3BCFA

Alpha-amylase b from halothermothrix orenii
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
585
structure length
585
Chain Sequence
SLFLIESEPSTGASVSKNLTEIILIFSNDINKVSQLALTDLITDSDIQGIDYNIEGNKVIINNFSLEPTCNYRLSYEVIDIYDNHLQGYIEFLVNQSNYPQIPDQEVNHTILQAFYWEMNTGEYATEHPEEANLWNLLAERAPELAEAGFTAVWLPPANKGMAGIHDVGYGTYDLWDLGEFDQKGTVRTKYGTKGELENAIDALHNNDIKVYFDAVLNHRMGADYAETVLLDENSRDKPGQYIKAWTGFNFPGRNGEYSNFTWNGQCFDGTDWDDYSKESGKYLFDEKSWDWTYNWDEDYLMGADVDYENEAVQNDVIDWGQWIINNIDFDGFRLDAVKHIDYRFIDKWMSAVQNSSNRDVFFVGEAWVEDVDDLKGFLDTVGNPDLRVFDFPLRSFFVDMLNGAYMADLRNAGLVNSPGYENRAVTFVDNHDTDRDEGSYTVSIYSRKYQAYAYILTRAEGVPTVYWKDYYIWEMKEGLDKLLTARRYYAYGPGYEVDNNDADIYSYVRSGFPDVAGDGLVLMISDGTSGNVAGKWINSRQPDTEFYDLTGHIKEHVTTDSEGYGNFKVIKSEDKGWSIWVPVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha amylase, catalytic region
publication title Crystal Structure of the Polyextremophilic alpha-Amylase AmyB from Halothermothrix orenii: Details of a Productive Enzyme-Substrate Complex and an N Domain with a Role in Binding Raw Starch
pubmed doi rcsb
source organism Halothermothrix orenii
molecule tags Hydrolase
total genus 198
structure length 585
sequence length 585
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3bcfA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bcfA04
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3bcfA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bcfA02
2BY1A 4JAWA 4JL2A 4FLSA 1YHTA 3VDHA 1BG9A 4L4PA 4AZGA 4U2YA 1ISXA 2X09A 3BVUA 3NYDA 1UWRA 3MANA 4PMVA 1E6NA 2UY2A 3HG5A 1GQKA 1US2A 4GO8A 4D6GA 3GBDA 2EPNA 3AS3A 1DWIM 1I1XA 3PZTA 3PTKA 2CETA 2FGLA 1J18A 2XGBA 3MV01 1KCLA 4CILA 1JNEA 2RGLA 3ALGA 3WNMA 4PSRA 1GW1A 3RM9A 1UG6A 4H8UA 4U5KA 4GZJA 1ZJAA 2D20A 1H0IA 3DDGA 2E40A 3VGHA 1HNYA 1NOUA 2W5FA 3APGA 3IANA 1JZ5A 2XPKA 2VX4A 5ABFA 2CIPA 3HG2A 1RP9A 2AMGA 1W2PA 1KQYA 1OGSA 1IX2A 1VBUA 4MDPA 3L2LA 3BCFA 1O6TA 4D71A 1U30A 3AISA 4NX0A 5F7UA 2DT2A 4IPLA 4P8VA 1UQYA 4GIAA 2DPEA 3WBEA 1GQIA 3AIUA 3B9AA 2C7FA 1XRVA 4JIEA 3A4XA 2ZE0A 4LX4A 3WQ8A 1G9HA 3QHMA 3ARVA 6TAAA 5CGTA 1MWOA 3WENA 2VCCA 4FLOA 3RCNA 1CECA 1E0VA 1EDTA 2VQUA 4WF7A 1JL8A 2WMJA 4GXPA 3H55A 3E1F1 4BS0A 4LGXA 4HA1A 2JEPA 2GSJA 1H6UA 1AQ0A 3CUGA 3W25A 4V28A 4W7WA 1LG1A 2DDXA 4GZIA 4E8DA 1VRXA 4EKJA 5M03A 1R86A 3BVWA 1HIZA 1W91A 2WKLA 2F7RA 3GXFA 1CIUA 3KEHA 5IHSA 1C92A 3IAQA 1L0PA 3VIOA 1G5AA 4CCCA 4YHGA 3A3HA 1XSKA 1P6WA 2VX6A 4P7QA 5JIPA 1QI2A 3BGAA 5CG0A 2OMUA 3WF3A 1HVQA 3PBGA 1BAGA 1QOXA 3ARPA 2WHLA 3A6OA 2VC9A 3FY1A 3EMCA 1WZLA 2BVYA 1KXQA 2J77A 3KLKA 5A6BD 3VIGA 1SMDA 2J8FA 5JIWA 4GINA 3VILA 4CC4C 2J4GA 2WVTA 1UR1A 1UYQA 1BPLB 1HTYA 3ZO9A 3DX1A 1W3HA 4MDOA 3W81A 3LXCA 4MADA 1VIWA 3SURA 1QI0A 4JFVA 2J79A 2VZSA 1E6XM 3FAWA 3IJ7A 1UQZA 2EPKX 5LA1A 1UWSA 1E6ZA 3BUIA 5CPSA 2C9PA 3WNNA 1E1EA 5HXMA 2DT0A 2YDRA 1W9BM 3AYRA 4AZCB 4M8UA 1M42A 1ZBCA 2O9RA 1JZ3A 1MQQA 2OSYA 1E5NA 4M82A 2W4XA 2PBOA 3CBWA 1ZBKA 3I3EA 5GPRA 1M01A 4HMDA 3BUQA 1KR0A 4P8XA 1JIBA 1JZ7A 3SUUA 1J01A 2W61A 5KZ6A 4AYGA 1B3ZA 4B3LA 3BUPA 3OZPA 2V3EA 5A6BA 2J78A 1H6TA 3VDCA 4WKAA 4CGTA 2Y8VA 2VMFA 4PTWA 1CNVA 3II1A 1JZ8A 1TE1A 3HU7A 4AXNA 3SCVA 3ZMRA 4ZE4A 5I5RA 3N04A 4NZJA 2X0YA 3VINA 3WMCA 1HL8A 4HA3A 4KGLA 1V6YA 1H1NA 4IISA 4KMQA 1DWGM 4V2XA 2F7QA 1OIMA 1QWNA 3T2OA 4UZSA 3LRMA 4PTMA 2XIIA 3BLKA 3W6MA 3T0DA 3L4WA 1NH6A 3CZKA 4CN6A 2Y4SA 2DGAA 3GYCA 2A3HA 3FNDA 3AMKA 4FNQA 1M9SA 4W93A 3CLWA 4V27A 1NOWA 3GXPA 4BQ5A 2XFFA 3BH4A 3W4RA 2XWDA 3AXHA 1VB9A 3L4UA 2XJ7A 3WEOA 3ZR5A 1TQUA 3CO4A 2NT1A 2WZIA 4Y7EA 3WNLA 3DX4A 1FOBA 3WUEA 2PWEA 2PB1A 4C7FA 4WLCA 2E8ZA 2WC4A 1TCMA 3L4XA 4W87A 4EE9A 4QLLA 5KEZA 3AMLA 1E0WA 1CXEA 3WH7A 4N0RA 4F9DA 3WNKA 4DO4A 3BAJA 4OOZA 1NP0A 4W7UA 2XSBA 1E71M 1KTBA 3CHDA 2GDUA 3EDDA 3TV8A 5EB8A 4AMWA 3MO4A 2OWWA 3BUDA 4WSJA 5LYRA 2JIEA 1U2YA 1HT6A 3WY4A 2BHUA 2VOTA 2CEQA 2QPUA 3RM8A 2HISA 2EQDA 2VR4A 3FW6A 1BQCA 4TX8A 1R7OA 2IXVA 1UWUA 1QI4A 1VAHA 4HU0A 1IZKA 2OW7A 5IFTA 3TA9A 2WK2A 3VD9A 2QMJA 4D72A 2GVYA 2VJXA 3VNYA 1I75A 3TOPA 1GJUA 4PMQA 1RPKA 4PEEA 4XV0A 4X0VA 3OGVA 3WIJA 5I3DA 1R34A 2F2HA 2ZX9A 3U5YA 4NSBA 3VDAA 3N13A 2C8NA 3LXAA 3BVXA 4KH2A 2WB5A 4P7RA 3H53A 1QI3A 4GZEA 2VZUA 1JI1A 4AQ1A 2VURA 4J3WA 4JKLA 3VX0A 4PBGA 2IXUA 5A69A 5AY7A 3MKKA 2D24A 2WNWA 3T08A 2YDSA 4CUCA 4AISA 4AIUA 4ZE5A 5M17A 3D52A 4OGZA 1BTCA 1KXTA 4LPCA 1NQ6A 3AJ7A 4PMYA 1C7SA 3PZGA 2CBVA 1UUQA 3AHVA 3LPGA 3WFLA 4J7RA 3CUHA 1US3A 3TTQA 4UQBA 1KBKA 1CLXA 3VIMA 4TVUA 1E6PA 3WY1A 1XEUA 3L4VA 2X8RA 3DDFA 2XGIA 3CMJA 3KZSA 1SZNA 2GUYA 4AD0A 4PMOA 1TQWA 5ABEA 2GK1B 1VFOA 3F5JA 3WQ6A 2OMWA 1JFXA 1QBBA 1HKIA 2CITA 3BAWA 1GUVA 2YKKA 4BQ4A 5LA0A 4ML4A 1UR4A 3D3AA 4QLKA 3A47A 1W2VA 2XWEA 5GNYA 2ZUWA 1UD3A 1NM9A 2WHMA 3AIQA 2ZXDA 4URIA 3EJRA 4AZBA 4RL3A 1PX3A 1BPLA 3EJTA 2XYLA 3RPMA 3GXDA 1H2JA 1UA7A 4HP5A 2J62A 3A4WA 2OMYA 1WP6A 2OMVA 1LLOA 1KB3A 1WZAA 1W1PA 1DWFM 4OJYA 5CPTA 1CLVA 4UQAA 5A6JA 2J25A 3U57A 4PTVA 1T0OA 3MUIA 2WMGA 4YN5A 1EHAA 4AZCA 2VRJA 1MYRA 3WH8A 1Y7VA 4DM1A 3VTRA 5CZKA 1DP0A 3ZJ7A 1IZJA 4TUFA 3KL3A 4A3HA 2FHFA 4EAMA 3WDIA 2ZWYA 4JKMA 5A8OA 4DM2A 1L8NA 1DEDA 5JBEA 2FE0A 2GFTA 3BAXA 4UR9A 1TVNA 