3BCEA

Crystal structure of the erbb4 kinase
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
289
structure length
285
Chain Sequence
TAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNAGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanism of Activation and Inhibition of the HER4/ErbB4 Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Receptor tyrosine-protein kinase erbB-4
total genus 81
structure length 285
sequence length 289
chains with identical sequence B, C
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3bceA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3bceA01
4RIYB 3B8RA 2R7BA 2O64A 2YDKA 2BROA 4M66A 4QP3A 2Z7QA 3G9LX 4WD5A 3ENMA 4AXAA 4DLIA 1J7UA 4XG4A 2ZV7A 4CKRA 3GT8A 3NW6A 4IZAA 4KIKB 3MS9A 4PQNA 1FVTA 4NW6A 3ZO2A 4ENYA 2J0JA 4JIKA 4X2JA 4DH5A 4D1ZA 3UO5A 2OH0E 2CGVA 5CEIA 4EZ7A 4M12A 5HIDA 4FT3A 3BYOA 3MFTA 4Z7GA 3QCYA 3LFSA 3SG9A 4WNPA 3VUIA 5CX9A 2VTTA 4KSQA 3ANRA 1DI8A 4UWBA 3FMLA 4F1OA 3PYYA 3NUUA 4GRBA 2B54A 4JG6A 5HHWA 3BLQA 2GHLA 4BDFA 2QU6A 3TEIA 5K5NA 5AR7A 4CYJA 3H4JA 4EBVA 3OTVA 4JQ7A 4I6HA 2C6TA 3DY7A 4UMQA 2CGXA 5I5ZA 3DBCA 3LMHA 4RX7A 3UO4A 3U9CA 1OL5A 4X6QC 5FXRA 5HG8A 4NM7A 2O63A 3QL8A 1M14A 2A1AB 3C4CA 4P4CA 3ORKA 3FUPA 4W8EA 2C6EA 3A7GA 4G34A 1KE5A 4XG8A 4AGCA 4ANSA 4CYIA 4IMYA 2BAQA 5CI7A 3VF8A 3U6IA 3KQ7A 1WBTA 1OITA 4DEHA 2W06A 3ORPA 4O0WA 2X4FA 3V5TA 3A7HA 3HV4A 3P5KA 4CGAA 4M68A 4D9UA 2JDRA 1KE9A 3DPKA 3GOKA 3VO3A 3DJ6A 4RWJA 2YLFA 4OAVB 2C1BA 4DEIA 5L2TA 4HCVA 4ITJA 3UBDA 3UO6A 2VU3A 5ANEA 3QFVA 3GP0A 2PTKA 3ACJA 3DS6A 3QGYA 2XCHA 3RK5A 4O83A 4IFGA 3TUCA 3BU3A 5DE2A 4U3YA 4RIWB 4KBAA 5EDPA 3TTJA 2RSVA 1PYEA 4EK8A 3PXZA 3IW6A 2PYWA 4HNFA 4OTDA 3TNWA 2XIKA 3EJ1A 1Q3WA 3HVCA 4WT6A 5EKNA 4KNBA 1BKXA 3D9VA 5F9EA 5BYYA 4RG0A 3CC6A 3D7ZA 2ITZA 3RBWA 3Q9WA 4Z16A 4A9SA 2ITQA 4OBQA 2VTAA 5F4NA 1XHAA 1ZMUA 3OWPA 3FPMA 2XNMA 3BE2A 3OVVA 2ITNA 3R22A 4O7RA 5L2IA 3R01A 2B9JA 3LOKA 4FKQA 1PMNA 3QWKA 4G9CA 4CVAA 1JKTA 3QRJA 3CGOA 4FV4A 2IN6A 2QONA 3DJ7A 4D58A 1PHKA 2G15A 4KKGA 3ALNA 3OWLA 4JAJA 4YSJA 2VV9A 4YBKA 2QO2A 3T9IA 3DLSA 3OEZA 4L3PA 4R78A 2JDVA 2UZDA 1ZAOA 3SX9A 5KX8A 2OKRA 3TN8A 4WBBB 3EZRA 3RAWA 1FPUA 3HDNA 3FY2A 2B53A 2PSQA 4U79A 4DH8A 2QOQA 2RFDA 4GYIA 4O1OA 4AOTA 2HELA 3AMAA 4I94A 2VWBA 3BRBA 4KIOA 3ZLYA 3WF7A 1OMWA 4PMPA 2YJSA 4YBJA 1YOLA 3GCPA 3O8TA 2IZUA 3PZHA 3ID6C 3AD5A 5CAUA 4U44A 4O27B 4ACCA 3A7IA 4MD7E 2DS1A 3TUDA 2WMBA 3EQCA 4PNKA 5D7AA 3IKAA 2JKQA 1MRVA 2NNWB 2QQ7A 1CMKE 2UW9A 3FMJA 3IDPA 4FV2A 2C5OA 3FL4A 5JFSA 2ESMA 2XK9A 5KCVA 4JDIA 3UVQA 4FKRA 1JBPE 1KV1A 2Z7RA 2YIQA 4O91A 4CV9A 5C26A 4O7YA 5AV0A 2X7OA 3HMNA 4IX3A 4NUSA 3AT3A 4GH2A 4TY1A 1F0QA 4W8DA 4WRSA 2Z02A 4FKJA 5IUGA 4Q5HA 3TIZA 4ASDA 3KMUA 4U6RA 3W2QA 2BKZA 3TWJA 3DKGA 3NAYA 5DA3A 4DG3E 3RHXA 4F9CA 3HRBA 4JVGA 1S9JA 3HP5A 5IA5A 5KMMA 4WSYA 3Q9ZA 2I6LA 3VJNA 5EW9A 1J3HA 4TNBA 3DXPA 2VD5A 3TKHA 4ZTLA 3ZFXA 4JG8A 4M15A 3ZFYA 4IWQA 5TR6A 5IQGA 3I0QA 3DFAA 3OD6X 3QX4A 4L46A 3SHEA 4ANOA 1AD5A 4PL4A 1YHSA 4K8AA 3TV6A 4AA0A 3QKKA 3OS3A 1M17A 3NYVA 2HY81 2XK4A 3EMGA 4WUAA 5IH6A 1Q8WA 3MB6A 2Y9QA 3BGZA 3DTCA 2QI8A 3GU4A 3IECA 3DK7A 3QCQA 4XG7A 3HMMA 4RVLA 2YM4A 3KK9A 3BYVA 5JRQA 3RWQA 5BUJA 4MF0A 5BVOA 3PA4A 3G6GA 2A27A 4IB3A 3TCPA 3MA3A 3P86A 4UZHA 3BYUA 4LL0A 2W1ZA 4FZAB 4YHJA 4DGLC 3O50A 3W1FA 1R3CA 4E8AA 4GW8A 4L6QA 4TT7A 3CD8A 4OBPA 4XMOA 5C8MA 4NK9A 2GS7A 4L42A 4V05A 5E7RA 1JKLA 1MRYA 3MTFA 3RTPA 1XR1A 1ZY4A 2J4ZA 3QC9A 3O8PA 2FH9A 3UG2A 2PUUA 4Y46A 3ETAA 4IZYA 4XEYA 4BCNA 1XBAA 1UWJA 4CFMA 3AGLA 3QLGA 2ETMA 3QTSA 5CT0A 5DHJA 4YJUA 5DT3A 5CY3A 5H8GA 2X81A 1KOBA 3IS5A 3OEFX 4Y85A 5ACBC 3DBDA 5AUZA 4U7ZA 3LFDA 3BYMA 3A7JA 4FSMA 2JKOA 3GBZA 2OJ9A 4PMTA 3QQLA 3V5WA 2WMVA 3KRXA 1REKA 3LQ8A 3VBXA 3C4XA 3PIYA 4X3FA 3ZXTA 4FKLA 2W9ZB 4LRMA 2HK5A 3OT8A 2WTCA 2OF4A 3QTZA 3A4OX 5JZNA 4CRSA 5GINE 2XIXA 1V0BA 4A9RA 5J9YA 3JYAA 4BGGA 2W99B 2XF0A 2C6MA 2ZYBA 4O84A 3FZTA 1T46A 3BHUA 3ZOSA 1UU7A 4B6LA 5C27A 2J5EA 3NZ0A 2WMWA 4H3BA 2FSLX 4I23A 3G51A 1BLXA 5D11A 3DZOA 3G0FA 3COKA 4XG9A 4FYNA 1J7LA 4DN5A 1XJDA 4CEGA 2WMAA 3PVBA 3KEXA 4KSPA 5G1XA 3ZH8A 3DFCB 4JRVA 4NJ3A 2IVTA 1MRUA 4G3CA 1J1CA 3L9PA 4O0VA 3C4EA 4LOQA 4QMMA 1XKKA 1OECA 3DXNA 3PJ8A 4QPAA 5M4UA 4C37A 3LXNA 2FGIA 3IW7A 1WBVA 4M13A 3P1AA 4HGSA 4JDKA 4ITHA 4JR7A 4EOQA 2XK3A 2V5QA 3LFFA 4NM0A 3PVWA 4GEOA 5IISA 4YLLA 3VJOA 1ZZLA 2R0UA 3ORIA 4QTBA 4R3PA 4W4XA 5M57A 4G5JA 3AG9A 4XLIA 3PE1A 4MXZA 2F49A 3NGAA 4KB8A 4YJRA 4YP8A 3BQRA 3DNEA 3KMMA 1W98A 4DBXA 4DT8A 1NW1A 4N6ZA 2REIA 3UE4A 5EQPA 3BHYA 5CF4A 2AC3A 4LM5A 4RFYA 5H3QA 1PXPA 2VTSA 2RGPA 2X4ZA 1FINA 4GYGA 4IACA 4RFMA 3SXRA 3VQUA 4BYIA 4DG2E 2PU8A 3UGCA 2XMYA 3BHTA 3K3JA 4QMUA 4JBQA 3O2MA 4MH7A 4QPMA 5L8KA 4ORKA 3OCGA 2W4KA 2W05A 2XYNA 3DKCA 4QQCA 2JAVA 3PP1A 5EYMA 2UVYA 3TV4A 3KF7A 4C3FA 1JPAA 5KMKA 5DWRA 4F4PA 5LVOA 4F99A 1U54B 5J1WA 3RP9A 5CS6A 3SC1A 1FGIA 4C02A 4D0WA 3C4FA 4PDYA 3PXKA 1CTPE 3G9NA 5LCKA 4I5PA 3D0EA 2GDOA 3JY9A 4PX6A 5L8JA 2PUNA 2BRMA 1M2QA 4DYMA 2PL0A 4KS7A 4IJ9A 4RA4A 4IANA 4AT4A 4BCPA 4CTCA 3VBVA 