3BCDA

Alpha-amylase b in complex with maltotetraose and alpha-cyclodextrin
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
585
structure length
585
Chain Sequence
SLFLIESEPSTGASVSKNLTEIILIFSNDINKVSQLALTDLITDSDIQGIDYNIEGNKVIINNFSLEPTCNYRLSYEVIDIYDNHLQGYIEFLVNQSNYPQIPDQEVNHTILQAFYWEMNTGEYATEHPEEANLWNLLAERAPELAEAGFTAVWLPPANKGMAGIHDVGYGTYDLWDLGEFDQKGTVRTKYGTKGELENAIDALHNNDIKVYFDAVLNHRMGADYAETVLLDENSRDKPGQYIKAWTGFNFPGRNGEYSNFTWNGQCFDGTDWDDYSKESGKYLFDEKSWDWTYNWDEDYLMGADVDYENEAVQNDVIDWGQWIINNIDFDGFRLDAVKHIDYRFIDKWMSAVQNSSNRDVFFVGEAWVEDVDDLKGFLDTVGNPDLRVFDFPLRSFFVDMLNGAYMADLRNAGLVNSPGYENRAVTFVDNHDTDRDEGSYTVSIYSRKYQAYAYILTRAEGVPTVYWKDYYIWEMKEGLDKLLTARRYYAYGPGYEVDNNDADIYSYVRSGFPDVAGDGLVLMISDGTSGNVAGKWINSRQPDTEFYDLTGHIKEHVTTDSEGYGNFKVIKSEDKGWSIWVPVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha amylase, catalytic region
publication title Crystal Structure of the Polyextremophilic alpha-Amylase AmyB from Halothermothrix orenii: Details of a Productive Enzyme-Substrate Complex and an N Domain with a Role in Binding Raw Starch
pubmed doi rcsb
source organism Halothermothrix orenii
molecule tags Hydrolase
total genus 194
structure length 585
sequence length 585
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3bcdA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bcdA04
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3bcdA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bcdA02
3LPOA 2X2YA 3WBAA 4PEEA 4YPJA 3CZJA 3KLKA 2YBUA 1MQPA 1HKIA 5AC4A 4P8XA 1KGXA 2DDXA 1FOBA 4AIOA 5A2BA 1DWJM 3G6MA 3K4AA 4AC1X 3VILA 1UKOA 4PMZA 4TUFA 3RM8A 1EO5A 4BQ3A 1H6UA 4CU7A 2E4TA 3CUGA 4NXKA 2VX4A 3WF4A 2Y5QA 3THCA 2EPKX 3VINA 3II1A 3OGVA 4AYSA 3HU7A 3BUQA 4UQCA 3GH4A 4JHZA 1C90A 5BXRA 4BS0A 5EBAA 2W91A 1TUXA 2GSJA 5A94A 3CZLA 1CXFA 4D6EA 1JFXA 3WQWA 1R75A 2QPUA 4FMVA 3WELA 5I78A 2WVTA 4PCTA 1B3VA 2CHNA 1XSJA 2FHCA 3SUVA 1GW1A 2XHYA 4UFHA 4Z2HA 2VTFA 1W2VA 4ZXOA 2ZXAA 4HA3A 2WNWA 3WF1A 5FL0A 5JIPA 1GONA 1WZKA 3ARSA 3GZAA 1CYGA 3L4WA 4DWSA 4M29A 2ZUWA 1YHTA 5E9AA 4D6FA 1U2YA 1XHGA 3OB8A 4EE9A 4LXFA 3ZSTA 2CCRA 2UY5A 4B9ZA 1BYBA 1HWWA 1H1NA 3F5JA 4MB5A 2WHJA 5E70A 3PZQA 4UTFA 5D9PA 3OBAA 4AD3A 3ZOAA 2Z1SA 2WC4A 1VAHA 4QLLA 1M04A 1V6XA 1TFVA 3B8SA 3CC1A 1F4AA 3IANA 4QLJA 4GO9A 3EBVA 4B3LA 3LPPA 3WUBA 4EK7A 1KXHA 1KCLA 1MFVA 3DDFA 3RILA 1FFRA 4W8BA 1OGGA 1TQVA 4CU8A 1E6PA 2BVYA 3AHTA 3DYOA 3LMYA 4OKDA 4OJYA 2VZSA 1JYVA 4LGXA 4BCEA 1IT0A 2ALWA 3WFLA 4NX0A 4HOWA 2VZVA 2GFTA 1BSIA 2WZHA 1UD6A 1QW9A 1XH1A 3GM8A 1QX1A 1QWUA 2YDSA 2ZIDA 1B3WA 1W9BM 2NSXA 5ICUA 1UUQA 3QHMA 3W24A 4CCEA 1QNPA 4XZBA 2E40A 3L4TA 1QWNA 1PX8A 3UEQA 3WUFA 3UR8A 1B3XA 1MYRA 1GOMA 3D5HA 4AMWA 4P7OA 5CZKA 5JIWA 4J3VA 2F2HA 5CG0A 5I2UA 2ZX6A 1XYFA 2DT3A 3AFBA 5DT7A 1LWJA 3S6TA 2FH6A 2WANA 4KRUA 1E71M 3WD1A 5ABFB 3W25A 3EJPA 4J3SA 1B90A 4X9YA 1WAWA 1I1WA 1CWYA 3RCNA 1UQYA 2A3CA 4W84A 2O9TA 1Q6EA 1UQZA 3VIKA 1OB0A 3DX4A 4QAWA 1DP0A 1V03A 3ZQ9A 1EH9A 5A8QA 3I3EA 2CIPA 1E55A 4D6JA 4C7GA 1V6VA 4JCMA 3VSVA 3WFZA 1NQ6A 3W6MA 3O6AA 3CMGA 1XH0A 1CTNA 4OZOA 1RD6A 1TA3B 1V6YA 1VFOA 2WQXA 3NSNA 2J4GA 1GPFA 3EDFA 1R87A 1W3JA 1UR0A 2VZUA 2G3MA 1BVNP 5HXMA 4X0NA 1OSEA 3H53A 2WHLA 4U3AA 4J7RA 4UQBA 4NZCA 3DYPA 1G1YA 1IV8A 2XG9A 1V0NA 3BVWA 1E5NA 5C71A 2EACA 4F66A 3FHAA 1QI4A 3OA5A 1EDGA 3SCOA 4U2YA 3VD5A 3A23A 1WP6A 4V28A 3HN3A 4B3KA 3ALGA 2EEXA 2X2HA 1R47A 3ARZA 3CPUA 3M6DA 4MNKA 4CILA 1WZAA 3PZIA 1PZ2A 3BVTA 2OSYA 3GH5A 5GNYA 1E4IA 1KGWA 4Z2LA 1UR2A 5HBFA 3AXHA 5D4YA 2CERA 3WMCA 3VDAA 4HOXA 2YLLA 4IM4A 1BG9A 1K9FA 4NSBA 4JAWA 3W82A 1EQPA 2CKRA 2J7HA 2ZOXA 5JBFA 2XIIA 1XD0A 4H8VA 4F8XA 5I6SA 3WDQA 1HJUA 3N11A 4TVDA 2VO5A 3L2MA 5BRPA 1NM4A 4LPCA 1GJWA 2WCAA 2DT1A 2J7FA 4HPHA 3KEHA 4LYQA 3T2PA 5ABEA 5DMYA 3BSHA 3ZT5A 4DO4A 5C8BB 1R46A 1X6NA 5A6BD 3N18A 3VD9A 5IFTA 4GO8A 2XFYA 3CZ8A 8A3HA 1W91A 1C91A 2CBJA 4KGLA 3RMEA 4W8LA 3AHVA 1GOOA 3BAXA 2Y4SA 1EA9C 3T0AA 2JEPA 3POCA 3MSDA 3AMLA 1JIBA 3TTSA 2QMKA 3W53A 3AHYA 5KEZA 3EDJA 3CZGA 1NARA 4PMYA 4PMVA 5BXTA 3AS0A 1HIZA 1J18A 1KB3A 4Y7EA 1GVYA 3AIEA 3VKKA 3VVGA 3OZOA 2WQUA 4S3KA 1JFHA 5A6LA 2OMTA 2HISA 4RE4A 5I24A 1E43A 1GQKA 3BGAA 1NOFA 3VGFA 1HKKA 3AYSA 4W88A 5ABHA 2WCGA 1OCQA 2XM1A 4CVWA 2XSAA 1HJSA 4CCDA 2B31A 3EMCA 5CSYA 1R33A 3CLWA 3T0BA 4W7UA 3NJ3A 4CVUA 3BH4A 1C7SA 3MMDA 2DIEA 2HVMA 1ZS2A 4J3TA 3UG3A 4KRTA 1Q6GA 1KXVA 1CEOA 4IUGA 2ZXQA 2WWCA 3U5UA 1RP8A 5IHSA 3BAJA 3WNKA 5GPRA 1NOUA 4NRRA 2Y24A 2OYLA 3RPMA 4JZ5A 2JF6A 2A3BA 1H41A 1E0WA 1VJZA 3U7VA 1CXKA 3FHQA 3WD3A 1V3IA 2WVVA 3TV8A 2EADA 3WDHA 1IZJA 2G3NA 1JZ7A 1ZBKA 3GXFA 2ZXDA 2F1AA 4CCCA 4TX8A 1V02A 4CD5A 3GBEA 1OINA 1GZJA 3D50A 2J7DA 4CUCA 2VNCA 1UYQA 4PSPA 3HG2A 2AAAA 1ESWA 2J7EA 2YLAA 1TQUA 4AZ5A 1KBBA 4MDPA 4DUWA 2WMIB 1W32A 1CGUA 2BXYA 2XSBA 3M07A 1LF1A 3AMGA 1MVYA 2ZX9A 1H3GA 1BHGA 1CXEA 4R5EA 2XM2A 2D0FA 4GQQA 1DTUA 3ARQA 5BXSA 1UD8A 4LYRA 2WMKA 4DO6A 3T2QA 4L4PA 1GHSA 4CGTA 1N82A 4J28A 1JF5A 3A4WA 4ATWA 1XSKA 4GI8A 1E6RA 1ISVA 2W4XA 2GJXB 2E9LA 3D52A 4D6GA 3ZJKA 3VPLA 2W67A 3A4XA 3TTOA 3WH8A 2G41A 2OYMA 5E09A 1WNOA 2DH2A 5M3WA 2E8ZA 3AISA 3IJ9A 3ARUA 3IJ8A 5CPTA 3DHPA 2JEQA 4NI3A 