3BCFA

Alpha-amylase b from halothermothrix orenii
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
585
structure length
585
Chain Sequence
SLFLIESEPSTGASVSKNLTEIILIFSNDINKVSQLALTDLITDSDIQGIDYNIEGNKVIINNFSLEPTCNYRLSYEVIDIYDNHLQGYIEFLVNQSNYPQIPDQEVNHTILQAFYWEMNTGEYATEHPEEANLWNLLAERAPELAEAGFTAVWLPPANKGMAGIHDVGYGTYDLWDLGEFDQKGTVRTKYGTKGELENAIDALHNNDIKVYFDAVLNHRMGADYAETVLLDENSRDKPGQYIKAWTGFNFPGRNGEYSNFTWNGQCFDGTDWDDYSKESGKYLFDEKSWDWTYNWDEDYLMGADVDYENEAVQNDVIDWGQWIINNIDFDGFRLDAVKHIDYRFIDKWMSAVQNSSNRDVFFVGEAWVEDVDDLKGFLDTVGNPDLRVFDFPLRSFFVDMLNGAYMADLRNAGLVNSPGYENRAVTFVDNHDTDRDEGSYTVSIYSRKYQAYAYILTRAEGVPTVYWKDYYIWEMKEGLDKLLTARRYYAYGPGYEVDNNDADIYSYVRSGFPDVAGDGLVLMISDGTSGNVAGKWINSRQPDTEFYDLTGHIKEHVTTDSEGYGNFKVIKSEDKGWSIWVPVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Polyextremophilic alpha-Amylase AmyB from Halothermothrix orenii: Details of a Productive Enzyme-Substrate Complex and an N Domain with a Role in Binding Raw Starch
pubmed doi rcsb
source organism Halothermothrix orenii
molecule tags Hydrolase
molecule keywords Alpha amylase, catalytic region
total genus 198
structure length 585
sequence length 585
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3bcfA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bcfA04
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3bcfA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bcfA02
3II1A 4JKLA 1JZ6A 1JZ5A 4LQ1A 2VO5A 3WDHA 3CC1A 2DIEA 3FNDA 2C7FA 1QVBA 1DP0A 3OLGA 3WBEA 2XJ7A 1O6TA 3KL5A 3BAWA 2BHYA 2WHLA 4AMCA 1BYBA 1J0KA 1NH6A 3RJXA 1Z32X 3SCUA 2FH8A 2ESCA 2JFEX 2DEPA 3K4DA 3WQ4A 1JI2A 3MKKA 1U2YA 1E56A 1G01A 2EABA 2B31A 3CHFA 2XVKA 1E6PA 2BVYA 2QMJA 4M29A 3RJYA 3WDJA 4MB4A 2C8NA 2V5DA 3H53A 1KGUA 4UQDA 4WKHA 4UQBA 4HZ8A 1GNXA 1VJSA 1QX1A 1TUXA 1UG6A 3BLKA 1XSKA 1N82A 3CZGA 4AD2A 1W1PA 2WC4A 1IV8A 1UHVA 4IPLA 2GJPA 3NSMA 1E5NA 2A3BA 4CCEA 1LJYA 1S46A 4XB3A 1W91A 2OYLA 1XH2A 1GQIA 3HG2A 2G8ZA 4XZBA 4CD4A 2DH3A 1UKTA 5JIPA 2QMKA 3WH6A 3O2LA 2E0PA 3WUFA 4AW7A 2BXZA 2F7QA 2J75A 1XHGA 1ISWA 2WXDM 1HN1A 4KMQA 2FHFA 1UH3A 2E8ZA 4MDOA 3APGA 1GOQA 3VMOA 5JBDA 1JZ8A 3LXAA 1BG9A 1LG2A 2YA1A 1OD8A 4UZSA 1JIBA 4ML4A 5A6JA 1KR0A 3T2OA 5FOOA 1I1XA 1TQWA 1QW9A 1MFVA 3TTSA 3OA5A 4AZ5A 4W93A 5JBEA 2PC8A 3AIRA 3AS0A 1AQHA 1V3HA 2YLAA 3N9KA 3WEMA 1F4AA 3PTKA 2PBOA 4C7DA 2WCAA 2BS9A 4JHZA 1DTUA 3WF2A 1J11A 3AISA 1PEZA 3RPMA 5D8WA 3DHPA 2XYLA 4TVUA 1ESWA 4UTFA 5A94A 2J7DA 3WUBA 2JIEA 5E1QA 3AMGA 4H8VA 1SYTA 1K9TA 2FYVA 1WO2A 2HISA 2WMGA 4FF5A 2WHJA 2WC7A 4NZFA 4JFSA 3KE0A 3MV11 4P7QA 1HKIA 4PMNA 5E6YA 3PN8A 1QI0A 1JDDA 3EDFA 3GH7A 4DO4A 1VJZA 4U3AA 4F8XA 1ZJAA 3A4AA 4HMEA 1BPLA 1YQ2A 2C9QA 3D50A 3OLDA 1ZU8A 1BVNP 3MMWA 4UQCA 3EMCA 1JD9A 4FNQA 3WH7A 3POCA 5HNNA 4HOXA 1CGYA 1HJQA 1WCGA 4KGLA 3TOPA 4V27A 1ZBCA 2PWGA 5ICUA 3MSGA 1TG7A 3VGBA 3KL3A 4AEFA 3L4TA 2FHCA 3RIKA 4AD5A 1SMAA 1VBUA 3GXNA 4Z2IA 4C7GA 5A95A 3OGVA 1R86A 3OIHA 2V38A 3N1AA 4U2YA 4NXKA 3UR7A 3EYPA 4AZBA 4ZE5A 3ZQ9A 2Y8VA 3SURA 4AZHA 3AS1A 2OWCA 3A6OA 4PMZA 3VO0A 5HOSA 3IK2A 3RCNA 4FLQA 4GQRA 3N13A 3CUHA 4CVUA 3CHCA 1PX3A 7TAAA 1KXQA 1ZB5A 2D0GA 2E9BA 3PZOA 2WM0A 5AY7A 1ISZA 1J18A 4W7VA 2W63A 3IAQA 4GI8A 4CC4C 1KWGA 2ZXDA 3VDAA 2WC3A 2JIWA 3GBDA 5HPOA 3UCQA 5A2AA 4MNKA 5DT5A 2XIBA 2BV9A 2ZX5A 1CXKA 9CGTA 8CGTA 3E1F1 4Z2GA 1CXLA 4W84A 4WKAA 5LA2A 2WKGA 3NUKA 3FHQA 5DFAA 3VD3A 3RM9A 1QWNA 1R46A 1A3HA 3AHVA 1FFQA 1F4HA 2WK2A 1JZ4A 3B9DA 2EBNA 1VEPA 5CLTA 1JDCA 1NWSA 2WVUA 1CXFA 4J3XA 3CLWA 3WH8A 1KTCA 3SCSA 4S3KA 4PSRA 2YLLA 3SUUA 2CYGA 4CCDA 1PAMA 1JNEA 1GJWA 1GONA 2ZX7A 3RMEA 3T08A 1CDGA 2O9RA 2WLZA 1UD3A 1BPLB 1NM4A 1VB9A 4DUXA 3SCQA 1K9FA 4J3WA 4H04A 3F5JA 1V03A 4J3SA 4UQ9A 5ABFA 1V0LA 5CG0A 3W27A 3CIVA 3WD1A 5A6LA 1C8YA 5A6AA 4UOJA 2F8QA 2FGLA 1KBKA 3UEQA 1FH7A 2Q8XA 1OB0A 3ARQA 3PZTA 2WQVA 1JNDA 3D52A 5EB8A 1JG9A 1R7OA 3GBEA 4MB3A 4CU8A 1EDTA 1L0PA 3WMBA 3TTOA 2ZE0A 1UQZA 3KLKA 1MW2A 4H8HA 3WSUA 3VNZA 4U5IA 1PJ9A 1RPKA 1R85A 1UH2A 1M7XA 4WIWA 4A3HA 4NXSA 3VMNA 4W89A 4GINA 2ZX8A 1U30A 3DX0A 1MWOA 2OMZA 3EBVA 2YL8A 2VURA 1H0GA 3SIMA 5A2CA 3UERA 2VI0A 4H41A 1AQ0A 1H0IA 4B15A 3MUZ1 3WBAA 4Q7NA 3TTQA 2ZWZA 2PWFA 3VGGA 2WQWA 3F4VA 1MQPA 3HJEA 3PZVA 1E71M 4XZWA 3T0BA 1WDSA 1R7AA 4E8DA 1TQSA 2WVVB 3BUIA 3AXXA 3DDGA 1UWIA 1XGZA 1E43A 5M03A 2VRKA 2Y8KA 4P7RA 4JHOA 3A47A 3LXCA 1OBAA 1MQQA 3EDJA 4AD0A 5IFTA 1T0OA 3AFBA 3N17A 1EDQA 3GDBA 4CD7A 3WQ8A 1R47A 4P7OA 2G3NA 1IT0A 3OGSA 4CUCA 1C93A 1OGSA 4PMVA 4Y7EA 3BZ5A 1J0HA 2XVLA 3U7VA 5I78A 2CKRA 3VIIA 2OMTA 3WUGA 5CJ5A 1TMQA 3HG4A 3QGVA 3VIPA 2DT2A 4D71A 2F1AA 1U33A 1H1NA 2VCAA 1BLIA 2GK1B 1V3KA 2CPUA 1G5AA 4LPCA 1HJVA 2WYSA 2VZVA 1EGZA 3PHAA 2IGTA 3WMCA 4S3JA 3WEZA 1UD8A 2D73A 2PI6A 1QOXA 1PS3A 4JCLA 4BZYA 5LA0A 4AEEA 1VFOA 2VNCA 1CGTA 1CENA 2HVMA 4M82A 3MSDA 2J79A 3LXBA 2ZX6A 3WH5A 1TVPA 3VUPA 5EBAA 5CPTA 4J3TA 1KQYA 1XD0A 5BRQA 4LXFA 2D24A 3ARXA 1ISYA 1QW8A 2WSKA 4J3VA 1QNSA 1VBRA 1UUQA 1UH4A 2GVYA 1NOWA 4GQQA 3O6AA 1TA3A 2D2OA 4V28A 2Z1KA 2X0HA 3ARSA 5GQBA 1WPCA 3WNNA 1CZ1A 3CH9A 5A8MA 2D23A 5A6KA 4RE2A 3ZJ8A 1BSIA 4HTYA 2BVTA 3BSGA 2WBKA 3HG3A 1BYCA 5FCZA 2PWEA 2Y4SA 4E4PA 1WP6A 