4CT2A 4F6UA 2O65A 4FT9A 3PWYA 2C4GA 4XCUA 2QOKA 4UWCA 3RPRA 3DDPA 3TV7A 4GT4A 5CAVA 2DYLA 3GQLA 2BHHA 3QYWA 2XKCA 3F66A 4RIWA 4CZTA 4P5ZA 2VTMA 5IF1A 3S2PA 3N51A 3VHEA 5LQFA 1BL7A 4Q9ZA 4DEBA 2PPQA 1TKIA 4FTNA 5KMJA 3C7QA 1CDKA 5L2QA 3TDWA 4S34A 4FX3A 4IXPA 5E90A 1Q24A 2WOUA 3VW6A 5F20A 4QMPA 3DV3A 5CANA 3QGWA 3V5JA 2HOGA 3ZSHA 3HL7A 4K18A 3C4WA 5AV2A 4BDEA 5L8LA 4GIIA 3N4VA 5EHLA 3DB8A 3QLFA 2R3HA 3HMIA 3QQHA 1DAYA 1OM1A 2YACA 4FUYA 4GVJA 2XNNA 4JAIA 1LEZA 5B2MA 1OGUA 2XVDA 4C3PA 5IPJA 3B8QA 3WZKA 5HX6A 5DR6A 4IZ5A 4ACMA 2GQRA 4FGRA 1ZRZA 3FJQE 2ZJWA 3HAVA 4DHFA 4LMUA 1VEBA 3ATSA 3L1SA 2G2FA 3LJ1A 4L3LA 5T3QA 5CSVA 4NYEA 2CGWA 3I0OA 3LXKA 3REPA 1G8AA 2JDTA 4XP2A 4QMQA 5CF8A 3KKVA 3ZZEA 1YXTA 2BRHA 1Q41A 3MJ1A 4FTIA 1OPKA 3FQEA 4I21A 4C36A 4BVUA 3GFEA 4FTRA 4K1BA 2RG6A 4YJQA 5LMBA 2YDJA 3VS7A 2YEXA 2W4JA 4APCA 3EB0A 4ID7A 4Q5EA 5LMAA 5J5TA 5KKRC 3NCGA 2I0HA 5CI6A 4U3ZA 5HIEA 5KZ0A 3NX8A 4TYEA 1R0PA 3D15A 4XBRA 2XUUA 4FOCA 2OJGA 3PVUA 4YZBA 1MQ4A 3L8XA 4H3QA 3RM6A 4XV3A 4L00A 4MCVA 3UZPA 3GVUA 4FIEA 3SLSA 4AW0A 4BGQA 3F2NA 4QYYA 2QOOA 4AAAA 1JQHA 2YCFA 1KE8A 1S9IA 2XKDA 3E7OA 3QTUA 4Y83A 5CSXA 4BFMA 4IHPA 2OXYA 4X0MA 3VUGA 2WTKC 1J91A 1VR2A 2PHKA 3V01A 4EUUA 4HVIA 5J7HA 4F7LA 2XEYA 5AP1A 1Q99A 3OY1A 4MNFA 2ZV2A 3PY1A 5KHXA 3HV6A 2HZ4A 3KGAA 1H0WA 2W7XA 4PP9A 2WNTA 5EK7A 2UZNA 2EXCX 3ENHA 3LFEA 5C8KA 3H30A 4LRJA 4S33A 3TACA 2WQMA 1JWHA 4FI1A 4RX8A 2H6DA 5HX8A 5CEKA 3KXZA 3HMPA 4D5HA 4BIDA 2OSCA 3AC5A 4QTAA 1IAHA 3DJ5A 3I6UA 4ANBA 4BBEA 5FTOA 4C34A 4YLJA 5HNGA 1Z57A 3EQHA 3DU8A 3KULA 2BFYA 3K5VA 4RGJA 5DPVA 2P0CA 2QOLA 2WU6A 4KIPA 4MXOA 4PWNA 3FMKA 2XBAA 1IA8A 2UZOA 3PVGA 4ZK5A 3OXZA 1Q3DA 5K0KA 4XRLA 4MTAA 3BIZA 5HG7A 3I1AA 4FTMA 2P2HA 5EOBA 4D28A 4I92A 1Q62A 3PY0A 4L44A 4MBJA 4J8MA 4DT9A 3LIJA 4GG7A 5GZ8A 1Y57A 4JRNA 2WTKB 5CU3A 2IW9A 4GKIA 2FSOX 4EOMA 4QMWA 4LOPA 4WA9A 2ZMCA 1Y91A 4YHFA 4XLVA 5I0BA 5AV1A 3TNPC 2YIWA 3L9MA 3BGQA 1CKPA 3RJCA 5AX3A 5BMSA 2BTSA 1HOWA 3QZHA 3PJCA 5DEWA 5IMEA 1WFCA 2GNHA 2PVNA 3E3BX 1JAMA 4ZSGA 3LFNA 5DR9A 3TJDA 3PPZA 4GK2A 1DS5A 2PWLA 3KA0A 4G3EA 3V8TA 1BUHA 3UC3A 2VX1A 3R1QA 1W7HA 3FLYA 3PXFA 5EKOA 2R9SA 3NUPA 4LMNA 3KRWA 1PXIA 5AM7A 5CAOA 2HW7A 4F09A 3AQVA 3AC3A 3IOPA 4K11A 1H01A 2VTIA 1OL1A 4O38A 1ZYSA 3DGKA 3QQGA 3VUTA 4Z9LA 2R64A 4BCKA 3VUHA 3H9OA 4FKTA 4F63A 4A9TA 1Y6BA 4TW9A 1PRYA 1R39A 4ZTQA 1YVJA 4UMPA 3HA6A 3DAJA 3GUBA 5BVNA 3FZRA 4GK4A 3BBTB 2R2PA 2RFNA 3FY0A 4RVKA 4M0YA 2UW7A 4P90A 2C6KA 2WTJA 2YCSA 3O96A 4TYHA 4AZVA 1GAGA 3WBLA 5KKRB 1YI4A 3OUKA 5C9CA 4GVAA 4NTTA 3KXGA 1OUYA 2XK7A 4JT3A 4KKHA 4ONAA 2OXXA 2PK9A 4CXAA 4KAOA 3D5WA 4UMRA 2VO0A 4H58A 5AWMA 2BKKA 3ZDUA 1R1WA 2BRGA 1NXKA 2C0TA 4AU8A 5K4JA 5IH4A 5A4LA 1A9UA 3CXWA 1K2PA 3QQKA 2RFEA 3QHWA 2XNPA 4HGLA 4NW5A 4XX9A 3RVGA 2KULA 5DFPA 4MVFA 3FI4A 5EW3A 3QRIA 4RPVA 3QD2B 3AC2A 4II5A 3VULA 4LV8A 3A2CA 2YAAA 3LLAA 3GU6A 3A62A 3P7AA 4DFUA 4FNZA 5EDQA 2OF2A 2PZ5A 2DQ7X 2J51A 4G31A 4QOXA 4BRXA 4CRLA 5AR8A 4FOBA 4PY1A 5M56A 5I3OA 3KMWA 2WZJA 5JRSA 5B7VA 4XV9A 3VUDA 2GNLA 4JBVA 5E8SA 2QG7A 5AP4A 1KOAA 3R7VA 3CTHA 3UP2A 2WAJA 2W1HA 2VX0A 3R83A 3O51A 2IWIA 4FZFB 3K54A 3WF8A 4KS8A 4G9RA 1Z5MA 4QMYA 3ZO3A 5A4EA 5C4KA 4W9XA 4Z55A 4Y5QA 3OXTA 4H1JA 4OTPA 4Q9SA 4QP7A 3TL8A 4G3DA 5FTGA 2EXEA 1WBPA 4G17A 5IUHA 3R28A 4TRLA 2WMTA 5IA2A 4IB1A 4O7ZA 3R30A 1W0XC 3ET7A 4EOSA 4RWIA 3SW4A 1WBOA 5CU4A 2JKMA 2QODA 4B0GA 3I4BA 3EN5A 4BB4A 3NIEA 3I81A 4L7SA 3ORLA 4DFBA 4A9YA 3F3WA 4TWNA 3KVWA 3MH3A 3WYYA 5HE2A 5M07A 5DIAA 2BZHB 1XH4A 3MW1A 5E8XA 4R6VA 3V5PA 2C0IA 2F7ZE 4BTKA 5HE1A 4C0TA 1NT2A 1OKWA 2IZRA 3COIA 5CAPA 2C68A 3LE6A 5EQEA 3G2FA 5AP3A 2XNOA 4S31A 3W33A 3OT3A 4F70A 3WYXA 1YHVA 4RIOA 2QVSE 2R3FA 2WTWA 3R7IA 4O96A 2BUJA 2GPHA 2KTYA 4ZZNA 4G1WA 3WF5A 4IVBA 2YIYA 4KUJA 1H00A 4AA5A 2WIPA 1Y8GA 3SRVA 2WELA 2VTLA 4J1RA 4PNIA 2UZVA 4RSSA 5DRDA 3DZQA 4BDAA 2XIZA 4TYGA 5IEXA 4HCTA 4FSUA 5BMMA 3GU5A 2FO0A 1UV5A 3L8SA 4BCMA 3R21A 2IW8A 2A2AA 2X6EA 2ITVA 3D4QA 3EYGA 3PXYA 4HVSA 4FEUA 3QZGA 2FA2A 3R63A 3NW7A 4MKCA 2UW5A 4EQUA 3TUBA 4ZLYA 4R7IA 4TWPA 4CMTA 3NW5A 4KWPA 3GI3A 3QTRA 1U59A 4J98A 1FOTA 3I7BA 5HU3A 5FXSA 3A8WA 4MXYA 2X1NA 4BDBA 2O8YA 4F9YA 5AUXA 4USDA 4XS2A 2R3PA 4ZJJA 1Y6AA 3Q5IA 3OROA 5ICPA 4EWQA 5AUUA 3TNIA 5CXHA 5LMKA 3TKIA 4E5BA 4DFZE 4BCJA 3QCSA 4CFVA 5A14A 2F4JA 3MH2A 1XBCA 2BDJA 4LUEA 4AQCA 4EHZA 1GIJA 3S0OA 4L43A 4RA5A 2VWYA 2F7XE 3WF6A 4HVHA 5JK3A 3FEGA 2C3JA 4G5PA 4APPA 3A8XA 3MSSA 4RWKA 5IMXA 2XNEA 3F82A 4OGRA 1F5QA 3H0ZA 3R7UA 3L8VA 2OIBA 3MFUA 3NWWA 4ANQA 2XJ1A 4QP2A 4USFA 5JFXA 5EM7A 2XB7A 4EL9A 2HYYA 3HX4A 3IO7A 3OMVA 4D4YA 4DGGA 4I4EA 3KF4A 5ETFA 4RC2A 2CSNA 2LAVA 2Q0BA 3OW3A 1H1SA 4B8MA 4C62A 5C03A 4OTQA 2P33A 1FQ1B 2R3QA 4JBPA 4JBOA 5E8YA 3PRFA 5CXZA 3C0GA 3PA5A 2J0MB 3ERKA 4YPDA 4EEVA 1VYWA 1P4OA 1QPJA 5HGIA 5CAQA 3A4PA 5HNIX 5L4QA 4LGHA 4XOZA 4QPSA 3NSZA 3U51A 5I9WA 3OW4A 1Q97A 2H9VA 3HV5A 3EL7A 5HE0A 2G01A 3KRJA 2W1FA 3EQBA 5AP2A 2G1TA 5TE0A 3JXWA 3SG8A 4BZDA 2HXLA 1TVOA 2R5TA 4K6ZA 2XEZA 4NSTA 3B2TA 4IQ6A 5KUPA 3FMMA 3MVJA 5HU9A 3PJ2A 4GT3A 3GC8A 