5BWFA 5D4YA 5M5DA 2VNCA 3WNPA 2Z1KA 2WZHA 4X0NA 1UH3A 8A3HA 3QHOA 1B31A 1V3IA 3WF4A 3VMNA 3THDA 3GZAA 1X6LA 2F18A 1Q6FA 3SUWA 4GI9A 3T09A 3SCNA 7A3HA 1H11A 2WCAA 3SCOA 1QX1A 2A3BA 5AC4A 1ECEA 4NF7A 1V0MA 1A47A 1K9FA 2W91A 4PUDA 2YL9A 2FHCA 4PMRA 4CVUA 2XFRA 1O6VA 4CC4A 5E6YA 3N1AA 3VIPA 4D6EA 3EDJA 4NI3A 4HZ8A 1CZ1A 2J7EA 5E70A 2WC7A 2CHOA 2J7HA 1NWSA 2J7BA 1W1VA 2WMIA 1EO7A 2ZWZA 3MV11 1E4IA 1CWYA 4AC1X 2BY3A 3A24A 5A6SA 1MXDA 3T2PA 5FKYA 2V5CA 3LPOA 1YQ2A 1MW0A 1DHKA 3UG4A 2EBNA 1D7FA 4W8BA 2CERA 4MB5A 3PZMA 3OLIA 1ESWA 1W1TA 2VZTA 5ICUA 3OIHA 4JFSA 1G1YA 1V0KA 3GM8A 1ITCA 2E9LA 1W1YA 3D4ZA 3SCTA 3VX1A 4U33A 3PTQA 3WF0A 2WW5A 4D1IA 1W9VA 3ALFA 1MW3A 4W5UA 4CD8A 1GCYA 1W9PA 3N15A 2X1IA 3TTSA 1JAEA 7TAAA 3WH6A 2NT0A 4PYSA 1O7AA 3KL0A 1FH7A 2X2HA 5I77A 1HX0A 3MMUA 3GH4A 2D1ZA 2DT1A 1CGYA 1XH0A 2DIEA 3LRKA 1V02E 4LYQA 2OWXA 4CU8A 2CPUA 1JAKA 1K9DA 3WY2A 3AMGA 3O6AA 2FH6A 5D9OA 3VMPA 3L2MA 2YDQA 3S6TA 3WQWA 4P7LA 1N82A 3G6MA 3ECQA 2WVUA 2JF7A 1JYWA 1JD9A 5FCZA 3QOMA 1UZ4A 4Q22A 1DTUA 5A1AA 5DT5A 1V6XA 1CXFA 1CDGA 4UOZA 1C93A 3ZSTA 4UFJA 4WIWA 2CKRA 1CXIA 5HOSA 4Z2HA 2D0HA 1BG4A 4OUEA 4GKLA 3RDKA 1UKSA 3LRLA 3RMEA 4D6HA 2C0HA 5JUVA 4P8UA 5FD0A 4E8CA 2J7CA 2D23A 4F8XA 2YA2A 3BVTA 2XVKA 1WDSA 3NSNA 4FF5A 3TP4A 2G3NA 2FDMA 4GI8A 3UG3A 1WCGA 2XM1A 3UERA 1HJWA 1BYAA 5DT7A 1CXLA 5AC5A 2IGTA 1ISYA 3OGSA 4E2OA 2WANA 4KWUA 2VVSA 3WSUA 5GQBA 3I3DA 1ZB5A 3RO8A 3DX0A 3SCQA 2VTFA 1LQ0A 2BVDA 4XX6A 2GK1A 3J7HA 2EAEA 4D6JA 2G3JA 3LPPA 2W62A 4CKQA 1QBAA 1PS3A 3A4AA 3WD0A 1C7TA 4A3YA 1MQRA 1JDAA 5HPCA 3WNOA 4AW4A 3F5LA 2O9TA 4AEFA 3HMCA 2EJ1A 3VSTA 3S5ZA 2WMKA 3S2CA 2XN0A 4CN4A 1VJZA 4W88A 2EPMX 1C8XA 1VEMA 2WMFA 1U33A 1CEOA 1V6UA 1BVNP 3SIMA 2A3CA 1LG2A 3POHA 3NUKA 1TUXA 1CTNA 2VO5A 3VGGA 2WM0A 1GOIA 4UCFA 2X0HA 2VL4A 2VRQA 3ARTA 2ZOXA 2D0FA 3ARQA 3D51A 1QPKA 1ITXA 1QNQA 4LYPA 1E1FA 2D73A 2YA1A 3FHQA 2DH2A 4F79A 4B16A 1W9DM 3HG3A 1H3GA 1B3WA 3WUFA 1HL9A 1IV8A 1FH9A 2GJPA 5BXRA 1W9UA 1BLIA 2DH3A 1B30A 3MS8A 2VUYA 2UZXA 3S5YA 2QLYA 2GJXB 3SCUA 3OZOA 4HU8A 1GOOA 1J0YA 4NZCA 2Y5QA 1QNPA 3AS1A 1TQVA 5FIPA 3U7BA 1RP8A 1J12A 3BC9A 3EBVA 1GORA 1C90A 4W8AA 2EPOA 1Q6GA 3K46A 1CGXA 3EJPA 1XC6A 3BXWA 4AMCA 2WLYA 1ZJBA 4HA4A 4IPNB 3UETA 3CZLA 1EDQA 1QNSA 3AXIA 1K6AA 5I79A 3WUGA 2ZUSA 4YHEA 1TG7A 1EA9C 1BGAA 4W84A 1E43A 4KRUA 3W28A 3ARWA 2EABA 1SFSA 4IUGA 4ACZB 1GNXA 4TVCA 4UFIA 2WSKA 4W89A 4CD4A 3K8MA 1M03A 3N18A 3VD5A 1E3ZA 1IT0A 1V3KA 3M6DA 2XG9A 4HOWA 2W63A 5CSUA 1A3HA 1W3JA 1TA3A 3WKZA 5FOOA 3CUJA 5A6MA 4BQ2A 2AOSA 4WKFA 4M80A 4JFWA 5A2CA 2PBGA 3CZGA 2BFGA 5HBFA 3CTTA 4H2CA 1UD2A 1B9ZA 5C8BB 1PX4A 4W5ZA 1UD8A 2JFEX 1AQMA 3AI0A 3ZT6A 4R5EA 1AMYA 4WKHA 4JHOA 1M7XA 1EHNA 5CGMA 1J10A 3VD3A 2XVNA 1E5JA 3GNRA 2F7PA 4HOZA 4H8HA 3MUY1 5I23A 1UKTA 4M1RA 3WL1A 2O9PA 4CU7A 1OM0A 2E3ZA 3BSGA 1V6WA 3CZSA 4MNLA 5EBAA 4AZ7A 1VFMA 5DEZA 2OW6A 1SR0A 2V3FA 2JF6A 3FHAA 4AD5A 5EMYA 1M53A 3L4TA 4DWSC 1EQCA 2E4TA 1FH8A 5CJ5A 2WMIB 2Y8KA 4PN2A 1VEOA 4MAZA 2YFOA 4PCSA 3FN9A 1PX8A 5D9MA 3CGTA 1B1YA 1WDRA 3AFBA 3T0BA 2YBTA 5I24A 1R47A 3K4DA 4PCTA 2BNJA 2JALA 3UESA 4UTFA 4F9JA 1ISWA 2ZXQA 4AZIA 4DUVA 3WQ5A 5ABGA 4WK9A 2XIBA 5A94A 1LL6A 5A8QA 1WB0A 2E8YA 1HN1A 4WSKA 1LWHA 1TVPA 3CC1A 2BY2A 4ZXOA 3NIYA 3GH5A 4D1JA 2D22A 4GO9A 3MMWA 3H54A 1PAMA 1J0HA 2QV4A 4J3XA 3AHTA 4H04A 2WBGA 4QCEA 4QLJA 2DT3A 3RM4A 5JBFA 2ZUMA 3AMCA 1C8YA 1HKKA 1HXKA 1B3XA 1OCQA 4C7GA 4H8VA 1MXGA 4CD5A 4DUWA 3VGDA 2J7DA 2BXYA 4M56A 1ODZA 1NWTA 2DSZA 3FXYA 3UG5A 4AD2A 1J0JA 2VZOA 1VFUA 3AIEA 5GNZA 1WZKA 5C71A 1E40A 2GJRA 1FFQA 4DWSB 2WBKA 3MUZ1 4J3TA 2QF8A 4QDMA 5FL0A 2F7OA 4ATDA 2D3LA 3AXXA 3KL5A 4Z2KA 1E0XA 5AYBA 1Q6DA 2WCSA 3EJQA 2EPLX 2F61A 1C3FA 1QVBA 3AIBA 1JG9A 1EDGA 1CENA 1CGUA 3VM5A 1TMQA 1VBRA 3WD3A 1J0IA 1HP4A 1V3HA 5EFDA 1PIFA 2NW0A 3EDKA 4Z2GA 1BYBA 1WZMA 5LA2A 3HJEA 4CCEA 1C91A 2BS9A 4GQQA 3BUBA 4H41A 4FLQA 3NSMA 1KQZA 3ARXA 1KXHA 4MAVA 3OG2A 3POCA 3DX3A 3MI6A 3WY3A 4DO5A 1H41A 4LQ1A 1PJ9A 1QNRA 1LF1A 1OD8A 4HZ6A 4J28A 2ZX7A 4FNSA 1BYDA 2CBUA 2GJXA 1PIGA 3SCWA 1UR2A 5DO8A 2IUZA 4PTXA 3VOCA 3GTNA 1QNOA 1UH4A 4XZWA 1HKMA 3W6LA 3ZJ8A 1BVZA 1GVIA 5A6LA 1QW8A 1W3LA 3AIVA 4S3KA 1WE5A 1NOFA 4S3JA 1KWKA 1E56A 2YL6A 3I3BA 1CPUA 2FH8A 1FP8A 5CQ1A 4GPNA 8CGTA 3CZ8A 3OLDA 1JD7A 2VX5A 3CZJA 3WDRA 5DF0A 1HXJA 2JE8A 4MB4A 3NDYA 1ZL1A 2V3DA 1R75A 5HDRA 2ESCA 4ACZA 4B15A 3AZTA 1GOWA 4MNMA 3PZVA 1HJSA 1LYQA 4UQEA 3RJXA 2YOCA 1BYCA 3EDFA 2UZYA 3WD2A 1W9XA 2OMTA 3U5UA 1FA2A 2DSVA 2XVGA 2WVVB 2ALWA 3VVGA 2YL5A 2BVTA 1WDQA 4F66A 4XB3A 5BYWA 2W92A 3AOFA 3WL0A 5A6AA 3AROA 2OSWA 3QHNA 1NM4A 3GBEA 4TVDA 3WFZA 4L4OA 3CH9A 4AEEA 2ZUTA 5BXPA 4D6IA 3DHPA 4JCLA 1GONA 5DFAA 4JCMA 1B0IA 2EACA 2XVLA 4BA0A 3TTYA 4HZ7A 1PPIA 5BXSA 5FL1A 1UR8A 1LJYA 4W8LA 4RE3A 2DSUA 4JFUA 1UASA 3ARUA 5CLTA 6A3HA 1B90A 4AIEA 3WQ4A 1UD5A 3IAPA 3ARZA 2C9RA 1JI2A 1HP5A 1E4NA 4AY1A 4HTYA 3BCDA 2WQUA 3M7SA 3VM7A 5CLWA 4U3AA 1HJQA 4J3VA 4Z2JA 3EMQA 1CGTA 3WMBA 4MB3A 3W26A 1TA3B 1GJWA 2G4FA 3UCQA 2FYVA 5E0CA 4OKDA 2X2JA 3WDQA 3AZSA 1QHOA 2WQXA 4HOXA 2C9QA 2Q8XA 1NWUA 2PC8A 5JBDA 4TXEA 1XD1A 4ZEPA 3D50A 2EO7A 4J3UA 1HF6A 3VDBA 1XSIA 4DWSD 3ZJ6A 1JXKA 3VU2A 2WPGA 