3BCFA

Alpha-amylase b from halothermothrix orenii
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
585
structure length
585
Chain Sequence
SLFLIESEPSTGASVSKNLTEIILIFSNDINKVSQLALTDLITDSDIQGIDYNIEGNKVIINNFSLEPTCNYRLSYEVIDIYDNHLQGYIEFLVNQSNYPQIPDQEVNHTILQAFYWEMNTGEYATEHPEEANLWNLLAERAPELAEAGFTAVWLPPANKGMAGIHDVGYGTYDLWDLGEFDQKGTVRTKYGTKGELENAIDALHNNDIKVYFDAVLNHRMGADYAETVLLDENSRDKPGQYIKAWTGFNFPGRNGEYSNFTWNGQCFDGTDWDDYSKESGKYLFDEKSWDWTYNWDEDYLMGADVDYENEAVQNDVIDWGQWIINNIDFDGFRLDAVKHIDYRFIDKWMSAVQNSSNRDVFFVGEAWVEDVDDLKGFLDTVGNPDLRVFDFPLRSFFVDMLNGAYMADLRNAGLVNSPGYENRAVTFVDNHDTDRDEGSYTVSIYSRKYQAYAYILTRAEGVPTVYWKDYYIWEMKEGLDKLLTARRYYAYGPGYEVDNNDADIYSYVRSGFPDVAGDGLVLMISDGTSGNVAGKWINSRQPDTEFYDLTGHIKEHVTTDSEGYGNFKVIKSEDKGWSIWVPVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Polyextremophilic alpha-Amylase AmyB from Halothermothrix orenii: Details of a Productive Enzyme-Substrate Complex and an N Domain with a Role in Binding Raw Starch
pubmed doi rcsb
source organism Halothermothrix orenii
molecule tags Hydrolase
molecule keywords Alpha amylase, catalytic region
total genus 198
structure length 585
sequence length 585
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3bcfA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bcfA04
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3bcfA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bcfA02
4GXPA 3LPFA 4UOJA 1VRXA 3W38A 4XUYA 3AHZA 2X1IA 2PC8A 2VCBA 5C70A 3OZOA 1HXKA 2ZXQA 2ZX7A 1MW3A 1JDCA 1GVYA 5KEZA 2JE8A 3WSUA 1G0CA 4GZIA 1H49A 3CZEA 4ZFMA 1E6ZA 4XZWA 3WDJA 3EJSA 4PSRA 3WNNA 4AYSA 1BVNP 2XIIA 1W1PA 3H54A 4IISA 1LWHA 1QBBA 4HA3A 4JFVA 2XSBA 3WMSA 1LWJA 3CBWA 3DX3A 1HVXA 1R46A 4KWUA 5AC5A 2VQUA 3HG2A 3NSMA 4AIUA 2NT1A 4BQ2A 1N82A 4A3HA 1FHDA 1H2JA 2BVTA 2ESCA 2WANA 3EMCA 1GNXA 1C3FA 1QI2A 3BSHA 3BMWA 4DM2A 4PTVA 1PZ2A 2YA1A 2VMFA 3BAWA 5A1AA 2DSKA 5DT5A 1PZ3A 2EPKX 1KBKA 1WZLA 1QBAA 1ZL1A 4AD5A 4U31A 2J8FA 4EAMA 1BAGA 3N11A 1M9SA 1E3ZA 4MNJA 4W86A 5BXPA 1QPKA 1VFOA 2WVSA 4TX8A 4DWSB 1J0ZA 4PCTA 3S6TA 2WMIB 1GJUA 3AZTA 1UR2A 4BA0A 1KCLA 2OYMA 4E8CA 4ATDA 2ZIDA 2WW5A 1JF5A 4NX0A 4XB3A 3W6MA 1PEZA 3FAWA 3VM5A 2VNCA 4MB1A 4HPGA 4JCMA 3CH9A 1OD0A 4EKJA 3VMPA 1BYBA 2BY0A 2BNJA 3POCA 2AMGA 4MJ2A 3K4DA 3CHCA 1UR1A 5A95A 4F66A 4OOUA 2WC4A 4GI9A 1DTUA 1Q6DA 4Z2LA 1QNPA 1KTBA 1VFMA 1E71M 1MQRA 3A4AA 2WZEA 1GHSA 2DSZA 3AHVA 1J0JA 4W89A 1XD0A 1UD4A 3N12A 3UR8A 3CUHA 3VM7A 