5CLPA 4YPSA 3P78A 5G6VA 3LHJA 3RINA 5FTQA 4F6WA 5AR2A 4FTUA 5HD7A 2WKMA 4D4SA 2C47A 4R8QA 2Y6OA 4CZUA 4QD6A 4FR4A 1WVXA 1PKGA 2GHMA 5JGAA 4X2KA 5CSWA 2VNYA 2E9OA 3KN5A 4O7SA 2B9HA 5EW8A 2VGPA 4O0SA 3ZUVA 2VWIA 4B9DA 3THBA 3Q04A 1G8SA 2YCRA 4ZTSA 5IA3A 4DGNA 1ZMVA 2OICA 2WGJA 2PUPA 4FE2A 4ALWA 2W0JA 4I1ZA 3MTLA 4UYNA 4CMOA 4F64A 2OBJA 1XWSA 4PL5A 2JGZA 2QCSA 3F5GA 1YWRA 2BDFA 4YHTA 1Q8YA 3QC4A 3GC7A 5AJQA 4F9AA 1JNKA 5L2WA 1OUKA 2GS6A 2Z2WA 1PXNA 4HYIA 5CVFA 4O86A 2PE0A 4XNEA 1IG1A 3UODA 2ZOQA 5TOZA 3DCVA 1LP4A 4NEUA 5HLWA 3F61A 4NM5A 2ETRA 3MPTA 4MBIA 4O2PA 4E5WA 4QNAA 5CZHA 5ETIA 3EQFA 3Q9YA 5E8ZA 5AA8A 1DAWA 4ZLZA 3KXMA 3RNYA 5JFWA 2XRWA 4DH3A 2B1PA 2V62A 4FT7A 4I6FA 4E93A 5CEOA 4BN1A 3EL8A 1PMEA 1XBBA 1ZYCA 1H25A 3ZS5A 2J90A 4BDIA 1FMOE 4RZWA 2FYSA 3UVRA 2OW3A 3KULB 4D5KA 2EUFB 3CCNA 1YWVA 3P79A 3QRUA 1GZOA 3AOXA 2ITPA 2UW3A 5ANDA 2Y4IB 1YI6A 3QKLA 3SV0A 4R7BA 2W5AA 4IX4A 5A4CA 1PW2A 3OFMA 5AFVA 2XA4A 5EFQA 3E3PA 4E4XA 4ZTHA 2OU7A 3P4KA 3QXOA 4FT5A 5EYKA 3EQRA 3UP7A 3CPCA 3PXRA 1YDSE 1ERKA 4XH6A 4ZY6A 5IA1A 3FI3A 4WRGA 2PY3A 4IH8A 5ANIA 4XBUA 4AW5A 4UZDA 4ASXA 2PVLA 1W82A 4ZS0A 4JQ8A 4C4IA 3OUNB 4F7NA 3FI2A 3LM0A 2I1MA 3OTUA 5K5XA 1URWA 3F5UA 3RM7A 4BCGA 4ZJVA 3LCDA 4IAAA 5HESA 4IB5A 4C59A 5M51A 3MB7A 4D55A 3Q3BA 4DFLA 4EKKA 4J96A 4QNYA 1Q61A 4ANMA 1VJYA 1UNHA 2VTJA 2BFXA 2YJRA 3SQQA 3PPJA 4JS8A 3W8QA 2PULA 4KINA 2QHMA 3O17A 4MD8E 1OKVA 3ZLXA 1JKKA 3TJCA 2WMXA 2XZSA 3NCZA 4S2ZA 5E8UA 2A19B 5T68A 4S32A 4C4EA 3PIXA 1JOWB 3EN9A 5ANGA 2WPAA 3RPOA 3RCDA 5M4FA 4FL2A 4FV1A 3C1XA 4YZMA 4C7TA 5J8IA 4FIIA 4O0TA 3RI1A 1YW2A 3D5UA 3LFQA 3QUPA 3AT4A 3V51A 4M0ZA 4DITA 3U6HA 4N57A 4H3PA 3ULIA 5CTPA 4EH7A 4ZSEA 3HMOA 4EH8A 3OP5A 4KIQA 4O0UA 4DINA 1OBGA 5AR4A 3BLRA 4L67A 4RIXA 4IIRA 4PMMA 4FV7A 4YSMA 4YC3A 3Q9XA 2E9UA 5ANJA 5E1EA 3Q96A 4F7SA 3R8UA 4XP3A 3ZZWA 2QOIA 2WMSA 4I5CA 4C4HA 4TXCA 3WF9A 3UMXA 4EC8A 2W17A 2VZ6A 4HJOA 4WHZA 3FXZA 2UZTA 5HVJA 2BHEA 4BICA 2Y4PA 5HO7A 3UOJA 2RIOA 2ITUA 5I9XA 3JS2A 2Y0AA 4I3ZA 4C35A 4DFXE 4GCJA 5LWNA 4FTAA 5FBOA 3PY3A 4ZSJA 4U97A 5HVYA 3QA0A 3S00A 4G6LA 3OCBA 4YTFA 5B2KA 4O0RA 4ZXTA 3ALOA 2ZB1A 4O82A 3HECA 4YC8A 1JSTA 4NCTC 1OKYA 5AR3A 5HG5A 3NNWA 4C3RA 3AMYA 2C3IB 2GCDA 3CIKA 4I6BA 3EN4A 3D2KA 3CJFA 3HDMA 3EKKA 1VYZA 5HBJA 3GU8A 2C0OA 5D1JA 4LYNA 2IVUA 1UNGA 2GS2A 3EHAA 3QTIA 1OPLA 4ZAUA 4RFZA 2W5BA 4IJPA 4HNIA 1HCLA 3ODZX 2WHBA 2JC6A 4QP4A 1PF8A 4L45A 4BTFA 4D2VA 4B8LA 4F0IA 3IK3A 4NJDA 3W2CA 3IOKA 1BL6A 3PFQA 3SVVA 4GKHA 4XV1A 4Y8DA 1V0PA 4YGAA 3UYSA 2J50A 4U9AA 4ARKA 2I0VA 3QU0A 2GSFA 4G16A 3TT0A 2JITA 3FQSA 3KL8A 5AA9A 3FC2A 3AD6A 4QMLA 1PXKA 4W4YA 3TI1A 4AZSA 4Y72A 4IB0A 2ZDUA 3FBVA 5K3YA 4B7TA 4KKEA 5B0XA 5E4HA 3R9RA 3MY5A 3FKLA 4GU9A 1OB3A 3U87A 2F2UA 4YO4A 2JKKA 3QALE 4YLKA 3KREA 3LQ3A 4HOKA 4CT1A 2Y4IC 5IQHA 4XHKB 2CKOA 5AV4A 1PXJA 3CS9A 5HI2A 2YM8A 2G2IA 4GMYA 3Q5ZA 4U80A 1XH5A 4IVAA 4NFNA 2J7TA 3RAIA 3WARA 4X3JA 4DH1A 2OK1A 3LLTA 1XH8A 2QHNA 4BY9E 4NZWB 1QL6A 5DYJA 3ZRKA 4DA5A 4QYGA 3UNKA 1GZ8A 3V6SA 1Z9XA 3H9FA 3W32A 1IEPA 2WEVA 3PP0A 4AUAA 2F2CB 3PJ1A 4EQCA 2G9XA 3MIYA 2OFVA 1V0OA 4AOIA 2AUHA 2HWOA 3E8DA 3EYHA 3AT2A 1CKJA 4PMSA 1H08A 3QCXA 2IZSA 4FZ7A 3F3TA 5CVGA 5AP7A 2ONLC 4RRVA 3C50A 2OIQA 3GENA 3K3IA 3WZUA 5FUTA 3Q6UA 4EHVA 2A4LA 4CV8A 2GFSA 2XK6A 2C69A 2W5HA 3HA8A 3I60A 3QQUA 2H96A 3NVKI 3RK9A 4R77A 2UZLA 3F3UA 5CSHA 5A4TA 2I0EA 1R0EA 4AX8A 1LR4A 4FG7A 4FZDB 1YKRA 3ROCA 5AAGA 2OFUA 3ZONA 5CSPA 3CQWA 3EQPA 1IR3A 4JNWA 4ZMEA 4BWKA 3COMA 3PA3A 3EZVA 4WG3A 2EB2A 4EJNA 4FG8A 4GUEA 5CZIA 1OZ1A 2GQSA 4MAOA 2ZM1A 2JDSA 3RZFA 2QNJA 2R3MA 3W55A 5A3XA 3BX5A 4EYMA 4E1ZA 4TYJA 4F7JA 4R1YA 5LWMA 3RKBA 2WFYA 1O6YA 4BDHA 3H3CA 3UQFA 4ALUA 1GOLA 2GNIA 1MUOA 3MPAA 4BI0A 1QPEA 5EG3A 3B2WA 5ACKA 3F69A 2X9FA 2C30A 2ZV9A 4OT6A 2ZM3A 1H24A 4RLKA 5J1VA 3IG7A 1U4DA 5FEDA 1E1XA 2OO8X 4AZFA 4AZEA 4TL0A 2ZVAA 3HLLA 5C8NA 5E1SA 3KC3A 3ZLSA 4BR3A 3E62A 3DAEA 1OKZA 4L68A 1B38A 5JFVA 3QF9A 2OZAA 3ANQA 5D7VA 1XO2B 4ZTRA 4AS0A 4USEA 3RHKA 2PE1A 4HPTE 3G5DA 4FZ6A 4CG9A 3LCTA 4I0SA 3ZSIA 3MI9A 4MXAA 2GTMA 5FRIA 3HNGA 5H2UA 4ACHA 3OC1A 2XIYA 2EU9A 3OF0A 2YERA 2QLUA 1UKIA 3AC8A 5CNNA 1PMUA 4FTQA 1H27A 2J5FA 4UWYA 4O0YA 3RAHA 4CNHA 4DCEA 4UX9A 4UV0A 2OWBA 4MQ2A 4WBOA 3F2RA 4IDVA 5AIKA 4MNEA 4PTEA 3OXIA 2VTRA 4DEAA 4E20A 2R0IA 4OW8A 5H8EA 3Q6WA 4J53A 3GCUA 5BQ0A 3C51A 4XUFA 4J95A 5HORA 3ZUUA 3E64A 3EN6A 3RAKA 4K77A 1ND4A 4HZRA 4BDJA 3NEWA 4L9IA 3ZLWA 4BCHA 4U45A 2XKFA 3K5UA 1FMKA 1ZWSA 3JVSA 3LFAA 2NRYA 3Q60A 3DB6A 5GNKA 4TTHB 4XG6A 5HQ0A 1A48A 3PSBA 4R1VA 4N70A 2JFLA 4RJ3A 2EVAA 3BHHA 3F5XA 2AC5A 4GU6A 3FC1X 1I09A 3UYTA 4YTHA 3Q4ZA 2XCKA 3W2OA 5HVKA 4QT1A 1P5EA 4BWPA 4D2PA 4YZDA 5CT7A 4IW0A 4NCTA 3GFWA 4U81A 5CU6A 3R8ZA 4C38A 4RJ6A 3PLAE 4YTIA 3O7LB 3P0MA 3FPQA 2X9EA 4D1XA 4WSQA 2GNJA 4J52A 2RL5A 3TNHA 2Y6MA 4QTEA 3TDVA 1O9UA 2BTRA 2ZMDA 1PYXA 2P4IA 2QR8A 4I6QA 3VS3A 5KNJA 2Z7SA 3DLZA 4Z7HA 3LKMA 2XJ2A 4QP6A 4YJTA 4RJ4A 3W2SA 5CEPA 4JDJA 3VVHA 1J1BA 1KE7A 4FL1A 4ZTNA 2RF9A 4E4NA 1H4LA 1SVHA 2WQEA 4QYHA 5KBRA 3PG1A 3OBGA 2BVAA 1YXVA 4CFWA 1REJA 