3BCDA

Alpha-amylase b in complex with maltotetraose and alpha-cyclodextrin
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
585
structure length
585
Chain Sequence
SLFLIESEPSTGASVSKNLTEIILIFSNDINKVSQLALTDLITDSDIQGIDYNIEGNKVIINNFSLEPTCNYRLSYEVIDIYDNHLQGYIEFLVNQSNYPQIPDQEVNHTILQAFYWEMNTGEYATEHPEEANLWNLLAERAPELAEAGFTAVWLPPANKGMAGIHDVGYGTYDLWDLGEFDQKGTVRTKYGTKGELENAIDALHNNDIKVYFDAVLNHRMGADYAETVLLDENSRDKPGQYIKAWTGFNFPGRNGEYSNFTWNGQCFDGTDWDDYSKESGKYLFDEKSWDWTYNWDEDYLMGADVDYENEAVQNDVIDWGQWIINNIDFDGFRLDAVKHIDYRFIDKWMSAVQNSSNRDVFFVGEAWVEDVDDLKGFLDTVGNPDLRVFDFPLRSFFVDMLNGAYMADLRNAGLVNSPGYENRAVTFVDNHDTDRDEGSYTVSIYSRKYQAYAYILTRAEGVPTVYWKDYYIWEMKEGLDKLLTARRYYAYGPGYEVDNNDADIYSYVRSGFPDVAGDGLVLMISDGTSGNVAGKWINSRQPDTEFYDLTGHIKEHVTTDSEGYGNFKVIKSEDKGWSIWVPVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha amylase, catalytic region
publication title Crystal Structure of the Polyextremophilic alpha-Amylase AmyB from Halothermothrix orenii: Details of a Productive Enzyme-Substrate Complex and an N Domain with a Role in Binding Raw Starch
pubmed doi rcsb
source organism Halothermothrix orenii
molecule tags Hydrolase
total genus 194
structure length 585
sequence length 585
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3bcdA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bcdA04
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3bcdA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bcdA02
1OT4A 2O9TA 3AIEA 3WDHA 1TZ7A 2YA1A 4IM4A 1TQSA 4Q7NA 1MWOA 1UD6A 5HPOA 1BTCA 1V03A 1C8QA 3EYPA 3EDKA 2CKSA 3U57A 1E9LA 2VUYA 4JHZA 2J4GA 4PUEA 1JYWA 3A23A 4ZE4A 1E55A 3LRMA 4NXKA 2EACA 4OKDA 3J7HA 4P8UA 4D6CA 3ZJ8A 3IJ9A 3WQ5A 1LWHA 5ABGA 4BQ4A 4UZUA 2DQXA 2WLYA 3AHZA 1ESWA 4AZBA 4AIUA 4A4AA 1W9BM 4GI9A 3B8SA 5D8WA 1EDTA 3L4WA 1W1YA 5I2UA 1HX0A 4HU0A 2JIWA 1W9VA 5EFDA 3VGFA 1GVYA 1UWRA 1C93A 1UH2A 1R86A 4MB1A 3WFZA 3BAIA 2D0HA 4CU6A 4B9YA 1JZ7A 1O7AA 1JI1A 4XV0A 1J10A 1XSKA 2FGZA 3ARWA 3NDYA 3WH9A 3SURA 3VILA 1ZS2A 4R27A 4OGZA 3BVWA 4E2OA 1H5VA 1W3LA 3SUUA 4E8DA 1DWIM 1QWUA 3WMBA 3ZR6A 3AS3A 3SUWA 3EJUA 3GXFA 3FXYA 4MAVA 3DX1A 4NI3A 3RMEA 4FNRA 2NT1A 3LXBA 2UY4A 3AI0A 2CITA 1LL4A 4MNKA 2F7QA 4E8CA 2XTKA 5LA2A 4CCEA 1W91A 3AS2A 2PWEA 3VIMA 4JKKA 1FP9A 4H04A 4U31A 1W3KA 1WE5A 1TVPA 2DPEA 1EGZA 2W5FA 3GZAA 3WD1A 3AHVA 1OM0A 4F9JA 2WBKA 3CZNA 2VX5A 3AQUA 2WVSA 4HPGA 2VVNA 2WM0A 2WKGA 2OMVA 1C8YA 4V27A 1TFVA 3ZJ6A 5HPCA 3HU7A 3AYRA 4BZYA 1OT2A 2AMGA 2EAEA 1WDRA 1KR0A 5E0FA 3VGDA 4BCEA 1JZ8A 4IUGA 2F18A 4S3JA 4LYRA 1OD0A 1UR1A 2CHNA 1VJSA 3SCTA 4AD5A 2XUCA 1LJYA 3PZTA 4UOJA 4DWSC 5E70A 1MFVA 4EAMA 1WO2A 1B3VA 3OGSA 1BVZA 1E6PA 2VJXA 1CPUA 2E9BA 2VTFA 2DSZA 2XN2A 3GXMA 1W9XA 1J0ZA 1AQ0A 2XVGA 2WHMA 4TX6A 3L4VA 3CHDA 2DSWA 4DWSB 2YFNA 1ZBVA 1B3WA 4GI6A 1MYRA 2VR5A 4WF7A 2BY0A 3VSUA 3AIWA 4W87A 5CPTA 5E09A 1E6NA 1X6LA 1FH9A 3VD4A 4NXSA 2D3LA 2A3CA 3RM4A 1NOWA 3FNDA 4W85A 2OSXA 3O6AA 1QHZA 3ZOAA 4HOXA 1QNQA 1VIWA 4UFIA 7A3HA 4JKMA 1GQLA 5ABFB 2IXVA 1XSJA 3GM8A 5M17A 1GUVA 3EJRA 3MMUA 5A1AA 3HG5A 3OLIA 4YN5A 1S46A 4AD4A 4Z2GA 5A6BD 1WZAA 2VMFA 1HVXA 2WWCA 4ZXLA 4WLCA 1PPIA 4R5EA 2DDXA 4PMOA 1QW8A 4Q22A 1CXLA 3RM8A 1W32A 5A2BA 3VDHA 4JFWA 1LG1A 4PMQA 3U7BA 2OMTA 3BXWA 3LPFA 2E0PA 1HP4A 1QOXA 4NX0A 4HZ8A 4KGLA 3RDKA 1HN1A 5BYWA 1ZBKA 1UASA 3VGGA 5FL1A 3DHUA 5GPRA 2YA0A 1MVYA 4UQBA 2GSJA 3GXNA 1TG7A 1WPCA 3AXIA 3GH4A 3ARQA 3WD4A 3FHQA 2D24A 3OG2A 2CBUA 3UR7A 4ZXOA 5A6KA 2OYLA 4UFHA 9CGTA 2IXUA 3BAYA 4E4PA 1PZ3A 2J8FA 1CGYA 3QHOA 3AXXA 2O92A 1D2KA 1JFXA 2PWGA 2WSPA 4C7DA 1UZ4A 2XFRA 5D9MA 3N1AA 3PTKA 4JIEA 3WMCA 1H1NA 3QGVA 2WW5A 3WUFA 4D6GA 4AY1A 3A24A 2DT3A 4D71A 1H11A 1UD8A 1GQJA 3DC0A 2XGIA 4AYSA 1V0MA 2JEPA 3VM5A 4J3UA 5DF0A 3VGBA 4D72A 1O6VA 1QVBA 3VNZA 3CZ8A 1EIBA 2ZXDA 1MW1A 1M01A 3W6MA 1V6YA 2WK2A 1V3MA 3U5UA 4QDMA 1J0KA 2VQTA 3OLEA 1V0LA 3FAWA 1H6TA 2E8ZA 5BRQA 5CSYA 5EB8A 4PN2A 1OGSA 4CCDA 1NWRA 3PZVA 1CIUA 3W6LA 3VINA 4XUYA 2WCGA 3DYMA 1YQ2A 5ICUA 4TXEA 3ARZA 1HKMA 4PBGA 2YDSA 3PN8A 1QX1A 4D6FA 2J7CA 2WZHA 1UH4A 2W66A 2WNWA 3PZUA 3RO8A 2F7PA 4GO8A 2W62A 3T09A 3UR8A 1E43A 4CU8A 1SR0A 4HOZA 3WH7A 1A47A 4B16A 1GONA 1BYDA 1PBGA 1TA3B 3N9KA 2ALWA 1UYQA 2ESCA 5A6JA 2Z1SA 1QI3A 1RPKA 1JAKA 2J79A 2X05A 4MB4A 2W67A 3AHTA 3WEOA 5BXTA 1Q6FA 2VL4A 3DX2A 4UTFA 3BCFA 1WZLA 2JE8A 2WQWA 1M9SA 5A8QA 3CZSA 4UQ9A 3K8LA 2C0HA 4MPKA 1HVQA 1O6SA 4URIA 2X2YA 3WF4A 1VFUA 2WYSA 1NWTA 3N13A 5DMYA 4AD0A 2YOCA 3VO0A 4HA3A 1V08A 1HJVA 2FDMA 4F66A 2UY5A 2YKKA 5A6BA 3BVTA 3W29A 2WMFA 1HJQA 1E0XA 3D5HA 1CGTA 1CTNA 1BF2A 1EHNA 1E1FA 2J74A 2DSVA 1MQQA 4D1IA 4TX8A 1VFOA 2OWWA 2OMZA 3WEMA 5CGMA 1HKKA 1KGUA 3CMGA 4P7NA 2O9RA 1CXKA 2ZE0A 3L4ZA 4PMNA 3EDDA 1P6WA 3VIFA 1GOWA 3GNPA 3MANA 3ZMRA 1KQZA 2PWDA 2GDUA 4HA1A 5BCAA 1G9HA 3T0BA 4B15A 3L4YA 1KXHA 2D0GA 1V3HA 1HP5A 4U5IA 6TAAA 3LPPA 5JIWA 2RGMA 4UQEA 1OGGA 2QV4A 4HA4A 1CECA 3FHAA 4X9YA 3CH9A 3PZNA 4L4OA 1V3KA 4DM2A 4JAWA 4AZCB 3W37A 4GQQA 1U2YA 1DHKA 2VOTA 2VZTA 4YHGA 3AJ7A 2QMJA 2FGLA 3BMVA 2VCAA 2IGTA 3M6DA 3MV11 4OZOA 3WEZA 1UR0A 2NW0A 1PIFA 3WD2A 3QHMA 2DT0A 1B3YA 3BGAA 3QOKA 3ZSTA 5DT5A 2XM2A 2FE0A 1JDAA 1BSIA 3EBVA 3KEHA 4J28A 