3MUIA 4HOXA 3O2LA 3SEPA 1KXTA 5FL1A 1UH2A 4FNUA 3WUGA 4HP5A 3WFZA 5I79A 2EXOA 3GNOA 2ZX8A 1BVZA 4P8VA 1B31A 3WUBA 3OLEA 5CG0A 2UY3A 2BHYA 3PZUA 1F4HA 1V08A 2VZOA 2B31A 3WQWA 1BPLA 3WNPA 2WHLA 1FP9A 1JIBA 2E9MA 2FH6A 4H7VA 4D71A 2GDVA 3OIHA 3N18A 3DX2A 2VJXA 4AZBA 2WSPA 2E8YA 3VO0A 1JNDA 3T0DA 1ODUA 3CZGA 4H8VA 2VZVA 1E4IA 5ABFA 1D2KA 1QHOA 1PS3A 1TVNA 4LGXA 1NOUA 2W4XA 2E3ZA 5BWFA 3VX0A 3PZIA 2VRKA 1OINA 1D3CA 3CZKA 2VX6A 3EMQA 1DWGM 2PWDA 3CMGA 2EPOA 3AS1A 2VZSA 3LPOA 5ABGA 3ZT5A 1E1EA 1PX8A 2JF6A 5IFPA 1RP9A 2D22A 1FFQA 2CITA 4UZUA 4AYGA 4M8UA 3WNLA 4AEEA 1V0NA 1IT0A 2W92A 3VDCA 1QNSA 4D72A 2HVMA 2OW6A 4NXKA 4OBSA 3K8LA 4HZ7A 4X0NA 2YKKA 3VIFA 4BCEA 1BQCA 1W9DM 4CD6A 1QI3A 1KXQA 1NWSA 1NWTA 3ZJ6A 1E5JA 2IXVA 2D2OA 3ZSTA 5HBFA 1OWQA 5A8MA 4GIAA 4UOZA 4JFSA 1WO2A 5IHRA 4L4PA 4D6JA 1ISWA 5JBDA 1ESWA 1C8YA 2VR5A 2XPKA 1H5VA 1BPLB 3DDFA 3GXTA 1W1VA 2W5FA 4CU7A 1D7FA 4A4AA 5I2UA 4MB3A 3IAPA 3PZGA 1GQKA 2VVNA 1QI5A 4F9DA 4AEFA 5CXPA 3LXBA 1LJYA 4P8WA 2YL8A 3PZVA 5CJ5A 4H2CA 5DMYA 5AY7A 2A3HA 1SR0A 1EOKA 4J28A 2YL9A 1QX1A 1GOKA 1M01A 2JEPA 3ZQ9A 4C7DA 1QW8A 3AISA 3ZJ7A 3ZT7A 4QFUA 4W8LA 1UKSA 3GXMA 3FHAA 3GXNA 1TE1A 3WQ6A 2G3JA 1J0KA 1CPUA 2X2YA 3BZ5A 1Q6EA 3DYOA 3MI6A 3N17A 1TZ7A 2WWCA 2Y5QA 2ZX6A 4MJ4A 4PMRA 3EDEA 4DO4A 1PPIA 4ATWA 3VMNA 1QI4A 2WMGA 2WHMA 1JZ2A 3W82A 1ZBCA 2E0PA 1HX0A 1GPFA 3RM8A 2YJQA 1JXJA 1EO7A 2YDSA 3WIJA 1E0XA 3OLIA 3THCA 4TUFA 2XG9A 1JYWA 3S2CA 3SCQA 1J11A 3AXIA 3EDJA 1F4AA 1BGGA 1TMQA 1VEPA 1ISVA 3AOFA 1PAMA 3VILA 3WD0A 7CGTA 2D0FA 1GQIA 1OGBA 1TA3B 4MNKA 1BYAA 2YBTA 1GVIA 2J75A 2WQXA 1PIFA 3VGEA 1TFVA 2QLYA 3DX1A 1O6VA 5IHSA 5LA1A 3RJXA 4D6FA 2G41A 4U5IA 1UHVA 2WKGA 2ZX9A 4KMQA 1HJWA 3VTRA 3D5HA 3W25A 4X0VA 5GPRA 3DECA 1U33A 4NSBA 1LQ0A 3WKZA 2YDQA 5D9OA 3AIRA 5I78A 4NI3A 4NRSA 2PBGA 3TOPA 2GUYA 1HKJA 4HMCA 5EBAA 3NSNA 2OMYA 3H55A 5LA2A 1P6WA 3L4ZA 5D8ZA 1MFVA 2G4FA 2GFTA 3MKKA 3GTNA 3ZR5A 1WDSA 1V6VA 2C8NA 4MTVA 1JYVA 1JI1A 3CUFA 4W5UA 1R75A 4BQ5A 1K9TA 1KTCA 2WB5A 3BAYA 3D51A 1BYDA 1VBUA 1XEUA 1R47A 2F61A 3CMJA 4JKLA 4J3XA 3TP4A 4AMWA 1KB3A 1JD9A 3VOCA 1ZB5A 2FYVA 4HU0A 5A6AA 2CNCA 2YFNA 1DWHM 1R34A 1GW1A 1VAHA 1JZ6A 5GNZA 5GNXA 1J12A 4PBGA 3KEHA 1OM0A 1E43A 3U5UA 1PX3A 3ARQA 4S3JA 4Q7NA 1HJSA 2CHOA 4MAVA 3WBAA 4Z2KA 1YHTA 1QVBA 3NYDA 5CLWA 1J9YA 3PZNA 1TA3A 3WL0A 2G3IA 1VENA 1H3GA 1CGWA 2MANA 2VCAA 4JHOA 3M7SA 1HJUA 5DEZA 4GI6A 2F1AA 4C7FA 1EA9C 2WZIA 4JKMA 1CLXA 1HF6A 1V02A 1G1YA 1E0VA 4HMEA 