3BCFA

Alpha-amylase b from halothermothrix orenii
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
585
structure length
585
Chain Sequence
SLFLIESEPSTGASVSKNLTEIILIFSNDINKVSQLALTDLITDSDIQGIDYNIEGNKVIINNFSLEPTCNYRLSYEVIDIYDNHLQGYIEFLVNQSNYPQIPDQEVNHTILQAFYWEMNTGEYATEHPEEANLWNLLAERAPELAEAGFTAVWLPPANKGMAGIHDVGYGTYDLWDLGEFDQKGTVRTKYGTKGELENAIDALHNNDIKVYFDAVLNHRMGADYAETVLLDENSRDKPGQYIKAWTGFNFPGRNGEYSNFTWNGQCFDGTDWDDYSKESGKYLFDEKSWDWTYNWDEDYLMGADVDYENEAVQNDVIDWGQWIINNIDFDGFRLDAVKHIDYRFIDKWMSAVQNSSNRDVFFVGEAWVEDVDDLKGFLDTVGNPDLRVFDFPLRSFFVDMLNGAYMADLRNAGLVNSPGYENRAVTFVDNHDTDRDEGSYTVSIYSRKYQAYAYILTRAEGVPTVYWKDYYIWEMKEGLDKLLTARRYYAYGPGYEVDNNDADIYSYVRSGFPDVAGDGLVLMISDGTSGNVAGKWINSRQPDTEFYDLTGHIKEHVTTDSEGYGNFKVIKSEDKGWSIWVPVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Polyextremophilic alpha-Amylase AmyB from Halothermothrix orenii: Details of a Productive Enzyme-Substrate Complex and an N Domain with a Role in Binding Raw Starch
pubmed doi rcsb
source organism Halothermothrix orenii
molecule tags Hydrolase
molecule keywords Alpha amylase, catalytic region
total genus 198
structure length 585
sequence length 585
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3bcfA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bcfA04
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3bcfA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bcfA02
4CD4A 3SUVA 1VENA 4UQEA 5HXMA 3AIEA 2VZUA 4J3XA 4B16A 2XGBA 3CH9A 1WAWA 1K9EA 2VZOA 3N17A 1SYTA 2YLLA 5I2UA 2D24A 5I0DA 3VIKA 3DX0A 2A3BA 1XYZA 1KWKA 5KEZA 2BVDA 1NQ6A 4NF7A 2XWEA 1B2YA 4MJ2A 1QBBA 1HT6A 1HXJA 4S3KA 1UH3A 1Q6DA 3RM4A 3TONA 3PZMA 2EO7A 1UKOA 1V3LA 3PN8A 3H54A 3GXDA 1DWAM 3WNNA 1UD6A 1W2VA 1M7XA 1TCMA 1OBAA 4BS0A 1KQZA 3WD4A 4UOQA 1KXHA 3W6MA 1Q6GA 3B8SA 3OIHA 2GJPA 3L2LA 1JYWA 4H7VA 1E6ZA 2VRKA 3S5YA 2WXDM 1EO7A 2ZE0A 2F7RA 3LPPA 1H2JA 1E4NA 1EQPA 4OOZA 2W91A 4GZJA 1QNRA 1Z32X 1ISYA 3A23A 2XN1A 4PTMA 2J4GA 3LRLA 3SUWA 3MV01 1HX0A 1UYQA 1VIWA 3F5JA 1NH6A 1PAMA 2J7CA 2DIEA 3AICA 1XSJA 3WH6A 3BVUA 3AHTA 2WVTA 3T0DA 4ACYA 3FAWA 4Z2HA 2JFEX 1JF5A 4CD5A 2J79A 4FMVA 2G3NA 4DWSD 2OW7A 2DQXA 4R5EA 3CBWA 4A3YA 4BQ3A 3CHCA 1ZU8A 3VMPA 1E1FA 2DGAA 4W87A 2V5DA 5IXEA 2WKGA 3UG5A 3GXPA 2W92A 1UWRA 1MW3A 3LXBA 3MMDA 4PMNA 4D6JA 4EANA 3F5KA 4IPLA 1C8YA 5CQ1A 1QI4A 1W9PA 4HZ6A 4MNLA 1JZ5A 4MAZA 1UD5A 3L4XA 1OD0A 4R27A 3AFBA 2XFRA 3WFZA 2WLYA 3PHAA 4FNTA 2ZXBA 5CZKA 3KL5A 4FNUA 5FL0A 2GVYA 1J01A 1KFWA 1R87A 2CKRA 5LA0A 3HG3A 4HP5A 1GHSA 3GBEA 1HNYA 2WB5A 3DYMA 1HKKA 1TZ7A 3AZRA 2J74A 2PBOA 1KXVA 1JGIA 1DP0A 1HIZA 1V0NA 2OYMA 3CUJA 2EQDA 4AIOA 2G8ZA 4ACZA 3CZKA 1JD7A 1W2PA 3CPUA 4QDMA 5DMYA 1MFUA 3MSDA 2E9BA 4PMXA 3WNLA 2ZUWA 1QWUA 4C7GA 1UR9A 4FLRA 1UR0A 4MB4A 2V38A 1E43A 1R7AA 3VIMA 3RPMA 4MB5A 4GINA 1IT0A 4WKFA 1QW9A 5D8ZA 1EHAA 1LQ0A 1US2A 1TG7A 2XVLA 5ABFA 4TTUA 1QNSA 3I3BA 1BTCA 1TVNA 3EDKA 3GH4A 4CVWA 2XVGA 1V3JA 3NUKA 1BGGA 3OG2A 3D5HA 1XH0A 4Q22A 1CXKA 5BYWA 3EJTA 1WDSA 3AIQA 1WZLA 2X2HA 1HL9A 1SFSA 1UHVA 5I79A 5E0FA 3BUDA 1KR0A 3PZVA 3SUSA 4F9DA 1C92A 5GQBA 3WDHA 2WHKA 3GM8A 1R34A 2WBKA 5EBAA 3KL3A 1W1VA 1CXLA 1D3CA 2PWFA 4AYSA 5D4YA 4GZEA 3VDHA 3BGAA 3ZSTA 3PTMA 3VSVA 1ITCA 2VCBA 4Z2KA 1V6XA 3AIWA 1EOMA 3BZ5A 5A2BA 1R86A 1TQUA 3DHPA 1GJUA 4FLQA 3AHXA 1G9HA 4Z2IA 1UKTA 2OMYA 1O7DC 2CHNA 2GK1B 2ZX7A 1VEPA 5ABEA 1NM4A 3OGRA 7TAAA 1AQ0A 2YBTA 1WDPA 3MANA 4X0VA 4P7QA 2O9OA 2VR4A 3VIJA 5CLTA 2EEXA 2DSKA 1QI0A 4D6CA 1B3WA 4XZWA 4HOWA 2VVSA 5A8OA 1HF6A 5GPRA 1NWUA 3BXWA 3EMQA 1RH9A 3F4VA 4RE3A 4AXNA 1W9UA 2CHOA 3PZQA 4W7WA 4KRTA 4JHOA 4KGLA 3J7HA 3ARSA 2XUCA 5EMYA 1GORA 1V6VA 3SUUA 1GOMA 1VJSA 4CN4A 1U2YA 2V5CA 2OMZA 5I5RA 2G4FA 2VOTA 2F7QA 4EAMA 4XV0A 3DHUA 4UFMA 2ALWA 1GQIA 2XJ7A 1XV8A 2ZX5A 3ALFA 1NOFA 2WKLA 3HG2A 2DSZA 4NX0A 1D2KA 2G41A 4CVUA 1GOIA 2W5FA 1OGSA 5IHRA 2BVTA 3AYRA 2XTKA 5AC5A 2XM2A 1O7AA 4HZ8A 2WVVB 2E9MA 3ZJ8A 4BQ4A 1OGBA 3TTQA 1JNEA 3WH9A 1C8QA 3QOKA 3BAXA 3ZMRA 3KLLA 1QI3A 4LYQA 4K68A 4PUEA 3CUFA 1HJWA 1FHDA 4LX4A 4MNJA 1UASA 3SCPA 1ZJAA 2WYSA 3W24A 2EXOA 4GO8A 2PWHA 3AS1A 1JZ8A 1BYCA 3A4AA 2EADA 2XFYA 3G6MA 2CERA 2BXZA 5EFDA 3UEQA 4M56A 1W1TA 3PZTA 1UA3A 2OW6A 4CC4A 3EJPA 1VBRA 4JKLA 3WY2A 2Y24A 1V6WA 3WF1A 4AZIA 2ZXDA 2FHFA 2VZTA 2ZUNA 1ISZA 3W29A 5HDRA 2DSWA 1WCGA 3GNRA 1EGZA 2O92A 4UFJA 4U3CA 3VM7A 1MVYA 5M5DA 2UWFA 4PMYA 1JD9A 4F9JA 4YPJA 1JZ3A 1FP9A 1FH9A 4CKQA 4HPGA 2F61A 4MB3A 2BY2A 1J0JA 5IDIA 1Y7VA 2ZWYA 1LL4A 3WEMA 2J7EA 1H0IA 5A1AA 3DYPA 3VD7A 1BYAA 2Y4SA 3BAIA 4ATWA 1DEDA 1B30A 4GKLA 2PC8A 1GVIA 3CV5A 1UR8A 3WD2A 2VQUA 1F4AA 2BY0A 3CMJA 1VFUA 2XVKA 2NW0A 2CEQA 2VMFA 2E40A 4GQRA 4CD6A 4W7VA 2W67A 2ZIDA 5D8WA 3DX3A 1VEMA 1KWGA 3CZ8A 2NT1A 3VIOA 4N42A 2VX5A 1PX4A 1UZ1A 3OA5A 1QWNA 3UERA 1MQQA 1GOWA 3VMNA 1HN1A 1W1YA 1XCWA 3WD3A 1HKMA 4U5IA 2Q8XA 2DT0A 2XIBA 1J9YA 3WDQA 3W82A 2F2HA 3D50A 4AEFA 2YKKA 4UZSA 2VQTA 5DF0A 1FFRA 3N9KA 2X09A 2WHJA 4LYRA 2DH2A 4D1IA 1SZNA 2J7BA 1E56A 4AIUA 4ATLA 3DDGA 3U57A 2JALA 3CTTA 2J75A 4GZIA 3GXFA 4PCSA 1B3VA 4FF5A 1R33A 4HOZA 1UWQA 4MPKA 2OYKA 2RA1A 4TVCA 4UCFA 1WP6A 4OBSA 1UOKA 3S2CA 3BCDA 1MW2A 4B3KA 5HOSA 4MADA 3KL0A 1E4LA 