3BCDA

Alpha-amylase b in complex with maltotetraose and alpha-cyclodextrin
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
585
structure length
585
Chain Sequence
SLFLIESEPSTGASVSKNLTEIILIFSNDINKVSQLALTDLITDSDIQGIDYNIEGNKVIINNFSLEPTCNYRLSYEVIDIYDNHLQGYIEFLVNQSNYPQIPDQEVNHTILQAFYWEMNTGEYATEHPEEANLWNLLAERAPELAEAGFTAVWLPPANKGMAGIHDVGYGTYDLWDLGEFDQKGTVRTKYGTKGELENAIDALHNNDIKVYFDAVLNHRMGADYAETVLLDENSRDKPGQYIKAWTGFNFPGRNGEYSNFTWNGQCFDGTDWDDYSKESGKYLFDEKSWDWTYNWDEDYLMGADVDYENEAVQNDVIDWGQWIINNIDFDGFRLDAVKHIDYRFIDKWMSAVQNSSNRDVFFVGEAWVEDVDDLKGFLDTVGNPDLRVFDFPLRSFFVDMLNGAYMADLRNAGLVNSPGYENRAVTFVDNHDTDRDEGSYTVSIYSRKYQAYAYILTRAEGVPTVYWKDYYIWEMKEGLDKLLTARRYYAYGPGYEVDNNDADIYSYVRSGFPDVAGDGLVLMISDGTSGNVAGKWINSRQPDTEFYDLTGHIKEHVTTDSEGYGNFKVIKSEDKGWSIWVPVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Polyextremophilic alpha-Amylase AmyB from Halothermothrix orenii: Details of a Productive Enzyme-Substrate Complex and an N Domain with a Role in Binding Raw Starch
pubmed doi rcsb
source organism Halothermothrix orenii
molecule tags Hydrolase
molecule keywords Alpha amylase, catalytic region
total genus 194
structure length 585
sequence length 585
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3bcdA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bcdA04
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3bcdA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bcdA02
5A6AA 2QF8A 5GNZA 3WNOA 1WB0A 5AC5A 1C8XA 3OGVA 4EE9A 3BUIA 1E6XM 4WKHA 2F1BA 3DYOA 3UG3A 1CEOA 1QVBA 2DSUA 1Q6GA 1FH9A 1UD4A 3DX3A 1FP9A 1N82A 1NWTA 4EANA 3DHPA 2WC4A 1PX4A 3ALFA 2FHBA 4FNSA 2O9PA 3PBGA 3WY2A 3AROA 4NRRA 1E6PA 4F79A 2NW0A 2C7FA 1DWJM 5E09A 2FH8A 1CWYA 4A3YA 2YL8A 4UZUA 4PMRA 5C8BB 1NOFA 3AYSA 2W67A 1UYQA 5DO8A 3MS8A 2WVSA 2OLHA 3AHYA 4D1IA 1OM0A 3N17A 7CGTA 5D9PA 2J78A 1MW3A 1W1VA 1W91A 3K4AA 3PTMA 4PMDA 2E9LA 5CPTA 4AWEA 1JF5A 2CEQA 3BAIA 4OBSA 4IPLA 1BTCA 2PWFA 2FGLA 1BPLB 3CZ8A 3BVVA 4P7RA 4CD6A 2OMYA 4GI8A 4JIEA 4XV0A 1UKSA 4CVUA 3UG5A 4AISA 3MSDA 4HA1A 4U5IA 4ZXOA 1EDGA 1TVNA 3LPFA 2XJ7A 1D2KA 4FNRA 5I3DA 1E6SM 5HXMA 1GJWA 2EJ1A 2GJPA 4UNIA 3DX0A 3WY3A 1UR1A 3A22A 2F2HA 5HDRA 1T0OA 5A8NA 1W9BM 4D6HA 5E0CA 4CCDA 2OYMA 4L4PA 4AD1A 4JCLA 3PZ9A 1QNOA 4HU0A 2WZHA 2J77A 1XSJA 4HPGA 4CN4A 4DWSA 2VCCA 1HJWA 1JYXA 3FW6A 5CGTA 4WSJA 4CN1A 4ATDA 3T2PA 2BXZA 4W87A 4UFHA 1HJUA 2V5DA 3LXBA 5HOSA 2WYSA 1IV8A 3KL3A 4QAWA 3EMCA 1CGWA 2J7GA 3VIFA 4JKMA 3CZKA 3D5HA 2QLYA 2J7HA 3M7SA 1CXKA 2Y8KA 2WC7A 1J0JA 3ZJ6A 1QI4A 1CXIA 2YA2A 4GPNA 4PCTA 1JGIA 1PX3A 3UESA 4M82A 1KXVA 2ZUMA 5HNNA 3RILA 3HG3A 1TQTA 1V6WA 1XCXA 1C92A 5M3WA 3MUZ1 1HF6A 3ECQA 1UD8A 1PS3A 1E9LA 2XTKA 1QI0A 2ZXAA 1CTNA 2BHUA 1TFVA 4FLQA 4IPNB 5CGMA 2X05A 5BCAA 4AZGA 1E4NA 4AC1X 2YFOA 1CBGA 2D0FA 1C90A 2Q8XA 4PTXA 1TQSA 1NARA 5CLWA 3GNOA 2FGZA 1VFOA 2PBOA 2PB1A 4U5KA 1E6ZA 3A24A 2XVNA 5D4YA 3I3BA 4B15A 2VURA 2FHCA 3WNLA 4PCSA 3WDQA 1FP8A 3ZSTA 5IDIA 1K6AA 5JIWA 3H55A 1NQ6A 5FCZA 1OIMA 2YL9A 4M80A 1DWAM 3SCTA 1BHGA 4AXNA 3AJ7A 3VOCA 1E6QM 4HP5A 3GYCA 4HOXA 3AI0A 1GQLA 1JYVA 1PBGA 1Q6EA 3WF0A 3GXDA 2O9TA 3ZSSA 3VDCA 2WHKA 1JZ3A 5BXSA 1KCKA 1H0IA 5E0FA 3KLKA 3EJSA 1J9YA 3AXIA 3PZIA 3WD4A 3TV8A 2WPGA 3U57A 4JFTA 1V6UA 3WQ6A 1I1XA 1CGXA 5KEZA 4BZYA 1EGZA 3A6OA 4X9YA 1LF1A 2WHJA 1QHPA 2E4TA 1US2A 3ARUA 5LA1A 1R85A 3PN8A 2W61A 3WMBA 4UOZA 3CUJA 2VT0A 3VU2A 2W62A 1NP0A 4UQCA 1GQIA 2OMTA 2QV4A 1VJSA 5HPOA 2OW6A 3MANA 1R87A 5IXEA 1J0KA 4ATWA 1TG7A 2OYKA 3CHCA 4KGJA 2VZUA 3ZR6A 1OT1A 2C9QA 4JKLA 2XYLA 3POHA 1BVNP 3GXTA 1VEPA 3SCQA 4CD8A 2VOTA 2WMJA 1L0PA 2PBGA 3WD2A 5A1AA 3RDKA 3GNRA 1JFXA 4W86A 2WMFA 3VD3A 2CHNA 1QI2A 3RCNA 3FHAA 2W5FA 2Y4SA 3D4ZA 3SCUA 2DH3A 4HMEA 1H09A 4JAWA 1WCGA 1HKKA 2WNWA 5FL1A 1JZ7A 2WCSA 3BVUA 5CPQA 2X2HA 4JFVA 2D2OA 4PSRA 2G3IA 1NM9A 1H41A 3VIKA 2NSXA 2CBIA 3BCFA 4CCEA 4U2YA 1GVIA 1EXPA 1HT6A 2Z1SA 2D3NA 3K8KA 4NZJA 3PZMA 1GHSA 1GW1A 2WCAA 3HU7A 1VFUA 2VX4A 1MFVA 2X2YA 3L4TA 4FNPA 1ZU8A 3W37A 1GCYA 1HL8A 5A8MA 1HXJA 1E6RA 3PZQA 1XH0A 1J10A 3IJ7A 1GOOA 2C8NA 3WUBA 3D50A 4PMOA 3WNMA 2JALA 3WEMA 1E5NA 5TD4A 3WMSA 1R7OA 1M01A 4J3SA 5DT7A 4AD5A 2Y2WA 2BS9A 1UH4A 4GIAA 2VCBA 4PMVA 2XFRA 4W7UA 2XVPA 4W8BA 2F7QA 3TTSA 3L2MA 4AZ7A 3VGHA 3AOFA 3GDBA 5A8OA 2WKGA 4OBRA 1NWUA 2VRJA 1LJYA 1KGWA 1BFNA 3W4RA 1EO5A 4Q7NA 1FH7A 2J62A 1B30A 2WQXA 4W5UA 3LXCA 2BY0A 2E8ZA 4QDMA 2DH2A 4PEEA 2O92A 2J25A 3M6DA 5BWFA 3N1AA 3BVWA 4NF7A 1BGAA 2WWDA 5D9MA 3RIKA 1UQZA 1V02A 4OIFA 3WUGA 2EQDA 1XEUA 1UWRA 3POCA 3VIPA 3OB8A 3NYDA 3VX1A 4GKLA 5I5RA 4NRSA 3IAPA 2UY2A 4TXEA 3KE0A 2YBTA 3FN9A 2GUYA 4FMVA 1E1FA 3IJ9A 2CKRA 2YFNA 3A21A 3DHUA 2X0YA 3AS0A 2XUCA 1UZ4A 1E56A 1JZ5A 3GZAA 2EPKX 1K9FA 2EABA 3CZNA 5GQBA 2JIWA 1KR0A 1KGUA 2FH6A 3VM7A 4HZ6A 5A6JA 1WZAA 1O7DC 2WQUA 4UZSA 2YDQA 2IGTA 1QBBA 2J4GA 2Y5EA 2WBKA 3DX2A 1G9HA 3QHNA 1B3YA 1UHVA 1W2VA 1V02E 3SCNA 4M24A 1JYWA 3OLEA 3CH9A 3EDJA 4KWUA 1CECA 1B2YA 3CPUA 4HPHA 3T09A 1E3XA 1JIBA 3AHTA 1KBKA 2QHAA 2WK2A 3LPGA 1QHOA 1KTBA 1OBAA 3W0KA 1JF6A 2VC9A 3WUEA 4UTFA 2CIPA 1X6NA 2J8FA 4CCCA 4IUGA 1DWFM 3MSGA 2VVNA 4W93A 1OT2A 3LRLA 3WQWA 1Q4NX 2WLYA 1CGTA 1UWUA 4X0NA 4ZFMA 