3L4XA 1DWFM 1JYXA 1TCMA 1JD7A 3ARXA 3F5LA 1UZ1A 4UCFA 4ACYA 2YBTA 1G1YA 4PEEA 4AC1X 1H0GA 1ZB5A 4FNQA 5LA1A 2J78A 3WD0A 1R85A 2FH8A 4CVWA 1MXDA 1J18A 3ZT5A 5CLWA 1OIMA 5F7UA 4C7GA 1E73M 4AD1A 3NSXA 3ZJ7A 3T0DA 3BSGA 2PB1A 1FP8A 3AMDA 2EO7A 1Q6DA 3K4AA 4WIWA 3SCOA 1KTCA 4PMRA 1VENA 2WVVB 1QNPA 3GNRA 2OYMA 2ZWZA 2A3EA 3MI6A 3MUZ1 2BXZA 2YDQA 3CUHA 1JZ3A 3DECA 3VD9A 4NZJA 4H8UA 3QOMA 3AMLA 1Q4NX 7TAAA 1J0JA 4M1RA 1BGAA 3D50A 2Y4SA 4W8LA 2DIJA 4AIEA 2OW7A 5IHRA 1R34A 1KR1A 1IV8A 3FW6A 2OSWA 2D20A 1RH9A 4LX4A 1HTYA 4GZEA 1QHOA 2EPKX 3PZGA 4DM1A 3DDFA 1O6IA 3THCA 4MAZA 1TQUA 1CGUA 1EO7A 4MJ2A 1VEMA 4QLLA 3WN6A 4CU7A 1PAMA 3MSDA 3CUFA 2CXGA 2ZX5A 2VRJA 2PWFA 1BLIA 2FHBA 3WNMA 2GJXB 4QLJA 4P7QA 2WCSA 3CC1A 2VZOA 4DO6A 1FH7A 2WMJA 5GNXA 4U33A 1DWHM 3IAPA 3LXCA 5CPQA 1CYGA 3ZM8A 3KWXA 2XWDA 4PMYA 1WAWA 3KLLA 1H2JA 2WWDA 2RGLA 5GNYA 4KH2A 3BC9A 2XSAA 4BQ5A 3A47A 3UG5A 5E0CA 1J11A 1GZJA 1V3LA 4NZFA 2HISA 4K68A 1UR8A 2JALA 2ZUSA 1FHDA 1LF1A 1E5NA 3TTSA 2UY2A 1J9YA 4MB3A 5JBDA 2V3DA 3EJQA 1V02A 3VNYA 4ML4A 1QI5A 2X0YA 4OUEA 2AAAA 4JCMA 4AXNA 2J8GA 3MMDA 1LWJA 4LGXA 1DWGM 3PZIA 4HU8A 1GJUA 1V02E 1W2PA 3PTMA 3VPLA 3AOFA 1VFFA 4RL3A 4W7WA 2IUZA 1WKYA 3DYOA 3WY3A 3VVGA 3WF1A 5ABHA 4QAWA 1EA9C 3FAXA 2OYKA 1OIFA 2W91A 2X8RA 4PMXA 3CUGA 1R75A 4NSBA 3KL0A 4QCEA 4B9ZA 2BHUA 1CBGA 3VIOA 1FA2A 3POCA 3VMNA 2YL8A 5E6YA 1C92A 1EXPA 3VIIA 1J01A 2BV9A 1D3CA 1VB9A 6CGTA 5AC5A 3RILA 4W7UA 1NP0A 1XGZA 3TA9A 3ZO9A 5FIPA 5A95A 1UQZA 1J0YA 1B9ZA 4OOUA 4UQCA 2GK1B 1JNDA 4LPCA 3RJXA 2CPUA 1UD4A 2C7FA 4AEEA 1QI2A 4DWSA 4UZSA 1E71M 5D8ZA 5BXRA 3UEQA 1UWSA 1JYNA 4H7VA 1RP8A 1F4HA 2V3FA 4CILA 1G01A 3ZQ9A 4N42A 4Y7EA 2ZICA 1I1XA 3WQWA 5ABEA 1IZKA 2TAAA 1GHRA 1TMQA 2VR4A 5DT7A 3GH5A 4RE3A 4XZBA 2YA2A 3AISA 5FD0A 2WQXA 1EDGA 1W2VA 4JL2A 1QNSA 4ZEPA 2XVNA 2O9OA 3K8KA 1QW9A 3WQ8A 1UKQA 4PSRA 3WF2A 2J7HA 5ABFA 1HWWA 3BZ5A 3LX9A 4W5UA 1CEOA 4NZCA 3BLKA 2GVYA 5BXPA 2YDRA 3PBGA 4PTVA 5M5DA 1A3HA 4IPLA 5AY7A 4CN6A 4TVUA 4FK9A 4NRRA 3ARUA 3BLPX 1JXJA 1W1TA 4PMUA 2J25A 2W63A 2BS9A 3AIVA 3RJYA 4GZIA 2X0HA 1HIZA 1K9FA 3A22A 5KZ6A 4XX6A 1JZ2A 2F61A 1GOOA 3VIPA 3ALGA 1W1VA 5IFTA 5DFAA 2CCRA 3VUPA 1VF8A 3ARRA 3MKKA 2XJ7A 3CPUA 2BY1A 3UG3A 3IAQA 1N82A 1BPLB 3BLBA 1L0PA 5FCZA 3IJ7A 1CXEA 1R87A 3L2LA 4J3XA 2WKLA 2QPSA 5BRPA 2J7FA 3ARSA 2HVMA 1PX8A 4WK9A 3APGA 2VQUA 1NM9A 5M03A 4F9DA 5I6SA 5HXMA 1JF6A 1ISZA 1H49A 4QLKA 5BXSA 4FLOA 2JEQA 2A3HA 5E9AA 1LQ0A 5EBAA 2YL6A 3WNPA 2VX7A 2WHLA 3ECQA 3BUPA 1NWUA 2CERA 4W93A 3AMCA 1OB0A 2BY2A 3E1F1 1C8XA 1QPKA 5A8MA 3K8MA 3MSGA 1JZ4A 2XFYA 2UWFA 1VAHA 4TOQA 5CGTA 4X0VA 1HNYA 2OMWA 1Q6EA 3T08A 4CC4C 3S6TA 2WBGA 1K9DA 1M7XA 5CSUA 1JGIA 3OZOA 4AZ6A 3T2PA 1E6ZA 3W25A 2VI0A 2WCAA 3WH5A 3VGHA 3I3BA 1XYFA 4HZ7A 3VDCA 1V3JA 5C71A 3ZT7A 2XN1A 3UESA 4ATDA 1MW0A 2JIEA 2J7EA 1J12A 2Y5EA 1K9EA 2ZX8A 2NSXA 4W5ZA 4A3HA 1UH3A 3ZJKA 3VTRA 3WQ4A 1GVIA 3DHPA 1ZBWA 4CVUA 4ZFMA 4AWEA 1NM4A 3PZMA 4KWUA 7CGTA 2QLYA 4PSPA 2WMGA 3AXHA 3M7SA 2VNCA 1HJWA 1GNXA 1C91A 3AIRA 3VD5A 1HXJA 1JDCA 2WSKA 3SCNA 3SUSA 3SCRA 2G3IA 2WXDM 3VSVA 4DUVA 2ZUWA 4Z2LA 1US2A 3WUEA 3N15A 3BMWA 4P7RA 1ZU8A 1C7SA 1WDQA 3WL0A 2DGAA 1W9DM 3SCWA 1CLXA 2V3GA 3S5ZA 3WIJA 3MO4A 1OGBA 4FNPA 3CTTA 2OLHA 1FOBA 2X1IA 2CESA 4UFMA 1GOKA 3CZLA 2CYGA 3BUQA 4ACZB 4ATLA 2BNJA 1DTUA 1MFUA 3F5KA 1E1EA 4JCLA 3VM7A 1UKOA 5I0DA 5D9PA 5CQ1A 2DSUA 1XSIA 5TD4A 1ZJAA 2CNCA 1PEZA 3GDBA 5A94A 4F79A 3RM9A 4RE2A 5DO8A 3LXAA 3EJSA 3WNNA 1DWAM 3WNKA 3WKZA 1CXIA 5A6AA 1QBBA 1M03A 4XB3A 4JHOA 3T2QA 1KGXA 4NF7A 1XRVA 2DIEA 3TOPA 4GQRA 4UQAA 1BGGA 2OMUA 3CUIA 3EMQA 4AISA 3VD3A 4EKJA 4HP5A 1Q6CA 4AZCA 3F5JA 3NYDA 4YPJA 1AMYA 2FHFA 1UR2A 2CBJA 1XYZA 4EANA 3VX1A 2VVSA 5JBEA 1LG2A 2J7DA 3WBAA 4WJXA 2VZSA 5A8OA 4AW4A 1BYAA 1H6UA 1UG6A 4EE9A 3MUY1 1VEPA 1XD1A 2BFGA 1QNRA 3PTQA 2OWXA 2W61A 4D6HA 4D6IA 1XCWA 3B9EA 4XZWA 3VDAA 1LL7A 2DT1A 1UD5A 2BVDA 3M07A 4U5KA 4M80A 4AIOA 1BAGA 2Y5QA 1UR4A 3H53A 1W3HA 2GDVA 3ZR5A 4CGTA 5D4YA 3EDJA 2WHJA 1OT1A 2CBVA 1ISYA 1U30A 1VJZA 5CPSA 4PUDA 3O9NA 4GXPA 5CXPA 1F4AA 1BYBA 2ZXBA 4W8BA 1XH1A 1H0IA 2C9RA 3AHXA 3H54A 4M81A 2J62A 3AZTA 2ZUUA 4PMVA 2D23A 1C3FA 4D1JA 2C9PA 4J3SA 3VIKA 1QI0A 2G3JA 4C7FA 1QHPA 2DH3A 3WNOA 2XPKA 1FHLA 1CDGA 5ECUA 4MDOA 1E5JA 4M56A 2OWCA 4GZJA 3D4YA 2VX4A 3IANA 3N11A 1UKSA 2YBUA 1UWUA 1IX2A 1EOMA 3G6LA 3LMYA 5BWFA 2X09A 4W89A 1E3XA 2Y24A 1V3IA 1PJ9A 1US3A 3OGRA 4M82A 2EPLX 4WSJA 3SUTA 1Z32X 1ISVA 2EQDA 3WBEA 2F2HA 2YL5A 2WMIB 1UWTA 4CD6A 4AZ7A 2A3AA 1UQYA 2UZYA 2OSYA 4D6DA 4HOWA 2FYVA 1ITCA 1R7OA 1KBKA 1NOFA 2XFFA 2WVTA 3WSUA 3AIUA 1UKTA 2GJXA 4NRSA 3WFLA 4KMQA 1CNVA 1LYQA 1BFNA 3EMZA 3II1A 2VX6A 3GXDA 3QR3A 4W84A 1XD0A 4U3CA 2QMKA 3WH8A 4S3KA 1E40A 4DWSD 5I77A 3S5YA 2VO5A 2D22A 2FHCA 3SCVA 1V6VA 1XH0A 1KQYA 1E4MM 5D9OA 1AVAA 5JBFA 1KCKA 1WCGA 3VIHA 1UD2A 4PTXA 2PF0A 3T2OA 3I3EA 3WF3A 2VURA 1IZJA 3HN3A 4AYGA 2Y8KA 2VRQA 3BH4A 1B30A 3CHCA 3LPGA 1JZ6A 4LQ1A 3VIJA 2E4TA 3BUDA 4B3KA 4FNUA 1UR9A 1E6SM 4HMCA 4KRTA 2ZUVA 1SZNA 2QF8A 2EPOA 3W24A 2EPNA 3CHFA 2WMKA 4PCSA 3U5YA 1B3ZA 2XIBA 1E0WA 1UD3A 1R8LA 4DUWA 3W38A 5A2AA 4Z2JA 4AD3A 3W53A 3L2MA 5AYBA 3MU7A 1GOMA 4HTYA 1JYVA 1G5AA 5I78A 3CBWA 1CXHA 