3CUIA 3LRMA 3SCSA 2GDVA 2V3GA 1J0IA 2VR5A 2XVNA 1ESWA 5CSYA 3EDDA 3LRKA 1HL8A 2C9QA 5CPQA 1ISXA 3K8KA 4W8LA 3ZIZA 4RL3A 1VF8A 4AD0A 1ISWA 1CXIA 1VBUA 3MSGA 3THCA 3HJEA 1KBBA 1DTUA 2YA1A 3K46A 2UY2A 4MDOA 1V02E 1V03A 2XYLA 2D0HA 3WQ8A 3EMZA 3BAKA 5BXTA 3CLWA 4JL2A 4C7DA 1HVXA 3WELA 5E1QA 3SIMA 3BVWA 1QI5A 4AMXA 1I75A 2CITA 4DUXA 1MW1A 3AI0A 5FCZA 3NDYA 2W66A 1H0GA 4NZCA 3LXCA 2F7PA 2F18A 4PEEA 1X6NA 3KLKA 3EBVA 3A21A 3TOPA 1FA2A 1BF2A 1OB0A 2QHAA 1TQSA 3AIRA 1UUQA 4QLKA 2ZICA 2ZUVA 4JFWA 4J3SA 3VMOA 3IJ7A 2WBGA 3SCQA 3VNZA 1GOOA 1UWSA 1BYBA 3GXIA 3WDRA 5CXPA 3WUEA 2BHUA 6A3HA 4TX8A 3AIVA 4P8UA 3QR3A 1UG6A 3AZSA 4YHGA 4FLOA 5AYIA 1EOKA 4J3VA 3AOFA 4AYGA 2Z1KA 3DECA 2ZUMA 1CWYA 4NSBA 1NOUA 1UH2A 1V3HA 1CDGA 2YJQA 4N0RA 3A3HA 4A4AA 1CGXA 2J25A 1UH4A 5JBEA 4J28A 3VGGA 1ITXA 2J7DA 3L4TA 1SMDA 3GXTA 4UTFA 4CD7A 4FLSA 1OINA 4W7UA 1CLVA 1UR1A 1LG2A 4BZYA 1E4IA 5HPCA 4UQAA 1UQYA 4W86A 3VDBA 3LXAA 1E55A 5FIPA 3W27A 1X6LA 2OMUA 1T0OA 2XSAA 1FH8A 3GBDA 3EDJA 1GNXA 3VGHA 2VURA 1XSIA 4OZOA 1LF1A 3GZAA 3AIUA 3AXXA 4M80A 1CGWA 4FNPA 4H04A 3WFLA 3ARUA 2Y2WA 3QOMA 4WJXA 3NSMA 5I78A 1WDQA 3D4ZA 5CPTA 3U5UA 4HU8A 3N11A 1MWOA 4JKMA 5I24A 4JKKA 2G3IA 3BUIA 1CYGA 2WCGA 4U2ZA 1JAKA 3ARPA 4AW7A 4PMQA 4W89A 1B1YA 4DUWA 2J7GA 2RGMA 3BVVA 3TA9A 5GNXA 3T2PA 1E6SM 5LYRA 3A24A 3ARRA 5ECUA 3HG4A 2DT2A 3WNMA 1H6TA 4MAVA 3LPGA 2WCSA 2OMVA 4D6FA 1ZL1A 3APGA 3D4YA 3CZEA 2XGIA 2F8QA 3QHMA 4DWSC 5FKYA 5HBFA 5A6MA 1GHRA 1S46A 3QHOA 4OOUA 4HA3A 1QX1A 3RDKA 4MJ4A 4V2XA 3W37A 1KGXA 4DM1A 2WNWA 5A3HA 3BCFA 5JIWA 4AD4A 2A3EA 3AYSA 1E1EA 1CPUA 1UZ4A 2X05A 2YOCA 1WZKA 1C8XA 4AIEA 3RJXA 3SCNA 3OLIA 7A3HA 1K6AA 4CN1A 1KCKA 2ZUTA 1H11A 2WK2A 3BC9A 4NXSA 4PMRA 4P7LA 4CUCA 2XN0A 5BXSA 1NP0A 4RE2A 2B31A 4U5KA 4NXKA 4M24A 3VX1A 3GH5A 1CXFA 2XVPA 3O2LA 3ARVA 1VFOA 3VUPA 4J3TA 2D73A 2WZEA 2DH3A 3CO4A 3WH5A 1OD8A 2VUYA 1UKSA 1KR1A 2O9RA 1GCYA 1HKIA 1UR2A 4H2CA 4GI9A 4FK9A 1VFFA 3ZT7A 4D6DA 4ZXOA 2C7FA 3VGDA 4ZFMA 4AC1X 2BS9A 2J7HA 1W9VA 3AZTA 1CTNA 1JDDA 4GI8A 1JYVA 5CJ5A 5ICUA 5BRPA 1KXTA 3WD0A 4JCMA 2BNJA 1JFHA 1FP8A 1CENA 3JUGA 3BAJA 3U5YA 1UWUA 1K9DA 1B3XA 2BFGA 2F7OA 3TP4A 3K4DA 2V3FA 1JI1A 1GQKA 3GXNA 1OIMA 5A94A 2XM1A 1BG9A 2FYVA 2WMFA 5C71A 3MU7A 2UY3A 1B31A 1GOKA 2YA2A 3U7VA 3CGTA 3VO0A 1VEOA 4BF7A 1TQTA 4LYPA 3SCRA 1OM0A 3AS2A 1I1XA 4D6HA 4J27A 1NWTA 2WC7A 2JIEA 5DT7A 4J3UA 4Q7NA 2YL5A 1ZJBA 5JBFA 4AZBA 2OYLA 3WF3A 4PTWA 4HZ7A 3A4XA 1W9BM 5A6JA 4AD5A 1XSKA 3OLEA 2PWGA 2TAAA 2OWWA 4U2YA 1M53A 2OSXA 4CN6A 2F1BA 2OMTA 1XYFA 3NJ3A 3F5LA 3MMUA 4AMCA 4HA4A 3MI6A 4P8WA 3POHA 3FNDA 3L4ZA 3OLGA 1AQHA 1R47A 4OBRA 3MO4A 5CGTA 2WHLA 1GUVA 3VNYA 5ABFB 1E6PA 2CBJA 1LL6A 1WZAA 1M04A 1E9LA 1QNOA 4H8HA 2GDUA 3DC0A 1UQZA 3D51A 1Q4NX 2WZIA 8A3HA 1QNPA 5CG0A 1Q6CA 1PIFA 4CC4C 4L4PA 3BVXA 2J62A 4NI3A 4W5UA 2DEPA 1LWHA 3FHQA 4HTYA 2VNCA 1O6TA 1H49A 1ZBVA 1UKQA 3FY1A 3KZSA 1MW0A 3WDJA 3HMCA 1JXJA 2AMGA 4V28A 4P7NA 3WQ4A 1TR1A 1BVNP 3WQ5A 1GQLA 2QF8A 1JG9A 4EE9A 3EJRA 2YL6A 2XPKA 1CBGA 3CHEA 4FNQA 3VILA 3WNKA 3WKZA 5BXRA 2YA0A 2YFNA 1L0PA 3NSXA 4OJYA 1LL7A 1JYXA 2D0FA 1BHGA 4PMOA 3A6OA 3AISA 4D6IA 1R7OA 3WL0A 3BLPX 3NDZA 2GSJA 4NRRA 4YHEA 1KGWA 1GVYA 4AMWA 3B9DA 4M81A 1XEUA 4W5ZA 3A4WA 2BVYA 1J12A 4AZGA 3NIYA 4AZCA 3MMWA 1VAHA 4OUEA 1L8NA 2VC9A 1CXEA 3CZSA 3ZJ7A 4KRUA 3WH7A 3UG3A 1QNQA 1BGAA 1C3FA 1E5JA 3PTQA 4TOQA 1NWRA 4QP0A 5A6BD 2JF7A 4UOZA 3N1AA 4H8VA 1DWGM 3UETA 2WVVA 2IUZA 1XD1A 3BUQA 1B3ZA 1G94A 3ARZA 3PZOA 2WSPA 1HP5A 4PUDA 1ODZA 3VIHA 3EMCA 2JEQA 1WPCA 1KGUA 3WF0A 4MDPA 4PYSA 1J0KA 2X0HA 1QBAA 4BA0A 2J78A 1CGTA 3VOCA 1HJXA 2WMIB 1CZ1A 3RM8A 2C0HA 3ALGA 1R8LA 3LMYA 2GJRA 1K9FA 1KTCA 4V27A 2YDSA 3S5ZA 1XH1A 1O6IA 2PBGA 1EDTA 3GNPA 5DEZA 1V0MA 3N12A 3W38A 3VVGA 1MXDA 3CZGA 2VX7A 2YBUA 3WF4A 4P7RA 3CHFA 2DSUA 3DYOA 3RMEA 3WL1A 4HMEA 4AZHA 3MKKA 4B9YA 1RPKA 3VD9A 3OLDA 3EJQA 3K4AA 1DHKA 5EB8A 3AHVA 2YL8A 1P6WA 4DWSB 2D20A 2OWXA 3B9AA 1TUXA 5A6SA 1VFMA 3H55A 1BSIA 3KEHA 1HJUA 3DDFA 3DX4A 1AQMA 1G0CA 3VSTA 5JUVA 3W53A 3BUBA 1V3IA 3UG4A 2DT1A 4JHZA 2PWDA 1V3KA 5KZ6A 3WEOA 5A2CA 5IHSA 2QLYA 4LGXA 3UR8A 5CSUA 2EPNA 2J8GA 3IAPA 2WAGA 1W9DM 3BAWA 1BQCA 3ZR6A 1KCLA 2DDXA 4W8BA 1BYDA 3LPFA 3WBEA 3AMDA 5JIPA 1JF6A 3GYCA 4CU6A 3WUGA 1O6VA 1W3JA 3GXMA 4D6GA 2GK1A 4KGJA 3WEZA 1PS3A 4CILA 2JEPA 2WWCA 4PBGA 2WC4A 3WD1A 3IJ9A 2J47A 4M29A 4J7RA 1NARA 4PMDA 1I1WA 1CLXA 2E9LA 1DWHM 2FDMA 5A8NA 3IK2A 3VGEA 2VX6A 4D1JA 1ISVA 1HTYA 2WMJA 5F7UA 1WB0A 1XC6A 1LG1A 4W84A 4UOJA 3NYDA 4F79A 1C90A 1PX8A 3HN3A 4UQBA 3EDFA 3CUHA 3W25A 3L4UA 3UCQA 1V0KA 1WDRA 4AZ6A 3EJSA 1JXKA 3VGBA 3SCOA 3WIJA 3QGVA 3FXYA 3OZOA 3K8LA 3GH7A 3ARQA 3BH4A 3FN9A 1J11A 2VRJA 1M01A 1UKPA 4CGTA 1NOWA 4A3HA 2EPMX 2CBUA 3M6DA 3BLKA 4B9ZA 4UNIA 4AD2A 1XGZA 5M03A 1QOXA 1LJYA 3GTNA 3ZSSA 1R85A 1V02A 2WMGA 3CMGA 2PF0A 1TE1A 3VD3A 2CNCA 4IM4A 4TVUA 1F4HA 4ZXLA 1JAEA 3T08A 5CPSA 1E72M 4GIAA 2CETA 2AAAA 3KWXA 2JIWA 2D3LA 3VSUA 5HNNA 3TTOA 4UR9A 3VINA 3ARWA 3WF2A 3SCTA 3BMWA 3VDAA 1BFNA 1EIBA 3DX1A 4UFKA 2UY4A 2Y8KA 5E6YA 2IXUA 1HJSA 1QW8A 3BVTA 5FD0A 5D9NA 1VRXA 4FNRA 4PRWA 3M46A 2DSVA 2VZVA 1TA3A 4JFVA 2GJXA 1RP8A 2EPKX 2WM0A 9CGTA 4WKHA 1W3HA 2CYGA 4HMCA 