3A22A 1NP2A 2XVGA 4PMNA 4GZJA 4DUXA 3AIBA 3WQ8A 1PX3A 4J3XA 1E9LA 2OMZA 2ZWYA 4FLOA 3BCDA 1GCYA 3WY1A 4V2XA 2VZTA 2CKSA 3BXWA 5E1QA 4MB3A 3PZNA 4W5ZA 1QBBA 3WH9A 4WKAA 1QHZA 5A8MA 4JKMA 3AMCA 4AZGA 2OMYA 2CESA 2F1BA 5FIPA 1WO2A 4ACZA 3RJXA 3G6LA 3NCOA 3VIJA 3B9AA 4AISA 1BLIA 2F7OA 3GXTA 2WWDA 1L8NA 3T08A 3WY4A 4PMXA 2EO7A 4UFIA 2W63A 1KXQA 2GUYA 3VMPA 3ARTA 3W26A 4BQ2A 2VVSA 5EB8A 4BA0A 3SCRA 2JIEA 1CXIA 4P8VA 4TTUA 2BV9A 2WMHA 1V0KA 4AEFA 3OLGA 1XYZA 4PUDA 1HT6A 2ZE0A 5I3DA 4DM2A 2WYSA 1BG4A 3BLBA 1ZL1A 2X2JA 3AIRA 2IXVA 3OLEA 2CNCA 3B9EA 3WMSA 3DX0A 5AY7A 3VGEA 3QOKA 3A47A 4XB3A 3M46A 2PWHA 2J77A 1LL4A 1NOWA 3WL1A 1SZNA 3U7BA 3KL0A 5LA0A 1B3ZA 1ECEA 5CPQA 3APGA 2PC8A 4B9YA 2AOSA 2XTKA 1RH9A 3W38A 2O9OA 2EXOA 3AI0A 1BVZA 2GDVA 5E0FA 3WDRA 1A47A 4WF7A 1E0VA 2WHMA 1E6XM 4L4OA 2WM0A 1M9SA 3D3AA 3ZJ8A 3WF0A 3VGDA 5FD0A 3B9DA 4U33A 3WDIA 2OW6A 4PSRA 1TVNA 3NUKA 2CYGA 2A3AA 2F7RA 2WBKA 3SCSA 3A21A 4JHOA 2CBUA 1VBRA 1MWOA 4OIFA 2PWDA 5DT5A 3AS3A 1E1EA 3SUUA 3FN9A 4RE2A 2WSPA 2C9QA 1XH2A 3BCFA 3WNPA 1O6SA 2W61A 2WKLA 1PAMA 5JBDA 4N0RA 2J8FA 2BHUA 1V3KA 4P8WA 4ACYA 1CGWA 1WE5A 2VR4A 4UZUA 1E40A 4JIEA 4JL2A 2ZX5A 3FAXA 1M53A 1UR4A 2PBGA 1VEPA 5GNXA 2VC9A 4K68A 3AZSA 3GXIA 4QLKA 3BAIA 3CUJA 5C70A 1QNRA 2EAEA 1QNSA 2NT0A 1W1TA 3EJTA 3QGVA 3CUHA 4FK9A 3D4ZA 3TTYA 2YIHA 4HOZA 2QV4A 3N04A 1O7AA 2V5DA 1C7TA 1P6WA 4OOZA 1WDPA 4PMOA 1CLVA 4W8AA 3IJ7A 1R85A 5KZ6A 4QP0A 1TQWA 4AIUA 1C8QA 2VRJA 1GOQA 1VEOA 4UFLA 1JG9A 7CGTA 1WCGA 3SCTA 4CKQA 3NYDA 1G94A 3ZR6A 1JAKA 4DWSB 1GUVA 4HZ6A 1GORA 3W29A 9CGTA 1ISWA 1C3FA 5A6JA 1CBGA 1LG1A 2YL5A 4KMQA 1OGSA 1VFFA 1Q4NX 4N42A 3KL3A 1J12A 1WPCA 1US3A 1FFQA 2OLHA 1W9XA 3DX2A 3BAWA 1HNYA 1E4MM 2VQUA 4HU0A 1UWQA 1R34A 3BUBA 1VJSA 3PZGA 1G5AA 2WAGA 1OBAA 3LX9A 2D24A 2J79A 4UQDA 5A6SA 4HPGA 3OLIA 3HG3A 3VDBA 2PWGA 3LPFA 1ZBWA 4FLQA 3ZO9A 5CLTA 4DM1A 1UWSA 2GJRA 3AXIA 4UFKA 5E6YA 4Z2GA 1JZ4A 4HA1A 2ESCA 1UR9A 4R27A 1M01A 1EGZA 1QI0A 1SMAA 1JAEA 1TZ7A 3N13A 1LJYA 5GQBA 1E6QM 1E72M 4ZXLA 5JBEA 4M81A 3VIMA 1VFMA 4JFUA 1NWUA 1LL6A 2VCAA 2ZUSA 1E6SM 4TXEA 3OGSA 3ZMRA 3VD3A 4H8UA 2VX5A 1SYTA 4M82A 1B9ZA 3NDZA 4AXNA 4LYPA 4FNSA 2DEPA 4D6DA 5IXEA 3UG5A 3VMNA 2JIWA 3WH6A 4GQRA 7TAAA 4W85A 1GOIA 4HMCA 4W93A 1HP4A 2GVYA 4CU6A 5TD4A 3VGBA 3BUIA 2D0GA 1R7AA 2W92A 1MW2A 3LRKA 1QNQA 3EJQA 4GI9A 1OM0A 4Z2KA 4DUVA 5F7UA 3A4AA 4GXPA 3IK2A 4C7DA 3L2LA 2Y8VA 1GVIA 3VIHA 1I75A 3EDDA 1OT2A 3LRMA 1D3CA 1UKPA 4M1RA 3U5YA 1C93A 5A2AA 4ZFMA 3L4ZA 4UOQA 1KQYA 4W86A 3WEOA 4OBSA 3TOPA 3NDYA 3J7HA 1W1VA 6A3HA 3QHNA 3SCQA 3VMOA 3I3BA 1E3XA 4PCSA 3LXBA 2G3JA 4CC4A 2ZUVA 3FW6A 1ITXA 2VRKA 4S3JA 3LXCA 2CXGA 2WMGA 2WZEA 5I0DA 2UZYA 3RM4A 4PTWA 2IUZA 3F5LA 3GXDA 3KL5A 5D9MA 2OWXA 4DWSC 1J10A 1GQIA 4H8HA 1OGBA 3GXMA 3QOMA 1LLOA 4UFJA 1KTBA 2XVPA 3AIUA 3O2LA 4PTXA 3DX3A 1CNVA 2YJQA 1H11A 2GK1A 2QHAA 3VOCA 1TR1A 3WEZA 2Y5EA 1Y7VA 2VMFA 1TE1A 3VSTA 1OD0A 2ZICA 2VR5A 2OYKA 1FH8A 5IFPA 3AZRA 3N1AA 1CGXA 2PWEA 1V3HA 1QVBA 4GZEA 1JDDA 1E3ZA 2X05A 3A5VA 1VFUA 4TVUA 1ISZA 1OIFA 2C9PA 2D1ZA 1EDTA 3AXXA 4ML4A 5LA2A 4A3YA 4ZENA 2OSXA 4H04A 4BF7A 3AZTA 2VJXA 3WH7A 1JI2A 2VX6A 3PZOA 3CMJA 1H0IA 3S5ZA 4QFUA 1AVAA 3W28A 3PHAA 1CLXA 3AIQA 3WL0A 2DSVA 1WDSA 3MANA 2D73A 5BROA 2PF0A 3TONA 4D1IA 2FHFA 2EABA 1V3JA 1L0PA 1KWKA 1TQSA 1RP9A 3ZIZA 5AC5A 5D9NA 1JGIA 3UG4A 1E70M 3EJSA 2C7FA 4JCLA 1QOXA 3IGUA 1SFSA 1C8XA 3MV11 3K8LA 4PTMA 3THDA 4PBGA 3GBDA 4JKKA 1FHLA 2GDUA 2PWFA 1PZ3A 1BYDA 3D4YA 1MXDA 5CLWA 1JD7A 2PB1A 3OG2A 2W66A 4WKHA 2PBOA 4PMDA 1DWIM 4MB1A 2BY1A 2YBTA 3VIPA 4WKFA 1JF6A 1JI1A 5I79A 1XEUA 2V3GA 4UOJA 4GIAA 1ODZA 1FH9A 1HJQA 2DQXA 4AY1A 5A8NA 2C0HA 2YFNA 3EJUA 1BF2A 3EYPA 1KQZA 1JYXA 4IISA 4P8UA 1UA3A 3ZT7A 3MSGA 1E56A 3CZNA 2E9BA 1X6LA 3W81A 4UNIA 2BHZA 1H49A 1KR0A 3MMWA 5FCZA 1HX0A 2DT2A 1QI3A 4V27A 4FNRA 3HMCA 4WSKA 5I77A 4B15A 3BVUA 4Z2JA 5ECUA 4JL1A 2YL9A 1HP5A 3PZUA 1HXKA 2OMWA 3SEPA 3BC9A 4UQEA 1VBUA 2WMIA 1ZU8A 3EDEA 4QDMA 5LYRA 1BQCA 4WLCA 1V0MA 2WVVB 4E2OA 1XC6A 2VCCA 3GXPA 3K8MA 4IPNB 5EFFA 5M17A 1UD5A 4AQ1A 3TTQA 2XGIA 1WDQA 3ARWA 1PEZA 3GXNA 1V3LA 2WZIA 2VUYA 2D20A 1H4PA 4AD0A 1B1YA 5D9OA 2O9PA 1H6TA 3ARYA 3ZJ6A 1FA2A 5FKYA 5A95A 3N15A 4AZIA 4OGZA 3WD4A 4HMEA 2BXZA 3FNDA 2OMUA 1W1YA 4AZCA 1TG7A 2WXDM 1JZ6A 3POHA 1UWIA 1XD1A 2E0PA 3BVVA 2E9MA 3A3HA 3AMDA 2YKKA 1B2YA 3WKZA 4A4AA 1EOKA 3F5KA 3H55A 4MPKA 2Y2WA 2ZX7A 2UY3A 1WB0A 4BQ4A 4YN5A 4J3UA 2V3EA 2J78A 3MMUA 2XVKA 4AD2A 2WC7A 4J3WA 2WMJA 1BYCA 3ZT6A 2V3DA 1EXPA 1UKSA 3W27A 3VX1A 1BGAA 3SCWA 2BY3A 1JYWA 2E8YA 2BY2A 2XIBA 1J0KA 4W87A 4NZFA 3ARPA 4AW7A 1UHVA 3EMQA 5A69A 1W9DM 3PTKA 1HL9A 4WIWA 4CD7A 2ZWZA 1BPLA 3VGHA 1UG6A 2F7QA 3VX0A 4GPNA 2CEQA 2J75A 5BWFA 3WH5A 1V0LA 5EMYA 1HKMA 1CZ1A 5A8PA 4WSJA 1MW1A 2J8GA 5A6AA 4U3CA 2YA1A 1M42A 1GNXA 1JD9A 4JFTA 2UY2A 3AHXA 5CPSA 4ACZB 1XCXA 3WNNA 1M7XA 1WZMA 1B3YA 3MUZ1 4UQ9A 1OD8A 1V6UA 1U33A 4D1JA 3BMVA 3I3DA 3A24A 4M8UA 2Y8KA 1O6TA 2EPLX 2CITA 3NSMA 3UETA 4W7WA 2BVTA 4CN1A 1G0CA 3KWXA 1CGTA 1DHKA 3WMBA 5A1AA 2MANA 1UH4A 1OWQA 1IZKA 2YOCA 3WQ5A 1W3HA 2X8RA 3VGGA 3HG4A 3EDKA 4FNTA 3VUPA 2ZUMA 1CIUA 2CETA 2NT1A 1W9UA 4AZHA 3AS2A 1DWHM 3N9KA 2FYVA 5ABGA 1ZJAA 1V6WA 