIPA 1US2A 3WFLA 2QPUA 2G3JA 1MQQA 3BUQA 2WMIA 4MNJA 3GH5A 3IAQA 2VOTA 1KXQA 1F4AA 3PZVA 2OSWA 5TD4A 2WZIA 2WHKA 3WSUA 4X0NA 1HF6A 2A3EA 1E3XA 4AD4A 1QI0A 3HG5A 2NT0A 3KLLA 2BXYA 1WZMA 3CMGA 3CIVA 1TVPA 3MUY1 1BYBA 5A2CA 4TX8A 1CXFA 2UZYA 3WUEA 4GI6A 5I2UA 1OCQA 1DEDA 1H1NA 1KQYA 4KGLA 2VVSA 3BVUA 2OMWA 3EDDA 3VIJA 2XGBA 2ALWA 4PSPA 3PBGA 2XTKA 3WNMA 1EDGA 2J75A 2E9BA 2QMKA 4U3CA 1A47A 3WQ6A 1GOOA 2DPEA 5ECUA 5BWFA 2CCRA 1R7OA 1LJYA 2EPLX 2F18A 2CKSA 1G1YA 3HU7A 5E09A 4WKHA 3TTQA 2VMFA 1XRVA 1IZJA 5ABGA 2YL5A 1VEPA 4GIAA 1I1WA 5HNNA 2VCAA 1ISZA 4ACZA 4JHZA 1ISYA 5C8BB 4MB5A 3WNKA 3VMPA 3UERA 4BF7A 4CC4A 4NSBA 2VZVA 1QX1A 3VPLA 2CERA 1CGXA 4U2YA 1H0IA 2JEQA 3VX1A 1LWJA 1O7DC 1NH6A 1UR1A 3AYSA 5IFPA 1KGXA 1AQ0A 3W53A 3POHA 1JZ7A 3WMSA 2DSUA 3WL1A 1CGWA 1E6XM 1S46A 1JZ4A 3B8SA 5E0CA 4AZHA 3AMGA 1UR2A 1H4PA 1KTCA 3IJ9A 1KBKA 2WC7A 2UZXA 3LPPA 3VIMA 1FP8A 2JEPA 1TR1A 3SCTA 1WCGA 2OMXA 4AW7A 2VZTA 2IGTA 4QLKA 2W62A 3DX3A 2W63A 1HKMA 4TX6A 5DT7A 1B1YA 1B31A 1BGGA 2BY1A 2ZUVA 1FHDA 3IJ7A 1WDRA 1C3FA 4F66A 3ZT5A 3ECQA 2G3IA
chains in the Genus database with same CATH superfamily
1F6AA 1Y18B 1OE2A 4Y1AA 3EYUH 1J8HD 6A3HA 2ZKWA 3MBWB 1BIIA 4WNJA 1GW6A 5KAQF 3DU0A 4ZXOA 1WV2A 4LBWA 3AREB 1OG0A 2NQZA 3PAUA 1FN4A 1LRNA 1QG0A 2ZSVB 2OQJA 4GY1A 4XAGA 3ZDWA 3H9ZA 4WXYA 1MF2L 2E09A 4PB9L 4ZA0A 3Q39A 3BWSA 3V6OC 4OZFA 4XNQA 1ZNNA 1G7SA 4KEUA 1SEBA 2W07B 3GMLA 3WEMA 3PGFH 1L9RA 3MBEA 5EBWB 2XIDA 3F8UB 3LOWA 5IR1A 4PJHF 2CWXA 1FZJB 5FO2A 3ZVIA 1QO3B 2A83A 2DFAA 1M2VB 4CBZA 4MPQA 3W00A 4IIEA 2Z6BD 1A9BA 4PN6A 1M7XA 4HIXL 4YO0B 3M17B 1O6SB 1BZDA 3C60A 2E74C 3O45A 4G7VH 1A3RH 3RVXC 4YZFF 3U1SH 5FEBA 2QHAA 1S5HA 5HVHB 1KTVA 2FVGA 2X2IA 1NIFA 1HHJB 5A7BA 1BZOA 2K6WA 5D5ME 5DK0A 2IH3A 1G9EA 1S7TB 4LUSB 5LA2A 1V3MA 2WXOA 3D3VB 5JLZB 2RGMA 1R24B 4LLQA 4Y1AD 5A3HA 4UCGA 2Z7ZA 1TE1A 2J4WH 5AYUH 4CVWA 4WFFD 5HP5A 2HISA 2XTLA 1X8FA 4LCWB 1RIHH 3R0DA 3A8JA 5IM7A 2DH2A 3Q3GB 1RZIA 1TV7A 4HJJH 5KVEL 1WS7A 4P4RA 4RDYA 4Z2IA 2VNKA 2O56A 3IMUA 1JVKA 1MCLA 2IVFC 3W83A 5BSXA 4LFHD 2DEWX 3G6AA 4PTNA 3T44A 4GJIA 5SX4H 5F7KC 2PKDA 4LCSA 5GGSA 2RC6A 4URTB 2I9UA 2J4WL 2JB5L 4MVAA 1ECYA 4HPYH 1EXBA 1SY6A 1ES0B 1KV8A 2R23B 2YN5A 1IZKA 1UUQA 4ZQCA 3MYZA 4XVDA 1Z69A 4HGWB 2VERA 1JCXA 3L9EA 3DI3B 4F2ME 2UWEF 2F38A 3ZRSA 1G7MA 4HLZG 2F54B 2PMQA 4N0UA 3MUCA 3WLHA 3CLEH 3FFCA 3ABOA 1RK1B 1R4XA 4Z0JA 1WX0A 2P52A 3NURA 1BFVH 4DIAA 4XNZC 3HN8A 5CZ0A 1JXFA 4K94L 1DVFC 1Q0YL 1HGYA 4OGYL 3BUYA 4Y4KB 3RY5A 3O41B 3BARA 3FCSA 3URBA 3JWDL 4XG1A 1F18A 3MLTB 4FR1A 1OGAA 3ZJ7A 3MUIA 5EU6D 1A5MC 4WUUB 4XAPA 5CKSA 1WD8A 2MEJB 3BYTA 4QY8A 1KTRL 1LJMA 2VM9A 4ZX4A 3A4WA 2F1LA 2HPOA 4P4KA 1Z8AA 2NY7H 3CV1A 4S3DA 1G7LB 1Z3RA 3FHAA 3HB3C 4P3IA 1NGWB 2ZZGA 5F1IA 1RIUL 2NZ9C 5FYJL 3WBDA 3DI0A 1LO2L 3DO3A 3L17A 3N91A 3P30H 3QJXA 4WKFA 1KIRB 2DYPA 2HS6A 2ZSWA 4J6IA 4UTAL 4X8IA 3RFAA 3KPLB 4UAOB 3MYJA 4OGAC 4CAGA 3VUPA 4R2GB 3ZTDC 5C07D 3U4BL 3H7LA 1XKJA 2W95A 5I3IA 2WUCH 3LS4H 5F6IC 4JTKA 4EWJA 4YJZL 3QXDB 5SWZD 2HWGA 1WBZA 3MZNA 1AXIB 3CHOA 4P2RA 3F4CA 3F62A 1B0RB 1JXGA 3RVTC 2HB0A 2IPKB 4M7TA 5E51A 3ZE0B 3JVFC 5D2TA 5A2AA 1E64A 2ARJQ 1YUHA 4QIRA 4XD3A 4KUCD 5KSAA 4JIPA 5CJNA 3MI3A 2NQJA 2TODA 3F2BA 2RKXA 3FMGH 3STLA 3CRZA 2V9UA 2N7SA 4AU0A 4F3FA 4KRPB 3BSZA 4OCLC 2JLLA 4YE4L 4NZJA 4PTUB 3N2MA 4DJEA 2ESCA 1ZCCA 5F9JB 5DQ9A 1A4MA 1MRCH 4PCYA 4LLDA 4JKPH 3BNWA 4HA3A 3EJZC 3G8RA 3IGAA 