1VB9A 2E3ZA 1LLOA 3M7SA 2IGTA 5IFPA 3BSHA 5A8MA 4Z2GA 3SCVA 2HISA 4MTVA 4B15A 4J3WA 3CZNA 3A5VA 1H6UA 2D0GA 3PTKA 1XCXA 2W63A 1VJZA 3AJ7A 2ESCA 4BCEA 1U33A 4IUGA 3MV11 3CZLA 1GJWA 4E2OA 1YQ2A 4WKAA 3EDEA 1BPLA 1LWJA 3ECQA 1V6UA 3AXHA 3E1F1 4HU0A 3CC1A 1XRVA 1H5VA 2WMHA 4OIFA 4AQ1A 3CIVA 1JZ2A 1JZ7A 3UESA 2OMWA 3WY1A 1EO5A 1M9SA 4C7FA 1JL8A 4MNKA 1HWWA 2WZHA 3ZT5A 4W85A 5A8PA 2WPGA 4KWUA 1PIGA 1E15A 3POCA 4ATDA 1XD0A 2YLAA 4EK7A 4PTVA 4FNSA 4D71A 4OGZA 2WQUA 5C8BB 3L2MA 1E0VA 1H3GA 4PMVA 2VCAA 4XX6A 4E8DA 2FH6A 5JBDA 4XB3A 3W81A 2Y5QA 3S6TA 3WY3A 1H41A 3G6LA 2CIPA 2WWDA 1K9TA 3U7BA 3VIPA 2ZUUA 5TD4A 3ZO9A 1PJ9A 1E0XA 2E8ZA 2WMIA 2C9PA 5CGMA 2PB1A 3B9EA 3FW6A 2CPUA 1EQCA 3IGUA 2UY5A 4F8XA 1PZ2A 1D7FA 1GOQA 2WC3A 2BY3A 3WSUA 1O6SA 2YFOA 3L4VA 3PBGA 2OSYA 1R46A 1C93A 5I77A 2GFTA 3AHZA 1E0WA 1DWFM 2VJXA 3T2OA 4DO4A 3AMKA 3MUIA 1IZKA 4L4OA 4CCEA 3I3DA 3VKKA 4DM2A 3LX9A 3OGSA 2FHBA 4XUYA 2WQXA 4MNMA 5E9AA 2DT3A 3TTSA 4M8UA 2OLHA 4JFUA 4BQ5A 2XN2A 1M03A 2D3NA 1AMYA 1GONA 4ZE5A 5M17A 2XWDA 2Z1SA 1J18A 5CLWA 3WY4A 1OCQA 3SEPA 2QMKA 1UR4A 3IAQA 2PI6A 3VPLA 4NZFA 4E4PA 4P7OA 2OSWA 1B9ZA 5ABHA 5GNYA 4IPNB 2XG9A 3N04A 3O9NA 3W4RA 4JFTA 3EYPA 3MS8A 1W32A 5A2AA 1PBGA 2CXGA 2X2JA 4EKJA 2UZXA 1V3MA 1SMAA 1HJVA 3T2QA 3N18A 1KBKA 5LA1A 1TQWA 1E5NA 3WQVA 3BAYA 3WBAA 4AZ5A 4QCFA 2FE0A 2UZYA 3ZJKA 4WK9A 5E0CA 3ZR5A 2VVNA 2OMXA 4TX6A 3WQ6A 2YDQA 3HG5A 3UR7A 1QHPA 1TVPA 3TV8A 4TTGA 2DIJA 1JZ4A 2WVSA 1Q6FA 2EBNA 1U30A 5DFAA 4Z2JA 3LPOA 3WH8A 1V0LA 5BROA 3CUGA 4UFHA 4B3LA 3VIGA 1PZ3A 3ZQ9A 3A22A 3IANA 1E6XM 2W62A 1NWSA 3II1A 2VZSA 1ODUA 1E6RA 1OT1A 3RJYA 1KTBA 4HA1A 7CGTA 1EDGA 3IJ8A 3PZUA 2J8FA 3BUPA 1LYQA 2VRQA 4UFLA 3T0BA 2VL4A 5AC4A 4CD8A 3PZIA 3T09A 3WQWA 1ZBKA 5A6BA 2V3EA 4H41A 2FGZA 1MXGA 3VD4A 2AOSA 1E70M 3FAXA 1KXQA 4JCLA 4P8VA 2VT0A 2VCCA 2E8YA 4Y7EA 4MB1A 3WNOA 2NSXA 4GPNA 2QV4A 2A3CA 1IV8A 5FOOA 1GQJA 2OWCA 1B0IA 1X1NA 4QLLA 3FHAA 4LPCA 2WHMA 3ARTA 2C9RA 2WLZA 3SCWA 3RILA 2CBIA 1GPFA 2A3AA 3VM5A 3ARXA 3RCNA 4ZE4A 2ZXQA 3W26A 5ABGA 2FH8A 5A8QA 5HPOA 5LA2A 3OGVA 4Z2LA 2ZXAA 2X0YA 2ZOXA 2PWEA 4KMQA 2BXYA 4AWEA 2ZUSA 2YIHA 1WNOA 3I3EA 4CU8A 1ECEA 3QHNA 3MUY1 3DX2A 3WMCA 4AD3A 1W3LA 1JNDA 4TXEA 3VU2A 4QFUA 2XHYA 1EXPA 2A3HA 1QPKA 2GJXB 4ML4A 1W3KA 4UZUA 2E4TA 4AEEA 6TAAA 4U3AA 3N15A 1H09A 1NP2A 1ZS2A 2VTFA 4ZENA 1HP4A 4M1RA 2EPLX 3MUZ1 1QI2A 2WMKA 4AY1A 4AZ7A 1FH7A 1MFVA 1CNVA 4JAWA 2XSBA 1B90A 1SR0A 1HVQA 2MANA 4PMUA 1TA3B 4OKDA 3D52A 3A47A 1UD8A 4UQ9A 1CECA 3AMGA 2FGLA 1OT2A 1C7TA 3BLBA 4AISA 1A3HA 2WANA 4HPHA 1MYRA 4AD1A 1WE5A 4QAWA 1JIBA 5A6AA 1CGYA 1PEZA 1OSEA 2D1ZA 2JE8A 2G3JA 2HVMA 4X0NA 1US3A 1R75A 1B3YA 3K1DA 2ZX9A 4GXPA 5AYBA 3VIFA 5A6KA 1IX2A 3SURA 4PTXA 2ZX6A 2WQVA 4H8UA 4YN5A 2QPSA 3BMVA 8CGTA 4D72A 4DWSA 4W8AA 4CCCA 4AW4A 1V6YA 3WDPP 3WMSA 3WDIA 2WCAA 3VGFA 4QCEA 1J0HA 1XH2A 5BCAA 4GQQA 2DPEA 3RM9A 3ZOAA 3RO8A 3VTRA 5D9OA 3EJUA 2J77A 3WUBA 4W88A 1IZJA 4UFIA 3O6AA 5A69A 2BHZA 5IFTA 1NM9A 2G3MA 2VO5A 3AQUA 1RD6A 5D9MA 1BVZA 3WNPA 1E73M 2C8NA 4JL1A 2W4XA 2VX4A 2D23A 1CXHA 1UD3A 3ZM8A 4JZ5A 5E70A 1FOBA 3OZPA 3W6LA 2O9PA 4WLCA 3AMCA 2CBVA 4GI6A 3HZ3A 1C91A 3AS0A 1PPIA 1J0YA 1E40A 2GUYA 1WZMA 2NT0A 4GO9A 2X8RA 2Y8VA 3K8MA 3W0KA 1M42A 4PSPA 2CKSA 3RIKA 2X1IA 1OT4A 4UQDA 5D9PA 5E6ZA 1YHTA 4F66A 1JZ6A 2WSKA 4LXFA 1JYNA 2QMJA 2EACA 4TUFA 1KB3A 1H4PA 2Y5EA 4URIA 2CCRA 1BLIA 1AVAA 1PX3A 4PCTA 5A6LA 3AROA 3THDA 3VD5A 5I23A 3WUFA 3N13A 1G1YA 2ZWZA 1QHZA 1FFQA 2EAEA 1MQRA 1W9XA 1BG4A 1N82A 3NCOA 3VDCA 1UD2A 1E4MM 3AHYA 1J0ZA 1W91A 5DT5A 2EJ1A 5A95A 3MUAA 1WKYA 5I6SA 1BAGA 4S3JA 5FL1A 3PZ9A 4IISA 1V08A 1CIUA 4NZJA 1RP9A 3NSNA 4CCDA 4PMZA 4WSKA 5C70A 2WQWA 2F1AA 3M07A 1J10A 3AXIA 1HKJA 1C7SA 1HXKA 3T0AA 3AS3A 2RGLA 5BWFA 5DO8A 1E6NA 1KQYA 4BQ2A 3AIBA 4ZEPA 1EH9A 3WMBA 1H1NA 4XZBA 2BHYA 1XHGA 1Q6EA 1TMQA 2O9TA 3GDBA 2XIIA 4PSRA 4W93A 3VX0A 4D6EA 1JFXA 1UA7A 3L4WA 2ZX8A 4CU7A 4NRSA 5GNZA 4ACZB 3OBAA 1OWQA 3CZJA 2CESA 3D3AA 5EFFA 1WO2A 2V3DA 1EHNA 1E3ZA 1UD4A 1CGVA 1OGGA 2BV9A 4HOXA 1W1PA 3ZT6A 4JFSA 1A47A 2XFFA 3CHDA 5AY7A 2J7FA 1TFVA 4P8XA 5I3DA 1E3XA 1JDAA 1ZBWA 3ARYA 3PZGA 3GNOA 4M82A 2WVUA 3HU7A 3L4YA 2EABA 4U33A 4WF7A 4KH2A 2IXVA 4PN2A 3WENA 4RE4A 2W61A 1DWIM 1OIFA 4QLJA 2E0PA 6CGTA 1UWIA 2BY1A 3BSGA 1EDQA 2D2OA 1TQVA 1BPLB 1QHOA 2YDRA 1EA9C 3OB8A 5M3WA 1JI2A 4WSJA 1CGUA 5E09A 4LQ1A 1ZB5A 3ZJ6A 2FHCA 1JDCA 2YL9A 3W28A 5BXPA 1E6QM 3PZNA 1G5AA 4DO5A 1CEOA 3H53A 5BRQA 3SCUA 1ZBCA 1MQPA 4UQCA 4E8CA 3SUTA 4WIWA 3TTYA 1DWJM 3KE0A 4JIEA 4AZCB 2QPUA 1GZJA 1QVBA 1FHLA 4TVDA 3VIIA 2WW5A 4DO6A 4HMDA 2X2YA 3AMLA 3WN6A 1GW1A 4X9YA 4DUVA 1G01A 1UWTA 2VI0A 2EPOA 2D22A 4U31A 2JF6A 2X2IA 1HJQA 1E71M
chains in the Genus database with same CATH superfamily