1GOMA 5A6BD 3GZAA 5DF0A 1IX2A 1FH8A 2EJ1A 4PCTA 3ZMRA 3ARTA 3S5ZA 1H09A 1WZLA 4LYQA 4Z2LA 5ABFB 2GUYA 1CXHA 5ECUA 4ZEPA 4B9ZA 1EO5A 5C8BB 2WHKA 3VM7A 1CXEA 2VVSA 1E6XM 1CGUA 4ATWA 3VIFA 2WB5A 1VFFA 3W26A 4UQEA 1WZKA 1MQRA 2WQXA 2VQUA 4PMXA 3EMZA 3IJ9A 4BQ3A 3WL0A 1C92A 4LX4A 3QOMA 2EADA 2EPKX 4AWEA 3KWXA 4GZIA 1JYNA 4B3LA 1O6IA 3VSUA 4GO8A 1WDQA 4DUWA 2PWHA 3U7BA 2OMXA 3WF1A 1BGGA 4HZ6A 3SEPA 2XWDA 4DO6A 1H5VA 1ZL1A 3ALFA 1BTCA 2CIPA 2O92A 3DYOA 1B1YA 3SCWA 4FLRA 1W9DM 2NT1A 4GKLA 2QV4A 3OG2A 1QI3A 4W87A 4JFWA 2XWEA 4UFHA 1EH9A 5A8OA 1WKYA 3AJ7A 1K9EA 3VD9A 3NSXA 1XEUA 1UKSA 1EQCA 2A3CA 4PTVA 2F7RA 2VVNA 2YL5A 2WKLA 4AISA 1E6QM 3WNMA 3NDYA 5A6SA 4FK9A 1CXIA 3CZKA 4XV0A 5JBFA 5A3HA 3WQWA 2EPNA 1KCKA 3SCOA 2YIHA 1OCQA 4R27A 4V2XA 3GXIA 2ZXBA 3BAYA 3CZEA 5LA1A 1UWUA 5GNXA 1HJSA 3M6DA 1JAKA 1TQTA 4TOQA 3KL0A 2VRQA 4CN6A 1C3FA 1D7FA 4AMWA 1W1TA 5BYWA 2YFOA 1OM0A 2ZX9A 3FY1A 4PMQA 1WE5A 2EXOA 3VNYA 2VX5A 1CBGA 3BCFA 1TE1A 3WQ6A 1UD6A 2UZXA 1VFUA 3WD0A 4PMYA 4PEEA 2CHOA 1O6VA 3PZGA 4OUEA 1LL6A 1VEOA 3AHZA 1OINA 3PZQA 1NQ6A 1O7AA 1HXJA 2BY2A 2QPSA 4TXEA 4OJYA 4AMXA 1I1WA 2A3EA 1MXDA 2ZXAA 3BAJA 5I3DA 1GZJA 3WF0A 1BYAA 4MNLA 1W9UA 5BRPA 1E0WA 3SCNA 1JZ3A 1VF8A 5CPSA 1A47A 2CETA 5D8ZA 1MW0A 3ZOAA 4PRWA 2WW5A 2VTFA 3BVWA 2FHBA 3GNOA 3S2CA 4HOWA 1GOIA 4HA3A 4CCCA 2VCCA 4AY1A 3BAKA 2WCSA 4BF7A 1ODUA 3VINA 4D1IA 3L4ZA 3B8SA 2W62A 1MVYA 1H11A 1YHTA 4OIFA 4TTGA 1VEMA 3K8KA 1UWQA 1W9BM 2PBGA 3VIOA 4AD4A 1B9ZA 3MUIA 2WBGA 2E3ZA 3EDKA 1QNRA 3SUTA 1HKMA 5I77A 1DWGM 1NP0A 5CQ1A 1TA3B 4RL3A 1JI1A 5FKYA 2VQTA 2W67A 4JL2A 5D9NA 4YHEA 4B16A 5ABEA 3BUQA 1TFVA 1E3XA 5A8QA 5LYRA 1B3VA 1HWWA 3CZ8A 1DHKA 3S5YA 3K46A 1H6TA 3DHUA 1KFWA 2ZUNA 4NZCA 3BMWA 1W1YA 3OBAA 1GHSA 1NM9A 3OZPA 3AXHA 3ARZA 1ITXA 1EHAA 4D6CA 3ZSSA 2Y5EA 4IISA 1W3LA 3AYSA 4MAVA 1J0YA 4W7WA 5C71A 5E0CA 3WY2A 3N18A 4W5UA 4F66A 1E0VA 1OGBA 3ALGA 2E8YA 4M8UA 1DWFM 1MYRA 2BVDA 3J7HA 4KWUA 3AS3A 4IM4A 2E40A 3TP4A 4UQAA 4PTMA 4HU0A 2D0FA 4C7FA 3M07A 2VT0A 1UD2A 3SUWA 4D6HA 4PYSA 1BVZA 4PMUA 4GXPA 3AXIA 1IZKA 2A3HA 2WHMA 2YOCA 2WVTA 4FMVA 4AYSA 1TCMA 3MMUA 5DMYA 4EAMA 1E1EA 3T09A 3CZLA 2W4XA 1UASA 4FNSA 3EJQA 1UWSA 4HMDA 3A21A 5IHSA 3EJRA 1GQJA 1FOBA 4PSPA 2J8FA 3N15A 3EJPA 3WL1A 2XUCA 1X6NA 3MU7A 4OOZA 3VIHA 2QF8A 2BHUA 1JYXA 5HDRA 1GORA 2W61A 2GJXA 3W81A 2D3LA 2CESA 2BFGA 1R34A 1JFXA 4MNJA 3BSHA 3DECA 4P7NA 2OSWA 2O9OA 3O9NA 3ZIZA 2XSAA 3KLLA 3ARWA 1PIGA 2CBVA 3WDIA 1B90A 2YDQA 3WIJA 3BLPX 3W29A 4KH2A 1OIMA 2W5FA 3WENA 1UR2A 1RP9A 2DT3A 3GYCA 4PMOA 3L2MA 3W37A 3ARPA 2WMIB 1B31A 2PB1A 2NSXA 2G41A 1HTYA 5ABHA 4BQ2A 5A8NA 3A3HA 5I5RA 1KTBA 1QNQA 1D2KA 3S6TA 3U5YA 3VGFA 4M24A 5CSUA 1JL8A 1UZ1A 3AHTA 5AC5A 1UKOA 4J3UA 3VVGA 2WWCA 1V02A 3NCOA 2W66A 1OD0A 5A8PA 5JUVA 5A6MA 2NW0A 3W38A 2CNCA 4W8AA 1FHDA 1XCXA 3CMGA 4DWSB 3M7SA 4RE3A 4ACZB 4W85A 3IGUA 4HOZA 3DX3A 3L4WA 1SZNA 4HA4A 4AQ1A 1QBAA 3ZJKA 1B30A 2VZOA 1V08A 1M42A 1KWKA 1O6SA 4BQ4A 2ZUWA 4UFJA 1RD6A 4DWSD 1BQCA 1NOUA 3TA9A 2EAEA 5M5DA 3DX1A 3HMCA 1W9XA 1UQYA 4TVDA 3TTYA 5E09A 4BQ5A 5IFPA 3U57A 1W1VA 4W88A 4N42A 3SCRA 4W8BA 3W28A 2WMFA 2XN0A 3GH4A 3THCA 4AC1X 4WSKA 1FA2A 4U31A 4QP0A 3GTNA 3GM8A 4AYGA 2EACA 1W3JA 2VMFA 1BAGA 1SR0A 4U5KA 2CBJA 4WK9A 1AQMA 1DWIM 3QHNA 1B0IA 4NRRA 3ZR5A 6TAAA 1K6AA 3A4XA 3L4UA 4UFKA 1SMDA 2V3EA 3WH9A 3VGHA 1R8LA 4QCEA 3OLEA 1BG4A 1EA9C 2NT0A 3D51A 4IPNB 3LPOA 4FNRA 1NWRA 3WQVA 1M9SA 1HT6A 3UR8A 3NDZA 1J0JA 1Y7VA 1XYFA 1QI4A 4D6EA 3VMPA 2XFFA 4XX6A 2DT0A 1X1NA 3EJTA 2YA2A 2XVNA 3K8MA 2JF7A 2XIIA 1LG1A 1J0IA 1OIFA 5BXSA 4WKFA 3NJ3A 1QHPA 4NI3A 2OYKA 5IHRA 3LPPA 3FW6A 1TR1A 4D6GA 1B3XA 4DM2A 1KGWA 4ATDA 3AIVA 5CZKA 3WDRA 5KEZA 3AHYA 2XM1A 1MXGA 3KZSA 2XVPA 4CD6A 4OBRA 4QCFA 2F7PA 2J25A 3LMYA 3ARVA 2TAAA 5E9AA 3AQUA 2X2HA 2BHZA 4JL1A 1W9VA 2WPGA 2X09A 5D4YA 1JXJA 1MFUA 3ARRA 2ZXQA 1I75A 4L4OA 3W4RA 1EO7A 4LYRA 4DM1A 7A3HA 1CNVA 1JZ7A 3LRLA 1BHGA 3JUGA 1GOOA 1E15A 1HL9A 3FAWA 1ECEA 2WVVA 3T0AA 1E1FA 3K8LA 3CMJA 1JZ2A 1X6LA 3OGRA 1E6SM 2XG9A 2XN2A 5M17A 3VOCA 3AIQA 1HJWA 5FIPA 2WLYA 1HVXA 2V5CA 3A5VA 2O9TA 4Z2HA 3PZ9A 5ABGA 3GNRA 5FD0A 1VRXA 3MO4A 2VOTA 2C9RA 4GZJA 4CC4A 1V6UA 4QLJA 3POHA 5EFDA 1MW3A 4D6JA 2CBIA 3ZO9A 1HJUA 3VD5A 2XSBA 3VDBA 1KR1A 1M53A 1C7TA 4DWSC 2DQXA 3BVUA 3N04A 3RM4A 1DWJM 1UZ4A 2WZEA 2E9MA 3BUBA 2WQUA 2D0HA 3CTTA 4E2OA 3ZT6A 1Q6CA 1E4LA 1UA3A 1J9YA 3MI6A 1OGGA 2GSJA 4CD5A 3AOFA 5M3WA 3LPFA 4ACYA 1OT2A 4MNMA 1EOMA 3ZT7A 1B2YA 1C7SA 5DEZA 2X1IA 3RDKA 4EK7A 2EEXA 1HNYA 3AZTA 4QAWA 2VX4A 1E5JA 1V6YA 3AIUA 4P7LA 1PIFA 1XH0A 3T2PA 4X9YA 2X2IA 2VX7A 2XGBA 5BCAA 3UG4A 4W5ZA 3VX0A 5D9OA 3M46A 4J27A 2E9LA 3ZJ6A 1V6VA 1K9DA 3GNPA 4FLOA 3LX9A 2CXGA 4URIA 2J7HA 3CUFA 1VIWA 2VC9A 3WY3A 1NWUA 1GOKA 3I3EA 4WSJA 2Y5QA 1C90A 2UY4A 3A4WA 2J7FA 3BUPA 1VFMA 2OW6A 3CUIA 4EKJA 2DSWA 1RH9A 3L4XA 3ARUA 5I6SA 2UY3A 3WNLA 5HPCA 3PTQA 1KB3A 4HA1A 2WZIA 1E4IA 1BFNA 1DWHM 4CILA 5A69A 1HIZA 2W92A 1GW1A 1M03A 1FFRA 1V3JA 1H49A 1PZ3A 1GQKA 3OB8A 3VKKA 3H55A 3PZUA 1V3IA 4AIEA 2ZUVA 2ZUSA 3LRMA 3D5HA 3CUGA 4KRTA 2GDVA 4P8XA 1XSJA 4HP5A 1IZJA 2JEQA 1W3HA 3WUEA 3WQ5A 5EMYA 1JF6A 4JAWA 1US2A 2RGMA 1H2JA 4NZJA 4U2ZA 2OSXA 4A3YA 3IJ7A 4AD3A 