3BTNA 4BWWA 2VQUA 4ALAH 1DHPA 4KXCA 3I6RA 2G5UA 5I3DA 4EE9A 5B4MD 1RHFA 3T0DA 1W72B 1UADC 4UOW0 5FJRA 2VOMA 1H3PL 3IVKB 2V2WB 1T5XB 1OTSD 2ZXWB 1F3JA 4ACPA 4C54A 3WLTA 5FXCH 3ARBD 4FQJH 4JQVC 4R4FL 3GQFA 3KGSA 4CN1A 5I18H 1EHLL 5EEUA 4TF4A 2DORA 1YJDL 1KYOJ 3MCKB 3MKKA 4X50A 3VZZA 3VYNA 1J93A 1ZAJA 4P2QB 4KWOA 5HXBA 1R5WA 2GFBA 2OA9A 3QJTB 5IMMA 4ZAKC 3EJTA 2EE9A 3DUSA 2E9IA 4MNGA 4FQXD 2QUUA 2QUNA 2NV9A 2CLRB 2HFGH 2YGNA 1F60A 4KBPA 1FNCA 4AIXA 4G5GA 1AMXA 1TENA 2BVQA 2YWYA 4QRBA 1FO0L 2XWJA 3FFOA 2R7EB 1DDTA 4YFEA 2FMNA 3WO4C 2A0NA 2EG6A 4MJHA 2C19A 4JY5L 5HGHA 3JQPA 1DDHA 3IJHA 5GGVY 3WAKA 4EZJA 4RDZA 1X5IA 2ZXDA 1UXLA 1ZJHA 3TX9A 4DWSD 2HMIC 4XC3L 4OOZA 1PY9A 1PJ7A 3K72A 5BNKA 4GSRA 2P50A 3A4JA 5TFSH 1XAKA 3TBSB 2DH3A 3CH1A 2NRDA 2A2IA 3OR6A 3LV6A 3M0ZA 1F45A 2EDFA 3Q1EA 2BM3A 3MRDB 1QMLA 3N3MA 3MROB 3TO4B 4XMPL 1E7VA 1PKMA 2VMEA 1ILUA 2X4OA 2A9NL 3GXIA 3IPFA 5DO2D 3TPUA 3TTEA 1L2UA 5HHQA 2NY4D 4XN9A 1T1ZB 4GI8A 4WY7H 3U2SA 1RXOB 2EDWA 2BIHA 2OTJB 3OF6D 4O9HH 3ZUCA 4PBXA 1BX0A 3VXOB 4H0IA 2DT0A 2JGQA 3CC1A 2V5LA 3HPSA 4UTHA 4JGUA 1M9SA 4YTQA 1U2HA 3LZPA 3DN5A 2C1PA 3QQ3B 2AXHA 4L1BA 4JY8A 1Z0NA 1JGEA 1MIMH 3VAVA 2HVJA 1YEFH 4OFVA 4B6ZA 2ZRWA 3WQCA 4AGMA 4YHKL 4E2VA 5LXXA 4DNRB 3UGUA 1SO5A 2IKGA 4XVSH 1DJIA 4O28A 1MWAL 1T1WB 4KZ0A 1PIIA 1Q13A 3VMOA 1R5IA 3EHBD 3FH7A 5IROC 3C0QA 2E7LC 4WWKC 2AZUA 4HP5A 4JE4B 2OYPA 3GHPA 3US9A 4AG4H 1F74A 1NEPA 1NAMH 1FRBA 2ZZ7A 4J4KA 4P7RA 1JNHB 2MMXA 5B3JF 1AOHA 3DWTA 3KW8A 4O4YL 4XZLX 5C55A 1NMCC 3IFNL 4K2SA 4X6FA 4UM8A 1AH0A 2QVTA 4UI2A 3DLQR 2DQHL 4PJEB 3ROLB 2DGAA 4DGVL 5IVNA 4YJ5A 1QRNB 2D0FA 1O5PA 3KPSE 4P7NA 1XYMA 4R90H 5BUGA 1ZM9A 4PFHA 1ITQA 3ZE2F 3B1TA 1EGMA 4IQDA 1ZHAA 2YGVA 3ABXA 2B1AH 3DBXA 1NIEA 1W91A 4PJAE 4FFTA 4ZTPL 4GIEA 4L6OA 3CLFL 2O7QA 2CHWA 2QJGA 2ZKXA 5HJXA 1Q66A 3BZDA 5H6HA 3WF4A 1EDQA 2QUVA 2ZE3A 3RXZA 5IB4B 1LBMA 5J6SA 3SECA 4JN6A 3L8QA 4Z0SA 1QLRB 3EBIA 3QYSA 4RE2A 3WFAA 1DBAL 1YDPA 2CLVB 3JWNG 2A5UA 1AD1A 4NZ5A 4PWHA 4CADA 4UINH 3LEXA 4JKWA 5HWMA 5E23A 3R0KA 5EGRA 2NR6A 1KW1A 4MNKA 2EINB 3F7LA 3EOTL 1RUAL 1JF6A 2PTXA 3CFCH 1K4DA 4GOAA 1JWUA 4KJPC 4IQLA 4HWZB 4CNSA 5IFJB 5C6WH 2FAUA 1FFRA 2ENPA 4U4IA 4ERGA 4DB7A 1N2RB 4XNXL 4M7SA 5CUSL 2OO6A 3ZS4A 1CDUA 1FVCB 3ZPDA 2QADD 4KQ4H 2VEMA 4S3KA 1WGOA 4P26A 1E27B 1JNNH 1Q4NX 3OXRA 1QACA 1KFEA 1BD2B 4EX4A 1A7NL 3IM1A 4GXVL 1USQA 3KEHA 3CBJB 4E6MA 1AGEA 1UOWA 4OIAA 3S4SB 4RNFA 3DRTA 3KPSA 3AS3A 3RKDC 3MQTA 1A6ZA 1S8DB 3K7UA 3V95A 5I1GH 3CNYA 2XVLA 3AT9A 5TF1H 1GOQA 4HNCA 3PSWA 3G9AB 1U92A 1LP9A 3MLWH 4GUHA 5EY5A 3VRJB 4P5MA 3IRZA 1IT9H 4ROXA 1HSAA 1KF9B 3T8XB 3ZXAC 5I0ZA 4TU1A 3WJXA 2IKIA 2YBGA 2XPYA 2C9AA 1SJXA 3HN3A 2YRPA 4E9WA 4ZL1A 3BOLA 2EXWC 3ZLQC 1FRGH 1KFCA 5A8NA 3QWRA 3RZCC 1CICA 3CZ8A 3RDTB 1FFOA 1EO8H 5C09A 1L8PA 4O02B 1B0WA 1TITA 4K7PH 3M5ZA 4GQRA 2OFQA 3UZWA 3HS9A 3F7JA 4GIPD 2ISDA 1F1AA 2WLZA 3PNRB 1CFQB 1IILE 3E74A 1ZT1B 3GYRA 2VDMH 3G5XB 3KHDA 5DBTA 4J3BA 1LEKA 4DUWA 5G1TA 1SPQA 3TEUA 3CYVA 3QPEA 4W4QA 2BHZA 1TR7A 3ZFHA 1TWDA 4NNXB 2VEFA 4QJ3B 1BOYA 1E4KC 2WZPA 5I71C 2ALRA 1I7ZB 5D7EA 3PSVA 1LWRA 5E2TL 1A4JA 1GOGA 1UD2A 3PWPD 2VR6A 4WW2C 1WWAX 1XGUB 2CJUL 5ERWB 4ONHA 5GS0H 1EXPA 3O2DH 2BOFX 2X70A 1F11B 1V4YA 2VJXA 4GRWH 3FB7A 4K3DL 3X13A 1E8WA 4N9DA 3L3KB 5I9QB 3T3PB 1MEIA 3MRFB 2YA0A 4PABA 4FHKA 4B9KC 4M48H 2QLYA 2HVNA 4HA4A 1KB5A 5D1QC 3AHZA 1Q2RA 1NZRA 1OARL 3CB3A 1VZIA 4FA6A 4XPAH 