2MPAL 5LGJB 5FF0A 3VINA 1DJSA 1VENA 3WF2A 5CSSA 4GG8A 4LGRB 4LLMA 3TE9A 1CL7H 2HJFA 4LC6A 4LF3A 3QEQB 2XGBA 4FZ8L 3CH9A 3M17A 2PDUA 2PDBA 4HYWA 2BGNE 5AVHA 1BQEA 4YDKL 2V9QA 5TAOA 4JANA 4PJXA 2PGRA 3LTSA 5ALBL 3IPBA 3N17A 3GIZH 3MLSL 3SE6A 5CEXB 2JK2A 1SYTA 3HBLA 5I26A 3O07A 1QASA 2R4RH 5EUKB 2O6CA 3AREC 4Z7VF 5T1MB 2YLLA 3E0VA 3W7DA 4GP4B 5AOMA 1TWDA 4DF2A 3DX0A 3A35A 4YBQD 5I1JH 4LVOB 2A3BA 4IU2B 1XYZA 2V63A 1PAZA 4TSAL 3ZRCC 2Z31C 4YWGH 1AGEA 2PCXA 1OZTG 3RX8A 1NQ6A 1BQKA 2AJUL 2UXTA 2XOTA 4XC3H 2EG8A 2VAAB 1B2YA 2XWEA 3ZXAC 1VFLA 1QBBA 1SPDA 4GRLA 2VDML 1YHPA 3GSOB 5MHBA 4PJ9B 5GRVL 4WOQA 3M5YA 4ELKA 4FD0A 2ACSA 2COVD 3TGXA 4NJAH 1TIWA 4BQCA 3EEZA 3DBPA 2HZGA 1UOVA 1KCRL 4Y4FA 2Q8BH 5E7FA 4M48L 1GZ1A 4XONA 5I76A 1VLWA 1NC4A 3I02A 2P0OA 1KDIA 1ANUA 1TCMA 1KFEA 3A4FA 1P7TB 4X4ME 1XKJA 4JQ1A 5CBBA 2W9DH 2FFCA 1OGTB 4Y88A 1B3OA 4XBEL 4PJBB 1IXOA 2EAWA 1OAUL 3A9BA 3OKNA 1A6TB 1AK5A 1EUUA 3BISA 3MBWB 1KXHA 3ZUNC 2D7TL 5GZOA 4RIRB 4LH8A 1YPIA 4PRHE 8FABA 1A5LC 2BVPB 3NJKA 5ECJE 4AEHL 2OLAA 3OIHA 3HZYB 1FN4B 1IC1A 1F6AB 4JTRA 5KTLA 2EIDA 4UNTA 4APQD 2VRKA 4JLRB 4OIIL 1E6ZA 2F8OA 1UOZA 4IPPA 4H1LH 4XP5H 2HT2D 1MY7A 4K5NA 3LZNA 4LEOA 2ZA3A 3DHDA 1E6JL 3DX6A 3MRJB 4OOZA 4Z0BH 2W91A 4AGLA 1QNRA 3U36B 4GY4A 1Z32X 3QO1B 1K72A 1ZTMA 3LH2L 3A23A 1H8SA 2XN1A 3QW9A 5C2BL 3B3BA 1YZZA 4AE0A 4F92B 4MAYD 1Z5YD 2J9ZA 3HE7C 3NZRA 3MR9B 1HX0A 1AR1D 2CZ5A 1VIWA 1UA6L 3K74B 4DK1A 4ODHL 3L21A 2IPFA 4JM2A 5LAXB 4IPIA 4QS6A 1NAKH 3E74A 1KJ2A 5I73C 4AL8C 3WH6A 1XSJA 5IJBC 2P26A 3BVUA 1RZ7L 3K0WA 2Z0UA 3T0DA 1BEYL 2F8VA 5SWZB 3DDYA 3BIKA 1MIEL 3ASQA 4YQXL 1QPQA 4EF9A 4TF4A 5FW7A 3V6BR 1JGEB 1UT9A 1ZTXH 4JN2B 5C0AB 3ZHFA 3VKBA 5D72L 3GS4A 4FMVA 1U8OA 2G3NA 4IHBA 5EORH 3S0CA 4PJ5B 4E9LA 4JQIH 5GZOD 4I4WA 3ZL4H 4QISA 2XU9A 4K7FA 1O9ZA 2CGZA 3BGMB 4Y4FC 3N6YA 2XFGB 3KR3L 3CXHK 4NWTH 4MZYA 1KIPA 4W6YB 2X53S 4R5EA 4AEHH 3TJHC 2IKGA 5IV2B 3RPIB 2ZAHA 4BQ3A 2ISSA 5GGQH 2OR2A 4UTTC 3DX7A 2DQCH 4DKDC 5I1IH 4LSDA 1FVEA 5LXVA 3EKGA 1XS2A 3L67A 2WB1A 4HC1A 4XNZC 2R2EB 4A7SA 4WFEE 1A64A 4UB9A 1VPXA 1BLNB 3UG5A 5L2KA 3OQ8A 3PNZA 2W92A 4HJ0D 1UWRA 4QUZA 4E0FA 4JQ4A 4QM1A 3WG6A 1TXKA 1E67A 2W0PA 5AD0A 1MW3A 3LH2H 2PU0A 4Z4YA 1X9UA 3CXFA 3LXBA 3SQLA 1P4IL 5DJYA 1XIWA 1W8NA 4KCUA 4PMNA 4D6JA 5TDPB 3QUXC 3ENLA 3MZTA 5FM5O 2W6JA 2IKJA 3RZCD 3V75A 2OTUA 4JO1H 4ANWA 4S39A 4UMBA 3T8VA 4NJJA 1QI4A 2L3BA 4RWHA 4HZ6A 3GHBL 3MRPB 4MNLA 4MAZA 3SODB 4Q32A 3AUVA 2R29L 5F7WC 4F5CA 1GYWA 4R27A 3ILDA 4HKXA 4BA8A 1VYSX 2TYSA 3NABH 3RTQD 1RZQA 2QSTA 1OM3H 3WFZA 4PJBF 2WLYA 4JOMA 3R0KA 5DEGA 5HHXL 1XGUA 4LLQA 3CHVA 5C0QA 1YPZA 2GBTA 2IV8A 1A6VH 4JM0A 1HI6A 3LKOA 3BQJA 1DVZA 3O4LB 3A3GA 4FNUA 5CZKA 4ZMWA 3SR7A 3JTBA 1KLFB 1J01A 1G4RA 4JO1L 1WA0X 4TTDD 1KFWA 1S7RA 2QNEA 3P3BA 2CKRA 5LA0A 4YSDA 1HJVA 4GYJA 3BGMA 2C34A 1GHSA 3HHSB 1X4XA 1V77A 3IIXA 4MPQA 4PY8J 2CLVB 1QBLH 3DYMA 4G6KH 4M6QA 4YGAB 1ZLWK 3OR6B 4XO4A 2BP0B 1MY5A 4DP9X 2CLFA 4I5BB 5DC9B 4IT1A 4M00A 2YGOA 1JK8A 1JGIA 4XBPB 2RJHA 3RGVC 1CICA 1WTLA 3RNQB 5I71C 3GVGA 4M5ZH 3U25A 3VXSA 4KJWD 1V0NA 4MKNA 2EQDA 3EH4B 2G8ZA 3B8DA 4ACZA 4M5TA 5DUPL 4K3DH 3QTGA 3WK1A 1A6WH 4ZQKB 4OLYH 1W2PA 1F1DA 3UC0L 4M6VA 1MFUA 1K8AD 2E9BA 4G1VA 4K94C 5JHBA 3BY2A 3N2MA 1DYZA 4RMUA 3WNLA 1QWUA 3T3MB 4KETA 3MO7A 4N2YA 1BREA 5DCDA 1Q0EA 1JRCA 4MF4A 3F2CA 4OCRH 2X6MA 5KW9H 5DZOA 2R8WA 3LCWA 4BI7A 3CCJB 2DYSB 1IEHA 4JG0L 3R8QA 3O3RA 4LAKA 3S8WA 2CU9A 4TLKA 4YHOL 1WFIA 1FNEB 4Q4PA 1T6BX 1VBJA 2ENJA 5F2GA 1F90H 4FP8L 4HAFA 4GUGA 4G8GA 1O1HA 5CBEA 1TJHH 3H0TA 3HPLA 3TIDB 3D3VD 4RNRB 1QW9A 1ILSA 4KTDL 2KYIA 4WKFA 4AGPA 4TR9A 4GD0A 1Q82D 1QAWA 1US2A 4GUHA 2B1AL 2I07A 2W07B 4XWGH 1PKOA 4HUMB 2SFPA 2G9KA 3I3BA 1FCUA 1BTCA 4HGWB 3WS3B 4KDTA 1U3HC 4F0LA 1MEIA 1S7QA 1KNOA 1FNMA 5I1DB 1QTPA 1J5CA 2C16A 5DANA 3WBWA 1V3JA 3D85B 2BPOA 1JDFA 2D69A 5HGDB 2ZKMX 4Q22A 1PJWA 2MNWA 3M86A 1VLXA 1CXKA 4R7VA 5BYWA 5FAGA 3DBSA 3HPAA 1MAKA 3V52L 3MV9D 4HGXA 2X2HA 3TCEA 1HL9A 1S9VA 4S0SD 4ZX4A 2WB7A 3D9AL 1KLZA 2UX6A 5E0FA 3IS4A 2JB5L 3VXPA 1K8ZA 4AZCB 1RXLA 3NZ8A 1M05B 4ZCIA 2BDNH 3THML 1TJ2A 2J27A 3SUSA 3ARDC 2YMTA 1M1XB 4FG4A 4MCNA 2CK0L 1T0NA 1VACB 2YK1L 3SPGA 2D2GA 3U7WH 4ABWA 2XSXA 4EI5B 3CCSB 2F43A 3BDBA 1OGPA 3O2WH 3ME0A 5D2NA 3I9GH 5M95B 5A5WA 2B59A 1CXLA 3TO4B 3E12A 5FECB 5IWLC 1D3CA 1ZIAA 1BFVL 1A0QL 2ICWB 3L3DA 3QQ9C 4LP8A 4PY8I 4R4FL 4UDTB 2VEPA 2FVNA 2PLJA 5EBLB 4LSQH 4GZEA 1A5SA 2HT3C 3U2JA 4XMKH 4KCVA 5C1MB 3BGAA 3VDHA 3LH8A 5IVZB 3ZSTA 3PTMA 3TBBA 4O02B 3VSVA 1QEWA 4X5PA 5EA0L 4AG4L 4IHOA 3CMMA 4NN7C 4WGKA 2YK1H 3ISXA 2A6DB 2QSQA 1L6ZA 3ZRSA 4A37A 8FABB 2IVFC 3E6HA 1IARB 5F0LB 3T2LA 2VCBA 3AIWA 3FGCA 4LCUA 3SO5A 5FACA 3RPTA 1HYRC 5B8CB 3IACA 3LZQA 3QXVA 5A2BA 2ZWKA 5F1UA 5CP7A 3ZLHA 2DY3A 3H2NA 1G9HA 3HBZA 5FA5A 3NL2A 3B9NA 5HGDA 1SOKA 1TZHB 3FUFA 5JW4Q 3ULUC 5D04C 5BU9A 4OI9A 1K85A 1IB5A 4POZC 2CHNA 4PS3A 4ZXBB 3EPOA 3PZNA 1XL9A 3TDFA 3GVKA 1RZKH 1VEPA 2EDMA 1T5AA 2CUHA 1YMYA 2PAJA 4I5XA 3SY0B 2V7VA 3TAKA 3M16A 3OGRA 3FOMB 5BZDB 4B9GA 4U1NB 4UYPA 4UQ3B 5CH9A 1M2VB 4DN4H 1VF5C 3RZCC 1TPWA 1IAKB 4QG9A 1RPUA 5LUMA 1JF1B 3BEVA 3KZ8A 2ZA2A 2G9HA 2VAAA 4WW2C 2GVLA 2H2SC 5GRJH 2WJ7A 2QCMA 3ILEA 2YYTA 1MRCL 3EJYD 5ADOH 1RJZB 3CFDB 4K07A 2I9TB 2BODX 2IALA 5FLUA 3LKSB 3NJIA 3PF3A 3PULA 4PVLA 4NL1A 4R9OA 1RUKH 4JFDE 4I3RL 3NOYA 2DF3A 1PY0A 3F4CA 4Q97A 3LNNA 2Q20A 3OG3A 2JVUA 4LMQE 1ZLUK 3C5ZA 4IMEA 1RI8A 4Z4ZA 2OK0H 3GSNH 2G60H 1X5FA 3QXAA 5GJTL 4RCXA 2DQTL 3QAZC 1FWNA 2XTSA 1A9BB 4ZPTB 4H5SA 3BV7A 1XGYH 2NY6D 4R3UA 4TQTA 4KKZA 3UNTA 5A8GA 1USQA 1W17A 4OLUH 2V5CA 1SJEA 2PDQA 3SCMC 2J24A 5JH1A 