3BCFA

Alpha-amylase b from halothermothrix orenii
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
585
structure length
585
Chain Sequence
SLFLIESEPSTGASVSKNLTEIILIFSNDINKVSQLALTDLITDSDIQGIDYNIEGNKVIINNFSLEPTCNYRLSYEVIDIYDNHLQGYIEFLVNQSNYPQIPDQEVNHTILQAFYWEMNTGEYATEHPEEANLWNLLAERAPELAEAGFTAVWLPPANKGMAGIHDVGYGTYDLWDLGEFDQKGTVRTKYGTKGELENAIDALHNNDIKVYFDAVLNHRMGADYAETVLLDENSRDKPGQYIKAWTGFNFPGRNGEYSNFTWNGQCFDGTDWDDYSKESGKYLFDEKSWDWTYNWDEDYLMGADVDYENEAVQNDVIDWGQWIINNIDFDGFRLDAVKHIDYRFIDKWMSAVQNSSNRDVFFVGEAWVEDVDDLKGFLDTVGNPDLRVFDFPLRSFFVDMLNGAYMADLRNAGLVNSPGYENRAVTFVDNHDTDRDEGSYTVSIYSRKYQAYAYILTRAEGVPTVYWKDYYIWEMKEGLDKLLTARRYYAYGPGYEVDNNDADIYSYVRSGFPDVAGDGLVLMISDGTSGNVAGKWINSRQPDTEFYDLTGHIKEHVTTDSEGYGNFKVIKSEDKGWSIWVPVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha amylase, catalytic region
publication title Crystal Structure of the Polyextremophilic alpha-Amylase AmyB from Halothermothrix orenii: Details of a Productive Enzyme-Substrate Complex and an N Domain with a Role in Binding Raw Starch
pubmed doi rcsb
source organism Halothermothrix orenii
molecule tags Hydrolase
total genus 198
structure length 585
sequence length 585
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3bcfA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bcfA04
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3bcfA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bcfA02
3MMWA 1VEMA 3VVGA 2WMIA 2JIEA 2V3EA 5BYWA 2VO5A 4DUXA 5EMYA 3WH8A 4MJ2A 3UESA 3H54A 1BQCA 3AISA 1HWWA 2VCBA 1HKKA 2VX6A 2FH6A 1E3XA 1XH2A 3FAXA 4M56A 2D2OA 1SR0A 5M03A 1UD6A 1LF1A 1GZJA 1X1NA 3WY1A 1CECA 2J25A 4FNSA 3WF1A 4NZCA 2XVKA 4P7NA 1MQQA 2Y24A 5ABFA 4PMYA 2WZHA 1V02A 4LYPA 5AY7A 2Z1SA 3A21A 4W8AA 2EAEA 1CXHA 1D2KA 1KGUA 4BZYA 4U31A 5CLTA 2OMXA 2FHBA 1EQPA 4HMCA 1XSKA 2OMUA 3D52A 1QNPA 3AROA 1MW3A 5FOOA 1BFNA 1J0ZA 4P8WA 4DUVA 2EPKX 4RE3A 5I0DA 2EBNA 2W67A 1JNDA 3CPUA 1IT0A 4PMVA 2A3CA 3DX0A 4V27A 4BS0A 1G0CA 3GTNA 3B9EA 2VZVA 1TMQA 4AD1A 4D6FA 4ATLA 1FHDA 1GCYA 1E6XM 1DEDA 4AYSA 2VL4A 4OOZA 2BHZA 5A6SA 5CSYA 2J79A 3CZNA 2F7PA 1WB0A 5BXRA 2WNWA 4MDOA 3MUIA 4MNJA 3FNDA 2OYLA 2UY3A 5CG0A 4U3CA 5E70A 3BXWA 4DWSC 2WKGA 1V0NA 1NOFA 5A2BA 3T0DA 4U5IA 2YL6A 4LQ1A 3W0KA 1UWSA 4YPJA 1PBGA 4D6CA 1J0JA 1D7FA 1ZL1A 3AXIA 1JD9A 3NDZA 4AXNA 1ODUA 2WQXA 4PTXA 3L2MA 1LLOA 2XM2A 5D8ZA 4JIEA 2XUCA 3WF3A 3D50A 2ZUVA 1C90A 1B31A 1JAKA 4MDPA 5I5RA 1UD2A 4DUWA 2D0HA 1W9PA 3BAXA 3VM7A 2XGBA 2OMYA 5JBDA 2JF6A 4GXPA 3S2CA 3FXYA 3BUIA 3TA9A 1GOIA 5I78A 4D6GA 4PCSA 2QV4A 5E1QA 3VNZA 1W2VA 3W29A 4AZCB 3N1AA 1E0VA 4TVDA 3SCRA 2GDUA 4Z2KA 2BVYA 1KBBA 1GHSA 1MW1A 4QDMA 3MV11 1MFUA 1WDPA 1IV8A 4ZXLA 3MSGA 3I3EA 3A4WA 1C92A 5CJ5A 5A6BD 1C3FA 1H09A 3HMCA 2D22A 4GI6A 1JG9A 4FNQA 5BXSA 3WY3A 3RM8A 1OB0A 1QWUA 3EYPA 1H6TA 1FA2A 1OD8A 3O2LA 4TUFA 4UFHA 3SUVA 4JAWA 2VX4A 1TA3B 4E4PA 4YHEA 1JFHA 4AIOA 3M46A 2GJXA 3LPGA 1BLIA 4FNUA 2EO7A 3WNNA 2ZX8A 3WMBA 3WN6A 1MYRA 5GNZA 1HJSA 1M03A 1VEOA 1MXGA 2X2JA 2WQUA 2O9RA 4PYSA 3WY2A 3VSTA 3AIWA 4W8BA 5BWFA 1QOXA 1UR0A 1VFMA 4AZ5A 1WZMA 3BCDA 1W3KA 2EABA 1C8XA 4JHZA 2JE8A 4P8XA 4PBGA 1B3ZA 3WH9A 5AC5A 4JL1A 5HPOA 3OLEA 2QPSA 1UA3A 2WVTA 2W91A 1RP9A 3WEOA 3PBGA 3CH9A 2CPUA 1GQLA 2F18A 4UFIA 3M07A 3ZJKA 2J62A 2CESA 2CETA 1B1YA 5ABGA 2FYVA 4AMCA 4AZBA 2Y5EA 4JFSA 5D9MA 1DWAM 3EDEA 1WZAA 4V28A 2X8RA 5ECUA 1R87A 2BS9A 3AZRA 1TQTA 3THDA 2XG9A 2YL8A 2X0HA 1V3HA 5LA2A 1T0OA 1CWYA 2WKLA 2WHLA 3S5ZA 1KQZA 2RGMA 3KL5A 3HJEA 2OWXA 3QHOA 4N42A 4XUYA 3KWXA 4NXKA 2BVTA 3KEHA 4GZJA 1QPKA 3QHMA 4CILA 1X6NA 2YFNA 4FLSA 1R85A 4PMRA 8A3HA 2ZXDA 2WB5A 2VCCA 1XH0A 5CPSA 3BUBA 2DSKA 4MB4A 3ARXA 1S46A 3VIPA 5ABEA 1E6ZA 4H7VA 1MXDA 1JZ6A 2GFTA 3EJPA 3N04A 1QNOA 4JKLA 1I1XA 1V3KA 4HU0A 3L4WA 1UWIA 3CUFA 3VPLA 5M5DA 5BRPA 1JAEA 1EDTA 4K68A 1RD6A 1BYBA 3CUGA 3NSMA 3ARTA 4Z2LA 1JZ7A 1CXLA 1GOOA 4UNIA 1C7TA 1EIBA 3UG4A 1XRVA 3WD1A 3FY1A 3MU7A 4CU8A 2AMGA 1K9EA 3AXXA 1JF5A 1XH1A 1HKIA 4W84A 3GNOA 1EGZA 4MNKA 4GZEA 5I2UA 4TXEA 1H4PA 4KGLA 5A6AA 4U2YA 4AIUA 4UOJA 4MNMA 2OMTA 3F5LA 3VX0A 3CZGA 5A2AA 2PWHA 4AZCA 4B3KA 4BQ5A 1CXEA 1GJUA 4AY1A 2YLLA 2Y4SA 1XCXA 3TTOA 1OSEA 5E6YA 3AS0A 3FHAA 3ARRA 4IISA 4QLLA 1AQMA 4C7FA 2NSXA 4Z2HA 4DO4A 3VDHA 1UH2A 3WDQA 1XD1A 1BG4A 1E73M 2OMZA 2J47A 1BYAA 2YBUA 4PMQA 2CERA 4QFUA 1MWOA 4M81A 2ZICA 3M6DA 3AS1A 2FHFA 1KCKA 2NT0A 3MV01 3LXBA 1RPKA 3BGAA 2WWCA 1NM9A 1K6AA 3UG5A 3L4UA 3VGDA 3ZT7A 2YA0A 1HN1A 4XX6A 2VRKA 1RP8A 3EMQA 1HXJA 1NWTA 1M42A 2WPGA 4HOXA 4HPGA 3PZUA 1O6TA 4NX0A 1EA9C 1QX1A 2DIJA 2WHJA 3F4VA 4UZSA 3TTQA 2JIWA 2J4GA 1R34A 1SYTA 1TA3A 3ALGA 3GXDA 1WZKA 5AC4A 1JFXA 2EPNA 4ZENA 3IJ9A 2OYKA 2E4TA 3OGRA 1BPLB 2G41A 1ZU8A 1GJWA 1CNVA 2C7FA 5A6KA 5HOSA 3NJ3A 3FAWA 1K9TA 3AMCA 4Y7EA 1E0WA 2C0HA 2E9BA 1JZ5A 2VUYA 4GI9A 1WZLA 5FKYA 2VZOA 1GNXA 2OMWA 1OINA 3WNMA 3RIKA 3L4VA 2YJQA 4NXSA 3DX4A 2PB1A 3CUIA 3OB8A 1SMDA 2BY1A 3UR7A 4HZ7A 1JXKA 5A94A 2CBUA 1V6VA 1MVYA 5EFDA 3ZSTA 3ZQ9A 3LXCA 2VQTA 4PN2A 1KXVA 5D9PA 4RE4A 1KTBA 1W1YA 3CIVA 5A8QA 1EHNA 1UZ1A 3SCWA 3SUSA 1CEOA 4XZBA 4PMXA 2CKSA 1JZ8A 5D9OA 1C91A 4OJYA 3GH7A 4QCEA 5DFAA 1W3JA 1HP4A 5CGTA 4HOZA 3EMCA 