2Y24A 2WMHA 2J78A 4LYPA 5BROA 5AC4A 4YN5A 4GI9A 1HF6A 1C8QA 1V3MA 1QNPA 2WZHA 2W91A 1OT1A 4DUVA 2VRJA 1V0NA 1H6UA 1G9HA 2RGLA 4Z2JA 3RO8A 1E72M 2J74A 2DSKA 4D72A 4J28A 2WNWA 3AMLA 3OZOA 3BVXA 1W3KA 2V3GA 3AYRA 4PTWA 1GVYA 1LL7A 4NRSA 4JFVA 3VIGA 1KXHA 4GI6A 1EQPA 2WAGA 1E40A 4NX0A 1FHLA 1CLXA 1H3GA 1J01A 3W24A 1KXVA 5FL1A 2JALA 3VU2A 1ZBWA 5FL0A 2OWWA 2GDUA 3MS8A 3IAPA 1KCLA 4W7UA 4F9DA 3WFZA 4OGZA 3AIEA 2AAAA 2G3JA 4F79A 3VDCA 2DPEA 3CUJA 4EE9A 3VPLA 4XUYA 2F61A 1OSEA 5A1AA 4JKKA 1JFHA 5CGTA 3WKZA 2WWDA 2DT1A 3AI0A 1UR0A 1TVNA 5CGMA 4UZUA 5GPRA 4W8LA 2VUYA 3CV5A 1CEOA 2D3NA 2OMWA 1UKQA 2J4GA 3AROA 3GXDA 6A3HA 1AMYA 4IUGA 1CWYA 1JF5A 1EHNA 1R75A 3SCTA 4W86A 4UR9A 1UR9A 2CBUA 3AHXA 4JKMA 4N0RA 3VM5A 3ZSTA 1GPFA 2CEQA 3AIBA 4FNUA 6CGTA 1ZBKA 2IXVA 1JGIA 1KQZA 2FH6A 2ALWA 3CZNA 1LWJA 5E0FA 3CZJA 7CGTA 3EJUA 3IJ8A 3WN6A 2OSYA 3CPUA 4HZ7A 1CIUA 1HX0A 3BVTA 2OW7A 4ZFMA 1QBBA 2O9PA 4U33A 3VD7A 1UR1A 3AMKA 4GIAA 4OKDA 4M80A 2XPKA 1CECA 1OT4A 2GJXB 1E70M 1PX4A 3FAXA 1TQUA 1Q6DA 3SCPA 2DSVA 2XGIA 1NWTA 1PPIA 4U3CA 1ZBVA 3AMDA 2BY0A 1SFSA 2D20A 3AS2A 3BMVA 1PX8A 2GFTA 3SUSA 2YDRA 1UKPA 2FDMA 1B3WA 2UY5A 4X0VA 4CGTA 1WAWA 3BVVA 4JFTA 1MW1A 2J62A 2ZOXA 2ZIDA 1QHZA 2VJXA 1JYVA 5GNYA 3FXYA 5DT7A 5TD4A 3CZSA 3F5LA 1EIBA 5I79A 4QLLA 4MB1A 4M1RA 3DX2A 3N11A 2F7OA 2G3MA 3BXWA 4D6DA 1JDAA 4D6FA 4NSBA 1EXPA 1WB0A 2EPOA 5HBFA 3GH5A 2DDXA 2FE0A 2EO7A 2AOSA 3LRKA 4K68A 3T0DA 5IXEA 3CBWA 3BUDA 1JD7A 3VSTA 3WNPA 3EDDA 5D9PA 1WDPA 4H2CA 1KXTA 4MJ2A 4MADA 2ZUTA 3MUY1 3BAIA 5BWFA 3PTMA 2YA0A 4MB5A 4D1JA 1HP5A 1W2VA 4QLKA 3WF3A 2ZWYA 5GNZA 2RA1A 2MANA 2YBUA 1HVQA 4P8VA 3T2QA 4DWSA 2OWXA 3CO4A 3LPGA 3WY4A 1R87A 2AMGA 2YKKA 3AZRA 2OMVA 1WZAA 1XH1A 1E4MM 1V0KA 2BY1A 2WMJA 2A3AA 2X8RA 2V3DA 3VD4A 4F9JA 4HPGA 5C70A 4Q22A 3OLIA 1H41A 3PZNA 1TZ7A 3WY1A 1EOKA 3W53A 4WF7A 5CPQA 1CPUA 1WDRA 4TX6A 2YJQA 2XFYA 2YFNA 1V6XA 1GUVA 1W32A 3B9AA 4ZENA 4HPHA 1ITCA 3AICA 4J7RA 2Y2WA 2IUZA 3VIKA 3TV8A 1J10A 4PBGA 3WDQA 2WCGA 1GHRA 2D1ZA 4ZE4A 1BF2A 1UYQA 4OOUA 1GQLA 1XCWA 5I23A 3AZSA 2ZUUA 1KGXA 1UOKA 3MANA 3RM8A 4ATLA 4WLCA 4PTXA 5A2BA 1C8XA 1FP8A 2JF6A 4ZXLA 2WMIA 4JZ5A 1ZS2A 2F2HA 2PF0A 2J77A 4AZIA 2D22A 4OZOA 1GJUA 4Z2KA 3QHMA 5CSYA 3HZ3A 1V0MA 1E4NA 2VX6A 3WMSA 4KGJA 3PZMA 3TONA 3UETA 5I2UA 5I0DA 3GXPA 1E6ZA 1UA7A 5DO8A 4M81A 3ARYA 4HMCA 4H7VA 3PZIA 4PCSA 4CKQA 3ZJ7A 2J47A 4CD8A 4TX8A 4UFLA 5BXTA 5CXPA 3A22A 3RILA 2UZYA 3U5UA 4CU6A 1WNOA 4QDMA 3QHOA 1M04A 3UESA 3MV01 2WMKA 2XTKA 3VGEA 2OMYA 4FNPA 4YPJA 3IANA 1UD4A 3EJSA 1B3ZA 3W6MA 2OYMA 1XC6A 4PMDA 4AZGA 4BA0A 5A6BA 3BCDA 1E6NA 4CU7A 2WANA 3MMDA 1HP4A 4PUDA 2OLHA 1QHOA 3G6MA 4TVCA 2DGAA 5D9MA 1GCYA 1E9LA 4MTVA 4EANA 4DO5A 3GXTA 1HKKA 4B9YA 5JIWA 4X0NA 4PMRA 1CGVA 1AVAA 2VL4A 4MAZA 4JCMA 1QNOA 2DIJA 2G4FA 3W6LA 3WNOA 4BS0A 4M56A 1HKJA 4AZ6A 2DH2A 2CITA 4PN2A 4UFIA 1HXKA 4YHGA 1BYDA 1LLOA 1E73M 2VZSA 5AYIA 4PUEA 1FP9A 3HG5A 2ZUMA 3A23A 1HL8A 1UWRA 3FN9A 2YL6A 1V6WA 4AZCB 3L4VA 3DYPA 2JEPA 2XN1A 2EPLX 2YL9A 1LQ0A 8A3HA 3D4ZA 1GVIA 1Q4NX 3WEOA 2G3IA 4WJXA 3EMQA 2F18A 1EDGA 3I3DA 3QOKA 3AMCA 4LGXA 1H4PA 3WD2A 2VCBA 4ZXOA 3VX1A 2VR4A 4MJ4A 3SCVA 2YDSA 1FH9A 3ECQA 1L8NA 4B3KA 3WD4A 1GOWA 3PBGA 2PWDA 3A24A 1OWQA 4MDPA 3EDEA 2X0YA 3NYDA 1PBGA 2J7EA 4D6IA 1PZ2A 4H8UA 3VTRA 4GZEA 4UCFA 4UNIA 2DSZA 4QFUA 5CLWA 2VZUA 2J8GA 1LYQA 3AIWA 4UOZA 1DWAM 2GJRA 3BLBA 3L4YA 1JAEA 4AZ7A 1QPKA 1LWHA 1CGWA 1E0XA 4TTUA 3DX4A 3VGDA 5E6ZA 4AXNA 4GPNA 3K1DA 3WELA 2CERA 4CN1A 1G0CA 2DSUA 2XHYA 2CKSA 1Q6GA 4UOQA 1O7DC 2BXYA 1G1YA 5BXRA 2V3FA 5IDIA 3G6LA 2JE8A 3GXMA 1HJXA 3CHDA 1W2PA 3I3BA 1XRVA 2GK1A 4AIUA 1C91A 1ODZA 5F7UA 1JYWA 4P8UA 1LF1A 2EPMX 2BY3A 2X2JA 5E70A 5EFFA 3CHEA 5KZ6A 3DC0A 3MUAA 2QHAA 1R33A 1J0ZA 3BH4A 4GO9A 4A4AA 4E8CA 1M01A 1G94A 3ZM8A 3DDFA 1E3ZA 4AW4A 1LL4A 1CLVA 2QPUA 3FHAA 4RE4A 1CYGA 4TUFA 2IXUA 2YBTA 3W25A 2J7CA 3THDA 4JFUA 4KRUA 3VDHA 1US3A 1QI2A 1J12A 5HXMA 2UY2A 5I24A 2C0HA 4NF7A 5BXPA 3BAXA 2XVGA 1KBBA 1Q6FA 3SUVA 3VIJA 3DYMA 2WSPA 1RP8A 2J7BA 1W9PA 4HU8A 3NSNA 2E4TA 1BGAA 2UWFA 1D3CA 2X05A 3BGAA 3VILA 2Z1SA 1VENA 3WF4A 2XM2A 4AD1A 2F1BA 3W82A 4CN4A 1UWTA 1ISXA 1CTNA 4L4PA 1E6RA 3GXFA 3N12A 1DEDA 4JIEA 1ISVA 4AIOA 5AYBA 1NARA 3CGTA 3VSVA 1B3YA 2C9PA 2FGZA 1V3LA 1VAHA 3D4YA 3NIYA 3L2LA 3WNKA 3ZR6A 4FNTA 1WZMA 3B9EA 1UR8A 3HU7A 4MPKA 1Q6EA 2CHNA 1E55A 1XV8A 3VIMA 1P6WA 2VZTA 4FLSA 3W0KA 1QI5A 3HN3A 1UR4A 3WDPP 4CVWA 4AZCA 1XSIA 2ZICA 4ACZA 3F5KA 4R5EA 1UD5A 1JXKA 4P8WA 1NP2A 2WVSA 2J7GA 3K4AA 2BNJA 2EQDA 2X2YA 1ZJBA 4BCEA 3UG3A 2OMUA 2CCRA 2XFRA 3KEHA 3WFLA 3BC9A 2VR5A 3D3AA 1QWUA 3ZT5A 3H54A 3WD3A 1CGXA 1XYZA 4OBSA 1TQVA 2QLYA 1NOFA 4UFMA 3UG5A 3QR3A 1V02E 1XD1A
chains in the Genus database with same CATH superfamily