4XMXA 3BXNA 4I18A 3ANVA 4QROA 4BSWB 2XQYG 5B3NA 4UT6H 5CEYB 2P52A 2E7LA 4ZXBD 4L1BA 1I60A 4YTQA 1YEJL 2BO0A 3R0MA 3GIRA 5KSBA 2R82A 3OAYK 3CL6A 2XJ7A 3QFWA 4IGSA 3NEVA 2L5HA 4QXTA 2NXYB 1D2KA 2QDHA 4OJCA 4JPGA 3QV9A 3MC0A 5IQ9A 2G41A 1GOIA 4MDIA 2IGFH 1F6YA 4RNJA 4N4QA 4EIBA 2F5AH 3NM1A 4GYFA 4WUUE 4HHAB 1Q6LA 5A89A 1PG7L 2CR0A 4MD4A 3AYRA 4KPHH 4HIIA 1QFUH 4XBPA 2ESVB 1O7AA 3G1DA 4PBDA 2AVGA 2E9MA 4K4KA 4B43A 1NSNL 1I0BA 3OVPA 2HT3D 5HY9B 2ZOKB 3ZMRA 4APXB 3BAXA 5EF3A 3LM7A 4BIKA 1A5UA 1T83C 3O0FA 2NQDA 3H9ZA 1AXSB 1N67A 2HKHH 4JDZB 3SOBL 4O14A 4C6NA 4TL5A 4H1ZA 3U9IA 3BWSA 2XG4A 4K3JL 1VHOA 2KHAA 1J5OL 1EWHA 2FLIA 3DFNA 4OQVA 3ME3A 2J2ZB 4XN9A 4D8PB 1X9RA 3QIBA 2GJKA 1AQKL 1N3NB 1JPEA 1KC5L 3CZFB 5F9JA 1LE9A 5C0ND 1P0KA 5DRZA 3NM3A 1E3FA 1INDH 1Q9WB 4GO8A 3F84A 2HJKA 3DNKA 2H32H 3EH3B 3Q6FA 2HMID 4RPDA 1BYCA 1NVMA 2E5DA 3A4AA 4HFWA 2R94A 2X4RA 3U7WL 3Q6RA 2EXYC 3G6MA 3M6YA 2GI7A 3MV9B 4N4YB 5CZXD 5SWUA 2WP3T 4ODTH 4M56A 4RETB 3QDMB 3T77A 3WSQH 1W1TA 4F91B 3BPNB 3VQMA 3SDCC 4CC4A 1EGMA 4N9CA 5C2XA 3BPNC 7PTDA 1MCHA 5LHFA 4EUPB 4I2XA 5HYSG 4X61A 1AMXA 3GW3A 1V6WA 3WF1A 4AZIA 3F4WA 3H7UA 5CBAA 3APCA 2FMOA 1BXAA 4XBJA 2FHFA 2DQMA 3FDWA 3R4DA 4LKXA 3W29A 1G0XA 3P4MB 4GW1A 2HUHA 5IMOA 3VXMB 2Z2BA 2DSWA 2R27A 1JPTL 3GNRA 4NJIA 3P2DA 4K3EL 4MNHA 4S2SA 5C2CA 2O61A 3HR5A 3KHJA 5E08L 3U2ZA 4UU9B 2H90A 1S9XA 2G2NA 3TEZA 2O92A 3VM7A 3U6BA 5M5DA 4FSAA 1JWUA 2V6HA 4BPRA 1UMKA 4TUJA 2A9NL 1WOAA 3QXUA 4HPYH 4YPJA 4LCWA 1JZ3A 1U1JA 4MGGA 3SRKA 1N08A 3AY2A 3QC0A 2WQAA 1K8IA 2KPWA 3DMMC 5BOEA 2VFHA 2QCDB 4GQ0A 3FCPA 5I3HA 3OHIA 4DVBB 1S9YA 1TPVA 1Y7VA 2ZWNA 1LL4A 1S5TA 4Y16A 1VD6A 2ITCA 4ZTPL 4L4TE 2J7EA 4F2BA 3NO3A 1A4BA 3V4UL 4C58B 1F61A 2EDFA 4HCRH 4Y19E 1AW2A 3PB0A 3EF4A 4HKZA 5MERA 1FWCC 4DAFA 2DYIA 2X4QA 5B80A 1JTPA 2X12A 3ZTNL 4GKLA 3KBNA 4ILSA 5D6DC 2ED7A 5JPMA 3T77B 1YY8A 5E03A 1Q9LA 4J5NA 1DXFA 3RFAA 4M6OL 1VP5A 1F4AA 3CFKB 2XWJA 1N0LB 3HG0A 2IADB 3MA7A 2BP3A 3UTZA 4C47A 1F3XA 1W5QA 3CMJA 1ZLWH 2NW0A 5K7JA 5JUEL 3LB0A 3GC5A 1KBWA 2DQDH 4L1HA 3SYPA 3ZWSA 1MRQA 4QRNA 4AX7A 1TTBA 2WNNA 4U6HB 3OYZA 3B83A 4N4PA 3H94A 1E2VA 5T3XD 1IR2A 5D8WA 1U8PA 1VEMA 1D7KA 1H5BA 1VPOH 1KWGA 3KAOA 4ZZFA 5AW3B 2GCYA 3EEGA 1PQZB 1XISA 3BSZH 4YO0B 3HQOA 2YSSB 2D2JA 2GY5A 1RERA 1KJMB 4M62H 1UZ1A 1AHWC 2ZTNA 3V0JA 4MJ5B 2QVMA 5CFHA 3P4OA 2DZSA 1AFVH 3DHFA 4C55A 4XMYA 3W2EA 5D6CB 1AJ7L 2WXIA 4ANVA 2HJPA 5CGYC 2XIBA 4KRPD 3QV6A 1VKFA 3TM6A 1QGAA 2GI0A 4HFUL 4F80A 1J9YA 3WDQA 4JHWH 4RGNE 3IKCB 5L8JB 1E8YA 2EG7A 3RZCB 1KFAL 4DJFD 4GQ9H 2V17L 1TVCA 4E0RB 1TRIA 4FXRA 1Y1DA 1QVFB 3P3YA 3QS2A 1QFWL 1WGVA 1PZCA 3EX2A 5DF0A 3OMAB 1M65A 3JZEA 3HMXH 3DERA 1UB5B 2X2GA 3K6IA 4Y7OC 3U6RB 3NQGA 4LYRA 3LVTA 3MMPA 3MV7A 4TUOA 3WTUA 1ZUAX 2XQ0A 4MCMA 2DMCA 1AIPA 4ZSOE 4FFZH 2DZWA 3E49A 3N2CA 4BK9A 4E6MA 4BFNA 1I9IL 5AVNA 2AFNA 1UM6L 3IPFA 3IVSA 3PANA 5EFIA 5DVKA 4AQ8A 1F7BA 2JALA 3PJUA 3T1GA 7ENLA 2HBVA 1ETA1 4BEIA 4E36A 3GVVA 3A6CH 3CTTA 2XUWA 4LVOC 4WOZA 5DD1L 2ZL7A 2J75A 4GZIA 4ZTOL 3GXFA 4Y5XB 2IH3B 1XR9A 3MLPA 1XF5A 5D7KE 5C6MA 3IS0X 2VERN 5E1AB 4Y16D 4HOZA 1UWQA 5D02A 3V7AG 3AADB 1VFSA 1Q7QA 3QUZA 4LVHB 4MMXC 4G6JL 3LQ6A 1Q94B 2QGYA 4IW3B 2RA1A 3KLQA 4W9LC 5JHLA 4UT9L 2MCAA 4QAMB 2N7SA 2J7KA 2HTLD 4Y4KB 3UAFA 2ZF8A 1MW2A 4CDGC 2GJ6B 3HLAA 2W0FB 3FONA 4YCPA 4R2GB 2PGFA 2OL3L 2EE6A 4ROXA 2FEEI 3WNJA 4OFYD 1TJ1A 2X6WA 3SCSA 2YCIX 4HYTB 1AZZC 5IK3A 3VFOA 3W7IA 3SYQA 4X9HA 3KZSA 1IEQA 1QG0A 2J20A 3EDDA 1VJIA 2IPUG 3LRKA 4HJJL 4L4VE 2Z2UA 2LHAA 5CPQA 3QJOA 3FU8A 5MP6L 3RWIB 1UJPA 4W4OA 2W65B 4H8QA 3ZIZA 2WINB 4P25A 4RL3A 1N8RD 3BQUC 5IYNA 4AIXA 4RKAA 1WLHA 4P5TC 4RDQF 4XVOA 5LBVA 5B8CA 4QTIH 1VBUA 3GX9A 3W7JA 1KCBA 5I82A 5E1IA 1KJZA 3QR2A 3QCVL 2XY1A 1FQ9C 4KWVA 1V02E 4O54A 3DFTA 4QXGH 3SN6N 5I09A 3IJLA 3UJTH 3KJ6L 1NBYB 1NZRA 2XZQL 3LIZH 5F70A 3H2EA 5BMFH 3ULUH 2ED8A 3IM1A 3QJXA 2DIKA 3OO2A 1TEYA 3BAKA 4Q9CA 1QFEA 3AG4B 4GFIA 3SQOL 1TX0A 3VFCA 2KQMA 1T5XB 5LNSA 4G8EA 4KO6A 1CF1A 4AZUA 2A85A 1LO4L 1HVXA 1XIWB 4PJIB 2UZIL 3SIMA 4QO1A 1NSJA 1I75A 3RGVD 4DUXA 2GYIA 3O8XD 5ICYA 1MW1A 1K4CA 3H2AA 3FU6A 5FCZA 2NW3A 3IDXL 1S39A 2W66A 1HSBA 2WSRA 2ZRZA 2AJVH 1WBXA 1XF2B 3C5XA 2ZNXA 4UC5A 3RF9A 1CD8A 1Z9LA 1DN0B 4CMHC 4JJ5B 2O55A 3UAJC 3CSGA 1IGTA 3QHFL 3A21A 4JFFE 4QHKI 3LHYA 4PS8A 5E6RB 4ZQOA 2ZL6A 1DSYA 3T4AB 5C0CA 2DQIL 1OB0A 1JZJA 1RY0A 3Q3GB 3AABA 4JG1H 1AGBB 4RMBA 4G2AA 4TN9A 4TUKH 4W81A 1H50A 4ZS7L 2QHAA 3Q48A 1PD0A 3AVWA 1TQSA 3BE1H 4Q8BA 1XIHA 1NCUA 3AIRA 3PABB 3GO1L 1S2VA 4B5SA 1NOAA 2CM6A 4QLKA 4BZ2L 2ZICA 4GH1A 3D87B 5A2KH 5I7GA 4RX4A 4HG4J 3CH0A 3ILQC 4XD6A 2FB2A 3IJ7A 2E9JA 4HK6A 2X4SB 4B9JA 3VXUB 5J4MA 1LQSR 1I2OA 4WJ8A 1DVFA 3KWUA 4KXBA 3OZ9H 3HS9A 4UOW1 4AL8H 4O1AA 3EOBA 3HZMB 3MRBB 4R4BB 5DZLA 5GGTH 3RWHB 3WMPA 4LLYB 1PHQA 2DVUA 5IESL 3HPFA 5DUMH 3L5MA 5CXPA 4UV7H 2ZRYA 3HJZA 3HMXA 4FADA 4E41B 5B21A 3GO1H 1HKFA 2AANA 5FM8A 4L0ZA 4HLZH 3QY8A 3QQXA 1ZEAL 3FKRA 4UNKA 1Q85A 1JHLL 2WXKA 1GJPA 4I18B 4OZFG 1T21A 2IEPA 4XZHA 4K71C 2Z1KA 4KVPA 3MUJA 3PG9A 4Y9BA 4Z7NE 3O6MH 1CWYA 5FA3B 4NSBA 1NOUA 3Q0HA 2DUXA 1I7UA 4KRPC 4M0LA 1DVTA 4ZDHA 5IFHL 3M0VA 3OR7B 1CDGA 3RWJA 5EMNA 3NFSH 