1VENA 1QHZA 3UCQA 4FNTA 1VBRA 3CMJA 4S3JA 1O6SA 1R86A 3M07A 2ZX8A 4BF7A 3PZVA 1NM4A 3PZOA 4PBGA 4MAZA 1QI3A 1E4LA 5E9AA 3ARVA 3BLKA 1TA3B 3WMCA 3VD9A 1HN1A 4MADA 5D8ZA 1KGXA 2ALWA 5JBDA 2ZX5A 2F61A 1E70M 1HKMA 1XCWA 4M81A 1JI2A 4Q22A 4E8CA 3WDJA 4GO9A 3BC9A 2XWEA 4AMWA 3ARXA 3BVTA 4CU6A 1UR2A 1WDRA 3OBAA 1MW2A 3WL0A 3L4ZA 3CZGA 1H6UA 3TOPA 4D72A 4LXFA 4MJ2A 3VGGA 1SMAA 3CO4A 3QHMA 2WBGA 1RP9A 4A3HA 3BMVA 1BYAA 2NT1A 5I0DA 4D6CA 2GDUA 4UFJA 2BHZA 4DWSC 1DHKA 4CD7A 1PPIA 3A3HA 3LMYA 1KR1A 1YHTA 3OGSA 4IISA 3B8SA 4D1JA 3RPMA 3AIVA 4F8XA 4AZ5A 5ABGA 2OSYA 3EJPA 4AD4A 1S46A 2PF0A 1JI1A 3CZSA 1LL4A 1AVAA 3HG5A 4OOZA 3WKZA 3GBEA 2YLLA 3B9AA 2D24A 2VUYA 1V0KA 3TTQA 4D6FA 4QCFA 2ZICA 4OKDA 5CLTA 4C7GA 3WH5A 3BAWA 1UD2A 4UOQA 1AQ0A 3I3EA 4P7QA 2WMHA 3FHQA 2CNCA 1KFWA 3A4WA 3EBVA 3GM8A 4LGXA 4MNKA 2J7CA 3SUTA 3OIHA 2XIBA 3HG4A 4FLRA 4B9YA 4ZEPA 2BNJA 1QOXA 4P8XA 2YL6A 2FDMA 4PTMA 3MUY1 3VGDA 4AD2A 3CZJA 3WEOA 3QGVA 3AFBA 3W27A 3KL0A 4DWSD 1GOMA 4J3XA 2VNCA 3VIHA 4F66A 1KBBA 1X6LA 3CUHA 3II1A 4B3KA 2UZYA 2YDSA 4V28A 4PMZA 2RA1A 4QLKA 1EO7A 4YHEA 2WVVA 3DECA 3GBDA 2GK1A 1R8LA 4AIUA 2DPEA 3OZOA 2E9MA 2WSKA 2VQUA 2XVGA 1GOQA 3ARPA 1UKOA 5A8PA 5BYWA 3OG2A 2PWDA 1C7TA 4UQBA 1ITXA 4PMUA 4Z2KA 3L2LA 1GNXA 3LRKA 1CGVA 2OWWA 3UEQA 4OOUA 4M29A 3S2CA 1SMDA 2X0HA 3PZTA 4TVUA 5LA2A 3OA5A 9CGTA 4P7NA 1CLXA 1TQWA 2PWHA 1JFHA 4WIWA 1OB0A 3W24A 5I77A 5E6YA 1J12A 2DSKA 2VR4A 1X1NA 2ZXDA 3J7HA 2DT2A 1UZ1A 4HMDA 1AMYA 1W3LA 1M7XA 1B3VA 1EA9C 4JFWA 1NH6A 3QHOA 4XZWA 2ZWYA 3AICA 2DGAA 5AC4A 2GJXA 3K1DA 1BYBA 3HJEA 3WNNA 1H2JA 1JYNA 5A69A 1EHNA 3ZJ8A 4MB1A 4CD5A 1BG9A 2WQVA 1KXHA 3ZOAA 4W5ZA 1EDTA 4WJXA 1V3IA 4KGLA 3WQ4A 1ISXA 3U7BA 4RL3A 2VI0A 2XG9A 3VDBA 5GPRA 1CDGA 3ZJKA 3EYPA 5AYBA 1O6VA 2CCRA 2J7FA 4EAMA 1E71M 1IZKA 1WZKA 2QPSA 2OMUA 2GVYA 4CGTA 1E0WA 3AZTA 4GQRA 2BVTA 1BPLA 2XVLA 4Z2LA 3N9KA 1OT4A 3VMPA 2XGIA 3VD4A 2A3EA 3LX9A 3CMGA 3WFZA 2J8GA 1CZ1A 2WMGA 1RPKA 1MXGA 4P8UA 5AY7A 1QPKA 2J47A 3TA9A 5DT5A 3OLIA 3HMCA 3WSUA 4LYQA 2XFYA 5LA0A 2GDVA 4XX6A 1DTUA 3S5ZA 2X8RA 2YBUA 1BG4A 1HNYA 1JD9A 3WH8A 3ZMRA 4J3WA 2WQWA 5D9NA 3QOMA 4HMCA 4W8AA 3THDA 3VVGA 5E70A 4CC4A 1W1TA 3AS1A 3VMNA 2ZXQA 1CXLA 5BXRA 5KZ6A 2BV9A 2RGLA 1HJQA 1UR0A 1VEMA 2AMGA 1VAHA 3VD7A 1CPUA 1GOWA 3CZLA 3ZJ7A 1XHGA 1ODUA 2CETA 2G41A 2JF7A 1TUXA 2QMJA 3WF4A 1B3ZA 1J18A 2A3BA 1PJ9A 2XSAA 2YJQA 2Z1KA 3SCSA 3D52A 4DM2A 2VTFA 3L4WA 1IX2A 1GHRA 1NWRA 3ZT6A 1BYCA 2WHMA 3LPOA 4GZEA 2FHFA 4JL2A 4AEFA 1E4IA 4LQ1A 4RE4A 5JIPA 1UWSA 5FD0A 4QP0A 1QNPA 1ZJAA 3WH7A 3AIRA 1BAGA 3RJXA 2ZX6A 5FOOA 4CVWA 3ARSA 5A6MA 1HWWA 4J27A 2VCAA 3VKKA 1UD5A 2G3JA 4ZXLA 3AIEA 3VIMA 1WNOA 1U30A 3VM5A 3F5KA 5EMYA 4DO5A 3BAXA 2ZUUA 4AZBA 3VDAA 5I2UA 4AEEA 1J11A 2WVVB 3GNPA 2ZX9A 3BUBA 3W29A 3ZQ9A 3IANA 2EAEA 4AW7A 4WSKA 5A2AA 1JDAA 1UA7A 2CBVA 2DSZA 5EFDA 3A5VA 1F4HA 3TTYA 4PSPA 5I78A 3G6MA 2QMKA 1GJUA 1RH9A 2YA1A 1ZBKA 3L4VA 1W32A 3BLPX 3OLDA 3B9DA 2ZUTA 4J28A 3WNKA 3HZ3A 3HN3A 5BXTA 1HP5A 4AZCB 5M5DA 1UG6A 1OGGA 3RM9A 5JUVA 4B3LA 4W7VA 4H8UA 3EDKA 3WL1A 2D22A 3G6LA 3WN6A 1UH3A 1EDQA 3W81A 5FL0A 5D9OA 3WQ8A 1W9PA 1JZ2A 3WF3A 3LRMA 4XUYA 1V08A 4DO4A 1LL7A 1UWIA 2G3NA 3ARYA 2YL5A 3AIBA 4N42A 2WC3A 5CPSA 1XD0A 1ZJBA 1XGZA 2VX7A 2GJXB 2XGBA 2D1ZA 2VX6A 5I79A 4BA0A 1CGUA 1UUQA 1L8NA 1VEOA 2DEPA 1NOUA 4UFIA 1GOIA 3VTRA 3APGA 1E55A 1TCMA 1K9DA 4QCEA 3AS3A 1BQCA 4UFMA 1O6TA 3SCPA 4OJYA 4JFSA 3BMWA 3EDFA 4H7VA 4DUXA 4PTWA 6CGTA 4TVDA 2CERA 1LL6A 1H49A 2BVDA 1PX8A 3WD0A 3WF2A 2AOSA 3EDDA 4PMYA 4CUCA 1WDPA 1B1YA 2VZVA 1OD8A 1LG1A 2D23A 4MDPA 3DX1A 2O9RA 2Y5QA 1VBUA 2D0HA 1MFUA 3AYRA 5A6KA 1CXFA 1JZ4A 2F7RA 3ARRA 1PIGA 1V3JA 3AXHA 2EXOA 3BGAA 3UR7A 4D6DA 2C0HA 3W38A 3GXIA 4Z2HA 3A47A 3IK2A 1PZ3A 3WY4A 4GXPA 1VB9A 5DF0A 2G4FA 4GI6A 7A3HA 4AMCA 1KWKA 4QLLA 2X1IA 4MB5A 4Z2GA 1MQPA 4PUEA 4WKFA 1I75A 2EPLX 2WANA 4ZENA 1TVPA 2WHLA 5BXPA 1W9UA 4AQ1A 1W1YA 4FNUA 1W9XA 3NSNA 3WBEA 2A3HA 2OMXA 1VRXA 2XN0A 1M03A 1PEZA 4HZ7A 3KZSA 2OWXA 5I6SA 4AIOA 3AHVA 4F9DA 3VX0A 1E73M 2UY3A 4D71A 1M42A 1W9DM 3VO0A 3CC1A 3PZUA 1UKPA 1HVQA 2CESA 3KWXA 3KEHA 2CBJA 2V3GA 2UZXA 4EKJA 4V27A 2YDRA 2OSWA 1HL9A 1E1EA 4ACYA 4H8HA 3T2QA 3WEZA 3O6AA 4ACZA 1UR8A 1MWOA 3NSMA 4YN5A 1LQ0A 2CPUA 1XC6A 4KH2A 3K8MA 3SCOA 2D20A 3BAJA 2FE0A 4YPJA 1ZBCA 4CU8A 1V6VA 4LYPA 1C93A 1LWHA 4URIA 1NWSA 1J0YA 1UQYA 1KQYA 4MJ4A 4H04A 2WZIA 2CBUA 3W82A 3WDIA 1FH8A 1HP4A 4J3UA 1EOKA 1J0ZA 1ISYA 1EHAA 4J3TA 5CG0A 4GZJA 1ZL1A 1KXQA 1G94A 5LYRA 2JF6A 1V3KA 1D7FA 5GNXA 4NXSA 4BQ3A 3W26A 1GZJA 1GUVA 1C7SA 1ZS2A 1EH9A 2OMZA 3ARQA 1UD3A 4AZIA 3NSXA 2WMIA 2EACA 1MVYA 3ARTA 7TAAA 5C71A 5F7UA 1KCLA 3N18A 3BUDA 5BROA 2TAAA 3UR8A 3KL5A 1XYZA 2EEXA 3BUQA 3ZM8A 1OCQA 1Q6CA 1E6NA 2EADA 1V3MA 5CZKA 1IT0A 5IFTA 2ZIDA 3VUPA 1R46A 3T0BA 2J79A 2B31A 2XIIA 2J74A 1HIZA 3DYPA 1E0XA 4NZFA 3WBAA 1JL8A 4ZE4A 2ZE0A 1NOWA 1BVZA 4FK9A 2J75A 2X2IA 4C7FA 4FLSA 2ZUSA 4OUEA 3SUVA 3D51A 2VZSA 3B9EA 4HZ8A 2W4XA 2WVTA 1Q6DA 1ISVA 4TUFA 3AQUA 1J01A 4MDOA 1Y7VA 4CKQA 4UR9A 1H1NA 2BVYA 5I23A 1D3CA 3VMOA 1W9VA 2UWFA 3ARZA 1DWGM 3H54A 1WKYA 1TE1A 3MMDA 3GH7A 4W7WA 4UQEA 2PI6A 3TONA 4IM4A 3DX4A 3GTNA 5ECUA 1LYQA 3N11A 4TX6A 4PN2A 1R75A 1E5JA 