4OUEA 1US2A 3PZTA 3TV8A 3IANA 4QDMA 1GOMA 3AMKA 5I6SA 3EMZA 4ACZA 1W9BM 3A5VA 1GORA 2E9LA 1WB0A 4AZ5A 3A22A 4UQDA 4V27A 2F2HA 2JIEA 1ZBKA 2CBJA 3AS2A 1H0IA 1E56A 4Z2HA 2OYKA 3KL0A 1JDAA 4LXFA 3WD3A 4JL1A 3SIMA 4D6GA 1V3HA 3T2PA 2F18A 2QPUA 1MXGA 3AXHA 1VBRA 4UFKA 5ABEA 2F7QA 4AZ6A 3LXAA 1ITCA 2VO5A 4UFMA 1IZJA 4P7LA 2Y5EA 2EPLX 1T0OA 3GH5A 2XJ7A 1C91A 4CKQA 4J3WA 4WSJA 2YLAA 1WPCA 4UQ9A 1R33A 1VFFA 1O6TA 1E6RA 2O9PA 2PWHA 4UQEA 2VL4A 4JFWA 3WQVA 4JL2A 4V2XA 4MADA 4M1RA 4D6EA 2A3CA 1UWSA 3K1DA 4IPNB 1B30A 3K46A 2O9RA 3BUPA 4U3CA 1G94A 1EGZA 2F8QA 1G9HA 2OSXA 4B9ZA 3VDHA 2ZICA 1VIWA 1HN1A 1U30A 3AJ7A 3ZR6A 1HIZA 2ZE0A 4NZJA 1AVAA 3BAIA 4CD7A 4F9JA 2ZWZA 4H41A 1DWAM 4URIA 3CUJA 4PTXA 2EPMX 4AIOA 1L8NA 3ZM8A 2TAAA 3HG3A 1VF8A 3F4VA 3KLLA 2PWGA 3AMLA 3LRLA 4OZOA 1LG1A 1JZ5A 4HOZA 4M82A 1MWOA 3D50A 4BZYA 1IX2A 5LYRA 2JFEX 4L4OA 2WXDM 5FCZA 2J74A 1JF6A 2DH3A 3BC9A 1ISYA 1UR0A 1E0WA 3U7VA 2YFOA 1NWUA 4MDPA 4UCFA 2DQXA 5IXEA 4NXSA 5A8OA 2OMXA 3HMCA 1I1WA 2ZUNA 3VGBA 4W84A 1NARA 2DPEA 2NSXA 5E6ZA 4CGTA 2CYGA 3AIQA 3TONA 3TTQA 3GXIA 5CPTA 1B3ZA 5E6YA 2DIJA 5CPSA 4FNSA 5HDRA 5FKYA 2WM0A 1CZ1A 1V02E 3D4YA 4W8BA 4W7UA 4CUCA 4RE4A 3L4WA 2RA1A 3CUGA 1MVYA 1WDQA 2J78A 2ZUVA 4UTFA 1H6UA 2DDXA 2XWDA 4BS0A 4D1JA 4D1IA 3VUPA 3AIUA 4Y7EA 3WN6A 3WH5A 1HJXA 3LRKA 2WLYA 4GQRA 1ISXA 2RGMA 3WY4A 2D3NA 3BCDA 2CKRA 2CETA 2BXYA 1EHNA 3THDA 3WFLA 1CGXA 3OGVA 3WUEA 2XWEA 1XYZA 5A8QA 1CXIA 3VD7A 1HP4A 4M24A 3BVVA 5CPQA 1C8QA 5I5RA 2X0HA 4GZJA 1J10A 1HJQA 5HNNA 3IAQA 3VSVA 3VIGA 4FMVA 5CZKA 4ZXLA 4H04A 3ZIZA 1UD8A 4FF5A 3B8SA 1H6TA 2BY1A 1JZ4A 6A3HA 3WNKA 3BUQA 3GZAA 4UR9A 2ZUMA 2BXZA 3DC0A 1DWIM 1WZAA 4OBRA 1Q6GA 5A6MA 1W9VA 3L2LA 2J79A 2X2IA 1QNOA 1RD6A 4E8DA 2WMHA 1EOMA 2XHYA 3TA9A 1B3YA 2GJXA 4UOQA 2FHCA 1MW0A 1CNVA 1GQJA 3VGHA 3BMVA 4DWSD 4OJYA 1CWYA 2VTFA 1UASA 1UA3A 1OD8A 4F8XA 1E6QM 5A3HA 1JZ8A 1HKIA 1ECEA 3HG4A 4PUDA 3B9EA 4U5KA 1E6XM 4UZSA 2J7FA 2V38A 1B0IA 2FGZA 4PRWA 3RILA 1DWFM 3WH7A 2XVGA 1A47A 5HOSA 3SCUA 2C9QA 3HU7A 1V03A 2J47A 2ZXBA 3AIEA 1BSIA 1JFHA 1UD5A 3CIVA 3CZ8A 4KRTA 3L4VA 2BFGA 3L4YA 1FP8A 4JCLA 2CHNA 4TOQA 4CCDA 3VMOA 1W1TA 3WDQA 3O6AA 4BQ4A 5CSYA 3QR3A 3AS0A 3VX1A 3ARTA 4FLOA 3ZO9A 2WQWA 5I3DA 3AZRA 1JAKA 1BTCA 1UWIA 3ARPA 3W4RA 1PIGA 2CXGA 3VIKA 2XIBA 1E5NA 4Z2IA 1K9FA 4DUXA 2OMZA 8CGTA 3NJ3A 4DWSA 2GK1B 2ZWYA 3W81A 2DT2A 3BH4A 1CLVA 1CBGA 1UWTA 4A3YA 3VIMA 2DT0A 4CC4C 3MV01 1UZ1A 3UERA 1FA2A 1NH6A 3FY1A 1V6UA 3WY2A 2A3BA 3ARVA 