3P14A 4JJ5A 4YEEA 4JM0A 4KZEL 3CT2A 3RA7H 3USBA 4I2XA 5FCSH 2AJ3A 3ZJKA 5H1WA 3KZ8A 2CUAA 4TUOA 1NCWL 1HXMA 6XIMA 5D1ZA 1UJ3C 1OAUL 1SXCA 1YI2B 1MUJB 2G3XA 3B7YA 4GKSB 1X97A 3VIOA 3DX7B 4NRXB 1LO5B 4YSOA 2BVWA 5EBWA 4JPIA 2PDCA 5BMWA 3TYZA 1ONRA 4WZKA 4L4TD 3L3JA 2EDYA 1NOAA 3I3DA 1A9BB 2X16A 2YARA 4ZAKA 3N1GC 3L5LA 5ABAA 1JPFB 1N5AB 5FDWA 4IJBA 3VXMB 5HYEA 3SUUA 2QZQA 1D6EB 2UX6A 1XGQB 4I2XE 4ZSOA 5F9WC 5LAXA 3FU9A 4X80L 5IEHB 1DQVA 5DD5L 5DC9B 2VXUL 2DICA 4IQJA 2P5WA 3INOA 3GNNA 1SF5A 3PWVA 1BQHA 2PABA 3H94A 5IM7B 2VFDA 2ARJA 2WHJA 1CENA 1DXFA 2Y89A 2IAMD 3E6FA 2OSXA 4P3DB 1OZUA 3IRPX 1XLHA 3D0CA 1AQFA 5J35A 3WJJC 4KX9A 4LC8A 2MPAH 1FH5L 4B9PA 5JIWA 1FL3B 3E3QE 2A79A 1J1XL 3KDPB 5XINA 2VQ4A 5DRWA 4BFKA 1U8LB 2PGFA 2GHZA 4UTTA 5E99L 4MA8H 1W5MA 1YEJL 3WIIH 5CBJA 4HUMB 4O50A 1IXNA 2R6OA 3VYLA 4B3GA 3C6LD 4JS7A 1W1A1 2FPTA 2HJLA 5EWIL 5IVXE 4G43B 4GRWF 3VNVA 4NIKB 3VU1A 4JRWA 7XIMA 2PWHA 5JUEH 4P2RE 2EP6A 2FYVA 1T0PB 1JZ2A 1UYQA 4XZWA 1G0XA 4XCYB 5BUPA 1AW1A 1KBGH 3W82A 4POUB 3E0IA 4ONFL 4HGKC 3FK3A 4MZ3A 4PS7A 3AMKA 4AZ5A 3BEVA 2ERJB 5E4EC 4Z9KB 5J13B 4QNPF 1E9IA 1GONA 1GZGA 1E6ZA 2WJVA 1EV2E 1U36A 2VLLB 1OAXL 3OC5A 2Y2TA 3VE0A 3DAQA 4YBLB 2QCNA 2W1NA 3GBML 2VD8A 2DQWA 1MFNA 3W9EA 3V0HA 5TE7H 2V7QA 2B2XH 3WS3B 2DM3A 1INDL 2K0RA 1D5RA 4Y16C 1ZHKB 1UWUA 1JZ3A 8CGTA 3WK2A 4ORMA 4UFIA 1AMOA 2YD2A 1YG9A 5IQLA 5JHLL 3N2TA 5E0KA 5C6MA 1UMKA 4IJ3C 4W93A 1CT8B 5ESAA 3HNTH 1UWGH 3DX4A 4J3OH 4X42A 3JV4A 1U8KA 2OTPA 3TM6A 2VDIA 2JH2A 2ODOA 1I8JA 5CMAA 3QIBC 3W2KA 2VFGA 4DJDC 3MA9H 3CVDA 2NW2A 5J4MA 1N5YH 3SLNA 3RWHB 1BG1A 3OYZA 3OWEA 2VQ1B 4PULA 2ZX5A 2IBBA 2BP0B 2P26A 5EU4A 3EZ4A 4PTXA 3IANA 3S6DA 3ZVHB 3AQXA 5FA4A 3C5SA 2CLPA 5F3FA 3ZKND 1G7JA 3N40F 2ICWJ 3V5DB 1HHJA 1IC5H 3TOPA 4DESA 4N9EA 1YAIA 4UQDA 4L1GA 2VISA 1ZENA 4MKNA 5FYLE 3P60A 1NCCH 3QEZA 1H50A 2UYLB 3H2PA 1H15A 1XGRA 1G5GA 2E6QA 3DFTA 3PHOA 1KCVL 3HIZA 3AMDA 2XIMA 3RX4A 3BZFA 2WLIB 2Z6FA 4Q74A 1T20B 1HIMH 1CI3M 4EZKA 3G1VA 2QKSA 2XINA 4E5XA 2R2BB 3CVBA 5B7EA 3LUTA 2SEBA 4Q9CA 5AAWC 1GGCH 1NANI 1YPZB 4YXLL 5D72H 3VSVA 1H2JA 5E2WL 5D70H 1TJGH 4G6FD 1OGGA 2VFIA 4XHJD 3WQFA 4FQQA 4XNUH 5A6BD 1X9LA 4FKEA 5M03A 3ZTNH 3OXSB 1HE8A 1UFUA 2HPTA 2Z6JA 3ULVH 3L0GA 2EEAA 2W9EL 1VB9A 5JUEL 1P4BL 5BOJA 3RHWK 1VLXA 5HSFA 2XGZA 2J6EH 3KCLA 5EBMB 2Q3OA 2CDEB 5AAWA 4S1QH 1D9EA 1CF1A 4XMKL 1IT7A 4OCXH 3VI3B 5A6AA 4ZENA 3RNKA 1UKSA 4H25A 3JV6B 5GGQL 1YN6B 4ZQKA 5SWSB 5FSEC 1GGBH 1E9YB 1P2CA 5LBSA 2AMGA 2VZ1A 2CWRA 3DSFH 4FXKA 2QDEA 4HIHB 3CXCB 2ZT9C 1U8CB 2CLZB 3QARA 2C4TA 1PTGA 1XQBA 2VZ3A 4PGLA 1XLFA 4XXCC 1DTNA 2XV6B 3PM6A 1KB9J 2H9AB 4DPQA 2BMWA 4M56A 1HQ4B 2MCPH 4LEEA 4A37A 2XTJB 2PFHA 2Y88A 4U3AA 1HJQA 5L2JB 4QY8B 1NTDA 3AFLA 4GMSH 2OZ4H 2CLOA 3UX9B 2AGTA 3SGEI 2K6YA 3VU2A 4PRRA 2XZQH 2DJSA 1QBML 3P4NA 4JZOB 2GCYB 5EO0A 1BZ8A 2EG8A 5C70A 3EYOA 5FWQA 1M1BA 3K72B 3BVDB 4U1LA 4ZQTA 2F19H 1TFVA 3R11A 2WVUA 3BDYH 3MRJA 4LAQH 4J2XA 4K8GA 3A67L 3RU6A 3LDVA 4TNGA 1EFXD 4I5BB 4IF2A 2FLRT 3QS2A 3H6AA 3P0WA 1Y6NR 1RHHA 4WTZG 3SE9H 3BK0A 1TPEA 1NCNA 5FFOA 2K4WA 2ADGB 3HR5A 3NGBB 4PWKA 3DVGA 3MUGB 5BQDA 3CO4A 5I1KH 3LKSB 4JX4A 4LF1A 4GUFA 3RLUA 3QIWC 1JK9B 3HMCA 2BNRA 1GVQA 4Y8AA 2X4QB 4KRUA 1SOQA 1Y0RA 1YNTB 4Y19D 3FY1A 4N4PA 2ICEC 3BUTA 1MRFL 4PI2A 5H4YA 1IRAY 1QAWA 2A6DB 3HPJA 4PV1C 3WNOA 1HZYA 4CDHA 3HNVH 5I0WA 4LB3A 3TYEA 3L2MA 1J01A 3BH8A 3WFHA 1ZOXA 1BAFH 3SPVA 4GS7B 4C1KA 