1K73D 2X70B 4PJGB 4X80H 3SE8L 3HZMA 3A35A 1EP2B 1ANUA 1EO8H 5CGYD 3OJDA 1R5WB 4LQ1A 4U1GC 1HH9B 3U1QA 5BSXA 1A3ZA 4QJ4B 1JZ5A 1OX5A 2NSMA 1NL0H 3ZDZF 1P5BA 4GVGA 4PRTA 5I7GA 4UTHA 1G9EA 3WDHA 4DXVA 4XAWL 3N9SA 2X89D 3CWHA 5CSZB 3U48A 1QVBA 3TXZA 2EVFA 1DP0A 3OLGA 3BVNA 2FMOA 5H8PA 3WS6C 3IF1A 1Q5MA 2JK5A 1H7NA 2LGNA 3BAWA 2WHLA 4AMCA 3QFGA 1MCJA 5F6HJ 1NH6A 5A5WA 4AX7A 2A3TA 2BSRB 4AY0A 1ME7A 1JPKA 2Y7GA 1DANT 1T0NB 2FH8A 1RBAA 3SCUA 1T7LA 3Q6QA 5DWPA 3DJRA 2JFEX 4JTEA 4N4PA 1JI2A 2XH7A 5J11B 4P2NA 4BQ6A 4CADB 4F33A 1RQBA 3X1FA 1AGCB 3GRWH 4DKDC 4NFDA 2VDOB 3TNNA 3BG3A 1DN2A 1OQFA 3T8XA 4MYAA 3PGCA 1O9VA 4X63A 2XVKA 1VA9A 4RZCA 4HEPG 3EWBX 3FU5A 2QMJA 4WI6A 2PMQA 5FA5A 4PJEA 1I18A 4M29A 2P10A 4MPQA 2CCWA 3NEOA 4I0CC 5GGQH 3LQZB 4UM8A 5C0CE 4S3DA 2D2GA 1BQHG 3KPRB 4LLAA 4OQ1A 4WI7A 2ISSA 3LV6A 3WO8A 4X05A 3TYZA 2ICWJ 2J6EA 3DI3B 3M1OA 1JHTA 3OAUL 1VQ8B 4JFZL 2HWGA 3PULA 4HZ8A 2FK9A 3O9WD 4RISL 3M86A 5EZJA 5AVZB 4FI4A 3BLKA 5L9FA 1PYWB 3G77A 1E27A 3AVWA 2NYKA 3CFQA 4HUWB 4JTHA 4PG2A 3CZGA 4AD2A 1KJVB 4OUUB 5DJ8B 3NK4A 5DK0A 2WC4A 3NCCB 4ADSA 4F40A 4DFHA 1WD9A 2AQNA 4TSBL 2APVA 1BMFA 3LH9A 2GJPA 3NCJH 3R4IA 2AI0H 3QRFM 4QISA 4TXVB 4CCEA 1QSVA 2QFRA 2R0ZL 1VP5A 3VFRB 3SSGA 2G8ZA 1I1CA 4GY7A 4Z18A 4FMKA 4NN7B 5IQ9A 4OJFL 2FX7L 3UJIL 2DUZA 4R4BA 4FP1A 1QFEA 2C9VA 4AZUA 1A4KB 4DN1A 1KACB 2CZFA 4YXLL 3WUFA 1FWNA 2IALA 2F7QA 4YOKA 1CICD 1TX2A 2GTWB 5AKTA 4LPVA 3HAEA 2FIQA 3GTIA 3S9DB 2X4TA 4ISVA 1RZ8B 1THFD 3N2JA 4KMQA 4XODA 1OWWA 1Z0NA 2WZ6A 2FT6A 2JQMA 2E8ZA 1IBGH 4MZIA 5FDYA 3V0WL 4O2FB 3IB4A 5HYSG 1VKFA 3NZ8A 4MDOA 4WEUD 3SDXA 4OE7A 4R3SB 5ICYA 1T21B 1F13A 1QA9A 3FB7A 2YWFA 1HH6B 2CO6B 4MA8L 1QPNA 5TRDA 2R82A 3PWVA 3MNDA 4J40A 4MJ6A 4Q58C 2MEJB 5KYYA 2YA1A 4ZQKA 5F3HB 5JXEC 4IRZL 1OD8A 4NUWA 1K6QL 3LHUA 4PGCA 3B0PA 5A6JA 3T2OA 1RULL 4FG0A 1MLCB 2AK4E 5I5MA 1JXGA 2I14A 1CGSH 3LD8C 3TTSA 2ATMA 4ADGA 2FR4A 1PMYA 2F6AA 3E9UA 4MJJA 2RDTA 5CMAA 4YDKL 5GJPA 4AZ5A 5JBEA 4GFXA 1CQXA 1WGVA 4DKFL 1Q9WA 2FQGA 2K45A 2A1WH 1V3HA 3K2KA 5DRNA 2AEPL 3FF7A 3PPCA 4XAGA 1F4AA 2H3XC 3QO1A 3QSYA 3ABRA 3UAJD 1K5NA 1NCOA 2GAZA 3INUL 3ME0A 4PLKC 3V52L 2BS9A 4JHZA 1EC9A 5IQ7L 2C4FU 2CLOA 2FJSA 3ARBC 3BP7A 2CLZB 3DX6B 4O15A 2XYLA 2CC0A 4D8LA 4PHZA 3ASWA 4Q4OA 1T1XB 1T1YA 3MFGB 4LNRB 1EQWA 1JE6A 3V0GA 4DERA 3RX9A 5J12B 3EG9A 5A89A 3UBXB 4BSVB 2I07A 4PJIF 3F62A 3RAJH 1V5JA 2A79A 3FSWA 5ELIA 5DDHB 4MGGA 3VI4B 2E7DA 3CC2B 5MEND 2NY6D 3QNXA 1HQRB 3FU3A 4LB8A 3X1EA 1G1CA 5JYLA 1TTQA 2HISA 2E74C 3TA3A 4M62L 3MUXA 3FNKA 2WHJA 2P5WB 3UTQB 2YGYA 1KC5H 1OSYA 4DF9A 4TO8A 3QFDB 1SJHA 1FNDA 1BQKA 3HB3C 3MV11 5HHQA 3CWNA 4EDWH 1PFOA 5J3HD 1VKXB 2LU7A 1SXAA 3QIBC 4QRUB 4YMPA 1JDDA 3MLXL 4HSQA 2P8BA 2HT3D 2WAQA 3GH7A 3OE7A 3T42A 4JY4B 5L88L 3DMMA 5E6IA 3C2AH 4NJJA 4F8XA 5FJOA 4KO6A 2B1OA 3IXTA 1T40A 3A4AA 1BPLA 4U1NA 4XAYA 2C3GA 4MZYA 3QT2A 5HVFB 4IGHA 3WQGA 3L5MA 3RF9A 2HV5A 3LYEA 2WJEA 4EUPG 3HC0B 1M7IB 2MJWA 2OU4A 4FNQA 3GR4A 2QJGA 4DVRL 2WNQA 3FIGA 3PGCB 3IJSA 3POCA 3NMEA 5K33A 4G6IA 3FCTB 3LEYL 4HIHA 3O6FD 4HOXA 1YYAA 1L6FA 3ZDYF 2X12A 4RFNC 2XTSA 3QUKA 1ELSA 3GD6A 1HJQA 4FFYA 3BP5A 4CC0A 4DGWC 2AERT 2F54A 1YPFA 1D6VH 4KWSA 5KYUB 1RZKL 2V81A 3ZO0A 2AZUA 2GY7B 1AZBA 2R1YB 4OFKA 2WPBA 3AXMA 3QUYC 4LSSL 5BRZD 1S7WB 1TG7A 3DJZA 1D6EB 4NO0D 3U9UA 4IK7A 4WV1A 3JYCA 2DLFL 4AQAB 1RVFL 2OMUB 3WIFA 1DXEA 4J5NA 4MD5B 2BP5M 2WBJC 2FHCA 3CFCH 2DMGA 5CWSA 3GMQB 4S0SD 4XVUC 3VTTA 1G7HA 1SMAA 3FSTA 4AQ8C 2MQGA 4OFYD 1BFOA 1XGUA 4C7GA 1YNTF 5E5MA 3IFLH 2P88A 3RWEB 2Z1WA 1SDDB 4XONA 3BOVA 4Z7OE 3QVQA 2ZNWA 2H0EA 4M6QA 3WQDA 3DUSB 4NXKA 1RIUL 3FONB 2OL3L 5JO5A 4HBKA 3LMJL 1L6GA 3MI2A 4XWUA 4V11A 1KJ2L 1OGAB 1B3OA 4RXFA 3CX5K 4JDEA 2O1AA 3P0VL 2Y8VA 2C5DC 3EZ8A 3O9WB 4G11A 3FUHA 4U1JB 4H1LA 5GS2D 3L9CA 5K59E 4JTQA 3BP6A 3BH8B 4UNUA 2QDHA 4I6VA 3TIMA 3GSIA 4TN1A 4GE8A 4Q2ZB 3APFA 4RE0A 4N2NA 1KLUB 2QQNH 4XLEA 3IJYB 4UT9A 3TNMB 3VO0A 3UEZA 3CQKA 3E9AA 4MZ3A 1MJ8L 1RSFA 1QNZL 3Q8FA 4R96A 3E0LA 5H94B 3GO1H 1QGAA 1DIEA 4CVUA 1TPWA 5BZWB 3CHCA 5CP3A 1E63A 4O0KA 1MEXL 4N8VA 1KXQA 7TAAA 1H1YA 2QGGA 1E9QA 4C4UA 1ID2A 2PPFA 5ES4B 2E9BA 3FPYA 2WM0A 5AY7A 1CUOA 3SY0B 3GU9A 2CK3A 3C60B 1XLMA 1MZHA 2ZZ3A 4G42B 5FAAA 4ALAH 2W63A 4GI8A 1UPMB 3CPXA 1KMHA 1AIZA 2B1AH 2IVFC 3QXDA 5F2FA 7PCYA 2AP2A 4UB9A 4N3NA 3ZE2B 1N2RB 3JQRA 2NVAA 4DEPB 4KWWA 1HL5A 1A8ZA 3UCQA 3QEGH 5F9WC 3CEPA 2NY6C 4JO3H 4L4JA 4PW9A 4A21A 3ILEA 4Z2GA 5DRNB 2BSLA 3I56B 1SY6A 1S7QB 1NUGA 4G9DA 4LEBA 5C7ZA 4QHUB 5JXQA 1A7OH 4O58L 4ELME 4C91A 2MCAA 3IRPX 2K4AA 4Q4KA 5J5DA 3CHQA 5DFAA 2VDRB 3EKCA 3TW6A 2N1KA 5FA6A 3FBQA 1VHEA 1ZM9A 4ADTA 4BI7A 2ZZEA 4IIQA 1R46A 1VHNA 2XRAH 4JQIA 3V9CA 3E8UL 3BJSA 4TMBA 4UTIA 3NP4A 3FF8A 3ZLHA 2ZZ6A 4PQXA 5IT2L 4NPKA 4ELMA 4C6LA 4DJFC 1JZ4A 3TCSA 3N19B 4UTWC 4GQNA 4F9LA 1UVQB 2G3ZA 1F73A 4DK1A 4FIRA 4YDKH 4GJ1A 1CXFA 3CVHA 5JXAL 4HKPA 2EZ0D 3QORD 2RHEA 3SSZA 1BM7A 1KTCA 3OWRA 1W1ZA 4HCIA 2FZMA 3ARDD 4YHPA 4PSRA 2YLLA 4HNOA 2JN9A 3F4NA 1OL0A 3LNNA 2WGXA 2X42A 4FRWA 2E5BA 4CCDA 1SOQA 1KFGA 4FULA 1BEYL 2X4RB 1JGLH 3UYPA 4YAOA 1AZZC 2O9RA 5CKSA 1DO6A 4BE5A 3NFNA 3EFOB 4GACA 2WLZA 1BPLB 1NM4A 2VUKA 3GGWB 1VB9A 3K6NA 3PAVA 2JJ1A 1K9MD 4MAYC 1I1AC 4UMGA 1TPXB 2A38A 4DUXA 1L9SA 3F5JA 2VGLM 4IOTA 4I5UA 1XLGA 1G9NH 3IPFA 4UQ9A 3SGDI 4MDRA 5JPNA 2B4GA 7REQB 1RZPA 4FFZH 3S97C 1K2DB 4LLVB 4L5FE 4QNEA 3QRLA 2ROXA 1K8IB 3I55B 1DFXA 2X4NA 4ZFOA 2F8QA 2Q6ZA 2ERJB 1KBKA 4JKPH 3UEQA 1KCSL 4G8GD 1FHGA 4RJLA 1RUSA 5BOJA 3KWWA 3V7AA 1RHFA 2Q8XA 3HJZA 5LHEA 2DVTA 2WQVA 1JNDA 3D52A 4XNAA 5CP7B 1P4CA 1V5VA 4P2QA 2AJYL 1JG9A 3TBSB 1PJ7A 4C6BA 5IBTH 