1HP5A 3IGUA 4PUEA 1E56A 1TUXA 1GQKA 1XYFA 2D20A 4UTFA 5A1AA 2W62A 3GBDA 2TAAA 2G4FA 3AZSA 2DT1A 1KGWA 3VMPA 2XFFA 4J3UA 1DWHM 4WF7A 2VJXA 3AFBA 4F9DA 1CLXA 2J7HA 1XSIA 1W1VA 2IUZA 2YDSA 1M53A 5EFFA 3VU2A 4CU7A 2G3JA 3H55A 1C7SA 3N11A 4W88A 1EHAA 3EDFA 4N0RA 1HVQA 4D1IA 2ZX6A 3WH5A 1W91A 3ZMRA 1NM4A 3JUGA 2DT0A 4IM4A 3VD9A 4URIA 2XIBA 3OLDA 3SIMA 3CC1A 1PIGA 1CXKA 3W37A 1K9DA 2YLAA 1UWQA 1QNQA 1ODZA 2VURA 3W25A 2XJ7A 1UD5A 3DDFA 5IFPA 4AZ7A 2G3NA 4QCFA 1JYXA 9CGTA 1OCQA 3EJQA 3WNKA 5HBFA 3T2PA 4DWSD 3CZKA 1V3IA 1BAGA 1JDCA 8CGTA 3CMGA 3WUFA 1UD3A 1NWRA 1J0KA 4UR9A 2ZWZA 3GM8A 1U30A 2OLHA 2ALWA 3ZO9A 1PX3A 4KRUA 1QHOA 3WSUA 4EKJA 2PWEA 1V02E 1FH7A 3WENA 2WMJA 3CUJA 1JYVA 3O6AA 3WDJA 3APGA 3LPOA 2ZUTA 3ARSA 3SCPA 2BY3A 3EDJA 2JFEX 2EQDA 4CVWA 1ISVA 3PZOA 5E9AA 1BGGA 1ESWA 2X2IA 3GXPA 5I24A 3RO8A 2ZXAA 1J0YA 3U5YA 3ARWA 2G3MA 3BMWA 4XZWA 2WANA 2WVVB 2XSAA 1GVIA 3CZ8A 1FH8A 3N17A 1J0IA 4X0VA 2VI0A 5I77A 1E4LA 3CHCA 2ZUUA 3K8MA 1V6XA 1CTNA 5A8OA 4JKKA 2WSPA 1O6SA 2V3FA 1H0GA 5JBFA 4HZ6A 1E70M 1HL8A 3SCOA 4TX8A 1V03A 3F5JA 1XYZA 1BPLA 3I3BA 1JI1A 5AYIA 3VIIA 1U33A 1U2YA 2BXZA 1V0LA 4AEEA 4F9JA 4A3HA 1MQPA 1Y7VA 1B3VA 3WDRA 2ESCA 4OBSA 4P7OA 2VMFA 3WIJA 2JALA 3AQUA 3LRMA 5DT7A 1E6NA 3MKKA 3WMCA 4X9YA 1E1EA 3CZLA 3VKKA 3PZGA 3EDKA 1UA7A 3U5UA 2E9MA 3AOFA 2UZYA 3VDBA 1VEPA 2X2YA 2D0GA 3MSDA 1N82A 4PMOA 4AISA 2J75A 4M24A 4P7RA 3OZPA 1DWIM 2W61A 1H6UA 3WF0A 1UWTA 1R46A 1UR8A 2UWFA 4D6IA 3WNPA 3HG2A 3UG3A 4PRWA 2WMFA 2BY2A 3VMOA 3DYOA 2VRJA 1JYWA 1E0XA 5DEZA 2VCAA 1V6WA 3J7HA 2DH3A 5CPQA 3VSVA 3MUAA 3N12A 1V0KA 1PEZA 1E1FA 4W7VA 2DH2A 3WD2A 4AD3A 2O92A 4BF7A 2WLZA 3VINA 1ECEA 2OW7A 3THCA 4C7DA 1GPFA 3U7BA 1TVPA 3HU7A 3NSNA 3PZTA 2XVGA 3CO4A 2CHOA 4LXFA 3BVXA 3AIUA 3W28A 2ZX9A 2YOCA 4J27A 3SCSA 3EMZA 1IX2A 3DX2A 1JZ4A 4UCFA 1WKYA 2X09A 2NW0A 3VGHA 2WMHA 1W1PA 3TOPA 1PZ3A 1VENA 2XN2A 1BGAA 3VIOA 5IHSA 4P8VA 1QI5A 4JKMA 2WVSA 2VNCA 2XPKA 2WM0A 3U7VA 3WNOA 4CN1A 4S3JA 1KFWA 3W53A 3UEQA 2WYSA 1FP8A 3WH7A 2IGTA 2FDMA 1YHTA 2AOSA 3CMJA 1HX0A 2C9RA 1KBKA 4H41A 4FLRA 1EDGA 1BF2A 1UYQA 2J8GA 4MNLA 1OT4A 1WE5A 3ALFA 1LWJA 1PX8A 4D1JA 3OZOA 5AYBA 3W27A 1UR9A 3AJ7A 3GBEA 1LYQA 2CITA 3EJUA 3UCQA 1QI0A 2W4XA 4FNTA 1V3MA 3EBVA 4AEFA 4Z2GA 5BROA 2ZUWA 2DT3A 1UUQA 3MI6A 1QI2A 4M82A 4FNPA 3ZT6A 2VOTA 3RPMA 4UQCA 3BCFA 1HNYA 1Q6DA 3SUTA 3VNYA 5A6BA 3DHUA 2XWEA 1W9DM 4A4AA 3A23A 2XSBA 2EEXA 3RCNA 4B16A 1H41A 1ISWA 1KR1A 2D1ZA 2CEQA 4PMDA 3BLPX 1Q6EA 1C8YA 2WVVA 5IHRA 2YFOA 2ZE0A 1G01A 3KL3A 3A4AA 4KMQA 5FL0A 1XD0A 3GXNA 2WMKA 5I23A 2Y8KA 3GYCA 2J7DA 1E4IA 4ZFMA 4OOUA 3B8SA 4J3SA 3VIKA 2E0PA 1DP0A 2BV9A 6CGTA 1KGXA 3SCQA 3EDDA 1AQHA 2EPOA 4PTMA 2DQXA 3GXFA 1EOMA 1K9FA 1M7XA 1PX4A 3ZOAA 3CZJA 4F66A 5JIWA 1TFVA 1QHZA 4NI3A 3N15A 4UQ9A 2A3HA 1MQRA 5DO8A 1HKMA 3T08A 1H49A 1CGWA 4CD5A 4U3AA 4PMZA 3RJXA 3HG5A 2D23A 3A3HA 3NCOA 4LYRA 1I75A 4B15A 4CU6A 2E8ZA 2FGLA 1EO5A 2WC7A 1HJWA 1ZBWA 1NOWA 2F61A 2QHAA 1CZ1A 2F7OA 4ML4A 4GIAA 5KZ6A 3WF4A 1W2PA 4FMVA 2XGIA 3EJSA 3U57A 3VO0A 4FLOA 1HJXA 4UFKA 1UKOA 1B3YA 4BQ2A 5C8BB 1CBGA 3WL1A 5C71A 5BCAA 2F2HA 1EQCA 1CXIA 1F4AA 1O6VA 3ARYA 4NF7A 4BCEA 4P7LA 3II1A 4X0NA 3WEZA 3GH4A 4ACYA 1NH6A 1OGSA 3BLBA 4TTGA 1RH9A 5I3DA 5M3WA 2XIIA 1SFSA 1OIFA 3KE0A 1OIMA 4B3LA 2J78A 3ECQA 5I79A 4EE9A 2PWFA 3N13A 3WQWA 3AI0A 1W1TA 2BHYA 1KWGA 7TAAA 4D71A 2WAGA 4D72A 3WL0A 4F8XA 2GUYA 4D6JA 1DHKA 3T0BA 4HA1A 1JD7A 4H04A 4W86A 5A95A 4E2OA 1ISXA 3PZNA 3MO4A 4PUDA 3QOKA 3CHEA 1QHPA 2WHKA 3WFLA 2O9TA 4WSKA 2F7RA 2OYMA 4KWUA 4YN5A 3ZIZA 2X1IA 5FD0A 3K4DA 3CLWA 1D3CA 5GNYA 4NSBA 3ZT5A 3SCNA 2WLYA 2QPUA 3FW6A 1GOKA 1M04A 3PHAA 2PWDA 3BUDA 1HJVA 2YDQA 1R8LA 1JXJA 5A6LA 2V5DA 1M01A 4CN4A 2MANA 2W5FA 3AICA 4UQAA 1UD8A 3CZSA 1YQ2A 3PTKA 1UZ4A 5LYRA 1OT1A 3WDIA 3ZJ6A 5CQ1A 5IFTA 4DWSB 2FHCA 4AZGA 1PZ2A 3WUGA 1OT2A 1WO2A 1E6QM 3CUHA 5CLWA 3VX1A 3NIYA 1KTCA 1OBAA 1VFUA 3BLKA 1XC6A 2DSWA 2V3GA 1J0HA 1VBUA 3NDYA 2PF0A 3BVTA 1E43A 3D4YA 3D5HA 3UETA 4W93A 2ZXQA 3ZR6A 1O7AA 1KCLA 5BXPA 1E3ZA 4JFTA 4AZHA 3CHDA 3TONA 4AQ1A 1CGYA 2G8ZA 3BUQA 3IAPA 2ZUSA 4J3XA 1E6RA 2JEQA 2X0YA 2UY2A 4TX6A 4DM2A 1ISYA 3WBAA 2XWDA 3W81A 1KQYA 2DPEA 4NRSA 2VVNA 3I3DA 1O7DC 4OUEA 1VAHA 4CD8A 2E3ZA 3A6OA 2XHYA 4KGJA 4W5ZA 5JIPA 2D3LA 1PAMA 4JCMA 5GQBA 4NZFA 2QMKA 6TAAA 1TQUA 4AZIA 3HG4A 3AMGA 3ARUA 2HVMA 3SEPA 1ZBVA 4J28A 3ZM8A 1LG1A 1BSIA 3K8LA 7A3HA 3D4ZA 1TG7A 4OZOA 1JYNA 2EXOA 1BVNP 4PCTA 4S3KA 2YA2A 4DM1A 3S6TA 2VVSA 4QP0A 2WC3A 4JFUA 2E9LA 1JI2A 2IXVA 3L4ZA 3DDGA 4WK9A 3TV8A 4AW4A 4CD6A 4EAMA 1ZBKA 3BMVA 1V3JA 1BYDA 1H0IA 4J3VA 2F1AA 3RM4A 2EJ1A 1CENA 2QF8A 2GDVA 2A3EA 3NSXA 3ZJ8A 3ZSSA 3VDAA 1TZ7A 1GQJA 4UOZA 1PS3A 3LMYA 4CD7A 4NZJA 4IPNB 2UY5A 2BVDA 3AYRA 3WD0A 2WBKA 4ZXOA 2FE0A 2CYGA 3AMDA 1R7OA 3AHTA 1R7AA 2C8NA 1V6UA 3WF2A 2WW5A 4Q7NA 3LPFA 4NRRA 1O6IA 2Y2WA 2DIEA 1UR4A 1LL6A 4GI8A 2DDXA 2F7QA 1VJSA 1GONA 4KRTA 4B9YA 2BHUA 5JBEA 2WZEA 1US2A 2VZUA 2NT1A 1UQZA 1WNOA 2ZX5A 4M1RA 1CGUA 2JEPA 1G94A 3A24A 1DWJM 3E1F1 3AHYA 5EB8A 1Z32X 1FH9A 1QBBA 1NOUA 2W63A 1KXQA 2EADA 4L4OA 2XFRA 3AYSA 3WDHA 4UFJA 1ITXA 4YHGA 3KLKA 2EPMX 1KXTA 1LL7A 3WELA 2C9PA 2EPLX 3RM9A 3T0AA 3WFZA 3VILA 1X6LA 4UOQA 