1KGUA 1K9DA 3UCQA 2FDMA 3EJRA 2J47A 5A6MA 3FXYA 3MO4A 5IHRA 4RE3A 2DIJA 1HKJA 1ZBVA 2WBGA 2ZUNA 2WC3A 3PTQA 3GNPA 2WPGA 1UZ4A 2WLYA 2DPEA 1UH2A 4E4PA 1K9TA 3PN8A 2WLZA 4QCFA 1GJUA 2Z1KA 1E0XA 4CN4A 2X1IA 3MKKA 3ARVA 4YHGA 3RM9A 1D7FA 1ODUA 4D6CA 3PZMA 4GZIA 1W2PA 2AMGA 4MNMA 2WQWA 2J7BA 3HJEA 4M80A 4P7LA 1EO7A 1NWTA 3PZ9A 3OLDA 1B0IA 4FF5A 4D6IA 1KXTA 2RGLA 4KGJA 1I1XA 2EPMX 4PMRA 4AD4A 2WB5A 1ISXA 2XJ7A 1VRXA 4DWSD 2WHKA 1Q6DA 4Q7NA 1SMDA 5CJ5A 3WSUA 1AQ0A 1GQLA 2EPNA 4XUYA 3VIGA 4UR9A 3UESA 1Q6FA 1YQ2A 4PN2A 3KLLA 2OSWA 3CZSA 3PZTA 4QCEA 4H2CA 1H2JA 2DH3A 3MI6A 3GNRA 3WUGA 2FE0A 4C7FA 1UWTA 3CHCA 1UH3A 5HOSA 3W0KA 4H7VA 1EDQA 1HN1A 1LL7A 2X0HA 1PIFA 2XN0A 3GH7A 1HTYA 5A3HA 1GOWA 3UR7A 2WCSA 1D2KA 5EFDA 1W3KA 4DO5A 2D22A 3L4XA 5CGTA 4CD4A 2GJPA 2EQDA 3WDPP 4BQ5A 5CSUA 5HNNA 1KTCA 1AMYA 1UA7A 1K9EA 4PMUA 1EOMA 5BCAA 2VOTA 2J25A 1CENA 3H54A 2J7CA 3AICA 3RJYA 3VIFA 3VO0A 1TVPA 1C8YA 2EJ1A 4MNLA 3CGTA 3S2CA 2BFGA 4D72A 4M24A 4H41A 3BLPX 2OMXA 4HZ7A 1CDGA 4HZ8A 4MAZA 1V02E 3ZSSA 1J11A 2QMJA 3MS8A 1XRVA 1R8LA 3RO8A 2QPSA 1G01A 1C92A 3CTTA 1E4LA 2XGBA 3S5YA 1TQTA 1HVQA 1DWAM 3WF3A 3CV5A 5LA1A 1WZLA 1MXGA 3MUY1 3SCVA 4HP5A 1HL8A 1MQQA 1LQ0A 5D8WA 4XV0A 5IDIA 1KCKA 4AZ6A 3BZ5A 1KR1A 2JFEX 2E3ZA 5HPOA 3WUEA 2DSUA 3OZPA 3BLKA 3VD7A 3VSUA 1BAGA 1PX4A 3M7SA 2ZX8A 1V3MA 4EAMA 3CHDA 3SUTA 5ABFA 3T2OA 3CZEA 1R86A 1JXJA 3DX1A 1IX2A 4HA4A 1XV8A 2X2IA 1UR8A 5DO8A 5A6KA 2BY0A 5A2CA 4OBRA 2D3LA 3WQVA 1GQJA 1GHRA 1PIGA 3SUSA 2VRQA 4TX6A 2BVDA 4MADA 1FHDA 3K46A 1QPKA 2D3NA 5JUVA 1WKYA 3MUIA 4JFVA 1BFNA 2A3EA 3FY1A 3AS1A 3RDKA 3EMZA 1J0IA 3DYMA 1W3LA 1TA3A 2WK2A 3WIJA 3SURA 4U2ZA 3VM7A 1AQHA 2DSKA 3UERA 2QF8A 4IPLA 1CECA 2YDQA 3SIMA 4MJ2A 1JXKA 4TVCA 4Z2IA 3HZ3A 1NM9A 3CBWA 2YL8A 2XWEA 1GOKA 2ZUUA 2FGZA 4PRWA 2UY4A 4UQAA 4B16A 4EANA 4HTYA 4P7NA 2XFRA 2XVLA 3CHEA 1NWRA 3DHUA 3QHOA 3WBEA 1VF8A 1UD3A 4MNJA 1U30A 5DFAA 3FAWA 3VTRA 4GI6A 1UD4A 1E1FA 1US2A 3GDBA 4E8CA 1FH7A 4MJ4A 5GNZA 1K6AA 3TP4A 3ZR5A 5I5RA 4EKJA 1MQRA 2DSZA 3DDGA 3AIVA 3WEMA 2UZXA 1FP8A 3WY3A 1VENA 4AW4A 1CPUA 4GINA 5CXPA 3VU2A 1J0JA 4JFWA 4PTVA 1BGGA 3ECQA 2C8NA 4LQ1A 3VNYA 4FNQA 3BSGA 4UFMA 3BMWA 1QBAA 3T0DA 2TAAA 1WDRA 4JFSA 3WQ6A 2V38A 4HU8A 1PJ9A 5FL1A 3WD2A 1RPKA 4J27A 1MW3A 1O6VA 1H5VA 1QHOA 1M03A 1JZ8A 3SCUA 1J9YA 1EQCA 3ARRA 2GK1B 2YFOA 1CXLA 4U31A 1CXHA 1MFUA 1A3HA 2YDRA 2IGTA 1PS3A 2J7GA 4X0VA 3ZM8A 4P7QA 1HVXA 2XFFA 2EPOA 3CH9A 1KBKA 1AQMA 1KWGA 4UOZA 3AHZA 2YA2A 4PYSA 4W89A 3VNZA 4Q22A 4ATDA 4GKLA 2XWDA 4JKLA 5BRQA 1JNDA 2XPKA 3KZSA 3CUIA 3K8KA 1SR0A 1UKTA 1VIWA 3IAQA 1UZ1A 4AMCA 2RA1A 3AOFA 2C9RA 1JYNA 3VDCA 1QNOA 3K4DA 5DEZA 2O9RA 1UOKA 1JL8A 3F4VA 4AZ7A 2XVNA 4AEEA 3SUWA 1CGVA 1E15A 3W37A 1DWFM 3CHFA 2XUCA 3MUAA 2CBVA 1W1PA 2W62A 3VIOA 3PBGA 3VM5A 4ZE5A 3DECA 2J62A 3AROA 1DEDA 3GNOA 2FH8A 3E1F1 4AD5A 4AIEA 2VCBA 2DGAA 5A6BA 3CO4A 3A6OA 4MTVA 2WKGA 1CGYA 2OW7A 4F9DA 3GYCA 1OIMA 3NIYA 1O7DC 5HDRA 1ITCA 4NZJA 3VD4A 2D2OA 1HJXA 1B31A 1ZJBA 1FP9A 1KFWA 3ARXA 1VB9A 2XN2A 1UWRA 4PUEA 4FNUA 2VZOA 2OWWA 2WW5A 3W4RA 1JZ5A 4U5KA 1HF6A 2X0YA 1OT1A 2W5FA 4AD1A 5FOOA 2YL6A 2G4FA 3AMKA 1UWUA 1MW0A 1J0ZA 1QI2A 2OMVA 2VURA 2JALA 1JNEA 4TOQA 3AQUA 2QLYA 1E5JA 3AJ7A 3IAPA 1F4HA 3N12A 1LG2A 2VQTA 2VX7A 3L4UA 1H09A 5AYIA 3MV01 2VT0A 4XZWA 1B30A 5A8OA 3LPGA 4WJXA 3N17A 2F7PA 4CN6A 4URIA 3BAKA 1HJWA 4HMDA 6TAAA 5AYBA 1XSIA 3GTNA 2XYLA 5BXPA 2O92A 4AMXA 2VL4A 1UASA 5M5DA 2V3FA 8CGTA 5I23A 2YA0A 3AIWA 1UD2A 2WVSA 3VIIA 4MAVA 4PMQA 3RIKA 3BAYA 4CC4C 4CD8A 3W6LA 4E8DA 3LRLA 2ZXBA 5CGMA 1OT4A 2CBIA 2D0HA 3WENA 2F8QA 1UKQA 3WN6A 1ZB5A 3HG5A 1J0YA 4OOUA 2RGMA 1TMQA 1E6ZA 6CGTA 4ATLA 1R7OA 1ISYA 4W5UA 3PTMA 4A3HA 3DC0A 2GJXA 4MB4A 4UZSA 1PPIA 5E6ZA 2WQVA 1PBGA 1E73M 1VEMA 2WVUA 2CHOA 1BTCA 5D8ZA 2FHBA 1ZBCA 2FGLA 3VDHA 1HJVA 4D71A 1JDAA 2G8ZA 5DF0A 3WQ4A 2ZUTA 1J0HA 4YHEA 3U57A 3CUFA 4WK9A 2J74A 2G3IA 1EHAA 1HXJA 2UWFA 3K1DA 3CZKA 3MU7A 2VI0A 1LYQA 2IXUA 1S46A 1EHNA 4AZCB 2Q8XA 3OIHA 1BYAA 4NRSA 3AYRA 2OWCA 1E6NA 3WF2A 1T0OA 3O9NA 3WNMA 1EIBA 1TCMA 5M03A 3T09A 4M56A 3JUGA 2F18A 4FLSA 1Z32X 2VVNA 3L4VA 1UR1A 3BUDA 3PZVA 7A3HA 4RL3A 3KE0A 1NWSA 4CD6A 3TA9A 2DT0A 2JF7A 2D23A 3BVXA 2V5CA 1DWGM 4F9JA 1XCWA 3OGRA 3NSXA 4W7VA 4LX4A 2NW0A 1JZ2A 3WY2A 5E0CA 1J01A 4OUEA 3ALFA 4F79A 3SCPA 4FNPA 4NF7A 2JE8A 4TTGA 4BZYA 4KWUA 2EBNA 2DSWA 4MDOA 3QR3A 1BPLB 2PI6A 1JZ3A 3WDJA 1O6IA 3LXAA 1NH6A 1Q6CA 1QW8A 5BYWA 3WNLA 2A3HA 5CQ1A 4AWEA 1W9PA 2BNJA 4XX6A 1G9HA 3L4YA 4U5IA 1W9VA 4AZBA 3CIVA 4NXSA 1X1NA 4KH2A 2X09A 1H0GA 1LWHA 2WSKA 4AYGA 4D6HA 1E4NA 3WNOA 3D51A 2F61A 1JDCA 2BHYA 5HPCA 4P7RA 1QHPA 1NP0A 3WD0A 4FLRA 3SCNA 4ZEPA 2BS9A 2CPUA 2XN1A 1XGZA 3BUPA 2WMFA 1QI5A 4UCFA 3ZJ7A 1V08A 4ZE4A
chains in the Genus database with same CATH superfamily