4L4OA 2BY1A 3RJYA 3DDFA 5IFPA 2XN1A 5CXPA 2HVMA 1CGYA 4P8VA 4LX4A 3N13A 1H0GA 1GORA 4GQQA 1H6TA 4JL1A 2DQXA 1IZJA 5CSUA 4DUWA 1HKJA 4AMXA 3JUGA 1PZ2A 1ZBVA 4D6EA 2E0PA 2VX5A 3EMQA 4N0RA 2F1AA 2XWDA 5ICUA 3EJUA 1QX1A 2G3MA 3GXNA 2OW7A 4P7OA 2WVUA 3I3DA 3S6TA 4QFUA 6A3HA 3SEPA 3MMWA 4AD0A 1U2YA 1UWTA 4ML4A 4TOQA 1W3JA 1HXKA 5ABHA 3MU7A 2PWEA 1KWGA 2PC8A 3RMEA 3WDPP 2YOCA 4K68A 5A6BA 3NJ3A 2J7EA 3W53A 3K46A 3AMLA 2OYLA 2WB5A 3AMGA 1B31A 2YKKA 1QW9A 1KXTA 2ZXBA 1TQVA 1QW8A 4OGZA 3RM4A 1QWUA 1O6IA 1V0MA 1AQMA 4JKKA 5M03A 1V6YA 2JIEA 3WDHA 3T0AA 3VIJA 2EPNA 1CNVA 4LPCA 1CIUA 5ABFB 3L4XA 5ABEA 3GXPA 1DP0A 2YIHA 1MW0A 3EJRA 3QR3A 4PMXA 1RD6A 3NIYA 1E3ZA 2F7PA 3A4XA 4KRTA 2CXGA 5GNYA 1V0NA 2WAGA 5A95A 5EB8A 4D6JA 4ACZB 3AZSA 1HVXA 3VGFA 1DWIM 1CENA 3TTOA 1QNQA 1F4AA 3WH9A 3LPPA 1YQ2A 3AZRA 5JBFA 4C7DA 4D6IA 1HJSA 2VL4A 2IUZA 4H41A 1UH2A 4AYGA 2WSPA 4E8DA 2O9OA 3NDZA 1FA2A 1KTCA 2VVSA 3THCA 3LXAA 1OGBA 1W3HA 2VZOA 3AMCA 5D8WA 4JHZA 1SR0A 1H5VA 3VSVA 3WENA 1I1WA 3CUIA 4HOWA 3GH4A 4QLJA 3SUWA 3AMKA 4MAVA 3VGBA 1WE5A 3F5JA 4FF5A 8A3HA 4BQ4A 2V5CA 3MKKA 1TQUA 1V3HA 3E1F1 1ZB5A 3ALGA 5A6LA 1MYRA 1GQJA 2GK1B 3CHDA 3VIOA 4DUVA 2UY4A 5A94A 3HG2A 1JD7A 5BRQA 1MXDA 1UR4A 3T2OA 2BY3A 3DDGA 1K9EA 1US3A 4M8UA 2A3CA 2GJRA 4FNQA 1O7AA 4HTYA 2AAAA 4DO6A 3CHEA 5IHRA 1ECEA 4TTGA 1JXKA 2OMVA 3OZPA 4U3CA 1JAKA 4HA4A 3BXWA 2CITA 4MTVA 4WKAA 4EK7A 3NCOA 4AW4A 1VIWA 2JFEX 5CJ5A 1G1YA 2G8ZA 4NSBA 1GQKA 3BSHA 3D3AA 3IJ8A 1B0IA 3WIJA 1CXHA 4JHOA 3SIMA 1V3LA 2W91A 3TP4A 1HTYA 2V3EA 3MI6A 5A2BA 1C3FA 4CU7A 2MANA 3PTQA 1Z32X 1RP8A 4MNJA 5DEZA 3DYMA 3BH4A 1MQQA 1E40A 2GSJA 1DEDA 1OWQA 5EBAA 4B16A 1HX0A 4A4AA 4NX0A 1ODZA 4AIEA 2V38A 3VGEA 1LG2A 3FAWA 1FFRA 1C8QA 3D4YA 1FHDA 2CKSA 2E40A 1XD1A 3AS2A 3VSTA 3VPLA 4WF7A 3CLWA 4AZHA 2ZUWA 1XH1A 1KB3A 3H53A 1R47A 3VDHA 3A4AA 2BFGA 4U2ZA 4CILA 2D73A 2DT3A 3PTKA 1PIFA 4U3AA 3WD1A 1HJVA 3WQ5A 2XSBA 5AYIA 3SCRA 2DSVA 1E72M 4F9JA 1Q6FA 1U33A 4W88A 1WDQA 1P6WA 3WD3A 1VFFA 2VR5A 1G01A 4KRUA 4M1RA 1J0IA 1OGSA 3VNYA 4H8VA 1JDDA 2C9PA 2DSWA 3MMUA 4UFKA 3BVXA 5CQ1A 3VIGA 4X0VA 4W8LA 4Z2IA 1XSIA 1GOKA 3O9NA 3FY1A 3GXMA 1UKTA 4UQDA 2YLAA 1FHLA 1SZNA 2WKLA 1OSEA 2ZOXA 3CHFA 1JZ8A 1XH2A 4JCMA 5EFFA 1H4PA 1E4MM 2ZWZA 1VF8A 2BY2A 4UQ9A 2DDXA 1BLIA 3CTTA 3WQVA 2WMKA 5HBFA 3M46A 5A2CA 3CIVA 3NUKA 1CXEA 2XFFA 3AIWA 3WUFA 2WWCA 4TVCA 5A8QA 1M9SA 3BSGA 4LYRA 3MUAA 4NXKA 4PTVA 1QI5A 5ABFA 4Z2JA 1UWQA 3BLBA 1HJXA 2DT0A 1UD6A 1H11A 1GONA 2WCGA 4H2CA 4BCEA 3WDRA 3PZGA 2V3DA 2YA0A 3VD5A 3K4DA 3RO8A 3SCWA 4UQAA 3CGTA 3L4UA 3S5YA 4R27A 3WFLA 3ZT5A 1OIFA 1FFQA 3AIQA 4GZIA 2JEQA 4E4PA 1WAWA 1WP6A 2W92A 1HKIA 3AIUA 5FKYA 4GINA 3UETA 1G5AA 2XVKA 4J3VA 4ATLA 1CYGA 1DWHM 3RM8A 1EOMA 1M53A 2WW5A 2Y24A 2VRQA 4MB3A 1OD0A 3CV5A 3VILA 3ZIZA 3O2LA 1XRVA 1C8YA 2X09A 3SCVA 2XHYA 5FIPA 1V0LA 1R33A 1G0CA 1VJZA 4BS0A 1UA3A 1BF2A 3EJTA 2RGMA 1EQCA 1R7AA 4J7RA 4WLCA 1M04A 1AQHA 4PMNA 2J7BA 2VZTA 1XYFA 1UOKA 4U31A 3U5UA 3AMDA 3WNPA 2WXDM 4P7LA 1QWNA 2IXUA 3KLLA 1B3WA 2XN2A 3UG4A 2WM0A 4MNMA 4TX8A 1JNDA 1WPCA 5C70A 3AHZA 2BHYA 3CUFA 3FXYA 3F5LA 3ZO9A 4NI3A 4RE2A 5DMYA 3MO4A 2JE8A 3U7VA 4PRWA 3ARWA 4D6GA 2C9RA 5A6BD 1K9TA 4AZCA 1JDCA 3N04A 1QBAA 5I24A 1XSKA 3W28A 2WLZA 3OLGA 2WZEA 2JEPA 2OSXA 3A23A 1UR9A 1SFSA 4AYSA 4PYSA 4E2OA 3N15A 1R34A 3PZNA 5CSYA 1EQPA 3WY1A 1KQZA 1CLVA 2CHOA 2DIEA 1TMQA 4FLOA 2VO5A 4P8WA 4W84A 4OZOA 1EIBA 1MW1A 1UASA 2PWGA 2E3ZA 2VJXA 1WDSA 1TR1A 1WO2A 2Y8VA 2X2JA 1H3GA 1JXJA 3NDYA 1BGGA 3MUIA 3U5YA 1B90A 2D0GA 1TA3A 3N12A 4JFUA 1BYDA 4W85A 2E9BA 2ZUVA 3VNZA 1QNSA 4CD4A 1WZMA 3ZR5A 5E1QA 5E6ZA 2D3LA 2GFTA 2DT1A 4TTUA 5A3HA 2XM1A 3AHXA 2XPKA 3EMZA 4AZ6A 4PUDA 1ESWA 2W63A 4YHGA 2OWCA 2EPMX 3FNDA 4Y7EA 3K8LA 1ZBWA 1W2PA 5IHSA 1B3XA 3CBWA 1E15A 2EPOA 4AD3A 5DFAA 1A47A 3EJQA 2UY5A 4S3KA 2ZX7A 1A3HA 3QOKA 3WF1A 4GI9A 1ITCA 2W66A 1MQRA 3L4YA 3DC0A 1VFMA 4AY1A 4MPKA 3WH6A 4UFLA 3W6MA 4W89A 3T0DA 4DWSB 4MB4A 2VMFA 4DM1A 3OGRA 1GPFA 4UCFA 4CC4C 4M56A 1FOBA 2QPUA 2ZUNA 2ESCA 3MV11 4HOZA 2EO7A 8CGTA 4NZCA 3BAKA 2HISA 4HA3A 1J0HA 1E43A 3AISA 4GO8A 2V3FA 3WELA 1W3KA 4XZBA 2F7OA 3SURA 3MV01 1ISWA 3BUPA 3W25A 2CYGA 3CZEA 1XV8A 1BSIA 3VSUA 2F8QA 4HU8A 3AXXA 1OINA 2IXVA 1UKQA 5HPCA 2VRKA 1JNEA 3IAQA 3W6LA 4R5EA 3SUUA 3SUSA 4B9ZA 2VQTA 2DIJA 1C91A 5JBEA 4JZ5A 1JG9A 4MNLA 3VINA 1ISZA 3IGUA 4V2XA 1LWJA 1LLOA 4UOJA 4RE3A 1JZ6A 6TAAA 1WZLA 2BXYA 1B9ZA 4XB3A 3BAYA 4ZE5A 4BQ2A 4BQ5A 2XM2A 4PMQA 3CUGA 2EBNA 1SYTA 3BCDA 2F18A 2FYVA 3FAXA 1NP2A 1W1PA 5BRPA 1TZ7A 4CN6A 1V03A 3UERA 1QNRA 5A6SA 3ZT7A 3GXFA 1GVYA 3F4VA 3EDEA 2A3AA 3BZ5A 1PAMA 2OMWA 4U33A 4WK9A 5M17A 2J7DA 3GH5A 2E8YA 1E0VA 2WMIB 2NT0A 3VIIA 3PHAA 3T08A 1JAEA 4KMQA 1V6XA
chains in the Genus database with same CATH superfamily