1G9HA 1TE1A 4MJ4A 1BVZA 2VTFA 4UQBA 2GK1B 2G3IA 1QW9A 1BYCA 1CGVA 1E5NA 2YKKA 1P6WA 2RGLA 4DO6A 1GOWA 4WLCA 3EJTA 5BRQA 4KH2A 1NQ6A 4J3WA 3OGVA 3W4RA 3MANA 1ISZA 5A6JA 4OIFA 1AMYA 4DO5A 4J7RA 1LG2A 3D51A 3DX3A 3WKZA 2QMJA 1E6SM 3AZTA 5E0CA 1VJZA 3ZR5A 4CVUA 4AD2A 3T09A 5IXEA 2CXGA 4WKAA 2DSVA 1E5JA 4AIEA 4LPCA 3WQVA 2ZXBA 1UH4A 1XGZA 1IZJA 3MMUA 4DWSA 5E0FA 1L8NA 1GOMA 3QOMA 3VGGA 2Y5QA 2OWCA 4HP5A 1HT6A 5A3HA 1C8QA 3BVVA 4H8UA 1VB9A 5CSUA 3VGEA 1A3HA 3SCTA 1CPUA 4V2XA 3AXHA 1W32A 4AD5A 2WXDM 3IJ7A 1WPCA 1GORA 1PIFA 3IJ8A 3DYMA 1AQ0A 3BAJA 1E72M 1R47A 3RILA 3PZMA 3VDCA 4GQRA 3BSGA 1B2YA 1AVAA 2GSJA 1ZJBA 3WQ4A 1QI3A 1E15A 4HTYA 4M8UA 3L4YA 4GQQA 3DECA 3B9AA 3GXMA 1BHGA 1ZJAA 1NP0A 4JCLA 1OD0A 3RDKA 2WWDA 3FHQA 4JFWA 2W92A 5D8WA 5ICUA 2XYLA 4P8UA 1UQYA 3BAYA 2J7CA 2CCRA 1OGBA 1VRXA 5A2CA 2YBTA 4PTWA 3GXIA 5IDIA 3VOCA 5TD4A 3IANA 3M7SA 1C93A 3D3AA 2ZWYA 1WP6A 2HISA 4PTVA 2VX7A 1TQVA 4OBRA 2ZX7A 4MPKA 3BVUA 1B3WA 3HN3A 2VR5A 2YA1A 3VGBA 1CYGA 3POHA 1QVBA 4MB3A 1OWQA 4U33A 1VFFA 3PZ9A 3VIJA 4TOQA 2WCAA 4JHOA 1J12A 4A3YA 3OGSA 2VX5A 5D9NA 3QGVA 3L4XA 1XHGA 3POCA 2CIPA 3TP4A 1VF8A 3A47A 2WQVA 4PSRA 5KEZA 1JZ2A 3AIBA 4CGTA 3WQ5A 4FF5A 4QLJA 2VZSA 3AIVA 3HG3A 2WK2A 5GPRA 1EXPA 3AHZA 3PN8A 3VIGA 1OGGA 2VZTA 1B0IA 3MS8A 4LYQA 3PTMA 1VIWA 4U2ZA 4QAWA 4E8CA 1UG6A 4H8VA 1DWFM 5HNNA 1GQIA 1GUVA 2CKRA 2W66A 2OWWA 1H11A 3GDBA 3UR8A 2WZIA 3G6MA 4JZ5A 3DC0A 4R27A 3CZEA 1TVNA 2PBOA 4HOWA 1XSJA 2ZUMA 1XEUA 3CBWA 1B3XA 3PZIA 4AD4A 3BAWA 2VR4A 1MFVA 2ZOXA 3AMKA 1FOBA 1M9SA 1QWNA 3SUUA 2PWGA 5JUVA 1KB3A 1H3GA 4U5KA 3A22A 2DSZA 2F8QA 3K8KA 1XV8A 2ZUNA 1GOQA 3VD5A 2YIHA 3KL0A 1L0PA 2A3BA 1UHVA 2AAAA 4ZE4A 2WVUA 1H5VA 3W6MA 4RL3A 4F79A 1NWSA 4GZIA 3TTSA 1F4HA 4AYGA 1JZ3A 4ATWA 1CLVA 2Y8VA 3PTQA 3GXTA 1LL4A 3WNLA 2GK1A 3SUWA 2J8FA 4HZ8A 2VRQA 1JNEA 3K46A 1R86A 3OA5A 4IUGA 3BAIA 3OG2A 1HL9A 3AHVA 4TTUA 1CGTA 1UKPA 3ARQA 4WKFA 2XVPA 3B9DA 3AIQA 4AMWA 1TR1A 2PC8A 4UFLA 1R75A 1QI4A 3F5KA 4GO8A 2CBIA 4H8HA 3BUPA 2CNCA 3VUPA 2DGAA 1KWKA 1OM0A 1V6YA 2F1BA 4W87A 3T2OA 4D6DA 1MW0A 3AIEA 2E8YA 4MAVA 4MAZA 3L2LA 1UOKA 4AW7A 1E71M 1V08A 4UQEA 4M29A 3SCVA 3W82A 4ATDA 4WJXA 1JF6A 1JDAA 2QLYA 1J9YA 7CGTA 3WQ8A 3WQ6A 4AMXA 2OW6A 4MB5A 3IK2A 1JGIA 1TQWA 3OLGA 1I1WA 1EOKA 4GO9A 2WSKA 3H53A 3VTRA 3ARZA 3W24A 2YL9A 1Q6GA 3RMEA 3CGTA 5HPCA 4PSPA 1CGXA 3AHXA 5D4YA 3DHPA 1W9XA 5LA1A 2ZIDA 2WCGA 4BQ4A 2WMGA 5LA0A 4L4PA 4EK7A 1FFRA 1J11A 2CHNA 4WSJA 3BH4A 4HU8A 1GW1A 1EDQA 1NARA 4HPHA 3GZAA 2IXUA 2A3AA 1DTUA 1UASA 3VIFA 5E09A 3LXAA 1J18A 5A69A 4FK9A 4MTVA 4ACZB 1JIBA 1KR0A 1W3HA 4LX4A 2EACA 4E8DA 2XVLA 2BFGA 4CCCA 4FLQA 1E4NA 1R33A 5CZKA 3WD3A 4OKDA 1E6PA 3ARVA 5FIPA 4ZE5A 1TQSA 5BXTA 3PZQA 4CD4A 1QNRA 3OBAA 1W3LA 4M80A 3QR3A 3NYDA 5I6SA 1CXFA 4CCDA 3WD4A 3EJRA 1US3A 5FCZA 3VIMA 2OSWA 5HDRA 2XM1A 1PPIA 3LPPA 3L4TA 1FFQA 1QNSA 2CBVA 2J7BA 4GKLA 5DT5A 2FGZA 4AD0A 3DX1A 3BVWA 4ZEPA 3TTYA 2OMVA 1G5AA 1CDGA 2PBGA 2VC9A 2Q8XA 4W89A 4D6EA 1SZNA 2WHMA 4B9ZA 4W85A 1Q6CA 4HA3A 2B31A 3KLLA 4CKQA 1VBRA 5E6ZA 3LRLA 1JDDA 3CTTA 3WEMA 3K1DA 1UWUA 2WMIB 5GNXA 4Z2JA 4AWEA 2Z1KA 4C7GA 3GNRA 4W8LA 5DMYA 1XCWA 1TCMA 1UKQA 3VD4A 1UR2A 5C70A 5A8MA 4UZUA 3W38A 1HXKA 4BA0A 3IAQA 5HXMA 1HJQA 1EO7A 5DF0A 3VD7A 4CCEA 3W26A 5FL1A 2X05A 3VSUA 4HA4A 4Q22A 2CBJA 3WDPP 6A3HA 2XFYA 3AMLA 3AIRA 4W7WA 1J10A 3N9KA 2C9QA 1PJ9A 1ZS2A 2JF7A 1ZBCA 3VMNA 2GJRA 4MB1A 2UZXA 2YDRA 5ABFB 2OSYA 3ZJ7A 5A8NA 3PZVA 2DT2A 2V5CA 5CPTA 5A6MA 1FHLA 3HZ3A 1UWRA 2GJPA 4JL2A 2D3NA 4UFMA 1B9ZA 1HJUA 3MMDA 2XVNA 2BY0A 5EBAA 1LJYA 3ARPA 2J74A 2VQUA 1V3LA 1GHRA 1G1YA 3CHFA 1ZB5A 3DYPA 3SURA 1DWGM 2J7GA 1BG9A 3AS2A 1A47A 2PI6A 2FH8A 1JL8A 3NUKA 5CXPA 4XV0A 2OSXA 2DEPA 3GH5A 1CIUA 4QLKA 5ABHA 3VD3A 1QBAA 4Z2IA 4J3TA 4FNRA 1KXHA 2D73A 3WUEA 4WKHA 2WCSA 3LRKA 1HF6A 1IZKA 3SCUA 3G6LA 2WQWA 2J77A 1WDSA 4PEEA 1W9UA 3OIHA 4CC4A 4TVUA 4RE2A 3QHNA 3GNPA 3BZ5A 2D0FA 2V38A 1J01A 1UKTA 1Q4NX 1UKSA 1ITCA 4BQ3A 5CGMA 2VT0A 1HTYA 1LWHA 2YL5A 4HMDA 3WBEA 2XTKA 4R5EA 4AZ6A 4JFVA 2XN1A 2E40A 4UQDA 3UERA 1NWUA 4WIWA 1W9BM 3W6LA 1GVYA 3MUZ1 1H1NA 2BXYA 3VIHA 3BC9A 2V3DA 4XB3A 1B90A 4PMUA 4AC1X 4W5UA 3OLIA 2J7FA 1MW2A 4CN6A 2J7EA 2GVYA 3T2QA 2BNJA 3S5YA 4H2CA 1LQ0A 4OGZA 3BSHA 2XN0A 1FP9A 4P7QA 1WDQA 3WUBA 5F7UA 1E4MM 1E40A 4ACZA 1UD4A 1VFOA 3O9NA 3WMSA 1HVXA 1UH3A 2DSUA 1WDRA 1SMAA 1Q6FA 3A4XA 4CC4C 4W7UA 4LGXA 1H2JA 4TVCA 4CUCA 3FN9A 3BAKA 4HMEA 2WC4A 2UY4A 1HKJA 4EANA 3WH6A 3A5VA 3AS3A 3MUY1 4PMNA 1EH9A 1WCGA 1W9VA 4GINA 4GPNA 3LX9A 4MADA 1UR1A 1NP2A 3VM5A 3K4AA 3CV5A 3WY4A 2O9OA 1WAWA 2D24A 3RJYA 2WBGA 3KZSA 4D6HA 1QW8A 1V0MA 2RA1A 5M17A 2X2HA 1B30A 3VGFA 1HIZA 1BTCA 2O9PA 1E55A 4IPLA 5A8PA 3N18A 1E9LA 2GJXB
chains in the Genus database with same CATH superfamily