5KJ4A 4GC3A 3NIFB 3QUXD 5FF0A 4YPJA 1AMXA 4E2BA 1JUFA 3QYQA 4RMSA 4DP2X 4XIMA 5K93A 2EXWC 1H6UA 1NCCL 3CUGA 1NMAH 3PGCB 2OTUA 4AYSA 4O2CB 5ANHA 5TFSL 3L2NA 5ABDE 3HCVA 3GQYA 2YQBA 4QRSB 4AUBA 1W5OA 1ELSA 3IEAA 4B5TA 4K7PY 1CVRA 3O6MH 1NBVL 1MEIA 4NZDA 1LK3H 3TT3L 5GHWH 1XYMA 2BVWA 1H51A 4Z7VE 4K9EC 1RZQA 5E9AA 2MIZA 3D3FA 5AVHA 2CCRA 3FQTB 3EPMA 4ZMPA 3AQXA 2HLEB 3BOVA 2Z31C 4UTBL 2Q02A 1YAZA 1B4EA 3VA6A 3US0A 1VAHA 3L1EA 2FZDA 1T5WB 1N3NB 4GO9A 4J9JA 4XZHA 2CJUL 3IFNH 2ZAGA 1VPXA 5F88B 1TKWA 4OV4A 1OGGA 4UF7C 3DYOA 1LOQA 3OQ8A 3Q05A 4KFMA 1Z66A 4TUOA 5JU6A 5FGCB 2E9WA 3QDMD 3VQMA 4HH9A 5DELA 5I30L 4YE0A 1SN2A 3KNBB 2J66A 2YDSA 2ZIDA 2CKNA 4IGSA 5I74C 4ACAA 3KAAA 1N6QL 4XMKL 2FECL 3UEQA 4FMFA 3HR5A 3LEVH 2X1RA 3ENEA 4CEXC 2XZQL 4AMWA 2XBTA 2IMMA 2BVOA 3M7OA 1OAXH 4BKNA 1I9RH 3PUNA 2QTEA 3S6TA 3BOFA 5BOZG 5CC3A 1XH3B 5B38A 3FOKA 3P5ZA 1U8PB 5C0AE 1NB0A 3MJ9L 5E1AB 4GNVA 4JFXB 3CMGA 3W57A 5T1JA 4ADGA 3QGKC 1BXXA 1CTNA 1IAKA 2XNAA 1NCIA 2B81A 5F4XA 1IEVA 4BGDA 1MREH 2MCAA 1CU4H 4KRLB 1NF7A 3P2VA 1EJ8A 4L5FE 4GRWF 3LNPA 5DVMA 3LIUA 2FGBA 3DRTA 2IC2A 1EZLA 4O51B 2ZAIA 4A7TA 4N87A 4NGHH 2XG4A 4Q0XL 1ILUA 2EEXA 5D1ZA 1EEXA 1AGBB 4MNKA 5IEHB 4UMAA 3FO0L 5E0KA 3VI2A 1PZ2A 4CVZB 1DVZA 4NHUB 2R1MA 2HKAA 5BSYA 5I15H 1UR2A 4HIJB 1J9QA 2XTSA 4ZA0A 5CM1A 4WZ9A 4AL8H 4NM8L 5IB3A 5A2LH 2AEIT 1RD5A 4HPHA 3O4LA 3T2PA 4QS6A 4PJ9D 2NXZC 5C8BB 1AAJA 3HRZC 4LLUA 4QF1B 3DKLA 3N18A 3L9EA 2QCLA 2IXQA 4KY2A 4P59L 3MZ2A 1IBZA 2Y4SA 1A3QA 3GR4A 1FBIH 3KCOA 5EA0L 4JZNB 5CIPA 1AQKH 1BQHB 1A5FL 1DQKA 1FFOA 3FT3B 3GZOA 5GRYA 1DL7L 2AKRA 3FHEA 1UGNA 3VVGA 3GRWA 3QMSA 3CPLB 4BFOA 3UR2A 3H70A 1Q9WA 3EO0B 3BGFB 3OSKA 4IBQA 1GA2A 2XSAA 3FOLA 5CO1A 1YHPA 3LMZA 3BZDA 2FO8A 1Q6GA 3EOLA 4QRNA 1G0XA 1RP8A 3MMTA 3W83A 2Y24A 3E3QC 2NDFA 1Q81D 5D7JD 5D6CA 1V3IA 3GW3A 2FZ3B 2BGSA 1MY5A 4OQTL 1XGQB 4L4TE 1NLDH 1V02A 2PLCA 3UZJA 1RULH 3H9YA 4AZ5A 5BOJA 3E49A 4F48A 1HE8A 2WOYA 3QO1B 1LF1A 3ASRA 4YDZA 2Q1EA 1FWTA 4KJWC 4UINL 2DY2A 4KVNL 5E9NA 3W39B 1QNIA 2VDOH 5ECGA 5FO2A 3M0LA 1BX1A 4IL2A 5LBSL 4H9VA 3AGVA 4XH2B 4TNVK 3WY9A 2W67A 4ZOEA 3RY5A 3SGJC 3MX0A 4HUUB 3TBWA 2CLOA 2EGZA 3FT2B 4S0TD 5CUSH 1A49A 5I73C 2V30A 3AB0C 3A22A 4PMNA 4KQNA 6FABH 1WS7A 4P3DA 3SJVD 3SGGA 3V16A 4GW4A 1LP9E 2VR3A 1AYRA 1NPNA 4V2XA 4LCUB 5IWLC 1O7SA 3VXRE 1VYSX 4ACZA 1ICPA 2QF7A 2MQ3A 2GJZA 1Q0YL 1IGMH 3FB5B 3B37A 1R3VA 3WY4A 3D7PA 4FAMA 3G5XA 1K8DB 1H15B 2PTTA 4BA0A 3SCRA 1CXIA 5TF1L 2J24A 1MFCH 5IFHL 1A80A 3VZZA 2AXGB 5EBWA 4F9LA 1NGYA 3GIVB 4HK0B 4NC1C 1GYCA 3O3BB 3I1FA 3QXTA 1NOWA 5DSZA 4IRZH 4WR3A 3TVMC 2XTKA 2P5WB 3W38A 1VGKA 2D2GA 1YN7B 5IROD 2BSRA 2WM0A 3E20A 3BLEA 1VQPB 3B9DA 2MKWA 3LA4A 3N40P 4PSRA 2DLFL 4P9HH 4IM8A 4OFYA 4IJRA 4FXGC 2NSQA 1VBRA 3ASNB 3VI4B 4WFEE 4XOEA 1G6RB 3BCFA 4FIQA 3GU2A 3PGFL 5AHMA 1CC3A 3O8AA 2I5YH 1LOSA 4DGVH 3KW3A 4UZUA 2L0DA 1SOSA 8FABA 2NYYD 3LDBC 3MRFB 2G95A 1IARB 1H8HA 2VEGA 1L6SA 2EAEA 2HVBA 1NKOA 4KAQH 4HOZA 4PS4L 3EWDA 5FK9B 2K45A 2Y69B 3ZL4L 4NASA 3QSRA 2ZUYA 3IJ7A 1A66A 1U3HC 4KPHH 2VRJA 3IGKA 3CV7A 5B4MC 3X3GL 2YAQA 3WD5H 3HFML 2HLAA 2CDFB 4AX3A 5I17B 4FKHA 1V54B 5JO5A 5K9OA 1EAPA 3QXVA 3G1FA 2YL5A 1ZXQA 4DF0A 1OGSA 3QZAA 3TXVA 4EDXA 1JVLA 1D1NA 3HE7D 4KXAA 3SKJH 4RW3A 5EBMB 3CVIH 5F7YC 3MRCA 3WYRA 2BFVH 4JQ4A 1GJIA 3I75A 1LNUB 3NL2A 1RMFL 4FN0A 2B4CH 1P84K 1OHHA 4PP1C 1GW0A 1NAKL 2KBGA 3ZO9A 2YD1A 4PVMA 4HT1H 3D0AA 3PNWB 1DG1G 1LJYA 4RDZA 2YLHA 3GD6A 2WBWB 3ZPNA 4J3OF 1KV7A 4J2QA 1TYRA 4KCWA 4GYPC 1UQSB 2ZUSA 4EWND 1D2EA 5C6WH 5TDNB 4H26A 4YPGA 4ZMYA 1NFPA 3QISA 2OFJA 1Q9OB 4U6TA 1DARA 4E41B 4XMVA 1TWIA 3T9PA 3WFEH 3IM1A 2FWUA 2FGWL 1IBDA 1QG0A 3FO2A 5C0CB 3IFLH 3RHWK 1OAZL 4QE1A 3C2RA 3MHUA 1OM0A 3S3CB 3RR1A 2KDYA 3H24A 1UFUA 3NA8A 1KELL 3A4AA 2WZTA 3W9DA 4GJTB 4PBWD 3PPGA 3VIHA 2X1OA 3L65A 1H8EA 4A1RA 3L4ZA 4E5XB 2OZTA 3P9MB 3TO4D 4GUOA 4OF8A 4XAWL 4EXBA 1HCFX 4KI5F 5F70A 1DVXA 4F57L 5CR8A 4UI2A 1N9PA 6PCYA 4N3TA 5LCVH 4A2HA 3SDCD 3DMMA 3OJXA 3HNTH 4K2UL 1KTBA 2WBJC 5I1EL 2OL3A 3IRDA 4OJCA 3T40A 1RY8A 3E9UA 3OYXA 3RFZB 4L1BA 1C16A 3D2UD 4LVHB 1CGXA 2JI3A 4OF5A 4EUPA 4B2DA 1PDKA 4KKUA 3WLKX 1U36A 1P2CB 3M43A 5I16B 3AZTA 4N2EA 4NNPL 1CICA 5F7AA 3CMJA 3V5OA 3JU4A 5DUBA 5BROA 1NCUA 5JHDB 3CPXA 1UM6H 1JBJA 3ZIZA 2HFGH 2VDPB 5HJLA 1I2QA 1SFSA 3LS4H 2DMGA 3E2HB 3TA4D 4U1SB 1XMEB 3P30H 4UNUA 1OX4B 3FRUB 4WKHA 5DMGC 5AQ0A 1P6CA 1INDL 4Y0GA 2QULA 4M4SA 2WO2B 1XYLA 2DVUA 4JJOA 4LGPB 3QPYA 3V5HB 2OKTA 2DN7A 3NQDA 4DZ8A 3P54A 4P8UA 5I8KL 4XWUA 3MLZL 3S36X 5GRJL 3UDWA 1BWWA 3KTCA 2ADFH 4MAUL 4Q6KA 2DT2A 1OP5K 1MLBB 1BVKB 4GSDH 3PZUA 4DN1A 2VCOA 5B7YA 1AGCA 4KRPD 4XD3A 2WVVB 1XR2A 5GISH 3TN5A 1UD5A 4AQ1A 3GXNA 2WZIA 2ROYA 4XPGH 3O8XD 1NUFA 2WKOF 5GGTA 2PO6A 5D9OA 1H6TA 3NCYS 4AYFB 1E79A 4JJHA 4OGXL 4QRPE 5EDXA 2JB6A 1CI5A 5KS9A 3CFBA 5HQLA 2SFPA 3LZ3A 4ES4A 4NS0A 3TFKC 3HG1D 4TRPL 1FWJC 4XCNA 1EJOL 4P2RA 1T89A 5KZCD 5IB5A 1EXPA 3FULA 3CCEB 1VQOB 4XZ4A 4A3RA 3QEGH 4OCWH 1W9DM 2QUUA 4BUGA 5MEQB 4BD4A 3K6DA 4DJDD 1IGTA 4HIBA 4AX7A 4NBSA 4QY8A 4ZMXA 2Z92B 2OMYB 5C0BE 3DV6B 4JCWA 4FP8H 1B3YA 4H9XA 4W9LC 1FQ9C 2CC0A 3RDTB 7ENLA 4DVRL 2VW4A 3BEVB 4I8YA 4A7UA 2VGLM 1HILA 4ELME 1URIA 4JY5H 4CQJA 1FNEB 4XNDA 3U6XA 4LANA 4JREC 2CETA 2H3NA 2KL6A 4YSSA 2BMKB 2Z1VA 4M1CD 1U1UA 4H4IA 3S6DA 4YALA 1P5VB 2CLEA 2NDGA 3MO4A 5JHMA 2PDFA 1RLBA 5AG8A 1ZBVA 1I3VA 2LLGA 4EO5A 3QBUA 3I6KA 3BFQG 5FF4A 3VO1A 1CCWB 1UH2A 3PN8A 1HYSC 3KPRB 3QSYA 3C08H 3T8QA 1S7XB 3T6CA 4NEHB 3UQNA 4ZX4A 2ZZGA 5GGVY 2DQFB 5DT1L 4KGJA 4K3HA 4P3CH 2ZAHA 1IEIA 1SO3A 2Y25A 4NUQA 1DVYA 3CLEH 4A55A 2CZDA 5J1AB 