5HDQH 1R7OA 3SE9L 2VDNB 3EF4A 5J35A 4MB3A 3VFSB 2RHGA 3SBWA 4WHTB 1WC7A 4ODHH 3U0TA 1AYRA 1FRBA 5FO9A 3O0FA 3D18B 4LBEA 3KVLA 3LZ5A 3CDCA 5D7SH 5HYSB 3KLKA 1P2CB 1F42A 1G7HB 4MMYB 3UZEA 3QQ9C 4ZUVB 3S2MA 2C1PA 4NNPH 2ZZFA 4MTMA 1M6OA 3WU1A 1R85A 3O6ML 2R1LA 4UTAA 2OEKA 4KQ3L 4P07A 3KHQA 1ZRUA 4ZL1A 3JZYA 5DQJA 2JV6A 1EJOH 2PTXA 4JX6A 1M1SA 4YAQB 2G0LA 3DETC 4GINA 3V0TA 4FQIL 1H6EA 2ZX8A 1TMLA 3DX0A 1MWOA 3O07A 1MWAA 2OMZA 3EBVA 3BFWA 3K6FA 3QAZC 2VURA 3TIDA 5C9ZA 4XKYA 1NCWH 2PCYA 4NYLA 1ASQA 4TVPD 4IOIB 5CN1A 5A2CA 2V5BA 2VC6A 2VI0A 3S4TA 1IAIM 3O63A 4N0UA 3DG3A 5HNUA 3GF8A 1H0IA 2PP0A 1JRHL 3MUZ1 1BM3L 1L9NA 1ZTXH 4FTDA 1ZSXA 4B15A 4RMRA 1QSED 3JBG7 3ESUF 4IIQC 2DQMA 3EOEA 3OU8A 4LMQE 3PZVA 1E71M 3I75A 2D2JA 4KFOA 4LF3A 4LY4A 1QEWB 5TDOA 3T0BA 5I16B 1XL6A 1EZ2A 2GIMA 3CAWA 2HNHA 2WXLA 1UWIA 2VRKA 4L05A 1EXGA 2Y8KA 5G4HC 1MUJA 1KGYE 6FABH 3ECVA 1D5IL 4YDZA 3LXCA 2WLKA 4M5SA 1LP9E 3WNDA 4TMVA 2EDNA 1IJFA 3NZPA 2SFPA 5D6DA 3ZC3A 5KZCB 2D69A 2QYGA 2CR0A 2OCJA 4JJ5A 4LNVA 1WQ5A 4XZ9A 4IOSA 1W8NA 1QRKA 1BW8A 2KLSA 4TRPL 3N17A 1PQZB 2HP4A 3HS0C 1J2WA 3GHTA 2CBTA 4WRHA 1NFAA 1EDQA 5JVLA 4UBDD 3W11D 3M0ZA 3E49A 3IK4A 3V0VB 2G96A 3PWPE 4HK0B 3ZBMA 2BG5A 2C71A 3C9NA 2BP3A 3VQ2C 1AH3A 4DJFD 4QPEA 4MQSB 12E8L 1C93A 4AH7A 4L29B 4PJ5D 1EBGA 4N3TA 4P4KA 1UIPA 1XAKA 3OX8B 5DJ2B 4N6FA 4Y7EA 1QLRA 1WYJA 3O3DA 2YCJA 4PC6A 3O05A 5DSCB 1I1AD 5I78A 1M2VB 4M2LA 1FBAA 3LUTA 4KTDL 3SDDC 4HAGA 2OMTA 2NY5C 1UGNA 3MCLH 4TLTA 4DF0A 5KW9A 1NCBL 1NSNL 1TMQA 2RDUA 3U4KA 3HG4A 2V17L 4K3JH 3B37A 3C2VA 3FB5A 4H13C 3R7MA 4D71A 5EEWA 2ZVRA 4I9AA 1GY1A 1ZPUA 1YJNB 1DDTA 3HBPA 4LGPB 4PMEA 2HRHA 4JCWA 4JG9A 1D5ZA 3E3QC 4JM2D 5E95B 5LDSA 1R3IH 1V3KA 4JFQA 1WOAA 3W7DA 3S6DA 1ZHBB 5HDLA 4OWGA 1ZT1B 4TMZA 4R2GD 1J93A 4RPPA 4XHQA 4D8PA 4AQ8A 4QLWA 2CIKA 2A83A 3MJ9H 3WYRA 5F71A 2ITCA 2FEEL 4FHJA 4NRYA 2Y70A 2NNXA 1YN6B 4XNXH 4NJGA 1ILUA 3FK3A 1ORSA 3BJFA 3GS4A 2DEUA 5H5JA 4NP4L 1JFQH 5EWIL 1AMKA 5GSRA 2VR8A 3LI0A 2EIDA 1WBJA 1ZCOA 5BVJB 1UD8A 3OAZH 5L8KB 2D73A 1IGTB 4MHHG 5E08L 2PI6A 4PS8A 5G55A 2ADGB 1H63A 3G04A 3MCG1 3AWEA 1EC8A 3C5JA 1BFVH 1B0GA 4NQ1A 1UJ3B 3SI9A 3QHZH 4NIKB 4R2GB 5LA0A 2J7LA 4AEEA 4IP5A 5FDWB 2Y2TA 3STEA 5IKCA 1VFOA 5I1DA 3WLBA 1IIKA 2VNCA 2ZKHH 1DBJH 3CHOA 1GVSA 3UY8A 3U4AA 4HTBA 1UFGA 4AEIH 3D34A 1HEZB 1NMAL 3RUGF 1IQDB 3Q2WA 3TEZA 2CZ5A 1IFGA 5TQ2H 1TVPA 3EGXB 3NQDA 5EBMA 4IJRA 1K8DB 3JV6B 4BI5A 2G9HA 4LARL 2CM6A 4XM3A 1QP1A 1UB5B 4MCZA 4NO5A 5IQLA 2MTPA 1KQYA 1L6ZA 1N8ZB 4JQ2A 2DQ6A 4C1NA 4FIQA 1SEBA 2GBUA 4HS8H 1GS7A 3GWJA 2FWSA 4YHNB 1LEIA 1RU9L 2WSKA 3GHBH 4J3VA 4ZODA 3WFHA 4W6YB 3Q65A 4L1GA 3QJUB 3R8HA 5AHMA 3T3PE 4OQVA 1PTDA 3DTDA 3ASPA 4S11A 3GXUB 1T83A 1NOWA 2EE6A 4GQQA 1SHSA 4BKTC 4JDVA 2D2OA 5AW2B 2V9DA 2X0HA 3N29A 4BBWA 4S3CA 1FAIL 3WNNA 4LBSA 4NYLB 1A7QH 4JTUA 2PCPB 3V4VA 3LKRB 4IKJA 1CLCA 4IM8A 4G56A 1BSIA 4AWTA 2YPVH 4AT6B 2BVTA 1Z9SB 3MBWB 3BSGA 1QATA 2OMNA 4LSDA 1F3DH 2BNQB 1WHOA 4HJ1A 4Z7VF 4L4TA 1N4XL 1FNAA 3VWKC 4I77L 5DBUA 3OKMB 3V76A 2B14A 4N9GA 3QFRA 2PWEA 1T22A 3LN3A 4G8AC 1OW0A 2B9AA 5EZLA 2CUIA 4IBWA 3L3JA 3KVPA 4F7MA 3HW7A 1HHGB 3LHTA 3AW5A 2E5DA 4JPGA 2CO3A 3RITA 2BB0A 3QIUD 1NCWL 1NLBL 1U21A 4LSVL 4AWJC 5EMNA 5BMFL 3LTVA 1XUZA 3QMTA 4XVUD 5TPWH 1BRLB 4YCOA 2E75C 5IJVB 3MJYA 3OMAB 5D7HA 4KPHL 4FNLH 4PY8J 4M1DH 1S9VA 4YSTA 1CXHA 3HVDA 4XMKL 2XGZA 4IRJD 3C3NA 1EO5A 1U5VA 3UAEA 1E9PA 3VM7A 1CXEA 1G6RL 2Y2YA 3QSTA 4KHXH 1SHMA 1MFBL 1CGUA 3E3HA 4GAYB 1EZVX 1ZVYA 1R3YA 3HQ1A 3QV6A 2WB5A 1USZA 4RWYL 2P80A 1EPVA 2EHHA 3AG2B 4OSUH 4YS1A 3FU0A 4MJHA 4MHBA 5CSZA 4J5VA 5C0NC 3PJTA 5HQLA 4GW4A 3HR6A 2J6EH 4E4FA 1OHQA 3MNZA 1HKVA 3VXRD 3AREA 2X4SA 1L7IL 4KKAC 2X53A 1CURA 1OCNA 3HGJA 1ED3A 1M71A 4GH3A 3WL0A 1ADQL 4FOKA 2AQPA 4FTVE 4A2FA 3OJWA 1KOAA 1VDGA 3HKZA 4KC3B 1FCQA 5CPLA 2QVIA 1KCUL 4WWKB 1VCBC 1U5JA 5AZ0A 5EFIA 2EADA 1H0DB 4ZFFA 1RULH 2OM5A 3ELQA 3SBQA 3L9BA 1EYWA 5KW9H 2N7AA 3OGCA 1S9KC 1BKHA 4YXKL 4PRHA 4ZOEA 1ZAGA 5DS1A 2PR4H 2PXYB 2VLKD 3QWNA 5M95B 1K1DA 4FA3A 4GO8A 1WDQA 4YK4B 2UX7A 5D70H 5J3HC 1OWRM 3HOJA 1MABA 5IMKA 4GC4A 5DVNA 5CJQL 3AVXA 5DUMH 2V17H 2PWHA 3U7BA 1T6XA 2O6CA 2OMXA 1KIPB 1XDLA 2IANE 1MHHA 1H42A 3MROB 2R29A 3MJ9A 4KJPC 2VW4A 2XWDA 4BDVA 4Q3MA 4V1XA 1CDIA 2OR8A 3FOMB 4ICWA 4LRNL 5FYJE 3U2SA 5AENA 5KBDA 3L7RA 3WQEA 3VKCA 2LV4A 1TV3A 1IAIH 1I7UB 4NWUL 3TCTA 4AGQA 2HTKC 1G0DA 3W11C 1NJJA 1UCTA 3MJ7A 4XO4A 2XINA 3ALFA 2O92A 3SJVD 4QVJA 5FV1L 1NCDH 4IBUA 2EDJA 3MJGX 4HWZA 4IS6B 3QDJD 3G5XA 1INDH 1FL5A 4OM1H 2QV4A 2EH8L 1QI3A 3F6LA 3JUYA 4L9LC 4M5TA 4ZO7A 3SO3B 4DQKA 3ATBA 3D46A 3E2VA 4LCCA 1P7BA 2Y23A 2YEVB 3ETSA 5FYKH 2IPTL 2OTLB 3LN5B 2HZHA 5LB1A 4BK8A 1H7PA 2F2KA 4ZV4A 2ZUXA 1P7QB 2CU9A 3CLFL 4PTVA 2F7RA 1C29A 4X99B 1YMME 3ARDB 1AG1O 1LOSA 1SF5A 4XX5A 3TYFA 2YZRA 1N7ML 3P30H 2PDUA 2WKLA 1FDRA 2Y88A 3D3FA 2WUCH 1OAYH 2JB6A 2OK0L 1YECL 1NBZA 3QY7A 3K2GA 1S2TA 2IADA 3HBGA 5F88B 1UZDA 2D7NA 3FFCD 4MBOA 4X80L 1QFUH 3D5OF 2WNNA 5JBFA 4C5ZA 4MKSA 1KCKA 2NNRA 3PIQB 1DJSA 4DPCX 5CBAA 2PU0A 5HVGB 5H35B 3W7GA 3MCKA 3CZFA 4V2XA 2C1HA 3IMSA 1L9WA 5LUMA 3AU1B 3ELAT 4NPYB 4PJDE 2YW4A 1TQTA 1BWVA 3HUJF 4LGSB 3KL0A 3O2DH 3ALXA 