5F7NC 4KVNL 4QRQB 4YHLH 4LGSB 3V7PA 3KRSA 3A0OA 2Y7GA 4RMQA 1WUZA 2YMXH 3KNBB 1PZDA 2IAMD 3CN3A 3GSIA 3IACA 3RY6A 2H32H 3I7RA 5ANMB 4BZ1L 2NTFB 1FBAA 1LF1A 2JXMA 3T6WA 1KOAA 2ADGB 3LKQB 2DI8A 1TYRA 3WK1A 3B2MA 2I7GA 5E5CA 3V3WA 5FYJL 4O2FA 4Y89A 2W60B 2SEBB 4MHHI 5AY7A 1AMOA 2R8SH 3S5LB 4IGBC 4S2CA 5F4XA 3NJXA 1O7SA 1YMME 3T4AB 5FYKD 3D9AL 3O8XB 4HOMA 2VDOB 4JTSA 4FK8A 2MCAA 3RZCA 4JN7A 4ZFFA 2J9ZA 4LLMA 5ESQA 1I2NA 3ONUA 4L4TD 4OY9A 1JNDA 4BDVB 3D25B 3CPUA 1I8KB 2VZVA 3UJTH 2QADB 4X5QA 4PUNA 4TV3A 5HHVL 4KZCA 2Z2BA 4E5TA 5I7GA 43CAA 4JTGA 1L6SA 4LVNB 1XGDA 3CZNA 3LKNA 1F6AA 3IRZA 4NP7A 2UY3A 3WLOA 4O9HH 4XTDA 3EF4A 2D3VA 1OAXL 2V2XB 4NKIL 4KQ3H 1ZL1A 4Y19A 2XH7A 3FT3A 3RGVD 5D7IE 1Z7AA 2PTDA 3UZXA 1SKQA 3K4WA 1Q0XH 3FPPA 2FWLB 3RI5K 1ZHKB 4XBSA 4OIIH 4GXPA 4HPYL 4JFEE 3GG8A 1LRNA 4OZFB 3N1AA 2OQLA 4TVDA 3UWQA 5D1ZI 3OC5A 4L1TA 3VB9A 3FOMA 3WD5L 5C2CA 5IVXB 3IEAA 2X53A 3SKOA 3P62A 5J1SC 1AG1O 3GR8A 1RZJL 3GVWA 4LHUD 5K9QI 4CW1A 1ETZA 2NLJB 3B5TA 3FSZA 4ZO7A 5CSRA 2AXHA 3BPOB 1MNNA 4LIQL 1ZLSH 3WY3A 2NY6C 4IEFB 2REQA 2BSTA 3REWB 2LLGA 2J88H 2NY4D 3VFOA 4FNUA 4EVZA 1F42A 1VEOA 5FYKU 3AIWA 1UR0A 3PJTA 4TSCL 5DZJA 1ZFJA 4FJYA 1W3KA 4ODTL 1D7BA 5AC5A 3FT9A 2W0KA 2FPYA 2XWBA 4P5MA 3FUHA 1KFGA 1QSEE 3ZTJG 2WBJC 3HE7B 5F71A 3VSQA 1WWAX 4LAMA 5EIQA 3EYSH 1DBKH 2V67A 4NO0A 4YSUA 1V10A 2XG9A 4YXKH 4J23A 1KIUA 3SKMA 3JWOL 5SWSB 4N42A 3ZKXC 3STFA 3LKRB 3PWVA 4AEHL 4KKTA 4B9GA 4GSQA 2EKSB 4X2PA 1S46A 2JI2A 5FLVA 1E5UI 4NBYB 3N04A 3GEWB 1EPXA 3GHTA 5H2BA 1TIMA 3CUFA 2D03H 3LQMA 4WHTB 3OKOB 3ZVIA 4P2QE 3SQOL 3DURA 3OYZA 4GS7C 3O9WB 3EX3A 3NABH 2XNJA 1JZ7A 4PJBB 1AZZC 3H2AA 4F7CB 1WD8A 3FONB 4O5LL 4DIXA 4NB7A 3RY8A 1GXEA 2BX5A 3DRQB 5ALCH 3O3AA 1H4PA 1WLHA 4MSSA 5F3BB 1YNLH 5T1KD 2C9UA 1SOSA 5LGXA 3C8KB 4OQ1A 2Y1AA 2Q02A 1AQFA 2NSQA 1X5LA 1K77A 3OZVA 1B4JL 3L95A 4PAAA 3NGBB 2CERA 4Q9RH 4WRHA 1RURL 3MRJB 4JHMA 4A29A 2HFEB 4LHJB 2WWCA 3QDAA 4KZEL 3QNXA 3VGDA 1VACB 3K2KA 4EUPA 5JPMC 1QMLA 4HNNA 4KV5E 4QUZA 4KIRA 2JIWA 1CZ8H 4FOJA 1B57A 3LRGA 4JN1L 1WZKA 3FGCB 2Q6OA 2OTDA 3X2QB 1VQ5B 4XP6H 2G41A 2QQLL 3PWJA 3C5ZC 5D1XD 5E1GA 1RD5A 3FULA 1VIZA 1GS8A 1MQKH 3O2DH 3RIFK 4QITA 4FFZA 3KR3L 3KVKA 1PVHA 1VFBA 4YHPA 2AQOA 2DZEA 4L4VA 3MQIA 3U2QA 1YMHB 5L2KB 4MJZA 1ZUNB 3ZZUA 2WB7A 5L9FA 3BP4A 4GIOA 2R1MA 3PWNB 3CXHK 1ZTXE 2AGKA 3KZ8A 2XNCA 1KELL 1EHNA 4XO5A 3ZBTA 5I5IA 2XTJE 5F7WC 3GH7A 3WL9A 4JTTA 4ZMGA 3L1EA 1BD2E 1CB7B 3MLPA 5SX4I 4RRPG 4G3YH 4EN3D 5IT2L 4J3UA 5EFIA 3DGCR 4IKLA 1MJJA 4GNJA 3I2CL 3NZ8A 1XBRA 2FR4B 4HETA 4F27A 1TWWA 5GGRY 5LWYH 4KK5C 5E6RB 1KJ2B 3NPXA 1F1AA 2W6RA 1W91A 4E2VA 4NQUA 1KTRL 1VQLB 2V2HA 2VLKB 3GLZA 5HDQH 1IB0A 5D04C 3QZMA 4I18A 4A6YA 2EDXA 4Z3HA 3S4SB 3TEWA 4Z6AT 3W9DA 3B8VA 5AOIA 4AC2A 1NGXA 4M1GL 3WNKA 3T2PA 2GQ9A 2XIQA 2Z65C 4XMLH 3D5OF 2WZTA 8FABA 3MSYA 2W6IA 1Z7JA 4HEME 1HO1A 4MYAA 3WJXA 1SN2A 3TCEA 1BJ1J 1QHOA 1SLWA 3TWCH 1CIDA 1QUMA 3QGAC 4Z3FA 3PPSA 4D9QE 5ENWB 2WN3A 2ROYA 4P3IA 1C1EH 4ODWB 4MNQB 1KCRL 1T5WB 2VI0A 5LXEA 1FO0B 4JY4B 2ZUXA 4YC2B 3JWNE 3K8MA 3C86A 4XKVA 1XF2B 3QTPA 3CV2A 1S5HA 1H0GA 5B8CB 2FZDA 4HZ6A 3SGDH 5CEYB 4XSMA 2QPEB 3WNJA 3IS0X 1U42A 3I3BA 4UTIA 3CUPB 2NW3A 2CBOA 4I2XA 5XIMA 4PJXF 4M3JA 3ATFA 1E1EA 1GHFL 1TJIH 3PZGA 4YXGA 4WY0F 2OP4L 1L0QA 3JV6A 1K6QH 4YXHL 2JKSA 3RWEB 1FQ9C 3MNWB 4KDTA 5GGVY 2Q9OA 4TRPL 2BY2A 2G60H 4QHPA 25C8H 4A6YL 4Q7BA 3VUAA 3RB7A 2IPGA 5IBXC 3Q2VA 3W2LA 4Q4MA 4HNCA 3FPXA 4EF8A 1FTXA 3WIAA 1FNMA 1MHEB 1ZHNA 4LHQB 3AIUA 3QZWB 3QUZB 2KERA 1MNUL 3HIZA 3RLUA 2EUZA 4KHXL 3HG1B 1S3HA 1IQWL 1YUHB 1I3GL 4YHKH 3GIZH 4OD2B 3MV7B 3HBPA 1U6AL 4PY8I 2ETWA 4RD3A 4JKMA 4WFED 2VNCA 4PTDA 4M7ZC 3VJ6B 4IS6B 2JJUA 1FWDC 1EAQA 1D5IL 1XIBA 3BYTA 2PETA 2GSIB 4H41A 2GQAA 5ANME 3QB7C 3UXAA 2J8GA 1LEKA 3RVXC 3HLKA 5TK4A 3PC0A 3FRPB 4AEFA 1WQVT 5DD3H 2RJMA 2VOTA 2HMID 1EFTA 4UQCA 1W35A 1KQSB 2A6DA 5HYQA 2H6RA 5LNVA 2BIQA 4G7WA 2H45A 4GRMA 4K9EL 5CJ8A 3ECBA 3W3BA 4XXDA 5I23A 1L9RA 3GYCA 4GH7B 6CGTA 4MQ7B 4LKXB 5IBTL 2X3CA 3EJCA 1R5IA 3QCTL 1M7XA 5CZTA 1QHZA 4FXTA 3EFOA 4O58L 4JIHA 4UT6L 1H49A 2QGCA 4HKBA 1YBQA 5LCVL 2J6XA 5D9SB 1TKKA 1ML0A 3TEZA 4LQFL 3JTBA 4H25B 2ARJB 3NCOA 3QZEA 4LYRA 3V4PB 4TNWK 2R0LL 5EU7E 3UWZA 5KJ7E 2IMNA 3PNRB 2QHAA 3FT2B 3SQRA 1GJPA 2VC2H 2YRBA 1PUDA 1RVFH 1FJ1A 1DL7L 4MAYA 1KTNA 4RAVB 5D93B 4M6OL 3D05A 5BCAA 1DVXA 5CLYA 1DFBH 2V2WA 2A5HA 5D2NA 2CBQA 2ZCGA 2K78A 5BMFH 4TTGA 1RH9A 2XIIA 3KAAA 3ZO0A 4UXDA 1I2QA 5IVXE 1XFOA 2JGYA 5A2IH 1PIIA 4HIXH 2OT1A 4NT0A 3UPCA 4PJ5B 3L21A 2VC7A 3TOYA 1GGUA 4AM0Q 2WHKA 1AGFB 4PRPA 2O9TA 3KWWB 5HYSB 3JTSA 2XZQL 3SCNA 1S1RA 3MLRL 3MZTA 2ZXCA 1FHVA 2YSSA 1JV5A 1KB5A 1S9YA 4JO4L 1XBZA 5LYRA 1D2OA 5CP7A 1DLHA 3E8UH 1PZ2A 3VNLA 3LHPL 3IDYB 3F58L 4FCAA 3CC2B 4IDJL 2HKFL 3B8WA 2F58L 4XXCA 1FSKB 2DKSA 5BXPA 1LWRA 1T04A 4ATTA 3GMNA 1E6RA 1DOSA 1YHPA 4PAZA 4OUEA 2ISSA 3FNKA 1GYNA 3A6OA 3KMDA 4N20A 5C6TL 1OM3H 1TX2A 1XP3A 2ESVB 5SWSE 1OB1A 4U49A 1IEAA 1EJXC 1LQBC 4GRLA 4HXBL 1TPEA 3VQMA 1JGLL 4Z1YA 3P27A 5KYUA 2Z7WA 2WC3A 1NGWB 4PS4L 3BSZL 5L0QC 1BAWA 4IM8A 3TBYA 3MOAL 1T5XA 2O30A 2IH8A 2GDVA 2FO8A 4I1PA 3VDAA 2Z28A 4MWAC 1L6WA 3PWGA 1VZIA 4C65A 2OGJA 3H26A 4I9TA 4PJBE 5LIUX 2E3VA 4PUUA 3STCA 1MI3A 4MZ3A 2Q76B 3LCHA 5D6DC 3DMMD 4FABL 4KKLC 1C12B 1UR4A 1LL6A 1NZRA 4WDTA 3KFTA 1S3RA 1VC4A 4AENA 1PD0A 1RZKL 3FBQA 2JEPA 4HVBA 1LM8V 3GSQA 1D9KD 4HC1A 3VOJA 2EE6A 5F1SA 5E23A 1KXTA 2K8QA 4XO9A 5ETUB 3H6AA 2X4TA 4AZ8A 4DO6A 1PJ6A 5BRQA 1GRWA 4BK8A 1EC9A 1TTTA 1X5MA 3MFGB 2WXRA 3F4WA 1DQWA 4J7RA 3FTUA 3JV4B 1AHMA 5DMGC 2DQFA 4KX8A 2DSVA 2AQNA 1UH4A 4H0HB 3DX9A 1QWHA 