5LCVL 1BQLL 2ENQA 2HTMA 4A4AA 2APWA 3KD4A 3KR3H 3UTSE 4X9BA 4CSSA 1PFCA 4X6DB 3WMLA 1N2RA 3U30C 3VGGA 1FWEC 2J7DA 2ZYIA 4LAJH 3PGFL 1EFUA 3PWVA 1F3DH 4ASUA 1JNNH 3CFUA 2QGBA 4MJID 4X4KA 4XRCA 4FLSA 4R84A 4DPRA 1OSYA 1OINA 1UR1A 2FMNA 2PS2A 4MFEA 4TMBA 3UZZA 1AH0A 5MI0B 4O0QA 4XMVA 3S88H 5I3IA 4IX0A 3MO1B 1FG2A 1E4IA 1NEYA 2VDNH 5D7IE 3CAFA 3ZYZA 1E55A 4UIOA 3CDZA 5FIPA 2OXGB 1Q1PA 2ZCLH 1JPSL 2BS8A 4XVJH 2Y7NA 5D1XD 2XSAA 1JJUA 3NEEA 4Z76B 1FH8A 1AIZA 3BW9A 3CRZA 1TCRB 4XMKL 4HZ1A 4OZOA 2JB6A 3ITXA 2WN2A 3UMNA 3PIQB 1ZGLA 2ZZ7A 3MSRA 4U1GC 1PWLA 2CHRA 1LF1A 2J6XA 3PP4H 1DQDH 4O5LL 2V0TA 1KLGA 3MJWA 3AXXA 4X0KB 1CGWA 3BEWB 3FT4B 4GAJL 4YDJB 2WO4A 4PRBB 2X3UA 2XZAL 4H04A 5LGKA 4XZMX 3RPDA 2H3KA 5IRPA 3SJVD 2Y2WA 1NMAH 3QORD 3IVKA 1HL2A 2AXHA 2DJXA 1WDAA 2OPCA 3QOMA 4F0MA 5EU9A 3TYDA 3MRDB 2Z6FA 3GHEH 1QYGL 3D4ZA 4IYKA 3MRLB 4NQEB 1YXCA 2ZC8A 4GY7A 3WLLA 3VFVB 1F11B 4EXBA 5ENWB 5HVGB 3RDTB 5KBLA 1QRND 1Y0LA 1JCNA 2WLMA 2CJUL 5HWMA 2X28A 2E47A 1H8EA 4JTUA 2A7PA 1ZLPA 3LLXA 4KO7A 5I66B 2D7MA 1ZSDA 4X83A 1J93A 5DJ6A 4Y9EA 4QSHA 2VDKH 4NM8H 4J2MA 1IJ9A 4ZUSB 1K8IB 4XZUB 3QNFA 1QO3B 5HHOA 3HURA 2Y7QA 1F8TL 1OPOA 2FSEA 4G1EA 1EP3A 4W89A 3RCYA 5F0MB 1B1YA 5B7YA 3FFCE 3NXFA 3H70A 3BVVA 2DV0A 2D7NA 4IMFA 5IVXB 1KENL 5ELIA 2KZWA 2GQ8A 4Z4TA 2Y72A 1YNTA 4IRJD 5ECUA 2EICA 5EOTB 3HG1D 4FFYL 1JGLH 4L3ED 3W9DA 4WEMB 3O3DA 4S0TD 4ZW6A 1H6TA 1P0DA 4D6FA 4Z1AA 2OMVA 1CD1B 2ZCLL 4MAYA 3FX4A 2CF4A 4XORA 3HG1E 3H9NA 2ADGA 3FUNA 4MJ6A 4TOYH 3APGA 3H4HA 1KLUA 2FD6L 3EOYG 3QHMA 5E8PB 4R7DB 3E9AA 5FKYA 1CLZL 2PLKA 1OCZB 2H47C 3N5AA 4QTIL 4XNMA 3ZZSA 5JPNB 4GABA 1CFVL 3O8XB 4Z4UA 2VKZG 3V52H 1BYOA 3GDMA 3A6BL 4IXHA 4FJYA 4OOUA 2X38A 3MRHB 2JNZA 3EGSB 3PV6B 1K6QH 3UO1H 1RCXB 4BFOA 1ZCRA 3H7LA 4OZIE 4JM2B 1LT7A 5F9AC 3UAEA 2MOQA 1NICA 3FBQA 3APTA 2YPLD 4DM1A 2WNWA 4X2RA 3URQA 3F5WA 1Y0LB 5HA7A 1CPUA 1UZ4A 2EGZA 4XZLX 1WKDA 3PL6A 1C8XA 3MRMB 4AIEA 3R13A 1UJ3B 2AL2A 3OLIA 2LOEA 1P6BA 2QDGA 3RJXA 4PWJA 3NGBB 2N1KA 3MNZB 2PO6C 1K6AA 2WNQA 5E6ID 4DBWA 2HWZL 2ZUTA 4RDBA 4Z4VA 1KPVB 4J4PD 3MJ8A 4NZTL 1EXUB 4UTBA 2AGKA 4CUCA 4KO5A 4HOMA 5IBTL 2IXQB 4HIHB 4NUQA 3MNDA 4RAVB 1NP0A 3LGEA 4YCOA 3GJFH 2DMBA 4U5KA 4WHBA 1ASOA 1DJGA 3QDJA 1A7PL 3LOWA 4UTBL 1Q86D 1MUCA 1P0BA 2GQFA 4WNQA 1AY1L 3VX1A 1NF0A 1P0NA 3GH5A 2Z6BD 3GWJA 4JFXB 4TPRH 4L3EA 3S34H 5HDOA 5GISL 4KKBC 3ARVA 4IIQC 1IGSA 1BX2A 4LEFA 2I26N 2OQYA 2QQKH 4J3TA 5IEHA 1R9YA 4AMAA 3OTTA 4D9PA 5DS0A 1LVEA 5D1QD 3CO4A 5C0GB 1Z6KA 2VLJD 3DHJA 1D8TA 1UKSA 2GJ6D 3FUMA 5BS0E 3WQ5A 1JZDC 4C6MA 1A14H 1HKIA 5LZLA 2IAND 3G1XA 4H2CA 4M5ZL 2PYED 4OF5A 3VXTB 1NWPA 3HI5H 4WHYG 4A3UA 1JNNL 5KW9L 5DHDA 5ERWB 1EUNA 4D6DA 2NW3B 4LHUA 4ZXOA 2ZDRA 3OAWA 2V9UA 4W9ZA 4PC6A 4EI6B 5KBPA 3P77A 4G9FE 5MKGB 3VGDA 1M71B 3SQBB 4DYEA 1ADWA 3NCEB 1W9VA 1Y6KR 2AQOA 3GW0A 5FF7A 1MCDA 1JYVA 4D94A 1EBAA 2RMNA 1T21B 3TURA 4JPVH 3CJJA 4PUNA 2YLHA 5ICUA 2QXWA 3S42A 1LJMA 1FWJC 2C4UA 5EZOL 2QUNA 5LIWX 4XAZA 5LQBH 3DSFH 1LG2A 5CEXA 4NUMA 3COOA 1L3WA 3H56A 1K4DA 4S1DD 1JPHA 4OCSL 4XPBL 2NQHA 2COQA 4I9MA 4WZHA 1K8YA 2IBGA 4NO3B 3APFA 4NO5A 3TYFB 4FQIH 3DH7A 4P46D 4Y9UA 4Q52A 3RKPA 3CP2A 1TTFA 2BFGA 3GMQB 3SZKC 1B3XA 2FQIA 1G1CA 2V69A 2CO3A 4F4RA 3F2BA 4PJ8B 1ZTXL 2YXFA 5D7LB 2JK5B 4L4JA 4CA4A 1QR1B 3LEXB 1JPKA 2KX9A 2R1LA 1CWVA 4CBPA 2PW1B 1HDMA 3SY0A 4QWWD 1NGQL 4MQTB 4N85A 4DSYA 5BVJA 4JFPA 3VO2A 1CDBA 3SDDD 2CLVA 2DL9A 1OIMA 3T1WA 5EMLA 3T7VA 1TVBA 5FXCH 1ORQB 1XFCA 1ZY9A 3OKMA 3D0AA 1XPGA 4S1QL 1JXGA 3KG5A 4M6OH 5I8CA 3QZNA 7FABH 1ONRA 4RD2A 2P43B 3JV6A 3B7RL 2UY3A 4GSQA 4P2QE 3L17A 3MU7A 4RCZA 3Q2NA 3QORC 4WQOA 4DZ8A 4ERSH 3GS7A 1B31A 3QPYA 3BW9B 5DO2C 4ZK8A 2GOKA 1MQ8A 4GUCA 4QRQB 4E9RA 4MJMA 4Y8FA 1S9XB 4ERAA 3QP3A 4DP0X 4BF7A 1YIXA 4LYPA 2WOBA 4LUSB 1UQSA 1HH9A 1R19A 3H2PA 1MUWA 2NY2B 4G8IB 4HK7A 1CI3M 3F7PC 2AEQH 4F48A 3FJ6A 3TA3B 1AHKA 1E42A 3T8XA 1BJKA 1N7MH 1QNZH 3K4ZA 2P5WD 2PP1A 4ODWA 2H2SD 1MABA 4J3UA 5IHUH 3TJEL 5J06A 5IGXH 1M7IA 3WMQA 2OYLA 1SHMA 3BIKB 2PLMA 1GZHC 4Z1CA 1COBA 5CCJA 4NAFA 4O2EB 4A8IA 1YNLL 1UWAA 1ETJA 4HZ7A 4F0KA 3SE8L 3VG9C 3STGA 4YSUA 2GC7C 2AQRA 3AT9A 4M93C 3NQAA 4RW3A 4AD5A 4EACA 1CCZA 1MCEA 3OLEA 3UPAA 2N56A 3EHBB 1XE1A 4ZUSA 4DZHA 1QGZA 4ACPA 3GHRA 1SGKA 3TO4C 2W9DL 4BK8A 2JGYA 1IGJA 3PJXA 2OSXA 4XBMA 2JB6B 5JHDD 1ZA3B 2JJTC 2OMTA 2QJJA 3CVHH 1CL7I 3ZY7A 4DFHA 1GC1H 3NIFB 3F5LA 3RPIA 3NH7H 3ZZTA 3KTCA 4K71B 3P82A 3POHA 3G1SA 1N0VC 2J56A 3D09A 1YYML 4JFEE 4F93B 2R23A 3RUGB 1AQHA 1PGRB 1R47A 3BKYH 2FL5B 1MFBH 4OBRA 4AJYV 3GK0A 1G0DA 1NDGB 1A6AB 4XG1A 3ATBA 4JHAL 5CGTA 5LDUA 2Q3OA 1SYVA 3NSJA 4JGDA 1PNCA 4X7SH 2BMWA 3H7BA 1FZOB 4H7CA 4IX2A 5C9RA 2X4OA 2DORA 3QGAC 3SE9L 4GKNA 4MMZC 1QLRA 1YEIH 4MJ5A 1AZUA 2VL5B 1BVNT 4X8GA 4HUNB 1E6PA 5A40E 3ZLFA 2IH9A 4JO2L 3QWOA 2VM8A 3LS5H 3U1SL 4L6HA 1WZAA 5TE6H 3CW2A 1M04A 2ZRXA 4H8HA 2OTWB 4MKMA 4PJ7F 5B1AB 1M1SA 4XVTL 3O3EB 1MH5A 4P9SA 3D1MC 3HW7A 3S36L 5LXGL 4UT9H 4RDJA 2C3HA 5C09A 4YN3A 1BF6A 1O66A 2WXGA 5C07A 5I3FA 3QB7C 2E5CA 4GW5A 4JPKH 4Z78B 4NRXB 1QNPA 1LD9B 4PIRF 4Y9NA 5TQ0L 1G7VA 4R7OA 2PUQT 1KM1A 3FL7A 4GSDL 3GSRA 1PYWA 2HX8A 5FIEA 3O6KL 4PJEE 3CSYB 1LO0H 3BVXA 3L3IB 3MLYH 