2Q09A 2QVMA 5EA0L 5A6AA 3UZWA 2EUXA 4MYUA 1MF2H 1VQ7B 2QF8A 2F54A 4UIMB 2ZOLB 4XE0A 5LGKA 4LCIL 3VR6A 1MNSA 3QEQE 3NPSC 1CC3A 1SBSH 5FB8A 4YLCA 5DD1H 2QCHA 4DKAA 1C8XA 1XGUA 3APFA 5I8KH 1DQUA 2RDWA 4TQHA 4C6DA 2BWGA 3CB4A 2HKFL 1L9MA 4WKHA 4A7TA 5D4QA 4NKIL 5AKQA 3TUUA 1U91A 3UG3A 4LIQH 4N6RB 2XA8L 4FA7B 4QITA 1XWYA 5CWSB 2XA3A 2JB6A 4NAJA 4GUOA 5I0XA 3TMQA 1Y6NR 1DQXA 3QORD 2Q71A 3G2GA 3IJIA 4CC0A 3UPBA 1YMHA 3FFCE 3VFCA 3QGAC 1OTUC 4P2OA 2PTZA 2WKOF 1P4BL 2DQIH 2KHAA 3PP4H 4I9XA 4NP4H 4WWKD 1UD4A 4WY7H 1LK2A 3WS6C 3EPNA 3O4LB 3EHBD 5E6ID 2JKAA 3DX3A 4FHBD 3QK0A 1H8HA 4OCXH 4P9HL 3SGJC 2VWEE 1FP9A 5I1AB 2GTZA 5FFLA 1NWTA 1VS1A 1W1ZA 2WC4A 1OQXA 4R5VA 1UUSA 1R3YA 3ITOA 4AHQA 2POTA 3MJ9A 5AVSB 2O9PA 4FXFA 1NPJA 3LNPA 5DY3A 1BX0A 1J9CT 3BJ91 3RFZC 3WO3B 3EOEA 3WKYA 4ZUSB 4LCCC 1VPYA 3E6EA 3VFPB 3PAJA 5U7SA 4XBSA 1E6PA 4NPYB 2OEKA 1JPTL 5LNVA 2QKFA 4PZVA 4F79A 2C7FA 4ZUUA 5C92A 5IROC 1SSGA 2BGNE 4O1CA 2C9XA 1RZJC 1CWYA 3DGDA 1XINA 5C07E 2WV8A 3FVDA 3LD5A 5F6HJ 5IM7B 3O2DH 4JKWA 2VH5L 5IG7B 2BGSA 2WO2B 4YSEA 5DJ2A 1UCWA 4C6QA 5DVOA 2GSIB 4X4ME 3IIVA 4P5TC 4MD4B 5HD8D 2MCG1 1QOQA 2FDSA 2KZWA 4LT7A 1A3ZA 3GQYA 3C52A 5DXXA 3H4HA 5DRIA 5HBBA 3RTQB 2EYTA 1V7NH 1QNIA 2WVSA 3LNHA 4KXCA 4NQDA 5C0CB 3PL6D 1VPQA 3WKQA 3EYSL 5FO8B 2OLHA 2D7NA 4R3SB 1MREH 3AHYA 5J7CC 1ILSA 4YDKL 3V7AE 4OD1L 4LUSB 5D9PA 4ONFL 4EX4A 4X0KB 1XWVA 3FTXA 1W91A 2G4EA 3N85L 5A7EA 4JBRA 4WFFE 3NSDA 4L23A 4WY0F 1E8WA 2IFFH 4PGEA 3P81A 4K9EH 3NYKA 2BRQA 3EGSB 3ATZA 3U9WA 2WO5A 3U4BL 4PFMA 5CDFA 2X4RB 1JF5A 4M43H 1H3UA 4XOCA 4PR4A 3T78A 4EKXA 4KEVA 1A66A 1IM9B 2JB5H 2E4FA 3NAAL 4POZC 2DMKA 3UC0H 1NTHA 4S2CA 1BPLB 3ASTA 2ARWA 2R0ZL 4LSUL 4QEGA 2AAMA 3BVVA 4JJHA 2A3BA 4P7RA 3VKJA 4ACAA 4CD6A 3HG1A 4PJBF 4EIBA 2RFXB 4XV0A 1UKSA 5IJCC 3UG5A 2X88A 1VZIA 3D1MC 5IMMA 1KMGA 1EJTC 3N3MA 1OAQH 4U5IA 3WLKX 1CI1A 2OG9A 3GZQA 2C6QA 4GBXD 1QABA 9RUBA 4XGZB 1TVDA 3LKQA 1E6SM 2DV0A 1AOZA 2VJJA 3W88A 5DD0H 4AZUA 3K71B 3EPOA 2IMMA 1Q6LA 4CQAA 3CFKB 3BO8B 4MCNA 4DP0X 2GJPA 1WUFA 1X9UA 1F4WL 1UR1A 1KYOJ 1FNFA 1YC7A 32C2B 1TJGH 3MZTA 1OC6A 3MY9A 2LFGA 1W5MA 4C6EA 1TSHA 2WTRA 3EZ4A 2EE9A 4DEPB 3R12A 5A8NA 1E0TA 3KH4A 3CJPA 1CQYA 2VWEC 3Q2DA 1J1XH 3IT8D 4TMXA 1JZGA 3LDBC 3ZVIA 3P4NA 3VXSE 1N8FA 2X4SA 3FB8A 2W9EL 1TX0A 2AGTA 2OYMA 2AQ3A 2CGYA 5DJ0A 4MBRA 4ZDHB 2YCKX 3H7BB 4WDIA 1A9EA 1A3LL 2DD8H 4JUSA 4Q2ZA 4UUJB 2IV8A 1E9QB 1NZRA 4FXGA 1HC1A 2J77A 3G5EA 3THQA 5D6DA 3TT1H 2QCMA 3CQHA 3TQPA 2DQFB 3QBTB 1NGZB 3BDBA 2YPKB 2Z6FA 3FW6A 4W70A 1JJKA 3ARDA 3C6LA 1QU4A 2OQLA 3B40A 2IDFA 5EZIH 3HPFA 4W87A 2XWTA 2HEJA 2IH1A 5M94B 2BSLA 1A49A 3LBOA 1E28A 2GW5A 3IEAA 1K6QH 4EACA 4L0ZA 3B8WA 3TQ0A 2DEXX 2VFHA 4GAJL 2X1RA 5HOSA 1AZ2A 3JS3A 1MCWM 1CGWA 5HGBB 3ARBA 3MFFB 3O2VH 3NPSB 5FF0A 4BUHA 3D5HA 2QLYA 3GFXA 3ZWSA 3ENEA 2VAJA 3M7SA 3NSCA 1CXKA 2B5IC 2IQAB 2WC7A 1F4XH 4C6MA 2GQ3A 3BESR 4TVPL 4YEFA 1ECQA 4HJUA 3V4LA 4NJJA 3ZJ6A 1QI4A 4Q9QL 4GRMA 4YXLH 2OEMA 3M0MA 3Q8EA 2Z8SA 4OSUL 4GW4A 2KAUC 4GPNA 4XK2A 1GZPB 1LO0L 3WBJA 3QEQD 2D69A 5HWJA 3PFUA 1JGIA 4E68A 1XGQA 3GUWA 4X6FB 4M82A 1TPUA 1CFVL 3A1PA 1UM5H 2YDAA 8XIAA 3HG3A 4B9GA 4DJEC 1EEYB 2Y9RT 1DEEA 3AY4C 4JG1H 3VXNA 4XOBA 5ADOL 3EOYG 5BXFB 5IT2L 4UNLA 4Z17A 1RQ5A 4XBMA 3FU7A 1E4XI 5I9QC 4E0RB 2WR8A 1XCXA 1KD0A 1QTPA 2IGFL 2XY2A 4M5TA 2QAFA 1GVHA 3VH8A 3MNWB 1I8MB 1A7OL 2FT7A 2Z91B 4RCAA 2RH9A 1EMTH 3UA3A 5IBLC 1D7CA 3ECUA 3E80A 2IBGA 3S3PA 3WO4C 2BC4B 2XTKA 3GUGA 1LLWA 2ZXAA 4HSCX 3I02A 3O05A 1CTNA 3GO2A 4Z2LA 5F4SA 3N91A 1TFVA 1QO3B 4TN9A 5MI0B 4MSSA 3T8XA 5BW6A 4UM9B 1K3UA 2VKZG 1N59A 3WFCH 5D30A 4MMYA 3TN0D 4KXDA 1UOVA 3MO1A 4AZGA 3WFBH 3GDTA 4R90H 3S42A 2IW0A 1CBGA 3W86A 3MV9B 4YCOA 1P5VB 1KFAL 4HKJA 3DTDA 4OZGA 4PCYA 5F9OH 5GGVL 1ASPA 3UDWA 3WTYA 1TVHA 1F3EA 1BYPA 2HA1A 2ZL5A 4KRPC 4X2UA 4AJWA 2Q8XA 2VMDA 3FU6A 1ACZA 3PL6C 3E3QE 4GMTH 4DQAA 4X6DE 5C2UB 1P1XA 1VZHA 2ZF9A 4HN4A 4N2IA 4Z7NB 2FGZA 1VFOA 2EE6A 2R83A 2A0LC 4B97A 3IFOB 4U5KA 3UWVA 5D4YA 2OP4L 3MNDA 2ADFH 2FJUB 2I85A 3I3BA 2ARJQ 3CL7A 3MHUA 5FAAA 4IL0A 3KPSD 4MA8H 3CHPA 2IC2A 4Q58C 3QDME 5E99H 5IQNA 4PLJC 4Z7WF 4YSOA 1DPMA 2TPSA 5DVMA 5B3SB 1MIEL 3I7QA 4L4VD 4DKEL 2CC2A 1I7RB 2J4WH 3JWOH 3LKOA 1MSPA 1UXWB 2MUCA 3B9OA 2HJFA 1WICA 3C0LA 3KPSB 3HEIB 4LEOB 3LOWA 1DFXA 5EMJA 5BWAA 1N4XL 3NSJA 4KTYA 4IMGA 2OX5A 4JN2B 3J8F7 1NF0A 3AJ7A 3DX9B 4GOSA 5KVEL 4P3DA 4P5RA 1YMME 2QDVA 4UIKH 4HOXA 2YD5A 3T8VA 1C5BH 3MV8E 4RMSA 5IBTH 5TPWL 1KYFA 1F07A 1RA5A 3LENA 3SE9L 3UVAA 1PBGA 1XLAA 1Q6EA 4ZXBC 4XAKD 4WI0B 1XRSA 15C8H 3KM2A 1NBZB 2O9TA 2QCGA 2QIWA 1TEGA 2I9EA 1GK8A 2JB6B 3T6QC 3G0SA 3CPWB 5I15L 2V69A 5E9DB 1JZ3A 1Z3GL 1TTAA 5E0FA 1HZKA 3IDIA 3H94A 3HMJG 4AIXA 2DY1A 2FO4A 2J1WA 3ESNA 4ZSOE 5EUKB 2WKJA 3SEJA 2CHDA 2J3SA 1MHHA 3EOAB 3WD4A 4D6FA 4N2GA 1IB0A 5EBLB 3U57A 4WUKL 3W70A 5KZEA 4IRZL 3AWNA 1K4CA 3D6NA 3EWZA 5CBBA 1TU2A 3Q1SL 3NP3A 2WHJA 5C86A 2OI9C 2QDXA 1QHPA 4FN5A 1ZSHA 2BW4A 1US2A 3RNDA 3STPA 5LA1A 4QT5A 5DC4B 3PN8A 2LU7A 5IMOB 2CZFA 4XPFH 3WNIA 2HLFC 4YBQC 3CUJA 4ZO8A 4XSMA 3ESPA 3QFRA 3VU2A 4ALAL 2OJZH 5DUPL 2OTWB 2GUOA 3U6RA 4UQCA 1GQIA 5D02A 4ZUUB 5KW9L 2C3VA 4Y2NA 5BRZE 1DTNA 1GOXA 4FP8H 1A1NA 1R2SA 5HPOA 3HUJF 1RUPH 1KC8D 1Z5YD 3QEGL 4R4ND 2OW6A 3UBXA 2O4MA 2OQYA 2DLGA 5IXEA 3ZYJA 3AXKA 4B90A 2OYKA 5F1NB 3CHCA 2WIIB 4OZIE 1U8KA 2R51A 2R0KL 3E02A 4QD2E 3VXTB 3FK4A 4DNRB 2ZCKH 3W1QA 3SE8L 1I9JL 2C9QA 2Z31D 4JKLA 4QXGL 1EHXA 3BSMA 3I9GL 4XOPA 5B39B 4ZNEE 3WTUA 1VEPA 1YKWA 5JDSA 1J8KA 3PA1A 4XNQA 5T1LB 3Q7JA 1G7LA 1DZ0A 3R06B 2WGNB 3DUUB 4RFOL 5D7KE 1EP2A 2PBGA 3KXFE 5BZWA 1YEGH 2J6EH 4KZCA 1U8NA 