2MPVA 2C6QA 3RU6A 3FU0A 3BZEB 2PPDA 4AV0A 1FZMB 5TH2B 4QT5B 2ATPA 2CXEA 4QYOA 3IJ7A 1JBJA 5GGSY 1E8XA 5L2KE 4OZIA 1S2WA 1ZTXL 4K8HA 4I90A 1AVAA 1XF5A 4D9RD 2VXSL 2GUOA 2MUCA 3BQJA 3MV8A 3FJTA 2HDNB 1YYCA 1WEJL 3RDKA 5F7MC 2VL5B 4H8WH 4GAJL 3EOBA 4C6JA 1HU8A 3ARDD 2C14A 1I7PA 1VRXA 5IW6A 5ESAB 4HPNA 3VOCA 2WOYA 4BINA 3IANA 1TQVA 3BVUA 4IIQC 3FEMA 1S7XB 4MMZC 1TJHL 1XIEA 2IQTA 4YN3A 3CZFB 3GO1H 4OFQA 4HKXB 2PDFA 4DNRB 1X8FA 3FB7B 1GVRA 4R3SA 5GPRA 3AHZA 4Y5XB 4LL1A 5KUKA 3WYZA 4ODXB 3OR6A 4NN5C 1VIWA 5KYWA 4F5CA 4H8VA 2IKJA 3QXDA 1GUVA 3QUXC 3GDBA 1HHJB 2KZWA 3ZKMC 3UABA 1XYBA 3IJSA 4HOWA 5CKGA 1KPUA 3IFLL 4XP1L 4JIPA 1B3XA 1OWRM 4Z7OF 1T7WA 3P74A 2V9TA 4XI5D 1Z8AA 5HHOB 1AGCA 3ANYA 1RZMA 1S72B 3VD5A 1GOQA 4Q6JA 4GUPB 5AVNA 1GVEA 3M1ZA 3TF4A 3W6MA 3QDMD 1F4HA 3DTXB 3OF6A 4EXPX 4XAKD 4Q6IC 3GXTA 3WNLA 3FFSA 1RQEA 2XOTA 3QCVL 4J35A 1D5ZB 2IPKB 3MKGA 4X7SL 4FXJA 4MNQE 1HL9A 1ZAHA 4KTDL 2M2DA 2BERA 1TR1A 2YZRA 4X4XA 4FQPA 3BUPA 2NX3A 1R3IL 1SEBA 4F8NA 2IIJA 3TQ0A 4M29A 3ZTCC 4RCYA 5LAPA 1EOKA 1L9NA 4DJFA 4ACTA 5JPNA 5FR3A 3VA2C 4PSPA 4G8GD 1R30A 2CSPA 4PWFA 4H1LH 3FX4A 3S0CA 3TX4A 2CHNA 2PFHA 1CD9B 4YHYB 4DF1A 1N64L 3GZAA 2OFJA 2X7LA 3VIFA 3M86A 4H6QA 3QBTB 2PEVA 4O14A 2LGNA 4ODSL 1KR0A 1M7PA 2IMRA 3M17A 4LEOB 4EI5A 4I4WA 1E4NA 2FQGA 4R2GB 4XWOD 4EF9A 5J1AB 1MJUH 1YNTA 5AW5B 1U95B 3CDZA 4GUHA 1A3LL 2DJ4A 3QUGA 5G2IA 3P4MA 5DT5A 5TQ0L 4ZB0A 4HAGA 1O5PA 4H8NA 3HG1E 1J7VR 4CKQA 2DZWA 4PJEB 3K1DA 5IHHA 1ILSA 2HRWA 1TCMA 3FQUA 4FI8A 3QR2A 4S1QH 2BP1A 4PWHA 2KS0A 1QZNA 3EB3A 4LOEA 5LNUA 4II3A 4XAWL 1CT5A 2JXMB 3O3DA 4JICA 2I69A 3S35X 4FXUA 2FWOA 4O2FB 5A8NA 2H8PA 3A6BL 2K1MA 5ACZA 2G2PA 2EDBA 1EZSA 3SEJA 5THXA 1HJUA 3MLSH 1R19A 3HM7A 3CV7A 4US6A 1KFAL 1MCPH 1XF3A 1JQVA 2CXKA 3EADA 3CHFA 1ZANH 4RWYH 2GJNA 1IAIH 4XNAA 3RZCB 4ZFFB 4LLMB 5ESQB 2XU2A 2O6FA 4XVOA 1JL8A 2VDOL 1JPGA 4AVFA 3URBA 4R96A 1ZVSA 4XAYA 4XMKL 1TETL 2D73A 2BRQA 43CAB 1HF6A 3ZU8A 3N29A 1A0EA 3P3TA 1OCWL 2V37A 1PQZA 3LKNB 1W9UA 1F6AB 1DQLL 2JB6A 4RFNC 4H00A 2NY0D 1UKTA 4XP4H 1F41A 1Q4NX 4AGLA 3ETBJ 3INUH 3UY7A 5IGXL 1OP5H 3TCSA 3QFWA 4Y19B 4PCYA 3FT3B 1IARB 5F9DC 3KDOA 1QK0A 4GK8A 2A6JA 1YAZA 1DHPA 3EEZA 1CDHA 1TF4A 2GQ8A 1DSYA 2AGJL 3LS9A 2XG4A 1MCKA 3QWRD 4P7QA 5B3JF 5CBIA 4RCXA 2XPYA 4QHKI 3LKPA 3FOMB 2R0KH 3IVSA 3LD8B 2FEEL 2HUEA 1UWEL 4NC1C 2O72A 3SKOB 4AMAA 3JUZA 4PGZA 4RMVA 2J9YA 5E9DA 2AV1A 2NWSA 4CW1B 1ETZB 2NYZA 2WXNA 3OHXC 2V9QA 4X7DC 5JIQA 5JO5A 1U2CA 3EBIA 2YJLA 3QDGD 1OXYA 1XYMA 3EOSA 2REQB 2BSTB 3BCJA 4PJ5E 1QBLL 3VAVA 1MFEH 1BAFL 3VFOB 2P9RA 2H6UA 3PB2A 3QIUC 2V3EA 5E56A 1DQTA 1H8NA 2F5AL 3WH8A 2AK4A 1WBZA 2APWA 2FH6A 3QUYD 2DMCA 3MMEA 4KROB 1A1MA 1UA6H 2XWBB 3WF1A 4P5MB 5CEZD 1CLZL 2PO6C 4QDGA 2Y24A 5ABFA 4A2LA 1LK2A 1WIUA 3A21A 4PBVC 2BOCA 3TYGH 2ZRXA 4NO0B 5C7VA 3CN2A 1OAZL 1A65A 5CPOA 1KIUB 3REVA 4HJ1A 3CD6B 3SKMB 3GRWA 3APYA 2WXJA 5FOOA 2ZYFA 3FCBA 2OPCA 4NM4H 3PWVB 3OKLA 4X6CA 3V6OC 1EP2A 2YW3A 5FA6A 2ESVE 3WNCA 5K7JA 4XNQA 5I0VA 4I9WE 4ATLA 1B4EA 1GCYA 3VG0H 1ZALA 2GBVA 4M3PA 5H2BB 4OZGF 3ATAA 2A21A 3FU9A 4DGUA 1XL6A 3FPYA 1AZCA 1VFAA 1KCSH 2YL6A 3A6CH 3L17A 1UWSA 2CIKA 1AANA 2WYRA 5IJKA 4GUCA 4N0UA 3FFCA 2V5KA 3F7LA 2ZVRA 4UDTA 2XM2A 2XUCA 1LLZA 1F11A 4ZX5A 1KV3A 1FGNL 2IBGA 4ZGQB 2NQ3A 3O3AB 1RERA 4RJLA 2LFGA 4TU1A 3U7AA 1N3NA 4D8OA 4PBWD 2Z00A 5I1AA 4XBMA 4DN3H 5F2GA 4L7ZA 3RJOA 1LBLA 2OS7A 5BQ7A 3MLXH 1CE6A 3GT6A 1KBBA 5FHAL 1DJZA 2HT3D 3H3PL 3H12A 4NJ9H 3L95B 1AQKL 2OFQA 5ERWA 3ICJA 3LDBC 1K7XA 2E7HA 4FX8A 1BMGA 1AW1A 2OEJA 1XT5A 3TA3D 1C3FA 3QNXB 3CK5A 3HO8A 1G43A 1KC7A 4EUPB 4U6YA 3KEDA 1SOKA 3CFNA 2AJVL 3HI6H 1GZPA 5D71L 5DMKA 2ZX8A 3PWJB 1ZLEA 2IKGA 1OSPH 3P5YA 3MB9A 1XDTT 2EABA 2JE8A 1EEPA 1VFBB 4YHPB 4WUIA 4L4VB 3WU1A 2VLMD 2CPUA 3H4GA 1OARL 3BP4B 4P1VA 2H9GA 3RFZA 5IYQA 3GZKA 1XYCA 3CAFA 2GVJA 5HMEA 5DZAA 3WL9B 5KOVC 1JNYA 1QPKA 4LUTA 2H0FA 4FLSA 3X3GH 2FX8L 2QHRL 4HV8A 5EFIB 2VYOA 1E6ZA 2CF4A 2WJDA 2C77A 1MXDA 3BPLC 4Z4YA 1MJJB 4EIUA 3NZ8B 5GS0C 2DFAA 1VERA 4JFOA 5KTEL 4HU0A 1HYRC 2F38A 5H37H 2ZXHA 3GI8L 2D3JA 2PURA 3ZK0A 5GZND 1N8IA 4I18B 5E2VH 1CXLA 2YEZA 3QDHA 2I07A 4A6YB 1UM6L 1AK5A 3WD1A 3LLXA 4CU8A 5BMWA 3B83A 1MRCL 4HIEA 2DTSA 3W9DB 3UP1A 2PXYC 1N18A 3C2OA 3VXUA 1W54A 1NGXB 1VHCA 1ASPA 3UJRA 5A8AA 5MHSE 3CDCA 8FABB 2YPLA 2OK7A 2WGXA 4B3KA 4DBWA 5ILTL 4DJEC 4Q14A 2F8OA 5CH9A 2VWEC 3VDHA 3NFSH 4B43A 2ALRA 4ZCMA 1QFWI 4NAQA 1XSOA 2AEOA 1DIEA 5HHOE 2BP0A 3V76A 4MKVA 5KBLA 4HB7A 3TUUA 5F1OB 2LAAA 4GY0A 2VH5L 3RLVA 2J57A 3BGGA 4X7FA 3EA1A 2J8UA 5I9QB 3QRGH 3NQGA 1S5IH 1XLEA 1FO0L 1S5HB 1TA3A 1MG2C 3NJKA 3H21A 2NXZC 2WMPA 4O50A 3HB3D 2B2XH 3ZMNA 4K7FA 1KBGL 3TQVA 5FYJE 2NW3B 3MCNA 4Y7EA 4I2XB 4GI9A 3KM2A 2X2GA 4XPBH 4QXUL 1OP4A 5DQ9A 2BSED 4RDLA 2C3HA 4PJFA 3WKNA 3QJOA 3Q2LA 3S3BB 2CBUA 3QYMA 5EFDA 3JV6B 3T2LA 5D9PA 1W1YA 5A8QA 3NSYA 2PUQT 3A3XA 3M47A 1PJ7A 3CCUB 4LHUG 4PRBA 2AHOA 1I9IH 2VNHA 4HU2A 4N2GA 5GV8A 1KGIA 3CU7A 1PY4A 1YN6A 1ZHNB 2XFFA 4IGBD 4X99A 4WF7A 1RSYA 1U8QA 3GZPA 1X3DA 1WTHD 4ZW3A 1MSSA 4PVBA 4FLHA 1C7SA 1VGEH 5T9CE 1A9BA 3WTSA 1LILA 1MELA 1KULA 5K4ZA 1A5KC 3CH1A 3QHFH 4RDQG 3TH3T 4PJEE 2YCIX 1I60A 1RY0A 1EDHA 1QNQA 1AD1A 