3MQIA 1OABA 3K6IA 3BIAX 5DXWA 1JPTL 5FM4A 3BJTA 2ZKHL 4P57B 4QTIH 3EXJA 4LLYA 5BO1L 5IFJA 3V5HB 3HFTA 1NDGB 1EA0A 3SKOB 4PMQA 3NZUA 2F4NA 3QI9A 2V68A 2YWYA 3FTXA 3VNYA 1IHIA 3EX3A 2HVKA 3TIEB 3ZKXC 1PXGA 4KAQL 3N50A 4NZUL 5GGRA 1S5VA 2V2HA 3WQ6A 2OK7A 1XEDA 5I06A 5EORL 5D32A 5E23A 2V9UA 2YC1A 3K4WA 4O8AA 1MEXH 4PMYA 3MV8B 2P76A 3FSUA 1RL1A 1KYOJ 2LU4A 1J2BA 3IXAB 3STLB 3M0IA 3PZGA 4XZMX 1LL6A 1VEOA 3AHZA 4PWEA 3DXIA 1BWMA 4PBDA 4NHUA 2XU9A 2QEXB 2IKIA 4R4FH 1F6KA 3B9KD 1D2PA 1HXJA 1NPUA 2AQ2A 4TMXA 3UY7A 3N1GC 4KKNA 4WFGD 3S2AA 3KM8A 2YQGA 1DORA 1IIGA 2BY2A 4C56E 3VK5A 2YD5A 4KCTA 1AZCA 3WTTA 1GSMA 4TUFA 1Z5YD 2RGSA 4O2FA 1WXZA 1MXDA 4JO4H 3VW3L 3GW0A 2CA4A 3SDXB 3BAJA 4B7IA 3URNA 3EBAA 4HGKC 4FA7B 1JBJA 2EXTA 1UCBH 2NW3A 1TZOA 2QUVA 2V5JA 3QGAC 2EKJA 4L6OA 4RZBA 2AEIT 4KXZH 1W9UA 4AI7A 1JZ3A 5CAKA 1J8SA 4NCDA 3I85A 2JLPA 1VF8A 3GO2A 3DGCR 4ODTH 4ZYKB 5CPSA 4C57C 1HYRC 2CG9X 3CFNA 4E0RB 4RDZA 5D8ZA 3T3ME 3GB6A 2COQA 2VTFA 4XT1C 5ESQB 3BVWA 4XN1A 5KBNC 3NABL 3Q2NA 3VNUA 2H26B 5FO7B 1N7KA 3GNOA 1JF1B 4F7PB 3S3GA 1F60A 3D0LA 2FATL 4ZDHA 5DHEA 4ABQA 2DLHA 2PDNA 3I7SA 3VCNA 5FGBC 4BJLA 3WFEL 4XAZA 2WCSA 1ODUA 3QR0A 1WIPA 3MRHA 1TJIL 4OLWH 1WSRA 2HX9A 1IGIH 4U6XB 4XN4A 3OKDA 1POKA 3U4FA 4YXHL 4TTGA 1DE5A 3KBSA 5T5FH 4P5MA 3QN3A 4K7PH 1OGTA 1VFLA 1FKXA 2HAZA 3BO8A 4H7ZA 4OKVB 4NUJA 1BFSA 4OUOA 2L8AA 1OVZA 4MXWH 3CQQA 5HYFA 4WUUB 5H8UA 3VIOA 2APXA 3TN0D 3ATYA 2QSTA 1XFBA 2V7NB 3HS0B 1PB0A 1XO8A 4WSHA 5JHMA 1I9IH 4HISA 1KB5L 2IAMC 4G8FA 4CVZB 5KVFE 2FQIA 1OE2A 2E1WA 2OK8A 3ALWA 3QUGA 3DX6A 4NO3B 4S0TD 1HL4A 3ITTA 2Z8VC 3O15A 1HKMA 5CHNA 3QV8A 1DIOA 1DWGM 4ZMPA 3UD6A 4YFLI 3XINA 1TA3B 4DKAA 4JY6A 4CEUC 4PC2A 1P4UA 2Q86B 3N3TA 3GG1A 4YHEA 2GTZB 4B16A 4II2A 2Y6SC 4GAJL 1A4JB 5I6LA 5GV7A 2I07B 2JI3A 3KLHC 1H60A 5T5NF 2OT1A 4XTIA 4K9JA 5KYWA 3EW3B 4O5LH 4PVNA 4HT1H 4EPEC 1L2UA 3CZ8A 4HWEH 4U1LA 2WO4A 4WUIA 1ZLDA 5IVNA 3S5YA 3STGA 3BP6B 1TMCB 3QNZB 4GAGL 4MNHA 4UV7H 1QMLA 3A9BA 3O3BB 2R4RL 1R2RA 1DUZA 4URKA 1SOXA 4JFDD 4RDWA 5HHPB 1Z42A 4OBTA 3S88H 3H6JA 4JG5A 4AEIL 4B27A 3OBAA 1W1YA 5ACLA 3IVTA 1GHSA 3IJSB 3CFCL 5BVPL 1A02N 3PQYD 3WBYA 3TJLA 1KXVC 3SDCB 1QR1A 1NM9A 1BDYA 4ZS6D 3AXHA 4AXWB 4EN3B 1N0UA 3SZ8A 1EHAA 2HSIA 3CUPA 4PJHA 4QHPA 5DR5L 1SFJA 2F54B 4NENA 5EIQA 1S7UA 2IDFA 5T3ZH 3B0VC 4YHYB 4MAVA 2J57A 5AHEA 4HIXL 2QCFA 4KHTH 4OZHE 3P6LA 2XNDA 5E0CA 3B4UA 1HSBB 5HATA 2ZBTA 3REQA 4O02B 2A73B 1E0VA 1FHUA 2CIIA 3ALGA 4HKBB 4KVPA 3ZPNA 2XBZA 4Y4FC 4XMUA 4ELKA 4X7SH 4M8UA 4F37F 2VGIA 3KPNA 4RAVA 4PJIB 1DWFM 2NUWA 4RSYA 3QZNA 5DEGA 4IM4A 4K8RD 1G87A 4Q9QL 4D9LH 1US0A 1YADA 3HHRB 5GIRA 3V0WH 1K4CB 2AK4D 3L81A 4J6RL 1H7XA 2OMWB 2OULB 5IV2A 4Z4ZA 2J43A 2F19H 2QGCA 5GGRY 3SUWA 4FQQB 4PWKA 1T1WB 5IEHB 3EO1A 4D6HA 5CKAA 1WS7A 4JDZB 4LV4A 2YMXL 2A3HA 2QR0B 2C9XA 2D9RA 5I07A 1TETH 1O5KA 3G71B 1AACA 3JZUA 5CKGA 3KTXA 1L2QA 5BZWA 4IJBA 1ZSDB 3ZHDA 3QAZB 3BKML 5TR9A 2C9AA 3BPCB 3UP6A 4TOYH 3I65A 1KK3A 1RQ5A 1EDHA 3QDGB 1UWSA 1F1AA 3VNMA 4AWUA 2VWEC 1T80A 2J8UA 3A21A 2V63A 5IHSA 4N2AA 4EBQL 4G42A 3BURA 4N7QA 2NY4C 1OKEA 5C0GB 2BS71 5AYUH 5JA9A 1FOBA 2J8FA 1TTGA 4E9RA 5KWYC 2BBFA 3N15A 2BO0A 2PW2A 7PAZA 2P52A 4P2AA 4L8CB 2CZNA 5T1MB 1SQ7A 2XUCA 3DH7A 3FFDB 3VXRB 3MU7A 2OTWA 3NFNB 4R7DB 3DX7B 1Q6RA 4FOMA 5K1VA 4D0CA 2LLNA 4XPAL 2OELA 2VFIA 3ANUA 5BJTB 3O06A 4B96A 4M93C 2J8UE 4EXPX 1JYXA 5HKKA 1TO3A 1XCFA 3TJXA 3LY6A 1H5BB 5DJXB 4WWPA 3SJVA 2HQAA 4O4WA 2GJXA 1JVKA 4GYPA 4IIDA 3TZNA 4YSDA 2ATKA 4JHAL 2WP3T 1HEJC 1ZWIB 3QHTC 4WDIB 4HJ0C 1IAMA 1ESOA 1HINH 4LUYA 1LEGA 1O4UA 4FWTA 5T5FL 4IRJB 2I27N 4OTKA 1GGBH 1DBKH 3DECA 3I84A 1KBWA 4TSCL 4F8LA 1GZ1A 4YC2B 5ICZA 2BMBA 4EAYA 3IJQA 4O52A 4U1IB 3KLLA 3LCLA 1PNCA 4AQOA 4HNNA 1QKZL 3B9KA 1PIGA 2ZJSH 3QYCA 5EPMA 4QRBA 3V0DA 3PAUA 4HXAH 8FABB 4HV8A 1DJXA 5ALBL 4E9WA 4KH2A 3EKLA 1FVDB 4JTDA 3TH6A 3UP8A 3W29A 5A43C 1CL7L 4I13B 1H7WA 1OIMA 3H4WA 4LOVA 1UR2A 4Z78B 2DJ4A 3BJLA 5LNDA 1RJYB 1RP9A 1JCYA 3R5EA 3S46A 4CQBA 4XP9H 3CVHB 1OFPA 5HHOD 5CBEA 4A1RA 5IGXH 3V55A 3GIZL 2WMIB 4KOCA 2V5DA 4LRIA 2HKAA 2CU0A 3F00A 1P9MA 3OTRA 2MQCA 5ABHA 1SY6L 2GTZA 3A3HA 3QE5A 2BLFA 1MRFL 1NDVA 2ZXCA 3DX8B 4HC1A 2VMCA 2AEPH 4Y9CA 2ABBA 3LQGA 4XSLA 4GAAA 4N1CA 2QPXA 1A4MA 5CSUA 3CHXA 5LXEA 3CCLB 4N86A 4I1NB 2A1YA 3CU7A 3DHJA 4J3UA 3A8IA 2YGNA 3TIDB 3V9FA 1HGYA 1H3PL 2QZRA 1XISA 2B0SH 1SN2A 2PUQT 4FHKA 4X6DF 1I7ZA 1RJRA 1X5FA 4FQ1L 1OD0A 4ECLA 5JUVA 4KH9A 4JRYB 5A6MA 3G08B 2OEMA 4Q6XA 1FHDA 1B4JL 4JZOB 3X11A 1J8HA 2PCFA 3NIGE 5C2UB 4TUKL 1BGXH 5TQ0H 4J3OF 4CNSA 3FFCA 4EF8A 3TJHC 4LY8A 1DEEB 1FL6A 1KN4L 1UOLA 4KKQA 5DU7A 4D94A 4AQ1A 3VI2A 2PE4A 5HAOA 3ZIAA 4TUOA 2VZOA 1M42A 2WBJB 3STBA 1UMYA 3QYSA 1WKFA 2FWOA 5I6MA 3BDXA 3MBXL 2Z1VA 1RD6A 5GXBB 3IDYC 4HCLA 1HG3A 4XV0A 1NDYA 3TCXA 3B7SA 2GK6A 1PJWA 4ZTPL 4M53A 4AITA 1Q94A 4E2BA 4IKIA 4U1MB 2EEDA 2YAHA 3DX1A 3FRPA 1S5NA 3KUMA 4TMCA 3KHJA 1CTOA 1P2CA 3B2UC 4MMYA 5KJ4A 3ABSA 3DG7A 4L4LA 1VS1A 3G1DA 4Z7WF 2QR6A 2OI9C 3DJSA 1T41A 2Q5BA 3KBMA 1O95A 4PJXF 1H3VA 3IN0A 3P40A 4DPPA 2WMFA 3NURA 4EVZA 1T0MA 3MBXH 1HKWA 1XR2A 3ULUE 4WHTA 4D3CH 3UWUA 1REIA 4XX1E 5IV2B 3SFKA 2OI9B 2XN0A 3NA4A 3RFAA 2W9DH 1WGOA 