2J7FA 4MNKA 1OINA 2YLLA 3MMDA 4HMEA 2PI6A 5I78A 3GNPA 1GPFA 4D6FA 2VCBA 2WHJA 5D8WA 1QW9A 1V3JA 2XHYA 5BROA 2VX7A 3W24A 2D0GA 4UQ9A 2Y24A 2NSXA 4AZ5A 3PZQA 3GXTA 5A8NA 3KWXA 1BGGA 1W3KA 3LX9A 2EEXA 2PWGA 1E4LA 3AICA 1JF6A 2D2OA 2ZX5A 4B9YA 3EYPA 2CBIA 3GXMA 4PMUA 2X2IA 3BAIA 3UR8A 2XN2A 4UOQA 9CGTA 2ZUNA 1E3XA 3NCOA 3WEZA 1FHLA 3CIVA 2EADA 2WSPA 2ZXAA 4DWSA 1CXKA 1UHVA 2DEPA 5A6KA 4KGJA 3CUIA 1K9EA 2YBUA 3BAKA 2XM2A 3PZUA 3DC0A 2WXDM 1OD0A 1X1NA 3MSGA 2X2YA 3EJUA 1TZ7A 1OIFA 3B8SA 4EANA 2VZVA 3BSHA 1KGWA 2G3IA 1Q6EA 2CHNA 4GQRA 1ZBWA 3N12A 2CNCA 1GQLA 1QHZA 1H5VA 2W67A 2G3MA 3W0KA 5I6SA 4UFLA 1E6QM 2PWHA 4MNJA 5I0DA 1WO2A 1E70M 4Q7NA 4PMDA 1PBGA 2CYGA 1D2KA 1O6SA 2WQWA 1NARA 4E4PA 5BXTA 3MUAA 3T2QA 4NXKA 3BVVA 4MTVA 1O6IA 1H49A 1V03A 4UFKA 2F1AA 3LXBA 1KR1A 4FK9A 4AW7A 1JZ6A 5ECUA 2B31A 1HKJA 3AS2A 5A8PA 2VRKA 2BHZA 4TOQA 5IHRA 4LXFA 1TR1A 2BY0A 2YFNA 1B2YA 4RE4A 4GI6A 2D3NA 2UWFA 1EOMA 4PMNA 3A22A 2F8QA 4EK7A 2QHAA 5D9PA 1XYFA 3MSDA 3D4YA 4ZENA 4P7NA 1OB0A 3SUTA 3VIKA 2QPSA 2V3GA 4OZOA 4CD7A 1V0NA 3ARSA 2WZEA 3DYMA 3DYPA 1JYXA 3UR7A 4MB1A 3PZNA 1M04A 3G6LA 1JNDA 4JFTA 1FHDA 3ARYA 4OBRA 3D5HA 2WVVA 3SUSA 2J7GA 3B9DA 4HPHA 1AQHA 4CVWA 5IDIA 2WYSA 2VQTA 3CHCA 2ZX6A 3OGRA 1MW2A 1VF8A 4AMXA 3ZOAA 2GDVA 2BXZA 3UEQA 4UQDA 2YIHA 1RH9A 1JYNA 1CBGA 3L4YA 4U3CA 3A5VA 1J9YA 1E4MM 3ZT7A 4BCEA 3SUVA 3ZQ9A 3WH9A 3W38A 1CYGA 3HN3A 3OLEA 1GHRA 3K8KA 3PHAA 3AIRA 4K68A 5IFPA 3IK2A 4P7OA 1UZ1A 3KLLA 4D6DA 1CGWA 4NZFA 4W86A 2OWCA 3PZIA 2XFYA 4UFHA 3AMDA 2Y5EA 2XUCA 1PZ2A 4Z2LA 1V3LA 2OYLA 1GQJA 3ZSSA 3PZ9A 1ISVA 1ZBVA 3AHYA 3IJ9A 1EGZA 4PUEA 1NWRA 2DIJA 3F4VA 4CU6A 1MFVA 1R85A 2WWDA 2Y2WA 1TQTA 2ZXBA 1UOKA 5D9NA 3EDEA 3U7VA 1K9TA 3EMZA 2WLZA 4WJXA 5BCAA 2RA1A 2DSKA 2YLAA 2J74A 3FAXA 4TTUA 2O9OA 3TONA 1XH1A 3VIJA 1VEPA 1AVAA 1H4PA 3A23A 1OWQA 2PWFA 1LWJA 4QP0A 1XV8A 5E6ZA 4AZ6A 2E0PA 4PMXA 2ZUVA 1S46A 1DWAM 1HJVA 5HPOA 1JYVA 2VR5A 1MQPA 3PZOA 3ZT5A 3QGVA 1UD6A 3WQVA 4M81A 4DUXA 2WKGA 2O92A 2OSXA 1XYZA 2FHBA 3M07A 4ATWA 4N42A 4UQCA 2RGMA 1RD6A 3THCA 4FLRA 1B3VA 5C70A 4CN1A 1ISZA 3AZRA 3VGFA 1GOKA 6CGTA 2OLHA 3AYSA 3VUPA 1JF5A 1G94A 1WNOA 3O9NA 3KE0A 5M3WA 1KGXA 1KGUA 4M24A 3VPLA 4OBSA 3VD7A 4J27A 1UR9A 1B3YA 4B3KA 4HMCA 3AQUA 4ACYA 1OT4A 4D6CA 1R33A 4M29A 4W85A 2BHYA 4JL1A 2UY5A 1E55A 1EXPA 1EQPA 4ZXLA 1VFFA 3RJYA 1KXVA 4C7DA 3VD4A 2A3EA 1HVXA 2MANA 3VIFA 4AD1A 1QHPA 2OYMA 1J11A 1WKYA 1PEZA 1X6NA 1GZJA 1BSIA 1SMAA 3T0AA 4U31A 3RILA 5GNXA 3ZR6A 1V6VA 4NRSA 5A2AA 1MW1A 1UKPA 5E09A 4AD3A 1XD0A 4J3SA 1G01A 5CSYA 4DO6A 2PF0A 3WD1A 4JKKA 4AD4A 5A3HA 3QR3A 1EO5A 1FP9A 4AIOA 3SCPA 1OSEA 1V3MA 3WN6A 1TQSA 3MU7A 4AYSA 2QMKA 4QFUA 4Z2IA 1QI5A 2V38A 4MJ2A 4UZUA 1E6RA 1EH9A 1WDPA 3GH7A 3OA5A 1OBAA 2WQVA 4BQ3A 3WUBA 2WHKA 2WMHA 5D8ZA 1Z32X 4OOUA 2G8ZA 3AIWA 4UFMA 3VSUA 1C8QA 4MJ4A 2PWDA 1CXHA 2VT0A 1R46A 1ZS2A 3BAYA 1UH2A 3WELA 3PN8A 1KWGA 1SYTA 1GOMA 1UD4A 3K1DA 2VI0A 2EXOA 1JZ4A 1OT2A 3VIHA 2YL8A 1UKQA 2CXGA 1UKOA 1HWWA 1ZU8A 3SEPA 3IGUA 2J75A 5BRPA 5E0FA 3LPFA 5I2UA 3BMVA 3BLPX 1UWIA 3WBAA 3WF1A 3ARRA 1E9LA 1J0ZA 5A8MA 1J0KA 5E1QA 2CESA 3N11A 5ABFB 1LL4A 1UR0A 2DSWA 4AWEA 1GHSA 4TX6A 1OT1A 3QOKA 3W37A 3WEMA 3BMWA 3K8LA 3VO0A 4AZHA 1O7DC 2VVNA 3VKKA 1CGVA 1DWHM 1FFRA 4P8WA 4LYRA 1D3CA 3GXIA 1HJUA 3B9EA 5E9AA 4B9ZA 2ZICA 3HZ3A 2G41A 4JZ5A 5CXPA 2OMZA 2JEQA 3RIKA 2A3AA 3BZ5A 3OBAA 1XH2A 3F5KA 1R8LA 3O2LA 3DHUA 4QCFA 4BF7A 4FNTA 1JDCA 3CHFA 4XZBA 3VIIA 3N17A 4ZFMA 1JDDA 4PMZA 1EOKA 2HVMA 3CZNA 3CPUA 4FNRA 2UY3A 1PZ3A 2YA0A 3AHXA 1R7AA 1R87A 3WDHA 3IJ8A 3GNOA 1VJSA 4CD6A 5A95A 1WPCA 2TAAA 2BV9A 3DYOA 2WCGA 3VMOA 3ZIZA 3VSVA 1NP2A 2ZX8A 3A21A 4ATLA 3NDZA 4U5IA 2W66A 2XVPA 2XN1A 3L4ZA 4YPJA 1V0LA 2CKSA 2XTKA 3JUGA 4RE2A 2OMXA 5TD4A 2XSAA 1DWJM 3W29A 1Q6CA 5CPQA 4IM4A 3ZJKA 2WAGA 2ZIDA 1EIBA 4UOJA 3CV5A 3LMYA 4OIFA 1G0CA 3GDBA 7CGTA 3N9KA 5IXEA 3SCSA 3DECA 2X05A 2F1BA 1KBBA 1KFWA 3W27A 1XSJA 3M46A 5BRQA 2J47A 1UA3A 2YJQA 5A2BA 1E72M 1JGIA 2CBJA 3VGBA 1QWUA 3WMSA 3WF2A 3AS0A 1V08A 2VCAA 1JXJA 5ABHA 2AAAA 4H7VA 1ODUA 2DQXA 4FNUA 4U2ZA 3PTMA 2Z1SA 4KRTA 1KCKA 4FNPA 3W82A 4HPGA 4A4AA 4PSPA 3VNZA 2FGZA 5AYIA 1MFUA 2WWCA 3SCRA 4JHZA 3CZEA 2OYKA 1WAWA 3CHEA 2E9MA 3WH5A 3BLBA 1UWQA 3AHZA 2WC3A 3W53A 3ZM8A 4QAWA 1JFHA 1MVYA 1VENA 3WD4A 2ZUUA 3OLGA 3WDPP 1BHGA 3OB8A 4MPKA 1GOQA 3NJ3A 4UNIA 5DMYA 1E15A 1V02A 1BF2A 5EFFA 3DX2A 1HJXA 4TTGA 2J8GA 1XCWA 5HNNA 2E9BA 3HG4A 4X9YA 1BFNA 1UWTA 4NRRA 1Q4NX 2UY4A 1XHGA 1H0GA 1KTCA 2JIWA 2V5DA 4PRWA 4W7VA 3TTOA 4NXSA 4CCDA 2WVSA 4R27A 1JZ2A 1LL7A 1OGGA 3WDJA 1TFVA 3CUFA 4XUYA 1H09A 1F4AA 1XGZA 3CMGA 3K4AA 1OGBA 3VGEA 3NSXA 1I1WA 3EJSA 2CCRA 1W32A 4BZYA 1XCXA 4FMVA 1E73M 1GVYA 3GXNA 1F4HA 1E6SM
chains in the Genus database with same CATH superfamily
