The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
198
|
sequence length |
585
|
structure length |
585
|
Chain Sequence |
SLFLIESEPSTGASVSKNLTEIILIFSNDINKVSQLALTDLITDSDIQGIDYNIEGNKVIINNFSLEPTCNYRLSYEVIDIYDNHLQGYIEFLVNQSNYPQIPDQEVNHTILQAFYWEMNTGEYATEHPEEANLWNLLAERAPELAEAGFTAVWLPPANKGMAGIHDVGYGTYDLWDLGEFDQKGTVRTKYGTKGELENAIDALHNNDIKVYFDAVLNHRMGADYAETVLLDENSRDKPGQYIKAWTGFNFPGRNGEYSNFTWNGQCFDGTDWDDYSKESGKYLFDEKSWDWTYNWDEDYLMGADVDYENEAVQNDVIDWGQWIINNIDFDGFRLDAVKHIDYRFIDKWMSAVQNSSNRDVFFVGEAWVEDVDDLKGFLDTVGNPDLRVFDFPLRSFFVDMLNGAYMADLRNAGLVNSPGYENRAVTFVDNHDTDRDEGSYTVSIYSRKYQAYAYILTRAEGVPTVYWKDYYIWEMKEGLDKLLTARRYYAYGPGYEVDNNDADIYSYVRSGFPDVAGDGLVLMISDGTSGNVAGKWINSRQPDTEFYDLTGHIKEHVTTDSEGYGNFKVIKSEDKGWSIWVPVE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal Structure of the Polyextremophilic alpha-Amylase AmyB from Halothermothrix orenii: Details of a Productive Enzyme-Substrate Complex and an N Domain with a Role in Binding Raw Starch
pubmed doi rcsb |
molecule tags |
Hydrolase
|
source organism |
Halothermothrix orenii
|
molecule keywords |
Alpha amylase, catalytic region
|
total genus |
198
|
structure length |
585
|
sequence length |
585
|
ec nomenclature |
ec
3.2.1.1: Alpha-amylase. |
pdb deposition date | 2007-11-12 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00128 | Alpha-amylase | Alpha amylase, catalytic domain |
A | PF09154 | DUF1939 | Domain of unknown function (DUF1939) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Barrel | Elongation Factor Tu (Ef-tu); domain 3 | Elongation Factor Tu (Ef-tu); domain 3 | ||
Mainly Beta | Sandwich | Immunoglobulin-like | Golgi alpha-mannosidase II | ||
Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulin-like | ||
Alpha Beta | Alpha-Beta Barrel | TIM Barrel | Glycosidases |