3F04A 1KNOB 1XLDA 5C3TA 3M5XA 1CZ8L 1EDTA 3LZ3A 1SJHB 3DOPA 1C5CH 1SZGA 2P80D 2WWDA 2KDGA 4DNLA 3I1FA 5IG7B 1A53A 1YHTA 1I1AC 2X1OA 4S0SD 4PR4A 3OW7A 2A5HA 1X5AA 4UR7A 3WKYA 4EI6A 2VDML 3P4OA 3BP7A 1QUNA 1HC1A 3VI4F 2HX8A 1QRNA 1CT5A 1MY7A 2GGIA 3AABA 4ZYKB 1QFYA 2OCFD 4JANB 4CVZA 4LL1A 1TZOA 3DMMC 1I3VA 3N40P 4MXQD 2IGFL 5ABZA 1YEEH 2F7OA 1WOPA 5IYQA 1SN5A 3GJEB 4P2QA 2PZNA 3QQ4A 4ONVA 5FEWA 4R0LC 5KS9A 4KDTA 3FA3A 4LDLB 3R1GL 4HXAH 4Y1SA 1IBBA 3PL6A 1W9XA 2EPMX 3KAOA 3CHRA 3IJ8A 2VW4A 4K2UH 3MCLH 1AI1H 4F57L 2XZCH 1Y5XA 2BGQA 3APGA 4HYTB 3H24A 4KCUA 5C54A 5KVGL 4HMNA 4WWKB 3BPWA 2Z8WC 1I1RA 4EN2A 1NDVA 3UYIA 3F3HA 4IM8A 1IAIH 4IRSD 3IUDA 2GT9B 2PPGA 1KJ2B 4Q8PA 1YDPB 4R7WA 3AHYA 2WIIB 5IUCA 1W0MA 3QC5X 2D73A 1HJSA 2J7DA 3IEBA 4G71B 4Y9UA 5DJ2A 3A4XA 4DWSC 2LU3A 4WCYH 2Y72A 4KHXH 5GSVB 1YECL 3U2EA 4QHNB 1EAJA 2VR7A 4RLIA 1V03A 3QQXA 1K4GA 4JFZL 3IFOA 4YLQT 4FG6C 1IC0A 1SXSA 1HYRC 3QQ9D 4KQ4L 1DQML 2BJMH 4AYGA 4LSRH 3LPWA 1EFTA 2X41A 2ZKYA 4WKZB 4B27A 5ANME 1ORQB 1IE4A 4QTIH 4X7DC 3N44B 3NJKA 3H9SA 2ZWZA 3PAZA 3IAPA 1OM9A 3P73B 4TUUA 4XZ4A 3VVWA 3C2AL 2Z1SA 4DY1A 4RX0A 4FLRA 5BRQA 5ADPL 4N6EA 3IV3A 4GLRI 4PJ5A 5BVPH 4NO3B 3QUML 1J7VR 3Q58A 2CITA 3GR8A 2FK9A 3RNDA 1E6RA 1E0WA 2XZPA 2WZAA 1CK0H 2JIZA 1OCCB 2DMKA 3VW3H 3SEPA 4U6VH 4DN3L 5F3HB 4HIIB 3G18A 3IDYC 2E86A 5C97A 3TAKA 1SKYB 2XWXA 2NWRA 3AWEA 4LCIL 5CSGA 5F2FA 2BNJA 4Z3HA 4LANA 3T3ME 4ENED 3IETA 3GMOB 1A8JH 3LMJH 5JPMA 5FW7A 5BRZA 4MMWA 3AVYA 1C1EL 4JFOB 2VR5A 4MD5B 3VIGA 3Q8FA 3V6FB 3QUYA 1IKNA 2BPBA 5AN7A 1ND0B 2J21A 1IM3B 2CIIA 3CLFH 4RLDA 3H7BA 5F0PB 2OL3B 2ZZ4A 2V9QA 1EIBA 3V0VA 3ARGA 5JPMC 1Q6FA 2YPIA 1KN2L 4D0DA 3UPRA 3UR2A 5C0DA 4GSQA 4R90L 4X6BA 3SCQA 1A1MB 3AQZA 4F8QA 3ATBA 3HOGA 3WLSA 1LNUA 4LC0A 1AQKL 1OHLA 1Q9KA 4KHXL 1TZGH 2L7UA 1IGJB 4TUJB 1RJRA 4AXNA 3BAJA 2IFFH 1ZV2A 3N1MC 1OBAA 1JK8A 4MYAA 3XISA 4BHUI 1Q9LA 5DF0A 1GZQB 1GJUA 1P5VA 4F8LA 2FWOB 4HFUH 1OGTA 2K78A 2XY1A 1HJBC 3SDXE 4ONHB 4TSAL 1SHXA 4HC1A 4CGTA 3M88A 2NDGA 4LNRB 3AO0A 4ODXB 4O11A 5D9OA 1TPB1 1GY1A 4IIQC 1JWMA 3DHDA 5HYIA 1TZIA 5AZ0A 3LMYA 4MQ7B 1EC7A 4MKSA 3X12B 1F97A 3QAZC 1XG3A 2XWBB 3UCQA 2ATSA 3R8GA 1B0IA 3V0TA 4DGYL 4GLEA 5DYFA 2XSXA 4OF3A 1VAHA 4ICNA 2NSOA 1WBXA 2GFTA 3NQMA 4KS0A 1LQAA 1H0DB 4XH2B 3B4NA 3ABMB 4P6YA 3Q6GL 3E1YE 3FFCD 2AJUH 3TVMC 3SUVA 3BWAA 4HEME 1ONQB 3BH9B 3E1F1 3BMWA 3GMNA 1CZ8H 4G42B 4I3RL 4A2HA 2JKJA 4XXCA 1K77A 1S4MA 3GB7B 3OJDB 5C7XH 1GCFA 1M3UA 1BQSA 3OMAB 1N3NB 1L6PA 2DQFB 5GISL 3QDJA 5J9PA 3PF2A 3HPFA 4DPCX 2VBUA 5IJVB 2DSWA 3MJMA 5IROA 1VFFA 2ZFAA 1NSNL 2BY3A 3HLAB 3VUAA 1S9VA 1ISVA 3QM3A 4ACZB 3EJJX 1CW2A 2JV6A 3U9IA 4WI3A 5GSRB 1ZANL 1A3WA 1U8IA 5DDHB 1ACCA 4XC1L 2O5XH 2V6HA 2YYUA 1DQTA 5DXXA 4AZ6A 2Z1BA 3MJ7A 4MXQC 4JREB 4RFNC 3T0EC 2DYIA 4CLMA 2IJ0C 1QWKA 3AVVA 1NEYA 3HI5H 4U0QB 3SJVB 5GS0D 4JN8A 3BE1L 2CUIA 2ADIB 3PJSB 2FB2A 3FQ2A 3GSUB 1NOWA 2DMBA 3ETBF 3ZDYB 2C9RA 1QOQA 1VS1A 2WYSA 3BCDA 2WM1A 1MHHB 1WSST 3FTGA 4FG2A 4DKTA 4DOHB 1KN4H 1UFGA 1KA9F 3BANA 4W7UA 5C2UB 2X38A 1XSIA 5E2UH 3VD2A 4NQEA 4JNYA 4ICCX 4JX5A 4KO5A 3U83A 2J6XA 2V9TA 3JTSB 4CCEA 3BDKA 2F19L 1J0YA 3GXDA 4LOUD 1PD6A 2IQAB 2XWTB 1DQIA 1XLKA 2H3BA 1A4JB 5AKRA 1AO7A 2X85A 3H6OA 2E3VA 4RMWA 3L7EB 2E5BA 4JX6A 4ZQMA 5FF7A 2WAGA 1H3UA 4K73A 5FGSA 4D8PA 3G2GA 1SOKA 4IIZA 3VSQA 1Z9OA 3DGRA 3MRBB 3RJXA 4MZYA 2ETWA 3AW5A 5M5DA 3W9EB 1BZQK 4WZEA 3GINA 3GDCA 5D8ZA 4O51A 