1NFDE 4PTTA 2QGHA 4TSBH 3BDYL 1CFNB 2Z7UA 4UZEA 5SWZA 2O4MA 1ZTMA 3SO7A 2EDEA 1Z7JA 1K77A 1TPFA 2EACA 3M0XA 2PXYD 3IGHX 1JQXA 3CSFA 4RGND 3LZFH 2K70A 4TL5A 1WAAF 5DJZB 2GWGA 3O7UA 2ZQKA 4NRRA 1P6CA 5CLZA 4QF1B 6TAAA 1ME9A 4XKYB 2GPZA 3FU7B 3G6DL 2NY0D 4NT0A 5FEWA 2V3EA 1Q72L 1RFDL 2W80C 3NSFA 4ZW3A 1WUFA 1SFHA 3WH9A 2J6EL 3MJ8A 3E0IA 3C5SA 1GVFA 4U3AA 3ISRA 5JQ9A 2I9LA 2ARJB 3ABZA 3T8VA 2VR6A 2KT6A 4RSVA 3IGLA 4KROB 4L9XA 4RWYH 4WX2A 3VXRA 3K4ZA 1KJMB 1P9MC 4U7KA 2A4ZA 4LLUB 4D0CB 5CM1A 4LOFA 3W7CA 1XCTB 1IIHA 2MH4A 3L6FB 4ODUB 4CKVX 2OAAA 3EXSA 4DT2A 1DVJA 1ADWA 2B1AL 4O28A 1Y7VA 5H37H 5C08A 1GC1L 1U8KB 1MLBA 2ATKB 2G5RA 4KK6C 1PO9A 3II3A 4PRDB 1IUZA 3I1FA 1ZVNA 4GKZB 3TBTA 4C83A 4JTGA 4O8RA 3HPJA 3W2LA 1QOKA 4AHQA 1IC1A 4B41A 1TITA 4IRJA 3MREB 3T1FA 3UP1A 3H2AA 5GJSL 5A16B 1XYAA 1C5BL 3K7UA 2X41A 3HLKA 1FZKB 3FQYA 4TUJB 5EEUA 3PJNA 3BXNB 4TMTA 2ODHA 1XZ0B 3IBOA 4U0RC 5IFHH 4R4ND 3K0YA 4HGWA 1P0KA 2V67A 4N2OA 1TFHA 5DHXB 2DZSA 1OIOA 3FDWA 3M41A 4LCIH 4O1CA 2XIIA 4V1DB 3BKYH 2BM1A 1J0IA 4GW1B 1VGAA 5BV7L 4H26B 4HWBH 2OMTB 5EUOE 3UIYA 5L0QB 1YI2B 4HK0A 4TLKA 5IBUG 2HLAA 4P2OA 2ZL7A 2WV8A 4L4TD 5AVRB 3T3PF 2G2RA 1ZP3A 5DUJA 1NCBH 1NSNH 5G5DB 5T1LB 4JM2B 5ESAB 4XP4H 1W3IA 4P4KB 4FX6M 5CUSL 4X7DA 1A7BA 2VNIA 1JV2B 1QLRB 1RZJC 4M7ZC 3PSVA 4KTDH 2BNQE 1AR1B 2WV3A 4IOFD 3OVQA 1HKLH 1S7RA 1UWYA 4YHML 5DZNA 3VNJA 4CD6A 1AIPA 1DJWA 3GNNA 2NQCA 3LBOA 1XMWA 4JHWL 1R1CA 1CLYH 3OJGA 4O53A 4Z7VE 1M05A 1SO5A 2BHZA 1UM5H 3D85A 2WPGA 5FYLE 1EFXD 3B2DC 3OODA 4YELA 3WI9A 3IDNB 5FEXA 5HHOB 3GU1A 1CJYA 4JTFA 3QRGL 1TPC1 3NEXA 3QPQD 1Z9NA 3I02A 1XLFA 1RUMH 5EULV 1OB2A 2QMUA 2ZXQA 1O5XA 2VOMA 3P2TA 3WG7B 3QJTB 3SKNA 1XINA 3RX5A 2GGIA 3GY1A 4EIVA 3W4RA 4LNYA 2JKLA 3H24A 2DQDH 3SE3C 1ACYL 4FXTA 5B21A 5HI3C 1CNVA 2VXUL 2CPCA 1HHGA 2DMCA 1BHGA 1U93A 7A3HA 2QIIA 3S37X 5C08D 1OG6A 5DTFA 4A7SA 3QSKB 4OZ4A 3VWJA 3EEZA 4HJEA 5FKPB 1RZIB 3SCOA 3S36H 4A6YL 1K8AD 2CRVA 5I2IA 3WHXB 4YDJB 2YCIX 2JXMA 3NSJA 3L9RA 1NJ9A 5BS0D 2GOKA 1WA0X 2GSGA 4JUSA 1WTLA 4I87A 2GSIA 3V8CA 1QSEA 3WQZA 3LCXA 2GVGA 1HJWA 4MJIE 1ZHKA 4NP9A 1G7JA 2WLYA 5CGBA 3FLUA 2J71A 5FIPA 3C2AL 4QE1A 3QI9C 1COWA 3WLBB 4P3CL 5AOZA 5DT1H 2O9TA 4HPNA 5J8LA 1Q7ZA 3MO4A 4O1DA 2AMUA 5GGVH 2YUVA 1U9KA 4NAFA 1KC7A 1MNZA 4HHWA 4LAJH 4I0PD 1OAUH 1YNKH 3NIDB 5IMLB 5DGQA 1HSAA 3E5PA 4M62H 4TQIA 4QLJA 2WW8A 1MI5B 2AZAA 5E00A 1BXBA 4PS3A 5DS8B 5EV7A 4FXJA 1WWCA 3GB7A 1N8ZA 1MW3A 3GDMA 1J5DA 1IAKB 1AYOA 1DQJA 2BP8B 5EOTB 1FG9C 1BX2B 3CPLB 1DLHA 5J11C 1KR1A 1C7TA 1LNUB 1M53A 3S37L 2EUZA 1H8LA 3T0EB 3WBWA 2AK1H 4DWSC 3QEHA 1XIHA 1MI5D 3NFSL 3LB0A 4HUUB 3DI2B 3V6BR 4I3RL 4PGBA 2MCPH 1MCEA 4DQAA 5I18H 1UZ4A 1NTHA 1MRDL 2FCBA 2WZEA 4LVGA 4PYGA 3NQVA 5I3JA 1ZLPA 4BKNA 3R0NA 4V1DD 3EO0A 5EN2A 3CTTA 4E2OA 1MRCH 3SBPA 4KKBC 4XPBH 1Q6CA 4FR1A 5J57B 3QIBA 4GX8A 1FA4A 5T33L 1E7UA 4G8GA 2DPKA 5C0AE 1E50A 3VU1A 1A6PA 4RFOH 4PR5A 1E4LA 4QG6A 3PHOA 2XZCL 3MI6A 1J9YA 1OGGA 2G30A 3LZFL 4JFXA 4JO1H 1R3LB 4NJAL 4N2YA 4OFCA 2OBTA 3C8FA 3EPMA 2JF1A 4AAJA 5H37A 1EJVC 4KZCA 2HTLC 5D7LB 4W9HC 1EOMA 4G6KH 3ZT7A 2OODA 2IH1B 2YD2A 4JFFE 5IWLA 4WCJA 2XSXA 4R27A 4YNGA 5CZJA 4JFFB 4W9JC 2VXNA 2PIAA 4FXGC 3VRLF 3W76A 3GDKA 1T7ZA 5C9WA 1U83A 3MREA 4K3JL 1X39A 1E2VA 4LCCB 1TJMA 4PP2B 4KKXA 1QSFA 3U2ZA 1JEZA 3AZTA 5E8NB 4EH1A 1QKZH 2PUZA 1GL4B 3WUWA 1E5JA 1NPJA 4JN6A 3ARDA 4Y5YC 9PCYA 2R2HA 3U46A 5L9DH 2IAMB 4X9YA 1XRSA 1QMUA 5BCAA 2AV7A 3GSNL 5ANHA 4JX0A 3OG4B 2G97A 1A6AA 2WLIA 2Q6WB 4F57L 1AGEB 1MF2H 1QSFE 1SO3A 2OV0A 2QJDA 3NABH 1JNLL 4HJFA 1K9DA 1TYGA 4LBYA 1SM3H 1AO7E 2FQFA 3SDYH 1XDJA 3W75A 4N2FA 4DCQB 3HBQA 1BSLA 5K9KB 5TY0A 1KIPA 3LV3B 4WNJA 2EEFA 5DSZA 2PDHA 2DMHA 1O94A 4R9XA 2EDOA 3QORB 3PB2A 3IGKA 3Q3GB 4PJ8C 2VC9A 3WY3A 1ZHLA 2YQ2A 3X14A 1GOKA 4U1GB 3OGCB 1AANA 3H4HA 5DXXA 5TH2A 1GTEA 2AVGA 2COVD 2GFBB 5IFJB 3E02A 5T3ZD 5I8KH 1TPB1 3A4WA 4L3FA 2VJ0A 3TA3C 4FYQA 4L8JA 5GGRB 1SM3L 4K5LA 3W2DL 2OMXB 1O1ZA 2ZOLA 3P3YA 3CUIA 4HB7A 3P0YL 4L3EB 2GJZA 1HHKA 3ARUA 3L2NA 4HS6A 5DMGC 1NFGA 1RH9A 2DSWA 5LBSA 4GXFA 2FPVA 2Y3AA 1FN4B 5A2KH 2QSCH 2VNKA 4DJDA 4GUOA 2VKWA 4D8OA 2B16A 1PDKA 1K72A 3VRLE 4QS5A 1KCSH 2PW1B 4GRWE 5DS2A 5CNHA 3B2PA 1DWHM 4HUCA 1GAFL 3NCXA 4IL2A 3WEXA 3TN3A 5A69A 4ZTPH 1EMTH 1FWGC 1M03A 2DVXA 4HKXA 4M6ML 1YXDA 4GD0A 3V5CA 3W71A 1GQKA 1OO2A 2P5NA 4H2AA 4APQB 4PB9H 5I1AA 6PAZA 1T89C 4GEIA 4LVFA 4GLRH 3PZUA 4Y19A 2R0KH 1AS8A 2VLJD 2VW7A 4UTBH 5FA4A 4AIEA 5ECGA 1AR2A 1KN4H 3LRMA 4M7LH 4P8QA 3IFOB 1KSRA 4X7SL 5CC3A 3O3UN 2P7TB 1O7VA 4X98B 1TV2A 1YBQA 4C6MA 1TR7A 4NNPL 5B6IA 3I6LD 1IZJA 4TKWA 4KZDL 3IU3B 1W3HA 1A22B 2QSCL 4RGOL 3GR7A 4L4TE 3VO1A 3WUEA 5E0QA 3QQ4B 5EMYA 5C0IB 4DB7A 4ZS7H 2ZBVA 1VZHA 3NQ8A 4E4UA 1AFVH 3GB7B 2VSKB 2EDYA 5DI8B 3SCMA 3N4FA 4MAUL 3REWA 4NZJA 4IG2A 4U2ZA 2OSXA 1EWYA 1F7BA 3K0WA 1QTPA 4LKCA 2J78A 3ULVD 2BVNA 3MLZL 2MCPL 2P8PB 3W07A 5FA3A 2A0LC 4IKLA 5AC4A 4Z1YA 1NEUA 4NO0A 5I6PA 3H2OA 4MCMA 1V3MA 1QNPA 4XN8A 3M7OA 3D87B 1CD1B 2XTJD 4DUVA 3AWFA 3W9ZA 3WLPA 1P7KA 4KIEA 1V0NA 3PV6A 1TUPA 1HOCB 2ARWA 4LLDA 3RFZC 1RA5A 1G9HA 2RGLA 3ZTDC 1Z6KA 4GVHA 4UMAA 5D04C 2TSAA 2X8KA 2X4OA 3QG7H 4HCRH 1U3HB 2DM7A 3V7AG 4NNXB 