1U9KA 2ED9A 1M41A 2UXFA 4H0IA 4WNQA 2X7VA 2Z26A 4X2UA 1DWIM 4G7SB 5REQA 4KRZA 3BAEL 2X7WA 2ZKMX 4NAFA 5I8OL 4F33A 4H8UA 3CVIL 1SBBA 1LXMA 4KXZH 4P2QB 4B97A 2OO6A 3HM7A 3G6AB 3HG2A 4DSYA 4UT6A 2IBBA 5DURD 4XPBL 1O6TA 2Q20A 1TPDA 3BXNB 1JZIA 1UQYA 2MJWA 3FQNB 4JYFA 4S2BA 1N8OE 3QHMA 3IFOA 1FL6B 2PIAA 1CUOA 1J9RA 5I17B 4C4KO 4UYPA 1N0VC 1F2QA 5AVHA 4KVCL 4YUEL 1TVCA 1CB7B 2YAEA 1JNNL 3W25A 3LKNA 1TQBC 2WOYA 4I0PA 4DK0A 1QSED 4HKXA 4IG2B 1FCGA 3GO1H 3GS6A 3BPOC 2ZTJA 4R7VA 2XQYA 1QACA 2V82A 1B4JH 4F7PA 1FI8C 4Z1YA 4MHHG 1LE9B 1JZEA 4LLWA 5IB3B 1CDIA 2OMUA 1DEEA 1YHPA 2Y1ZA 3D0AA 2NW3B 3JQPA 5JHDD 1DQLL 2OMWB 5IHHA 3H9SA 3UTSE 4RGMC 3FU8A 2BVYA 3S9YA 3AADB 4QDWA 1XVSA 3E2SA 1P1ZA 3JQOB 4X7FC 1O9ZA 2DS4A 3IRDA 4FQLH 4Z4UA 1NCAH 2V7HB 1UQZA 1AYOA 1EX0A 5JOPE 5J11C 1RY8A 3BG3A 2VXQH 2OSYA 1E5NA 4M8QA 2QHLA 2DQCL 2OXHB 2Y36H 3K72B 1IHIA 1J8KA 4PR5B 1A4BA 4M1GH 1MJ7H 4KUCD 4B3LA 5A6BA 2M83A 4JE4B 5FCUL 1T6XA 4KJQD 3WFCL 1F56A 2J7KA 1FG2B 1MCSA 2A1YA 4TN9A 2WWMC 5HMFA 4X3ZA 5AD0A 3UYPB 2QCCA 3QDJB 3RRAA 1VQ4B 4RWYL 5FA3B 3T0DA 5EIQA 3S34H 2Y25A 1CLCA 4LFHG 4U6TA 4W93A 3BH4A 3V0GA 2O5YH 4QWWD 1IM3A 3ZTCC 1NBYA 4GMEA 3PM6A 4QTFA 2X6AA 3QZPA 5F1IA 4S2SB 4GKSB 3T65A 3DO7A 2XFXB 5LHFA 1HCFX 4X2RA 5IBTH 3U36B 3FFDA 1CXEA 1YHQB 1L6YA 5FOJA 1CLZL 1A4AA 4M1CD 3GDCA 3W1XA 5EB8A 4XWUA 1XQLA 2OCJA 2R29A 2R1WB 4PMEA 4PCPA 4UQ3B 2PD5A 4LW7A 2FO1A 3TA9A 2HRWA 3ELQA 3VNYA 5KSBE 3EYSL 4O02A 2H3XC 5I1AB 3F2CA 4GUGA 2NX5D 1WD8A 5CC3A 3N13A 2WB5A 1TJMA 4XN3A 3QYMA 3FXIC 4Q7DA 1QI3A 3AQXA 1MCPH 2NQ9A 5HHNA 1HOEA 2V68A 5GIRA 5JW4Q 3AUJA 3R0UA 4I3SH 2XZCL 2DI8A 4XCYB 5EU6B 5M17A 1BQSA 3LN3A 5EL1A 3WIIL 3QG6B 5A2IH 4JPIA 3O6FD 4IBQA 1CLXA 3WV0A 2ITCB 3LY6A 5B39B 3ZDYF 5DQJB 4XONA 2J6EH 4PMOA 2E27L 2IDTA 3UQNA 3W9ZA 5EPDA 3G1AA 1YPXA 4IKIA 1D6VL 5GZOA 1KCRL 3D3AA 1UD3A 4HEPG 3MRGA 5LGHL 2H0FA 4JTTA 4J39A 3UR2A 4MTMA 3BP6B 5ENWB 2ZITA 4IJCA 2XYLA 3L23A 3GXDA 4HP5A 3B82A 3U0PB 3OKEB 4OJYA 4C0SA 5CPTA 3KXFE 2FZBA 1TJRA 1Q4WA 4R96B 2XV2A 2CRYA 3RWJB 3RCYA 2EF9A 4GIPD 5B7ZA 4TUFA 2YR3A 4OVUA 4JTHA 2FLRT 2Z34A 3AU1B 2K9UA 4ZFZA 2GSHA 3B5TA 3EA3A 4W1TA 4YEJA 1QLRB 5I1KL 2IH3A 4EZMA 3HG1B 3DVGA 3O3BA 2DQGH 3HPLB 3B6SA 4NQEA 1FO0B 2MCPL 2YXOA 5IV2A 3NIGF 5EUOA 1R3IH 3KP0A 4GABA 2DQDH 4PTTA 4WZHA 2F53A 3P2TA 4LLQB 3VIPA 2Q7NA 4X6BB 3I56B 3BMXA 5E70A 1J8HB 1NL0H 3PGCA 1WK0A 4NYLB 4LLVA 1J1PH 1E1CA 3EGDA 4MS8D 4XSLA 3W75A 2GGGA 4W8BA 2NRDA 2WLJA 4HG4J 3EOEA 2RCSL 4WWVA 5C9JB 1FORH 3BFQG 1F13A 4UBPC 2WLHA 3HZVA 4PH8A 1L6WA 4FHAA 4NM4H 3MV7D 3AUOA 1QFPA 4Z08A 4C6EA 5EU6D 4B90A 7REQA 1FPTH 1H5BC 1OPGH 2OWXA 4O15A 3INOA 4MHBA 4P5RA 4QRUA 5KS9A 1JUKA 4RA0C 4BCXA 4DEWA 1T1XB 3D0LB 3OVPA 3G6MA 3UBPC 2DJ4A 3EOYG 1O7VA 1X39A 5L2KA 4IW3B 1OB1A 1C93A 1BXUA 1NRKA 4Q8MA 5GVJA 2GJZA 2OOGA 3CBJB 5ACZB 2RC5A 5LGZA 5FV1L 3QIWC 1JGLL 5DVLA 3RMEA 5KAQG 4ZAKA 2PMZA 1OCWH 3TP4A 1AAJA 2YD1A 2IQ9L 3HNSL 2IWGA 4NO0A 1W72L 2BWQA 3CQKA 2VTFA 4NNXB 2G3JA 2WGXA 1QBAA 1FTXA 4FPSA 3UP6A 1GL4B 1ADSA 1JDAA 3KJ4B 3FFOA 3UNDA 4DAGH 1IMHC 1XB3A 3HG1D 4ZGNB 4N5UA 1S2TA 1XF1A 4W4OC 2WMKA 4BZ2H 5T9BG 1P7QA 2VDQL 4Z77B 1YN6A 4X0KA 5EF0A 3GNNA 1T6VN 5IJBC 1XFOA 1BQKA 2B7DT 2JMRA 4AG4H 3DUUB 3BYYA 2F8XC 3ES6A 3NUKA 3RDTA 3RLHA 4OQTL 2W9EL 2HWGA 3WTSA 1DANT 4W9FC 3U2SA 4R53A 1TQXA 1J8HD 1A3RL 1QJWA 2GJPA 3F7LA 2H6OA 1AQKH 1LK3H 5LZLA 4APQC 1XWYA 1YJDL 4HU8A 4XNYL 5I82A 4XVUC 5FEBA 1ZTXL 4L1BA 2Y1AA 1R5WA 1T2QL 2EPOA 3SCMB 3UX9B 3ZDYE 4EO5A 5DHVB 3WSQL 4BFKA 2EO9A 1DBJL 5I09A 3MRJB 2DZWA 1F60A 5H8PA 3ARWA 4DZHA 3DHDA 4PUJA 3MSYA 2CLLA 3IGFA 2NY5L 5BPPA 2ZZ7A 2VXUL 4XC3H 1XTMA 3NFPB 4GJTB 3TBSB 4ZFFA 3T2LA 3B3BA 4Z1PA 3QQXA 2CO6B 2XG9A 2R0ZL 4X6DF 5HGBA 4M6ML 1RA0A 1ETB1 3VFTB 3CZGA 3UH8A 5GXBB 1YDYA 1G7HB 1M68A 1PS9A 2JFEX 1K2DA 2BN4A 3CIWA 4Q6IB 3AAMA 4FXGA 2BDQA 3JTTB 4PJIA 1E5JA 1UOLA 1RZKC 4L7ZA 5I73B 1AZNA 3CVBA 2A7RA 4AZ7A 2IPUG 4HNOA 2VAAB 5J89A 2JF6A 4PCNA 3NIGE 1GPWA 3ZZTA 1WKEA 3GDRA 1B0RB 3WNCA 1KN4H 4P6YA 2YFOA 4QYOB 1PX8A 5F9DC 5MENB 5HD8D 3UPWA 1XX1A 4GKZB 1ZHBB 1B1YA 1WXYA 2VEIA 5ID0B 5ERWB 1TEGA 4B7IA 5ABGA 3TN3A 5JIMA 5A8QA 4FN5A 1HN1A 4HKJA 2JCCF 2YRBA 3BZEB 4HSAC 1J9ZA 2Y3NA 1YZZA 3TROA 3ZZLA 1R9YA 1FC1A 3OMIB 4HU4A 3LOWA 1MXGA 1MFBH 5D72H 1JPMA 4RPBA 3ARBB 3ZHLA 1OCOB 5T1LB 3MKGA 4URKA 3AU2A 1TV5A 1WZKA 3LNEA 2PDUA 1FFQA 1MCEA 3E0FA 4PJDB 3LKOB 1E6JH 4GK8A 2DOCA 4FQCH 2ZCLH 1X4YA 2I60H 5FYJD 1OSYA 3CLFL 1QLEH 4XI5C 3PSVA 4BFBD 3SCMD 2NQZA 2F61A 2I9EA 4DWHA 1CGUA 4A38A 1FFOB 2AQPA 4M43L 3WD3A 1X5GA 1TSRA 1LLZA 3PB0A 3V4PA 5GS1B 1RR2A 1BVKA 3H24A 3MZNA 1GVRA 3NSMA 1KQZA 3G6EB 5CLZA 3QE5A 2VLRB 1B9BA 4S0TD 5E7BA 1SOXA 4LVNB 1QNRA 2PODA 4MBRA 4OTXH 4J28A 1BIHA 4G1MB 2Z2BA 3PULA 4HNTA 3Q3GA 2Q87A 4FEMA 2VERN 4POYA 2WD0A 4LCCC 4TVPL 3GTNA 2F7FA 4RMUA 5F44A 5L8JB 3UYIA 3P9LB 1E9YB 3LGEA 2V4DA 2P52A 1R3HB 1RZIA 5KITA 3WZ0E 2HPOA 4M51A 1K3UA 4HISA 4I77L 4NUJB 3NJKA 3CXFA 4X4YB 3KYMB 2V3DA 4N9DA 1R75A 4ZG1A 1N8IA 3LI0A 5K9CA 3EPOA 3CCEB 4L8SB 5AYQA 4Y2NA 1WSVA 4QOKA 1FA2A 3T40A 4G1VA 2CDEB 2YL5A 5FYKD 1WDQA 3FDKA 4MMZC 5MEND 4GAAA 3IEAA 5ADPL 4JCLA 4XCNB 5MEQB 2EACA 5J9PB 1I1YA 1GJPA 4MDJB 1LJYA 2FSDA 3VCLB 5I5JA 1FRNA 3G7TA 3Q37A 4LHQB 4BDVA 3LHUA 2Y7FA 4HTYA 2ZWNA 3VM7A 2CZFA 4NENA 5FEPA 1ZSDA 4N0FB 5EN2B 5T1LD 4P2OB 1KZQA 3UCCA 3TWCH 4DQKA 4ZTXA 3EGSB 4XNQB 1OEPA 3KPNB 5JBDA 2J7LA 1XD1A 4MNHA 2XGZA 3T8LA 4YXHH 3MMDA 5TQ2L 1NFDB 3SDDC 4X6DE 4NQDE 3O6YX 4YO0A 4F27A 3UC2A 2QPFA 2Q6ZA 3A9BA 3TK7A 3LX9A 3FRPA 4WDUA 5LXXA 5DO2D 4RAUB 5F9JB 2NUXA 1HGYA 2GTWB 4XAWL 4NI8A 2VLRD 5EPMA 2QCMA 4QE5A 3BD3A 4N3TA 5IMOA 