4FXGA 1EXUA 3JWDC 4FKKA 1FE8L 5AOIA 2K1MA 3T2NL 3FSTA 3NPWA 2IXQA 3FHQA 3ZE0F 3OR7A 1IQDA 4ZX6A 4CVXA 3WLIA 2IDCA 1T8XA 4JQIA 1URLA 4IGNA 4E4UA 1NDMB 4M1DL 1MIML 1F6AA 3T78A 1KV3A 4OE7A 4BFGA 3ATDA 1JWSB 2ATPB 4LK4A 4FOMA 2AMGA 4KFZC 4IOSA 4P7NA 2E27L 4FZEH 1TR1A 2V68A 5CC5A 3OC8A 3W7OA 2YL6A 3CHEA 2OO6A 1EZVY 3MROA 5JO5A 1JDEA 4FQJL 1NBVH 2XCMC 2IDUA 4DF1A 2IADA 3MA7B 5G4NA 2R0KH 3URAA 2DTML 4RDKA 1WEJH 3VILA 3THUA 4ZQKA 2VDMH 1VR6A 1MEWA 2E28A 1HP5A 4LVFA 2HA1A 2R1XA 2PCPB 5DJCA 3VFPA 4XSLA 1A8ZA 1U8NA 2Z35A 1OAQH 1PLGH 3MRNB 1LL7A 3QRGL 5EY5A 1BHGA 1U42A 2NR6C 3A6OA 4HS3B 3RWDA 3WLSA 5KW9A 3IFLH 5KNLA 5DK0B 4PFHA 2IOOA 1OG6A 4OI8A 3LNMA 2GSJA 4JO4L 3SBWC 4NOFA 4Y4KC 2EUXA 4IGBB 1WC7A 1CF8L 1JGEA 4PBVC 1X8CA 1LNUB 2XKNA 1BVWA 1QSED 1SUHA 1KGWA 3K2UH 1MJUH 3FB5B 1QFHA 4AMWA 2IMRA 3HMXL 1SHWA 3FUEA 2DYPA 2J88L 4HEPA 2VYRE 4ZAKA 4WI4A 3T3PE 3TYGL 4DY1A 3ECUA 2DM3A 4NKOA 4N3UA 4OJEH 2PLCA 1NIBA 2XI9A 3B43A 1J12A 3L3KB 2LR4A 4ZG1A 3MV7D 1EFQA 5C0NC 3ETBJ 5SX5H 3V8CA 5I66A 3NIYA 4KESA 3TS8A 3VNLA 4AZCA 3U1QA 4HBQA 2JIZA 4OUEA 2CLZB 1CQXA 1OW0C 1CXEA 3QJQB 5H37H 4OGYH 4DT2A 2PN5A 4TSAH 3VWJD 1SN5A 1VPQA 2YN3A 1EP2B 4KRUA 1NUFA 4UNLA 1EZLA 1GZQA 3RHWF 2O5YH 3UG3A 4BFBD 5I30L 5L7XH 5BRBA 1E5JA 3WFBL 3H9SB 4MLIA 4N8UA 4NNJA 2EDDA 5AD0B 3OJWA 4EOWH 1NWRA 4QP0A 3GRWL 4POCA 1QO2A 4MCZA 4UOZA 1LYXA 3UGEA 3B40A 2VR8A 3RVXC 2ISWA 4FQXC 1S72B 3NG5A 3QEUA 3F65A 2WJFA 5EMKA 1RLBA 3REQB 1N9PA 4WI6A 5ICXB 5KINA 3W2FA 1KIUB 2FJGB 3CXOA 3X12B 1XD1A 5EU6D 1N3NA 1BM3L 2IUZA 1TPFA 3T0EA 2P7TB 4LUJA 2WSPA 2CWRA 1T2JA 4OFIA 3IGHX 4X9SA 5GHWH 3WQPA 2NUPB 2FVLA 1ICPA 3QEQD 4Y4KA 3UNDA 1E51A 1OK0A 3QUMB 3LHAA 5CGYD 3WAJA 1IT8A 4PJ5A 4C4UA 5F9OH 4YEJA 1YUHB 5FX3A 2NY0C 3MKGA 3KBFA 6FABH 2AS5M 2JEQA 3EWDA 1XHHA 1TPXC 2G3FA 1XSOA 3TFXA 3SYOA 2C15A 4MA8L 1LO2L 1BM3H 5DK3A 2EFGA 2Y5SA 4AF0B 1R9FA 1J8SA 3C6LB 1WSST 1OEPA 1KD0A 4C1KA 1T1YB 4U0RC 2FTPA 2J78A 5H6HA 4HJUA 5E2VL 4KO9A 4V1XA 1CBJA 3DBXA 1VFBA 1NTDA 3VWJA 4P5KA 5LDSA 1HJXA 1RZ8A 4URTB 1ME9A 2CWXA 3IJDA 2ZP8A 4HIJB 4I0PD 1WFOA 2MCMA 1YY9D 4EDWH 4GOAA 3HZYA 3RM8A 3AU1A 1J8KA 2C0HA 5HXBA 1EPXA 2GJRA 2ZUQB 3MXWH 2IWGA 5F1SA 1Z69A 5KSWA 1N7KA 1NMBH 2YXOA 4QLWA 4ONFH 1J87A 1O7VA 2AJZA 4P99A 1EDTA 3SQMA 1KIQB 3BEVB 4HALA 1PKVA 1Z7AA 3GNPA 3B9KA 3BH9B 5EMMA 2GGGA 3LCHA 4Z9KB 4ESKA 5HYJB 2EVGA 4FA6A 5D2LE 3AM8A 3CZGA 3GDLA 2YBUA 5EO9B 4O2EA 2WYZA 3MN8A 2BCKA 3CHFA 2DSUA 1WWCA 3DYOA 1NSNH 1QLRB 3UC2A 1MI5B 2VR7A 3KPLB 3FS9A 3ZHNA 2BERA 4RZ5A 4AZHA 3DROA 1S38A 1U1UA 5IJCC 4KKBD 3C5JB 1RPKA 3GK8H 3IDIB 4MWAC 1YUHA 5JW3L 3FVMA 2HMAA 5E6UB 3HHSA 4ZMLA 3G08A 3IEBA 1NLDL 5J12C 5EB8A 1I3GL 4IIZA 3G18A 2ZSWB 2GUOB 4IF2A 4AQZA 1Q13A 1PKQE 3WHXA 4WI7A 1DL7H 2XBDA 35C8L 2VN3A 1WU8A 3B9AA 3QIWB 4KUCD 4NDMB 1VFMA 4QNPF 5LVEA 3QQ4B 4X5XA 1W3TA 4OTKA 1MLCB 5TIMA 5IOBA 5DHYB 3TLLA 2YZ8A 1I9RH 2WZTA 1MHPL 1SYVB 5LHDA 4HLJA 1I1FB 1DV7A 4JN1L 3W53A 3R06A 2J21A 1VQ6B 2XA3A 1AKJB 5IB5B 1PL9A 1THAA 4HV8B 2BSLA 1IC5H 1WZ1L 3CFJA 1KYFA 3TESA 4LPUA 4JB9H 2FLBT 4PJIA 3DFPA 3NL5A 1RY8A 1IC4H 5IESH 1C08A 1RA0A 4I8YA 4FLHA 4N8VG 2O6DA 2PDPA 4Y96A 5KZ6A 2VXQA 4XCFH 3QDAA 3W75A 1EJTC 2QLYA 3KPQB 1PSKL 1XCFA 3IIOA 5D2LA 4BE6A 1VERA 3C2OA 4EZJA 1OCCB 3UR8A 4NUJA 5D2NB 1OC7A 2EIMB 1V6TA 3BP5A 1ZTVA 2F6XA 3C75A 3P93A 3WL9B 1W0KA 3STZA 4Z7IA 3CVIL 4C57C 4BY3A 3WBKA 1W9DM 3AO0A 3NABL 3Q45A 3WKQA 2FTAA 2LAGB 5KJ4A 1GY1A 1OTTD 5JQIB 4F15C 4TV6A 5GRUL 4EBQH 5AAMA 4CC0A 3FFDB 4F7MA 1BYDA 4W8BA 2B7OA 4NQXB 4I2XE 3NZSA 1ZK9A 3SE4C 4CNIA 3V4PB 2UWEF 2ICEB 4HBCH 4B5UA 1MXSA 3C3UA 1M7IB 4IRZL 5FECA 2PYFB 3Q39A 1O6VA 1B0WA 2BNQE 4K3HA 4P23B 6TIMA 5FEWA 3ZQWA 1H51A 2F53A 2NX5D 3FT3A 3RQ3A 1MRFL 1F8MA 2J13A 3BFOA 1JGVL 1WIPA 4KGJA 4YHIA 5KYUA 4LC8A 1PS3A 1IIIA 4NQEE 1UT1A 1FNGB 4L8SA 1E6JH 3E0IA 3SYCA 1X5IA 4HTBA 4O4VA 2QIIA 2X8KA 2X6AA 4M6NL 1YY9C 2R2CA 4M29A 4YBHA 5I00A 1RJRA 1U58A 4O16A 2ESVA 4Y2LA 1OOAA 3LBOA 3GDCA 2JI3A 4W9IC 3VNIA 2H3XC 3KYNA 2QPEB 2QGGA 3H7RA 1DTNA 2HXAA 4U0RB 3GB7A 5G1YA 2DWTA 1KFJA 1LDPL 1UM5L 2G5BB 5AW7B 3IK2A 1SXZA 3LIZL 1TOXA 3DPBA 4FDWA 4HKBB 5H37A 3DV4B 1R3JA 1HTYA 1V7ML 4DERA 2P49B 1TJHL 4I3SL 3VUSA 8RUCA 2XWBA 4ANUA 3P9WB 32C2A 4P4KC 1RD5A 3UZYA 5E1AA 1BPVA 3KBSA 5C9UA 3QIBB 4A2RA 2J66A 3KYOB 3EX4A 3WLKX 1DDTA 3CQHA 3KWSA 4ZNCD 1H6EA 2A77L 3VFTA 3COTA 2BOBB 4H8WH 2RC6A 3CWOX 3O0RL 1JHTB 4YH6A 4F79A 4KW2A 2HH0L 4RFOH 1VFAA 2XH0A 3UZ5A 2MNUA 4UQBA 3N0PB 4PRPA 5GGRB 4GT0A 3SIKA 3UCQA 1E50A 3E80A 3OWEA 4IRSD 1WDRA 3EHBD 2ZZ1A 3WX7A 5D7SH 3JWNG 3S6OA 2BOFX 3VABA 3H2WA 5CR1A 5EU3B 5AKSA 1HZHL 3FU3A 3VGBA 3UWUA 3LKSA 1MHCA 4Z7QF 2FZMA 3SCOA 2BGSA 2VQ1A 3Q1EA 5F1NB 3MJ9L 4UTIA 4RMTA 3KPOB 1MEXL 3K8LA 4P23D 4XAKE 1NDHA 5IQMA 2PWVA 1Q8MA 3GH7A 4XISA 3FN9A 4Z1BA 3O3EA 4G8GE 4QE1A 4RRPG 5IEHB 3E9TA 1Q81D 1UWGH 1UKPA 4N2MA 3VI4B 1XIFA 3TYZA 3MZGB 2OYPA 2Q09A 4HGWA 3KDMB 3SO3B 4P2OC 3RB5A 3JWOL 4DCQB 3GHPA 1XBXA 3BSZL 1B3IA 2WCPA 1U8QB 1WAPA 4NZUH 1IM3B 4U1SA 1FH2A 5FA6A 4BFIB 4YSCA 5AYIA 1T4WA 1RIHH 1H60A 1IWAA 3BLKA 4B9ZA 1AE6H 1BTMA 1KIRA 1RJYA 4OD3H 1E9QB 3WJLC 4HAKA 4Y9GA 5DD1H 1IO4C 3ZSSA 5CCKL 2EYTA 2WMGA 2R1WA 1P4LA 1OM3L 2HLFC 2EEFA 