5E6IB 4BQ3A 2IALB 3CCQB 1CYXA 1LE9B 2WZ0A 2P43B 4GEJA 2WM0A 1ZVYA 3KGRA 1EUNA 4NAEA 4H4NA 4AVFA 1VLYA 4FNTA 3QH2A 1A5UA 3PJLA 1X7QA 4LMQE 1REQA 4G9DA 3C56A 1J1OL 1U93A 5IQ7H 3VD1A 1YEYA 4JFVA 4FP8H 2VC9A 4FZIA 3SYPA 1NBQA 3UXKA 3L4VA 2OOFA 4AZBA 3G5YB 3NJIA 4UDUB 3FPKA 4Z7NB 5E24E 1Y0YA 5BWAA 2O30A 2ACUA 4PRHA 2X9YA 5HPMA 1MKFA 1Z48A 2QLVB 3NG5A 4Y5YB 3OZVA 3FSUA 3FCUB 4HF5L 3ZZ1A 2ZVIA 4MIMA 4QFUA 2F6UA 3UA3A 4KNSA 3FT0A 3OC8A 3WE6B 5IMOB 2PXYD 4WFGE 1P4CA 1QSVA 1HNGA 1ZK5A 1HOEA 4O8RA 2N1KA 4WJXA 2O92A 2QDGA 3W2JA 3WTYA 4G80A 4OGYH 3KPOA 1OSEA 4OECA 1H7PA 2FL5B 2SODB 3VXUB 3W5NA 2BNUA 2QJNA 3VACA 1YPZA 1U8NB 5E9XA 3MLXL 2Z31B 3GGWA 1GYCA 1C93A 1EQCA 1XD0A 1NWPA 1VRDA 2YDSA 4TTGA 3BAKA 3H56A 1DPMA 1I0DA 3SCWA 3VXRD 5IJKA 4LLWB 3UR5A 1X6LA 1GYVA 3ITGA 3HI1B 4UMSA 5FJJA 1G9ML 4QO1A 3GKWH 2CKBH 3EOBA 3Q5TA 4G43A 4GXMA 1KTNA 4Z4YA 4YUEH 4JL2A 2Z34A 4RGMC 5EB8A 1JA0A 3BY1A 2NY5C 3MLSH 5LLIC 1JV5A 3C60D 4AB4A 4JFZH 1BVLB 1VFAA 2HWZL 2E27L 2OV0A 4Y19E 1BG9A 3LEYL 3QEGL 4G8IB 1Q5MA 2P24B 3M45A 1ROWA 3EW3B 3MJWA 4JG0H 3DHFA 2C91A 4MRBA 2JBMA 5GJMA 1A3ZA 4P57A 4EEEA 1B30A 1S7XA 1ISWA 1HO1A 2YCJA 1P53A 3BXNB 1FX6A 1PLBA 1VF8A 1V3KA 4DEWA 4TQ8A 4QDPA 1XR8B 3RWDA 3UJIH 2WB7A 1S9YA 2OR7A 4I4WA 5JIKA 3ZL2A 4KKCC 3MUHL 3WIHA 1Q8AA 3IDYB 1AJZA 4N2YA 3VXPB 4E9YA 4IMFA 3MRMB 3UZJA 4AZCA 4MA1B 4PS3A 3FU3A 3MB9A 2EG7A 4X6CE 4FQ1H 2IC2A 4XD4A 3VGHA 3JU2A 4B41A 3EBAA 4PGJA 3MBWA 5DC0A 2Y5EA 2G75B 4U6YB 3E49A 1I8MA 1CB7B 3VINA 4PJDF 1GYLA 4XP4L 4ZFGL 3MX0B 5D30A 3W24A 1J6PA 1SLXA 1I1FA 1FJ1B 2ICSA 1LEGB 4OFIA 5C1MB 2AGKA 1V10A 3VFGH 4HIXH 3ITLA 3OV6A 3U5UA 1KYDA 3MRIA 4LHUG 4N2LA 4MJIB 5E95B 4N28A 4LCUA 3TNMB 2CCVA 4ISVB 3C9NA 4NNYA 5CZJA 1FFQA 1CYWA 1FZJA 4DLFA 4TVPL 5E99H 2KQMA 5HDBE 1SFJA 3IGHX 4J12A 5D4QA 5HVFB 1Y8BA 3UY8A 2UZIL 3DXAD 5ECJE 5KAQG 3KL0A 2EE2A 4CD7A 3CDYA 3N43F 3ZGHA 5MERB 4U1GB 2J5LC 1GJPA 4JHMA 1BAFL 4LVAA 4KCTA 2F4NA 4UTCA 5DJYA 3RLHA 3UAAA 4NUQA 1HX0A 2A6DA 4QEGA 4HW6A 1IQDB 1OGAD 1SJEB 1KJVB 3J07A 4JDZA 4GG6F 2CBVA 4N4QA 3S1XA 5CLXA 4P22A 5FWRA 1IT8A 4D1IA 3V52H 3QZBA 3NA9L 3TA3B 2A7PA 4QM1A 1U4EA 2VUYA 4KTEH 1K5NA 1NFIA 5C08A 1ZMYA 5B1KA 1QOXA 5AB2A 1G1CA 2MWCA 2Y3AA 3NCJH 4OI8A 2E6AA 3BICA 2DYPD 4UTIA 3W1AA 2OX4A 3OGRA 4Z7WE 3TH3T 3CQPA 4H01A 2A0LC 3ZKMD 2IQTA 3SDDC 1P4IL 3O9WB 4P7QA 3QCTL 2Q8AH 3ES6A 3QIBB 4MJID 5DJ6A 3JV6A 4ML4A 5D2WA 4XNDA 3R0UA 3QOMA 4JFYA 3CN4A 3V4PL 3GSWA 3T0WA 2WD0A 2XZQL 1EDHA 1G43A 1F4HA 1BJKA 4I7ZC 4ODWB 4X5WB 5TDNA 1LG1A 2ADAA 1SBBA 4JXCA 3V52L 4Z2HA 3L3OC 5I8KH 4N0FB 4JFPB 1ZXQA 2VGBA 2BVPA 3UJEA 4M5PA 5KOMC 2VXVH 2GJXB 4S38A 3WJLA 1BVWA 1HFBA 1FG9C 1YAZA 5DEGA 5E8PB 3KM2A 3KTCA 3CIXA 4GRLD 4OZFG 1ROCA 4XO4A 3F2CA 2BNQB 2OM5A 4L1HA 1A3QA 3EWZA 2YLKA 3T81A 1ZA6B 1NCBL 4BDVA 2I07B 3G22A 4LNVA 2ZG2A 3SGZA 4XAWL 3LKOA 5HNUA 2JSFA 4JX0A 4CBPA 1MCQA 2Q09A 4PC8A 5DJXB 2DEXX 1BPVA 3WL0A 4XZMX 2BSED 2JE8A 1HZHH 3EXSA 2QJJA 3LNFA 3K0WA 4XPFH 3APDA 5TQ2L 5K9JL 5CGTA 1QU4A 1P4BH 3VGEA 5GGUB 1M3JA 1UJ3A 4EVNA 3AVUA 3LMZA 4HK0A 4APQB 1EO8L 2IBZX 2XVNA 3E12A 5AOIA 2NVCA 3FJLA 3PHQA 1O1ZA 4BY3A 5I1IH 4KW2A 1CNVA 3BPOB 4J3SA 3KWWB 4WTWA 3G5VB 4LSVH 5D1QA 1BWLA 1D8WA 2QMJA 5B38B 4MPKA 1BJ1H 4LU5H 1HIML 2HLEB 4O10A 3FUIA 1GAWA 3T77B 4FEMA 1YC8A 4NJHA 3WG7B 5IVOA 1CVSC 1X1OA 1FGVL 3UJIL 3E1ZA 4Q8BA 5EMNA 2Z2BA 3PIQB 5F88B 2OGYA 5GGSY 3ZDYE 1GC1L 5LBGA 4P8XA 2UUDH 4E2BA 3K5SA 2BM1A 4EJ1C 1GYAA 