5EORH 3WX7A 5F7KC 2DYPB 4ODSL 2YZ1A 3VRLE 4X8IA 3KVJA 5KBKA 5CAHA 3VD3A 2PTVA 2X6YA 3R4DA 1A53A 3JW7A 3RCNA 3F83A 2Y4SA 2NNAB 3FHAA 4IRSC 3BCJA 3SCUA 2DH3A 1F7BA 3OKXA 4MASA 5CPNA 1B2RA 3EYQC 5EORL 4HMEA 4P4KA 3TO4C 4ES9A 4TOYL 1H09A 1VFAA 5FIUA 4B3XA 2NY6C 4JAWA 2NQDA 2JKIS 3HUJB 4LCCB 4F3FA 4HKXA 5F2MA 3UWQA 2C1IA 2BSED 4KWSA 4Q4KA 3CAKA 3DFTA 4JM2D 4EN3A 3MWAA 1I9JH 3GVVA 2EPHA 4ZA0A 5AKVA 3MKCA 1ZGLM 3V4UH 4NC1C 4AG0A 1KK3A 4XAWH 1L2QA 2HT3D 2R0KH 3CSBA 4WEUD 5DJZB 4TQPA 1F0LA 3QNYB 4LMQE 4JG5A 3VWJA 2W27A 3AQYA 2A9NL 2D2OA 3W00A 1RUPL 2G3IA 1N64L 3GRBA 3IU3A 1MPAH 4NN6B 3S2AA 5E00B 1PZBA 1H41A 2A7PA 2VXSL 3O6FD 2CO3A 4PBXA 5EB9A 4Y19B 3BCFA 4CCEA 4Q6IC 5EN3A 1B0GB 5E6UB 5DN1A 1H7NA 2D3NA 1BXXA 4MYWB 3KXQA 4GBDA 5AHNA 5HMEA 1LUCA 3PFQA 5BMXA 1PAZA 4GB9A 1FH2A 2AQOA 4DN4H 3HU7A 4C6CA 2CKNA 3PWJA 3I65A 1QWKA 4IBUA 4XMPL 1X96A 2JQZA 1VFUA 5E4EB 1A2YA 4ZNCD 1YMYA 4NZRL 1EV2E 2X2YA 2A6IB 5AC8A 3L4TA 3NFPA 1SJBA 3GSQA 4PB5A 5LNEA 3QJFA 1JPSL 3TCLB 3GG1A 3Q9PA 1BX1A 3W2DL 2VYOA 3QFJB 5A8MA 1NGZA 3B8TA 3LB0A 3SD2A 5I6XB 1IEQA 5K1NA 1URZA 5ANMB 4CQ8A 3MP3A 1Y1UA 1LBLA 4ADUA 2AV7B 3D50A 4GRWF 4WEBL 4X7TB 1LLZA 4PMOA 1QPXA 3S34H 4N6EA 3UJ2A 3MTXA 4FX8A 4ACBA 1IBYA 4KFNA 2HJKB 3CASA 4CQJA 1Q9WB 1HYSC 4HPXA 4E4UA 2XQYA 1M01A 3B8VA 1HOCB 1T6VN 1PLAA 1YEJH 3U46B 3JU2A 4J3SA 1KLGB 1A0EA 1ZWIB 4AD5A 2Y2WA 4HIJB 1QSED 2X4NA 1V08A 5M7QA 3M0VA 1DANT 1WISA 5A7BA 4LHUA 4HUWA 3H9SD 4KVNL 4APQD 5EO9A 1A3XA 1QUMA 1JRBA 4JS7A 4W7UA 1LG2A 1QFZA 3FCGA 3CUZA 1J86A 3F03K 4Z42C 1ETB1 3RNKA 1SYVA 3NJIA 5L0QC 4Y9PA 3VGHA 2Z6BD 4J4PA 3O2DA 2DWDA 1HJCA 4IX0A 4YK4B 3STZA 2QZRA 3GSNL 4JW3A 1VDGA 1JFQH 2PUQT 2PYEA 3GDBA 2BIHA 3LMJL 3MV8D 3P9WB 3S96A 1TJPA 5A8OA 1FNEB 4BQ8A 1DJXA 1JGDB 5JXAH 1BA9A 2WKGA 1EEYA 1XB3A 3FDWA 4XAKE 2CLHA 2KVOA 1DQIA 5IBXA 2LLNA 1FSKC 1QVGB 1AFVL 2HSIA 2Z9TA 3GRWA 3IE9A 4Y8AA 5DURB 4ELMA 5J89A 1KGWA 3C5ZB 3FU0A 3DXAE 1EO5A 3QIBA 4Q7DA 1BFNA 1SFLA 3ZUGA 2VDLH 3K30A 4WQ6A 4P4KC 3TO4A 2JIZA 4GZ7A 4W5UA 1GY1A 1FX0A 2ZAIA 3AG1B 4NYLB 4JFXB 4OFVA 1AG1O 2AMUA 4QDMA 3O8XC 2B1OA 2O92A 3QWRD 4O5LL 4G1KA 3SJVE 3ZDZE 4REQA 1VERA 2MNWA 3L48A 1CT5A 3IRCA 3Q6GH 1BWVA 2EDKA 1KFLA 4NO0B 2BGJA 2O6PA 1BGAA 2E6QA 2OGJA 3UJJL 1AKJD 4U05A 1T1WB 3RIKA 3SBRA 4C83A 1UQZA 4DVOA 1HDMB 5DLML 4KKCC 3WLOA 4MY9A 3GHSA 2EQDA 1NIBA 3KW8A 1OK0A 4DZBB 1J6OA 1GEHA 3GXUB 1OP3H 3OB8A 2HB0A 3PG9A 3VX1A 1JE6A 4GKLA 4LL9A 4W6WB 3B4YA 4GWEA 3V0UA 3ZKND 4HAKA 5I1LA 2ZC8A 2QQQA 3G5VA 1M6JA 1KOAA 2DYIA 3KE0A 3Q1SH 4O11A 3RUBL 1MRDH 5PAZA 4G8GD 3FN9A 4PV8B 2YBTA 3ZVHA 2R1WB 4MLIA 4XWGH 4FMVA 4XXCA 4X8JA 1H1YA 1UM5L 5I5MA 3KWSA 4YELA 3E7JA 5D1XA 1FO0L 2X0YA 3AS0A 1MCEA 2AV1B 3UP8A 4DELA 3ILDA 2XUCA 4DP9X 1JPHA 2D7TL 2HXAA 3NPUA 4PUNA 3ZZ0A 4WGXA 1IE4A 1LP6A 3G8EA 1YNPA 4FNLL 2V6HA 2EP6A 3QDJD 5ITBH 3QYMA 1RZIA 3FTGB 3DX6A 3ELAT 4XO6A 3WBXA 3O7UA 1TLLA 4AE0A 2EEDA 4AG4L 2X2GA 1JK8A 4XCYA 5D5MA 3PUNA 3UPRA 1KPRB 1C5BL 5TPWH 4IMAA 3VM7A 1GIGH 2K7QA 3N44B 4PJ5A 4IOTA 4MYAA 4JX5A 2UZIH 1SO3A 1ADQA 4Y8DC 1ZTXE 3Q39A 2IGTA 1YTEA 5FYLH 1GA2A 5IEKB 3KOFA 3PREA 1EBPA 5HGHA 3SGUA 1I9IH 4JM4L 4WZKA 1ZTVA 2VBUA 2IH3A 3RWFA 1V02E 2A74A 4XORA 2XNAA 3FSWA 3NRFA 2M5SA 5FEBA 1QOKA 1JYWA 2VRAA 5I3KA 4DAFA 5DJYB 5CD5D 4NKDA 1DLFL 3LCGA 4FO4A 3NJXA 1MJJA 3EDJA 1S4IA 5HGGS 1G4TA 3HGOA 2FTPA 2D2GA 1HOEA 3H4XA 3IGSA 1EBGA 1FO0A 3M16A 4QGYA 3ZDZB 4B9JA 2CO2A 4HF5H 3GSMA 3SSGA 3GPEA 2P5WB 2BVQB 4NI6A 4BH8A 1KBKA 4P6VF 1N6UA 4BZ1A 4JY8A 2QJJA 2WBJD 4WEMB 2NXZD 4Z7UA 3R8BB 4MM1A 4QR7A 4KKXA 1KLUA 3W0KA 3HS0A 4RISL 2X53A 1GVEA 3W7PA 5DUMH 4KTGA 2GDQA 2LHAA 2H26B 5JHDB 1U92B 5EF3A 1JGMA 3WFEH 4JEQA 1KG0A 3TXAA 2CIPA 2Z31A 2BO0A 1A4BA 5D2LE 3QISA 3IVKB 3KYMB 3LJ3A 5E23A 5TE7L 1I4FB 2NY3B 3CDYA 3PNWA 1PFOA 1EC9A 1T96A 2D4DA 2YQ2A 5GS2D 5CEZL 1BZ7A 1HL4A 4MNHB 4YMZA 3O11A 3TJPA 3UNTA 2YKLL 1IEVA 4U6HA 2VP8A 4GJJA 4LANA 4MXWL 1ZALA 3C8KB 3EX2A 3LSOB 1OSYA 4HSOA 1JWSA 1IIKA 3DVNB 3UJRA 2QKIB 1L6PA 3FTVA 4NIYE 3TYCA 1FWIC 3R0UA 4FNTA 1AGCB 4HS6A 5H35B 3NVDA 3UR5A 8TIMA 1O7DE 1FVEB 3PHOA 5TRDA 1KN4L 4JE4B 5D96C 1TPEA 5HJLA 3URQA 5DHVB 1N3NA 4N20A 2HCVA 5TDNA 2QPXA 2DIAA 3R06A 1V4YA 1NBYB 2OV0A 2ZX8A 5LUMA 3KVDD 4LEXH 3F00A 1IFRA 4A39A 4P23C 3BZEB 1E27B 1VKXB 1KJVB 4LP5A 3MBDA 4JYEA 4PODA 2CHXA 1XIBA 1YNQA 3ARVA 3UX9B 1OX5A 5J3HC 4RV8A 3WXWL 1KEGH 3EFFA 1OWRM 3VD9A 4J4PC 3VI4A 2R6HA 5BMFH 4WEBH 1KM3A 2HMCA 1PS9A 2LW3A 3H85A 2QTLA 3MREB 4ONFH 5BRZB 1P5UC 1F3WA 2PDUA 4N28A 4KKNA 3AY4A 4LMQI 4MJIB 1JNYA 2ALWA 4PRHD 3OF6A 3LKRA 1A6ZA 2ZDRA 2F61A 1WS7A 3AVUA 1L9NA 4HFWA 3GSXB 5TE4H 3QJTB 3UO1H 4PTDA 4JAMA 1ZUNB 3LQ6A 3C2AL 1M68A 4M81A 3QJUB 4RH4A 1HSBB 1GVFA 3MODH 4KKTA 1M7DA 1KK0A 4DVBA 3MTWA 3P02A 4HUUB 4UTAL 2Y85A 3B2UC 3NURA 3T6ZA 3GSWB 2R2BA 4XPTL 3DK0A 1K70A 3PAVA 4GSDH 4HWZB 2IWKA 4V11A 4N8CL 3WFDH 3WDJA 3CG8A 1EPXA 4PBFA 4HLZH 2AJYH 2P44B 3X12A 1HGYA 2ZYRA 4MMXC 4AMWA 4UTTC 2K4AA 3BVTA 1LOQA 1QPNA 2XG5A 4WD0A 3OQEA 1OB1A 5AVWB 4OTXH 3TA3A 3WN5C 2ZL7A 2B39A 1DV7A 2QCCA 2TODA 3OBEA 1MW2A 5G55A 2E1RA 3LMZA 2A1WL 1X1ZA 4F0LA 4MY1A 2YSWA 3LKPA 2ADIB 1P7QB 4NBZB 5CN1A 3QJFB 4ZYKB 4C4UA 2BZNA 4D72A 3F12B 3VFUB 4DLFA 4YYFA 