3CUIA 1C5DA 3IETB 1I8MA 3TVMA 4LEXH 1KW1A 1TO4A 2K6YA 3BEWA 3NIFF 2FL5A 4K94C 2IPWA 1GH7A 3O3DB 4ODHL 4HLZH 1UYWH 3C6LA 2PWHA 1J5OH 3Q38A 3KCLA 3LK6A 3PGDB 2CKBH 5MI0C 4QNEA 3P80A 5G5IA 4PG2C 1F6PA 3F7RA 3CAFA 4KKAC 2ONEA 1G7VA 3MKVA 4MTVA 2JCCE 4Z7QF 2VKZG 1VPOL 3TC7A 1OC5A 5FF2A 5IROC 2H5UA 5TE7H 2BHZA 4F7EB 5KWYC 2VSCA 2A7BA 4A8IA 1RZJL 4ZENA 3ARFC 1NDMA 1W0WB 4YVNA 3QXVA 3GMQB 1YN7A 4H26A 4IFKA 1MHHA 3OJDA 1O1HA 1KCUL 3T0TA 2WKOF 4RGOL 2B5IC 5GRWA 3ARYA 4MGXA 4S10A 5DD0L 1DJXA 5KZDA 3M16A 3JZUA 3TO4A 1S2VA 4P2OD 4LUIA 1LDCA 4QJ3B 3L6FB 2VABA 2X41A 4FFZH 1JOIA 3MODL 1GC1H 3WTTA 4ZUVA 2OWCA 4YAOA 3FFCA 1IQ8A 2OXGA 2DLFL 2DP3A 4P5MA 1V3LA 1P1VA 2PWVA 4RZKA 3L3IB 1ZCOA 3RGTA 4GW1B 1GGBH 4B3FX 4A6YB 3U7VA 4GOSA 5I7GA 5K4ZA 3F85A 4TQIA 3UJFA 1G7SA 4LSPH 3ITYA 3TONA 3G6JF 2JJTA 3VXUB 3GSUA 1JPIA 2V2WB 4F3FA 4AY8A 3WLRA 4LQFL 4IPPA 4JYDA 2Z31B 4XXDA 3N50A 5J6GB 1XGDA 1XR9A 2QLVB 3QGVA 2R1XB 4U7SA 5E1HB 1A21A 5LBSA 5E5UB 3SE8L 3T6XA 3STLB 3QMTA 2VDMB 1TLMA 4RNFA 4OBTA 1E5ZA 1G94A 4O4WA 3ABZA 3PWPE 4G80B 1WDTA 3A9IA 2X3AA 1CZ8H 4BXSV 2OTWA 1MAJA 1FCQA 1QGZA 3PJSA 4JRYB 1ACYH 5EEZA 4HMCA 1XLEA 1F4XH 5B6IA 2O93L 2R6HA 4W85A 2BTMA 1R0MA 4L0YA 2NNCA 4FFYA 4J6IA 3NSJA 4G6AD 2OR9L 1YDPB 3RJYA 4XR6A 1EJFA 3UMNA 3UR5A 5SWQA 2GJLA 1QQDA 4AD1A 2XN9E 5EIIA 4NG3A 3TFCA 4KZCA 2X3CA 4OV5A 3GVJA 5I30H 1S7RA 2J27A 4IRZL 2AV1B 4RCAA 4AMKL 4LHJB 3IFNH 2B81A 1NKOA 3T53B 5B1CA 1K4CA 2QNEA 2XTSA 2Y6SD 4BK5A 1KGYE 1PKOA 4FERA 3UWZA 3AVVA 2QVIA 1ZZMA 2XTJE 2V63A 1A8PA 1HWWA 1I7ZB 1BSLA 3B7TA 3IGUA 4DP6X 3MVTA 2I5QA 1WBZA 3BMVA 1UWIA 1E9LA 3HBQA 4OF0A 3NIFE 1UCBH 5ABFB 2DSWA 3MOAH 4WQMA 4QRSA 3V0UA 1CIDA 3V0EA 4PJHA 1MEHA 2VJJA 3K8LA 5CPOA 4JPWH 4FG0A 1EZVX 5HI5C 3F7YA 4PREA 4UDTA 2EIKB 2EDKA 1ZS8B 3C75A 1BEYH 4MLIA 3FO2A 4KFNA 2IAMB 5CXPA 4HJEA 2AQRA 3RIKA 2YKLL 3VXUD 3H9NA 3ONUA 3VQMA 3CHFA 2BRRL 5D1XE 3HAEG 3RX5A 5TF1H 4N4PA 4HPYL 2Z31D 5A6TC 1K28D 4OGXL 4Z7QE 2V8MA 4MKNA 1WORA 2G3FA 4HMNA 1ETJA 4YDVB 4F7MB 2DZUA 4CD6A 3BJTA 4C6BA 3VFNA 2BV9A 1M2OA 1EFQA 4GRLA 3QZOA 1QWHA 1JK8B 3NDZA 4U5IA 2XVPA 1BBJA 4JRYD 3SSGA 4XORA 3NQ8A 3JUGA 4RE2A 1DJZA 4K7PL 1UZHA 4NM8H 3HRZA 2WAGA 5E4IA 1DIOA 5GGUB 4NIRA 1SFHA 4FHKA 3KPLB 4OIFA 4LAQH 2PP9A 4MAYB 5CINH 4XAPA 4AL8H 4KK5D 4GY4A 4UV7H 2PSNA 5F9OH 1MUJB 2OBGA 3WF2A 1VCBC 4L4VE 2OL3L 3BGMA 4RDVA 2WW8A 2VB5A 1KCKA 4EKXA 3VNZA 2YMTA 5FO9B 1HINH 2FQEA 1FDLL 1W3NA 2HCZX 4N8CL 4ZTOH 1E63A 1VQ9B 2DVUA 1ZM3A 4XAZA 1H50A 1O0VA 4Y5YB 4UNIA 3SZ8A 4Y90A 3VWJC 4ZMGA 1HJXA 1F7BA 3G5ZB 4ODVL 5GRVK 4LPYA 2VSDA 5LIXX 1JQVA 2QJGA 2CLRB 4NT6A 4UTBL 3G6JE 2AXWA 2HJKB 2VBSA 2ENPA 2Y5TB 4FCAA 2VDKB 4LGRB 3DX7B 2CCWA 4CCDA 1JVLA 4TIMA 1GOXA 4XUYA 1OGBA 1I1WA 4NRXA 3WGVB 1Q9WB 5F3HB 1V0FA 4MWAA 3PVFA 2F5BL 1ISXA 2IAMD 3CAWA 1A0DA 3RWDB 3GBDA 2A6LA 2I5GA 1MG2C 5BZWA 2IG2H 2LAGB 1U95A 3U9UB 3MV01 1L9NA 4EIGB 5IBUG 3NO5A 1J5TA 4PRRA 1XGPA 1ZLWK 1CE6B 3UPCA 4PJ5A 3IDXL 5KVFL 1JK9B 4OLVL 2HLDA 3W1QA 3APGA 4TLKA 4X83A 4M4SA 4E9TA 3VXTA 4HFWB 4LRIA 1QUEA 1IX2A 3VFGL 3QRHA 2PW2A 3TH2T 1N55A 3KOFA 2AJYH 3TJEH 3ECVA 4US5A 4XZIA 1PGRB 1S72B 4TKWA 1ZT4A 1EWDA 1X96A 3RCNA 2W0KA 1TUPA 4NX5A 3S2MA 4L1GA 3MCOA 4ELKA 2JKEA 1JL8A 2BH0A 5E08L 1ZVNA 5I0YA 3E1F1 3VO1A 2VYRE 4ICMA 2VJ8A 3HNTL 5I74B 4S2CA 1AQ0A 4W7WA 2VH5H 2DQWA 3ZTEA 5E5LA 3HLAA 1GZPB 4GS7C 1NUFA 1XQBA 3A3HA 3ZYZA 4P7QA 4IS6A 1LM8V 3VTTA 2IPGA 4IHCA 2BNQA 4TN1A 2UYLA 1AD9A 2W6IA 4LOUC 1BBDH 4QUOA 5FB8A 4B9IA 4R4NC 3IFPB 2E7LC 3EG9A 3ZRFC 4QRPB 1OSPL 4A22A 4FC3E 5INDA 1TTFA 5I15L 3KPRA 1EPXA 4AMAA 2EPKX 3LNIA 1YAZA 3AYRA 4QR7A 2VW6A 4KJPC 4P3DB 4MZIA 2HVJB 1HIML 4WDXA 3W1UA 5L7XL 1MIMH 2OP4H 3DIDA 4ILSA 4O1BA 4AYGA 4YHZH 4R26H 1AKJD 4U3XA 2BIOA 4YELA 1BMZA 2Y8VA 3TCXA 4AXNA 4J40A 1IGWA 4W9IC 2MPAH 3EO1A 2XPYA 1AH1A 4U1NA 4H44C 5KJRH 3LA4A 1HWGB 1L7IH 2FATH 3FTZA 5T1KA 4ZL1A 3ZE2B 2FK9A 3P4MB 4MX7A 5H4ZA 1FP5A 4FNQA 4RUBA 1K03A 5ACLA 3OJVC 2XZPA 4ODUA 3RK8A 5GV7A 3PCYA 1I8KA 1C9WA 3LTVA 3WEOA 2ODIA 2QKFA 2RKXA 1OX4B 4CQ8A 2DZPA 2P3YA 2HFTA 1CLYH 2IGFL 1KFJA 5LNSA 3RUGA 1VRDA 3QUMH 1JPKA 1QUPA 4DO4A 1RCYA 5IUCA 3C8KB 3Q5OA 5AZ2L 1UIOA 3B78A 1YEWA 4K8RL 1V7NH 1LMIA 2JB5L 3MPCA 4PULA 3UGEA 4DJDD 3WY4A 4JX5A 3X1GA 3ZK0A 4XVTL 2W88A 2BSBA 1IZKA 2WK2A 3SGUA 4QG6A 3P5YA 4WGHA 3UWUA 3TLQA 2R9RA 5E4EB 1DOSA 4NZ4A 1T04A 5GGRB 3J27A 5AW6B 1YECH 4CADA 2F15A 4KH2A 4LCUB 1N8FA 1N7MH 1YO4A 3UTTA 4Q58C 4ZUSA 1IBDA 3X13B 3TH4T 3QRGL 2R8SL 1WOBA 5DUML 2WQAA 2AW2A 1H3VA 5AY7A 1VKXA 1DJSA 4GP5B 4QRPD 2ESVA 4X8JB 4HIHA 4X42A 3C6CA 3VYLA 2WAHA 1MRDH 3MGTB 2Z0IA 4S39A 3DXAA 4FEIA 2VZLA 1E6PA 2OG9A 1WF5A 3FGCB 3U1PA 2GUYA 4JPKL 4WEEA 1E90A 3MV8E 1XF3B 4PIBA 1JZDC 1Z2KA 2VR2A 2C4FT 2XWEA 1OW0C 1JPTH 1KY6A 4HULB 4NLHA 1H2JA 3O6CA 4P23A 1K70A 4PFMA 4IBYA 3PWIA 3U0TA 3CXDL 5E5MB 4YN5A 3H70A 3GKWL 2Y89A 1Y7VA 1BZ9B 3Q0HA 4WEMB 1AK5A 5DBTA 3HB9A 4ERSH 3TYEA 3LCXA 3M0ZA 3FXGA 3HC2A 4H7CA 5D2YA 3JWNE 4GJ1A 5GS2D 1GOHA 4HS6A 3K2UL 2DYRB 4B9FA 3MZ2A 2WZHA 3FONB 1WCQA 3CFCL 1S9YB 4IXHA 5CBIA 2QS8A 1X6LA 5CIPA 4XVEA 5FX3A 3RU8X 4FZEL 1XUUA 1JHTA 5SWZE 2CLEA 3V0TA 1KIUB 1A5FL 1ECEA 1X4ZA 3WTYA 3MB9A 5AYZA 3B8HA 5DJCA 4PWEA 1AGCA 1XGQB 