4FNRA 3N13A 4B15A 1V3LA 2XM2A 1QW9A 3D3AA 1UQZA 1OIMA 4FLSA 4CD8A 4GI8A 1E15A 2VR4A 2O9TA 5M03A 3AROA 1TQWA 3QHMA 2WMIA 3BVXA 1W3LA 1HVQA 4AZGA 2J62A 3MSGA 1AMYA 3T09A 2OWWA 1UR4A 1ODZA 1CGVA 4JZ5A 2X2JA 1UG6A 2WVVB 1QWUA 4DO5A 4ATLA 8A3HA 5C8BB 3II1A 1O7AA 3L4UA 4ACYA 3PBGA 1SMAA 1VEMA 4E4PA 4KRUA 4KGLA 3TTOA 4UFJA 2WVTA 3WUFA 3EYPA 1I1XA 2J7GA 2QHAA 1SMDA 1HT6A 3W0KA 2GK1A 2CEQA 1GOIA 2DSWA 3E1F1 1W2PA 4DUVA 1TQUA 2YA2A 1UWRA 1ZU8A 5DO8A 1J0HA 2WCSA 4WLCA 3LRMA 3QOKA 4Z2GA 1E1FA 2FE0A 2WQUA 1W1YA 4WK9A 3BLKA 2DT3A 1CEOA 4AD4A 3DDGA 2XM1A 2XFRA 3OLGA 3DYMA 4AZIA 5F7UA 2WHKA 2E8ZA 2EEXA 5JUVA 3ALGA 3QHOA 1IV8A 1MW2A 1J18A 3MMDA 4W85A 3CLWA 1W9XA 3WBEA 3ARXA 4UQCA 5DF0A 4D6IA 4W93A 1B2YA 4CU8A 3WENA 1W9PA 1V6WA 2DSUA 2VT0A 1HJVA 1R87A 3UG4A 1EHAA 4N42A 4P7RA 4JFTA 5I23A 5A6BD 1VJSA 4QAWA 4HOWA 3RCNA 1JD7A 2A3AA 3A6OA 3FN9A 3VGDA 3GNPA 1V6XA 1TG7A 3UEQA 5CLTA 3WMCA 2CBUA 5CSUA 3HN3A 3JUGA 4PMZA 3W53A 1KR0A 1TQTA 1VJZA 3CPUA 1X1NA 4R5EA 1MFUA 4U2YA 1B3XA 3N04A 3VD4A 1MYRA 4K68A 5BXSA 5ABFB 1HKMA 2Z1SA 3EBVA 3PZQA 1E4LA 2VVSA 5BXRA 3AIBA 3W27A 1LL4A 1Q6FA 3LPPA 1C7SA 2FGLA 3BVWA 3CZSA 2EBNA 1ZBWA 4CU6A 2C9RA 3BXWA 4QP0A 3CUIA 3A24A 4AD2A 4V28A 2W62A 1Z32X 5BYWA 2O9OA 2XN0A 3UG3A 3T0BA 3LMYA 1OT2A 3J7HA 3W26A 3NDZA 2F7OA 4YHGA 3NSXA 1GCYA 4IM4A 2Y8VA 5M17A 4PCSA 1UYQA 4AZ7A 4JFUA 3VD3A 3A21A 3ZJKA 3B9AA 3PTQA 5CQ1A 4AD3A 5D9PA 2QF8A 1JGIA 1JNEA 3WF3A 3POHA 3OG2A 3U5YA 3BSGA 4OOZA 2FHFA 4IUGA 4RE3A 4RE2A 1UWUA 1X6LA 3G6MA 1OGSA 4QCEA 3M6DA 2DIEA 5E09A 5I0DA 1M42A 1H09A 1XCWA 1DWJM 3AQUA 3D52A 1WCGA 3LPGA 4ZENA 5TD4A 1GOWA 4DO6A 1JFXA 1HP5A 4OIFA 3VSTA 1OGGA 3IJ9A 4WKAA 4RL3A 1BGAA 1H11A 1K9EA 1NP0A 4CN1A 2V3DA 2ZXAA 2G3NA 3I3BA 3EDDA 3IGUA 5A2CA 2ALWA 3WH8A 1CGTA 1O6SA 2D20A 4UFIA 3AI0A 2D3LA 2EQDA 5DFAA 3ARZA 1EDGA 2VZUA 3GYCA 5JBEA 1JZ7A 2XYLA 2CERA 1XSIA 9CGTA 3UG5A 4F79A 3WDHA 4WIWA 1HNYA 3CC1A 3WH9A 2X09A 2V3GA 2EABA 1CXHA 3RDKA 1GZJA 1W3JA 4ML4A 4W7VA 1RPKA 3RM9A 3BLBA 4HA1A 2YLLA 2CBVA 3MU7A 4AZCB 5ECUA 4PMVA 1UOKA 4EK7A 1BG9A 2ZUWA 3KZSA 3SCWA 4PMYA 4ACZB 5CGMA 1ZJBA 3FHQA 1QHZA 5HPOA 4MB5A 1R7AA 3AYSA 1M04A 5BROA 3EJUA 2J7DA 2PB1A 3VD5A 5JIWA 2GJRA 5D4YA 3EJPA 2Y4SA 3PTMA 2UY2A 3AIVA 1RP8A 2D24A 4D6HA 1CTNA 2YBUA 2ZOXA 1KXHA 2WBGA 2OWCA 1SZNA 1KGUA 2BHZA 4UFLA 4AD1A 1V3IA 4B3KA 1I75A 1ZJAA 2J25A 2E4TA 3GXFA 1OB0A 3TTYA 3ARSA 2F7PA 1ZBVA 2EACA 1K6AA 3LX9A 5I24A 3U57A 3EJRA 1BLIA 4LYPA 1L0PA 3VGFA 3WEZA 6CGTA 5IDIA 