3QG7L 4AZ7A 2VR3A 5CC6A 5FHBH 1H19A 3CZKA 1LEKB 3UWVA 4N90E 3K6SA 2ZQKA 4WZ9A 4NZ5A 4LIQE 3WENA 2A6DB 2IG2H 3LZLA 2HFGL 3SCPA 2EO9A 5HYQB 4TVPH 5C0AA 3MLUH 1CK0L 1CE1H 4GRMB 5LN4A 2XSAA 4R88A 5DEFA 4XXDB 4RH4A 4D9PA 3FF8A 2QXWA 3MOQA 4LL4A 1I85A 4BF5A 1KFJA 2AXWA 2V3FA 1R5IB 5IEKA 4E41A 3TFBA 1BG1A 3TPUA 3EFOB 2VM3A 4NQTA 4HKBB 1N0XL 1YBQB 2CC0A 3N1MC 1B3VA 3WDRA 3I9AA 4OBSA 4YDLC 2Z6FA 5D7KD 2NY6D 3BIKA 1XXDC 4IGNA 1H9VA 3AOFA 4W9JC 3V4PL 4YFDB 4Y19E 5FJOA 1GYWA 4FFYA 5DK2A 2X2YA 4J6RH 4XNYH 3VOIA 3PE9A 4LDCA 2J75A 1DWIM 1FJ1B 1E4KA 4MAYB 4A3QA 2WMFA 5KSBA 1I8JA 4C6FA 1JYWA 2WO4A 3MWCA 2V2WB 4EIBA 5TIMA 5D2NB 4PR4A 1PS9A 4E9XA 4K15A 4E2DA 3HE6A 4S2BA 2XWCA 2O92A 4GJTB 2WBJD 5E1AA 1MABA 3F7JA 2XVGA 2FJHA 3UAFA 1YEIH 4R7LA 4PG9A 3UZJA 3CQFA 2QSQA 4PULA 1IX2A 3MVSA 3P0XA 4KPHL 4DT2A 1KZQA 4PRPB 4NG3A 4ZT1A 2UZIL 3JTSB 4CNTA 5C0CD 3W71A 1VENA 4BUQA 4L0ZA 2VXTL 3WNOA 2FWSA 2IDFA 3L65A 4CN1A 3W53A 1JV5B 1KB5B 1S9YB 2LU3A 3N6QA 1JPKA 5I6XC 5CP7B 3VNVA 1DLHB 5J13B 4H9TA 1IT9H 3FT1A 3CMJA 4BHUI 1BVKA 2VM9A 4EOUA 2DQIL 3RIFF 1WE5A 3L12A 3W5UA 1MZHA 4LLDA 4G7FA 4FNTA 4Y2DA 3GMNB 1W1IE 4HU4A 4R83A 5H8UA 1HNYA 1NMAL 3N91A 3KHQA 4A4AA 2P46B 1XGQA 3RCNA 1EJOL 1H41A 3DI3B 4JQVA 4O4YL 2ZZ7A 4AV4A 4OQTH 4R7NA 2WVVA 1OB1B 1I1RA 4N3UA 1UYWH 1IEAB 1XBYA 2VEFA 4GRLB 3NH7H 4MZIA 1A6AA 5CO1A 1G4EA 2AVFA 1YAIA 4PJHF 3QZBA 5KYUB 1J9QA 3EDDA 4PTMA 2GBTA 4GXWA 4GRSA 4LTSA 3H8NA 2BSRA 3TBYB 1E5YA 4Y9OA 2QVHA 1T5XB 2IPTL 3T3MF 2ZL7A 1DQDH 3RX3A 1YY8A 3TM6A 1F1DA 1S3KH 1PG7W 3KM1A 1RLCL 3FFOA 4HWBA 4CU6A 2DQHL 3EAUA 4RMSA 4KUCD 5EA0L 4MQXC 2YWZA 4M7SA 4R7XA 3KVDD 2OOFA 3C5ZD 3QPYA 2V8MA 4UFKA 4HK0A 3U7WL 4BQ2A 4P9MH 3UPBA 4GY4A 1O6VA 2O7QA 4XO3A 4AENB 5I71B 2IPUK 4X6DA 1OGSA 2WM1A 2N4IA 4GLRH 3L81A 3GSQB 1EERB 3WTUA 1G9NH 3FDWA 3TIEA 3MJYA 1YEFL 3AI0A 1KXTB 1BZ8A 5E4AA 4OVVA 2Q1EA 1JD7A 3X17A 4WWOA 2X4TB 4A3RA 1KTVA 4AZ8B 2GK6A 5FD0A 1DJXA 4OAWA 1M04A 5IJCC 4M1BA 1AZBA 2LTQB 4WY7H 2CZEA 4TSAH 3C2AH 3I10A 2DQFB 2P24A 1FH2A 4A8RA 1J8KA 5KS9F 2VGFA 1QR4A 3V55A 3DX9B 4JG0L 4KK5D 1GAQA 5F0JB 4N2KA 3NIYA 4CC0A 4QXVA 1XC6A 2EDQA 5KSVB 2HN7A 2BTMA 4DQWA 2ATPB 4QYOB 4L4VE 1H85A 5FF3A 1O7AA 4OZIB 4JFTA 3UY8A 2BWIA 1EXBA 1INEL 3BZGA 4AQ1A 1RA0A 2G8ZA 4FG4A 1XF5B 5KBNC 3MV8B 2Y2TA 4KGJA 4Y9PA 4HWBL 1IBZA 1IXOA 3EOBB 5C7XL 2W8CA 4AZIA 1I45A 3ECUA 3SEPA 2IH1A 3V4UH 5IW6B 3V5DA 5H1WA 4QHYA 3OMAB 2AKZA 1F60A 3AQXA 4N4PA 4Q2ZA 2WSRA 1MRZA 3FA4A 1IEQA 3S6TA 4NWTH 4DESA 4NN7B 3PUGA 1RAKA 3BY1A 4KX7A 2QUUA 5EEYA 5LNEA 2V63A 4JKPL 2EJ1A 4XO6A 1KLUA 2VJJA 4ZI8A 1OG6A 4GCAA 4NZJA 5KSWB 2BVDA 3OR6B 3AYRA 1G4SA 5KYWB 4EPKA 3QXDB 4FFVD 4GC3A 1R7OA 2AKRA 4Q7NA 2ZKWA 1Z0NA 4ENEC 4XCFL 3TLLA 1KPUB 1F58L 2DTML 4PRID 4R7OA 3NMEA 2Y1YA 1R17A 1K3ZA 4ICWA 3SPVA 4DAFA 4JM2C 1AGCB 3SYCA 1XG4A 2W63A 1SVCP 4ZQMA 2Z7KA 3WFZA 4JTAA 2NUYA 2QQKH 3P2VA 5C0NC 5DA0B 1DBJH 1E5NA 1GOWA 1D1NA 1FVDA 5KN5A 5M95B 1NTHA 1WV7T 1ADSA 1INDL 2AS5M 4UZGA 4X4XB 4DO5A 1SFTA 3ZZ0A 1SEBB 1MIMH 2CJSA 3H8AA 3TZVC 2EC8A 1V6TA 1L8NA 1AYOA 4I2XE 2IAMA 1J1PL 1VB9A 5JPNB 2H2SC 4AC9A 4V2XA 4GG8A 3LZRA 3TC9A 3VYPA 5FNZA 1XLLA 2CLEA 4K1WA 1Z3GH 3MW7A 3OKDA 3UCRA 4TNWF 5LHDA 4MDIA 2E1RA 3BSGA 5KAQF 3MSRA 1F4WL 3N1PC 2HSAA 1MXSA 2ITCA 1LO0L 2J24A 4M8UA 1QR7A 2A6KA 2X7LB 3CFJA 1A2YA 3GXMA 1BECA 3M17B 4JPSA 1I9JH 3WHE0 3BJTA 4EI5B 4I4WB 3EWDA 3RVXD 4KRZA 1EPFA 3CNYA 2J7CA 4DF9A 3QQ9C 3GXIA 5IREA 4NX5A 1YNTB 1CF8H 3JU2A 1FA4A 3CDZB 2DWTA 1M1XA 3KBJA 1FWHC 4NAMA 3P4MB 5T91A 2Z64C 1WT5C 2KYIA 1W1A1 3G6JF 4O02H 1BZDA 1HA3A 3WJWA 1DVSA 1U36A 4RFEA 4XAZA 5C09D 5B4MC 4NGHL 1V5JA 3FQUB 4E38A 5JW4N 2VZTA 3ZL1A 2WZAA 1GAFL 2BZDA 4K3EL 4LASL 4BQBA 2W66A 3O3DB 3UR8A 1XE1A 5CKAA 4IX0A 1MUCA 4D9LH 2FWOB 2R4SH 1D7DA 4OWGA 2H8PB 5ACZB 7PCYA 4ZDHA 1MFVA 1CNEA 2K70A 2H3XC 1KMHA 1OAQL 1XF3B 3R13A 1XH3A 1Q5MA 5CZRA 3GIRA 3LS4H 4AWUA 3QIBA 1NAMA 4NOFA 1OKEA 2UX6A 3IRCA 1T5KA 2BF4A 2OCJA 2EECA 3HVDA 1JPGB 4YNGA 4IICA 5ICYA 1T99A 2YLKA 1LP9F 1JHKL 1ZVSB 4R96B 3DOHA 4M9OA 4FD0A 1L9WA 1LK3H 2I56A 5L4IA 3BOLA 3VO1A 2B1HL 1SLVA 4OGXL 1F8TH 2CBIA 4UINL 5GSVA 3GK0A 1PQZB 4EXQA 2JB6B 2A0NA 4PH8A 2VITA 1J5HA 3EOYG 5HPMA 5HA7A 1E71M 4DFIA 6PTDA 2N0KA 2CCLA 4DP7X 4MKSA 4AMXA 4L1GA 2GJ6D 9XIMA 2BMKA 3IBOA 3HFYA 4JMQA 5JIMA 2A6JB 5D4YA 5IROC 5DEJA 2R4RL 2FTAA 1XF4A 2XG4B 4JO2H 5FJIA 5LBSH 1SEQL 4IHBA 1GW1A 5LGJA 2VW4A 4XNDA 4FK9A 1XIWC 3CB8A 3LKPB 2W9LA 1RJRA 4XNZC 4M8QA 5EOCL 3VB8A 3FB8A 4OR1A 3V5HA 3ASPA 5E9DB 2AV1B 5MERA 2OR8A 1NEUA 3NZ1A 4NFDA 5FCZA 5GGVH 5JO5B 4LVOC 3E0FA 3UJEA 4HIZA 3U2IA 3L4TA 3Q48A 2CBVA 3V7AG 3QMSA 3QG6A 1G5AA 2BGJA 4PRPE 3GVQA 5L4MA 2CNYA 3W7DA 3GBMH 4AIBA 4IBQA 5HVWA 3VKAA 2NX5A 2CRMA 2GIMA 3WE6A 2YWFA 5C70A 2AK4B 3H3KA 1WBZB 2RCSH 4IIEA 2VCOA 3MMEB 4N0FA 1BXBA 1A1MB 3AGVA 1OANA 1XTMA 3P11H 3FKKA 2QVIA 3R12A 4LJ3A 5ABFB 4MWAD 3EOTH 4FEMA 4O00A 1LK2B 5CPTA 4C0SA 2BOCB 1K9MD 4JDZA 2MCPH 2Z7GA 1MFCH 3MRHA 1JRBA 3QC3A 3WBXA 3REVB 4OFCA 4W6WB 4Y9MA 4KKLD 3CNKA 2A9MH 4YHIA 2HX9A 3OKLB 1LL1A 4X6CB 1EP2B 3KS0H 1N70A 1BQHG 5ABHA 1R38A 2XX1A 4XNQB 3M9YA 4YK4B 1AHWC 4XUGA 3Q1SH 4P3WA 2WXHA 3MBXH 4R26L 1WDSA 4ODHH 3TBSA 4A38A 3WNBA 3GNPA 4LALA 1CD0A 2D0FA 