3QORB 4YHPB 3TCSA 4LIQH 4M7KL 4UANA 2J57A 3NCWA 1IEAA 4UTIA 4WJ8A 1O9VA 1EO7A 4J5VA 3QDGB 1JWMA 3REVA 1KYAA 1NOAA 3F05A 4JY6A 5IFJB 1GS6X 4KUCF 4R97B 2YGPA 3F7QA 3U1SH 1ITCA 2FX3A 1L8PA 2DQIH 1ZV9A 1BX2B 4X5QA 4FX5A 3P3UA 4MYPA 2ZZ5A 1MW3A 5CWSB 4W5UA 5E2TH 2NQ5A 1YEEH 1ZDSA 1WC7B 2XTJC 3EFOA 3H6AA 1OY3B 5C7ZA 5I77A 1EJSC 4L1DA 3BDBA 3GH4A 2IFGA 1DE5A 3W22A 1TVLA 1R3LA 4QLWA 2ZCHL 4Q4PA 3WY2A 1A5MC 1OYBA 4CJ1A 3EWUA 5I1JH 3FOLA 1KPRB 5BS0E 2PAJA 4FO4A 1DUZA 3ECQA 1BGXH 1OZTG 5KSUA 2C1GA 1ML1A 3HI5L 3HVNA 4A7TA 1ZV5A 3IDGA 4HVXA 3GVKA 3CXHK 1LO5B 3UTPD 5HOSA 1FXPA 1MUCA 1C1EH 1R5IB 5D1XC 3RDKA 3LRLA 3O4LE 1WIOA 4XCFH 1HH6A 5FD0A 4WK0B 1EZUA 4G7YL 1WCGA 3RVXC 1CXLA 2WANA 3WSUA 4K5NA 1OAQL 2XWJA 3MJ6A 4PJ7B 2BNUA 5A8GA 2BZDA 3EA1A 2QDVA 3WNOA 4JN1H 4HUWB 4AEFA 3CDYA 3GSWA 1RV8A 3T4YA 1J8RA 3B0UX 4CN4A 4PCKA 4PL1A 3CEUA 5IM7B 1GC1C 5BO1H 4N9BA 3L54A 4O4YL 3LB6C 3CB3A 4P4RA 4HPNA 2ADAA 1I4FB 1TTCA 5C0EB 1QPKA 2AK1L 2DYIA 5DWUH 4WY7L 4W68A 4OCYH 4N22A 4QJ5B 1W0KA 3QORD 4LF3A 1H3GA 4ZPVB 2C26A 5AB0A 3Q67A 3QDGD 4XPFH 5F6HI 4FWTA 1KTDA 4L64A 4PS3A 4S38A 1ID2A 4O11A 4JFXB 2VITA 4DGVH 3OTRA 2A6JB 1X9QA 3FRPG 4C6MA 1R9XA 1R5VB 5BW7C 1BM3L 5DRWA 1IIGA 5A16A 4ZUUB 1GZQB 4OHQA 1UMKA 3T6CA 3V55A 3MC5A 5EZJA 4O0ZA 1G7JB 1SUXA 2QGGA 3GJFA 2O55A 3T4WA 1A6AB 3BESR 2X0WA 1T22A 1HZKA 3OXSA 4HUVA 1HI6B 2C7UA 4IGMA 4JM2B 2R24A 1QSEE 1A14H 2FLBT 2IANB 3S8WA 1NTHA 5C55A 3AI0A 3DPBB 1IU1A 5J13C 1FWSA 3GIZL 4Y4FC 5T8IA 1RZ7H 2HSIA 3VD3A 3E12A 3H7BA 5JHDE 4DJFC 3F2LA 1V6WA 2O6PA 4LIQE 4MD0B 3OF6A 3QFJA 3WHXA 1RMFH 3SOBH 4QRQA 3I6KB 4H8NA 3TPUA 5AOKA 1RLCL 4F8NA 3KVQA 3IDNA 2PPCA 2BOCA 4ODWA 1A7PH 3FN9A 3GPEA 1FWCC 3JVGA 3T0BA 5EEXA 2BASA 3UESA 1S5WA 2IDSA 4F9JA 3INUH 1MJUL 2VLKB 1UEYA 5I2IA 1DBKL 3P81A 4JO4H 4UDUA 3C60C 3HS0C 4WSKA 4N86A 2O6CA 1NDHA 4FRWA 3QFDA 3MMWA 3WNDA 3UJIH 4BPRA 1MHCB 1HJBC 3BLOA 3SBRA 2BXYA 3NN8B 1NWTA 4Y2DC 3C0LA 1EANA 4EN3B 3CSGA 3KW8A 1BD2A 3SRDA 3AIEA 1R3VA 5EFIA 3SBWA 5GGQL 4WTXA 4JHUA 1NMBH 3L5XH 1UCTA 3A0OA 1Z9PA 3NJIA 2CO7B 5D71L 3IMVA 2OT0A 3CMEB 2R14A 4AU0A 4FQJL 5M1TA 4BE5A 4H41A 4YHML 4HHWA 3TC6A 5DZJA 2INEA 3T05A 3Q6QA 1LF1A 1DN2A 1BYDA 2GJXA 3SCWA 4P5SA 3W7NA 2R2EA 4JM2D 1QNOA 4OCWH 4RA3A 4WDIB 3S5LG 4CBZA 1WBHA 4LARL 5C3TA 4A66A 2IAND 1C29A 1TZIB 2AL1A 4NY2A 3D69B 2QVHA 3H2QA 2NQHA 3OLDA 4P4KB 2NX5E 1T5KA 4A7VA 4DQOH 3LEYH 2WXOA 5TK4A 3GAKA 1LM1A 4PH6A 2UZYA 1N6UA 3SDCC 1FO0H 2WVVB 2VFHA 2PPAA 5ESQB 1MRFL 4XBGB 3IDMB 1CDHA 3B8DA 5EIIG 4A6GA 4F66A 2DW5A 4NJ9L 1Z3GL 3FSOA 3BFOA 3FA4A 4DPBX 3LN9A 1XT5A 3MCMA 2EH8H 4HLJA 3GC3A 2VLKD 4GT7A 4TSAL 4PP1C 3SJ3A 2EEAA 1REIA 4BCZA 2EINB 4N2YA 3FYOA 3FT9A 5HGDA 3TBYA 5C2CA 4IEFA 5JORB 1JI2A 4JTLA 4BIKA 2Y07H 2R0LL 5DCBA 2YZ8A 3KPPB 1KCXA 1HJQA 4KRNA 4EN3D 3EJYD 4U1IA 1AZ2A 2R23A 4TXEA 2QGCA 3C09C 3SODB 4QAIA 4FR1A 1XSIA 5EU7E 2DZAA 2PI6A 3GLCA 1F3RB 5BROA 1BECA 5FFOA 2LAAA 4HJ0C 1NJID 2XKNA 1R5OA 3GHEH 5KSBF 5FO7A 3HIJA 3NYZA 3UZEA 3GLDA 2ZX5A 3L7FA 2G9HB 1P4CA 2X2IA 1GO2A 4AUUA 3MRHA 2KZBA 1PD0A 1JN6A 2XFGB 2DAVA 2FSEB 5EG6C 2JQAA 4IP4A 4KGJA 2XIDA 6PCYA 1H8EA 3LPWA 5EU4A 1CU4H 3UJJH 4JHBA 1VQ7B 5AVUB 5I1GL 3S8GB 2VWSA 1KGWA 2O5XL 4IMKA 3KMDA 5ITBL 5F0MB 1UP2A 4GQRA 2V9RA 1OGAB 4DGWC 4P4KD 5HAOA 3PG2A 3G9AB 2KVOA 1ICPA 5I0DA 5DA4A 4BYHA 3VI2A 1ESOA 4AIXA 4PRIA 4JQ1A 5HY9B 3SR7A 3Q2LA 4IHOB 5TGBA 3MV7E 1UJ3B 4OCSL 4UFKA 5K9QG 2EG8A 2LLGA 5EU6E 2XHNA 4QT5B 5I1EL 4KEUA 4E0RA 2B31A 1RUKH 3ECUA 3JWNC 1RPUA 3QXAB 5M94B 2BY0A 2X6BA 2I9TB 5ESAA 2VE6B 1JFQH 4K94H 2VQ4A 1OP3H 1XM3A 1U8KA 2XG5B 1FFTB 3VIKA 5I76B 2R1KA 1AZVA 2RJMA 3GSNA 3DYMA 2W5PA 2DICA 2AEPH 4JFTA 3BN9C 2W9DL 5J12B 4RZCA 5FYJH 5IQOA 2DQEH 4Y9GA 1MFDH 4X7CA 4HH9A 5CN2A 5DHVH 1WBXA 1XCTA 4ORZC 4FI8A 2NSQA 3DWTA 4F5CE 3R4IA 1FQ0A 3L3DA 4M3KB 3LV5A 5KYWB 3PHAA 1AY1H 3PWJA 4Z4SA 3MLUL 3IK2A 3NPZB 4TOYH 4CMHB 2WXRA 3H0TA 4JVUA 4LVHB 4OM0H 2XUCA 4HD5A 1PZ2A 2V0AA 2DY3A 2AI0L 2JK5B 1O5XA 4XX1E 4MVAA 3HG1E 3A3GA 1F11B 4CU6A 5F70A 3V4VH 2G50A 4E9VA 3QYCA 4BWWA 2JQZA 1N06A 2I9LA 2DSKA 3KLAA 5JXEA 2UY6A 4JM0A 3VE0B 3DVFA 5J1TC 3QXUA 1QA9B 4XNXH 4YU1A 4LLMA 4JRWA 4HUCA 3W2MA 4QP0A 2WJZA 3GS4A 1TCRB 1XPGA 4DPRA 4BCYA 1J8HE 3C6EA 4ERGA 4MJ5A 4PLOB 4ZDHB 1RQPA 2LABA 2WKGA 1NAMA 2V17L 2Y1HA 3LNHA 1XMEB 2WXJA 4OSUH 4N42A 1OGAD 2VDNL 1RJQA 5I03A 2X9XA 1XPYA 4IYKA 2YPVL 2X0KA 3P84A 4P2QD 1PL3A 4IMFA 4M6UA 5GRXG 2D4FA 4CVZA 4EE2A 5GJSH 3M5ZA 4NNJA 4KKCD 4JL1A 5GISL 1EXPA 2HT3C 3N42B 3LGDA 5B21A 5IFHH 4WQOA 1QLFA 1X5YA 1KXVA 5EBGA 5DS8B 1HVXA 1KV5A 4J2QA 1BQHA 2HS6A 3WFHB 1BSIA 1VERA 2Y69B 1AMKA 5FJOA 4DX3A 3BQUB 4AZ8B 1V6VA 2W6RA 4NRSA 1T66D 4ZB0A 2AEQH 1Q9LB 1PTZA 2RHGA 3WNJA 4AIOA 3NM3A 3SCPA 1Q72L 3H2PA 5KW9A 1TPEA 4XD3A 1IGML 2V38A 3NYKA 2ZVIA 3U6RA 1WKDA 4BQ3A 3CLEL 1OQFA 4QLRA 1C8QA 4MJ4A 2PWDA 2FVLA 1P4IH 4IMLA 1U2HA 4K7FA 1PDKA 4AC7C 1V27A 3CYVA 1AC0A 5MHSD 1KLUB 5D70H 2EEBA 5LB1A 3SDAA 3GG1A 1PAZA 3SY1A 3DC8A 1S7QA 2GG1A 5INCB 4TX6A 4K3GA 3VO0A 1OM3H 3NCJH 4DYJA 1YNKH 3CSPA 1PSKL 3BPCA 3LS4H 2FDSA 3SKJH 3QIBB 3CFNA 2W60B 5BV7B 3B1UA 2C9AA 1TLLA 3DHUA 4BF7A 5JR1L 4TV6A 1SHWA 1JDFA 1SHSA 3MU3A 1EIXA 4O51A 3ILPB 3VFVB 2Y7GA 4XO5A 4U1HA 2INZA 