1OCRB 3H9ZA 2R0LH 1Z6KA 4P9HH 3TK7A 3QFJA 5FHBL 1EXUB 3WYAA 2FJHB 4GUPA 3BMVA 2PKDA 4WY7L 2ED8A 1FCVA 4LW7A 3SY1A 1OO2A 5J6GB 5BPPA 1LQSR 2BHZA 3D2TA 3ZDWA 3LM7A 3E1YE 2Z7UA 1F3JB 1ZPUA 1I31A 1CB7B 3O63A 1I4NA 2WOYA 2EVJA 1KR1A 1YHTA 4IISA 2HJKA 4XNDA 3B8SA 1AIZA 4JLRB 1UROA 4ZAKC 4PMQA 3SSZA 4YE0A 5LWYH 1OABA 2BSRB 5AAWC 2IBZY 3CHSA 5KANG 1CK0H 1X5LA 2UY6B 4I0PB 3UYOD 3UZVB 3VG9B 1U1UA 2CLIA 3KFTA 2RKXA 3VWJC 4UOW1 1S3TC 3N2OA 4XT1C 1YBQA 2XXMB 1BP3B 5D1QD 2ZXCA 3ZLHA 4NQ1A 1NDGA 3CZSA 3RL1B 1LL4A 2MPVA 1AVAA 3HG5A 3MLXH 1Y1DA 4NRYB 1B6UA 2OTDA 4Z18A 4OOZA 4Y5YA 5KOVC 4QEHA 1MXSA 3OAZK 3W9DA 1G6CA 3GBEA 4AH7A 1NEZG 4H0GA 5DHEA 2PSNA 3B9AA 3QLLA 3QI9C 4PJFA 3B4UA 3TZNA 3VG0L 2M83A 3QEGH 1T4WA 3E2HB 4CSSA 4EMZA 2Z1PA 2CH8A 1SF3A 3DERA 4HSNA 1CE6A 5HAOA 4GIPD 1K5NB 4F2TA 1CLCA 1H42A 4QCFA 4OKDA 3RLHA 2YD6A 5CEZE 3TN4A 1GS7A 5EF0A 4DYJA 4KV5E 1FPTL 3C5ZA 3BAWA 5A16B 3WH5A 4GFSA 1AW5A 1AQ0A 4KWWA 1PEWA 1LM8V 1V54B 3MGTB 3CCEB 1MUWA 1N05A 2VNIA 4XNAA 1Q4WA 3CZFA 3A4WA 3GM8A 4RGNB 4LGXA 2L8AA 4JDZA 2XV0A 2J7CA 3SUTA 2G2RB 3DJRA 3RZCB 4S38A 4EOWH 2FATL 2PR4L 3LZFL 5HDQL 4JM2F 2FIRT 4FLRA 4O9HL 1T1YB 5FO7B 2V2XB 4PRTA 4ERAA 3M1CA 3TEXA 2Z6JA 3BP5A 1BMGA 3OF6D 3KWUA 1DJIA 5IMLB 4C83B 5T3ZH 3QUZA 3CV2A 3TCEA 3ZE0F 4EIUA 2ZCHL 4X7SH 1VADB 2AQWA 3B9KC 2Q5BA 4DZBA 2H3BA 5JXED 2IPGA 3VKAA 2KDYA 2AK4E 1GOMA 4J3XA 4O2FB 3OQ3B 4B9PA 4J5NA 4RE0A 3VIHA 1KBBA 4PUKA 4DGVL 3DOPA 3CUHA 5FJOA 1JCNA 2PW2B 3II1A 4PYGA 4H83A 4PU2A 3CCHB 1TZZA 1D9KC 4RPPA 3VRIA 2BRRH 3QRFM 5TDPA 4V28A 3W7MA 5IB2B 4QLKA 3L9EA 2QL1A 2I60L 1E4WH 2P24B 4YXKL 3U2SB 3DO7B 3AVXA 2YD2A 3LH9A 4OKVA 2BP1A 3DECA 4NWTL 3SDXB 4ODHL 4II2A 5LCVL 1JBJA 1G7RA 1MQKL 3GAYA 3ZC3A 4B91A 1U8OB 5DTFB 3QZAA 4NY2A 2CKBA 1KIPB 3S3DB 4AFYA 3BUTA 2E9MA 2ZNXA 2O5XL 2F54B 4C6OA 3TW7A 2VQUA 2GJJA 3FRPG 1KPRA 5SWSB 3OJGA 4IF2A 3W2EA 3JQOB 1B4EA 4IYKA 3FN0H 4GG8B 1SBSL 4IU2B 3G9VA 2NY5H 1EJFA 1MRAA 2ZYFA 3KPOB 3VO1A 3GZ3A 1C9SA 4D9LH 3OG2A 2PWDA 4UQBA 3JQQA 5B7FA 3K7UA 2VD8A 3M4HA 3IWVA 1WIOA 1MRFH 1JXDA 1S5TA 2QHLA 2A3TA 3QAZC 5GGVH 1L6GA 4M29A 3SYOA 1KM2A 4ANUA 4S1DC 3E6FB 4H26B 4XVUD 1SEBB 1SMDA 4JDTH 4J4PD 4KUCD 5DR5L 3QRHA 4LF3B 1J8HB 9CGTA 4P7NA 1CLXA 1D6EB 2K8QA 4GW1B 3Q65A 4WIWA 3HE7A 3OKNA 4PS7A 4LVOB 3DVGB 3W24A 1QLRB 1O9VA 2ISDA 1G1CA 4NJGA 5I77A 3UXFA 3WLWD 2X6WA 1D9EA 4G42B 1D5RA 1UZ8B 4XTDA 1PKQE 5DVNA 3B43A 1KKOA 3D3FA 3LQAH 4ZUSA 1UZ1A 4MYPA 1KG0B 3CQQA 1HKFA 5GISH 3NJHA 5TE6L 5C09B 4OF6A 1AMYA 2A6NA 4MWAC 3SQSA 35C8H 1I4FA 1M7XA 2PPCA 3QIWB 4E9SA 3TU9A 4PJ7F 1J5SA 1IEAA 4G9PA 2CF4A 2FZ3B 4PW3A 3L5XL 3SZ6A 2F38A 2G5RA 4L8JA 3HO8A 2ZWYA 5FM5M 4QE1A 4XZWA 3SYPA 2X6CA 3HA1A 1Y0EA 4LBRA 5EH1A 2VUKA 4MD4A 3NTCL 1A6VL 1RJZB 5KVDL 3T4YB 1H2JA 2VIRA 5ISZA 3GHBL 4JFFB 3G6AB 1LEIA 4JGNA 1JQXA 4DWDA 3RTQA 1Q94B 3BKML 2V7XA 1NF7A 1NDVA 3DAQA 1FRQA 3WSQH 4DZIA 4Q9QH 4MD0A 4AI7A 1R3LB 4X50A 1BG9A 4V2CB 3M17A 2BJMH 4KGLA 3B03A 5HDOA 4HJJL 2RC5A 2AEIT 4GT0A 3X3GH 2O61B 1ISXA 1G7QB 1PNDA 1VQLB 2F7IA 1DUZA 2HTLC 4PB9L 3CCJB 5TF1H 2CLZB 3CYJA 1X7QA 4MSWA 3CK5A 2GBAA 5I6KA 5GPRA 3T6WA 1CDGA 3ZRSA 2HK0A 3L5LA 1SLWA 1A0DA 1Q1JL 1GPWA 3KOXA 1K6QL 2VM9A 4JY5L 1K8AD 3NFSH 1E79A 1S7RB 5K59E 1IXQA 2Q02A 3VI4B 3MS8A 5D1QE 4NZ5A 3HB3C 3UTOA 3O3EA 3L3DB 1IZKA 1WZKA 4JQXC 1UP3A 3RP1A 4O58H 1S9WB 2NYKA 4CGTA 2WWOA 2BVTA 1B2WH 2X7LB 5TQ2L 3AZTA 3HQOA 1S5IL 4NCDA 5E2TH 2D03L 4JRYA 4M6NL 4I9WE 3LZNA 4R97B 1HZYA 1OAXH 2NSOA 3CMGA 5AUMA 4IM8A 4L37B 1MCPH 3BZJA 1GOHA 4YN3A 1E1CB 4I48B 4MJHA 4DOHE 1QPKA 3HBLA 1NOAA 3HR5A 3FYIB 1YEIL 4RRPM 4XN7A 1NCDH 3TA9A 3QDMA 2A6JA 4OCRH 3LY6A 4FYQA 2A77H 4TNGA 3ULUH 5AZ1A 3U2CA 1WV2A 3ZTNH 1KRCC 5LIWX 1E50A 4XUGA 1T6YA 5IDZA 2DDQL 3RLGA 3IDNA 4LYQA 4OFCA 4DZHA 4LUIA 5L2KA 3G8RA 2R8SL 1XIWB 5K9XA 3R4RA 1HNYA 1SJHA 3ILPB 1F02I 5DJ8A 2IKIA 1W0WB 2K70A 2XTJE 5T1KA 4MJJA 1DBBL 1OAYH 3NK3A 4QCIB 3U7WH 1E9QA 3L5JA 4RJLA 1A21A 3WH8A 2A7RA 3BXNA 1YMMA 2DV6A 1VP5A 3ME0A 2Z2BA 3L4CA 2Y1ZA 3CN2A 3QPYA 1B3IA 1I9EA 1SUHA 3QOMA 1M3UA 3DMMD 1MI5B 2C3GA 3FVMA 1GYWA 2J8UE 1A4CA 1A6WL 5E70A 3ZDZF 4HNOA 2VDGA 3T3PF 1MFAL 1KXQE 2DYSB 5DO2D 5L8KB 1GJIA 4MG4A 4L6HA 4X2PA 3C9NB 3LEVH 2H9AB 4UB9A 5FA3B 4AQ1B 2BV9A 4LLYA 2RGLA 1J1OH 1AMKA 3L3IA 5BVJA 1UR0A 4KX9A 5C3IA 2XX1A 3L08A 5J11B 3TAOA 4K5PA 3ARFD 4UANA 4CNOA 1T03L 5CKSA 3W02A 3ZTCC 3BG5A 3VNVA 2XISA 1E6OH 1ME9A 3CZLA 2P5EA 2X0WA 1EUUA 1QMUA 2A3LA 3CVIL 3RX3A 3CTLA 2XH4A 1XHGA 5HVHB 3ZJ7A 1DQVA 1VQ9B 2MPAH 3BSZH 1XYBA 1Q9OA 3EYSH 2O5NA 2JJSA 4UDTB 1J4EA 1TSIA 3WF4A 2Y7SA 1B3ZA 4NASA 4J0QA 1DDHB 1PJ9A 1CI3M 3MXVL 4TTDC 3DBNA 5EBWB 4GG9A 4U7MA 4GPVA 5I0YA 1CQXA 1AO7D 1HH6B 1S5VA 4MCYA 4HIXH 2VTFA 4ONHB 5CUSH 1SXZA 3MRQB 1K5NA 3TYBA 1IX2A 1GHRA 4HBQA 2GGHA 3GEFA 4LLMA 1ET8A 5IOKA 3LPOA 1P6AB 5CEXA 2FHFA 3HBZA 5BZZA 4UXDA 1E4IA 1UGKA 2GBTA 2YK1H 3LG3A 1F6KA 3SGGA 1ITBB 1YXDA 1R19A 5E9NA 1O1ZA 4C1NA 5HI4D 5JHLA 3C6LC 5DXYA 4LQ1A 3MNWA 2BIOA 4ZFGH 3H3BC 4MHHG 3DARA 5G4OA 3RL2A 3RWJA 1I8MA 1EGJH 1QYGL 3BW9A 5JQ6H 4YWIA 2D3VA 4AVZA 5DHYB 3SQOL 4J40A 2J1ZA 3MLWH 3ESVF 3WDPP 1LILA 3AIRA 3VXUD 1DR9A 2VAAA 2DVXA 1A1MB 5C0DB 4K68A 2DQCL 1OC7A 5CG0A 4XMWA 4F92B 1R6WA 1P7BA 1RHCA 