1VA9A 1VFAB 4JMXA 3GDCA 3EZ8A 2CIKB 2VISA 1YPXA 1HTYA 4N0UB 2YL5A 3FFCB 1EJUC 5D1XA 2TRSA 3EKCA 3U9UA 4UDTB 3QLDA 1GVYA 1F11B 4QXGL 5KVEL 3Q9PA 5KYYA 2XZOA 4DVOA 4ZOAA 4WNSA 5DMGD 1N3NB 4YLQT 2Y7LA 5IHZA 2I60H 5I1AB 2DM7A 5CAYB 3UFYA 4FHKA 3LNIA 1MREL 5CN1A 5ENLA 5BO1H 1U3HC 2Y5TA 5BQ7B 1CE6B 2WQRA 4ACZA 4GAAA 4LAOA 4XLEA 3BDYL 2J1ZA 1MCWM 1NCHA 2X4PB 1OX6A 5ERWB 3WH6A 2XQYG 2CLVA 4YBQD 3K4AA 2BSBA 2GC7C 4KRMB 4U6YB 4D6HA 5DD0L 4DVRL 1V0MA 4IL0A 1OC7A 2IADA 1A6VL 3QHTC 2O9PA 4AMKH 1GZPB 5DMKB 3DJSA 3S46A 2D74A 5EMYA 4HD5A 3LRSA 3ZXWA 3UESA 2F6KA 5DJ8A 2OBGA 1GGBL 3FAXA 2BP5M 2PR9A 4WK2B 1SR0A 2FTWA 4FFZL 1JRHL 1OD7A 4ZD3H 2B7DT 2FLRT 3BI9X 3QAZC 2H9GB 5FGSA 3RFZB 5B1AB 3U2ZA 3G22A 1R0AL 4LAUA 4OZIE 2X6BA 5JXQA 3T4YA 2DICA 2FHBA 1VP5A 1HZHH 1JK9A 5DD5H 1QNPA 3ZKMD 5BOPA 3EW3B 4LAKA 1E7UA 1A6WH 2P49B 3ULUH 2J6WA 4LUTB 4RE3A 2WPDA 3G0SA 1QGZA 1Q0YH 2W67A 4HV8B 3CQJA 5EZLA 4EO5A 2ACRA 5D7IF 1FHDA 1IGCH 3C6CA 2YSWA 1Y8BA 2ATSA 5F0MB 4N2IA 4HCGA 4JFOB 3ABMB 3AC0A 1C5CH 1RQ5A 1UT1A 2OYLA 4DEUA 5EPMA 2X5PA 5AUMA 1O5DT 4Y9EA 1DE5A 5B22A 1LQSR 2YEZB 2I07B 3SQSA 1DQXA 5H8MA 4HIEB 1NCBH 2QTVA 3WGVB 5I3IA 1QFZA 3VXUB 3KX6A 3G9VA 1AC0A 5I5RA 4WX2A 5F7KC 4K07A 2YPLB 1TPXC 2HCJB 4HK7A 5DCCA 3OAAA 2JF1A 4NZDA 3VWJA 3N44B 2VFEA 2DIKA 2BP0B 4QTIH 1KYAA 5FUZH 4L8SA 2GABA 4XORA 3GEFA 3AZUA 4UT9A 3BZFA 2J8UB 3EYPA 1EHXA 1TA3B 3MV9D 4YHEA 3A1PA 2WMPB 3LPGA 4ZUVA 3KOYA 2IFFL 3ULVH 4DXKA 4K7FB 3RDTA 1HEZA 3UZZA 1TCRA 4XQFA 3KBEA 3BCDA 5C86A 2NYYC 3VACA 1J2BA 5EEXA 2QPSA 5DQ9B 3B2DC 2ZPKL 5EZIH 2PLFA 5K5YA 1A7BA 3NFUA 1NDGA 4PJFB 1JCJA 2J62A 1QSZA 1SW7A 4JY8A 3GVVA 5FWRA 3QFJA 5E8NA 4P9HL 3HAEG 4NI6A 3U0HA 2HKHL 1I1YA 3H2PA 1IC7L 3GTHA 3ZZQA 4ZQOA 2J8OA 3VOHA 4MHBA 4PRBB 3KWXA 1YJDL 3RVVD 1YN6B 4FL4B 4X99B 1Z5HA 3Q6GL 4QS5A 1JZ6A 1U8QB 4OM0L 5K2ZA 4JKLA 1IJEA 4LSSH 5F97E 3R06A 3PBMA 1A9BB 3A8JA 1ODAA 2QCGA 4FCHA 3ZR4A 4TQIA 4A2HA 3G08A 4LEBA 5CJNA 1KJ3L 3CH1B 3K71A 1QPNA 4ZTPH 4DQOL 2G9KA 5BW7A 1B0RA 2AK1H 2QJDA 4UT9L 5DCBA 1BXVA 2VUKA 4QRFA 1S8DA 3FUEA 2RR3A 4MNMA 5DMJB 3QFSA 1UMLA 2C1GA 4KV5F 1ZSHA 1VR6A 4AY1A 3K6SB 3FQ1A 3DO7A 3YPIA 3FHAA 3QORC 1E73M 3LEVH 1TWSA 5C0AB 1PSKL 3FU7A 1PTDA 4G6IA 3BGAA 1LRTA 5DEFB 3PM6A 3HPAA 2WPGA 4PWIA 1T6MA 4JHWL 1EA9C 1SBBA 2VQ4A 4DBEA 1LOLA 3PBVA 3FKSA 4HHAA 1M1SA 1FCQA 5IEKB 1E8ZA 4E41B 1JFXA 3W02A 1OY3B 5BOZG 1QG3A 5FFGA 2FBJH 3PAVA 3UXFA 5FFLA 2H0EA 1E0WA 3GSMA 4OHQA 4KMTH 5E24E 3OR7A 1B4RA 4AE1A 3BIKB 5DY3A 4Y8DC 4BHYA 3CHQA 2C9XA 2VDRL 3NQ8A 4YTQA 5DK2B 1AJ0A 1V6VA 4R7VA 1RK1A 4U9UA 3G5VA 4S3DA 5KSBB 2XBZA 2GJKA 1J9CT 3O11A 2VDQB 2CKSA 1MCBA 4R97B 1OFRA 2WKJA 5DFAA 3Q8AA 1NLBH 4YE0A 5J6SA 3C09C 1ZE3C 4HT1H 2PO6D 4HQVA 3GBDA 4RGOL 4RV8A 1YVLA 2D2HA 3LQAC 5E1AB 3EB2A 2RHEA 2FJHB 3UACA 1YEHL 3PWPA 5E9DE 5U4NA 4PG9B 1K7EA 3K2UH 1VFHA 4WCYL 4JG5A 3L7RA 5EOCJ 4KRLB 4X6EA 4YTUA 3MNVA 5D96B 3KRUA 3ARBA 3N11A 1T6WA 2R2CA 3S8HA 3SDDD 1D8CA 1FNGA 4WI3A 2AXJA 1O7VA 1FBIH 5GJTL 2MKWA 4BFAA 4XZLX 1KB5L 2AK4E 3ZKNC 3D30A 4E9VA 3I6SA 3AREC 2NXYB 1BVKB 4JNZA 2HBVA 1W72A 2DQEL 3CMGA 4B7LA 1QVFB 4MRCA 1R3YA 4LLDB 3DMMA 4B96A 3SBWA 4V1DD 2XLLA 4L6DA 2X38A 5AVHA 4ES8A 4Y2DB 4O1DA 3M0MA 3V1HA 3P8IA 1IBGL 3FV9A 1RK0A 3GZQA 4CMHC 3SN1A 1Q9SA 1XGQB 5B38G 3DDMA 1A4LA 2YD8A 2JCWA 4OE7A 3B04A 1UCBL 1B2RA 4R7NB 4TOYL 3GSRA 2ZXAA 1LDPL 1JUKA 4EPDC 2WANA 2WVVB 2Z3FA 4UUJA 5J12C 1T7VA 3M7WA 4M6NL 4X6CE 1A6AB 5TE6L 4ZSUA 3CZUB 3NPZB 5IYNA 3X3FH 1P6AB 4TQHA 1BWKA 2BSRB 3AAZA 2HLDA 5T3XE 5FM8A 1YY8B 1LO2L 4WJ8A 1HHIA 3LRMA 2VEIA 3MACH 3ESNA 4DP6X 2Z31C 4N0UE 2UYLB 5HWNA 3FFCE 4AKOA 3L5JA 1WA0X 4XLCA 2YR1A 4JFXA 1N82A 1KYDA 4P7RA 4PC6A 1SDDA 2QR0B 4PRWA 4HK0B 2FATH 2ENYA 1T89A 3TO4C 3U9IA 4X6DB 4WUKH 3OAWA 2Z27A 5DR5H 4E4FA 1XZWA 3G6AA 4H9VA 4YLBA 1AC6A 3TIEB 5IHUH 4TMWA 3PZTA 3DESA 1W72L 4NWUH 3CO4A 3K7UA 1ID2A 2QQNL 4JX4A 4HC1L 5A5WA 5DT1L 5IF0A 1S7WA 3KPMA 2VLKE 5HHXH 1AH1A 3FVDA 3BIAX 4OAWB 4WEMB 1BGAA 4B50A 3NFPA 1AG6A 3K2IA 4HSAC 2DBJA 3E0IA 2YXOA 3RRAA 1FAKT 4B2DA 3VQ1C 5GS0D 5IQ9A 3QV8A 4L5FL 4ABQA 4X8JA 4GAGH 4CL7A 3CBRA 4FQIH 3KBWA 1OFEA 3CQKA 4PJAA 1QMUA 3CFCH 2NZIA 1LO3L 5AYBA 4YIQA 4WW2C 1CNFA 4AQ1B 4AVJA 1ZM9A 3W1MA 2PXYD 3VNYA 4M7KL 1E9ZB 4B16A 1E9OA 4LCUA 1UMKA 4RRPA 1SXZA 1UT9A 1OC6A 2WNQA 4DGIL 2IH1B 2C15A 4KMQA 4DJED 3V5DB 4C4UA 4APQC 5CR8A 1JHLL 3T71A 3MTRA 3O4OB 2CO6A 1CGSL 2RMNA 3PRZA 1ZHBA 1HKMA 3MJ7A 1YQVL 1KLUB 5GSRA 5BZWA 5HXBA 2VXVL 2NXZD 5IVXF 4BD4A 1EAPA 4FG0A 3PPEA 4ML4A 3F85A 1DN0A 2AKRB 5CN2A 1W2PA 3V5FA 1IXNA 1XYAA 3VXUE 4G8GA 1AH4A 2K3HA 4N1CA 1J9ZA 4XNXL 3LQ6A 2YPLE 5I06A 3SPVB 3F2BA 1Q1JL 3TNOA 2HLEB 3A4JA 4H44C 4HS8H 4RGNB 3UO1H 3ECQA 4TMTA 2VENA 2OCFD 4TPRH 2OCCB 3T55A 2PWFA 1SF3A 4WEBL 1TE6A 1RFDL 3F4CA 3FT0A 5F2FA 4XBEL 3MV7E 2ZWKA 4WGWB 2Y88A 4M0XA 4WSKA 1I4FA 3HVNA 2FL5A 1FVDB 4J12A 5KN5B 2J8UE 4ZQPA 1PFCA 4YHOH 1R8LA 2AAVA 2Z4TA 1ADOA 5CGQA 2MANA 3P2TA 3DXIA 2H3BA 2OTUA 2A3LA 1YQ2A 2NY7L 1BQGA 3TXAA 1TJ0A 2YGYA 2IPWA 5TGBA 5T3ZE 5I82A 2FHCA 1DJSA 3DEQA 2IAMB 4EQ2A 4CJ0A 2IV8A 2BSDA 4HN4A 4QEHA 4GG8B 3OKDB 4MDIB 3CHDA 1FHNA 4EZMA 2ITCB 2UY2A 1YN7A 3JZYA 2A6KB 2QKIA 1UUMA 1YEEL 3CFJB 3WAJA 1A2YB 5FGBC 3WEBA 