1EOMA 3SJVE 4QT5A 3CMFA 2WLYA 2KL6A 4D6FA 1U42A 5BOZG 3PZIA 2HWZH 1FH8A 2LAGB 2VGFA 3L0NA 4O18A 3KPNA 2E9JA 5JW5B 2CR0A 2JXMB 2YCIX 2XQ0A 4YUEL 2V7VA 3IN2A 2DMHA 4R7NB 5F6HJ 5IBTH 1YBQB 5H91A 2VZUA 1NBCA 3BIAX 3DROB 4GAYB 3M0XA 5EN2A 5AVYB 4NT6A 4YEFA 1W3KA 4UTTC 3VI2A 4LPUA 3P3TA 4NRSA 2DQIH 4X6BB 1HHHB 1OXYA 1VRSA 3DO7B 4AXWB 1MXSA 2AL2B 5K2ZA 4ZBCA 4GK8A 3GDMA 1EXUB 3TTSA 4Q4RA 5C9RA 4I18A 3KCPB 3ULAB 5HVHC 2J8UB 1XGEA 3TJ4A 3QWNA 1Z0MA 1EFQA 4NPJA 2CALA 3TCTA 2B0SH 3TP4A 1OIMA 2V7TA 4QMEA 4G7SB 4PRPA 2NZIA 5FO1A 5GV8A 1KZYA 4ETYA 3ITVA 1V0KA 5EF3A 3ATDA 2FQGA 5DJ2B 5BZWB 1RBAA 3FCBA 5IM51 2JI2A 2PWFA 2Z8RA 1MOEA 2AV1A 5E9DA 4J4PC 4M5SA 2NUYA 1AIPA 3EH5B 3C6LB 4EI5C 4WGHA 3T4CA 1J18A 3V0AC 4FK8A 2Z64C 2OKTA 4J2PA 1WA1X 3IBOA 3OBKA 4NRZA 2CNCA 5EWIH 4YGVA 3RYSA 2A3TA 5D71L 5KANI 4G1MA 4Q7BA 2A7RA 5IMLA 4JVPA 2H8PB 3PQYA 4V1XA 3TPUB 1LK3H 3QJOA 1UOLA 5CLZA 5AD0B 1IAII 1F73A 2MNJB 3SDXB 4CW1A 3VMNA 3MRHA 2DQHH 5DMJB 1GW0A 1E9ZB 3HC0A 4GG6E 5DFWH 1IB0A 3OKXA 1F7BA 1BPLB 2AKRB 3B9VA 3CFBA 2X1UA 4OWGA 4NIRA 2JIXD 1S2UA 3QTGA 2FQFA 2ZOWA 3KR3H 2M1KA 2Y7GA 3EH4B 1F3XA 1BXNA 4ES4A 3LCFA 2HUEA 4P9MH 3DPDA 3ZBUA 4P12A 2BS9A 5AW2B 4CC4C 5EIIA 1A5SA 2E9LA 2VNIA 5L6UA 4N6FA 1H49A 3EAKA 1F3EA 4PJBB 2WOYA 4OCRL 1V7MH 2P7TB 3CN0A 1SOSA 4WJ5B 2DD8L 4X6CA 5KVDL 5I1HL 1L6SA 1MCRA 3SURA 3FQTB 4GMEA 3BSZL 3TZVA 1AXSB 4YTUA 1I75A 3VB8A 3WH9A 3DG6A 5BROA 4ILDA 1E5ZA 1KLYA 1PX3A 3OEEA 1G7IA 1DVFD 3GSUA 1YMMD 1ME7A 3CJPA 3F4VA 1HGWA 5DR5H 5I1JH 1E4XI 1H3GA 2CQVA 4PJGA 4PMZA 2P9RA 5J6GA 1NLDH 2V33A 3FQWA 1VHEA 2GB2A 3PP4H 4IOSD 4U05A 4AGQA 1AZ2A 4XBJA 3LCYA 4RD0A 2XVKA 3HS8A 3Q0HA 5BS0D 5FKAA 3MGTB 1IWPA 1GYNA 3KW3A 4RIRB 4N2GA 4Y9EA 5A2BA 3W5VA 2EVFA 2R4RL 3LH2L 4N0CD 3L23A 3KPTA 3MLZL 5EPDA 2DQJH 1YN7A 4F91B 3OKNB 1NJ9A 5GJSH 3OFNA 4XD7A 1EUUA 4C4KT 3WQZA 4YFDB 2WHMA 3W7HA 2WXLA 5TGBA 5BMXA 2AJUL 2IOMA 3VQ1C 1XGZA 5D4YA 3IVSA 4EIZC 2YW4A 2EUWA 2FT8A 4AGNA 1MUMA 4L4VA 4NAEB 1M6OB 4JTQA 2IQDA 2ITEA 3QZLA 2EDDA 4WLCA 3N19B 3W6LA 4DX3A 2FIKB 4JNZA 1NEUA 2IGLA 5HD8D 5IHWA 1XBVA 4WGWB 1R3JA 4PC1A 1AIFB 1GKEA 5F0LB 2JIEA 1OT1A 1QWHA 2EDTA 1ZWIA 4AG0A 3PV7A 3GLCA 1VACA 3SN6N 1KC5L 4AV0A 3ARBB 5JZ7D 4HPGA 3TOYA 4FAMA 2D24A 3CZFB 3QSKB 1XB6A 4Z7UB 1GHFL 1QRND 3H85A 2O6FA 3VWJA 4AL8C 4HNLA 2BSRB 3UJTH 1L9SA 4OKDA 4I88A 5IFAL 2FSEB 2VWEE 1MNZA 3ATAA 1R5OA 4HEPG 3VI4A 4Z4ZA 1MRCL 1OHHA 2DQFA 5AW6B 5CCHE 4F5CE 1JV2A 3MV7E 2P3MA 3R94A 4A21A 4HZLA 4ZB0A 1HI6A 5D38A 8XIMA 2QS8A 3IFPA 1E67A 1YSOA 2HLFC 1EWYA 1NGXB 4NPYA 3FU0A 2VLMD 3GZ3A 1EEPA 3W7GA 1U8IB 5TK2A 1BP3B 1XZ0B 5FJOA 1A66A 1BLNB 3FFDB 1OCNA 3CCEB 2CLHA 4TIMA 4Z2GA 5TDOA 1IIIA 1TTBA 2XT1B 4UIMA 1DCLA 3FN3A 1BTMA 4KVNH 1IVTA 3LCHA 1Z7JA 1CTOA 4R53A 2V5RA 3B9AA 4QRQA 4L48A 3KGTA 2OMTB 5HHPA 1RLBA 5FJIA 3TROA 1QVOB 2WO4A 1FORH 3DX8B 4BJLA 2BV9A 3WD0A 1G7VA 2XJLA 4LCRA 1FVDB 1Z2KA 1YEHH 1R3YA 3BGFB 4WI5A 1JA1A 2HKAA 5F7HA 1ZK9A 1OB2A 1T80A 2NY4B 4DOHE 2XDFA 2OL3H 3F6IA 3DXAE 3WTTA 3T0AA 3HVDA 2RAGA 5LIXX 3OKLA 4RNRB 3AXKA 2P24A 2X40A 5IB2A 3DMMA 3V9EA 4NENA 3QUXB 3WXWL 3WD5H 1IEBA 1PS3A 4XOEA 4XD6A 1VBHA 2E1RA 4RXFA 2LVEA 1NGPH 2P5WD 2Z91A 2J6EA 4OOUA 1TWSA 5DEFB 1COBA 2APFA 1AW5A 1KTDB 3WYRA 1WLHA 1K8CA 1JTPA 2X70B 3DGCR 3EJYC 5K9OB 2GJPA 2DQTH 1P43A 3MSRA 3UQNA 3CX2A 1Q0YH 4HZ6A 3EGDA 4KDVA 4KY1H 2QDXA 3GSNH 4M7KH 5DD0H 4ZUWA 3ZTJG 3VW3L 1W1PA 2BMBA 1IC7L 2A85A 4Y9FA 1R0MA 4KEVA 1TQTA 