3IJ8A 1MF2L 4ZUWA 4ZNEA 3I9GL 3ZUGA 4NZTL 5FYJE 1S7WB 5FUOH 3DYOA 4KJWD 1I2NA 5CCJA 7PTDA 2E47A 3QDJD 4GEIA 2W66A 1FX0A 4IKJA 5TD4A 4FHBD 2XSAA 2XYBA 4WWKB 3HBGA 3AU0A 3V75A 1KB5A 4EUPH 3NVDA 4HIQA 1X44A 5E8NB 1BX0A 1NFDF 4UWQB 2F1BA 4LT7A 4UTAA 3KBPA 3BQUD 4GH1A 2DN7A 3C8DA 2BW5A 5JW5B 4EBQH 1ODUA 1QPNA 5T9CE 3ESMA 5TR9A 1B88A 5FI8A 2CCLA 2FECI 3ULUD 2KL6A 1LCOA 2QE7A 4G9FA 3NG3A 4KJQC 3TA3B 4WEBL 4C90A 2J24A 1AW5A 3P73B 4UWMA 4MPKA 1FWXA 4F93B 4GMSH 3DX2A 4XNMA 4G8GA 4TTGA 4D9LH 2IIJA 4II2A 2REQB 4NRRA 1YIXA 5FYKE 4I5UA 2E7MA 4FKEA 4JVWA 2JIWA 5BWAA 2F38A 5MENE 4OE7A 4IGHA 4QWWC 5IHWA 1IXOA 2EYRA 4NXSA 2WVSA 4Q56A 1OGGA 4FTDA 3PBMA 3CUFA 1AP2A 3LYEA 1F4AA 2QJDA 2Q8BL 5KVDL 5HYSA 2YR1A 2C3XA 3PPCA 1W32A 4M1CC 4DNTB 5G4OA 2EIMB 3SN6N 5KYXA 1UEMA 3WS6C 2X09A 3BVUA 3EUDA 5IIEA 3IFLH 4P2YA 2Y1YA 4E4UA 2DQ6A 5K2ZA 4HPXA 1NDGA 1HHGA 2WXGA 1J96A 3LMJH 4HWBH 3S42A 3SBFA 4FKHA 1OSZA 1BDYA 4EIBA 2VXTL 1YEFH 5GJNA 4Z7WB 2FB3A 1ADQL 3U7YL 4X80L 1G7PB 1YXYA 1UZ8B 3N34A 2UUDH 3UZVA 4AJYV 1KRAC 1Y0LB 1OP5K 3BCFA 4D71A 3AY4C 5A2LH 3FSUA 4KDVA 1T3FA 4X99A 3H6OA 1LQBC 2PDWA 1XRVA 1NPJA 3BGFC 4MA8L 4WWKD 5FDWA 2NWSA 4ZMLA 3GNMH 2OCFD 3KH4A 2VLRE 4KI1A 2VQUA 3LCLA 3VH8A 5DLLA 1VPYA 2ATSA 3O6FC 5DYOA 2NUYA 3H55A 4MXVF 4CNSA 3DU0A 1VCVA 2LVEA 5HSFA 5BVJB 4PRPA 2P7TB 2I17A 5D2VA 1IBFA 3P67A 5IHZA 3EOUA 2YW3A 3FQYA 3IVKB 1RZGA 3B0VC 1SOQA 4L1TA 3WKNA 3ETTA 4YAQB 3EOAB 3MRIA 4V1DB 3TA3D 2WHLA 1OHHA 5K9KA 3T5WA 3OKDB 3FO9B 3H12A 4B91A 4HNNA 2ZXIA 1AR1B 2J8FA 5EU7C 4DKEL 3RZCA 3EWCA 3ZVHB 4ZYKA 1COWA 4S3DA 2OQJA 5D7IA 5C0CB 4NASA 3H2OA 3L1EA 3IJ7A 2ALAA 5CPSA 5C0GA 2EE0A 2YDRA 1P7HL 3VJ6A 2XV6B 3B9NA 4N9GB 2W4XA 5J35A 4ZW8A 5D38A 5GPRA 3IDIA 2ZTKA 3MO1B 3STZA 1LTXA 4L4LA 1J01A 3WUWB 5AAMA 2W61A 3VSQA 3L5WB 3LS5H 3OHXA 2GSMB 2VDMH 1K6WA 3CDZB 5PCYA 1WBYA 1TSHA 2AQNA 3AVWA 4UIMA 2HSAA 1TV7A 2J1KA 2J8HA 5IB5A 4Q2ZA 4MS8C 3DFYA 1OIMA 3CQFA 1DCLA 1NFDE 3HNVL 5DHMC 2R69A 4QQ3A 4PGLA 1GW6A 4ADUA 3FU3A 3PWUB 4PVLA 1UWAA 5D1ZA 4RRPM 1KCSL 4C7FA 1JWUA 1ZXKA 3EJZD 1U1JA 3CDGA 5D2LA 5FK9B 4FG4A 4BWTA 1DV7A 2GDUA 1DVYA 4KAQH 3LU2A 1H3PH 4MY8A 4HPOH 3N2MA 2FBRA 1T03H 3GFYA 2CFFA 4OB5L 2VC2B 4XAGA 1G9MC 1J1OH 5HI3D 3V0JA 1T6ZA 5DCCA 3FSVA 4D94A 3KYKH 3S6CA 1GRWA 2IPKB 2A79A 1RK1A 2IDCA 2HX7A 2ZX9A 2ICWI 1MKFA 3RX7A 2DQTH 4NQCA 1FNSL 3R10A 3MRRA 4GZEA 3NTYA 3SGKC 2VURA 1PDZA 1F4WH 3OAWA 3SE9H 3JT0A 4P5KA 1FA4A 3M8OH 3OVGA 3PP4H 3D52A 5C0CD 5IMKB 4PMYA 2Z1XA 1W37A 3OXRB 3WFLA 1GVOA 1ITQA 2AXFA 3TZFA 1U8PB 2XWXA 3VIMA 1M7DB 3GRWH 1EF3A 1HE7A 5JDSA 1V93A 3MRLB 1FCVA 1OADA 5HHQB 5KUKA 5JXAH 3WQ6A 1FNGA 3GNXA 5SWSA 4XPTL 4AEHH 3LSBA 2AQVA 1O7SA 5GNYA 3WS3B 1TYJA 4AENB 4JFEA 1ZOXA 2YCIX 2G75A 2H1PH 1B6UA 1BPLA 2BC4B 3WTWA 3AAZA 4AUYA 5TE4H 3LHVA 1WZAA 4LP5A 1W1PA 4OD3H 4O58L 3G04A 1BZ7A 2WQRA 4MUPA 4GCAA 3IS0X 1U3NA 2HFEA 1IC7H 3BPLC 4MXVE 4DI8A 3LBCA 5EMLA 4DM2A 4YLBA 1YY8B 3GFZA 3BJ91 5DJ6B 3BAXA 2JV6A 4HSNA 2YK1L 4ADJA 4FMFA 2OEJA 3JV6B 3ESNA 3GZAA 2Z7ZA 4IX0A 1VSCA 1RZPA 3HC4H 4N8UA 4GXUM 3BLLA 4LV4A 2DQJH 1SJMA 4HWNA 2A3BA 4V33A 1A47A 3B0PA 2FHCA 3VXUE 2WXIA 2P8LB 4B3XA 1MDAA 3Q8FA 3N1AA 4P5TA 2GBUA 1C9SA 4L05A 1M7IB 3JTSB 3VYNA 1MVUA 1AH4A 4MKMA 2BLEA 3ARBD 3NA9L 4IP5A 3RWGA 5GS0L 5C9XA 4KKLD 5EC2B 4LVDA 3Q44A 3DVNB 1HSBB 2ADIB 1KFGA 3OIHA 3PV6A 4YIQA 1LJMA 3GHSA 4BSJA 4ML9A 4JRYE 4MOZA 3ZLHA 5CILH 1NFKA 1LP9B 2EVFA 1W9PA 2XICA 4OCRH 4BEQA 1JHLL 2N01B 4DZ5A 2D1ZA 5HD8C 1XH0A 1A1OA 3EFDL 4RFEA 4CU8A 1NMCB 3KJ4C 2WZ5A 1S2CA 2HN7A 1RIVL 1K02A 2VIRA 2PE3A 3W7LA 1JYWA 1OIOA 1JD9A 1KJVB 1UUMA 4G8FA 3MVSA 3L21A 3V6ZA 1JPSL 4NIYE 7TIMA 4K23H 1OAKL 2MNUA 4YXLL 1P4LB 3ABXA 5ENLA 4L29A 4FQHA 4M6AA 3KVPA 2YA2A 3BVTA 3N1FC 5FHAL 1OAYH 1RJLA 4XCEA 1GVFA 1FH5H 4GQPH 4RV8A 5E5CA 5MKGB 4RFNB 2VNIA 4OFVA 2V2XA 3SKNA 2FIKA 4NKDA 2I1LA 3I02B 3S3SA 4E8GA 3SCMC 3HQPA 4PHZA 1W34A 3AO0A 1PS3A 4GIYA 3A4AA 1G1OA 3KYNB 1MHEB 2VWTA 3QJFB 4HN4A 5IJKA 2AMUA 3NSYA 3QGKC 2D3JA 4DKDC 1RIUH 2Y8UA 2VO5A 1T5EA 3VGGA 1RUAH 1X7QA 2ZRZA 5GJTH 3FT4B 3K0YA 4DPCX 3W00A 3CC5A 4JNMA 4RNRA 4Q6IC 1RH8A 1AZCA 2OCCB 4RQQB 4B5SA 3TSBA 1NLDL 3ARDB 2FEJA 3U7BA 3ZJAA 5I73C 2Q7AA 3L3KB 2WTRA 1SXZA 3GSOB 1ZAHA 5IB2A 2VBUA 2BM0A 4HA4A 3S2AA 4L9LA 4MXQD 3S96A 2DWDB 3SYAA 1Q6LA 1EA9C 2AFNA 3W28A 1QW7A 2B0SL 2R2HB 3HC3L 4EI6B 3ZE2F 3FL7A 2J5LB 2GIMA 4PB9L 1KXQE 3W2DL 1W3JA 3UC0H 1DFXA 1R3JB 1FZMB 4TSCH 1SY6A 4ZW3A 4IJ3B 1A7RH 4Q8UA 4DF1A 4YGVA 4F0SA 2ZYIA 5IOPB 4JHOA 5D4HA 3CSFA 4WW1B 4TLSA 3QYQA 4PGZA 1I85A 4MLSA 3NSFA 5GS2H 3D3VA 1M53A 1CWVA 1FZOA 3V4UL 8RUCA 4AC2A 1VEOA 2W07A 1LOLA 3V6FA 2BRQA 4N8VB 2P8PB 1B4LA 3K4DA 5KSWA 3N41F 2Q10A 1ISWA 4P8QA 4DUVA 5GS1C 2Y7QA 5DO2C 4EF3A 3OX8A 1A7OL 2E8YA 1PKQA 3CC1A 4FG6D 3ILEA 1I1FB 3TJ4A 5AYUH 1QUMA 4LVNC 3US1A 2SEBB 1MQ8A 1PAMA 1J0HA 4H5SA 5EZOL 1QYGL 4LGPB 1SLXA 5DYFA 2WBGA 3FOMA 2XQYG 2AV7B 8FABA 4D8PA 1F90H 1K8CA 5DS1A 3FNKA 4AWUA 3UG5A 4B9JA 5IR1B 3OKMB 4GLEA 1NUDA 3FQXA 5IOKA 3EKCA 4K5PA 2XWBB 3DGBA 4X8CA 5GNZA 2YD9A 2GJRA 2R2BA 1ZA6B 2HFFB 2GVJA 3D33A 2WBKA 1KG0B 4J3TA 2CDFB 4BH8A 1GVQA 3AXXA 3ARDD 1XDMA 3MP4A 2Y06H 5B1JA 2C0AA 2MQGA 4L8SC 2TRYA 3B8IA 1T83C 1Q65A 3ME0B 2BVQA 