4H41A 4P7LA 1V0NA 2YJQA 2V5DA 5C70A 2JF7A 4CD5A 4EK7A 1KXVA 3QHNA 3BVUA 4MADA 4LYPA 2WPGA 1XV8A 1JZ5A 3ZT6A 3HJEA 2Y8VA 1VBUA 4M24A 1EOKA 2FH6A 3WNLA 2WZEA 8CGTA 1U33A 5A6MA 5D9NA 4DO5A 4UFKA 3BVVA 5E6ZA 1QNOA 1VEOA 3A3HA 5HOSA 3WY1A 2B31A 4CN1A 4P8XA 2X2IA 2PBOA 4KGJA 3TTQA 3DDGA 2ZXQA 3PZQA 4DUXA 2GK1A 3UERA 4IPNB 1C90A 3DX0A 4GI8A 2E3ZA 1UKPA 5A8NA 3WDIA 1W1PA 4OOZA 2WHKA 1KBBA 3GXIA 3D3AA 3WDQA 2YIHA 4J3TA 1PX4A 2ZX9A 3H55A 2D73A 3G6MA 4TTUA 4MNMA 1R47A 3HG3A 1G0CA 2XM1A 4AQ1A 1VFMA 1V6UA 3M46A 2ZX7A 4HPHA 1JL8A 2GJRA 3W27A 4ZE5A 3GXPA 2CKRA 1W3JA 3AS0A 4U3AA 4AZGA 3WY2A 1SMAA 2J7BA 4AMXA 1WDPA 1ECEA 2EXOA 3SCPA 3CO4A 3ALFA 3HG2A 1J0IA 3VMOA 2GFTA 4AZIA 4OIFA 3B9DA 3A6OA 1NWSA 1E72M 2D1ZA 1ZJBA 5IDIA 5C8BB 4CUCA 3WELA 1LL6A 2CBIA 3FY1A 4JFTA 3CZKA 1CENA 1KXQA 4Z2KA 1OSEA 3KZSA 4W88A 1BVNP 1TQTA 5EMYA 1FFRA 1E6RA 1SYTA 1B3XA 4OBSA 1SMDA 3WF0A 1X1NA 1E4LA 3L4TA 2BVTA 1B90A 1B1YA 1WB0A 3K46A 2BY3A 1KXTA 3TTYA 4N0RA 4JKLA 4WSKA 1GPFA 2OW6A 1TR1A 2X2JA 2NT0A 1QBAA 4JFUA 2C8NA 3HZ3A 4QCFA 2WZIA 1BPLA 6A3HA 4MTVA 4H8HA 1TE1A 1AQHA 3ARPA 2EJ1A 3AFBA 2WMHA 3WDPP 3BAWA 2W4XA 1EHAA 2XSBA 4PYSA 2CIPA 4GINA 3AS1A 3POHA 5CG0A 2XGBA 5HNNA 3LRKA 3AICA 3GNOA 3W4RA 3GTNA 3K1DA 4U2YA 2D3NA 5IXEA 3A4XA 4J3WA 3WQVA 5HDRA 3PZ9A 4W8AA 2XYLA 2WQUA 1CLVA 3L4UA 2EEXA 1XHGA 2ZIDA 1JNEA 1CXFA 4UQDA 2WQVA 3AZRA 3ZIZA 3AMGA 1O6TA 2PC8A 3BVXA 2ZUNA 1WZMA 1H3GA 3KL3A 3BUBA 2WVUA 4D6JA 5I5RA 2CETA 1RP9A 1TVNA 4FNTA 1NH6A 3D52A 3WENA 1MQPA 1UUQA 4KRUA 1YHTA 2E9MA 1KTBA 3IJ8A 3VSTA 4P8VA 1GOIA 3TTOA 1V6XA 3BAXA 5FOOA 2YLAA 3S2CA 1M04A 4H2CA 4CKQA 2ZUMA 4TVCA 3RIKA 4AEFA 1C7TA 3TONA 3CHEA 3FN9A 4GO9A 1DEDA 1JI2A 2VZUA 1EQPA 4CC4A 1JIBA 1UHVA 4BQ2A 5CJ5A 1QWNA 2VCBA 4AMWA 2Z1KA 4J27A 3BAJA 1Y7VA 3N12A 1AQMA 1EDQA 2UY3A 5A8PA 3N18A 1PZ2A 3WUBA 4PMZA 1XH2A 4UFJA 3NUKA 1K6AA 2XN0A 2ZWYA 3N04A 4QP0A 3VIGA 3OLDA 5IHSA 1B2YA 2G3MA 2A3BA 3AHYA 4GKLA 1WNOA 1ODUA 4U2ZA 4B3LA 3EJPA 2W92A 3EDEA 5I23A 5EFFA 4BQ3A 3ARYA 1WZKA 3BSHA 1K9TA 4TVDA 3TP4A 4M29A 3LRLA 4CN4A 4YHEA 3PZOA 4FF5A 1DP0A 4ATWA 4J7RA 1XC6A 4V2XA 3CLWA 3F4VA 3NJ3A 1I75A 1TUXA 2DSKA 3WL1A 3W0KA 1J0HA 1EQCA 4WKHA 1W9PA 5CLTA 3DX4A 1OBAA 4ACZA 2BVYA 1CZ1A 1OCQA 5LA0A 2G3NA 3A21A 2RA1A 3GBEA 1JDDA 1R46A 1GW1A 3GH7A 1H4PA 2V5CA 5A2CA 1V0KA 1B31A 2J47A 2CHOA 1NQ6A 3JUGA 1UOKA 1UA7A 1QI4A 2WANA 4A3YA 2EADA 1HL9A 3AIQA 3MUAA 1TA3A 3CUJA 4J3VA 2YFOA 4AZ5A 2EBNA 1KWGA 1E6XM 2MANA 2WLZA 1GQKA 2VCCA 3OZPA 3CIVA 1E6QM 4CD4A 1M42A 2G8ZA 2OMYA 1KGWA 3I3DA 4FLQA 1E70M 1KB3A 2WC7A 3CMJA 1VBRA 1HXKA 1BQCA 1Q6GA 5CZKA 3IGUA 2DT2A 1HJXA 3K4DA 4MNJA 3VOCA 3D51A 1ITXA 2JF6A 3T0AA 2C9QA 1HKJA 1WP6A 2XVPA 3W26A 3AZSA 4UFLA 1PX3A 4F8XA 4L4PA 3UETA 1OD8A 1PIGA 3OLGA 4WKFA 3NCOA 3VD7A 5I24A 2VZVA 3NIYA 1LLOA 3VU2A 1NOUA 4JFVA 2WB5A 3U7VA 4FLRA 2VRKA 3LPOA 2XHYA 4UOQA 1CGWA 1TQVA 4CD8A 5E1QA 4FMVA 3VDBA 1MW3A 4RE4A 1WDSA 3CZEA 4PRWA 3PHAA 4P7OA 1KFWA 1GCYA 1E0VA 1XEUA 1E15A 2Q8XA 4UOZA 1HF6A 4UR9A 2F7RA 4Z2HA 2E9LA 1GQIA 3SIMA 3AYSA 2PWHA 1HKIA 2YLLA 4JZ5A 4HZ6A 4BA0A 2VT0A 3GXTA 4W7VA 1GJWA 1HT6A 3NSMA 3VGEA 1UWQA 2BXYA 4BF7A 1OWQA 5I79A 3O2LA 3THDA 3NSNA 1GOQA 2DH2A 1D7FA 5BROA 3HMCA 4D6EA 2F1BA 3WH6A 3KL5A 1CGXA 3OA5A 2ZX6A 5KEZA 3DYPA 1JF5A 1BYCA 1FH8A 4GIAA 5A6SA 2QHAA 2DEPA 1RD6A 3EMCA 4M8UA 3CV5A 2PI6A 1XCXA 3BUIA 2F1AA 5LYRA 4AMCA 3OGVA 3AROA 1BG9A 1JAEA 3VMPA 2XWEA 2WMIA 1HJUA 4WKAA 3DX3A 3SCQA 3ZSSA 2E40A 4LXFA 1W9UA 1H41A 1BHGA 4OJYA 4H8VA 3VX0A 1MXGA 1E56A 2YL9A 4DO4A 3ARVA 1CGVA 4HMEA 2QPUA 3W28A 3KE0A 1ISWA 1KWKA 3MV01 3UG4A 4HMDA 3MS8A 3SUVA 1PS3A 2WVVA 3HG4A 3BAKA 4MB5A 3SCSA 3WQ6A 2D2OA 1MQRA 5FL0A 3UCQA 4OBRA 1KCLA 1ZL1A 5AC4A 1DWJM 1EH9A 1ISXA 4CD7A 4PTMA 1FFQA 2G4FA 1GORA 5GQBA 4PCTA 2WC3A 1MW2A 4IISA 3W82A 5A69A 1R33A 8A3HA 3GBDA 4AZHA 3SCUA 2J7GA 2GUYA 1I1WA 1JD9A 3TV8A 1UA3A 1H09A 3GYCA 4MJ4A 1BG4A 3WD3A 1V6WA 4AD2A 3WDRA 1SFSA 5A3HA 1CWYA 1NARA 4Z2IA 2J77A 1UWIA 3OB8A 3EJTA 4MDPA 3N17A 4W86A 3D4ZA 4TUFA 1GHSA 4ZENA 2V3EA 2WAGA 5JIPA 4BS0A 4FNSA 1OINA 1JFHA 4MNLA 1TQWA 4P8WA 1X6NA 3VKKA 3CZJA 5GNZA 3CZGA 2XVLA 4UNIA 2XG9A 2EABA 5I3DA 2GJPA 5DEZA 4JFSA 3EDFA 3SEPA 1G94A 2EPMX 5HBFA 2O9PA 1JXKA 1R7AA 1NP2A 3RPMA 4FLSA 3AIBA 4V28A 1T0OA 4X0NA 3A5VA 4PTWA 1E3ZA 3MUIA 4LYQA 2XIIA 2BHYA 5FKYA 2F8QA 2OMXA 3WUGA 1VRXA 4GPNA 1IT0A 3ARTA 1JG9A 2BHZA 3A4AA 2G41A 4JL1A 5IFPA 2F7OA 3WY4A 1E4IA 1HL8A 3A4WA 1L8NA 2X2HA 3WDJA 1O7DC 3AMKA 5AYIA 2Y2WA 3RCNA 2PBGA 3OBAA 3IK2A 4QFUA 4TTGA 3B9AA 1ODZA 1ZBCA 1HJSA 2D0FA 2ZUTA 2ZXAA 2CEQA 3NDZA 5M3WA 2UZXA 2ZOXA 3WMSA 2WC4A 3OIHA 4PMDA 3BCDA 3CGTA 4AW7A 1EO5A 2V38A 1M53A 2XVKA 2E8YA 5JUVA 3MMWA 2JFEX 1E4NA 5A6LA 2J75A 4CCCA 3W81A 3KLKA 2VC9A 2AOSA 1B0IA
chains in the Genus database with same CATH superfamily