2C1HA 5CZVL 1OSZA 1OK8A 1NIDA 2QQLH 1E3FA 1EEQA 3STZA 5I1DA 3CZSA 4XNQB 3V9EA 4Y8DC 2OLDA 2Z24A 1DSFH 3E2QA 3W0KA 3R7RA 3EOTH 4LARL 2VWEE 4JFHD 5AN7A 1X7QA 3X3FL 1Z48A 4YDJA 5AW1B 4Y8EA 3DHJA 3VFUA 4HWEH 1DUYB 2V2WA 1W3KA 1PLGL 4DNRB 2Q5BA 3QARA 3W2NA 4YXLL 1OAQH 3K2KA 4KESA 5F7MC 4QE4A 3V6FB 1KJ2L 2R0KH 3BPNB 3H3PH 2PDBA 2ZKHH 5FYLD 3STCA 1KJMA 3EOBB 2R1KA 3WF3A 1XBRA 3PL6C 2V7HA 5H5JA 1R3IH 5T1DH 3ZN6A 4JRXB 3D4CA 4Z0XB 2JFEX 3I02B 3HB9A 5HPOA 3MMPA 3VYPA 3KYKH 1KCSH 4NO2A 1F6FB 3QHZL 3IVUA 3F7RA 2Y88A 4JO1L 4AKOA 1TIWA 3EGSA 4E36A 4EAMA 3T2OA 1FWAC 1D7DA 1YUHA 3STFA 4IQJA 1W16A 2NXYD 1H7NA 1NUGA 3TV3H 1I8KA 1F3WA 1QSVA 4GRSA 4N6FA 2VRQA 1Y1DA 4B97A 3UYOD 1ES0A 2PDJA 4WU5A 2F84A 2HCJB 5LGYA 1GZPB 2J9ZA 3IGAB 4C58B 3TWCL 2IAND 5IQ7L 4DBUA 2Y89A 5EUKA 1TO4A 3DJ9A 4GKNB 1ZK9A 3L5WA 2GL5A 3WFCH 3FPXA 3O11A 1UD4A 1OVZA 3MO7A 4KO9A 4PWFA 1KTNA 4IH3A 1MEXH 2QVKA 2B9BA 1WDAA 3WAJA 5ID1A 3TJEL 3N2TA 1MQRA 1AMKA 3B2DC 1FP8A 3BT0A 3FUHA 4MZ1A 3N1QC 4G8GA 5D1ZI 1G7IB 3VCRA 4EQ3A 5ISZE 3KCJA 2EDNA 4UFMA 2VMCA 4MMXA 1XG4A 4BFAA 3V0JA 4KWSA 4OZFA 1OZTG 4H83A 2J21A 2JIXB 2KZBA 4PJEA 3IFOB 1B2WL 1RPKA 3L2IA 4XVJL 4XXCC 1SEBA 5E08L 4PJBF 2GK1B 3AC0A 1IC4L 1UA6H 3QULB 4GRWE 2Z0BA 4MDIB 1K2DA 1CE1L 2CDEB 3N9RA 1AQMA 1KWGA 3M86A 3GHEH 3RGTA 3ZU8A 2JCCF 3S6OA 3K4DA 4Z78B 1MCPL 2XTJE 1IJEA 4AVZA 2XETA 4LPTA 3CAFA 1YY9C 5DWUH 1MFEL 3AROA 3CYVA 1N0UA 5EO9A 2XN9B 2YGQA 2FMOA 3PENA 4R3SA 1RJYA 4LC0A 1OIMA 3NIYA 2VGGA 3QHFL 4B47A 2CBOA 4OGAD 3PNZA 5C92A 2CO2A 3MRNB 2VZOA 1MG2C 4P3WA 5CIPH 4X6BA 2BNRB 1D5RA 5HYSA 1MVFA 2CG9X 3GRWH 1S7RA 4QXUH 4M7LL 4MUPA 5C9JA 4XOAA 2EIJB 4Y9RA 3GLCA 1YEKH 4B5ZA 3QUKA 3P80A 3LD8C 3TYGL 2XYLA 2O92A 1JEZA 3EEGA 4PL1A 4HWZA 2A0LD 2PW1B 3HC2A 3NQVA 3MCLL 5HHOA 4TIMA 4FQXB 4M7KH 2DD8H 5H4YA 2OLSA 3LNNA 1AS8A 2D0HA 3LHYA 2A2IA 2W60A 5J11B 1H0DA 4GPVA 5JHBA 2FR4A 5DJ2B 3VOFA 2G8ZA 4YHEA 4P2CG 4YHKL 3S1UA 4PRHA 3RNQA 1GIGH 3VYNA 1UPPA 2ED9A 4YJ5A 3ZXWA 1PWLA 5G2HA 1E9ZB 1ZGLP 1KULA 2Q86B 1H6EA 2FATL 2UXVA 5IGXL 2DWXA 4PJEF 3FT4B 1CO1A 2VN5A 3RU8X 5IT2L 1UWGL 1H7OA 2D23A 3LTYA 4LEXH 1OGAB 5IOKA 2Q10A 2PW2A 3N4AA 3GFYA 1JZ2A 3LQLA 4LX4A 4HJTA 1J01A 3ABXA 1T6WA 2XVBA 4KTEL 3LXAA 3SKBA 4OECA 5FCSH 4JIPA 1UEMA 3WTVA 4LKCA 1N2RB 3OX8B 4AWEA 5AVQB 1CDUA 4WFHE 5HI3C 3TIMA 3LBCA 5EMLA 2DYRB 5FI8A 1VHOA 4G8FB 1G4RA 2H26B 3RVXD 3LD5A 4TF4A 5JXED 1Q8AA 5TE6L 4EIBA 2IFGA 4UCFA 3QJVB 5HYEA 3WBAA 1I53A 3TWAA 2WYZA 3UJFA 5JOPE 4QWWD 3UCCA 3K6SB 1QASA 3W7NA 4P8XA 3O4LE 2X0VA 4XMLH 3WO3B 4AX6A 3L54A 1DWJM 5FW7A 2Y1HA 2B39A 32C2A 5D7KD 4Z7VF 4IX2A 4PFHA 3KOZA 3VINA 4NKQB 2DJSA 2INFA 1LE5A 4UQCA 5AZ2L 3G6AA 2Z3FA 4A22A 2YPKA 1U3JA 4ACPA 2D7TL 3LERA 1U8CB 2ZBTA 2CO6A 4L9DA 4L4VD 2BXVA 1BAWA 4XR8C 1FIGH 4BV1A 5FV1L 2JCWA 4XB7A 3RCMA 3D69B 1ADSA 1PSKH 3JZEA 4B5NA 1LM1A 4BFRA 4HA3A 1GQNA 3PHOA 2J8UA 3GZAA 1CG9B 2PDUA 1KK1A 3OPUA 2B7OA 2ZOUA 5EUOB 3CU1A 4KKXA 5F1SA 1ZEAL 3BDYH 5I07A 3MRJB 4RZ4A 3F5JA 3MO1A 3CC5A 3L68A 1UB6B 4M3JA 3SPVA 4F7PA 1U8HA 4HIXH 4Q4SA 1CLZH 3U3HA 4QLLA 4ECNA 5J6HB 5ADOL 3FSUA 1MJUL 3OXRA 5CSGA 1IC7H 2G2RB 2C16A 1QOQA 3V18A 3RGBA 3T4YB 5CBIA 1TQVA 3SJPA 3HGSA 3ZHKA 3MYJB 4OLUH 3R8GA 3NN8B 3UYRH 2YSSB 4NX0A 2OMXB 2VZVA 3G8RA 1MAMH 1BSIA 2FSDA 3SGZA 1GJRA 4O9HL 3CFNA 1UD6A 1OHZA 1MCRA 1IMHC 3EO1A 5IQNA 5E93A 4CCEA 2GLKA 2YD8A 1BVNT 2QQQA 2G2PA 2ENSA 3FFDB 1S7SA 4JDZB 2J44A 4DLFA 5SWSD 2XFGB 5EU7C 4HKJA 3WD1A 5ABFB 3MP5A 4OD1H 5CJQL 4BE5A 4PHZA 2P24B 1M57B 3MNVB 3KCWA 3SE9L 4QIUA 3DVGB 3S5NA 5FYJU 1YJWB 4WI5A 4HVXA 4PV9A 2CM5A 4H9MA 3I3EA 1DN0B 4IKNA 3WFZA 3W6MA 3DH7A 4QHYA 4G6KL 2W81C 2BIHA 4N5UA 3RTQB 4IRSD 4ZD3H 3GMOA 4JS7A 1DIEA 1W3JA 2G3MA 1OSEA 4MD5B 3ALXA 5T5FA 4HUWA 1PG7H 3IIVA 1HI6B 1YNKL 5C71A 4KS0A 1YEGL 3QH2A 3FHAA 1OVDA 1UWYA 3BDBA 1HOEA 1INQA 4LBAA 3OODA 2EIKB 2BM0A 1AIZA 3L3OB 1KLFA 4TQIA 2X2HA 1FHUA 3KS5A 4MLRA 5TF0A 4G6FD 1QLRB 3L3GB 3NVQA 2PYED 5E8DH 2ZZ7A 1IGYB 1FO0B 1XKYA 2Z35B 5D7IF 2Z0IA 4XP6H 2J8UF 3BRDA 1E28B 5FJUA 4G59C 3SN4A 1LK3L 2NNAA 5FLVA 2OL3H 4KI5E 1NM4A 3T44A 4LYQA 2BVPA 1TWSA 1OSPL 4OIIL 4KQ4H 4DVOA 1IEBA 4L37A 1REQB 4TL4A 5GZND 4EUPH 2JGYA 3E0FA 3IV3A 5IKCB 3BURA 1KB9J 1U8IB 4JZJA 1EBPA 4ROQA 4S11A 1CFNB 4YAOA 1A5NC 2E77A 3WLSA 3EH1A 4X07A 2V6AA 1XUUA 3CPWB 3HZMB 5IMOB 3BGMA 1MHEB 3ILQD 5E8OB 3NSCA 2ZOTA 4QEHA 3RWCB 2WCGA 2B31A 5H59A 2PU0A 4WTWA 1X5MA 1FLRH 4DJFD 4NO0A 1CDCA 4I77H 3UG3A 2ZXQA 3P2BA 4UBDC 1QWKA 2DUZA 1F3DJ 4PGCB 1KNWA 3O6FD 2ZQ0A 5DDHA 1H41A 5EN2B 2FVKA 4X7DC 3WD3A 3W11C 3CFDB 1L4IA 3KXQA 2OMVB 3QBTB 2A4ZA 1WZ1L 2AJVH 5GGSA 3TLLA 1JCVA 2J7DA 2AAAA 1JRHL 1MCDA 3NSDA 3T4AC 4J39A 1ZT4A 2P5EE 2NSMA 4ZBCA 1JGVH 3V7PA 4H8PA 4JMNA 4ZSOB 4YLWA 1PKMA 3NBNA 4H88L 1WBHA 1E4KA 4J28A 4KKAC 1CU4L 3DPBB 4HKBA 1XSKA 3E0WA 1TEGA 4PY7A 3CIWA 5HXBA 1EUUA 2IWKA 5CCKL 3HS0A 3AREC 2EH7L 4R85A 3F5WA 3DFYA 4LLMB 3QDGD 3OR7A 1A2YB 1ADOA 4I9WE 1R0AL 1DQXA 4OJAA 2E6DA 3DUHA 3ZZTA 1EA0A 2XCMC 1BLIA 5LGJA 4RD3A 3V0HA 5T3XD 4GFTB 1Z9NA 2NW3B 5DLCA 1CQXA 4AL8L 2QT6A 3LKPA 2BNQB 4ERAA 1QLEL 4I87A 1IU1A 4IRZA 2ZE0A 4Z76B 4MWAB 2X2JA 1PCSA 3B40A 4OTXH 4HOMA 1CE6A 5FR3A 2OKMA 4Z7UB 1SXSA 2DM3A 4GMSH 4CNTA 1EO8L 4P2QD 3GJFK 