5AYYA 3UROR 5EUOE 3H7VA 2GJ6D 4TN1A 2B59B 4KKBD 4P3WA 4DZBB 4LYRA 3WFEH 3O3BA 3RMJA 3KLAB 4OP7A 4S3EA 2EYRB 5GVJA 1QO3A 2A83B 4ERSL 3EYQD 5I9QC 1OB5A 1GA2A 1GR7A 5E03A 4DAIA 5DO2C 3MKGA 2ZDSA 4DAGL 4E3TA 1CFNA 5LMZA 2OK8A 4XOTA 1JB9A 2R4SH 1S5IL 4BH7A 4PN2A 1I9RL 4WCYL 4LAKA 2NV2A 5F97E 4KRTA 1NAML 2YO3A 1D5BA 4U6HA 3TVMD 1H3XA 2CKBA 4FKKA 4LCWA 3HVNA 3SQBA 4WQOA 4ZSOB 4L0ZA 3V4UL 3T07A 3NCBB 1OE1A 1OAQH 2DZVA 3VXRE 4JAMB 3ROOA 4EZLA 4XVSL 4OLUL 3LLXA 3HKFA 1A5BA 5FW6A 4DYEA 1BXAA 1MFUA 4HUXB 3L3HA 4X05A 4XOAA 3EB4A 3BWZA 1QVGB 1E1QA 1ODAA 2ARJB 4LRNH 1H7XA 2PW2B 5F9JA 2ZL7A 4Q8MA 1JOIA 2GSGA 2KERA 4OCSL 1A4KB 5CIPB 4KO6A 3LZLA 5C0AE 1PJ5A 2P42B 3QIWD 4KAQH 5FGBA 5I3GA 1R3SA 3ZL1A 1TMHA 3PUDA 1P5UA 2VLKE 1CLZL 5HVGB 3LRSB 3SJNA 3LAFA 1D6VL 5E6ZA 4AIZA 4D9PA 2DQCL 4L5FH 1KTKE 4UTUA 2W94A 3TCXA 1G7MB 2PF8A 4OGQC 3SQRA 1JPIA 3SKJL 1QHOA 2VZOA 2IWFA 1R0AL 5HZBA 3WYAA 4MZ2A 1GKQA 3EEZA 4MG4A 2UXGA 3VWKD 5I8OH 3V4LA 1SW7A 3G6EB 5EMYA 4ZGQB 4L4JA 2XZAL 1UZDA 3RURA 3O41A 4TV5A 2UY7B 4DXKA 7REQB 1VDGA 1E79A 3BP5A 3RX8A 2DQUL 2ZOTA 4MMZB 4PRDA 2E7DA 3HNVL 4GUOA 2A7NA 3TJXA 4CQAA 2WLHA 2R7EA 2Y1VA 4XOCA 3QY6A 4P5KB 1UJTA 4XBGA 3RUGB 2G50A 2YXGA 5F7NC 3FULA 3I9IA 2GDUA 4PMRA 4AVOA 2DJUA 3CC5A 3OZWA 3JTBA 4HWNA 4Z17A 4POZD 4X61A 5LIKX 3WEXB 4Z5RA 4ZUTB 2ZITA 1Q85A 1S7QA 1NFGA 5I06A 1LDSA 4G9FD 4N2CA 3H0TB 2CKRA 2HFFA 2F54D 5SX4I 1QRKA 3RM4A 3TO4A 1MCCA 1KJ3H 1Y6MR 3WNDA 3WFDH 3M0KA 1EEYB 1AE6L 4X7EC 4XO5A 1A21A 5IB5B 2KZBA 4AKOA 1V6YA 5JO5A 3UGRA 4X8JA 3U6RB 1XAUA 3CVHA 4W6XB 5KSBE 4L8CB 4IJ3B 1G4RA 4KROD 4TNWF 3MXWL 1DIOA 3ANUA 4OD2A 2O6DA 5I30L 3TBYA 1KRAC 4D7BA 1EYEA 4TSCH 1ZIBA 2CGRL 1AR2A 3CUIA 4ZO9A 4GMSL 3BAEL 5I15L 2PLCA 4NF7A 2PD5A 1N0UA 4O2EA 3VABA 5A2KH 1FHGA 3P93A 3A1PA 2F15A 2WXMA 2BSAA 3GI8L 3HZKA 1XH0A 1FA2A 3SIMA 2VRAA 1DVJA 1AJ2A 2R59A 3W2DH 1QFZA 1U83A 4HNNA 1A6TB 1VHOA 2G9KA 3NCFB 3QH3B 4M62H 4MWFB 3PPSA 1AL8A 1SFSA 2Q10A 3DSFL 1RZ7H 3MJ9L 4JHAL 4IMLA 1N6QH 1JZHA 3G1DA 4LUJA 3UFYA 1VP5A 3EH3B 3V0IA 5HULA 1HU8A 4J3VA 4C6FA 4QRUB 1A6WH 3DOHA 4K07A 4PJGF 5EFIA 2CR6A 2V8MA 3O9WA 3IVKA 5JHLA 5J3HD 4RBPH 1RV6X 1UZ4A 4PY7B 2Q01A 3T4WA 3PDDA 4PJ7E 3LHZA 2HRPH 1U3ZA 3DGGA 1WCQA 4RMBA 1PZUB 1L6YA 1LCOA 2NQDA 5D1XE 2YQ3A 4LXFA 1T66C 1QFPA 3SDXF 2Y70A 2UVEA 4KFNA 1PGRB 1TREA 3N4AA 5D1ZD 4JPWH 1VC4A 1HP4A 4YXLH 5CBAA 2BSTB 5ES4B 2XVBA 2FLMA 2Y5TA 3OOQA 3B0XA 2CLZA 2ZA1A 1A5LC 4LLVB 3BV4A 2K3HA 3Q3GA 3W39A 1YXDA 4KHTL 3IRDA 2J4GA 3RU8X 2CK0H 5DMIL 4KNUA 4MB1A 1WWCA 2DQMA 1RZKL 4BKLB 4JTRA 1FNHA 4P3YA 2UVFA 1T83A 1Q1JH 1TCMA 2OBTA 3LEXB 1DVTA 2FTAA 3RB5A 5IEKA 4GZJA 3TJIA 3E9TA 4WUKL 2V0TA 4KAQL 5G1YA 1NLBL 1JDAA 1UD5A 4F92B 3C08L 2Z2UA 4DERA 3SE6A 3G6DH 3LKPB 4QXGL 3VI3F 3CBRA 4NLHA 3QRLA 3HE7A 2VRJA 4F2TA 4HGWA 2BG5A 4Q0XL 4BA0A 4RA3A 3CW2A 3LTPA 1OJXA 1CF8H 4TQHA 1TUIA 1OFEA 4X99A 4WO4D 3TV3L 2Q76A 2VM4A 3CHXA 2X87A 4XP5L 3RL2A 3A0OA 3SZKC 4B7IA 2ALDA 2HE8A 3Q44A 1YEGH 1BPLA 2AKRA 5F89A 2YGOA 1CL7H 3T40A 4JUSA 5AUMB 3JYBA 1Z9SA 2H0JA 4AEEA 1B5TA 4U5KA 3MDWA 3MHUA 4UTBA 5KZDA 1NC4A 4EMZA 1R8LA 4QXTB 4C6CA 5DRZA 1ZTVA 3TE9A 5HVWA 2NY0D 1RUQL 4H9XA 1QR7A 1SDAB 3W7KA 1GEQA 4WWVA 1A1OB 4KIRA 1AGDA 2FEJA 2VURA 3I6KA 1OPGH 2P8LA 3KRUA 1QK2A 2ZTGA 2FBJH 2QSTA 1Y5VA 3TA4D 1SJHA 5I16A 4HJUA 4P4KC 5JW5A 2CZ5A 5G2HA 1QNQA 5MEOA 4F7PA 4BFJA 2GUYA 3MP4A 4FFZA 3ZWSA 5SWSE 3OZYA 4F58L 3DUHA 4MNQE 1TKKA 3CQIA 2XETA 2DQTL 1RZFH 