5FOOA 3ARSA 4PWKA 4OVUA 5I76B 1IWBA 5A6MA 1SU5A 2DVUA 3G3DA 4D94A 4NQCB 2R24A 2BZ7A 4GJTB 3CXFA 3AIEA 5ITFB 1TV3A 2MH4A 4X6DF 1U95A 2X3AA 3QXDB 2XQYK 2CIKA 1V6TA 3GO1L 4R8WL 3ABOA 2NQ5A 3S83A 1U30A 4LIQL 1IGWA 2B0MA 2DQUL 1DBKL 4HQQL 3VM5A 3NQEA 3GFYA 3F5KA 1MCWW 1E1QA 3OODA 3WLNA 2N1KA 1F45A 4XTIA 2R4SH 2QJNA 4GISA 1HWHB 3DX5A 2ODHA 1YE4A 5DMIH 4MJMA 4YL9A 2AW2A 4AEEA 1FZOB 1VPOL 2JELH 3CHOA 4AZ6A 4XP9L 4QLRA 3VG0H 1IAII 2ICEC 1VQ8B 4OZHA 2OMZB 4LCUB 2ZX9A 5EA0H 5KWYC 1OVDA 3GNPA 2E7LC 3MA8A 4RNRA 2XH0A 4WWKA 4TN1A 2EAEA 1KK1A 2HFFB 3HAEB 3JV4B 4L3CB 4OIBA 4R7NB 1PDYA 1U58A 1UM4H 1G4MA 5A2AA 4O12A 3W7HA 5FV2A 3U2JA 3IRDA 4QJ3B 1JDFA 4FX6M 4XP9H 5EFDA 3JWDC 1F4HA 3NEEA 4MDJA 5HHMD 1DN0B 3PU7A 3TTYA 3MRPA 3MZGB 4FRWA 4WK0B 3Q8CA 4XI5D 2HVNA 3G6MA 2FUTA 4WTQA 2R4SL 3PUOA 2YA1A 43C9B 3QH3B 3RWDA 1E67A 1OAYL 3U7WL 4ZAKA 2CD0A 3CXCB 2DQUH 1WD8A 3R4IA 1I1FA 3L3KB 1DXEA 4JN7A 3FSOA 4OCYL 1RK6A 5AOKA 3VNMA 3HAGA 4JM2C 3M0YA 3FUKA 4WW2B 5EIVA 1WT5A 4AZCB 3N42F 3LZPA 1T1ZA 2E9WA 3AAZA 4KK9D 1UG6A 2PU0A 1ASQA 4ZR8A 2E9IA 5JUVA 2XZPA 4DNHA 3TO4D 3EUUA 5HZAA 4IS6A 3EYQD 2WXRA 4Y9UA 2F58L 4HCRH 4KTDH 8XIMA 1SY6A 2PR9A 3BWAA 3EDKA 4WI3A 5LDSA 3CHVA 1OFRA 2DQTH 2DWTA 1FDLL 1GSMA 3MX0A 3WN6A 3Q0HA 5FO2A 1BQGA 2XZQL 5CSRA 4QT5B 1EDQA 2QPFA 4AENB 4XH2B 4J3BA 3VTAA 3VK5A 2P9RA 2PO6A 3FL7A 3M88A 3FO0L 3ROOB 4K8EA 3FKRA 1OAXL 2R1YA 3KDPB 4JZJC 1JZ2A 3HAEG 4JKNA 4H0HB 2OTJB 1QFOA 1H5BA 2PO6D 2GUOB 4K73A 2QJMA 1U8CA 1LP9E 4DO4A 3N06B 4GLEA 6REQA 2MOQA 5KSBA 1M57B 3R1GH 1XCQA 3SGKA 3C0SA 2ACRA 4S1RL 4FFWC 1HEZA 5H5JA 4DHGA 5MKGB 5AW8B 1UG9A 3KYKL 1XGZA 4OUUA 2VX7A 1KV5A 2D1ZA 5EMLA 1H50A 4GH7B 3MV7D 1NTDA 4FQQA 1XCTA 2OJPA 2VX6A 2Q8AH 5I79A 1CGUA 1R0MA 4MD0B 1AIFA 1USZA 4QRPE 5TF1L 4AQ8A 5CN3A 1VEOA 4JHBA 4O15A 1XS2A 5JXEA 5C55A 1Z89A 2BM3A 1N0XH 1CLOH 1SY6L 4YC2C 4YAFA 4Q97A 1E55A 1TCMA 1WFTA 2GYSA 5FIEA 3H22A 3LOTA 1BQKA 1KZYA 2CUMA 2EDRA 3VYOA 5JW5A 4OJYA 1MHCB 4JFSA 2VXQL 4KTEH 3T6XA 4NBXB 4H7VA 4PGOA 3U7YH 4BGLA 4HZAA 2Z2AA 4NBSA 4MAUL 3VA6A 4RZ4A 4K6AA 1REIA 4PHZA 1IYXA 3BP6A 1LL6A 4IG2B 5DELA 4IFKB 2E5DA 1NSNH 4PREB 5DDHB 4D8PA 1S5NA 4U1SB 3SDCD 3PP7A 3RY6A 4KJQC 1MMFA 2AOSA 3PXHA 3I4KA 2QLVB 4L8DA 4PMYA 1YQVH 4CUCA 1FZMB 1WKFA 1WDPA 2YEZA 4LNYA 3WXVH 4Q89A 3SKNA 5AHFA 3S8FB 1XCFA 1ICTA 4PTUB 4IMDA 3PV6A 4GAYB 1OD8A 3KTXA 2PCQA 1T41A 3PNZA 3N2XA 5KSBE 3P7YA 3ES6B 3T0EC 2AABH 4U1IB 3LNGA 1YNLH 4RDKA 2EIMB 1F6LL 5K9JL 2WZAA 3RA7H 2QQLH 3DUSB 3TS8A 4YBHA 1J87A 2DWEB 3CFJB 3RUGA 2W88A 4BQ6A 5E00A 1TJ0A 2Y5QA 3QDMB 4XN1A 1CTOA 4XP6L 1S72B 3WGUB 1KCSL 5D2NC 3ATDA 4Z6AT 4MA3A 2IS7A 3GTTA 2VDMB 2ENJA 1GYMA 3ECWA 3SLNA 1URLA 3EFOA 3WBYA 2ZYIA 4TKWA 1LUCB 5A6KA 1YLVA 4TMWA 1ZSDB 5L2KB 4ZCLA 4O2EB 3CV6A 5JH1A 1TCDA 3D85B 1D6VL 4QHUA 1MAMH 2F7RA 3L9BA 4O4YH 3BGAA 2VDLB 3VXME 2G9HA 2R2EB 5AG8A 3DXAB 3IAGC 2C0HA 3NXFA 3NFPB 1KTVA 4I8DA 2WP3O 3IMUA 4XZ4A 5JORB 1YPIA 3A47A 3IK2A 4M0LA 3LUTA 4GXPA 3CMEB 1VB9A 4WFGE 1MKFA 4IOSA 4TNWF 4YLWA 1AGDB 4YBLB 2J5LB 5E2JA 2Y7FA 3B8YA 1T66C 4Y8FA 2NY2D 3SKJH 3NO5A 3TXZA 3GT6A 1QWGA 1YUKB 1TV5A 5EO0A 2UBPC 1CZ8H 3PYCA 1KWKA 2CBQA 4MB5A 5HJXA 3K6DA 4CQ9A 1DVXA 3L3OA 3B37A 2UZ9A 2F8XC 4GSRA 5DD5L 3GKAA 4JM4H 3UZQB 5TY0A 4BSJA 4MYXA 3AU1B 2Z25A 3MOBH 3U9IA 5B7ZA 1W9XA 3WFAA 2VLJD 3HAEH 3L3IB 5SX5K 4QBXA 2O72A 1F2XK 2CBMA 1KJ2H 4X07A 5D93B 3S1VA 1AIPA 4XC3H 2ATSA 4MZ2A 2OMXA 1VRXA 3OPSA 2FQEA 3PWPB 4IOIB 1M03A 2ZWKA 4Y9BA 3QIUA 4KRMB 2OBGA 1DQQB 2SEBA 3DI3B 3K0WA 5B8CA 1GPOH 3RTQD 3KZSA 1UWYA 3KS0J 3S9YA 1JUEA 4AG4H 1T40A 1E73M 3E0WA 3R2GA 4I3RH 5G4HC 3Q05A 3DBSA 5ESVB 1DDHA 3VO0A 6PCYA 5JMUA 1ROCA 5D5MF 2OZ4A 5IY5B 1HVQA 4JFDA 3RVTC 2INZA 1I8UA 2NX3A 3KWXA 1VQTA 3KEHA 3DVIA 5C2GA 5H8MA 3TBBA 1FWGC 4YGAB 1FO0H 1K8DB 4V27A 2CJSA 2DCUA 4WY0B 2P7TA 1MJUH 1YYML 2WIMA 4KOCA 4NM4L 3WKPA 1CD9B 1MHEB 5SWQA 3U2IA 1FVPA 4H8HA 3F1QA 3WEZA 1RI8A 4EOWL 2BP8B 4YVPA 4ZX5A 1CLYH 4Z3EA 4ZV4A 1S78D 2KL6A 4PMJA 3UXKA 4XN4A 5JHAA 3SCOA 2X1TA 4L0PB 2H0PA 1QLEB 3DBXA 3PFMA 2D20A 4L65A 3IVTA 3BAJA 1EFQA 3RTLA 3MGOA 2VISA 2DI8A 2AFNA 2VDRH 4OV9A 5K5YA 4ILDA 1YJNB 1NGQH 1ODAA 2GPJA 1ZKAA 3GSNB 2F2KA 4IQLA 1J0YA 2FBJL 4MJ4A 4NAMA 1UQYA 4YAOA 3QSKB 5D7SH 4P2VA 4ZL1A 5E8PB 2V67A 5KW9A 3NN8B 2CDGB 3ULUE 2WZIA 1NFDF 3W82A 4HLJA 4BFNA 3HS8A 4YDVA 4J3UA 4BFJA 1H62A 3WQPA 4D0CB 1EXHA 2JTYA 2OZ4L 4DP2X 3PBWA 2FT6A 1XIFA 1DVZA 5C7XH 3H9SA 3KDMB 4APQA 3C0JA 2OCJA 1W87A 3GMLB 3PP3H 4HUXA 4PS4L 1W8NA 3E0LA 5HYJA 4LAOA 2VM3A 1RQBA 2VEPA 2JI3A 2BINA 1HE8A 3G5VB 2ZSWB 1U4EA 4NXSA 2OT1A 4Y5XC 2DTSA 3DPBA 2R1WA 3FN0L 3PPEA 5EU3A 1GUVA 1EJOL 1NAL1 4KRNA 3QJVB 1WQ5A 1KJ3L 3BT2H 4L3AA 3CBRA 2CHZA 3NBNA 3IXTB 3TBVA 3LMJH 5D1XB 2QDGA 3BDKA 1MJ8L 4LC8A 4LJ3A 3OKOA 3S46A 4KPHL 3MV7E 1QA9B 3H23A 4M7SA 1UT1A 1AD9A 1FL3A 2ZTGA 1FL5A 4CSPA 4ZZFA 3NSXA 3SCMC 2V2DA 4QROA 1EVUA 1MVYA 1RK1B 1BAFL 2VJ0A 3KHQA 4IRJA 4CVXA 5IWLA 3F7KA 2QGYA 1EZVY 4PCNA 4US6A 3ARGA 1U58B 3V7MA 2NCEA 3QFDB 3SGDI 1S7WB 1NAML 1IGTA 4GFTB 2PPFA 1PD0A 2TAAA 4PJ5B 4AF7A 1E4XL 2Z00A 4PC8A 4K3EH 3W2JA 3Q2NA 4AVFA 2R0LL 4BK8A 5DEGB 4WZ9A 1BJMA 1NICA 3ETTA 1QG3A 1YEJL 2FQDA 2VDOB 3ALWA 2NYYD 3Q2CA 4FDWA 4F7EA 2EADA 