3ZSGA 3MY0A 2VAGA 3PUPA 1O6LA 2C3KA 3CP9A 4B4LA 2YM3A 3D83A 5IEYA 5EH0A 2IJMA 2YAKA 3R8PA 2H34A 4OUCA 5LMKC 1H28A 5ETCA 3M2WA 4MBLA 5HCXA 4HW7A 5KMLA 3O0GA 4EK3A 3IPHA 2X7GA 4IC7A 4J71A 4TYIA 2YZLA 3GEQA 2VNWA 4FKVA 4IC8A 5CENA 4YJPA 4EZ3A 3R02A 2BZIB 2RFSA 2PVJA 2IO6A 5EM5A 5DOSA 3ZM4A 2YISA 4FK6A 3VS0A 2YFXA 2VRXA 4IFCA 1JVPP 4EQMA 4AGWA 5A46A 5JEBA 2PE2A 5JN2A 3CPBA 2VO7A 5EHYA 5FQDC 3N4UA 2QOHA 2BAJA 4DTBA 3ORTA 3DBEA 4ITIA 2DWBA 3FAAA 4O1PA 3ZRMA 4EI4A 2SRCA 2F7EE 3S95A 3II5A 5LXMA 2CN8A 3F3VA 4XYFA 5C1QB 2VUWA 3PDTA 3L8PA 1BI8A 1E1VA 2HY0A 4L8MA 3VHKA 3FYJX 4X2NA 4BC6A 4C33A 5IZFA 3V04A 3VRZA 3VS4A 1ZMWA 4GK3A 5JH6A 2Q83A 4NTSA 5FP6A 5KMOA 4JX3A 4L52A 4JDHA 4FSQA 4X2GA 4O22A 4R3RA 3QHRA 2XNBA 4BZNA 3UTOA 3ACKA 5JGBA 3WZEA 3BZ3A 3E88A 3NAXA 2BCJA 1Q5KA 4WIHA 1M7NA 5JZJA 4D1SA 2DUVA 5E8WA 2UZEA 1WAKA 2VO6A 2QD9A 2W1CA 3N4TA 1YOMA 3NVMB 2BAKA 4JIAA 4FBXA 4TWCA 4X7QA 3Q4CA 3R7EA 1DI9A 1E9HA 2UV2A 5EI6A 4WKQA 1WMKA 3OCTA 5J95A 5CEMA 4LL5A 4CQGA 3C9WA 3ZRLA 5ANOA 4JL9A 3NYXA 4QP9A 4KABA 4X6RA 3Q53A 3QZIA 3W2PA 3FZOA 5D41A 4ZJIA 4YNOA 5A54A 5D9HA 2C5XA 4C4JA 4RQVA 3RCJA 4PPCA 3RNIA 2CMWA 3FWQA 1ZLTA 5EI2A 4HPUE 3QQFA 5LVPA 1UA2A 4FNWA 4EH2A 2ZB0A 4QO9A 3R73A 2WTDA 5FLFA 5I4NA 3LXPA 5M55A 5KZIA 4BGHA 4OTHA 3R7YA 2CKQA 3VWAA 1SNUA 2PMIA 4NFMA 2JLDA 5DGZA 5FG8A 4WNOA 4Y5HA 2OZAB 3DA6A 1TQMA 4CLIA 2BMCA 4MEDA 1G5SA 2VO3A 3UOHA 4ZZMA 2RG5A 3PWDA 3UG1A 5JGDA 3VN9A 3HUBA 4AN9A 3FLZA 2YHVA 3TZ7A 3SA0A 4N6YA 3EH9A 4YZ9A 2RKUA 5FWKK 2GQGA 2PZYA 4R7HA 2XIRA 4A7CA 5FGKA 3DQWA 4FV6A 4JR3A 5HG9A 3BU6A 4ERKA 5AM6A 3KXNA 5J79A 4X21A 2F9GA 1OL2A 2VWUA 3GXLA 4OTIA 3NYOA 1Q8UA 3CGFA 2YM5A 1YXUA 4L01A 3HKOA 4UBAA 4DFYA 2E9PA 4RBLA 5I9VA 5GIOE 3BU5A 3F5PA 3EOCA 5DRBA 4KA3A 4PP7A 1PXLA 4H1MA 2QKRA 3S3IA 1OIRA 2YZAA 4IAKA 2R4BA 5AP6A 2EB3A 3FKNA 4A4OA 4FTOA 2UUEA 3FHRA 4DC2A 5IQEA 4U42A 4UMTA 2NO3A 1JSUA 3POOA 3FZ1A 3Q2JA 4E6QA 4LUDA 2Z7LA 2WO6A 4OT5A 3FI8A 2HZNA 4Q2AA 1U46A 1URCA 4C57A 5M53A 4NIFA 2CDZA 4RJ8A 2QOBA 3LCOA 4FNXA 1ZXEA 3BGPA 4LRKA 4IVDA 3BI6A 3VQHA 4TKSA 3DKFA 2VWXA 3KK8A 1M2PA 4FV9A 5HOAA 4FODA 1FVRA 4QMSA 3FZPA 2EXMA 5BVKA 4RX9A 4J8NA 4O7LA 3T3UA 3ZMMA 3OY3A 2VWZA 3SXFA 5JQ5A 2C6DA 2P2IA 3EN7A 5HICA 3CBLA 2G2HA 2X39A 4AW1A 4IAYA 4J99A 4XG2A 3TNQB 3BWJA 1KSWA 4O6LA 2YN8A 4NKAA 2W4OA 3GQIA 3JVRA 3RGFA 3WIKA 1JSVA 3T8OA 2WQBA 4AGDA 4ERWA 2R3KA 3UDBA 3QXPA 3R04A 1TQIA 5M08A 4FICA 4EH5A 4FTTA 4D2TA 4E4MA 5BX0A 4CFUA 1YHWA 3CE3A 2XNGA 4QMTA 2BIYA 3E5AA 2UW4A 3MVMA 4QMZA 3TIYA 4C2VA 2QLQA 2PMOX 4LV5A 2QC6A 4FEQA 2X2KA 4MWHA 5GJGA 5EYDA 5LOHA 3E7VA 2X8DA 3HRCA 1RQQA 3IGGA 3VS6A 3OZ6A 1LPUA 3FZSA 3NUYA 4TWOA 3I5NA 2OJIA 3QD3A 3O23A 3RMFA 1XH7A 2NP8A 2UVXA 4FK3A 4CFXA 3W2RA 3BYSA 2WTVA 1NVQA 5TF9A 4CLJA 3DBFA 4BHNA 4YR8A 1OL6A 5CWZA 1SNXA 4LG4A 4FKGA 3O7LD 4GFMA 1XH6A 3BEGA 3ORZA 5IEVA 3FKOA 3R7OA 5LVMA 3E87A 3RALA 4BDKA 4FVRA 2BALA 2B7AA 4HYHA 4BI1A 3I7CA 4MK0A 4QRCA 4YUQA 3ZEPA 4CCUA 4FSTA 2UW6A 1P2AA 3NYNA 4EH3A 1IAJA 4AF3A 5KMIA 5KMNA 4XG3A 4O7VA 5AUWA 2ETKA 1Q8TA 2B55A 2BZKB 2XYUA 1KV2A 2B52A 4I20A 4MD9E 4JG7A 4HVGA 4NL0A 1NVSA 3MFSA 4IADA 4S30A 1KE6A 3G6HA 3QUEA 5LARA 1H26A 2PMLX 3CQUA 3TKUA 3E8CA 2OGVA 3H10A 3H9RA 4MF1A 3G0EA 3WE4A 2BZJA 3TM0A 2WIHA 3HP2A 3HV3A 3U54A 3PXQA 5AMNA 2PUIA 2YDIA 5J7BA 3E63A 2R3JA 4GV1A 4DCAA 3GB2A 1BMKA 3R8VA 4A9UA 4XJ0A 3OHTA 4ZSLA 2CHLA 4NM3A 1UNLA 3BV3A 3HUCA 2C1AA 3E8NA 4GS6A 3D5VA 4JLCA 3ZU7A 4Y95A 2HWPA 3RPSA 3MY1A 1WBWA 3NNUA 4I0RA 3SRVB 2R3RA 4D4VA 5F94A 3UZTA 5BVDA 2ZV8A 2E9VA 3F6XA 3CD3A 4PDOA 3VBWA 2JAMA 4RJ5A 1PMVA 2XS0A 2XK8A 3NLBA 2BIKB 5HEZA 3SW7A 4DE4A 4QYFA 4M14A 4UXQA 2XM9A 5TT7A 4C8BA 5FXQA 4DEEA 3CEKA 3VAPA 2ITTA 5J9ZA 5F95A 4DEDA 4AFJA 3OWJA 3KXXA 2C3LA 3ORMA 4EH4A 4QTCA 2B9IA 3ODYX 2PVKA 1CSNA 3OWKA 5EM6A 1JKSA 4LGDA 4AN3A 3S4QA 2JBOA 1IA9A 4FA2A 5JQ8A 1PXMA 5GJFA 1H8FA 2O0UA 4UN0C 3ZM9A 4I5MA 3I79A 4BL1A 2WMQA 2J2IB 3P7BA 4NKSA 5B2LA 3D2IA 4XV2A 1EH4A 3E8EA 3MFRA 4CFNA 5LVNA 4UEUA 4YZCA 3R8MA 2FSTX 3A61A 5CYIA 5TO8A 3VBQA 3UIBA 2ERZE 3VS5A 2V22A 3E92A 4KRCA 3C0HA 1A06A 3QD4A 3LW0A 4MXCA 5AIRA 4RVMA 4AT5A 5IA0A 5BUIA 1QCFA 2WB8A 4I93A 3AC4A 2X0GA 3IW5A 3W10A 3BV2A 4BCIA 3R00A 4BHZA 3ZO4A 2UZUE 4ZOGA 4ENXA 3DK6A 3DOGA 3LJ0A 3NIZA 4GL9A 4IZ7A 3HZTA 3SXSA 2IW6A 4F9BA 4HYSA 3NR9A 4WO5A 4CFFA 3EIDA 5HLNA 2YWVA 3W16A 3M1SA 5BUEA 1K3AA 1QPDA 2CNQA 1J7IA 4P7EA 5DVRA 3HEGA 2JIUA 4IM2A 3OOMA 4M69B 2V55A 4C58A 3VW8A 1KWPA 4M69A 2I0YA 4IVCA 5FDPA 2FVDA 3QTXA 4MYGA 4E26A 1NVRA 3UIUA 5HIBA 1FVVA 3QKMA 2HW6A 4QMVA 4GFOA 5K9IA 5E91A 2UZWE 3UJGA 3TZ8A 4DBNA 4E6DA 4YZNA 4RQKA 2I40A 4ZSAA 3EKNA 3GC0A 4FKOA 4WG4A 1GIIA 2VWWA 5M09A 2FUMA 2ERKA 3R1SA 4LQMA 4FGBA 3ITZA 2VGOA 4NIFB 4JOAA 5HO8A 5IQBA 4DGOA 3F7ZA 4BKYA 1NY3A 2QKWB 3QRTA 5FM3A 2WD1A 5GZ9A 4L7FA 4ZY5A 1PY5A 4W9WA 2CNVA 1GIHA 3S1HA 2E9NA 5DH3A 3DQXA 3IONA 3R2BA 4FTJA 1W8CA 2CPKE 5KE0A 1Q4LA 2ITYA 3ELJA 3ZDIA 4AT3A 4BYJA 5HCZA 1WZYA 3R1NA 4PF4A 4G2FA 4C2WA 5J9LA 4HCUA 1YRPA 4GJ3A 4DLJA 1B6CB 5DLSA 3KXHA 5CF6A 1TQPA 1IRKA 2Q0NA 4IE9A 2W1IA 4UB7A 4PPBA 5BVFA 4ALVA 