1CENA 4J3VA 3BCFA 2W61A 4UNIA 4FLRA 4U33A 2CKSA 3W37A 1BF2A 4AIEA 3WEOA 3OGSA 5E0CA 1E4NA 1TR1A 2YL6A 4PYSA 1HL9A 2FDMA 1CYGA 2CBIA 2WCGA 3SCRA 4HPHA 1MW1A 4LYRA 3HG5A 2QV4A 3K4AA 1JYNA 5FOOA 2WZHA 2CIPA 4J3UA 3MS8A 3ARRA 3WY1A 5ICUA 2O92A 1AQHA 3WL1A 2GSJA 3CHFA 3MMUA 2WC7A 3UCQA 3DHPA 1S46A 4KGJA 3B9DA 4H8UA 2XN1A 1CXFA 3K8MA 5E70A 3WQ4A 2VZTA 2D1ZA 3KL3A 1MQPA 5D8WA 3ZT6A 2WMFA 2YDRA 1FH9A 1HKKA 4MNLA 3BAKA 1PJ9A 1MXDA 3SURA 2X2HA 3L4XA 2EJ1A 3IK2A 3CTTA 2OYLA 4AW7A 1PBGA 2HISA 2VI0A 4PUEA 2WK2A 3SUTA 1NOWA 3OLDA 4PEEA 3CHEA 2BS9A 3MMWA 4PMUA 1NQ6A 4WKHA 2VRJA 2G8ZA 4B3LA 3BUDA 5AC4A 3KE0A 2F7RA 1UA7A 3PZOA 2QMKA 2BHUA 4JHZA 4FNPA 1V0LA 3AIWA 2WPGA 1W3KA 2VX5A 4HTYA 4TXEA 2A3EA 2J8GA 3AXXA 3FW6A 4MAZA 3GBEA 4CCCA 1WZKA 2FHBA 4P7OA 3BAXA 5E1QA 2W63A 5AYIA 3W29A 1RH9A 4PMQA 2W66A 1OT1A 3DX0A 3VSUA 1EQPA 4P7NA 4CVWA 3S5ZA 4TVDA 4GO8A 3PZMA 3GXDA 3SCNA 4MPKA 3N9KA 2UY4A 3F5KA 1XD1A 3SCSA 3VIHA 5EFDA 5BCAA 3PN8A 3W28A 4GQQA 3G6LA 2DSVA 4AXNA 2DEPA 3FAXA 1SFSA 3ALFA 4W7WA 3WD2A 3PHAA 1M53A 4B16A 5M5DA 1GOOA 1O6IA 5FD0A 1UD2A 1UQYA 1UKOA 2BY3A 3AMCA 4AW4A 2JIWA 3BVUA 3MV11 1WP6A 3NCOA 4DWSC 2VQTA 1CXLA 1C92A 3UESA 4OKDA 2AOSA 6TAAA 2BY2A 5A6SA 4HZ8A 3RMEA 1CGUA 3HZ3A 3DYPA 4JIEA 5CGTA 3SCVA 5I77A 4GKLA 3WH6A 4C7GA 5FL0A 2WAGA 4UQAA 2WMJA 3T2OA 2CCRA 2UY5A 1DP0A 5A2AA 3VIPA 4GO9A 1TQVA 4UFHA 2PI6A 4TTUA 2BV9A 1W2VA 3MUAA 3LXCA 3VINA 2C9PA 2VC9A 2WC3A 3NUKA 3AMDA 2J4GA 4PMDA 5A8PA 3IJ7A 1V3MA 1KWKA 2C7FA 3A47A 4P7QA 2XUCA 4FLQA 3EJQA 2JALA 5A6JA 1XSKA 1UD3A 1J01A 2Y8KA 2D23A 2OSWA 4EANA 5LA0A 3F5JA 3VNZA 3W6LA 1FOBA 1WNOA 4HU8A 3ARWA 1FFRA 1BYCA 1BHGA 2VX7A 2XVPA 3TTSA 3MO4A 4J3SA 1WZMA 3GNRA 4R27A 3FXYA 1MQQA 2XFFA 1G5AA 4HMDA 2V5CA 4TTGA 5A6LA 4FK9A 3WD4A 5ABHA 1SYTA 5JIPA 3L4TA 1E6PA 4CD5A 1E55A 4MNMA 2WSKA 1QOXA 1W9UA 2D73A 4QLLA 3T2QA 4EE9A 2UZYA 5KZ6A 4J27A 2YIHA 3EJTA 3ZJ8A 3VKKA 1CXEA 2PWEA 4XX6A 4AZHA 1B9ZA 4PN2A 1ITXA 1VB9A 1TVPA 1QNRA 3CZNA 4GINA 1EDQA 3RPMA 4W5ZA 2XVLA 2QMJA 4AD0A 1R86A 1Q4NX 1YQ2A 1UR9A 3MUY1 3OBAA 4DM1A 1EDTA 3BAJA 4YN5A 2XN2A 3DX4A 4S3KA 1B90A 1W91A 3FNDA 2ZUUA 2FH8A 1KBBA 3BUIA 5EMYA 4D6CA 1C93A 3WF2A 1J0IA 4XZBA 1M03A 2WMKA 4M29A 2Y24A 1XC6A 2ZUSA 3NIYA 3WNMA 1EH9A 1UZ4A 4NZCA 3UR7A 2WVVA 1V0MA 1O7DC 1BG4A 1WDPA 1OCQA 4WF7A 1E40A 4AY1A 1OSEA 2G3MA 1HXJA 3T08A 2BVYA 5BRQA 7TAAA 4N0RA 5GNYA 2VX4A 4NZFA 2XVKA 1LF1A 2C0HA 4AMCA 1TCMA 3A4XA 3OGRA 1LL7A 4JKKA 1EQCA 1E73M 3D4ZA 1NWRA 3AYRA 2V5DA 