5BV7H 4LSQL 1PAMA 2HS8A 5AC6A 2DB8A 2CG9X 1UM5L 4X8CA 3S2MA 2G2RA 4PJBF 2V5YA 4KEZA 1M1XB 4PCTA 3T8LA 1ID5I 4L6HA 4W1TA 1F3XA 1MF2L 3E9AA 4C90A 4DLMA 4NYUA 5J11B 2YWHA 3GJFA 3P77A 3QBUA 1B3JA 4IMCA 4NO2A 3NSXA 1P6FA 4RFEB 4Q4IA 1JNNL 1IKNA 1TZHA 2FB4H 3FA3A 3DOPA 1PS3A 4G6ML 1N55A 5TK2A 2YWYA 2HJFA 2WGNB 4FKKA 2C5BA 4GGBA 2QN6A 3U9WA 2LT9A 4Z0BH 3VTMA 3WK2A 4ZDHB 5DX7A 3LXUX 4G5ZL 1DQMH 2OXHA 3IJDA 2CR3A 1MFAH 1AH3A 5A6IA 4S3FA 1XH3B 3HAEA 3OX8A 1NOUA 3C08L 3QIBB 2EADA 2X3UA 4PGOA 1NAMB 4NZ3A 3KJ4B 2YQBA 5C0AE 4X60A 2HVNA 3AT9A 4IK7A 2EUVA 1TE1A 1AI1H 5ICYB 2EIDA 3QDGA 4J3WA 2FEEI 3NGFA 5GSVB 2ZT9C 3QRBA 3DX3A 2IC2A 3LS5L 2BB0A 1DJGA 2VITB 4E41E 2NY4B 2BS8A 5HPMB 1R2TA 4XAGA 3T0EA 4QE5A 4ES4A 3EO0A 3PVFA 2BMKB 3DI1A 4MMXA 3LQGA 4YPGA 3L3OC 1CFTA 1GORA 4N2CA 3WY9A 5C07D 2CLKA 4NS0A 2FVLA 1XF4B 2VXUH 4MVBC 3SOBH 5LGJB 4U6TA 3CN1A 1TVLA 5KSBE 1RLBA 4R8WH 1BHGA 4JCLA 4M8QB 3CHVA 2EH8L 3FB8B 2XYLA 3TZNA 3V5HB 1V0FA 5MERB 2DM2A 5ID0A 1OM9A 3DURB 3D3AA 2YGVA 3ARGC 1MJ8L 3GS4A 2AAMA 3QG6B 4MIMA 5EU5A 4N2YA 2VEPA 1OADA 2WAQA 4KY2A 4M7JH 4DN1A 3B4YA 1T7ZA 1IC0A 1MHHA 2A85A 3SO5A 2NX5B 3AIVA 3WE6B 5LNGA 2C26A 4R71A 3PTMA 4R90H 2DQCL 3KLAA 1CFVH 3NPWA 4N0FB 2R6OA 1ZTVA 3UWUA 2VGLM 1TR9A 2YX0A 1EVTC 2QS8A 1POKA 2AMUA 2A38A 1W56A 2OQYA 2FT8A 2DQDL 4JY5L 1YRRA 4JDZB 1IR1A 4POZC 1QNVA 2XKNA 3MRHB 5AKTA 2DSZA 3ZZSA 1TVDA 4P2CG 3P3RA 5FW7A 4MQXD 2YIHA 3G8RA 1H5VA 5KMYA 3QVAA 4YHIB 3GRWL 4U1SA 1HCZA 4I85A 3DBNA 4JVPA 4DH2A 5EWIL 4N8UA 1Y6KR 3M0HA 1CDYA 4J8RA 3VRIA 4A2DA 4RZBA 3SECA 1BEYL 3ESOA 4NPKA 4JPGA 1I3UA 4KUZH 1A1NA 1X4ZA 4BSJA 3TBSB 5FFOA 3CLFL 5FW6A 3LUTA 3T2OA 2CIIA 3AIEA 3LNGA 1UOKA 5T3XL 2VISB 3H9SD 3U4BH 4J6IA 3PBUA 3V4VH 2B7OA 3TT1H 1IGJA 3U9UB 5HPCA 4W9DC 4PMFA 1NCNA 4INFA 5KYYB 3ZS4A 5IHZB 4YJZL 5FO1A 1H51A 3LI0A 4HPHA 1X5IA 2Y5TB 5F4JA 4ACZB 3ENLA 3R1ZA 1YJ9B 1W1B1 4X6DE 3HGJA 4M80A 1MFMA 2CLVB 1QUFA 4ZX6A 2FZMA 3WJJA 3QI9C 1F3TA 2P48B 4AD0A 3O6DA 1L6PA 2IADB 4W89A 1ZCCA 3QFTA 4B5TA 2BIOA 3WUWG 4EJ1C 4JNMA 3UTPD 3GM0A 4NZUL 3WEMA 5MKGA 5AC8A 3GNRA 1JNLL 1XCWA 3LRSB 3QIWC 1CQXA 5C0BD 5FSDC 5DJ8B 5KSAC 2QUTA 2DD8L 1T2XA 2X89A 4HA4A 2CBJA 1FORL 3ITLA 1Q38A 4LARL 1ZDSA 4M5ZL 3SKBA 3SIKA 3BDBA 3MYZA 4XPAH 2YXFA 1YECH 3T4YB 4RNFA 3MDJA 5A16A 1JK9B 3NA9L 1QLEH 1G1YA 1A8PA 3SGKA 5AVQB 5D6CA 3R1GH 1BG9A 4WI2A 4ES9A 2ZAHA 4Y4FC 5CWSA 4ENED 4EX4A 3U30C 4EDXA 4RMRA 2YRZA 4A3UA 4ZR8A 3OAYK 5CXPA 3Q3GA 2OSXA 5EZLB 1DBAL 3KBNA 3ZL4H 3OZMA 4JM2D 4HEPG 2DQJH 1SBSH 5SWQA 3U1QA 4GXVL 3L9BA 4AVIA 2A4AA 3STPA 3X13A 2KQNA 3QZNA 2EHHA 1LWIA 4AFYA 5EPMB 5AUMB 3EGXA 4ORIA 1E79A 5SX5K 4Y9GA 5C0ND 1EBPA 4AIXA 3LMZA 1A14L 2Y9RT 3GU1A 2VZ3A 4U1IA 3EH1A 3RI5F 1N6VA 1P4BH 3B2VH 1T80A 1MW2A 1ZK9A 3RPIA 3MCMA 2BOLA 3TZVD 5G55A 4IIGA 1O5XA 1HH9A 5L4JA 1FP9A 3LEYL 1YUKB 2H2SD 5D5MA 5AKQA 3VWJB 4KNQA 4HCRA 3THAA 1A4AA 1ZLVH 4B4DA 1RAMA 1EH9A 4OUIA 3BGJA 3UG8A 2Z26A 4L8SB 3VM5A 3ILPA 2E7MA 2O9OA 1TFPA 4IGBA 3SQBA 3BZFB 4AYEC 3W7PA 3W56A 5F7YC 4IPLA 4RR4A 4ZUVB 3QQ9D 4WI4A 3F7KA 3NQCA 1XB6A 3RDTB 1HEZB 3R11A 3FUFA 2R9RA 1TCRB 5T3ZL 1Z89A 4FHJA 1TG8A 1HCFX 1UD6A 5TDPA 1NDGB 1YDPA 2B81A 1YLOA 1HOCA 1RUSA 3SDAA 3QFJB 3BPNB 5E8NB 5B4MD 1V02A 3DFPA 3W76A 3ECBB 4L4MA 4PFEA 3EO9H 3EYVA 1I1YB 4LOCA 3MLZL 2CHWA 5AZEL 1YDYA 4XIAA 4JO1L 3LGEA 2XYBA 3NJFA 4OCXH 1QJWA 4KY1H 3EWXA 1ACYL 4DKDC 3W83A 3W7QA 5KW9H 4HMNA 2BRRL 4QV2A 1MZYA 1BZ9A 4Z23A 5BU6A 1IWPA 3G04A 2VDRB 5A6SA 5JYLA 1G7TA 3R06B 2CLIA 2E7FA 2VP8A 1AE6L 3O6FA 1A5CA 2X85A 4C54A 1EXUA 2PDLA 3W0KA 3G08B 1PBGA 4JM4L 3K71B 2X4SA 4XOEA 5K9XA 4JQIA 1VLWA 4O0KA 4AXNA 4KZDL 1TVBA 3ATYA 1B0RB 4Q6YA 4GFSA 4FN0A 4E68A 4GBUA 1A6UL 1U8CA 1Z1WA 1S8DB 2F19H 1TMCB 3IPFA 1OHLA 4PCSA 2Z0IA 4AEOA 3DO7B 1GTNA 2EEDA 4LPXA 2BVYA 5MI0C 5F72S 4OF6A 3GDTA 1RULH 3NQDA 1MW1A 2V5MA 3WXVH 2CO7A 4P26A 1KLZA 5IROD 3FU7B 3MLVH 5JH1A 1YIJB 1WIOA 4J4KA 3K6FA 3F83A 1XIWD 4WD0A 2YSSB 5CCJA 2NNAA 1HIML 2BMBA 4HHAB 5DMIL 3LBCA 2E6QA 2E5DA 2WSDA 3KTCA 5EF0A 3O3EA 1CDUA 1KIRA 4PYSA 5DUML 1F90H 5AFAA 4Z3JA 1EHLH 2V7NA 1T04B 3OR7B 3M8OL 4OFIA 3WH9A 5A40E 5IQOA 3CVHA 5TNVA 2WVTA 5AN9A 3U3HA 3LU2A 2C9SA 1DUYA 5F9JA 1F13A 1IU1A 2WYHA 4BZ2H 3AVYA 1RK1B 4WQOA 4FFYL 2X8RA 3G5VB 2GQ3A 3WTYA 3O6KL 2BGQA 2CKBH 2Q5BA 1SGKA 3CVBA 2HEJA 3O11B 3KDPB 3V52L 4U1GC 4JQIL 4DBUA 3S6DA 3G1XA 3B5GA 2VDQL 3OVRA 4GT7A 3NFNA 5GVJA 4IJCA 5D4IA 4ZXBC 5KVGE 1XVSA 1Q82D 3CRZA 2ZXDA 4KEVA 3PWPB 2YXMA 3HKZA 1R3WA 5KANI 3QP3A 1VCAA 4X6EB 3MNVB 3ARBB 4PFMA 1KK2A 2OB3A 5KVEE 1PHWA 2IALA 1FNGB 1BYBA 3T3PB 3FVMA 1BWLA 5G1TA 2F5BL 2CRZA 1JCTA 2VGGA 4TNEA 2NX5E 1AKJA 3QPEA 4KTEL 1EGZA 3ABZA 3V0TA 2HJPA 4L3CA 4AIUA 5B7YA 1VQTA 4NZ4A 1BVWA 3UCDA 1W72B 1M6UA 5T5FA 3DMMB 1NC2A 2Y4SA 4MXQC 2OJ1A 3TTOA 1AQMA 5EIIG 5E2WH 1UH2A 3U1PA 1DVQA 4X9FA 1RK0B 4TV5A 3HFMH 3CVHL 1BBDL 3NCMA 5D72H 4QY8A 2ERJC 4GQ0A 3VFTA 2TPSA 2FHFA 3CVCA 5CJOL 3KPLA 4EOWH 4P4KA 3HR5A 3UGUA 3GSRB 4K5NA 4EPBC 2QGDA 4UUJB 1U3HD 4RKAA 3W1AA 4P61A 2H0JA 3QUHA 1WD9A 4DW2H 4UZSA 3LLDA 4JEJA 2R1LA 3ZWSA 5AC4A 2H1LM 4AYBA 1KJVA 3AAZB 3RX9A 1MY5A 3ZMEA 4S3BA 1FV1A 2EYSA 1NBQA 2E9BA 3GTFA 3A8IA 3QKZA 5C08A 3GXUB 1HHIB 3IMSA 4KNSA 4KO6A 4F2MA 2CU0A