5CASA 4EWHA 2VTNA 3R9NA 4EOIA 4GFGA 5HTBA 3DT1A 4FG9A 3R9OA 5JMSA 3AMBA 3WE8A 3DK3A 2R7IA 3SAYA 2R3LA 2CNUA 1L8TA 4GSBA 4NT4A 2XBJA 4DF3A 4O7NA 2IZTA 4P2KA 3R6XA 3MV5A 4R5YA 5GIPE 1OVEA 3G90X 3WZDA 3O8UA 4Z3VA 4IWDA 2J0IA 2J0LA 3UPZA 3T9TA 2P55A 1PJKA 3VS1A 1YXSA 3K2LA 1NA7A 1GY3A 1LEWA 2WU7A 4V0GB 4BIEA 1FGKA 3IW8A 2VTPA 4G3GA 4ZS4A 3EFKA 3ZYAA 3DBQA 1AGWA 3BQCA 3UOKA 4YNEA 3QX2A 3W18A 5DI1A 3V5LA 3WIGA 4BCFA 2XP2A 1OIUA 4JJRA 2OH4A 4UYAA 2V7AA 3UZRA 3PLSA 4ZIMA 4XP0A 4EHEA 2PZRA 3GU7A 4R5SA 4V01A 3RPVA 3TZMA 3BELA 4QMXA 1ZY5A 1YQJA 3D7TB 4ANNA 1M2RA 1W83A 2CKPA 4FSYA 3WI6A 5HLPA 3VBTA 4EZ5A 1I44A 3CKWA 2CGUA 4FNYA 4J7BA 5AP0A 1H1PA 4K2RA 4ASEA 5IG1A 4RMZA 4EK6A 4E4LA 2OJFE 2WMUA 1U5QA 5HKMA 5LVLA 1R78A 1SZMA 1PKDA 2J9MA 1H07A 4K33A 2HCKA 3SOCA 4ZEGA 3LQ5A 3VRYA 3LFCA 4O21A 2XJ0A 3GC9A 4WOVA 4CMUA 4F1TA 1H1WA 1ZOGA 4FC0A 4C4GA 5M4IA 4ZLOA 2JD5A 4EKLA 3NUNA 2C5NA 4JX7A 1WVYA 3ZHPC 3ZFMA 4DTAA 5BVEA 2OI4X 4OTGA 4TN6A 3NRMA 3P9JA 4OBOA 5CEQA 4AZWA 3FHIA 5A9UA 4K9YA 3V8WA 5KO1A 2HENA 3DDQA 5L6OA 3OCSA 5HBHA 3PIZA 3JR1A 3MGYA 4GJ2A 2CN5A 3CLYA 1UU8A 3CTQA 4BI2A 5IKWA 1ZYLA 2Y8OA 3EWHA 4LGGA 4EORA 1Q8ZA 3U6JA 4FL3A 3FLQA 3NPCA 4FKWA 3QWJA 1JLUE 2W1GA 5GJDA 4F0FA 3D7TA 2ITXA 3RZBA 3UQGA 3TZ9A 4YURA 3C5IA 5FM2A 1UWHA 4F9WA 2HXQA 4IAIA 1BI7A 5CU0A 2B9FA 3MN3A 4G6NA 2O5KA 1YDRE 4AGUA 3KB7A 1V1KA 1IASA 2Z60A 4YJOA 4JQEA 4FMQA 4FV8A 1DM2A 4E6CA 3A60A 3EQIA 3LMGA 4IM3A 4MHAA 1BYGA 3T3VA 4ZY4A 4EOOA 4FKUA 4ASZA 4PDPA 5M44A 1YOJA 4M97A 3HYHA 3PTGA 5CQUA 5EOLA 4PDSA 2QOFA 2YABA 3NMUF 3ATTA 4RIXB 3VIDA 4ACGA 4BDDA 5IH5A 2VX3A 4Y73A 4IBMA 3Q2MA 4P5QA 2ITOA 5IDNA 3Q32A 2P3GX 2QURA 4QQ5A 4BBMA 2JBPA 5J5SA 3GNIB 3FMDA 1APME 2JFMA 2R3GA 5AUTA 3COHA 4UMUA 1ZOEA 4FV3A 2X6DA 2GTNA 3ORNA 4MWIA 3IDBA 3E93A 4EK5A 2YITA 3ZC5A 4IEBA 4IM0A 3MVLA 1WBSA 4L3JA 1WVWA 3MA6A 4I41A 2UW0A 3R9DA 2VTQA 4AE9A 4FIGA 4JXFA 4U40A 5FEQA 4FEVA 4DH7A 4WG5A 3CY3A 2X7FA 4I5HA 3VUMA 4F08A 4CQEA 3DKOA 5DBXA 4QQTA 4CTBA 1WBNA 1OBDA 3SDJA 1B39A 2E2BA 3LZBA 4BZOA 5CU2A 4PRJA 4BWXA 4E3CA 3KN6A 3FXXA 4AA4A 3U4UA 3VUKA 3R2YA 4F1MA 3CR0A 3QRKA 4XRJA 5H8BA 3JY0A 2WXVA 2Y7JA 3KRLA 4YJSA 4E7WA 2QG5A 1GNGA 2BR1A 3IQ7A 4N0SA 5AAEA 4FF8A 2PVRA 5L6WL 3FLSA 5DMZA 5JSMA 2C6OA 2FB8A 4DFNA 3MH1A 1ZYJA 5F1ZA 4YJVA 5IU2A 4D2RA 5C4LA 4EC9A 4IWPA 4KBCA 4OAUC 3CY2A 2LGCA 3MDYA 2YLEA 5A4QA 3SKCA 4ACDA 4GUBA 4I0TA 2PVYA 4N4SA 4NWMA 3U4WA 4DGMA 1GZNA 2Z8CA 4U0IA 5IUIA 5BVWA 3JUHA 2PVMA 1MQBA 2ITWA 4FTCA 4MNEB 1RE8A 2C6LA 3FLWA 2QO9A 3PPKA 1H0VA 5CQWA 2QU5A 1CM8A 3N9XA 4FKPA 3ROYA 5DG5A 2QOCA 4FV5A 5AR5A 3LXLA 4RLLA 2OZOA 2XKEA 5FP5A 1CKIA 1HCKA 4F65A 2CKEA 4RX5A 1M7QA 4F6SA 3QUDA 2NRUA 1XQZA 5FD2A 3TG1A 2VTHA 4D2WA 3NUSA 4RVTA 3IDCA 3VF9A 2PVFA 3L9NA 4U8ZA 4CKIA 4G6OA 4M84A 2FSMX 3OOGA 3FXWA 4IX5A 4O7WA 3BHVA 4BKJA 4RZVA 3MBLA 4BIBA 5AP5A 5DT0A 5FBNC 2PVHA 1QMZA 5L2SA 3G15A 3EFJA 3FL5A 4ZP5A 3C5UA 3NDMA 4U5JA 3MH0A 3FYKX 3LCKA 3UNJA 5IQIA 5IDPA 1ZOHA 3V3VA 3F7WA 1LUFA 3CQEA 1K9AA 4D2SA 4FVQA 5BYZA 4RT7A 5I3RA 3HV7A 4YO6A 4OR5A 4TZRA 2OG8A 4IX6A 2YIXA 4E6AA 2R3OA 5L3AA 3GCVA 4QP1A 4BKZA 5E9EA 3R7GA 2BRBA 4FUXA 5AUYA 2YA9A 4YU2A 2B0QA 3A7FA 4PPAA 2CCHA 2OXDA 4LOOA 1BX6A 1T45A 4X3FC 3SD0A 3MIAA 3DNDA 3QZFA 3UNZA 4EOKA 3DXQA 4IAFA 4RC3A 3M42A 5DEYA 1RW8A 5J87A 5L6PA 3JPVA 4LFIA 5AAFA 3BKBA 3PRIA 3ZUTA 5HZNA 4GIHA 3G33A 2ZAZA 3KU2A 3IW4A 4W4WA 2WTIA 3QTWA 2WMRA 3HRFA 4X3FB 5HTIA 1SYKA 2VTOA 4GT5A 5DN3A 1O6KA 2W9FB 3FMHA 4RWLA 3FDNA 5CNOA 3F88A 4AOJA 5BYLA 4LI5A 2XM8A 4FV0A 2J6MA 3P08A 4EK4A 1ZARA 4M67A 2ACXA 3UVPA 3PZEA 3UIMA 1KUTA 3EFWA 2BPMA 4EHGA 4QTDA 1UU3A 4R3CA 4AFEA 1P14A 1X8BA 3RPYA 2A0CX 3R1YA 5EM8A 4QQJA 4OTFA 3MWUA 3QYZA 1YDTE 2CLXA 2ZM4A 2C5VA 5ANKA 5AUVA 4CSVA 4O0XA 3VC4A 4AW2A 3Q4UA 3QA8A 3IGOA 4AN2A 5GZAA 4UY9A 4FT0A 5HO6A 3VNTA 1UU9A 4MQ1A 3BLHA 5DNRA 2YWPA 5JKGA 3PG3A 5AV3A 4EUTA 4PL3A 4V04A 2IVSA 3A99A 3LFBA 2QR7A 1SVEA 3QAME 4OTRA 4PTCA 4TPTA 4EONA 2CJMA 3BEAA 3FE3A 2YM6A 3SGCA 4H39A 4PV0A 2W1EA 3NS9A 4OLIA 2GFCA 3V6RA 4X2FA 4IDTA 4AG8A 3BWFA 2EWAA 4D9TA 3R8LA 1YXXA 2YM7A 2GNGA 5M06A 3BBWA 3QD0A 1PXOA 3UMWA 4FKIA 5DT4A 2C5YA 3TXOA 4FSNA 5FEEA 4I24A 5GHVA 4BDGA 5AEPA 4DEGA 2WOTA 2UVZA 4EH6A 2O3PA 4AWIA 2BRNA 5E8VA 5LCJA 5AX9A 4OTWA 4BTJA 2O2UA 4RJ7A 3HAMA 2GNFA 2HZ0A 4RC4A 1UKHA 1F3MC 4FEXA 5IQFA 4ANLA 3F3ZA 4QMNA 3LM5A 3C4ZA 4WUNA 5E8TA 4U41A 1U54A 4AE6A 3UOLA 3DAKA 4TNDA 1OL7A 1OIYA 4M3QA 4UALA 5BNJA 3FMEA 3PSDA 2X2MA 2UW8A 3BCEA 3FLNC 3UPXA 1U5RA 1GZKA 2XH5A 3KVXA 3BE9A 3QQJA 1RJBA 3MPMA 4YJNA 3WILA 5EQYA 3TTIA 2IPXA 3H0YA 2F57A 2GMXA 4WNMA 4K0YA 3VS2A 2PZIA 2ONLA 1OIQA 3D14A 4HYUA 4D4RA 3ZCLA 1AQ1A 4QMOA 5D10A 5E92A 3LMIA 4EOLA 5DR2A 3AC1A 3GCSA 3UIXA 4AACA 3MJ2A 5TKDA 4FSRA 3FSKA 1W84A 4BF2A 3KY2A 3UQCA 4HGTA 3WZJA 4BCOA 5K4IA 5HNBA 2HZIA 4FIFA 1XH9A 5I9ZA 4FSWA 3NUXA 3W8LA 4KD1A 4MX9A 4FKSA 3D5XA 4FIJA 1MP8A 4NU1A 3M11A 2R3NA 5CALA 3OBJA 2OIDA 3NNVA 2JIIA 4E5AX 4XOYA 3CJGA 5H9BA 3ZO1A 3C13A 4CG8A 3FV8A 1SVGA 4DG0E 3CTJA 3L9LA 4YMJA 5CVHA 5I9UA 3KRRA 3RK7A 3F2AA 4GG5A 2V0DA 4W4VA 1OI9A 4CCBA 4QP8A 