3MV7D 3FU9A 1SDDB 2BSTB 1UD6A 1IIGA 1H42A 4JOMA 1FIGH 1E28A 2YD0A 5IM51 1N8RD 3U6XA 1EJTC 3T4CA 1G9MH 1XF2B 4ZTEA 3LRMA 1F6PA 2F84A 3C4UA 5DZOA 3W5NA 2DZSA 2WLYA 3WYZA 1SXCA 3CSTA 3FS2A 5I6XC 4GI9A 2VC6A 3M5XA 1YUHB 2X70A 2WMPB 2OTJB 2AJXH 5DUML 4ZOBA 2P0OA 3HPXA 4UT9L 1SLXA 3TNNB 5HR6A 3Q9QA 3UA3A 1J10A 1EPVA 1MMFA 3C6EA 3TC6A 4E8DA 1KLZA 3MBEB 1VACA 5FFLA 2JIXA 5FO8A 3BYTA 3QEGH 4YIWA 3EO9L 1ASQA 2F7QA 4OPVA 2ZKXA 1I8KB 5JQHC 4OLUL 4X9SA 3DIFA 4V15A 2Y6SD 4GOSA 2CKNA 4U31A 4AZ8A 1HCVA 2CK0H 4OKVA 3TWCL 3AHVA 2PCQA 4WUUE 1MVUB 3WJLC 2BASA 3PBUA 4CQBA 1A4CA 2OAAA 5JO5A 3FT2A 4ZZ9A 1PZ1A 1Q9SA 5I03A 3O63A 3CEPA 5CCHE 1KR0A 2PE3A 3E7JA 2HX8A 2H26B 4QXUH 1B54A 5D7LD 1E4KA 1LJYA 2IF7A 5IJKC 4CGUB 1CQKA 1MAML 3V5DA 4LCWB 2BOEX 4DGVH 4LHUB 1IQDB 4ZMXA 1L7IH 3ET9F 4AX6A 1Z0NA 2IBZX 1Q13A 5ITFA 1CR9L 2W65A 3S7GA 2ZG2A 3GQFA 4OLXL 1DEEB 6ALDA 4DT2A 1PYWB 3PPHA 3N43F 4PCPA 3QPXH 1Z3GL 1OSPH 1E6OH 3B9KD 4PJ7B 4X4XA 3V5FA 5F2FA 2F4NA 2YCEA 4PYGA 5D09A 4ZXLA 2R29A 1JA0A 3S1VA 2QGGA 4Q22A 2WUBH 2I07B 4PMQA 1Z3NA 5DMIL 3NZHH 4JAMB 4S3AA 4JQAA 3US1A 2B39A 3CHVA 3AXIA 2XY2A 3PC0A 3GI9L 1CFSB 5LNUA 4ODTL 1SF3A 1TTAA 3QKEA 1M1BA 2YS4A 9CGTA 2CKBH 4C6EA 1GCFA 3M0IA 4A2GA 5FO9B 2O92A 1E4XL 4OTXH 3WS3B 2Y0SA 2ALDA 15C8L 2A0LD 4RWYH 5ILTL 2CO3A 3FFCD 3KRUA 1A8ZA 3DC0A 4WHCA 3OZWA 2MCPL 2Q6WB 4J3UA 4BR1A 2Q6LA 2X9ZA 1EIBA 5IW6A 5J3OA 3W6MA 4FZ8L 1FDYA 5B1JA 4DGYH 5I1GH 5CSYA 4A2HA 1XLHA 4F5CA 2IIJA 2Z92B 2AGTA 3S5NA 1TETH 1IIHA 5F4JA 1IEXA 1MJ8H 4U6HA 5IB4A 3V6ZB 3W1AA 2OOFA 5AW7B 4GRWF 4TXEA 1AGEA 1KYFA 3QUXD 1AA1B 2Z35B 3R25A 3G5VB 4TVSa 5EIVA 5K9OB 2BSSA 2AK4E 1CDUA 2YB1A 1AS6A 3CG8A 3COOA 1A47A 3R1GL 5ESVB 1GONA 3HG1B 4NAEA 3KBJA 2ESCA 3D2UD 4OFIA 4I18C 4AEIH 5HGHB 4PG9B 4HNNA 4MPKA 1NQBA 7XIMA 4GY7A 2YGVA 2WYSA 4HPYH 1ETZA 3VXSA 3C0SA 3SD5A 3E5BA 1UFUA 5HDBE 4P5RA 1LM1A 4RD3A 3D5HA 4PRBB 4LL4A 1CTNA 2YPVA 3VMFA 5JXAH 3UWZA 2NPFA 2V2DA 2A0NA 1KGUA 4LVOB 1G9NL 4QXGL 3Q6RA 1J5CA 3EDDA 3VI3B 3GNPA 1EXMA 3CD4A 3C60B 2WJYA 1EEQA 4HA1A 4GW5A 3LS5H 1OYBA 4J35A 1TZHA 4Q8WA 1OXYA 2QV4A 4XVSL 3O05A 3LEVL 1TYJA 1PFCA 2R7EA 2NZ9D 1GGIL 3W02A 2CKBB 4P5TC 4S3CA 3QMTA 4D9PA 5EEVA 2FE0A 1OGPA 5DJ8A 5JLZB 3S96A 1NQKA 1ZB5A 2QDDA 5CBJA 2IGFL 4B3FX 2FH8A 3KAAA 2W9LA 4YDIH 2IJ0C 4U4IA 4HHGA 2VR9A 2GZXA 3BSGA 1UWYA 3JYBA 3CASA 2KMWA 5DC2A 4PGDB 3D0AA 5HDBF 4I7ZC 2ZQ0A 2DRUA 3B05A 4NKDB 1RQPA 3DECA 4H8UA 4BKLA 5FYJH 3TN4A 5D02A 4DAFA 4M8VA 3V55A 2Y4SA 2HS6A 5IB3B 1TJ0A 2VGBA 3LV3A 3A3GA 1TV7A 1XX9C 2VDPL 3UIYA 3ECUA 5BS0B 1P5BA 1LQ2A 3DFYA 1JV2B 3I9AA 4QHMB 1RLWA 2VC2L 1Q66A 4JM2B 3UPMA 3QUZA 3GSIA 4PJAE 3KTCA 2CXGA 3DJSA 3ZHFA 4GLRI 1QNZL 1AGBB 1TCDA 4UTTC 3WJZA 3CFDB 3LD8C 3VACA 3KPRD 4ZG1A 2XGJA 3LKOA 4HHAA 3VW3H 2J21A 1P6AB 4R2GC 1A0EA 2AABH 5E00B 2YW3A 4KH2A 4JQXA 4TSBH 4REQA 4B47A 2Q20A 1SRDA 5J1TC 1Q7QA 5KYYA 3L45A 3V5HA 5D2NE 3B2PA 1XLDA 3H9SA 3UJRA 4OGAC 3SQOL 1W2PA 3O2DL 5LHDA 1KKRA 3KW8A 1WKYA 1UT1A 3ESPA 1K2DB 2P88A 3DJTA 1X5YA 5AOJA 1Y0LA 3SE9L 3DOSB 5JA8B 4L4VD 1CBGA 5E9NA 2GABA 4GCAA 4H1LG 3X3FH 3SB3A 1KFJA 2PE4A 4R4BA 3BP5A 2QUTA 6CGTA 3IGLA 4PJAF 5EZIL 5E5RB 3BZFB 1NEZG 4O02H 5BZDA 1B9ZA 2FIQA 4NQSA 3G0SA 6XIAA 2BFVL 5I3FA 1EXHA 2PS2A 4A6YA 3SJVE 1QI2A 2A9NL 2BTMA 3O6LL 3FO1B 2XLLA 3ARFB 3T8VA 4B43A 1B4KA 1I7PA 5GS2D 1ZUNB 4YPGA 5BRZE 1ADQH 2WQXA 2CBMA 4AZUA 3PPCA 4UNKA 2X5PA 5GGQL 3SY1A 3LX9A 3IFNH 3UOAB 2CF4A 2F58L 4EVZA 4XVDA 5HP5A 3LKNA 3SQLA 2E7MA 2HJKB 4CN6A 2EVGA 4HWEH 1JXJA 3MHUA 2FB3A 1T03L 3B37A 1QFWM 4OLVH 3CFJB 4MIMA 1M7JA 5KZ6A 3TTEA 4ZXBA 4JRYA 4BY3A 3ARRA 3RWDB 1TVBA 2ICEA 2OPJA 4QO1B 4ZZFA 4J2QA 3O2VH 1ZPLA 1CXEA 3FCTB 3QFGA 2HJFA 5BRPA 5K9QG 1SLVA 2H90A 4OM0L 2XWBB 5I6SA 1KGYE 4YR6A 1JF6A 1B88A 4MX7A 1SXSA 4QLKA 2J12B 3TPKA 3BOVA 2NQLA 1UM5L 4US5A 4HJGB 4JVWA 1P1MA 2P3ZA 3BUPA 2P8CA 2CIKB 1J8SA 1HHHB 5T8IA 4NWUH 3PL6C 1RHHA 4Y9MA 5GV7A 5DK2A 5FO2A 2APVA 5T1KB 1AO7A 2P4AB 3BRDA 3FOMA 1EBHA 4TUOB 1F58H 1ZANH 2XZZA 1ITUA 4A68A 4PJEB 1UJ3C 2R8SL 4XXWC 1YDPB 1UB5A 1KBIA 4G7SB 3EGXA 4PJFB 1RK5A 2Y5EA 4JRWA 2XZCH 4O02B 3FTSA 5G5IA 3UZEC 4CVUA 4BSWB 4AWEA 3PBVA 5DVPA 4DW2H 3G8RA 1GNXA 3R06B 1FX6A 4C1NB 2PR9A 1U8MA 5F7AA 2HJPA 2NY4D 4X2UA 3QPQD 3STGA 1T1YA 3G6JE 5A43C 5JIQA 1EL3A 1KC7A 1Y5WA 1BXXA 4RNIA 2DD8H 1JCXA 1EX0A 5IWLC 2I69A 3PHOB 1XIWD 1CLXA 5IGXH 4AL8H 4JMNA 1OCWH 1ZRUA 2XOKA 2YGOA 5EU3A 3R58A 1CI1A 1PJ5A 2B77A 5D1XA 3QY6A 1AFVH 5J04A 3L7EB 3VI4F 1GYAA 3T0CA 4TQIA 4YTQA 5DRCA 2FJGB 2DDQH 5FDYA 5IFJA 2CR6A 3EH1A 2EF9A 3NPUA 2X0SA 4DY1A 4GKOA 1JPFA 1C16A 4U1MB 3SAZA 4Z4WA 3F5JA 4HN8A 4E36A 2XN9D 3BT2H 3R94A 1LT7A 3RHWK 1XYZA 4EANA 4M93C 4X6CA 5IB1A 5K4ZA 1D2EA 3PWLA 4Z1AA 4RM0A 3DG6A 1D6VH 1XD1A 2B5IB 1SUJA 3MBED 1H60A 2GJZB 2WLKA 1PB0A 3GTTA 4O13A 1DQIA 1YIJB 4CW1B 2WZPD 3N2CA 3G6JF 3CQ0A 1QFUH 1TLKA 5FW6A 1TZGH 2CJSA 3N3MA 2K6YA 1CLOH 1FWEC 1KYDA 1D9KB 4YL9A 5K9DA 3ARBA 4GXPA 2ZBVA 4JFDE 4FFVD 1G43A 1H0IA 3T78A 4K07A 4YBQC 3AZTA 1I1YA 3USBA 2C9PA 4FXKB 1QI0A 1XGPA 4NN6C 4WO4A 5DQDL 3NIDE 3TZVB 3L08A 3KS0J 3R8HA 1JS4A 3BFQG 4YTTA 2HBXA 1IXPA 4IUOA 2YL5A 4BQ6A 3N1QC 4K15A 4BKTC 2FQEA 3PR2A 4LCWD 1CN4A 4LHUD 2YD3A 1XD0A 2NCMA 2QMKA 4Z7VA 3FB6B 3AC0A 1NMAL 1V6VA 4YAQA 3DERA 4ZI8A 3OZKA 4DN3L 4LALA 1NTHA 2XKNB 3T8XA 3GVWA 3A12A 5IMMA 4I3GA 5FDWA 4OJEH 2QF8A 5GS1C 4ZMGA 4A7TA 4MJIB 3OXSA 4H6RA 1EBAA 2KLRA 2ZRZA 5DLML 4AD3A 4JMQA 4IIHA 2JH2A 1JYVA 3S4SA 4OCYL 3NIDF 1OHHA 4GAJH 4JGNA 4M6PA 3W07A 1MFEL 2JF7A 3AG1B 3BVUA 5KOVC 1XV8A 2JK2A 4MXWL 4MDJB 5KAQG 4M24A 2VKZG 4L6OA 5TV2A 2VQ1A 1N5AB 4QIRA 1VEOA 1WC7A 3GNMH 4MQ7A 1J8HD 3XIMA 