4X3ZA 4TVUA 4K1WA 1T5XA 2WKOA 1MNZA 5EMJA 5JW4R 3S1WA 1F4HA 3PQYD 4MA1C 5KSWB 3EKCA 3S1XA 2ZUQC 4PODA 1VBGA 1GKEA 2VXVL 3M8OL 1AKJD 3RX2A 3CC7B 3BRFA 1X98A 3D0LA 3L5XH 1SVBA 2YPKB 3KWXA 2JIWA 5D7LD 3VSUA 2PZ0A 3S37H 5HNNA 2OQLA 2NY3B 3EADA 3CFKA 2POZA 4X5WA 5F7DB 4DK6A 4RDVA 4NUGH 4EMZA 3ZKXB 3FVDA 4O9HL 1CQKA 4Z3JA 1AH4A 1IBDA 4RMWA 4RMSA 2JKLA 1EIBA 3P1VA 1RQBA 1MCIA 2WN3A 1CTMA 1Q38A 2AL2B 2E74C 1RU9H 1V5XA 4UFKA 5E6YA 1HJSA 1EFCA 3CMOL 2NV9A 4HH9B 2UYLA 3S34L 2Z0IA 2M8XA 5XIAA 2DPKA 1AOHA 3VA6A 1YDVA 3W70A 4HIEA 3FB7B 3RL1B 1T04A 5GRXG 1EAPA 1VH7A 2DSVA 4G6JH 4G1KA 4IMCA 1TA3A 4Y2WA 1HH9B 1EJOL 1IC7L 1N64H 4XTRD 3DX7B 5E5LA 5I6OA 2FTYA 4KRZA 3FSAA 5GV7A 2DZUA 2YXXA 4FMFA 4Z7VA 2EPKX 1OFBA 2IBZX 3USZA 3GFYA 4WKHA 4ZTXA 3GFUA 1TENA 1HHKB 3MJYA 3C6EA 1LLOA 3P3SA 1EDHA 2NY3D 3GDTA 3HGOA 3M7SA 1UFUA 4BWLC 2PPDA 2NY4B 4YQXH 1IC5L 1UCBH 5I8KL 8XIAA 1NKRA 1E7UA 3ETBF 2EDWA 1EFRA 5HK4A 5D5MA 3WBXA 3IKKA 3RVUC 3GBLA 3LD8C 4M03A 4US5D 3I6KB 4J3WA 1XFBA 2OTUB 1GG1A 5FO7B 2F15A 1SXCA 3SPIA 4PBWD 1OX4A 2OT0A 5IB1A 3KPQA 1DLFL 4RFEA 3ZXWA 3HHMA 3GGWB 4X4MA 4KTGA 4ZFZB 1M41A 2ESCA 4BCEA 2AMXA 3AY4C 4FB7A 4W9EC 4ZNEE 5DD5L 3V0DA 1E0TA 1KQSB 1U6AL 3WZ0E 2XIDA 3QJAA 4I7UA 2Z64C 4JHWL 4N5UA 3GS0A 2QELA 4ZB2A 1G6RA 3QPZA 4E2OA 3UZXA 4JFZL 2P24A 3EG9A 4PGCB 3MNMA 1TVHA 2HDNB 1YQ2A 3QZAA 1O75A 2BW5A 3NDYE 4DELA 1XT5A 1LWJA 4P2NA 3RO6A 3ULSB 2WINA 1PTAA 5AB1A 2JMRA 2BB0A 1V6UA 4AQEB 2CR6A 4D9LH 1SDDA 5FKPA 3CC1A 1MG3C 2A77H 1XRVA 2P8PA 3L9BA 2NNRA 2RALA 1OLLA 1JZ2A 5BMWA 2Y7GA 2VWEE 2AJUH 1JZ7A 1RAKA 3UESA 4PRBA 3QKEA 3Q8AA 3DRQA 3CMEB 2VOMA 4B9KC 4M6NH 3EB4A 3CFQA 3JS3A 1FZJB 4LHUB 4PMFA 4XO9A 2X1WL 4NFBA 4R2GC 2NVAA 4H6EA 4M5YL 5F7EL 5BV7C 1BYPA 3E6EA 4HYVA 1XRFA 2HT4D 2WSYA 3PUOA 4TX9A 4G1MB 1A4KA 1LEIB 4GX8A 4ZQRA 1RZFH 3POCA 5AOZA 5EZOH 3L7RA 2YLAA 3Q43A 1EHLH 4A04A 1UP0A 2WXHA 1QSEE 1SM3H 2I5GA 4HSOA 4D71A 1IEAA 4U1JB 1H3GA 3DIFA 4MYWB 3FQ2A 1H5BB 3NIFE 4PTTB 4UV4H 2VCAA 2ZRWA 4MWAE 4PMVA 4XX6A 3HB3B 2FH6A 3QIBD 4G3YH 2F6AA 4O58H 3BD5A 3ISWA 4UB0L 4ELMF 3S6TA 3G6LA 1EC7A 4RFNC 1UJTA 4QRFA 2C3GA 4E3TA 4J8RB 4N2LA 2I14A 3C2RA 1PJ9A 2BNRA 1GXEA 1E0XA 3U0TB 5H1WA 2X0UA 5EN3A 2X6YA 3NQ8A 2C9PA 5CGMA 2QFRA 3TIDA 1P7BA 2V5TA 3FW6A 4GSXA 5CN3A 3VNJA 3W7EA 1T1WB 5JXEA 1NFGA 1XDMA 4F33A 4TMXA 3MU3A 2WO2B 3O1NA 4ETQA 3K1KC 2BY3A 1IXQA 5JW5B 5I06A 1HXMA 3U8GA 1OGJA 2YFOA 3L4VA 1TZIB 3OM3B 3QNYB 1FI8C 5J1AA 3QXDB 4A2HA 3QI9D 4RNHA 3CCHB 2GBAA 3CB4A 3HZKB 2G0LA 4BDVB 2CDEA 1C93A 2GFTA 1I8KB 4OVXA 5FJTA 3W01A 5I77A 1SJXA 5C0DB 4AXWA 1KK2A 1R5NA 2ZUXA 1W3NA 1W8OA 3NFPB 3Q06A 4C6OA 1Y65A 5AVXB 4F8PA 3KDOA 4MUZA 3IDYC 3TYUA 2GIYA 4DO4A 4EOWL 1UB6A 2V6AA 1X1ZA 1XG3A 1LILA 3QORB 1SUJA 4PG2C 4UF7C 1C9SA 3T07A 1E79A 1NIUA 2C1IA 2R0ZH 3LAFA 4EDXA 5A3IC 3S96A 4HJ1A 3O9WB 2AK4E 2K6ZA 4B9IA 3OGSA 2WSDA 4XUYA 3DX9A 2EINB 1O7SA 4JRWA 4G6FD 4UM9A 4FMKA 2PDLA 5KYWA 4XZ9A 1U8JA 5FYKH 3QJZA 1NDGA 1GO2A 2QV2A 2X89D 4MNMA 3WJXA 5E9AA 2DEXX 4F58H 3GSOA 1P7QA 4Z7WA 1EJUC 3U4AA 3BPWA 4JYFA 2QUMA 3OB0K 4DQOL 3HE6B 5IK3B 2VQ1B 5GSVA 6FABL 3GFXA 3ASOB 1TJGL 2BNUA 3UAJA 3VVWA 4GGHA 2CRMA 5CZ0A 3QEHA 3TWBA 4KEMA 3ZKNC 2GJ6A 4AHQA 2XWDA 3II3A 1LK3H 1V79A 3BWAB 1YTDA 3SEPA 4LAOA 1RUSA 3SIZA 2Q86B 2R8SH 5D70L 1MDRA 4KK5D 4ICMA 3R8HA 3I7QA 1EJ6A 4E4PA 3UGXA 1DQQB 3MRKA 3L8QA 5BO1H 1MREL 4NPKA 2CCLA 3BO8B 4JFOB 25C8H 1MF2H 1DJIA 1FL3B 3WBDA 3WIHH 1IXNA 2H2PD 3HKZA 3GQFA 5B38A 3EYPA 5C8JA 1WH0A 3GMNB 4FRWA 1B2WH 4LSSH 4E5TA 2R8SL 1EZ2A 4EKJA 2Z28A 3DOIA 3E0LA 4YDJA 1SMAA 1OP3K 4AYID 5E24E 2ZZ4A 2CGYA 3U46B 4HUXB 4X99B 1I2RA 1A3ZA 3EFDL 3RTLA 1MI5D 1KBKA 3T2QA 5HHPA 1DXEA 3TT3H 4TLTA 4ZMNA 4DZAA 5C92A 5FEBA 3CDFA 3D3VE 5C7VA 2HWGA 4UIMA 4UAHA 5HJDA 3GUTA 2D03L 3WBAA 4DAIA 4FHAA 4P46A 1MFDL 1ZHBB 4XIMA 2UZYA 5IJDC 4HGKC 4ORGB 2O6EA 2B0MA 3X11A 1AYRA 5E0CA 3WQ6A 1KELH 3TPUA 2IFGA 2YDQA 4JAMB 1CDJA 3VRLF 3VNDA 1UVQB 5CIPA 4ZYKB 3TV8A 2EYSA 4A7GF 1JGMA 1P5BA 3W00A 1B6UA 4X4ZA 4BSWA 1JZ4A 3UWYA 3O4LE 4PJ8A 3KLAB 1AA1B 2E56A 4I0PB 2EBNA 1ZLEA 1SJVA 1TMCB 1LWIA 1BOGA 4HD9A 4AX3A 4KQNA 5BROA 3WH8A 5C0JA 1XICA 3CUGA 5D70H 2PO6B 2BP8B 3MRKB 4OM0H 1IWBA 1P2CA 2Z7WA 1TR7A 1XGRA 5JNYA 1E6XM 2QQQA 1XINA 3EWCA 3II1A 2P10A 2NNCA 4P2QD 4Y1SA 5B1JC 2XBZA 4Z77B 2PDXA 3Q65A 3B8TA 5DRWA 4ZTOH 5IMKB 2X30A 1E6RA 5AOUA 2W9EL 2YD0A 1RVFL 4Z7UE 3RJYA 4CNOA 5BZWB 4XVEA 2PGEA 4X4YB 1LO3L 2WY3B 7CGTA 5IHLB 1EDGA 1KY7A 1PKMA 3M0XA 3PZUA 5ENWA 1D9KD 2J8FA 3DIVA 3OAUL 2Z7GA 2O5ZL 4HU4A 2YD5A 1F6FB 1T6WA 3S8HA 3CWGA 3MX0B 2A1WH 1J48A 4ES9A 5F7HA 5ID0A 1KRAC 3T0BA 3BLLA 3QUGA 1CLKA 3EH1A 2DERA 1KIRB 4P4RA 5EDSA 4GLRH 2OELA 5JOFB 5IMMB 2XT1B 2DI9A 4R4BA 3CL8A 1EFTA 2BLFA 5CMAA 1YEIL 4YSTA 1IM9A 2PDGA 2QULA 3EW3B 2ISFA 5I5JA 3OKKA 4WK4B 2PTDA 1IM3A 3ARDD 4U1SB 4BFIA 4JTTA 2P45B 3WQGA 3BW4A 3FK4A 4ZCMA 3GSUA 3OJDA 2B1AH 4JCLA 2YCKX 5CIPB 1DZBA 1I18A 2DBLL 4WGXA 3DAQA 4O8RA 4K9JA 4HCFA 2MSPA 5DHMC 4EIGB 2E8YA 2WLIB 1YYAA 2VCCA 1JSYA 3L6FA 1S7RB 2F58H 3Q44A 4OY9A 4PJ8D 4QHUA 5GV8A 1ZHLA 4C4KT 5ADPH 4NP7A 3SW6A 4CNTA 4GPNA 2RD0A 5CGBA 4OW6A 5AWNH 2VBUA 3WLWD 3WN5C 3C09C 3BD3A 3H2FA 4HWZB 4L8CB 4KJPD 5D7JA 3CT2A 5FSDC 1P6AB 1HI6B