3WF4A 1C90A 3QOMA 3L2MA 4BF7A 1V6YA 1Q6CA 2GJPA 2XFYA 3VPLA 3SUVA 3ZMRA 1R85A 1CGYA 2NW0A 1WE5A 1QNQA 4NRRA 3M46A 4ZE4A 1XYFA 4CCEA 4AISA 4HA4A 4U3AA 3WQ8A 5JBFA 1M7XA 2WQVA 3VIIA 2JF7A 4AWEA 4CD4A 2OMTA 2ZX5A 3N1AA 4DUWA 2ZUTA 2E40A 2J77A 2VUYA 1KQYA 2DGAA 1NM9A 1E3XA 1FH7A 3GM8A 5DT7A 4H8HA 1E9LA 3ARYA 4JAWA 1B1YA 3CO4A 4NF7A 4MB4A 5D9NA 3WELA 5EFFA 4YPJA 5E9AA 3ZSSA 2Q8XA 3KLKA 3SUWA 1W3HA 1XHGA 2JEQA 4GPNA 3A3HA 1KWGA 1U2YA 1JXKA 1XCXA 2YL5A 1E6SM 4HZ6A 5C71A 1KGXA 1CIUA 3WY3A 3K8KA 4OGZA 1A3HA 2W67A 4WJXA 5M3WA 1XRVA 1QHPA 5A8NA 3SCOA 4U2ZA 1XGZA 1OBAA 5FIPA 1XH2A 2YA0A 3QGVA 3RJYA 1ISZA 3KL5A 1GQLA 3BGAA 4Z2JA 1VFUA 4QLKA 4TVUA 2WBKA 2VOTA 1GOQA 1TUXA 2XVNA 3AFBA 2RGLA 1PX4A 7A3HA 3WDRA 2J7HA 1EO5A 5IFTA 4PMXA 1DHKA 4CN6A 3BVTA 5A69A 4PMNA 4M80A 2PWFA 1CECA 2EAEA 1CXKA 3MSDA 1JZ3A 1UR8A 1KXVA 2OWXA 2VURA 3AHYA 1ZS2A 2X8RA 1HTYA 1W32A 1CDGA 2V3EA 3PZ9A 2W91A 1HWWA 4P8XA 1JG9A 2YOCA 2WVUA 3IJ8A 3VDBA 3H53A 5A2BA 3KWXA 1JDDA 4IPLA 2ZXDA 3VDAA 5EB8A 4CC4A 3CHDA 4LQ1A 1R8LA 1K9DA 3GH7A 3AICA 2EPNA 1J0YA 4PTWA 1TQSA 1QWNA 3I3DA 1LYQA 1NOFA 3WDPP 3APGA 2D0HA 4AMXA 4GZEA 2IGTA 1WAWA 1UKTA 4UQBA 2PBOA 3WEMA 2AAAA 2XTKA 2DT1A 2NT0A 3GXPA 2GJXB 2WHJA 3SCPA 4W8AA 1KQZA 4BQ3A 3VIJA 5A6KA 3ARUA 1XH1A 2WKLA 2J7BA 3BLPX 2OW7A 3VNYA 1LG2A 2EO7A 2IUZA 4YHEA 4AC1X 2OLHA 2BVDA 3SCTA 3VGGA 3N15A 4PMOA 3BUBA 2CESA 5BXTA 3CZLA 1UH3A 4TX6A 1EXPA 4AZCA 2OMUA 2X05A 4KH2A 2V3FA 4QLJA 5GQBA 1WDRA 3F5LA 4J7RA 3MANA 2E9BA 1EIBA 2OMVA 2EADA 3WMBA 4LPCA 2GDUA 3SUUA 2WCAA 1UKQA 2VCCA 4XV0A 1V3JA 1E72M 1OIFA 3VD9A 2XSAA 3MUZ1 2CPUA 2UWFA 3I3EA 3AZSA 3WF0A 2X0YA 1Y7VA 2IXUA 3CGTA 1FH8A 3HJEA 3SUSA 2WNWA 4B9YA 1QI0A 4M81A 1JYXA 4D6DA 4MDOA 1NM4A 2UZXA 1UUQA 1H41A 3WQ5A 4W87A 2PF0A 4TVCA 3PTKA 1R7OA 5A94A 1E6NA 3GDBA 4WSKA 3QHNA 1UD6A 3RIKA 4CVUA 3A23A 4CN4A 3WD1A 2OSYA 5BRPA 1E70M 1JAEA 1XV8A 3W24A 3O9NA 2F1BA 2XGBA 3GH4A 1UWQA 3EDFA 5AYBA 1BFNA 5D9MA 3RM4A 2OMWA 1B3WA 3RO8A 3OZPA 3NDYA 1VEOA 3VIOA 3OA5A 1NP2A 4LYQA 4FNTA 4PTMA 3UETA 1KGWA 3EDKA 3ZOAA 3M07A 3AS3A 4ZEPA 2WLZA 4J3TA 3ECQA 5HXMA 1B3VA 2J7EA 3A4WA 3OB8A 1X6NA 1C8XA 4ZXOA 1FHLA 4CILA 2WWDA 1KCKA 1E4MM 3CV5A 1IZKA 1V0KA 3GBDA 1OT4A 2QPSA 3AMGA 2GVYA 4P8UA 1KFWA 3U7BA 1US3A 2XGIA 4WKFA 1LLOA 1H1NA 1C7TA 1LL6A 4Q22A 2WYSA 2J7CA 1XH0A 2D0GA 2Z1KA 1HL8A 1UH4A 1WKYA 3AHXA 3WDIA 1KR1A 1GJWA 4PSPA 3WF1A 1XSJA 3VU2A 3DHUA 3T0AA 4FNQA 3CZJA 4W88A 4M56A 5HPCA 3VVGA 1GONA 1G01A 4ZE5A 3S5YA 1DEDA 1AQMA 4E2OA 4QCFA 2DH2A 1JI2A 1V3KA 2VRQA 5A6BA 2Y2WA 4AQ1A 5E0FA 1GUVA 3WNOA 1GHRA 4X9YA 1H4PA 1AQ0A 1JL8A 3AHTA 4LX4A 1UKPA 1H0GA