2KH2B 5DJDB 3Q5YA 4HKXA 2P5EA 1OF2B 3ZPNA 2PMDA 5JZ7D 2W95A 2EDNA 1ZCRA 2QCGA 3AS0A 5D71H 4JM0A 5TGBA 3X12A 1PZBA 1AZNA 4U1IA 3CLFL 4WK2B 5ECVA 4QE1A 2AXFA 5IROD 2GAZB 4L3CB 5HVHB 1A25A 1EEZB 4C6NA 1Z89A 3FYYA 5I1LB 1JRCA 1TPWA 3QSKB 1NL0L 1TQTA 2V7NB 4UV4H 3NVTA 2PXYB 3ABRA 2IANE 2XOTA 4ASTA 5CD3B 1WB0A 2BODX 1M57B 3UJJH 1AOZA 1D2OA 5H8MA 1BLNB 1SFHA 3E6HB 2BCKB 4D0DB 5TE7H 4M7SA 4X22A 5FA3B 4DTGL 2C4TA 4KKQA 3IGSA 1OSYA 4LVHC 2F9RA 5HDQL 4J1UA 4GX8A 5CJXC 1RUAL 4MXVE 3NEXA 4QTHB 4U2YA 4C6LA 3TZFA 4PUMA 2H2SC 4GS7B 4DK3A 1SUHA 5LG1A 4F8NA 1PKMA 4N0UA 3T3MB 4UAOC 4WWOA 3TFKC 3TNBA 4D6JA 4KNSA 3Q2LA 2V2TA 3C6LC 3X13B 1A4BA 4APQA 1GOIA 1IC7H 3ZZ1A 4A2MA 4G72B 3C60D 5I30L 5AVRB 1E67A 4IF2A 3RIKA 3PFRA 2DW5A 3MZNA 4OGXL 2AJUL 3TT1L 4KTDL 1H3PL 4LP4A 1JIBA 1I2PA 4QRUB 1DUYA 4R9HA 4KCUA 3OP2A 3SKNA 4HNVA 2V2CA 2QJIA 3EYOB 4I90A 1TSIA 4H0GA 3IJ6A 5A8PA 4NSKB 1U42A 5IYNA 1AG1O 3IVSA 1L6YA 3QARA 4B3LA 1F0LA 4ZD3H 1LNUB 4LLWB 5ANMA 4LLYB 5EFFA 4LSRH 5HY9B 2DM7A 1K9TA 1R9YA 4HH8A 3TC9A 3H56A 2ZUXA 2QTEA 2GVGA 3NQ6A 4X7EA 4Z8FL 5CLTA 2PTXA 1L2QA 1CZ1A 3QDGE 3A35A 1UGKA 3EGSB 4E9RA 1GW1A 2KI6A 3K6NA 1GGBL 2D74A 1JZEA 2EYSB 4RGOH 4YAFA 3SGKC 4JZOB 4HNCA 3TYFA 1J5HA 5BS0D 1IARB 2V7HB 4XAYA 2NQDA 2GREA 7ODCA 1E6XM 4C83B 3IETB 4JM2D 4QY8B 4NOFA 2J8UB 3ZYZA 3RIAF 2P5WB 3WEXA 4S3EA 1XF3B 5C0AA 3ITCA 2W9EL 3IGAA 4FHJA 4YNYB 2PCFB 1JXDA 4GH7B 3PF3A 3W26A 3LBCA 4E0RB 1FJ1B 2X6YA 1JZIA 3U7VA 2NY1B 1EVUA 1LDSA 3U7YL 1CGWA 4QG6A 1PKVA 1C1EL 3MLWL 2J6EH 1F8MA 4UTJA 1AGCB 3KPSA 4LU5H 2YLLA 4IMAA 4QGTA 3VGEA 4JQ4A 1I8UA 4U1KA 3P73A 3I85A 5BROA 1KLGA 3PUEA 5F89B 3PWIA 2XFXA 3MNZB 1XRSA 1IWAA 4UDTB 1DVSA 1JVNA 5JYLA 4JTTA 4XMVA 2QN6A 4J5VA 5EF0A 4TV6A 4A2DA 1W9UA 1I9IL 1R3KA 1HQ4B 2WGNB 4OQTA 2V2XA 4L8BB 2PGRA 3SUVA 1DG1G 5HHQB 4JIQA 2P8PB 1TJRA 2WYRA 5IF0B 3RUGA 5FL0A 1ZT4A 2KZ1B 3ARFD 1BZQK 3HAEH 1NICA 1L0QA 1O60A 1LDPL 2EDBA 2W0PA 4P07A 4S2SB 5FYJD 2PGFA 3PJUA 4X98A 2J7GA 3GYCA 1WA0X 2Z8RA 4X8XA 3WD3A 1V6WA 1E3FA 1BJ8A 1LUCB 3V4UL 2XSKA 1YY9D 5IBUG 1KFLA 1NPJA 2MCAA 3GB7B 3V35A 1CK0H 2VDNH 4QOKE 3V9CA 1CLYH 4YX2L 4GWEA 4ZQTA 2UXTA 2K9UA 4UNIA 3ZKSD 1T21B 2WYZA 1JCLA 3KOXA 1DN0A 3EDFA 1YN7A 4Y9FA 4F58H 1JXKA 1NP2A 1MAJA 5B22A 4IOSA 5E8NA 4PY8I 4PTWA 1MCPH 1E3ZA 1X7TA 1GMEA 1OQXA 4H8WL 3E0FA 1Z9OA 5FKYA 1PUDA 4XXDB 1P0SE 3DEQA 3ARTA 1JG9A 4MNQD 1II4E 3NCXA 5F44A 4K9EH 4I3RL 2WXRA 2EYRA 2NTSP 5JOPE 3V0FA 4FFWC 1TIUA 3A6CL 5CAKA 3B2DC 2ZOXA 5LXGH 1BJMA 1RIHH 2OCJA 5T1KD 5HUPA 3OJDA 1E4NA 3THAA 1OB5A 3U25A 3VWKC 3U1QA 1ZAIA 2YB4A 3L5XH 4JZNA 2Z91B 4JJOA 4DVOA 2AQQA 1NCAH 4DK6A 3TT3L 4NM4H 1BIHA 3NN8B 1OPOA 5IVOA 2OTUB 4XPGL 2AK1H 3F7RA 3G04A 4BQ4A 3HAEB 2FJHA 2DQXA 1FUNA 1I2OA 3P77A 1KM1A 3S8FB 5DMLA 2DMHA 3ZPDA 4NBYB 2PRLA 4IP5A 5LIYX 1R86A 3T2LA 3BICA 3BO8A 2M1KA 4BZ1H 2AHIA 1TTCA 3C5ZD 3JWDC 5DQPA 4JCWA 3TLQA 3WH9A 1KT2A 3KCWA 2P46B 4L4LA 1XR2A 2VDNB 2BNRB 3CUPB 1HXMA 1X5MA 1XQBA 5AD0A 1DCLA 3RMEA 3VDGA 4GAYB 4AXWA 5LBSA 1BD2E 5DK0B 4UINH 4XVOA 4WEVX 3N4EA 1GHFL 1XLKA 4LEQA 1FNDA 1R5VA 1UEYA 5IYPA 1T5XB 1O66A 2NX5B 3P4NB 4MBOA 4BH8A 5D1QB 1A21A 2QPXA 4UILH 4A2LA 3HKFA 4EDWH 4DXXA 2AXWA 2WM0A 3LVTA 1TFVA 4X4ME 2POZA 4RNFA 1D6EA 4KI5D 1C29A 1NGWA 1O1HA 2AMGA 1HGWA 4MNHA 2X41A 3HZYB 3QO0B 4GQBA 3TBCA 4IMDA 2PYEA 1XX1A 3O8XD 4E41E 1D9KD 2E4FA 2LVCA 1SF5A 1LWIA 4NBSA 4ROPA 4NT6B 5HJBA 1CPUA 4H9YA 1L3NA 2DSZA 3N1MC 3U6RA 4LEOA 4M6AA 3GRWH 1FNSH 3MACH 5CPTA 4ICNA 4DX3A 1PSKH 1YLOA 3V8OA 4KJWC 3GSWA 3S9DB 5M94B 4HOXA 1VIWA 2RFGA 4NERA 1PF3A 4P3YA 1T22B 4RMWA 4P8QA 4N2EA 2QJGA 2X4SB 1R3QA 4GYBA 2ZZ1A 4Z7NE 3GG8A 1S46A 1FRNA 1K85A 1J9TA 1D5RA 1XFCA 3RDTC 2WWCA 4R5EA 5D05A 3LERA 4RFNC 3TC7A 1HHIA 4NZRL 1GK8A 3GHRA 3U7BA 3BXWA 1QOXA 1ZBKA 1JGDA 2VDMH 5JPMA 3MHZA 3SE6A 3ZDYE 3B8WA 3GH4A 3LIZH 3WD4A 1SXBA 1ZLWH 1A5BA 1OK4A 3SGDH 4ZW7A 2J4WH 2XTJB 1MRZA 4XQFA 3JXAA 1TMLA 2IQ9H 4MJID 2IBZY 2GG1A 2WLNA 1QLFA 2JBMA 2Y07L 4DYKA 1A3WA 4Y89A 1FFNB 2WW5A 4EI5B 1IHMA 3NESA 3CZ8A 2WJDA 4KVNL 1MWAL 4XPHL 4JXCA 2Y69B 4R0LB 1FKXA 4QDMA 1V0LA 4ADSA 3ALPA 3B8HA 4MKMA 1NPUA 4OCRL 3KVKA 3PZVA 4Z7NF 1FVEB 3D85A 1RZKL 1DQWA 5F7KC 1EJ7L 5H8UA 2I25N 4JTQA 3ISYA 1MO0A 3PN8A 1S7UA 4LEXH 4OF7A 2WBWB 3GYRA 1UH4A 4TUKL 4EOWL 3UTTA 3G05A 4QV2A 1JPST 4PJHF 1SR0A 4HDIA 4PBEA 1PBGA 5C09E 1OAYH 4O57A 3ZDYF 4XODA 5FO1A 1Q6FA 3DX2A 3CFCL 4M8QB 4ZSUA 1HVQA 1A8JH 4Q6IC 4HUCA 1K02A 1XLBA 2QEJA 4LCUA 1IVTA 5LIUX 4Z7WE 2PXYD 4J6RH 1FV1B 4F66A 1PYFA 3MOBH 4QQ3A 3T4WA 1B0RA 1CGTA 1JPMA 3GTHA 1SFJA 4J3OD 2J74A 3MJ9L 2ZONA 5PAZA 4FL4B 1VFAB 1HKKA 1WLHA 5DS0A 4UTBA 3ARGB 2ZE0A 4PMNA 4A8NA 4BH7A 1T41A 3ZMRA 3DVIA 1J9QA 3ZRFC 4U1LA 4FHBD 2VDMB 1Y5VA 3WUWB 4HA4A 1S7TA 4FFZA 4ZAKC 3HURA 4X9YA 1V6TA 4KDTA 1JGLL 2V2WA 2XPYA 4JX0A 3F7VB 4JVUA 1X7SA 4PGBB 5MENE 5LDUA 2FGBA 2FBOJ 3VXME 3LZRA 2Y72A 1E0TA 3FXIC 7ENLA 4FNQA 1M6OB 1EP2B 3H22A 2A21A 2BJMH 3S37X 3NSXA 1GIGL 2Y6ZA 3LN9A 2X4TB 2ATPB 1VLXA 1OCBA 4MYXA 3K4AA 3FTGB 2PURA 2G50A 1YNLL 3CCJB 3OX8A 1MH5A 3UZVA 3GSQB 4MRCA 3T2NL 3ESNA 4YXHH 2E6YA 3GSUA 3PG2A 4GG9A 4ZR8A 5I00A 1RIUH 2EJAA 3QRGH 4U7MA 5JQ6H 2O61A 5JR1H 2FGWL 3D3VE 1WSST 4AVKA 1R34A 2OSWA 1QHOA 3G8EA 1U8NA 3M4HA 