3TCSA 1CLKA 2ADJA 3AI0A 3TA3A 5EPMA 1FBIL 4TOYH 4XNMB 3R7QA 1GRWA 3EJYC 3JV0A 1QEWA 3WF0A 4AIBA 2XA3A 3ZY7A 2GSEA 1RJZB 5FO9B 1MWOA 5IYQA 3AS3A 1SKQA 1XH2A 1O6SA 3O81A 2J8FA 4YVUA 5K1NA 1E4WL 1MUJB 3EJZD 2E5DA 4Q3MA 3GVVA 2QVHA 2P8LA 2W1NA 3QPXL 3ETBJ 4BRJA 1LDPL 1S8DB 1K6QH 2ZX5A 4NNXB 3GRGA 4M19A 3ELQA 1V55B 2N0MA 3CV6A 5KANI 1WBYB 5I8OH 4K5OA 5HGAA 1GXEA 2NT0A 12E8H 3ZUGA 4FK9A 3D4ZA 2YMTA 4MVAA 3LZFL 3WJLA 3FJTA 5FFLA 1GVRA 4OOZA 4G43A 1ORSA 3WJZA 3WFHB 2H9AA 4OZ4B 5HINA 3BVJA 4DAFA 3PCYA 3SQOH 4JNZA 4ICXA 3O2WL 4OUUA 3VNJA 1VEOA 2GYIA 1IL1B 4RCAA 2MCMA 4RAHA 4HKXA 1FI8C 4Q8UA 3QXAA 4V15A 2XPYA 4JTCA 1S4MA 3G1RA 1LG1A 2CSPA 4FADA 2APFA 3ATFA 2YX0A 2P8MA 3KL3A 4RNFA 4X98A 4YSCA 1FBAA 3O9WC 3DX2A 4LVNB 4X6EA 2MTPA 3BLIA 2CK0L 4N1EA 5DK3A 1NOAA 3DFOA 2CFFA 2NXGA 2NPLX 1SYSB 3EGXA 1HHIB 4GJIA 1NBMA 3AWEA 4PA8A 2YAHA 4QXGH 4QLWA 3RY4A 3B2VH 2XLLA 3NRPA 1OGJA 3OGCB 1ZHNA 1XW8A 4M1GH 4P2RE 3GBNH 3U6RA 2TRSA 4XNZC 1BDYA 1FORL 4HALA 5AL0A 4AG4H 4WUIA 1BZ7A 1A6ZB 2JQMA 3SGKC 3UTTD 4OD2A 1PZSA 4DUVA 4TV5A 3NQKA 5C08B 1CZ8H 1C1EH 5EBLA 1I75A 2BPBA 3EDDA 2XSXA 1LLZA 3KPTA 1MCOL 4WEBL 4TSCL 2X0KA 4TMPA 2R4RL 3NDYA 1VHPA 3S37H 6A3HA 1BD2B 3RWJB 3GK0A 1SSGA 3UH8A 1FZKB 3KWUA 2WZEA 4PTWA 3PULA 5CD5C 1GQIA 2AV7A 2MQCA 3N4EA 4BH8B 1KPRB 2CO7B 3WEZA 1IM9D 2R1LA 2VR2A 5D03A 1GS6X 2ZCGA 1NC4B 3H4WA 2LV4A 2IVFC 4X8CA 2PD9A 1D6VH 4DZBA 5GRXG 2X4TA 4F2ME 1M3UA 1JWMA 1FCCA 4OLEA 4O1EA 3CDYA 5GS0D 1POKA 2VX6A 3BWUF 1B3OA 3PLYA 4M48L 5JPMA 1AVAA 2EO1A 3BJLA 2AABH 5AHNA 3WD5L 3TONA 3HIJA 5IVNA 1F1DA 3B4NA 2XRAH 1XGUA 3T0EA 5AC5A 4ZX6A 3SCMB 1FWHC 1F76A 3QPEA 4Q9QH 1S9YB 5J06A 2G96A 1EFXD 2Q87A 3DROB 4MY9A 2H6PB 3LV6A 5AG9A 1JD7A 1KYUA 2W66A 2PMQA 2OA9A 1JI1A 4Y2NA 1JHLL 4YQXH 3WL9B 5JDSA 3Q01A 1EC7A 3GMQA 5TQLA 4G5ZL 1D8CA 1JYXA 5I6KA 4O19A 5FKAB 4DP5X 2EIZB 4OFVA 1RVKA 2B7DT 2YXXA 4J4PA 1H49A 4LU5H 2NR6C 3G9AB 4OVVA 2NY7L 2W07B 3CK0L 4UQEA 1ZU8A 2A6KB 3K8MA 1TSIA 4BE6A 4ALAL 3ZKXC 1GC1C 1PEZA 3IFLL 5C0FB 1HE7A 5CAYB 1PKYA 3ARYA 1FA2A 2GEEA 4Y1AA 5FOBB 1A5MC 1AC6A 4H7ZA 1JSYA 1PG7W 1RBOB 1TG7A 5T3ZL 1I1FA 3DXIA 5ES4B 1DFBL 4X5WA 4MMYA 1X5KA 4PJIB 2XPGA 4B9CA 2O55A 3UIYA 5DS8A 2UY3A 5L9DH 3GDLA 5MHBA 4CQ8A 1MCWW 2HDNB 2XVKA 4Z3FA 3MTXA 4PJ6A 2CGRH 4HPJA 2V3DA 5HQMA 1A53A 1XBDA 3BVNB 3SCWA 2YR3A 1J8HD 1TPEA 1RA0A 4JY9A 2ZWKA 4QRRB 4AW7A 3F64A 1KTVA 5A69A 4MFHA 2R6OA 3DVIA 3RZCD 4PJXB 3MA8A 1A4JA 5FDWA 3T3PF 3IIZA 1Q5MA 1FWBC 1WV2A 4B5EA 4O58H 4W9DC 2H9GA 4G8GE 4BQ9A 3TCLA 3SY5A 1PD1A 4AK2A 1L9MA 3CVHB 1OD8A 3F3HA 1TV7A 2FWOB 4D1JA 4FX5A 3I3DA 4MCZA 3NSMA 2VJJA 1RU9H 4X83A 3KHQA 5EWIL 1YBQA 4PJEE 2ADAA 4C83A 4MBOA 1KO0A 2ZZ4A 4JTHA 1DWHM 2CHWA 5F7FA 3VW3L 3SYOA 4DGIH 4DERA 2NQ3A 4FYTA 4F1ZA 3CTAA 2OMBA 3I56B 3DI2B 3MLRH 3O45B 4JDEA 1AW5A 1XLMA 3QZWA 2DPEA 5BNXD 3BXNA 2Z00A 3RM9A 4GEJA 1A6WL 1C5DA 2PTWA 4NZRL 4D6IA 4ZMGA 4R4BB 4XOCA 2Q20A 1R4XA 4W6WB 3US1A 1SM3L 3VIGA 3ML9A 3V9FA 3QFCA 2CBTA 3G5WA 2CR0A 5HR7A 4JM2F 2NLJB 4J2PA 2VM3A 5H8DA 1NC2D 2XJLA 3NPWA 3GH7A 1JOIA 3Q06A 3LNMA 4MTMA 4G6ML 3GHRA 1B0GB 1T1ZB 4DO5A 4QTHB 3CDZA 4XPGL 1ETZA 5CGTA 2PP7A 3G5YB 3EZ4A 1EOMA 3ARBA 2R82A 3AICA 1RJQA 4CMHC 2AJSH 2R23B 3ITGA 2EIEA 1U8NB 2JWYA 4FSAA 4MA3B 4LO9A 3FB6B 5H35B 5C0QA 4D9LH 1GMEA 4FG6D 3RWFA 3MBEB 5HHOE 1MNUL 4ORZC 3I6RA 1XRVA 1DBKL 2AQOA 3O2VL 3GUTB 2BODX 2EPHA 3SCVA 3UNTA 3P3RA 5FXCH 1M1XA 4Y8AA 2GBUA 2AXHA 3PB0A 5FEZA 3CQJA 3ZE1F 5FSEC 2GT9B 1YPFA 4LDLB 4QCIB 5F4JA 3UPRB 2YPLB 1G9NL 4F0LA 7FABL 2LABA 4Q8PA 5JPNB 4YEFA 4PRHE 2B7CA 3MCKA 1GQJA 5DD6B 2P7TA 5M94B 2HXAA 3DUSA 3RNKA 1BFNA 3FXGA 3JS3A 4TR9A 4NNYB 3FQWB 3SKNB 3ZJAA 1DJWA 1RZPA 2D7PA 3FFCB 4U2ZA 4BA8A 4E38A 1S1PA 2B3RA 4HX1B 1GW6A 3C56A 3MJWA 2FJGB 1XQ4A 2JFCA 3UTSD 4NQSB 4GG8B 3KPQB 5CLZA 1DQML 4IQHA 2ZUUA 2P44B 5K1JA 3H42L 4RDYA 4HYTB 3K3QA 1P48A 3V52L 1OG6A 4EN3A 3HZVA 4EDWL 3DUUB 2A6LA 1UM5L 1FH7A 3WIFB 3VNIA 2C7UB 3VXMA 3DC8A 2UZXA 4IBVA 2UY6B 3P7YA 4A6YA 4PTVA 2YPIA 3P3TA 4NAFB 3FN0H 1E9IA 1GSKA 5M95B 3SYCA 5C2BH 5I8CB 5T5FH 5CFHA 3V4VH 3QRBA 4KUCF 4G56A 2EUWA 1W8SA 5A2IH 1WDRA 2HAZA 1AI1H 4GP4B 2V38A 4N2DA 1MW3A 3ZL2A 2EICA 3OQEA 5HI5D 1MFUA 4KRMB 5IVZB 4BK5C 4QXTB 1DSFL 4JFQB 3EGDB 1XBVA 2VSKB 4KTGA 5CSZA 4BWWA 2ZNXA 5KSUB 3C0LA 4H8WL 4M8VA 4WFGD 4UMGA 1YNLH 1QNOA 4NZUH 1WBZB 5DURD 9PCYA 1M3IA 4AIZA 1CGVA 5DJAA 3CHFA 1H85A 4DW2L 2QELA 1E8YA 1EL3A 4FQQA 4DXKA 5FWQA 4A04A 4AIEA 2J43A 3LGEA 3GNMH 4MSSA 3QDJD 5AAMA 5HKKA 5D7IE 2J8UE 1J86A 1NCHA 4XD5A 4HCFA 4JRYB 3MYZA 1D9EA 1ZTXH 4JN2B 4EVNB 4JPWL 3CXHK 3JRKA 4FNUA 4PY8I 2OWWA 4ANUA 3W4RA 4G1MB 4U7SA 4OUIA 1IEHA 2P45B 1MCCA 4CL7A 4ROPA 3MRDA 3DNKA 3U2SA 4IS6B 1RZ8B 1LG2A 4PJ8B 5IB4A 3N1PC 1FH5L 2MHAA 5L2KD 3MV01 4CNIB 2BASA 4IFRA 3DX6A 3IDGA 4DZ5A 6TAAA 3TV3L 1T03H 3GSIA 4ZXBB 4AHPA 3LEXA 1FG9C 5F97E 3TC3A 5B8CA 5HDQH 3T5WA 4X8IA 3WJMA 2J8HA 3N43B 1KPUB 1J1PH 1UTDA 4GNKB 4HJUA 3D39B 2HT3D 3EOYG 4BCYA 4AY7A 2EDHA 4WCYH 3U1QA 2WJFA 1BQEA 4W9IC 3CDCA 4DF2A 4E42A 2CXKA 3VQ1C 4ORGA 3MCOA 2FSEB 3WFCL 1JPFA 4QHNB 1EB3A 4NDMA 1J7VR 2R8WA 4C90A 3TJXA 5FM8A 1VA9A 1YNPA 1MEXL 4PUBH 3HW7A 1SYVB 1TZIA 2DKMA 5D4QA 3B05A 3GKWL 1TVCA 1P6FA 4R26H 3MV7A 1AH1A 1W0YT 