5IEKA 5C0CE 2YZ5A 3SDDD 1V3MA 1G6RA 4IBVA 1NEYA 4OI8A 4MIMA 5C0EB 1CTMA 1RVFL 2WLNA 1FAIH 2Z92B 4ICXA 1UACH 3BQUC 5I66A 2XIIA 5D2NB 1JCXA 3PL6B 1HIZA 2J74A 1P9MC 3JT2A 1YNTB 1X9LA 2XFGB 3E9TA 1DQJA 5AKRA 1C12A 2WO4A 4N2HA 4POZD 3ZFHA 1S8DA 1JL8A 5LAPA 3NIDB 5JHLL 4QY8B 1BVZA 3S3JA 2N0MA 2KZKA 5H91A 3DTXB 4OLXH 3MUHL 5JA8B 3B2UD 1KTJA 4FLSA 4OUEA 4EBQL 3MJ9H 3TX4A 1HXYB 3DO3A 3D51A 1Z1WA 4HS3B 5C0AB 2IWEA 2C16A 3CO8A 3EXSA 2WVTA 4Z1AA 2WZPP 2OKTA 5F44A 5TIMA 3B3BA 3SRKA 5J4MA 3QLDA 3JV6B 2IAAC 1I8LC 4N2CA 3VOGA 4GO6B 1EJ6A 4Q6YA 3A12A 4Z4RA 4WTZA 3ASNB 1U36A 2VXSH 4MNHA 4YFLF 5DURD 5E51A 1W9VA 4X60A 1CNEA 3BGFC 3ARZA 1GYUA 3CH1A 2FIQA 1HHKB 1G4PA 3A9IA 2GJZB 2QKIA 3GH7A 5IROA 1MFEH 3LTVA 1SEQH 1TENA 2FZNA 5C0CA 3TONA 3NQAA 3NK4A 3CT2A 3DX4A 4XTRC 1YJWB 4WQOA 4NZ1A 2WD0A 1LYQA 4JMXA 4GAGH 3RIAK 3N11A 2JJSC 3SGDH 2QDDA 2QUUA 4TX6A 2EIBA 5EOTA 5FXCH 4I9MA 3V5CA 3NZ1A 1UA6H 3RJYA 4YXWA 5IFPA 1OF2A 5DRXB 5D37A 3I74A 1RVKA 3W7KA 3BPCA 5HWMA 2X6MA 3SDOA 3TZVC 5C1MB 4JDYA 2XKUA 1OAZL 3TYEA 3O3BA 1G9NC 3EFFB 1FIGL 3RGVA 5E0KA 1LO4H 3BP6B 4ZGNB 2ORBH 3EHBC 4M7LL 4NAFB 1CD8A 2XY1A 4GQQA 4AK1A 5EEYA 5DWPA 4AVOA 3PJUA 3N50A 3ETSA 3PIQB 4IRJC 1UB5A 1YECH 3SCMA 2EECA 3SE8H 4DQLA 1C8PA 3L3JB 1RJRA 3ZE1B 3D3VA 6FABH 4JRWA 4KO7A 4LARH 4GH1A 1FWHC 5FAGA 2VX5A 4H1LH 4MKNA 1MIML 2XWDA 1FNSL 5D33A 1RZKH 3LQZA 1ZHNB 4ZW8A 3W73A 4MAYD 3CFJA 5F2LA 2IMNA 4F8OA 1BLNB 3F84A 1KBPA 3GXNA 5XINA 4XD3A 4XBEH 5DRZA 2ESVD 2WVUA 1NL0H 2A6DB 1JPFB 3OPZL 4KESA 4AD0A 2R7EB 3BISA 4HJ0C 4UMSA 3EFOB 4M7JH 5KAQG 1MFCL 2FTYA 2F54E 3MXWL 4LSRL 4RRPG 5GJTH 3SPJA 4ZMLA 1LROA 2FVGA 1U1HA 1NEZB 3QEZA 2WLJA 5KINA 3MODL 4PJ9C 3C3NA 4PP1C 3GU2A 2F8IA 5JNYA 3EWDA 3MU7A 2PC8A 4X7FC 3DXAA 3ABSA 3RMEA 3B5TA 2YOCA 3UO1L 5GS2H 3P3TA 3QHFH 1DE4A 1VBHA 4RDQG 3LKPB 1TQBB 4KK8C 5FYLL 1OG0A 4P3CL 5AAPA 4G56A 3W53A 3AMLA 3ULUD 1F6AA 3SKOB 4NS0A 1ZA3A 2W0UA 4G6CA 5FEXA 2AHIA 1LORA 3D0CA 2WB5A 1JP5A 1AGDA 5G2NA 2NW2A 3LBMA 5EPMA 1B31A 5EPDA 3PHQA 1QW9A 3JQRA 4Q4MA 2ZXBA 1TQVA 5EO0B 1TELA 4QXTB 2WQRA 3ULSB 3C6LB 5IV2B 1U2HA 4M8QA 1G4EA 1PJ6A 4UIOA 1II4E 1U8JA 2BNUA 4V1DD 5LXVA 1HIMH 1A7PH 2ICEB 5EUOB 4BEUA 3REVA 4ELKA 3AU1A 2G50A 4YBLC 4F0SA 1YITB 2FDBP 1A8PA 1AZBA 4KK5D 5E5MA 3GMMB 4UWQB 1OFPA 4I0PA 4N2FA 4S1SL 5GGTL 2ZFAA 1CMOA 4LPCA 1CIUA 3NCJH 4WZHA 1T89C 1TB3A 3L4XA 3EYVA 3UGXA 3FB7B 3RUGF 1N4XH 3L8QA 2R15A 2YIHA 3VE7A 1Q85A 1FCUA 2DQGH 3EJRA 4RMVA 2DB8A 2FZDA 3UZJA 1HQTA 3PF3A 5AW5B 3UC2A 4KXZI 2RAGA 1AYRA 4OFYA 1GZPA 1DJWA 1EUTA 1FNAA 3A67H 4PJXA 1DVTA 5BO1H 3RTQC 4CMHC 1MIEH 5ID1B 3EG9B 4WAFA 4FXKC 3LYRA 3MCKB 2ZKHL 4EO5A 4JY6A 2YKLH 4U1JA 1LWIA 1F56A 2WAGA 1P7KA 2P45B 2ENQA 5A95A 1KELL 2OTPA 3LQAC 4NQDE 1RLCL 3SDXE 4ACZB 4D6JA 3AZSA 3N4EA 2V5RA 1K8YA 5HSFA 5EGRA 1FRGH 5FO9A 4LQFH 3UYPA 4LASL 2E6JA 3MGTA 2YCJA 2LLGA 3GI9L 3P77B 2Y5TA 4WGHA 1YQ2A 2QCDA 3AZRA 1CFSA 5JBFA 2HPMA 3UP1A 2ADJB 1S9VB 5IVXE 5B3JF 1QUFA 4HF5L 2WSPA 5JXAL 4E8DA 3VYLA 4X5RA 1CDIA 2V2XA 4L9LC 5IMKA 4J4KA 3WBDA 2HLFD 2ZKHH 3DRQA 3KVPA 3QDJA 3AGQA 4YBQD 5CBAA 1KNWA 3ZY7A 3LXAA 3V6ZB 2VZOA 3GMOA 5IMLA 1OGBA 1CB2A 3P93A 4L6DA 3B9VA 1IQWL 4P2RE 4W9LC 3DGBA 2F53B 2FKPA 4WV1B 4QTIH 4HUVA 1REQB 1I9IL 3GMLA 3BE7A 4NAEB 2R0WH 1SR0A 3NJJA 4N1CA 3VSVA 1N2VA 2DQGL 2ICSA 5MEPA 1TE6A 3IJQA 4UYPA 5C2CA 4QLJA 3IFOA 4UAJA 4YSQA 5JHDD 2PW2A 5IT2H 2ADYA 4MAVA 3SJNA 3VGBA 1ID5I 1WE5A 3RVVC 1R3JA 3BN3B 3F5JA 3DHMA 3L23A 2XZAH 4S1QL 5I1JH 1OGAD 4LKXA 4ZFFB 3IXTA 3TBVB 1SZRA 2C34A 1GZHC 3R7RA 1VGAA 2CJUL 1QH0A 1Q8JA 1QD0A 3ALGA 1AD9B 3AABA 1I7RA 4NQCD 3BMXA 4I5UA 1LO0H 1OLLA 2JJVA 2VSKB 2YZRA 2P49B 2P52A 4TXVB 2FD6L 3SBQA 1A7PL 1EFCA 2HJFB 4ESKA 3TFKD 3TH6A 1FRNA 4JPKL 1VC4A 1IFHH 3JV5A 2EC9T 1L5GA 1IIIA 2WLMA 2NX5B 1BF6A 4M5YH 5HHPA 3CWOX 2GPTA 1IAIL 1UR4A 3D12B 1IGTB 4L29A 2BSTA 3W87A 4JGDA 4L4TE 4Y2WA 2BZCA 1A1OB 4M8UA 4PJBB 5GHWH 4LUJA 2IMRA 5IVXA 4QRBA 3VOHA 3V7AA 4HMNA 1GW6A 3VE9A 3CDCA 1S5HA 1MZYA 1A7QH 2V9TA 3RAOA 4ENLA 2JKEA 4OD3H 1CU4L 1RD5A 3C75A 1VYRA 3BOXA 4L8BB 2V9RA 1J8VA 1JHTA 4PLJD 1AR1B 3KJ4C 5CO1A 4GJIA 3VCLA 4OV5B 4AQ8C 3DC8A 4M8RA 3QDGD 3JUYA 2BXVA 4OZFG 2CITA 2QUMA 3B0XA 4EK7A 1RKRA 4AW4A 2NY7L 5TF0A 5EEXA 3LRSB 4RQQA 5LSMA 1GYVA 5DD6A 2B5IB 4JFZH 1NL0L 3OZKA 4FG4A 4RBPK 5EUKA 5BW7A 3E6HA 2V2HA 3H2OA 4R7OA 1AFSA 1NFKA 1UJ3A 1TCRB 4KU1A 4N8UA 4NOFA 4WHYH 3HE7B 5BS0B 2YBVA 3M43A 5F1VA 3SB0A 2FPTA 1FNSH 3AREA 5HGAB 4JHOA 1E90A 4JK0D 1Q7ZA 4IIDA 3TP4A 5FYJE 1CR9H 1HTYA 4KROC 5CJOH 3B2DC 4DW2L 3FQNA 4C1KA 4G7RB 1JWUB 2WBWB 5CJMA 2PO6C 4IDJH 5I3FA 4QAMB 1OM3H 3VTTA 3RN6A 1MQQA 4KCVA 5HJDA 4NHCL 5E1IA 1DEDA 3E49A 1FZKA 1UWXH 5D1ZD 3T55A 4ETYA 4PRBB 3US1A 4KZEL 2CLRA 3UWZA 3UBXB 1B4TA 1HX0A 4AQAA 4JFYA 4B16A 5BOEA 1WJ3A 1B0RA 2WLIB 1JPGA 2HN7B 2RTTA 1IM9D 4GQBA 4A4AA 2YQ3A 1IC5L 1NDMB 4HC1A 1YIJB 1ODZA 5CHNA 2CK0H 2OBTA 4OLVL 4WJG3 3K4WA 1WT5C 3CAVA 4AIEA 3NGBB 5GJMA 4ZBCA 1D5XB 2P1YA 5FDWB 1TZGL 3FAWA 3K2UL 1FFRA 2OJEB 3KPMA 3IFPA 5T1LA 3TH2T 4G1EB 1G84A 4MXQD 2R1NA 1EXGA 1GGCL 3VSTA 5IEHB 3VA8A 2BNQB 4Z0XB 4XNMA 4ODUB 1GVRA 3I10A 4UT6A 2P26A 3MNVA 1O5RA 3QDHA 4IEFB 2WXQA 1QX4A 2CE6A 3E2HC 3Q13A 4PRNA 2J9ZA 3C4UA 1S7RA 1R47A 3BHBB