2BIPA 3CL6A 3RYMA 5ICYA 4ACAA 1YQVH 3C0QA 4Q3MA 1G5GA 1ONQB 2X6XA 4DH2A 4QF1A 1P84K 1VGAA 4ODBD 3DBPA 3MDJA 2EXSA 3CQIA 2WO3B 1TT6A 1M7OA 4JQIA 4XZWA 1FYHB 3SQMA 3EZ4A 3CDFA 4U7MA 5A6LA 4JHVA 3THMH 3UA4A 1WE5A 3U30C 5B3SB 1BJ1J 5CEZD 3I3BA 4JTSA 5GHWL 2IWKA 3NPVA 4MB4A 3TU6A 2ESCA 1J79A 3FCBA 3NZ8B 4PWIA 4K6AA 4P2OC 4MNMA 2J1YA 4S1SL 2GWGA 4R7XA 2DEXX 3ULSB 2YOCA 2O30A 1BYCA 3Q6FB 1S7VA 3U5UA 2DPKA 1H85A 3N9GH 4R84A 2XKSA 2AHIA 3DX5A 4JX0A 2Q3RA 3V3WA 4H7ZA 5AKQA 4QRPE 5BYWA 1Z6JT 4YJZL 2GW5A 2NTFA 2GDQA 4L4OA 2ZUTA 4XKYA 3DHPA 1PY0A 4JQVC 4JTAA 1W0VA 3Q06A 1SNRA 1II4E 1EFRA 1REQB 4RJEA 3JQRA 1IBGH 1ZM9A 2HPTA 3IJ6A 4KUZH 2C9RA 4G9PA 1IWAA 3QQDA 3LH9A 4Y9RA 3F62A 3G24A 5CGQA 5E8EB 5FA6A 3GTVA 4FDWA 1ILUA 2NUWA 1QFEA 1NWUA 1YPZB 3G5XA 2HRPL 1IAIL 2GSEA 1MREL 2ARJB 3ZE2E 5F7EH 1EBAA 1OINA 1CQKA 2HH0L 2VDPH 2XT1B 3Q43A 1QZ1A 5C8JA 4L3EB 3RLUA 1TYEB 1DYSA 2GFBB 3LQLA 3G22A 1IGFH 3NM1A 4G6AC 5IZ7A 3RWHA 1LYXA 1YY9D 2ABAA 1SJHB 3BLDA 4UOQA 4GWEA 9CGTA 2X70B 1E3XA 4FF9A 1FHLA 4HC1L 4DQLA 3RPBA 1EERB 2H9GB 5FGBC 2ADYA 2XM2A 2I07B 4MF4A 4UBDD 4AXWB 3TASA 4PD4K 4GEJA 3EJUA 2Z92A 3HR5B 4YDJB 2VM4A 4LASH 3S1UA 4RMVA 1S2EA 3PAJA 4RD1A 1DVFC 1OCNA 3S3BB 3RR4A 3E8UL 3MYPA 2BOBB 4RMWA 4C5YA 3GMRA 3V5HA 4XGZB 1A9EA 1SYSA 2Y6SC 1A7NL 2EDOA 5CSZB 5DRZB 2DQUH 4DETA 1O6SA 1NARA 4FXRA 2YSWA 1KK2A 5KSVA 5ILTL 5IB4B 1V03A 1CQYA 3HUJB 3PDOB 4APXA 3BTNA 2YAQA 2E9JA 4ZX6A 4A8NA 2OX5B 1FWGC 2VRKA 5IHRA 2KBGA 4EVNB 3VFCA 1L9PA 4FA6A 4M62L 3Q5YA 5CP7A 4HGWB 3II2A 4NP4L 3QJOA 4MAYD 3I68A 1QO3B 1IBZA 2FO8A 3ARSA 3IAGC 2WSSA 1SVZA 3AC0A 4ZOBA 4B7LA 3UTPE 1T1ZB 4C91A 1AQHA 1GGTA 2Z31C 4KO5A 3IV3A 3UEQA 5ICZB 2DLGA 1EJWC 3JWNH 3AIRA 4FR6A 5LGJB 2WPDA 4KKRA 1JULA 2XU9A 5F4SA 4I89A 4L3ED 1SF3A 2QT3A 5DY2A 4HIEB 4Q8BA 2QZQA 1JF1B 3PWVA 2OYLA 2YD7A 3WIFA 3B7YA 1IJNA 3C3NA 5FKPB 3DX6B 4LSUH 3FAXA 4KK5C 3U9IA 3AVYA 3LNMA 1UVQB 3W73A 3C9NA 5L6YH 3FCUB 4BZ1L 3UAFA 1D1NA 3RIFF 2VDOL 2NLIA 3KR3L 2O92A 3QDGE 5BVPL 3WFEH 2RGMA 4KY1H 3GSMA 1ISZA 3GIYA 3UZQB 3NQ7A 2NQLA 5JHLA 1EHLL 1WUFA 3C3UA 4M24A 4Y96A 5C0IA 2AXGA 4R7LA 3PUNA 4B3KA 4ACYA 4IOSA 1T0NA 3VH8G 2PZNA 3UA3A 2FZDA 1R5NA 1K4GA 3TS8A 2MANA 1BEUA 3MBFA 1CD0A 1RURH 4GAYA 2R51A 4NQSB 4X61A 4Z1MA 4XZLX 2VENA 1FE8L 4I18A 2W1NA 2NY0B 3VFPA 4YHNA 5EDXA 2ZADA 3H2NA 3SPVA 1TQSA 5DVMA 4ENZA 4Z2IA 1QI5A 4X4MA 3UY8A 3X14B 1CXHA 2VT0A 3BAYA 1IAMA 2QGBA 1SYTA 2X53A 4PJ7E 3RXZA 2CLPA 1U8IB 5AN9A 3QULA 3SGJC 2WLKA 4ENED 2VMCA 4C4UA 1FXQA 2PS2A 4OIBA 2CAKA 3ALWA 3HKFA 2O72A 4E42B 1OT1A 1W8NA 3ZL2A 2B2XH 3TNNA 1T41A 4AZHA 2VVNA 2EP6A 5AAWA 1XQ4A 1D3CA 5E9AA 4K3JH 1TQJA 4QHKJ 1N9PA 3U2OA 4LVEA 2A3AA 4RDWA 3X1FA 3LYRA 5SX4H 4UU9A 4E9WA 5I0XA 1ET7A 1S7XA 5DRXA 1TZGL 4NHUA 4B60A 1QVFB 1W8GA 2UY3A 1ZT7B 2YA0A 1QEWB 4HX1B 3WDHA 4IL0A 5A95A 1QBLL 1J1XH 3D07A 2WCGA 3SPHA 5AVWB 3USZA 4MMYB 5HDWA 4H8WL 5D93B 2CK0L 2PCPB 4E3VA 4KKBD 3N3TA 4ZCIA 3L7EA 1MEXH 2TSYA 2QADB 4OZFB 3EYVA 2HNHA 3WLIA 3M46A 4ZFOB 2YJQA 5A2BA 1E72M 3DJRA 2QVTA 4QM1A 2ZF8A 5I19L 2LLEA 1NGXA 3GK8H 2IANE 2AJSL 1C5BL 1HH9B 2AGJL 3BW2A 1PYFA 3PTMA 1K6QH 4WJG3 3DFQA 2NY0D 1KPVA 4ISVB 3W7QA 3O2DA 5AFAA 5FL7A 4YE4L 3IN2A 3CZEA 4HZMA 3WH5A 1FL3B 2P42B 2PURA 3H2AA 4UTUA 1MRCL 3UYCA 1J5CA 3A6BH 4P9MH 2DJLA 3F12A 4E9LA 2NR6D 5CCGE 4NAEA 1B2WL 4PGBA 4N2OA 3P0YL 3I75B 2NUPA 1MFAH 2PTYA 4JOMA 4M5PA 3ENLA 4C6LA 1RZ8B 1G1CA 2VLKE 4C6JA 3L66A 1AHWB 3CNKA 1Q8MA 4KPLA 2F6AA 1TF4A 5AB3A 4N0YL 4MNQB 4ILDA 5F4XA 3V0WL 4U2YA 3SY5A 5LNRA 3NYDA 1GPOH 3F58H 3GWJA 1GQKA 3D6GA 1EKOA 1OB2A 4DJDC 5D7KD 1NCWH 3V79C 1QP1A 1RSCA 3QUYA 2YXVA 3S9DB 4IBTA 4UT6L 4XD4A 5IOBA 1RZFL 3LQAH 3PPHA 1BJKA 3NQ2A 3N19B 3LVBA 1U8CA 1XKJA 2CIIB 4B48A 4X60A 2VISB 3SE4C 1VC4A 2EDRA 3FB6A 4NX0A 2DT2A 4G7EB 3ISRA 2FB2A 3R6IA 3EADA 3FU0A 3BEVB 4AHQA 5HYJB 1XH3A 2INFA 4UR8A 2ZE0A 4CVXA 1A5UA 1MWOA 4ODTH 1E0VA 3RGVC 3AREB 1PKVA 4D7BA 1CICA 3R1GH 4N2IA 3UJSA 4K9EL 5C86A 4Q6KA 1ES0B 3U79A 1VFTA 1CF8L 3T2NH 4GD0A 1AA1B 4KPHH 4QIRA 1DE4A 3NJGA 5CAHA 2F1LA 3VCCA 3MGOA 3REQA 3MCAA 1AJZA 5C2BL 3C2VA 4P06A 5HWNA 5CG0A 3EYOB 4IHBA 1Z9OA 4Z4YA 4F2MA 3K1GA 4MSWB 3U46B 3FY1A 1OZUA 2SODB 1RQEA 1VACA 2J77A 3W84A 1G7MA 3GMPA 4GINA 2J4GA 3T7VA 1UR1A 3OJWA 3Q01A 4ONHA 1XIFA 5LLIC 4NZUL 2VZ3A 2B7QA 4YSCA 5F0JB 4IBUA 3QO1B 5LA1A 5I71C 2R39A 1IVLA 3DIFB 2WYHA 4PGDA 2X89A 4LB3A 4M8UA 4JKPL 1WYIA 3TIEB 3CPXA 5LCVA 3DFPA 3WEXA 4MNQD 3ONBA 3PENA 1JCLA 3BUPA 3OZPA 2JJSC 3T71A 3B4NA 1CNVA 2NDFA 3ZMRA 2V5KA 3S1XA 3E6HA 5JIDA 1Q8AA 1X5AA 4V2XA 1HKFA 4Q33A 3O9WB 5E4EC 1ZHAA 1PYMA 4NO2A 4UT9H 4XSMA 3W1ZA 3ULUF 3O15A 1N0UA 1FLTX 1ZA3A 4R4FL 3L4UA 2QKSA 3ILDA 1TQUA 2BSRA 4OT1L 1L6XA 2O1AA 2PWEA 5C0RL 5HYJD 4IOTA 5HNTA 4KO6A 2K6WA 1A3XA 5ABZA 2LTQB 3K71A 2R29L 3ARED 5G1TA 2XSBA 4Q8PA 2J66A 2X4TA 3RWCB 1ACCA 2CBPA 1XZ0B 4Q4EA 3HZYB 5E7FA 2VOTA 1PCWA 4O02L 5IM51 3J8F7 2H47C 2IXVA 3QZBA 2I16A 2VJXA 5HNUA 1OGAE 3TOPA 1Z9SA 2C1OA 4X0VA 2FZNA 1MCOL 1WT5C 3RHWF 4KQ3H 4P2QE 1KJ2B 3V4LA 4JFDA 2F8VA 4LNRA 4UZEA 1DO6A 5DJ8B 1L9OA 1EP1B 4RNIA 1AIFA 4HNLA 2FT6A 1EJOH 4JN2A 2K6ZA 4Q8TA 3JSSA 5BQ7A 4OGZA 1BTCA 2N7BA 3UF9A 1YX1A 3MHGA 1NQ6A 3AJ7A 2NZLA 4AQEA 3MMEA 4N3GA 5HYQA 2FQGA