chains in the Genus database with same CATH superfamily
3IU3A 3LPFA 4UOJA 3P4OA 1IXOA 4ISVB 4W9EC 1KRAC 2OR9L 3ITVA 3U4FA 3GWJA 3UPAA 4QY8B 5B7ZA 4NAEB 3RNQB 4YAWA 4WW2C 3HMXH 4ZSOB 2VCBA 3HVDA 5TQ2L 3GU9A 4LB4A 1F60A 3OZOA 3WJZA 3VXNB 1HXKA 2P88A 1YDPB 3R8BB 2A4AA 3QZ6A 2CO6A 4XZMX 3OEHA 1RJYA 3CHXA 2ZX7A 4J4PC 5AVSB 3PBGA 3S96B 3DMMC 4X8CA 4DVOA 2XN9A 5KEZA 1AZ1A 3WL9B 4HKZA 4KQ4H 1IBZA 3R19A 1J86A 4FQHA 2FKPA 1G0CA 1QO3A 4YHOH 5DXYA 3WSUA 2OTDA 2UVEA 3F7VA 4ZFMA 3A13A 3E7JA 3R8RA 3WDJA 1EXGA 2Y36L 3QHZH 4BJLA 4I7UA 2OZ3A 1PKQE 2XIIA 3ZL1A 3HLAA 1UXSB 4O02A 4IISA 4Q8VA 4JQ4A 2VQ4A 5CJMA 1KB5B 1QBBA 3VFTB 1VCVA 2DGAA 4DCQA 4HA3A 4DXXA 5DMNA 1Y18A 4NUJA 4N02A 2IV8A 4U6YB 1CB2A 3FLUA 4JG9A 4OV5B 1R46A 2G60H 4BJHA 4AV5A 4GWEA 3SYCA 2O30A 1GOHA 4A2GA 3DX7B 3LGEA 4QQ3A 1D9KB 1YPFA 4IK6A 3TYGL 1IKNC 3NSMA 4RD4A 2NT1A 3NZ1A 1FHDA 2BVTA 2AQNA 2J8UE 1IMHC 3ILEA 3BLDA 3EMCA 3I4KA 5EIIB 4JKWA 5IB5B 2Q8BH 1OP4A 1N12A 3GIQA 2DQGH 5D2NB 4IRSD 2WJ7A 4G7EB 1BM3H 4MZRA 3P9WB 4HX1A 4ROPA 3OW7A 5MKGB 2HKHL 3QWNA 2EPKX 4ZUSB 3WNIA 4F7KA 4ANXA 5HGDB 2VLKE 3S36L 3I6KA 2C5HA 1WVZA 4UM9A 4EI5A 4IHBA 5DT1H 4JFFD 3TIEB 3UZXA 2DUXA 2LR4A 2OMAA 3SB3A 2J8FA 4DJDD 2XWTA 2TYSA 2V9TA 3JVGC 1IAKB 3ASQA 2V7HB 2LGNA 5DQ9A 5SWZA 1FWBC 3OQEA 4PCKA 4MNJA 3BWUC 3D87B 3FO1A 1TB3A 4TX8A 1WV2A 3T7VA 3GLEA 3DX6A 5E4IA 1K2DB 2PDUA 3EKLA 4DWSB 2YD9A 1KLUA 4PJXB 4OCSL 4PM1A 3QIWC 2GSMB 5DC2A 4BQ9A 1QR7A 1T96A 3QFRA 1NDHA 4GY7A 3FOKA 3GK8H 1KTNA 1OG0A 3NOEA 2RQEA 3KGSA 1KZLA 4HH9A 1TZGL 4PP2A 5DVLA 1HGWA 4BXVA 3HJ0A 1YLVA 2PPDA 4QS5A 1A7OH 3T8XA 3AXMA 5D2YA 4W6WB 3TW7A 3HS0C 5JR1H 4ATDA 4QTGA 4R4BA 3G5WA 3D30A 4I4WB 1PLGH 2BK8A 3NAAL 5LQBL 3IJ6A 3P3BA 4L4VE 4WV1B 1N0LB 4FSAA 2VENA 3RU6A 4X99B 4Y8AA 3T5WA 3H9SA 1IEBA 1OK0A 1PEZA 3FAWA 3ALPA 3HNVL 4OOXA 3OHXC 3VFVA 4RFNC 4PVBA 3M0LA 3Q6RA 3CH9A 2H26A 1EWYA 5ADOL 4LKCA 3BJSA 1K8YA 2ZL5A 1W1ZA 4APQD 4PJGF 5EB9A 2J6WA 3BFOA 4U6HA 1RQHA 2BNJA 2CRZA 1EUUA 1KY6A 3KVMA 4MLJA 3P73B 2FATH 4Y4FA 3K4DA 3L4CA 3BDXA 3SLDA 4IGBB 3WFEL 1BYPA 3DKLA 4MY1A 2R4RL 1ZANH 2WLMA 4RNRA 4XQ6A 1UOLA 4CJ0A 4JZJA 4M6ML 2H8PA 2ADFH 5DWUH 2J5LC 2B3RA 3Q7JA 1EGJL 1RSFA 3NH7L 5B1JC 1IXNA 1FWHC 1TETH 4OOUA 4FG6D 3RJOA 4L8SA 4GI9A 3VO2A 4K8GA 1P4BL 5T26A 3JYCA 3VOJA 3FO0H 1OP5H 1B4KA 1S1RA 3A4EA 1QNPA 3KYNB 1JNYA 1E65A 2EDXA 