5HBEA 1ZYDA 3GGFA 5T6KA 2WQNA 3U55A 4KIKA 3DTWA 5IA4A 3QTQA 4HZSA 3ZBXA 4TYHB 4BDCA 2JEDA 3AXWA 3C0IA 3KCKA 3ORXA 4KBKA 2C6IA 2GHGA 4EOPA 3PSCA 3PJ3A 3KFAA 3EFLA 5EHOA 1FBNA 3CSVA 3ZEWA 1L3RE 5I9YA 2WQOA 4I4FA 3ZXZA 1ZZ2A 5IQDA 2ZDTA 2OJJA 4B99A 1G3NA 4M7IA 2X8IA 3R9HA 4A4XA 3MYGA 4BBFA 5KBQA 3ZBFA 4BCQA 4O2ZA 5ITAA 3I5ZA 4D0XA 5EDRA 3P7CA 2W1DA 4U43A 2XRUA 2HAKA 3U9NA 2W96B 4EOJA 4FTLA 4RIYA 4HVDA 3HGKA 3F9NA 4EYJA 3LVPA 2PMNX 3OG7A 3AGMA 4EBWA 4H36A 3CKXA 3I6WA 3PE2A 4O6EA 5A6OA 2YIRA 1UVRA 4CZYB 4FTKA 1STCE 1ATPE 1P4FA 2R3IA 4IAZA 3BPRA 2J0KA 3KCFA 3LPBA 3R0TA 2VWVA 4FVPA 3RWPA 5HCYA 4DTKA 3UC4A 1SM2A 4ZZOA 1YI3A 3LAUA 4AZTA 1RDQE 4A4LA 1YWNA 3ULZA 4O7TA 2BDWA 5D12A 2I7QA 2IVVA 4PUZA 4WNKA 3O71A 3ZC6A 5AADA 4QYEA 2OLCA 3SOAA 2NPQA 4CD0A 3POZA 4ZMFA 2X8EA 3GOPA 4FIHA 5EYCA 4H05A 4J97A 5LJJA 4JI9A 4UXLA 4CKJA 5EI8A 3MVHA 1QPCA 3WOWA 2B4SB 4C61A 3QBNA 5IQCA 4F0GA 4BTMA 2WEIA 2JDOA 4FEWA 4A07A 3Q52A 2YCQA 3ZTXA 4G3FA 5FDXA 2H8HA 1Y8YA 4PTGA 3GCQA 3V8SA 5M4CA 5ETAA 4IWOA 5IQAA 3EQDA 4FSZA 3P23A 3VBYA 2QO7A 4YTCA 5BPYA 4MXXA 5HTCA 1WCCA 4E73A 5KHWA 2X2LA 2VN9A 3NNXA 3R71A 3FMNA 4I22A 5HE3A 3AD4A 4ZTMA 2GU8A 5C01A 2V7OA 2UZBA 3EQGA 4DAWA 2CLQA 4KRDA 3V5QA 2IG7A 4EH9A 5HD4A 3NUAA 4HGEA 2JIVA 2HIWA 1H1QA 5JT2A 5CF5A 4V0GA 4AP7A 3FSFA 5K0XA 1OPJA 3LJ2A 3FQHA 2PZPA 3Q4TA 4C4FA 4EJ7A 3U8WA 1VZOA 3D94A 3MESA 1M52A 5A6NA 4YC6A 4A06A 4L53A 4M8TA 2CCIA 1GJOA 2AYPA 4NH1A 1H1RA 4O81A 2BILB 4FYOA 3LCSA 1SMHA
chains in the Genus database with same CATH superfamily
4RIYB 3B8RA 2R7BA 2O64A 2YDKA 2BROA 4M66A 4QP3A 2Z7QA 3G9LX 4WD5A 3ENMA 4AXAA 4DLIA 1J7UA 4XG4A 2ZV7A 4CKRA 3GT8A 3NW6A 4IZAA 4KIKB 3MS9A 4PQNA 1FVTA 4NW6A 3ZO2A 4ENYA 2J0JA 4JIKA 4X2JA 4DH5A 4D1ZA 3UO5A 2OH0E 2CGVA 4DDIA 5CEIA 4EZ7A 4M12A 5HIDA 4FT3A 3BYOA 3MFTA 4Z7GA 3QCYA 3LFSA 3SG9A 4WNPA 3VUIA 5CX9A 2VTTA 4KSQA 3ANRA 1DI8A 4UWBA 3FMLA 4F1OA 3PYYA 3NUUA 4GRBA 2B54A 4JG6A 5HHWA 3BLQA 4QEBA 2GHLA 4BDFA 2QU6A 3TEIA 3P5JC 5K5NA 5AR7A 4CYJA 3H4JA 4EBVA 3OTVA 4JQ7A 4I6HA 2C6TA 3DY7A 4UMQA 2CGXA 5I5ZA 3DBCA 3LMHA 4RX7A 3UO4A 3U9CA 1OL5A 4X6QC 5FXRA 5HG8A 4NM7A 2O63A 3QL8A 1M14A 2A1AB 3C4CA 4P4CA 3ORKA 3FUPA 4W8EA 2C6EA 3A7GA 4G34A 1KE5A 4XG8A 4AGCA 4ANSA 4CYIA 4IMYA 2BAQA 5CI7A 3VF8A 3U6IA 3KQ7A 1WBTA 1OITA 4DEHA 2W06A 3ORPA 4O0WA 2X4FA 3V5TA 3A7HA 3HV4A 3P5KA 4CGAA 4M68A 4D9UA 2JDRA 1KE9A 3DPKA 3GOKA 3VO3A 3DJ6A 4RWJA 2YLFA 4OAVB 2C1BA 4DEIA 5L2TA 4HCVA 4ITJA 3UBDA 3UO6A 2VU3A 5ANEA 3QFVA 3GP0A 2PTKA 3ACJA 3DS6A 3QGYA 2XCHA 3RK5A 3BL7A 4O83A 4IFGA 3TUCA 3BU3A 5DE2A 4U3YA 4RIWB 4KBAA 5EDPA 3TTJA 2RSVA 1PYEA 4EK8A 3PXZA 3IW6A 2PYWA 4HNFA 4OTDA 3TNWA 2XIKA 3EJ1A 1Q3WA 3HVCA 4WT6A 5EKNA 4KNBA 1BKXA 3D9VA 5F9EA 5BYYA 4RG0A 3CC6A 3D7ZA 2ITZA 3RBWA 3Q9WA 4Z16A 4A9SA 2ITQA 4OBQA 2VTAA 5F4NA 1XHAA 1ZMUA 3OWPA 3FPMA 2XNMA 3BE2A 3OVVA 2ITNA 3R22A 4LDTA 5L2IA 3R01A 2B9JA 4O7RA 3LOKA 4FKQA 1PMNA 3QWKA 4G9CA 4CVAA 1TZDA 1JKTA 3QRJA 3CGOA 4FV4A 2IN6A 2QONA 3DJ7A 4D58A 1PHKA 2G15A 4KKGA 3ALNA 3OWLA 4JAJA 4YSJA 2VV9A 4YBKA 2QO2A 3T9IA 3DLSA 3OEZA 4L3PA 4R78A 2JDVA 2UZDA 1ZAOA 3SX9A 5KX8A 2OKRA 3TN8A 4WBBB 3EZRA 3RAWA 1FPUA 3HDNA 4FJVA 3FY2A 2B53A 2PSQA 4U79A 4DH8A 2QOQA 2RFDA 4GYIA 4O1OA 4AOTA 2HELA 3AMAA 4I94A 2VWBA 3BRBA 4KIOA 3ZLYA 3WF7A 1OMWA 4PMPA 2YJSA 4YBJA 1YOLA 3GCPA 3O8TA 2IZUA 3PZHA 3ID6C 3AD5A 5CAUA 4U44A 4O27B 4ACCA 3A7IA 4MD7E 2DS1A 3TUDA 2WMBA 3EQCA 4PNKA 5D7AA 3IKAA 2JKQA 1MRVA 2NNWB 2QQ7A 1CMKE 2UW9A 3FMJA 3IDPA 4FV2A 2C5OA 3FL4A 5JFSA 3AKJA 2ESMA 2XK9A 5KCVA 4JDIA 3UVQA 4FKRA 1JBPE 1KV1A 2Z7RA 2YIQA 4O91A 4CV9A 5C26A 4O7YA 5AV0A 2X7OA 3HMNA 4IX3A 4NUSA 3AT3A 4GH2A 4TY1A 1F0QA 4W8DA 4WRSA 2Z02A 4FKJA 5IUGA 4Q5HA 3TIZA 4ASDA 3KMUA 4U6RA 3W2QA 2BKZA 3TWJA 3DKGA 3NAYA 5DA3A 4DG3E 3RHXA 4F9CA 3HRBA 4JVGA 1S9JA 3HP5A 5IA5A 5KMMA 4WSYA 3Q9ZA 2I6LA 3VJNA 5EW9A 1J3HA 4TNBA 3DXPA 2VD5A 3TKHA 4ZTLA 3ZFXA 4JG8A 4M15A 3ZFYA 4IWQA 5TR6A 5IQGA 3I0QA 3DFAA 3OD6X 3QX4A 4L46A 3SHEA 4ANOA 1AD5A 4PL4A 1YHSA 4K8AA 3TV6A 4AA0A 3QKKA 3OS3A 1M17A 3NYVA 2HY81 2XK4A 3EMGA 4WUAA 5IH6A 1Q8WA 3MB6A 2Y9QA 3BGZA 3DTCA 2QI8A 3GU4A 3IECA 3DK7A 3QCQA 4XG7A 3HMMA 4RVLA 2YM4A 3KK9A 3BYVA 5JRQA 3RWQA 5BUJA 4MF0A 5BVOA 3PA4A 3G6GA 2A27A 4IB3A 3TCPA 3MA3A 3P86A 4UZHA 3BYUA 4LL0A 2W1ZA 4FZAB 4YHJA 4DGLC 3O50A 3W1FA 1R3CA 4E8AA 1TFFA 4GW8A 4L6QA 4TT7A 3CD8A 4OBPA 4XMOA 5C8MA 4NK9A 4I6LA 2GS7A 4L42A 4V05A 5E7RA 1JKLA 1MRYA 3MTFA 3RTPA 1XR1A 1ZY4A 2J4ZA 3QC9A 3O8PA 2FH9A 3UG2A 2PUUA 4Y46A 3ETAA 4IZYA 4XEYA 4BCNA 1XBAA 1UWJA 4CFMA 3AGLA 3QLGA 2ETMA 3QTSA 5CT0A 5DHJA 4YJUA 5DT3A 5CY3A 5H8GA 2X81A 1KOBA 3IS5A 3OEFX 4Y85A 5ACBC 3DBDA 5AUZA 4U7ZA 3W0OA 3LFDA 3BYMA 3A7JA 4FSMA 2JKOA 3GBZA 2OJ9A 4PMTA 3QQLA 3V5WA 2WMVA 3KRXA 1REKA 3LQ8A 3VBXA 3C4XA 3PIYA 4X3FA 3ZXTA 4FKLA 2W9ZB 4LRMA 2HK5A 3OT8A 2WTCA 2OF4A 3QTZA 3A4OX 5JZNA 4CRSA 5GINE 2XIXA 1V0BA 4A9RA 5J9YA 3JYAA 4BGGA 2W99B 2XF0A 2C6MA 2ZYBA 4O84A 1VLRA 3FZTA 1T46A 3BHUA 3ZOSA 1UU7A 4B6LA 5C27A 2J5EA 3NZ0A 2WMWA 4H3BA 2FSLX 4I23A 3G51A 1BLXA 5D11A 3DZOA 3G0FA 3COKA 4XG9A 4FYNA 1J7LA 4DN5A 1XJDA 