4C91A 2RIKA 5F7HA 1AKJB 2QPDB 4CDGC 4RL3A 1ZS8B 4QISA 5L46A 4WX2A 1TPWA 2EYSB 3GSWB 3QNXB 3DX7B 1O5PA 1VESA 3C2SA 1NDGB 5K9QG 4QHLB 4KWUA 3VJ6B 1KA9F 4HG4K 1JZ3A 2HJKA 5JHAA 3IIXA 3RNDA 1Q63A 2OCJA 2WQDA 5AKSA 1YDOA 1RJRA 1LL1A 2KT6A 4OU3A 5I00A 3W1QA 3C8NA 1FL3A 1HTIA 1U8MB 5HPCA 4RZCB 1QHPA 1NP0A 2E1WA 2ZKXA 4KROD 4YOKA 1A8JH 4XQ6A 4YZFF 4WDUA 2PLFA 1DANU 3WIIL 3L0KA 1BJMA 2HG0A 4U4MA 1PCXA 4N2LA 5DK2B 1NA8A 5JQ6H 3LS9A 5AAPA 5A2BA 3NJXA 4IJCA 2YCLA 1Q3NA 1NFKA 2AJZB 3F6JA 5FL7A 2E4TA 4WDXA 4JKNA 4YS1A 2Y5QA 2IV8A 4GXVL 1RIVH 1ZTXE 4XM3A 1YEFH 3DHFA 4L1TA 3LM7A 4QXUL 4KMLB 2CALA 1NDYA 3U0TB 4FMVA 5LWYL 4PCTA 1A4AA 4RDQG 1AGFB 4FQHA 4DXXA 4L9LC 5KG9B 4Q14A 5E99H 3ARSA 1A9EB 1CGSL 1CYGA 1QGZA 2XT1B 1TQCB 4HAGA 2VE6A 1YHTA 1HDMB 5JH2A 4JPSA 4LXFA 5KN5B 1GYMA 4LLWB 2PE4A 1JA0A 1MJ7H 4G8AC 2Q3AA 3CC2B 4KJQC 3ASSA 4IGBC 1M04A 1QO3B 1S9WB 5EZOL 1LEGA 4P07A 5F1IA 1OADA 2O5ZL 4ZPTB 1KXHA 2VNKA 3GNDA 2XIQA 1FFRA 3RILA 3VFPA 3LMYA 4OJYA 1OFPA 1GGIH 3EG9B 4KDWA 4PVBA 3PPEA 4YE4L 3B6SA 4CNUA 4Y5YB 2ZP0T 1Q8JA 3GIPA 2Y07H 4J5NA 4QDGA 1QW9A 4DOHE 4FTVA 1B3WA 3VG9B 3BAEL 3PPSA 2DI7A 3CFEA 4JHVA 1QNPA 1ET5A 1A50A 3L4TA 4LEXL 1QFWM 1MYRA 4TNGA 1XKJA 4XGZB 1N08A 2NUWA 5MENA 3L13A 3LZLA 1VGEH 1ZQ5A 3Q39A 1M90D 1NMCB 3QDMB 1NEZA 2XWZA 1AZNA 4RMVA 4W84A 3AXLB 3DO4A 3BT2H 1Q6EA 2OI9C 4MOZA 3TX4A 2DLIA 3UPWA 1IGSA 4ENED 2WWKT 3FLUA 3HA1A 3LRSB 4O10A 4WTQA 1M7IB 3TESA 2VNHA 4JW3A 1ITUA 1NGZB 1CFBA 2ISFA 5DA4A 3JWDH 2F7IA 3STPA 4JDYA 3QCUH 4HHAA 2K9FB 4ZMQA 2RCSL 3HI5H 4UQBA 1N05A 2CAKA 1G1YA 4UB0L 3TJLA 1E5NA 5CD3B 3RPIA 3WLBB 1NLBH 5BS0E 5KW9A 4U2YA 2V5BA 5E6RB 1IVTA 2A6JB 1L9OA 1FGNL 2D03H 1M7JA 5FX3A 1NWOA 1BVLB 5IYWA 5LIYX 3ARZA 1QVFB 3A0OA 4G6AD 5EIQA 3QTPA 5HBFA 2XWBA 1MO0A 4M62H 2ZZ2A 4PRPE 4HOXA 1FH2A 4NT6B 5C0IB 3I7SA 4P5TC 3DTUB 5I6SA 5HJ3B 1PSKL 1S78C 4BFIB 1HJUA 3N11A 3NWRA 4DJEA 5BRPA 4OP7A 1W2KT 5HUPA 4YELA 2EKSB 1KV3A 1TV4A 5G4EA 1X9RA 3LZ5A 3CNYA 3F03K 4UQ2A 2Q8LA 5ICYA 2X16A 3RMEA 2R4SH 4AQEB 4NQQA 5BO1H 1YEHH 2NVCA 3MSDA 4PTNA 1PV8A 3B7UX 6ALDA 4QRTB 3M0HA 1RHCA 1YRRA 2X6MA 4Y7EA 4P1VA 2WQUA 4S3KA 1LXMA 5A6LA 4PJ9B 1AJ7H 3IARA 2BOBA 4RRPG 4W88A 2KS0A 5H2BB 3DOHA 4G2AA 4W7UA 1ZDQA 1UP3A 3WBDA 4DWDA 1HHHA 1UXMA 1YEJL 2O5XL 2I32A 4K8RD 3BW2A 3G8EA 4JZ5A 1X9LA 3D6GA 5C86A 1TLLA 3C2VA 4NQ1A 1OAUL 4WDIA 3JZUA 3U7WL 2J6XA 2F1AA 4UTAA 4JFFA 1T1YB 2G5UA 2BTMA 3K2UL 5I1GL 4Z7QB 4DUWA 3H2WA 2SODB 4D0BA 4O0ZA 4DGUA 4QHPA 1BHGA 4IOSA 3TYZA 4H9UA 1WFUA 4GQQA 3QE2A 1UD8A 1UWEL 5D7JB 1MSSA 2AJ3B 2QFPA 4OY9A 3SY1A 4MHHI 4ELKB 4NRYA 2QADC 3A4WA 4ATWA 4ZS6C 1ISVA 1FNGB 2WV3A 5FO0A 3BE1L 2NY2C 4N9GB 4M4RA 5FJTA 3D9AH 5M3WA 1M7OA 2HYMA 4ABWA 3ARUA 1V5XA 1I8IB 2QKSA 4YX2L 5F7DA 1DPMA 3C5ZC 3QAQA 5DZLA 2OMZA 4O1DA 3KPOA 3ZRSA 4PS8A 3BXWA 4CNOA 2AXFA 4UYQA 2R2HA 4G7YL 3AMCA 4AZGA 1X9QA 3D4GA 2F1BA 3TT1L 3NDYE 4XI5D 4Y4FD 1ND0B 3NCOA 2NUTA 3VIJA 4ABQA 3M5VA 3QEUA 3T08A 3Q45A 2CLZB 3FNKA 5MF5A 3QAZB 3MZGB 3H4FA 2WMHA 1HC1A 1SXAA 5I3DA 3SJVB 1ZL1A 3OLEA 2VYRE 2WXHA 1VHCA 4X5RA 2DQEL 2F6AA 4PBFA 2G75B 1SZNA 3GLAA 1B3ZA 2BRQA 2IKHA 3ECBB 1N18A 3T3PE 1EFZA 4UAOC 2XZZA 4GW1B 4RMUA 3K6IA 2RDTA 1F02I 4IJTA 2K70A 1AD0A 2HPMA 3FQ4A 3CH1B 3ANUA 4OIFA 1GPOL 5KSAB 3O41A 2WSPA 3S4SB 3NZ8B 1KJ3L 1WUNT 3T0EE 2MOVA 3T65B 2WLIB 4PV1C 3A1PA 1F07A 4EIUA 3DRQA 3QC5X 1GYWA 1YW1A 2YQGA 1WXZA 4ZMWA 3BKYH 1SPQA 1QNSA 3ZHDA 2F4NA 3UTPD 3CUHA 3LI0A 5BVPH 3D46A 1H7XA 4KXBA 1RZ7H 2XH0A 2OTLB 2L7EA 2D4FA 2Q8AH 5E4AA 3VE0B 3KOWA 1C8QA 3MBXH 1QFYA 4K7PX 2C1IA 2JK5B 3ZLFA 4HYVA 2CJSA 1QABA 5BXFA 3IJLA 1M71B 4RQQB 4HZ6A 4XPHH 4AGLA 2PXYD 5KS9F 2ZCLL 1IQDB 4OLWH 4ZAKA 1C3FA 1TWWA 1C8PA 3V4PL 4FHAA 4ONGL 4MNQA 1US3A 3IJDA 4C6FA 4E0RA 4YNGA 5GGTL 3ZC3A 5GIRB 4JG9A 1BFOA 1ZA3B 3AXIA 4PRID 4Y1AE 4L3CA 1R24B 5G1TA 3FUFA 3V0WL 1E72M 1QPNA 3THUA 1IGJB 3VIMA 3HLKA 1VFMA 1EKOA 2AJYH 3HE7B 1ZGDA 5F9JA 2PGWA 4UMCA 4P5RA 3OGSA 2X2UA 5DZJA 1S7UA 1ZM2A 3VCNA 3ZL1A 5C97A 1KACB 5IMLA 4ONFH 1FC2D 1WDWA 3Q3GA 4UYPA 3P0XA 1VQ8B 3S1XA 4AWTA 3X1BA 3ZE1E 2BP8A 3AYVA 5EZLB 1ZMYA 5E1IA 1QMUA 4XPTH 5GGRY 2Y3NA 1WDDA 5D2NA 1OQOA 4AT6B 2F5AL 2VXSL 1A7OH 1Q7ZA 5F72S 4N2OA 5A2AA 4ZFMA 5HYFA 2FPYA 5E00A 1MRCH 4E9LA 1HHKB 3IB4A 1DXFA 1NBZB 1HIMH 3LXBA 3FW6A 4FDWA 5AHEA 1WWCA 1G6CA 4Q6IB 2P3EA 4FXUA 2W38A 1JJKA 4DWSC 1ZLPA 3O15A 3GDMA 3B06A 4UFJA 4N86A 2ATKA 4ZZKA 2VP8A 5BZAA 1M1KD 3OKXA 4I6KA 1ZOXA 4PYHA 5SV3A 4U6YA 4A6YH 3TO4B 1F3JB 1VQ4B 2IQ9L 2EIXA 3GU9A 4X8GA 1V3HA 1VPOL 1ZLWK 1IT8A 1IXOA 2APVA 5HHPB 2HCVA 4NQCA 3TJHD 4TVUA 1G87A 5C07A 4Z7OF 4LAUA 1KT2B 5C09A 4BF7A 3MRHA 4GRLA 2KAUC 3SDCB 3PZOA 1H0IA 2JELH 5T1MA 5DFTA 2I9EA 1WRFA 4LSSH 1NJID 3ARFD 3D2UB 3HFTA 1TIUA 1G7PB 1MI5D 3NQIA 5BW6A 4G7FA 4HSHA 1E70M 4ALAC 1FY6A 3KYAA 1T1XB 3IGUA 1C8XA 43CAA 1UUMA 3GMRB 4FYSA 3BSZL 4QHUA 4MMZC 4IK7A 2C4FT 1ZP3A 3E9TA 2V5KA 4PMDA 4ZUWB 4UTHA 4WKFA 4I0PC 4JX0A 3VRJA 3SE8L 3LHTA 2IAAC 4P48A 1E64A 1MWAA 4Y90A 1V79A 3V0AC 1OWWA 5JORB 2ILLA 2AZUA 1KCUH 1TE6A 2NW2B 3VFTA 2EXYC 1KV8A 1RK0B 3BVUA 2YCJA 4ZMLA 4PRDB 1MH5A 4YNYA 3ZW3A 4Y88A 5IEKA 4CVXA 1F6PA 2QYGA 2VCCA 4PE8A 5C0GB 3GPSA 4O5LL 4RAVB 2J73A 1ZDSA 4Z6AT 5DD0L 3UAJD 1B1YA 3G3DA 2BINA 