1PYFA 3FH7A 3KXFB 3B97A 5MKGA 3MFFB 4H1LH 3ZHKA 4Y2DB 3W87A 1OF2A 3LIZH 3HZMB 4NO3A 3BVXA 1IC4L 2VFEA 4AHPA 1W3KA 4KEVA 3TNBA 1A4LA 2V3GA 2YMXH 5F9OL 1RUQL 1U3YA 3KVDD 3AYRA 3W7JA 4Z7OB 5LQBL 3ILPA 1OK0A 1FO0B 1XLBA 1GG0A 4CQAA 3FQ4A 1A4JA 1FVCA 2G60L 3PFMA 3WO4B 2BVQA 1QVFB 2NY1B 3KPMB 4LOUD 1KXHA 4NKIL 4PRNB 5TDNB 4XBKA 1S8DA 1T2JA 4GI6A 4PRHE 4WTZA 1SHWA 3FYYA 4MWAE 3KP1A 3C6LA 1XLDA 4NKIH 3CT2A 2RMNA 4DZAA 3OMIB 2IPUK 3CFDB 3GSWA 4NX0A 3AB0C 3TA3D 2LFEA 1CLXA 1E42A 2XRAL 4KV5F 1T6MA 5KSAD 5LNWA 1MFMA 4Q6IC 2BOEX 3W24A 4YVUA 3ARFD 3LS4L 5HNTA 3MMEB 3FL7A 1EBHA 2PGWA 2EIMB 3QO0B 1OGTB 1VGEH 3LS5H 2FATH 3QZWG 4G70B 4JN1H 2HPIA 2BDNH 3IAPA 1KCLA 3LLFA 4YEFA 4W7UA 1QGZA 2X88A 2ICWA 3RIFF 3CQFA 5EMLA 2AAAA 3CN3A 1NMCB 2WQPA 1WEJH 2G2NA 5J6GB 5AYZA 3EPOA 3VDCA 5EZJB 3M8OH 3LO8A 4FFZA 4U6XA 4B0MM 3DARA 2BZDA 4WWKC 3VTMA 3Q39A 4D0BA 1UQSB 3CL8A 3CQIA 4EI5C 1XF4A 5L9DL 3S42A 3WBXA 1NC2D 2DDQH 4JQIH 4P5MB 4LEXL 5DQ9A 5HI4C 5CGTA 3PG8A 4EXKA 4UUIA 3QV9A 2P49B 2JWYA 2WWDA 5FUOH 2DT1A 1FDJA 1UR0A 1IC7H 1JV5B 3H9SD 3X3GH 4F24A 3VFTA 1TVNA 2Y07H 2WMHA 3EX6A 3N6JA 1MEIA 3NDYE 4XNUH 3ZL4H 2DQGH 4TS6A 1LK3H 1OX4B 5JQIB 2OMWA 4TVPE 4PLJD 1NIUA 1AH0A 2DWTA 1R3HB 3AROA 1XGPB 2Y7OA 1GG1A 1LD9B 2J4GA 1AMYA 4OZHF 3RVUD 4JJOA 5B38A 1EHNA 1P4BH 4IUGA 1IM9B 3G5WA 7FABL 2IALB 2W81C 4YHZH 1J1OH 3GHUA 1ZA6B 4N0FA 1W0WB 4HJJH 3Q6GH 2CBUA 3TC6A 2MMXA 4MXVE 4P9HC 3TYDA 1F4WH 3ZSTA 2EIEA 1GPFA 2CEQA 2PLJA 2Z35A 3WJMB 1X3DA 3BVNB 4FNUA 1O12A 4I90A 5I1EH 1ID5I 4XBSA 3W1PA 5HHMD 6CGTA 1CD8A 3F3HA 3GZPA 4PJ8D 3DKJA 4MD4A 4J2PA 3RR1A 5A2JH 1MG2C 4W1TA 3G0XA 2ALWA 3EZ4A 4ELDA 4NENB 3GNXA 2P53A 4BHUA 1S7UB 1KELL 2GGEA 2XH0A 3ONCA 3NCFB 5KYYB 1TVCA 4HSNA 4ODWA 3EGDA 4WFFE 5DFVD 4PMJA 2OQJB 5KN5A 4ZFZB 1FAKT 1HX0A 1X5KA 35C8L 4PRPB 4C4KO 1GEQA 3WD5H 2FTYA 3REQB 3XISA 1KGCD 3DMMD 5E6ID 5I17A 3CSYA 3VD7A 1QR1B 2XZLA 1KC5L 3E9TA 5K1JA 3DAQA 2Y7DA 4OKDA 3KGUA 4GK8A 4WWOA 1B5TA 2XPKA 4GP4B 3OZYA 1UGKA 3KYMA 5DJXA 2XT1B 3RYMA 2GJXB 2HK1A 2QAPA 3HC3H 1PX4A 1E70M 4LKCB 5C6WH 3FAXA 4Y7CA 1TQUA 1X5JA 3EJYD 4OIAA 3RVWD 1RHCA 3O16A 1NWPA 4R0LB 5GZOD 3ERPA 1YDYA 2DWDB 2YAEA 3D9AL 2W3ZA 2LU3A 3PWNB 3SCPA 4R53A 2BSSA 5AW4B 2OMYB 1XF2B 1PPIA 4L2YA 4F8PA 5IHBA 1K8CA 4GBUA 1FNGB 2D7TH 4P46A 4J2MA 2DB8A 4AZ8A 3LDBB 3UZYA 2W88A 3QI9D 3ZY7A 2YWHA 3OHIA 5EOCH 4XNQB 1B3WA 2FYYA 1TVBA 2G9KA 4S1RH 5JOPD 3DG6A 2IANB 1ZSDA 4CGTA 4JDBA 3MTXA 4OLVL 3I4EA 4O1BA 4I0PC 4RDYA 4YJ5A 2WZPP 3HC4H 1NCCH 2XQBL 4G2AA 1SN0A 1ZOXA 2X1XR 3FB8B 4XBPB 1LO3H 3KPRD 4BWTA 1W0VB 3IMVA 1J8KA 3L1OL 3MTRA 4JFTA 4N0UE 3B05A 4B90A 3MLPA 1S9YA 2QR0A 3G1YA 2ZIDA 1ADOA 4GXWA 4MRBA 3VTAA 2GGJA 3UNTA 3OW7A 2YO3A 2FO8A 1NCGA 2VJXA 4QMEA 5DD3L 1QHZA 1WXYA 3ORWA 3VI3B 4ODSH 1XXDC 5GNYA 4E5TA 4N2BA 3CH1B 1ORQB 3QR2A 1I1YB 2FLMA 4G43B 5FF6B 4LC8A 4DPQA 3CZSA 3DGBA 4WUKL 4K5MA 1MCSA 3ZIYA 5T5NG 4PB3A 2UZYB 2J2ZA 3N2TA 1N6QL 5F7NC 3DX2A 3KTSA 3PFUA 5FS5A 4D6DA 5C0CB 4MA1B 4O12A 3TYBA 3PNWA 4CL7A 3UZWA 2AQSA 5CFHA 1SVDA 2VDIA 1VADA 3BPNC 3D30A 2EPOA 2DJMA 5F89A 3ORJA 5AOLA 5ITFB 4G7FA 1SZGA 3AUWB 4QHLA 1RCQA 4LCSA 1P48A 3MXWL 3STZA 1RJPA 4OF7A 3DXAB 5HI4D 2ZZGA 5C7XL 1PG7X 2VDNL 4K68A 2W95A 3ASTA 1BQLH 1ZWIA 2CKBB 1DVXA 3PU7A 4WDIA 5HI3D 1DJNA 3C0JA 3BUDA 4GCAA 2Q0ZX 3BKYL 2AJUL 2F53D 1XPGA 1TKWA 3EDDA 3VRIA 3WNPA 1M4KA 5IWLC 4RCZA 1RJYA 4MJ2A 5EC1A 5AZEH 1WFOA 2Y6SD 1SYSB 5JZ7C 3MUY1 5LVEA 5CBEB 5D7IA 3U2OA 4YZFE 4X4XB 8A3HA 4XNDA 3EKGA 2ERJC 4LC0A 1YDVA 2QSVA 5DURB 5HY9A 2OX5A 3Q8CA 1M7JA 4D1JA 3HPSA 3L7FA 1FSKB 2VLKA 1DFBH 4ONFH 1X8FA 3VH8A 3R4DA 5GNZA 2RA1A 4LL9A 2MANA 1HVQA 1ZY9A 4K55A 2VDPB 3NSCA 3MX0A 1AGBA 4JB9H 4KRLB 3NXLA 4F0KA 3CO4A 4ZW8A 2VENA 3WBKA 5CILL 1ONXA 1R87A 3GMPA 2A6JB 3BQUC 4K0OA 4N8VB 1R3KB 2XWCA 5GJMA 1WH0A 2BRRL 4FC3E 4YEEA 2EYRB 5ICXB 5GZND 3T4YB 3EBIA 1WZAA 1XH1A 3AZRA 3KXQA 3MYZA 3NPUA 5INDB 1I8AA 5CLYA 2WMJA 3F7VB 4Q9RH 5K7JA 4HZMA 4K5PA 4WO4A 2R56L 3U2EA 2EILB 2WXPA 1QFUL 4IBTA 4W9CC 5DLLA 3SOBL 5AVXB 5IG7A 2DTSA 4HPGA 3OLIA 1T03H 4NQUA 1WQVT 2VDQH 2Q09A 1LJMA 3HE6B 2YEQA 2ZOOA 4MWFA 4C4KT 4HWBA 4KWVA 3W53A 4RRPM 1T03L 5CPQA 4AF0A 2HXAA 1TPDA 4X6EB 4EANA 4I5BB 3BEWB 4KO7A 2YJQA 2JFCA 1C5CL 3A6BH 3T9WA 4TIMA 4ZGQB 2WBJA 3GBLA 3KYMB 1DV7A 5C08B 4X4YA 4N9DA 3PJWA 2ZYHA 1UZHA 2X0KA 1WBXA 4PRAA 4HPHA 1ITCA 1FZOA 4J7RA 3EYQD 4OLEA 1NAMH 4XN2A 4P46C 1KG0A 3G6JA 3NZRA 3UFIA 4MWAC 2XVBA 5A16A 4UTUA 1Q2SA 2HWZH 2WCGA 1BVKA 3N85L 4DHLA 2XWBB 1MCWM 1FWDC 1UYQA 3G1VA 1YJWB 4M6PA 1XGRA 1WZ1L 1ES0A 3DIDA 3QFJA 4JKPL 1GQLA 4QEHA 1XGUB 1A9BA 2YKLH 4TV3A 5I23A 2GZXA 2L7JA 1VQMB 2XNJA 2ZUUA 1SJBA 3PP7A 4MWAB 4E5XA 1LM8V 4OGYL 2RFXB 1IEBB 4LCUB 3RU8H 1PZCA 5KVEH 2BP0B 4K4KA 3GQBA 2R0WL 1YIXA 2D2HA 1A3XA 3LNEA 4M1DL 4LIQH 4UDUB 4NZ5A 1ZLSL 2F08A 2IXQB 2E77A 3WMLA 2XN9B 3BN3B 5DC4B 4OZIE 1ONWA 5D2LF 2H0FA 2BF4A 5I8CB 1T96A 2EC9U 4Y16B 4AVIA 1JPHA 1NGYB 3WLLA 1TU2A 3GKWH 1ZS2A 4H88H 4TSCH 1FL3B 5DJZA 4XLCA 2KERA 2V2WA 2A6IA 4L4VB 3MLUH 1H85A 4OGQC 3WJLC 4ERSL 3SE4C 3BUVA 3CH1A 4OZOA 3WHE1 4UM9D 4L1TA 5FCUL 4Z2KA 4AVNA 2AJUH 3CDYA 3CQJA 4OD2A 1IEWA 3HZ3A 3R8QA 4P5KA 3HPXA 3TX4A 2DY2A 4FAMA 2XQ0A 4WFGE 3WMSA 3C60A 4QYOA 1SJEB