4CEGA 2WMAA 3PVBA 3KEXA 4KSPA 5G1XA 3ZH8A 3DFCB 4JRVA 4NJ3A 2IVTA 1MRUA 4G3CA 1J1CA 3L9PA 4O0VA 3C4EA 4LOQA 4QMMA 1XKKA 1OECA 3DXNA 3PJ8A 4QPAA 5M4UA 4C37A 3LXNA 2FGIA 3IW7A 1WBVA 4M13A 3P1AA 4HGSA 4JDKA 4ITHA 4JR7A 4EOQA 2XK3A 2V5QA 3LFFA 4NM0A 3PVWA 4GEOA 5IISA 4YLLA 3VJOA 1ZZLA 2R0UA 3ORIA 4QTBA 4R3PA 4W4XA 5M57A 4G5JA 3AG9A 4XLIA 3PE1A 4MXZA 2F49A 3NGAA 4KB8A 4YJRA 4YP8A 3BQRA 3DNEA 3KMMA 1W98A 4DBXA 4DT8A 1NW1A 4N6ZA 2REIA 3UE4A 5EQPA 3BHYA 5CF4A 2AC3A 4LM5A 4RFYA 5H3QA 1PXPA 2VTSA 2RGPA 2X4ZA 1FINA 4GYGA 4IACA 4RFMA 3SXRA 3VQUA 4BYIA 4DG2E 2PU8A 3UGCA 2XMYA 3BHTA 3K3JA 4QMUA 4JBQA 3O2MA 4MH7A 4QPMA 5L8KA 4ORKA 3OCGA 2W4KA 2W05A 2XYNA 3DKCA 4QQCA 2JAVA 3PP1A 5EYMA 2UVYA 3TV4A 3KF7A 4C3FA 1JPAA 5KMKA 5DWRA 4F4PA 5LVOA 4F99A 1U54B 5J1WA 3RP9A 5CS6A 4O4DA 3SC1A 1FGIA 4C02A 4D0WA 3C4FA 4PDYA 3PXKA 1CTPE 3G9NA 5LCKA 4I5PA 3D0EA 2GDOA 3JY9A 4PX6A 5L8JA 1ST0A 2PUNA 2BRMA 1M2QA 4DYMA 2PL0A 4KS7A 4IJ9A 4RA4A 4IANA 4AT4A 4BCPA 4CTCA 3VBVA 4CT2A 4F6UA 2O65A 4FT9A 3PWYA 2C4GA 4XCUA 2QOKA 4UWCA 3RPRA 3DDPA 3TV7A 3ML1A 4GT4A 5CAVA 2DYLA 3GQLA 2BHHA 3QYWA 2XKCA 3F66A 4RIWA 4CZTA 4P5ZA 2VTMA 5IF1A 3S2PA 3N51A 3VHEA 5LQFA 1BL7A 4Q9ZA 4DEBA 2PPQA 1TKIA 4FTNA 5KMJA 3C7QA 1CDKA 5L2QA 3TDWA 4S34A 4FX3A 4IXPA 5E90A 1Q24A 2WOUA 3AKLA 3VW6A 5F20A 4QMPA 3DV3A 5CANA 3QGWA 3V5JA 2HOGA 3ZSHA 3HL7A 4K18A 3C4WA 5AV2A 4BDEA 5L8LA 4GIIA 3N4VA 5EHLA 3DB8A 3QLFA 2R3HA 3HMIA 3QQHA 1DAYA 1OM1A 2YACA 4FUYA 4GVJA 2XNNA 4JAIA 1LEZA 5B2MA 1OGUA 2XVDA 4C3PA 5IPJA 3B8QA 3WZKA 5HX6A 5DR6A 4IZ5A 4ACMA 2GQRA 4FGRA 1ZRZA 3FJQE 2ZJWA 3HAVA 4DHFA 4LMUA 1VEBA 3ATSA 3L1SA 2G2FA 3LJ1A 4L3LA 5T3QA 5CSVA 4NYEA 2CGWA 3I0OA 3LXKA 3REPA 1G8AA 2JDTA 4XP2A 4QMQA 5CF8A 3KKVA 3ZZEA 1YXTA 2BRHA 1Q41A 3MJ1A 4FTIA 1OPKA 3FQEA 4I21A 4C36A 4BVUA 3GFEA 4FTRA 4K1BA 2RG6A 4YJQA 5LMBA 2YDJA 3VS7A 2YEXA 2W4JA 4APCA 3EB0A 4ID7A 4Q5EA 5LMAA 5J5TA 5KKRC 3NCGA 2I0HA 5CI6A 4U3ZA 5HIEA 5KZ0A 3NX8A 4TYEA 1R0PA 3D15A 4XBRA 2XUUA 4FOCA 2OJGA 3PVUA 4YZBA 1MQ4A 3L8XA 4H3QA 3RM6A 4XV3A 4L00A 4MCVA 3UZPA 3GVUA 4FIEA 3SLSA 4AW0A 4BGQA 3F2NA 4QYYA 4AAYA 2QOOA 4AAAA 1JQHA 2YCFA 1KE8A 1S9IA 2XKDA 3E7OA 3QTUA 4Y83A 5CSXA 4BFMA 4IHPA 2OXYA 4X0MA 3VUGA 2WTKC 1J91A 1VR2A 2PHKA 3V01A 4EUUA 4HVIA 5J7HA 4F7LA 2XEYA 5AP1A 1Q99A 3OY1A 4MNFA 2ZV2A 3PY1A 5KHXA 3HV6A 2HZ4A 3KGAA 1H0WA 2W7XA 4PP9A 2WNTA 5EK7A 2UZNA 2EXCX 3ENHA 3LFEA 5C8KA 3H30A 4LRJA 4S33A 3TACA 2WQMA 1JWHA 4FI1A 4RX8A 2H6DA 5HX8A 5CEKA 3KXZA 3HMPA 4D5HA 4BIDA 2OSCA 3AC5A 4QTAA 1IAHA 3DJ5A 4DDGA 3I6UA 4ANBA 4BBEA 5FTOA 4C34A 4YLJA 5HNGA 1Z57A 3EQHA 3DU8A 3KULA 2BFYA 3K5VA 4RGJA 5DPVA 2P0CA 2QOLA 2WU6A 4KIPA 4MXOA 4PWNA 3FMKA 3UDTA 2XBAA 2X0QA 1IA8A 2UZOA 3PVGA 4ZK5A 3OXZA 1Q3DA 5K0KA 4LV7A 4XRLA 4MTAA 3BIZA 5HG7A 3I1AA 4FTMA 2P2HA 5EOBA 4D28A 4I92A 1Q62A 3PY0A 4L44A 4MBJA 4J8MA 4DT9A 3LIJA 4GG7A 5GZ8A 1Y57A 4JRNA 2WTKB 5CU3A 2IW9A 4GKIA 2FSOX 4EOMA 4QMWA 4LOPA 4WA9A 2ZMCA 1Y91A 4YHFA 4XLVA 5I0BA 5AV1A 3TNPC 2YIWA 3L9MA 3BGQA 1CKPA 3RJCA 5AX3A 5BMSA 2BTSA 1HOWA 3QZHA 3PJCA 5DEWA 5IMEA 1WFCA 2GNHA 2PVNA 3E3BX 1JAMA 4ZSGA 3LFNA 5DR9A 3TJDA 3PPZA 4GK2A 1DS5A 2PWLA 3KA0A 4G3EA 3V8TA 1BUHA 3UC3A 2VX1A 3W0NA 3R1QA 1W7HA 3FLYA 3PXFA 5EKOA 2R9SA 3NUPA 4LMNA 3KRWA 1PXIA 5AM7A 5CAOA 2HW7A 4F09A 3AQVA 3AC3A 3IOPA 4K11A 1H01A 2VTIA 1OL1A 4O38A 1ZYSA 3DGKA 3QQGA 3VUTA 4Z9LA 2R64A 4BCKA 3VUHA 3H9OA 4FKTA 4F63A 4A9TA 1Y6BA 4TW9A 1PRYA 1R39A 4ZTQA 1YVJA 4UMPA 3HA6A 3DAJA 3GUBA 5BVNA 3FZRA 4GK4A 3BBTB 2R2PA 2RFNA 3FY0A 4RVKA 4M0YA 2UW7A 4P90A 2C6KA 2WTJA 2YCSA 3O96A 4TYHA 4AZVA 1GAGA 3WBLA 5KKRB 1YI4A 3OUKA 5C9CA 4GVAA 4NTTA 3KXGA 1OUYA 2XK7A 4JT3A 4KKHA 4ONAA 2OXXA 2PK9A 4CXAA 4KAOA 3D5WA 4UMRA 2VO0A 4H58A 5AWMA 2BKKA 3ZDUA 1R1WA 2BRGA 1NXKA 2C0TA 4AU8A 5K4JA 5IH4A 5A4LA 1A9UA 3CXWA 1K2PA 3QQKA 2RFEA 3QHWA 2XNPA 4HGLA 4NW5A 4XX9A 3RVGA 2KULA 5DFPA 4MVFA 3FI4A 5EW3A 3QRIA 4RPVA 3QD2B 3AC2A 4II5A 3VULA 4LV8A 3A2CA 2YAAA 3LLAA 3GU6A 3A62A 3P7AA 4DFUA 4FNZA 5EDQA 2OF2A 2PZ5A 2DQ7X 2J51A 4G31A 4O4EA 4QOXA 4BRXA 4CRLA 5AR8A 4FOBA 4PY1A 5M56A 5I3OA 3KMWA 2WZJA 5JRSA 5B7VA 4XV9A 3VUDA 2GNLA 4JBVA 5E8SA 2QG7A 5AP4A 1KOAA 3R7VA 3CTHA 3UP2A 2WAJA 4DHIB 2W1HA 2VX0A 3R83A 3O51A 2IWIA 4FZFB 3K54A 3WF8A 4KS8A 4G9RA 1Z5MA 4QMYA 3ZO3A 5A4EA 5C4KA 4W9XA 4Z55A 1XMLA 4Y5QA 3OXTA 4H1JA 4OTPA 4Q9SA 4QP7A 3TL8A 4G3DA 5FTGA 2EXEA 1WBPA 4G17A 5IUHA 3R28A 4TRLA 2WMTA 5IA2A 3BLAA 4IB1A 4O7ZA 4DHJA 3R30A 1W0XC 3ET7A 3KIOC 4EOSA 4RWIA 3SW4A 1WBOA 5CU4A 2JKMA 3VONA 2QODA 4B0GA 3I4BA 3EN5A 4BB4A 3NIEA 3I81A 4L7SA 3ORLA 4DFBA 4A9YA 3F3WA 4TWNA 3KVWA 3MH3A 3WYYA 5HE2A 5M07A 5DIAA 2BZHB 1XH4A 3MW1A 5E8XA 4R6VA 3V5PA 2C0IA 2F7ZE 4BTKA 5HE1A 4C0TA 1NT2A 1OKWA 2IZRA 3COIA 5CAPA 2C68A 3LE6A 5EQEA 3G2FA 5AP3A 2XNOA 4S31A 3W33A 3OT3A 4F70A 3WYXA 1YHVA 4RIOA 2QVSE 2R3FA 2WTWA 3R7IA 4O96A 2BUJA 2GPHA 2KTYA 4ZZNA 4G1WA 3WF5A 4IVBA 2YIYA 4KUJA 1H00A 4AA5A 2WIPA 1Y8GA 3SRVA 2WELA 2VTLA 4J1RA 4PNIA 2UZVA 4RSSA 5DRDA 3DZQA 4BDAA 2XIZA 4TYGA 2XALA 5IEXA 4HCTA 4FSUA 5BMMA 3GU5A 2FO0A 1UV5A 3L8SA 4BCMA 3R21A 2IW8A 2A2AA 2X6EA 2ITVA 3D4QA 