5SX4H 5JQ9A 5A95A 4HMEA 3WQGA 4KV5F 4AMAA 2ID5A 1RPQA 4XO6A 4EMZA 4MWFB 3V0VB 4KRPB 3W88A 1WB0A 5AYUL 4QEGA 4YN5A 3H2EA 1ZLVK 2TPSA 3O8XB 2LU3A 4ZX3A 3C87A 3RBSA 3SE4A 1JYWA 4HIIA 2BY2A 4N8VG 2W9DL 4AEIL 4K38A 4I18C 5F93C 4LCRA 2K3TA 2NZLA 4YCPA 3R6JA 3MWCA 2PGRA 1V0LA 4ZR8A 4HVBA 2NOYA 4JB9L 3H7LA 5LXGL 3QUHA 4Q58C 2BSBA 2YK1L 4UIMB 4OV6F 5TGBA 3HG1B 1NDWA 1D6VL 4FTDA 2BSTB 4QAMB 5KZCB 3WNNA 3IK4A 4XP9L 4XZNX 2EPLX 2CITA 2XIDA 2VFDA 1RZKH 4C6KA 4BKLB 2NV2A 5D9SA 1UH4A 1F8TH 3FK4A 2RC6A 4N90E 2W6JA 3VUPA 3EDKA 1UYWH 1ZK5A 1HH6B 5DQ9A 3AXMA 2ACSA 3AS2A 1JCKA 3N9KA 2YZ8A 4G8TA 3OA3A 3QEQD 1TUPA 3IDMB 3RX7A 4HBCH 4DQOH 1Y5WA 1W5MA 2Q6ZA 1S1RA 3S1VA 1QTYT 4RNRB 1CBJA 4F8NA 4XL9A 1QSEA 2IBZY 1LDCA 4P2OA 3N1FC 1HJCA 4NJ9L 1W2PA 1PDZA 4F0HA 1B0IA 4XP1H 4AF0A 2Y61A 1G9ML 3WTYA 3UP8A 5FYKH 3U9PL 2H3BA 1Q6DA 5ANMA 1YN6B 4YZFE 2IH3A 1AQ0A 2X6AA 4S0SD 4XUYA 2BC4B 4UTKA 2WNQA 1TTAA 3MLSH 2EDQA 1YEYA 3SBPA 2R1WB 1B57A 2D3VA 5K1VA 1BBJB 1PL9A 2KPWA 1R3LB 3S83A 4N2HA 1FCVA 5DS2A 2DBJA 5FV2A 1CT8A 2UZPA 4M8QB 3VXPA 3H4GA 4CD4A 2EQDA 1O5XA 4JM0A 4C6IA 4FOUA 5LNUA 3H3KA 4S3AA 3RCYA 4RMRA 4LUYA 3BKMH 2J7CA 4NENA 5EU6A 4R53A 4ZB0A 3CZFB 2E3VA 1NQBA 2Z8WC 4HPOH 1N10A 1BPVA 2FB2A 2D31A 4ZMAT 1V02E 1YNTB 4BZ1H 3QG6A 3D3VA 4R7JA 4Y7CA 2XGBA 2XNCA 4W4OA 1A4LA 3VYOA 3LCLA 1MXGA 1BVOA 1AZUA 4FQCL 5IMMB 1U91B 2ZC8A 5C2CA 1EZSA 3T6WA 4JY4A 4H13C 4JFYB 5ILTH 5AW7B 3NPUA 1UT9A 3DJSA 2BOEX 2LAGB 5DO8A 2GSGA 3IDYC 1LUCA 5KJRH 3MV7E 3QIBA 5H37G 1WUZA 2WIIA 1J5OH 2GQFA 3NH7H 1J0IA 2Q7YA 2J20A 1Y0YA 3P4NA 4GS7B 2IOIA 1FVEB 1PD6A 4LVOB 1ED3A 3CDGB 3HZ3A 4AENB 3G0XA 5E7BA 1KCRH 4KK8D 1IILE 4DSYA 4ICCX 2NXYB 5I1LA 5HGBA 3MROA 4HTYA 1VFTA 3WN5C 4H8WC 4L5FL 4LQFH 2PLMA 5A7EA 2VBSA 3FC8A 3VTRA 1K4CB 4Z23A 3FU3A 3GDCA 2CUAA 3S9ZA 3C0SA 3MNWB 4HFWA 3WEMA 3V4VA 1XGTB 3M5ZA 1BLNA 2FYYA 1I3RA 2IANB 3QUZA 4JFWA 2GUOA 4I5BA 3FJ4A 1MXSA 3FGCA 5AAWC 1NMAL 2GY7B 3F7JA 1EIXA 1PJ9A 5KW9H 2C0AA 4MFDA 4YHZH 1A6VH 1X97A 4ZTYA 1M03A 2I85A 3OG3A 5FYKE 3UC0H 1EQCA 4XVUD 5SWZD 4RZKA 4NQXA 3LNIA 1OAKH 2VDMB 3GG7A 4XN1A 4LL9A 2EPOA 3O6ML 3OWRA 5M7QA 5GHWL 2AL2B 5F7BA 4JKLA 5BRQA 1IVLA 3K8KA 5C5YA 4JPVH 4ZNEA 3BG9A 1ADDA 4JQVA 2JNZA 1JL8A 2VUOA 3P84A 2C9SA 5F1OB 1B0RA 3FSAA 3FYEB 2AGTA 4UU9B 1S7WA 5JYMA 3Q1SH 2VHLA 2BNUB 4LSVH 1CGYA 2I9LB 3IFNL 1EC9A 4IU3A 1WBXB 4AYID 4O00A 3C0QA 3F85A 4RLDA 4Z3HA 1JCMP 3LNEA 3KRZA 2XWTB 1XBYA 4XPBH 4U6HB 1WFTA 5GZOA 1LGVA 3GMLB 1GGBH 2M26A 4ADJA 3LB6C 1IYXA 1AHWB 2ZSVA 1IF2A 1T66C 2FPTA 2ZOKB 1VR6A 1QI2A 4KKBC 4Z3GA 1LRTA 3V5KA 1E5JA 3HE6A 2RAGA 4WJXA 4KO7A 3LEVL 3REWA 2OU4A 5DHEA 3SW6A 2BP3A 2V3FA 1OAXL 1O5DT 4PC1A 3O4OB 1I9RL 4QRQA 5CEWA 2IQ0A 1X5YA 1I4NA 1YDNA 2EO9A 3PYCA 1J0YA 2PS2A 2VM4A 2OSLB 4K71C 4UTAH 3KWWB 3TYFB 1Z6KA 2YEQA 1GGCH 3MRKB 2J13A 1CFTB 1CT5A 3O1NA 5MENE 2IPTH 2WSSA 1MREL 2C91A 1JDAA 3WQ4A 5HYQB 5E4EC 1WKFA 5DX7A 2E5EA 2YGYA 3PVFA 2QJIA 1EHAA 1KIRA 5JOEA 3MU7A 2VI0A 4UTCA 5I66A 1C12A 3WF2A 4A21A 4RXGA 3U4EB 3ROLA 1NCWH 4NGHL 1B88A 5I0YA 4XTRC 5EMNA 3IKCB 2NCEA 3H6JA 3WE6B 4ODUB 3EADA 4O57A 4F33B 1DDTA 4ODSH 4Z0BH 2I7SA 2K6YA 5I15L 1XTLA 4DP7X 1IBFA 3KVPA 2DSWA 1I85A 3LCXA 5CEZH 5D1XD 5BYWA 1YKWA 3QG7H 3ZBUA 3DGBA 4KH2A 3ESMA 4L8SB 4DKTA 2O4MA 5E0QA 3WNOA 3R6IA 1EJSC 1R3KA 5I02A 4XO9A 4PFEA 3HI6H 1Q38A 1AQKL 1T7ZA 3S47A 4XX1G 3LJ3A 4TT3A 1TPB1 4IBTA 3TVAA 2P5PA 3FEMA 3GGWB 4BK9A 3SBQA 2ENPA 4FI6A 3FZUC 3VAVA 1IXQA 1NTHA 4D6EA 4JANB 3EOEA 2ITDB 4I9JA 4I4WB 1BFTA 3FQNA 2X89A 1QFZA 1Y65A 3VUAA 1G7HB 1P7TA 4EF3A 1FSKB 3SYQA 3VZYA 4L48A 1NLDL 4WGHA 2QVIA 1EX0A 4N2AA 1RULL 2H2PD 2BERA 2C3VB 5C0EA 2CK2A 4JGMA 1HWWA 3PZQA 5EMJA 4JQAA 2EE3A 4L4VB 3M5XA 3VFOB 4FYQA 1IQ8A 3ZKND 4JFFE 5BQ7A 4J3OC 1MFVA 3S1WA 3EFOA 2VDOL 4OFKA 2P1YA 4HOWA 4BXSV 4YHOH 1SJDA 2X40A 5CUSL 1OQFA 5HNUA 5MERB 3MNDA 3VXUA 1QYGH 2V2TA 4G7XA 6FABL 4F58H 2ERJC 1TV5A 1KBWA 4WTXA 1A0QH 2YWGA 2HSAA 2G3XA 2E40A 4ZUSA 4HD5A 1T0MA 5KS9E 1MRDH 5HVWA 3UXAA 4J3VA 2OELA 2FIKA 2ZXEB 4P4KA 5CGYD 3G1YA 5DLMH 1SHMA 1IGML 2WANA 3DPDA 1NUDA 3EJPA 3CJJA 1I1WA 1UQYA 1TPC1 2PDMA 1DYZA 4OF0A 1L7TH 3BGGA 1XGDA 4HCDA 4NRXA 2PPEA 1EH9A 1GS7A 1MFCL 4NIKB 4Q2ZA 2CIPA 4DAGH 2WR8A 1U8KA 4X6CB 1KV5A 4G9FA 4AM0Q 3ULVD 3K0WA 4MXWH 4WW1B 2IAMD 2BVQB 3L1OH 1YE4A 1GPFA 3EDFA 1QTSA 3TF7C 5SWSB 4IRZL 1CFSB 3FF8A 5IRPA 1U8LA 5DRZB 3NL5A 4PZVA 3UJEA 1UXWA 4C4UA 2OX1A 4IRJB 3BVWA 5B80A 4HCRH 2NY6D 3MRQA 1QZNA 5IHZB 3PP4H 4P9HL 2FIQA 1UWXK 3C2YA 3NG5A 2ZG2A 3SOBH 4IRSB 2HT4D 3GHBH 2WLKA 4AY0A 1YEFL 3PVDA 1JTPA 4LDEB 1BD0A 3S2JA 2I5YL 1Q94B 4DGVL 2V37A 4WZEA 5E2WH 3B9KA 3SPIA 2V2CA 4IM4A 3W82A 4NSBA 2CKRA 4H8VA 3HKZA 2AQQA 1A6PA 3V5DB 1DCEA 3QO0B 4KAQL 2YZRA 3F65A 5FO7A 2XY2A 3PBYA 5EFIB 1X6NA 4G6FB 1MUCA 2EDTA 4LASH 2PYEB 5IFTA 3TO2A 2JKRM 3W7OA 4KPHL 3IJHB 1C91A 2CBJA 3HURA 1XDMA 1W35A 2DYPA 2DMCA 1QR1B 4PTTB 3FCSB 3EDJA 4QKXB 3N9GH 1YXYA 5HDWA 3AS0A 5GS3A 5I5JA 1OB1B 5I7GA 4UM9D 3VKKA 4LGSB 3OZWA 2E7LC 2JJTC 5HQEA 4Z7OE 2QGBA 3PS7A 4O53A 1LEKA 1E43A 1DDHA 4F7EB 3SKJL 3CVIL 5AC7A 2OTJB 2BFVL 2WQ8A 3T0BA 2B4CL 1EAJA 5C3IA 3L5JA 5E9DD 4DBWA 4HT1L 1BFSA 3U5UA 2IPKA 4MNQE 1U4EA 1MWAH 4Z1CA 3PF3A 5G4NA 2YAOA 1VGEL 1D9KC 1UCWA