3J27A 2FPVA 1LE9B 3FU5A 5EZLA 3RB5A 3BHBB 5AOKA 3CC4B 3EB3A 4Z4SA 3F84A 1ZT1A 3WGUB 4BWLA 5I09A 3EZJB 2ON3A 3ASTA 5AZ2L 3ECBA 3B56A 2WIIB 4QJ3B 5EWIH 5EO1A 2YLKA 4QLJA 4U6VL 4DO6A 4GIEA 1QVFB 5DQJB 5DD6A 1BAFH 3C61A 2FJFB 3FONA 4MA1B 2PDIA 2ZXCA 3N2MA 4FQIL 5BMFL 2UWEA 2R91A 2C14A 3HUJE 5D7HA 3UCRA 4BZ2A 1J5IA 4HE5A 4GT7A 4LGPB 5FYLE 3GIYA 1FWAC 5KW9L 1L2UA 3F7YB 3MJ7B 4AEHL 3BG5A 3E3QE 3WHE1 1A4JB 2H0EA 4YDLC 3MJWA 1U8CB 4EQ3A 1KLUB 1OCNA 3PTMA 4PB3A 4EVNB 4UT6L 3N06B 5IVXA 5FEBA 3CSGA 1XI3A 1CTOA 2XH4A 3NQ7A 2NY1D 1U5JA 1XICA 1VCAA 2ZZQA 4JQXC 1ZP4A 4QG9A 5KVFE 4WX2A 4AGMA 2YMTA 4Y9UA 2R1PA 4LYKA 3AY4A 4YC2C 1RJYB 3T56B 1MJUL 1SDAB 1XAKA 5A95A 1TIWA 2B7QA 3RVUC 3TXZA 1SVBA 2YOAA 1G1CA 2DKMA 1QSFA 3F8UB 2REQA 1A0QH 1E71M 1E1CA 5K39B 1KACB 3J81k 3ZQ9A 2NXHA 1V7ML 4M48L 4WW2C 3ABXA 3P2BA 2UVFA 3AB0B 1GHRA 3TPUB 3MB9A 1HXYB 2AQNA 3IIVA 4QTIH 1ZIAA 4I48B 1UA6H 1VZGA 1ZHLB 5JA9A 3RR4A 3LVEA 4FALA 5DEFB 3D39E 4J2XA 2ZWLT 1R0MA 4PMUA 1FL3B 1AD1A 1RIVL 5J12C 2PTVA 1X98A 1T04B 4XAWL 1VKXA 4EF3A 3ZKNC 1HIZA 1AHWA 3VWJC 3VGAC 4ZFZA 3VE0B 3TBSB 2CCRA 1VF8A 2HEJA 3VH8G 1BZOA 5K9XA 3KLQA 1DE5A 1N82A 2OODA 1MCKA 4RGMC 4KK9D 5CCJA 5FCZA 2DBJA 3O6DA 2WKLA 3ZUGA 2DU2A 4BKNA 3T0WA 5J0BA 3QIUC 3LD5A 4FZIA 1ISZA 3PUCA 4IPIA 2ORBL 1H49A 5BXSA 5EBAA 4QR6A 2ALAA 3HCVB 2VXQH 5D2YA 4ZXBC 4D9RD 5CEZD 3RAJL 3WK2A 4KRMB 3K8MA 2XFYA 3BGFC 5FA4A 4P6VF 5CGTA 3T08A 1W1A1 5BJTB 1YPXA 4AZ6A 4AF6A 1QLEL 2ZD0A 3WH5A 5KANG 4M6UA 1IXOA 1AD0B 3S8HA 4XOPA 2QADC 1J12A 2NV2A 4HSHA 3OBKA 5KITA 3T65B 1S72B 4I1NB 5EU6B 3QIBA 1TYGA 4N5ED 1CCWB 3S36L 4I89A 8XIAA 5JW4M 4I0PA 6PAZA 4CQ8A 1HXJA 5EUKA 5IVZB 3SI9A 3KLDA 4BWWA 3GD1C 4CVZB 4MNGB 4F15C 1LO0L 1NC2D 5CSZA 3EOBB 4BI6A 3L1GA 2E46A 3TF4A 4G5ZH 3Q43A 1LO2L 1FPTL 1MUCA 5K4XA 2X1IA 5ERWA 3UGXA 4Z7UB 2JI1A 4JCLA 4NQXA 1R5WA 4ADGA 3C2SA 2GCYA 1PEZA 4NO0A 1SM3L 4NZ4A 1R3JB 3GSRA 1PCXA 4ZCLA 4LF1A 3P3TA 3TROA 1CE1L 3LQMA 3RCYA 2ZWKA 3VC6A 2VD9A 4J4PC 3UABA 4X4YA 2VSMB 4NKIH 3JV6B 2OMUA 1PV8A 3SDXB 3ME0A 4LNRB 4MZ2A 5DJYA 1UR2A 4Z0BH 5AB2A 4MZ1A 3RVWC 2CBJA 2ICWI 1YQVH 3GIZL 4P23D 2K7PA 5JBEA 3W2DL 3OGCA 4XP6L 3QFJE 4FX5A 4PQXA 2OWXA 3AVEA 5AAWA 2BNRD 1YPIA 2A79A 6ENLA 4FQLH 1GPOH 3HKZA 3ZK0A 1DPMA 4M80A 1WUZA 3OODA 4CSTA 3B7RL 2UY7A 3CC5B 1UR4A 5IOPB 1H7OA 3IF1A 3UQNA 5FXCH 1G1KA 1TO5A 5CPSA 1FORL 4PUDA 3KS6A 1KBGH 4ZUWB 2NX5D 4UNVA 4P2OA 5D1QD 4WI8A 5HNTA 4JZJB 1Q1PA 4MSWB 5DWUL 3QO1B 4JPWL 5L2JA 5F2IA 4V1DD 2B5OA 4ELMA 2WQSA 4GIYA 4PUBH 2YBUA 3RTQD 4FTVA 3RXZA 4PWFA 1MIEH 4W89A 2Y24A 1FG2A 1DDGA 4FTDA 2XIMA 2AQTA 4JRXB 5C2BL 2A74C 5HI3D 4HOWA 1FBIH 1KB9J 4JDBA 4N2MA 3OQ3B 4QRPB 3QR3A 1G67A 4WO4C 4XZUA 4R7LA 3C12A 4K39A 3GSNH 1EFQA 3H7VA 1P7TB 3SZKC 4QROA 2VURA 1IZJA 4HPXA 3QORC 2CZEA 3GU2A 43C9A 3LHTA 1NGXB 3MP3A 4Q4IA 5D7JA 4A7GF 3F1QA 1K73D 5JOFA 3S3PA 5EZOL 4L1XA 3QJFB 5CS7A 2CRVA 2XIBA 3BEWA 5A2AA 4NHCH 4YDZA 3W53A 1C08A 2Q9OA 5AYBA 1NPNA 3ULAB 3MLTB 3UEZA 2YKLL 3NGBC 1MY7A 1KEGL 4EK7A 2R4RL 4MADA 1KB5H 4JFFE 5LB1A 2KDYA 3EXLA 4QHPA 1W72A 3LNPA 2DWDB 4A37A 4UFKA 2Z26A 5F1OB 4D8PA 5DO2C 1NCGA 3G3MA 1AR1D 4GI8A 2HLAA 1EHLH 4LSPH 3FU7B 1G0CA 3S6DA 2R9HD 3QHZL 5L6YL 1JL8A 5B6IA 4G7QB 4EI5D 3E38A 2J7BA 5I1CH 1CFBA 5C8BB 2A77H 3I55B 4L3ED 2QSTA 1GYMA 3UWWA 2NSMA 3A6BH 5T1MB 4EN3A 2FD6H 1BVNP 1OM3H 2Y1YA 3QZ6A 2DUZA 1SYTA 4PVMA 4LLVB 3EZ4A 4MD4B 2VMJA 2X6CA 4HXBH 1KXQE 4BQCA 4IRSC 3C5SB 5IMKB 4FHKA 3QQWA 1EFCA 5AYUH 2Q76A 3JT0A 4LARL 3QUYB 5KWYC 4W9ZA 3JUZA 5DUPH 1SW3A 3ARPA 5LWYH 4XKWA 1YBQA 5DI8A 1ONQA 2Z6FA 3GSNB 2CIPA 4WQMA 4QI3A 2NQ9A 3SQRA 4BEQA 1QSEB 3X3GL 4XE5B 3ZL4H 5C0CE 4P2QD 3IPEA 1CLVA 4J8QA 1L5GA 5C0BB 4KZDL 4Y16A 4MQXC 1A22B 3QUMH 3AMGA 3U3HA 3LNGA 3BUBA 1KCSH 3CV6A 5KVGL 3PP4H 1ZLUK 4FNTA 4H4NA 3D52A 1KTBA 4LL1A 1A80A 5DJCA 3ARGD 4ZO8A 3OR7B 2BS8A 2X2UA 1K28D 4JS3A 2DL2A 3TCSA 1Q5MA 5CNHA 1KB5B 1PZDA 1M1XA 4S0SD 4DPCX 2QIWA 2Z0UA 1F6KA 2VFIA 5HSFA 3ML8A 3LSBA 5BO1L 3EWBX 2E7CA 3ULUL 1FSKB 4AIZB 1XB3A 1EDQA 4R7NB 1MRQA 1P9MA 4K6AA 5DXWA 2R51A 4R7VA 2VDOL 2H8ZA 1YNKL 1DQML 4FWTA 3AXKA 5SX5H 1I7ZB 2CK3A 3EYFB 4CQAA 1IM3A 4JTDA 3B34A 3O15A 3DO4A 3CLWA 4EXPX 1QUNA 1WD9A 2M8XA 1J0HA 4JDYA 3D30A 1EPXA 3P02A 4DJFC 2ZKHH 2BVYA 1M2VA 1JDDA 3T3PB 3C2VA 4NPKA 4C6IA 3N9GL 4OLZL 3ULVL 2YBGA 2YK1L 3PUOA 2FEDC 1UZ8A 1XH3B 5JUEH 3KVJA 4NNXB 3ATZA 2HRHA 3KS0H 1E70M 5TR9A 1FWCC 3RX4A 1A5FL 2XZQH 1VPXA 1FZMA 3OW1A 3CVHH 2G96A 4XNFA 3GK8L 3RUBL 3BE1H 2Z8SA 4ZOAA 2MKLC 1BEYH 3PNZA 4LTSA 2L0DA 4ACBA 1F20A 4XNMA 3ABKB 2WB5A 2GKIA 3HOGA 3NQKA 4F8TA 3QUMB 2J27A 1QAWA 35C8L 3VOGA 2D9QB 4RNHA 3EJZD 3AUVA 1GYWA 4Q4OA 4JN2A 3EOEA 3MRMA 2ATSA 5A5WA 4K2UH 3VFWB 4LP8A 3S2JA 3W56A 5I79A 3MSRA 4JG1H 2DZBA 1SGKA 1ORSB 4CADA 4GG8A 5DD3H 4JHUA 1DORA 3KOFA 1OTSD 2YZ5A 4M8UA 4WGWB 1JK8A 3VTMA 1FVPA 3BUIA 1IGFH 1NF0A 4TX9A 1BG9A 4APXB 2AL1A 3MRQB 3TA3B 4OOXA 3B9VA 1U3HA 4HMEA 5E4EB 4OCXH 2EZ0D 1XLIA 3AO0A 4LS0A 1Z66A 3ESUF 3TYZA 2ZCKH 2WP3O 1QFHA 2Y1AA 1HIML 1KRHA 5CKAA 3SCMC 3AUWB 1UACH 1BRLB 1DLHA 4G7EB 1QVOB 4PTMA 4YSAA 4B9JA 2YAFA 3W82A 4MVBD 3GBDA 3URBA 3NQEA 2HRWA 1HYSD 4GKSA 3TV8A 5ACMA 4DELA 4B2DD 3SDCC 2V6HA 1OZMA 3CL8A 3EJTA 5IHWA 5KBPA 1S7XA 3LHYA 