4UT6L 3VGGA 3WH7A 1OHQA 3D0LB 3FL7A 3PFMA 4HZ8A 4PB9H 4BQ4A 3TZNA 3GG8A 1NL0L 3SDCB 1PJ6A 1R3KA 5T1LD 1U6AL 2D1ZA 4IP4A 2GDQA 3SFWA 2GZXA 2K70A 1V27A 3ABQA 1X9UA 1E0OB 3W56A 3MZGB 4TTUA 4R33A 3TMLA 3BAWA 4G56A 3UAFA 4UXDA 2JGYA 3X3FH 4JRLA 5F8QC 4YS4A 4FZEH 2PCYA 1CLYH 3WNNA 1IWBA 3AM8C 1OQFA 3M6DA 3DX6A 2I9EA 4JO4H 2RDTA 2XXMB 5BZXA 1OADA 3NVQA 3W9DB 4ZS7L 4E41A 1HHIA 3P62A 4BKNA 5KTEL 3DSNB 4O2FB 4G6KL 3PUGA 4IFRA 4ROQA 5D2LF 2VLJB 3C6LA 3IFLH 5IMKA 1WQVT 4M3PA 3VWJD 2ZOKA 5TGBB 1RQPA 4TLUA 2QCEA 5KBMA 3QXAA 2BZCA 3HZMA 1VIZA 4YDKL 4EXQA 4ZD3L 1W72A 5LWYH 3MOQA 3PGDB 3N04A 4OVXA 2ED8A 2J79A 2R15A 1HXMB 1A49A 3GAKA 5A3ID 3KS6A 2FIKA 1B4RA 4KKSA 4XUGA 2F7PA 4LPWA 3GHEL 4WF7A 4UZUA 4NP9A 3X14A 2VFEA 1PTDA 5GRVL 1EL3A 2D7NA 2JJTC 2WBXA 4MSWA 1SQMA 3GSQB 4P4KD 1FNLA 1U8HA 2NR6D 5D7LB 3HG1B 1LQ0A 1TPDA 2IWEA 5HJGA 3UPWA 4GI4A 3VVGA 3CL8A 1LQ2A 3VFRA 3W75A 2PLFA 4HMCA 2OR2A 4A29A 3TXAA 4GFXA 3OEXA 1QBLL 3VI4B 5AHMA 1XGQA 4DGWC 5JW4N 4IFOA 1FI8C 1LP9B 5HQLA 1I2OA 3KP0A 3UC0L 4S0HA 4RK8A 3QFSA 1JXKA 3IJHB 1JHTA 3D48R 1WG3A 5I6MA 3H2CA 5IHUH 5INCA 4P7OA 4N20A 2P0OA 3ZL4L 4GRMB 4MHBA 1U3JA 1ZE3H 4LK4A 3B78A 3QEQE 4C4BA 5F3BA 3AIEA 3H4HA 5JHDA 1X5ZA 5KUKA 4PJCB 4F4RA 1OWQA 1PTZA 3NZSA 4Q4SA 5A5WA 1P7BA 3U9PH 3RU8L 5I71B 5HHXL 4WNSA 3VNYA 3GH4A 4RD6A 35C8L 3PK7A 1T1ZA 2EKSA 4WW1A 5FOBA 2WPDA 2PU0A 1UWSA 3M64A 4HOMA 3ARTA 1Q86D 5CILL 4NFDA 3FC8A 5FKPB 3BWWA 1BMGA 4HHWA 5F7FA 1JXDA 3B7RL 7PCYA 1DLHA 1SBSH 4YALA 1FRGL 4XNFA 2Z31D 4XCEA 3QIWB 2AC0A 4JFUA 4DHGA 1N26A 5KYWB 3FJOA 4P0DA 4RIRA 3QFDA 4TUJA 4YHZH 4EPDC 3EKCA 2PAJA 3BEVB 1ZDSA 1KXVA 1PCSA 4NENB 4GH7B 4AMWA 3ZJ8A 4HAKA 4HUKB 3CGTA 5GRWA 3V4VH 5JMRA 1U3HD 5DJCA 1U8MB 4XIMA 4JO2L 15C8H 3VE0B 3TEWA 1HXYA 2BP8B 3VD7A 1GK8A 4W84A 5I1DA 1X5GA 2CESA 2IH1B 4YHEA 2DM7A 1EKOA 5AN9A 3BAIA 4NQDD 1K3ZA 3O9WD 4WNQA 2GTWA 4I2XB 4P46B 5E8DH 1E4XL 1JWMB 3FF8A 4PGZA 3VXME 1E72M 2QCDB 1IXPA 1JNNL 2PBGA 3HGRA 1WWBX 2KI6A 1DE4B 3PWNB 5CPQA 5C09D 1WKDA 1DUYB 1QEWB 3K1DA 4YIQA 3G6JF 6CGTA 1I7RA 5K9QG 1RCXB 3D3FA 1MCNA 3VI4E 2CDFB 4PRTA 5FA3B 3WNCA 4OZGE 1UEMA 1RMFH 4L3CB 3RWHA 2E76C 1XDJA 4O4WA 4GMTH 5IXEA 1I8IA 1AA1B 4MWAE 1YJNB 1ET7A 1W8NA 2WCSA 2Z0BA 1BTCA 3MQIA 3CFCL 1NDMB 2PWEA 4CUCA 2WHVA 2ODIA 3GTFA 4XX6A 1URIA 4N90D 1T0MB 4FZ8L 3ZDXB 3KPMB 1WOBA 4CQJA 1JV2B 4CCCA 2VC6A 2WLJA 4ZX6A 1KIPB 1RUML 2GJLA 1G4SA 4S39A 1PG7L 1W3LA 4UTJA 4JRXB 5FL0A 2JJ1A 2BSCA 1MFBH 1N3NA 2XWZA 4Z2KA 2XQYK 1YNQA 3L9RB 4NOBA 5D2LB 3OD3A 3MRCB 3NFSL 4LUIA 4YHPA 3QDJD 4IOIB 2NMSA 2V68A 2WWCA 3QRHA 1OAYL 4ESKA 4RGOL 4C8XA 1Z9NA 2ZXCA 3CLWA 1ITCA 3ZE1E 1DUZB 5HI4D 2DWYA 3LI0A 1JZJA 1FWIC 5CAYB 3AYTA 3UVIA 2ZRUA 2GQ9A 5J5RA 3I02A 3RLVA 3V0DA 1V5VA 1UWIA 1QLEL 1ZBWA 1EGJH 1Q2SA 1XQ4A 2GQFA 4X9GA 3LBOA 3A9BA 3UNTA 4EWND 4FHBD 4BFIB 1OVZA 2EDLA 4LVDA 3U7WL 5JQ6L 1FVPA 1FH9A 2ACRA 2WB5A 4ROPA 1EERB 1FWAC 3L6FA 1GGYA 1OGIA 2WLLA 1O66A 4R0LA 1R5NA 1P6BA 2VM3A 4PZVA 4RZ6A 2ADJB 3QI9D 1ASPA 3VH8A 4GPNA 1K70A 1MRZA 1XISA 4MNQB 3V3WA 1PHQA 5TQLA 2AXWA 2Z92B 2ZXEB 1H62A 4PTWA 3GZOA 3TV3H 1RJLA 3VIFA 1W9VA 5CSUA 3KH3A 3MGOB 4XBSA 4A39A 4BCZA 3GM0A 1X4XA 4HG4J 2OX5B 2DDQH 3HURA 1RY0A 3RX3A 4YR6A 1B3ZA 1YEFL 1OTUC 1BIIB 5FGCB 3UO8B 3NQGA 5KANG 3G4SB 1IGWA 1UR9A 3RWEA 1F20A 3GBNL 4FABL 2F7QA 3P4NB 4Q7DA 2BW4A 3S5LA 5GXBB 5KG9A 1RA0A 3O3EA 3DPBB 3QHZL 1NDYA 5AB0A 1OAKL 2XVPA 1BQGA 4BEUA 2EYRA 3BL3A 4HTBA 2YYTA 5F6IB 5AVUB