3EYGA 3PXYA 4HVSA 4FEUA 3QZGA 2FA2A 3R63A 3NW7A 4MKCA 2UW5A 4EQUA 3TUBA 4ZLYA 4R7IA 4TWPA 4CMTA 3NW5A 4KWPA 3GI3A 3QTRA 1U59A 4J98A 1FOTA 3I7BA 5HU3A 5FXSA 3A8WA 4MXYA 2X1NA 1ST4A 4BDBA 2O8YA 4F9YA 5AUXA 4USDA 4XS2A 2R3PA 4ZJJA 1Y6AA 3Q5IA 3OROA 5ICPA 4EWQA 5AUUA 3TNIA 5CXHA 5LMKA 3TKIA 4E5BA 4DFZE 4BCJA 3QCSA 4CFVA 5A14A 2F4JA 3MH2A 1XBCA 2BDJA 4LUEA 4AQCA 4EHZA 1GIJA 3S0OA 4L43A 4RA5A 2VWYA 2F7XE 3WF6A 4HVHA 5JK3A 3FEGA 2C3JA 4G5PA 4APPA 3A8XA 3MSSA 4RWKA 5IMXA 2XNEA 3F82A 4OGRA 1F5QA 3H0ZA 3R7UA 3L8VA 2OIBA 3MFUA 3NWWA 4ANQA 2XJ1A 4QP2A 4USFA 5JFXA 5EM7A 2XB7A 4EL9A 1W2FA 2HYYA 3HX4A 3IO7A 3OMVA 4D4YA 4DGGA 4I4EA 3KF4A 5ETFA 4RC2A 2CSNA 2LAVA 2Q0BA 3OW3A 1H1SA 4B8MA 4C62A 5C03A 4OTQA 2P33A 1FQ1B 2R3QA 4JBPA 4JBOA 5E8YA 3PRFA 5CXZA 3C0GA 3PA5A 2J0MB 3ERKA 4YPDA 4EEVA 1VYWA 1P4OA 1QPJA 5HGIA 5CAQA 3A4PA 5HNIX 5L4QA 4LGHA 3UDZA 4XOZA 4QPSA 3NSZA 3U51A 5I9WA 3OW4A 1Q97A 2H9VA 3HV5A 3EL7A 5HE0A 2G01A 3KRJA 2W1FA 4QDVA 3EQBA 5AP2A 2G1TA 5TE0A 3JXWA 3PFYA 3SG8A 4BZDA 2HXLA 1TVOA 2R5TA 4K6ZA 2XEZA 4NSTA 3B2TA 4IQ6A 5KUPA 3FMMA 3MVJA 5HU9A 3PJ2A 2X0OA 4GT3A 3GC8A 5CLPA 4YPSA 3P78A 5G6VA 3LHJA 3RINA 5FTQA 4F6WA 5AR2A 4FTUA 5HD7A 2WKMA 4D4SA 2C47A 4R8QA 2Y6OA 4CZUA 1G8KA 4QD6A 4FR4A 1WVXA 1PKGA 2GHMA 5JGAA 4X2KA 5CSWA 2VNYA 2E9OA 3KN5A 4O7SA 2B9HA 5EW8A 2VGPA 4O0SA 3ZUVA 2VWIA 4B9DA 3THBA 3Q04A 1G8SA 2YCRA 4ZTSA 5IA3A 4DGNA 1ZMVA 2OICA 2WGJA 2PUPA 4FE2A 4ALWA 2W0JA 4I1ZA 3MTLA 4UYNA 4CMOA 4F64A 2OBJA 1XWSA 4PL5A 2JGZA 2QCSA 3F5GA 1YWRA 2BDFA 4YHTA 1Q8YA 3QC4A 3GC7A 5AJQA 4F9AA 1JNKA 5L2WA 1OUKA 2GS6A 2Z2WA 1PXNA 4HYIA 5CVFA 4O86A 2PE0A 4XNEA 1IG1A 3UODA 2ZOQA 5TOZA 3DCVA 1LP4A 4NEUA 5HLWA 3F61A 4NM5A 2ETRA 3MPTA 4MBIA 4O2PA 4E5WA 4QNAA 5CZHA 5ETIA 3EQFA 3Q9YA 5E8ZA 5AA8A 1DAWA 4ZLZA 3KXMA 3RNYA 5JFWA 2XRWA 4DH3A 2B1PA 2V62A 4FT7A 4I6FA 4E93A 5CEOA 4BN1A 3EL8A 1PMEA 1XBBA 1ZYCA 1H25A 3ZS5A 2J90A 4BDIA 1FMOE 4RZWA 2FYSA 3UVRA 2OW3A 3KULB 4D5KA 2EUFB 3CCNA 1YWVA 3P79A 3QRUA 1GZOA 3AOXA 2ITPA 2UW3A 5ANDA 2Y4IB 1YI6A 3QKLA 3SV0A 4R7BA 2W5AA 4IX4A 5A4CA 1PW2A 3OFMA 5AFVA 2XA4A 5EFQA 3E3PA 4E4XA 4ZTHA 2OU7A 3P4KA 3QXOA 4FT5A 5EYKA 3EQRA 3UP7A 3CPCA 3PXRA 1YDSE 1ERKA 4XH6A 4ZY6A 5IA1A 3FI3A 4WRGA 2PY3A 4IH8A 5ANIA 4XBUA 4AW5A 4UZDA 4ASXA 2PVLA 1W82A 4ZS0A 4JQ8A 4C4IA 3OUNB 4F7NA 3FI2A 3LM0A 2I1MA 3OTUA 5K5XA 1URWA 3F5UA 3RM7A 4BCGA 4ZJVA 3LCDA 4IAAA 5HESA 4IB5A 4C59A 5M51A 3MB7A 4D55A 3Q3BA 4DFLA 4EKKA 4J96A 4QNYA 1Q61A 4ANMA 1VJYA 1UNHA 2VTJA 2BFXA 2YJRA 3SQQA 3PPJA 4JS8A 3W8QA 2PULA 4KINA 2QHMA 3O17A 4MD8E 1OKVA 3ZLXA 1JKKA 3TJCA 2WMXA 2XZSA 3NCZA 4S2ZA 5E8UA 2A19B 5T68A 4S32A 4C4EA 3PIXA 1JOWB 3EN9A 5ANGA 2WPAA 3RPOA 3RCDA 5M4FA 4FL2A 4FV1A 3C1XA 4YZMA 4C7TA 5J8IA 4FIIA 4O0TA 3RI1A 1YW2A 3D5UA 3LFQA 3QUPA 3AT4A 3V51A 4M0ZA 4DITA 3U6HA 4N57A 4H3PA 3ULIA 5CTPA 4EH7A 4ZSEA 3HMOA 4EH8A 3OP5A 4KIQA 4O0UA 4DINA 1OBGA 5AR4A 3BLRA 4L67A 4RIXA 4IIRA 4PMMA 4FV7A 4YSMA 4YC3A 3Q9XA 2E9UA 5ANJA 5E1EA 3Q96A 4F7SA 3R8UA 4XP3A 3ZZWA 2QOIA 2WMSA 4I5CA 4C4HA 4TXCA 3WF9A 3UMXA 4EC8A 2W17A 2VZ6A 4HJOA 4WHZA 3FXZA 2UZTA 5HVJA 2BHEA 4BICA 2Y4PA 5HO7A 3UOJA 2RIOA 2ITUA 5I9XA 3JS2A 2Y0AA 4I3ZA 4C35A 4DFXE 4GCJA 5LWNA 4FTAA 5FBOA 3PY3A 4ZSJA 4U97A 5HVYA 3QA0A 3S00A 4G6LA 3OCBA 4YTFA 5B2KA 4O0RA 4ZXTA 3ALOA 2ZB1A 4O82A 3HECA 4YC8A 1JSTA 4NCTC 1OKYA 5AR3A 5HG5A 3NNWA 4C3RA 3AMYA 2C3IB 2GCDA 3CIKA 4I6BA 3EN4A 3D2KA 3CJFA 3HDMA 3EKKA 1VYZA 5HBJA 3GU8A 2C0OA 5D1JA 4LYNA 2IVUA 1UNGA 2GS2A 3EHAA 3QTIA 1OPLA 4ZAUA 4RFZA 2W5BA 4IJPA 4HNIA 1HCLA 3ODZX 2WHBA 2JC6A 4QP4A 1PF8A 4L45A 4BTFA 4D2VA 4B8LA 4F0IA 3IK3A 4NJDA 3W2CA 3IOKA 1BL6A 3PFQA 3SVVA 4GKHA 4XV1A 4Y8DA 1V0PA 4YGAA 3UYSA 2J50A 4U9AA 4ARKA 2I0VA 3QU0A 2GSFA 4G16A 3TT0A 2JITA 3FQSA 3KL8A 5AA9A 3FC2A 3AD6A 4QMLA 1PXKA 4W4YA 3TI1A 4AZSA 4Y72A 4IB0A 2ZDUA 3FBVA 5K3YA 4B7TA 4KKEA 5B0XA 5E4HA 3R9RA 3MY5A 3FKLA 4GU9A 1OB3A 3U87A 2F2UA 4YO4A 2JKKA 3QALE 4YLKA 3KREA 3LQ3A 4HOKA 4CT1A 2Y4IC 5IQHA 4XHKB 2CKOA 5AV4A 1PXJA 3CS9A 5HI2A 2YM8A 2G2IA 4GMYA 3Q5ZA 4U80A 1XH5A 4IVAA 4NFNA 2J7TA 3RAIA 3WARA 4X3JA 4DH1A 2OK1A 3LLTA 1XH8A 2QHNA 4JMQA 4BY9E 4NZWB 1QL6A 5DYJA 3ZRKA 4DA5A 4QYGA 3UNKA 1GZ8A 3V6SA 1Z9XA 3H9FA 3W32A 1IEPA 2WEVA 3PP0A 4AUAA 2F2CB 3PJ1A 4EQCA 2G9XA 3MIYA 2OFVA 1V0OA 4AOIA 2AUHA 2HWOA 3E8DA 3EYHA 3AT2A 1CKJA 4PMSA 1H08A 3QCXA 4AXFA 2IZSA 4FZ7A 3F3TA 5CVGA 5AP7A 2AEGA 2ONLC 4RRVA 3C50A 2OIQA 3GENA 3K3IA 3WZUA 5FUTA 3Q6UA 4EHVA 2A4LA 4CV8A 2GFSA 2XK6A 2C69A 2W5HA 3HA8A 3I60A 3QQUA 2H96A 3NVKI 3RK9A 4R77A 2UZLA 3F3UA 5CSHA 5A4TA 2I0EA 1R0EA 4AX8A 1LR4A 4FG7A 4FZDB 1YKRA 3ROCA 5AAGA 2OFUA 3ZONA 5CSPA 3CQWA 3EQPA 4AQKA 1IR3A 4JNWA 4ZMEA 4BWKA 3COMA 3PA3A 3EZVA 4WG3A 2EB2A 4EJNA 4FG8A 4GUEA 5CZIA 1OZ1A 2GQSA 4MAOA 2ZM1A 2JDSA 3RZFA 2QNJA 2R3MA 3W55A 5A3XA 3BX5A 4EYMA 4E1ZA 4TYJA 4F7JA 4R1YA 5LWMA 3RKBA 2WFYA 1O6YA 4BDHA 3H3CA 3UQFA 4ALUA 1GOLA 2GNIA 1MUOA 3MPAA 4BI0A 1QPEA 5EG3A 3B2WA 5ACKA 3F69A 2X9FA 2C30A 2ZV9A 4OT6A 2ZM3A 1H24A 4RLKA 5J1VA 3IG7A 1U4DA 5FEDA 1E1XA 2OO8X 4AZFA 4AZEA 4TL0A 3TYKA 2ZVAA 3HLLA 5C8NA 5E1SA 3KC3A 3ZLSA