1KTKE 2ACQA 4FQXA 4BS0A 4BFEA 4MAYB 3E20A 2ZPKH 5F9OH 3EYUH 5J56B 4J3ZA 4PRAA 5GNZA 3F5WA 1OP5K 1S7RA 1NEYA 3FO2B 1JRBA 3CVHB 3DETD 4PJXE 2VLKA 3RU6A 1BW8A 3KRBA 1HE7A 4XBSA 3VOIA 4GC4A 5I66B 3QHTC 1EJFA 4IHOA 3LCHA 3T6CA 1IT0A 1IGCH 2VLRE 2GK6A 4GVHA 3WNDA 4BFBD 1XFBA 1F3EA 3MWAA 4QWWC 4XP9L 1GYNA 1ML0A 5HDWA 5IFHH 4N6RA 1MUMA 4AY8A 1PKQE 4PMDA 4MHHI 2FPYA 3TCTA 2ZT9C 4MAUH 1RUKL 3KDOA 3VQ1C 4P2RE 5HD8C 1ZFJA 5LGKA 3TW7A 4LSQH 3UR2A 3KLKA 2VC9A 1OT4A 4DXKA 1HZEA 3KR3L 4BV1A 2O6FA 2EILB 1LRTA 3F3HA 4WAFA 2KUTA 2EAWA 3S9IA 5EU6D 4Y9PA 3R0NA 5KSAA 1E9LA 3RBGA 4ESKA 3X11A 1Z5HA 3HNTL 4ZE4A 1MCJA 2HUEA 3QXWA 1WDTA 3Q8CA 4HK3J 4RRPA 2I9TA 5GRXG 5DN1A 2PLFA 4GUPB 4YHPA 4UQ3B 1DQJB 1T7YA 2CMRL 4ONOA 4ERAA 1QPQA 2CCLA 3LNDA 3PHQB 2VDQH 2HG5A 3NXLA 3T4YA 2PDGA 4M5ZL 1U3ZA 3WFZA 4KJPC 1R0AH 3I75A 3K13A 3MLXH 3GEFA 4JX5A 3GIVB 4G1EA 2ADGA 1ZS2A 3FCUB 4XD4A 4RPBA 1DBKL 2DBLH 5K3VA 3MLYL 4PGLA 2Z8WC 2JCCE 3LXBA 2OU4A 3L3IB 3W72A 3VIMA 4JKKA 5TPWL 3WFBL 3MJ8A 2NNAB 3N4AA 1EGZA 2W5FA 1XLCA 3ASPA 2V9TA 3ROOA 43CAA 4A8RA 4YDJA 3ZJ6A 1QLRA 4K94C 3NR0A 1N12A 1G6VK 1J8VA 3LAFA 1XQLA 2QR0B 1B6DA 3O3DA 5DMNA 1ONWA 1TJGL 4ZUTB 4DQOH 5F0MB 1A65A 4GKZA 3IJSA 5I3HA 2IVFC 2OXGA 3OHIA 3DX5A 1MFVA 3QJRB 2VM9A 5JHDB 3IRSA 3MV7A 3FB7B 5D70L 4TX6A 1DKWA 5LO7A 3BQ5A 3T0EB 3OP1A 5FYKH 2IXQA 4WF7A 1UXSB 5HYIA 2QPEB 4O2CB 3MYJB 3OMZA 3CFBA 7A3HA 4RETB 4JRXD 1XGEA 4N85A 5M17A 3NZPA 1TEFA 5H2ZA 3UZXA 5KBMA 3KCJA 1BOGB 3S3SA 5FGCB 3L4CA 2D3VA 4QRPD 1HOCB 3HMWH 2VDQB 1JNLL 3RM8A 1S39A 4WEMB 5AVYB 1A0CA 3TJHC 1G4RA 2DWSA 2OMTA 1X7QB 3O8AA 3MP5A 3KLHD 2AEPH 4HG4J 2QVFB 1TG7A 2X2GA 3M5YA 3ITOA 5TF0A 2YQBA 2R6OA 5A7BA 4LWWA 4YS4A 4P3CH 1BZ7B 2EEBA 4OLYL 3QHOA 2BVPB 4Q8UA 2QVHA 1JFXA 3MLZH 3RI5K 1A4MA 4LSVH 4WI0B 3TH3T 4F8OA 5BV7C 3PWPA 3QWQB 4DJED 2O6DA 1HYRC 3BGMB 2Y7LA 4FA3A 4D72A 4Y2OB 1NANH 2E75C 5FWQA 5CN1A 3EAKA 2GBUA 3VFPA 5EB8A 3I9IA 5FS5A 5IFAL 4DK0A 1NELA 3HNSL 4UBDC 4Y1AB 5D7LA 1I1AB 1M05A 1SY6L 3FQNB 2PPEA 1HHKB 4N2CA 2OQYA 4Y7MA 3FQUB 3N4FA 3DHMA 4ONHA 4OZIA 3QFRA 2W62A 3T09A 5DANA 4YWIA 4GG6A 5LGYA 4BQBA 1JUFA 2YYTA 3IWVA 1XCFA 3INOA 5A6JA 5EORL 1QI3A 1RPKA 2F5BH 3VOJA 4LC0A 2WQWA 5CPNA 2RUSA 1A9EA 1NBMA 3ANUA 1QBML 4ODBD 2EIMB 3P11H 3S2LA 3B9KA 4NFBA 3GBMH 4LRIA 4G3YL 4P06A 3KVLA 2YOCA 4ODSH 4RNRA 5A8GA 3NAVA 1R3LB 3OO2A 3EWDA 3LSOB 3E0GA 4NPJA 5JXED 5CJ8A 1IGMH 1YVLA 2ITDA 3CQPA 4GEIA 4NX5A 4WY0A 3QUYD 3VVWA 1MNUL 1ZSHA 1X1OA 3L5IA 4R3SA 4WJG3 3VD2A 2K7QA 1A3LH 3INUH 2OJPA 4PJGE 5FV2A 1G9HA 3W0WB 1OD9A 3EFFA 3TQVA 4YAOA 1QSED 1A4LA 4HKZA 4W9DC 3NDOA 2Y06L 4RRPM 2MNUA 3FHAA 1KFEA 4AZCB 3W37A 3GC4A 5DMMA 1U2YA 3QNFA 5C0BD 2NY6C 4OZOA 5T33H 2X4RB 3QHMA 3WNIA 3FFCA 1LGVA 2AZUA 2XM2A 4U1GC 1TV8A 1TV2A 4DLFA 1Q9KB 5T3XH 2AF2A 3HAGA 2GITA 3EGJA 3NZUA 2Y61A 4S3FA 4ZV4A 2BDNL 4TVPE 1O7DE 3SOBL 2OK8A 4FA8A 2EO7A 4HT3A 2TRHA 1I8IB 4K5PA 4D8LA 5DTFA 1R17A 1OAUH 4DZ8B 1WBHA 3PXHA 3E2RA 1A7NH 4LUYA 1RUPL 2X7VA 3QUXA 3KGRA 1KBLA 1ZVNA 5E5MA 3MV8E 3UZQA 1UM6H 3KXFE 1MF2L 1RH8A 2DIJA 2HP4A 5IHRA 3O11B 2OZ4L 5IM7B 4YLQT 2A7RA 4MJ2A 5GGVY 3D2UA 4QHNA 1YXYA 4ZS7H 4WR3A 4WFGE 4M5SA 4S3GA 3NABH 1N3NA 6REQB 3UXDA 2BGSA 3QQ3B 2DJUA 4NFDA 2PWFA 1BLIA 2FZ3B 1Q1JH 2HH0L 3TO2A 1I2RA 1S7QB 1JUEA 4P9ML 3M17A 3UCCA 2WMJA 4Q4KA 4NZUH 2XEXA 1DWHM 1FL6A 2Z7YA 3T77B 1IEAA 2PZ0A 2LTQC 1WQVT 3TCLB 4DZAA 1GKEA 2E25A 1T1XB 5GNYA 5HJ3B 4X6DB 4ODHH 1OAKL 1UR8A 5LNDA 5F4OA 2OKTA 2Z7WA 1JMXA 1JHTA 2R1YA 5AOZA 5DC0A 1NIEA 2R24A 2AAAA 2F7IA 1R6WA 3LQAH 3BT0A 1GJUA 4O15A 4LAOA 3V5CA 4HWNA 4QXVA 4UR7A 4JQVA 5JPNB 1GAQA 1LZOA 3VVGA 4K3ZA 3P9MA 2HJLA 4O17A 2W91A 3QFDB 4JO2L 4RQQB 3MROB 4GUCA 3ZDWA 2DJLA 3PNWB 4X8IA 1TFPA 1O9ZA 2HSAA 7FABL 2Z3FA 1VB9A 4GUGA 4W7UA 3OV6A 1AR2A 5DHYB 3RNKA 1Z42A 2GK1B 1ME8A 2OX5B 2JJ1A 3NQFA 5D1ZI 2GJ6B 3BO9A 1GSKA 3OOQA 3HG1D 1F4HA 1MFNA 1G01A 1TUIA 1CLZL 1FE8L 3AT0A 3BYYA 3CMEB 4UV7H 4DEPB 3ZDZB 4HHHA 3S5OA 4EE2A 3RU8H 3S4TA 2VJJA 3TLLA 1QW9A 3WQ8A 3TA3D 4NBXB 4LUSB 1WIPA 4G71B 2IKIA 3ERXA 2BRQA 1BQLL 5LZLA 4IU3A 3PBGA 3W57A 2EVHA 1CFVH 3IGHX 4IQHA 4LCCA 3IVKB 5CUSH 4FN5A 1Y6NR 4FQ1L 3QV6A 3TIEA 6PTDA 2OL3A 3RJYA 4GZIA 2V37A 1IIKA 2X0HA 3TO4C 3ZBUA 4D0CA 2XNAB 2BC4B 3EYQD 3VUPA 5DELA 3MKKA 3KPRA 5EBLA 5KZEA 3IAQA 4G8FA 1DVFC 3BLBA 4RZKA 5AWNL 3WJJC 3W7OA 3RY8A 3QEUB 1L6WA 4RXGA 2G9HB 5EEZA 3ARSA 1JQXA 4AVZA 1HC1A 1B6UA 1F56A 5AFAA 1IAII 2HV5A 1H3WM 3T4AB 4KFMA 4FLOA 1ORQA 1KRBC 2EDKA 4AQOA 3CU2A 1P7QA 3DSFH 3FN0H 4N4PA 3H24A 4MXVF 4FQQA 1L0XA 1F3JB 3TEVA 1ZVSA 2Z2BA 4CC4C 4XKYB 4RMBA 3L9RA 1E30A 1K9DA 4KZEH 3VGHA 4JX4A 3AQYA 4BHUA 1G7QA 5C0EA 1Z44A 5GHWL 1EEUA 5A2FA 1EHKB 1S5IH 2HRPH 3TCEA 3G6EB 3MBWB 4PU2A 4X5XB 1FCUA 2R1MA 3OZ9L 4UMCA 5J9PB 3U9WA 3MA7A 5CN2A 4TIMA 4N2KA 1XCTB 2WSKA 1TQXA 3DVFA 2AI0L 1D8TA 3GC5A 5FF2A 3QJVB 3R11A 4EPKA 2DGAA 3E96A 5GS0H 3ECVA 4WHTB 4MFEA 3FMGH 1ESOA 1R3HB 2CYGA 3BXNA 4ATLA 2C7UB 4IK6A 1E1EA 4ZFOA 2R9VA 2F6XA 4I0PC 2DSUA 3UYCA 1ZV9A 4DP8X 5KVMC 5TH2A 4TMCA 4F79A 3FB8B 3MRJB 2Q86A 4ONGL 1P5VB 3I6GA 3WNNA 3R1ZA 1BTMA 2FSEA 3H42H 4JHOA 2UZ9A 3J07A 3G6DL 3QC5X 5XIAA 4LKXA 4HIIB 4YHMH 5LSMA 2I9UA 4QXTB 4ZNEA 3U7WH 4AW4A 3I7RA 4FZEL 1ZHNB 2V8ZA 2DQFB 4LVBA 4I7VA 2J56A 1B4EA 4U1HB 5HHXH 3QNYB 4GACA 4QG8A 1MABA 4QS6A 2Z4TA 4MJJA 1U30A 1XGQB 5LHEA 1BYBA 4KK5C 3FCBA 4K38A 1ME9A 5HJLA 4ZQNA 1XUUA 4ODXA 1SFLA 1N7ML 3OVQA 1KZLA 4JIRA 1I8LC 3WNOA 4D9LL 1ZM3A 3W2NA 4ANVA 5HJXA 4BKSC 3C08L 3OKXA 4KKAC 1INEH 2MPVA 1OIOA 2R69A 4POCA 2OSYA 4MWAC 2AMXA 4P2OC 1XGUB 5ICXB 1XIWA 5JHDD 4JO5A 2BSTA 1CLCA 3WH8A 1GEQA 4NC1E 3DGRA 1W3IA 1KM3A 3AG3B 3T0ED 1DE6A 2VO5A 1BSLA 1LJMA 4G42B 1M6JA 4RCXA 1PHQA 5DRXA 4MYPA 4KXAA 4XMKL 3WF3A 1XF2A 3O3EA 4H19A 1MHPL 4M43H 3T55A 4Y5VB 1JFQL 2HRGA 2E4TA 3S1GA 4PTTA 4G1MA 1D7BA 1BVLA 4PV9B 3JVGC 3MCAA 4NJ9H 1FGNL 1D5ZB 4WZTA 4KX9A 2WMPA 1BQHB 2XN9A 1N2VA 3H2NA 5XIMA 2FWLB 3CBWA 2FX7H 2AJ3A 2OS7A 5TE6L 2YJQA 3UG8A 5F4WA 4YL4A 2W0KA 4JRFA 5IQMA 3H2FA 5KSVA 4WGHA 1IO4C 1VBUA 4NIKB 4DF9A 2RMNA 2QSCL 5A6MA 2YR1A 3KWUA 3DPDA 3L23A 3GHBH 1A14H 5C9JB 3DDGA 4YELA 2IQDA 5H4YA 3DX0A 3DKHA 1B4LA 4E5TA 2D7PA 4QLRA 3U4FA 4ZB5A 2E9IA 1HTIA 3M46A 4X07A 1WKFA 2DMGA 4M1DL 4PC7A 1WA1X 2R0ZL 3JYCA 2J1XA 1SMAA 1INQB 3DBSA 4GVIA 1PKOA 1W17A 5ICZA 4HYRA 4AZIA 3B9DA 2XBTA 4PR4A 2BOLA 1B4JH 2YD7A 3A8IA 2P47B 2H26A 4JFTA 1FWBC 5GVJA 4AAJA 1I1AD 4RZ4A 1KYOJ 1W8GA 3IIXA 4LCWA 4HPOH 3DBXB 4WUKH 1B1YA 3L1FA 4LHUA 4QRAA 2PLKA 3BV4A 1Q7ZA 4M7LL 3CMOL 2QZRA 1TZAA 1J5OL 2YX0A 4PRNB 5AENA 2XG4B 2PCPA 6A3HA 3V6OA 4DEWA 1LD9A 1XAUA 5THXA 1PYWA 4HYVA 3P3RA 1LE5A 1WYIA 2D03H 1Q45A 4JFZL 3A4XA 1VRSA 3WKNA 3RZCA 1J1XL 3L4UA 3MNVA 4EI6A 3ZIZA 2OJEB 3BVXA 4MMXB 2EE6A 3NJIA 5HYSG 2IFFH 5I5RA 1IBDA 4UQIM 4WV1A 4FQ2H 5CBEB 3BJLA 1BBDL 5LDSA 3H4XA 4P8VA 4JAMA 3JWNC 4FGMA 5JBQA 2G5BA 4H2CA 3W0WD 1F86A 4II3A 2P1YA 1DFBH 2OVLA 1S5VA 1J8HA 4C58B 5F3HB 3I2CL 2KDGA 2Y5TA 3M5ZA 2E6QA 4BQ2A 5CJ5A 5FO9A 5C9WA 2OR9L 3WS3A 5C0DB 3BE7A 5DZ9A 3US0A 1L6SA 1A6PA 5TQ2L 3P84A 2E77A 3TZVD 3R8QA 1AE6H 1SEQH 1XL9A 2ZWYA 4ZMVA 2A2QT 2Q6WA 4QP0A 5AOLA 1E4KC 1H1ZA 1RZQA 5ENLA 1XE1A 1LO4H 5C3LD 4FG6C 1ZS8B 5D7KD 3IUDA 1J8RA 5IKCA 2QGHA 2F54B 3O07A 3HC3L 5IROA 3GMPB 5DSCA 1G7SA 2J88A 4M29A 4FF5A 1IM9B 3PPGA 4J7RA 2BOCB 3NJ3A 1QQDA 3AVXA 1KCWA 3V6ZA 4ACAA 4LV9A 5LA0A 3SQSA 2Z35A 4F0MA 2RA1A 4Q4RA 4N2BA 3RX7A 3O3BA 1BZ9A 2HLFD 4NNPL 1RK0B 2JK5B 4LOVA 1P6CA 3OKOB 1W5PA 2H0JA 5DJZB 1PO9A 2EBNA 5J1AA 1E5YA 3BVJA 5GJTL 4G7YH 2E3VA 2NXGA 5HGHA 2XZLA 1NBVL 1D5XA 1MEXH 4KKXA 5CZKA 4G8GE 4XPAH 3OR6B 5I26A 1S8DB 5E23A 3M8OL 2ICWJ 5DJAB 1V7AA 2AW2A 3GNDA 1YZZA 3MRLA 3OKLB 2IQAB 1NCIA 1XGRB 1FTXA 3B8YA 1KTDB 5CILH 1RK7A 4GLRH 2V5JA 1TITA 2CDGB 5G4EA 4AUUA 1E50A 2EKSB 1GKPA 1L9OA 5CZVL 1GQIA 3M0XA 3U0WL 4TV5A 4WRHA 1U95A 4CNIA 5GRVL 3VNIA 4ORGA 4N5UA 2IPKA 1J05A 1YY8B 3QG6B 1TU2B 5B1JC 2DY3A 3PV7A 2DERA 3WSQH 3TJEH 4GHRA 3CN0A 4GIAA 5A6SA 4RX4D 1OFRA 5E2TL 1FBAA 4XLFA 5JLZA 4AITA 1F74A 1NFKA 1V51A 4N26A 3W1PA 4KHXH 5T3XD 5GSRA 3ARVA 2CLVB 1QTSA 2XDFA 3KYMB 5CD5D 3D4GA 5CC3A 4PGDA 5DWPA 2Q2EB 1CFTA 2GJ6D 2VKWA 1VESA 4MB5A 1HZHL 3CXCB 1E2ZA 4NKDA 1QOKA 1WWWX 4LF2A 3TR2A 4O2FA 4CD7A 4RZBA 1P4MA 4LBAA 3DJRA 4PJBE 5J8LA 3THUA 2GUYA 2DEXX 3MLUH 3EHBB 1JV2A 3NIFB 3IIOA 3OB8A 3QSRA 5E8OB 4O00A 5IQ7L 3C2FA 1IXNA 4FIQA 2O6CA 4JNXA 1MNSA 3Q65A 2HSIA 5K59E 3WFDL 4UR8A 2NQJA 1CJYA 4OB5H 2Y8UA 2ZL5A 1YXCA 2EABA 5I3DA 4GBXA 4K7PH 1N64L 3STLA 1Q38A 2C1OB 2C91A 4Z7WF 1SXAA 3MUIA 3QWRD 1T0MB 2B1HL 2NY3B 2PODA 5E95B 5C0QA 1BXCA 5LCVA 4LPXA 3HRZA 4IBQA 4M6OL 3QDMB 5IFPA 2W5PA 1BMZA 5JORB 4H1ZA 3AVUA 3U4BL 1RU9L 2YO3A 1MRFH 5HI4C 2MH4A 1TRDA 1K2DA 1COBA 3SR7A 3NDZA 3MV9B 2Y3AA 2VM4A 1FNEB 2X3BA 4LPUA 5I15L 2KT6A 3VFGH 2XV0A 3NQDA 2V9QA 2YXGA 2C9UA 5GISH 1JGUL 4XRCB 4YVNA 1L3WA 2P8BA 4JR9L 1WFTA 3EYPA 4PBFA 3U57A 3FO1A 3S88H 4AF7A 4WZLA 3QCTL 3J7HA 1LWHA 3QUZC 1JVOA 4L9LA 2P5WD 1ESWA 1Q9OA 3TU6A 4YS1A 5E2VL 2ZZGA 5GJSL 5IHZA 2BINA 4N02A 1UWRA 4P5KA 1LEKA 3C8KB 2X4QA 2HJKA 1WAAE 5EZJB 4L0YA 1XSKA 2GC7C 4Q8MA 1XXDC 2EKCA 3UCDA 2EFGA 4NGHL 2CUHA 1RKRA 4YEJA 3Q44A 3FRPG 2VNKA 4RGNC 1YNYA 4ODUB 3SUWA 3UYRH 4FLHA 1QSVA 1KJ2H 2I60H 3G6AA 3NCYP 1MFBL 1A3RH 3RWDA 3RYSA 4DZ5A 3D25B 3VZXA 1YJNB 3ZUCA 2NUYA 2VIRA 3FCTA 1FZOA 2DQHH 3OHXA 1WISA 3C56A 4RMUA 2LU4A 1W3KA 1RZJC 1TVPA 3WD1A 4MNQA 3Q0HA 1AIPA 3CXDH 2GQ8A 3HUJF 5KYUB 3E02A 5HPCA 3TBTB 3STCA 2CIKA 2IO5A 3KDMB 5FYJU 3QFTA 3AGQA 5EULV 3H2PA 1QFZA 4MXQD 2CHNA 4C6DA 4XHJC 4OZHB 1OAXL 3QJUB 5J7CC 4QSFA 5HMSA 2ZSVA 3IMUA 3VQLA 1YDPA 1F4WH 2V33A 3GIQA 1OHQA 3ISIX 4QTGA 2ZG3A 4O02A 3OVPA 4W87A 1J9ZA 3UC0L 4OSUL 4ERIA 2ESVE 4LDCA 3ARDB 4TQEL 3ZE2B 5CGYC 3T44A 4HXAH 3C09B 5FJUA 1G7IB 1ED3A 5HANA 1JOIA 5HI5C 4KUZL 3FYEB 3KP1A 1HVXA 1KNWA 2NQZA 1ODAA 3B3IA 1E42A 5GS0D 2ICEC 1CXLA 3S3DB 1W0WB 4D7BA 1LG1A 3C5ZA 3LPFA 3WHE0 3GBLA 2H2PC 3RDKA 5JIKA 3JWDL 1W87A 1UASA 2CK2A 4UQBA 2ZG1A 3JQPA 5ADPH 3HR6A 4OCNC 3KHQA 3ZHDA 5KBLA 4GEJA 3LOWA 4H9ZA 3EUDA 1B3JA 4UFHA 4G6KL 5D5MB 1KJ2B 2IXUA 3TBWA 3T0VA 1QVGB 4LPYA 4OZGA 1UZ4A 1OAZL 1FNMA 4GRWB 5JW3H 4MGXA 1TJXA 2VJ0A 3HPLA 5ECGA 1UD8A 3JV5A 3BLLA 2ZOKB 2X9YA 3N55A 5T5NF 3AYTA 1U3NA 2Q8BH 1DIEA 3QG7L 2VLJA 2E8ZA 2NSQA 3KBHE 2P5NA 2BIPA 1YAZA 2MPAH 1C5CL 1BYOA 2IAAC 5JIDA 4D7PA 5BOFA 3O8XA 1NTDA 4XUYA 2YGQA 3QZMA 2Y22A 3DI1A 4PTNA 4HTBA 1SN5A 1R3IH 3FUEA 4GW4B 5E2UH 1E43A 4LUTB 2Z7KA 2GIXA 2IADB 5I3KA