3MOAH 3TEWA 4Y2WA 5HULA 4PJDF 1H1ZA 1CFQB 1SJHA 4NQSA 5J4MA 1UCWA 3OC5A 3LTYA 1G0YR 4JHVA 4HJIA 2BDQA 2DM2A 3TVMC 3KCPB 1Y5XA 1YADA 4AQAA 3VCLA 5BRZA 2Z91B 1GHSA 1DVUA 1UC6A 3F12B 3OFNA 2Y2YA 4KVCH 2ZP8A 5FYKE 5T3ZL 3W88A 2R1YA 1R5IA 2P8PB 4KI5C 3RVXD 1BBDH 2VP8A 2Y5TA 1UD4A 3QIBA 4R5XA 4F9PC 4E9XA 5I1GH 3PWNB 3IDMA 1QH0A 3LD8C 1TG8A 2EJAA 2VLJB 1BD2B 4NJHA 4X7DC 3ZKMC 1FTXA 3GSUB 2K6WA 2F1EA 4DEFA 2D03L 4HF5H 3O2LA 3SEPA 4JHUA 4PRNA 3T3PF 1RZIB 5FL1A 1UH2A 2Z35B 1XLCA 1AO7D 4JFOA 1XYLA 1R5VB 4WRLA 1AAJA 1UJ3A 1ZIBA 3IIXA 1E1CB 1BD2E 4D2JA 3GQBA 3NCJL 3PJWA 3RFZA 1LT8A 1CBVL 4FB7A 3F62A 1P5VB 4L6OA 4I2XA 5CU9A 3L6FB 1QW7A 1YG9A 1OGAD 4XK2A 1ZM9A 4KKNA 5KZEA 2V7NB 4HJJL 4DH2A 3ES8A 3LKPB 2AVGA 5DLCA 4YZWA 3HRPA 3HPJB 1U8LA 5C0AA 4JY6A 4WK4B 3S5LA 5LXGH 4KMTH 3LB6C 4LDOB 1A0EA 2Y1HA 1V8HA 3ULVE 1HIML 1QFOA 3A3BA 1HXMA 1PBYA 4KKLC 4LARH 3TZNA 2XXCB 3NXLA 4D71A 1F9CA 2VN4A 3ZVHB 3W11C 3OIHA 3W71A 4Q4SA 2C5DC 3N18A 2DKMA 5AB2A 3ABLB 3O4OC 4G59C 1TNNA 2QZQA 1SY6H 3DX2A 4LARL 5I9QB 3X12B 3NJXA 5D1ZD 4DN4H 1I7TB 2CBOA 1PS9A 3LCXA 5LXEA 2R2HB 4X8JB 2OTWA 5HANA 2HJFA 2AZUA 1AP2B 2M2DA 1EFRA 3RGTA 3SW6A 3IMRA 1BQKA 3DOPA 3IWPA 3GJFH 3UACA 1K03A 1LO5A 1TF4A 5HY9A 5KYXA 1JNDA 1P48A 3GJEA 3G1RA 4JQIA 1OP9A 3QFDB 4BDVB 2HLFC 1W3NA 4C6FA 5TDNA 5ABFA 1BFVL 2UY6A 3NIGE 4Q58C 4L9YA 1U8MA 3W1AA 1QHOA 4I9MA 3UPBA 1ZT4B 2DZVA 3PFRA 2Z0IA 3KS5A 4I5UA 1ED3B 4LNRA 4XAKD 2YS4A 4G1EA 9PCYA 1VFHA 1KN4L 1X5MA 4JFED 2NQDA 5DJXA 4QDPA 3WJYA 4HZAA 2NUYA 5GRXG 3ASRA 1LQBC 2P47B 2D03H 2YCLA 4BWLC 3VX0A 3PZIA 5F7DB 5DYFA 5BWFA 5I30H 1J1OL 3CZKA 4LSUH 1TIUA 2PWDA 3CMGA 2OVLA 4AEIH 3UZEC 3H7VA 4IRJC 3AS1A 3WQDA 3GGWB 4XAYA 5I9QC 1BBDL 5AFDA 1XIWD 2QADB 5DK3A 1PX8A 1E1EA 2JF6A 4LVAA 4C56B 3ZLQC 5GJPA 2EKSB 3QO1A 1CF8H 3WIFB 1WH0A 3CN3A 4HS3A 1SYVA 3M0IA 2JK2A 1FRGL 5JPMA 3SKNA 1FFQA 1YC7A 2OLDA 4NO0B 3VXMB 1J5OL 4UZUA 2CITA 2QCEA 1I7UA 3TPUA 4AEEA 3AGWA 1C9DA 4A63A 3GMNB 2CUIA 2W92A 1F6PA 4YLWA 4D72A 2HVMA 4XWOD 4NKQB 3I6RA 5F1VA 1ULVA 2QHRL 3GSVA 4Q4KA 1NCNA 4X63A 3SJVB 4E2BA 4P2QB 2JK5B 1CB4A 1MAMH 3IDXH 1NOLA 4GRWB 2ZKHH 3K8LA 3FO2B 4CL7A 3B8UA 4GIOA 4HZ7A 2YKKA 3NEVA 4Q2ZB 2SEBB 4AL8H 4KJWD 2P52A 4XORA 3W9EA 3LCIA 3PWUB 1VDGA 2Q76B 4LFHG 4IFOA 2PP7A 1E5JA 3GEFA 2IXVA 1PCSA 3WFEH 3G1FA 2QGCA 2JB6B 3FQRA 4GKTA 5HBFA 1OWQA 4BQCA 3AADB 2VJIA 2DAVA 2YXMA 3SQBA 2J8HA 3CFEB 5IVNA 4GIAA 5F2MA 1YEFH 5TPWH 2H9AB 1WO2A 3HPZA 5IHRA 4WWPA 3JWOC 4DBDA 3AVWA 3HNVH 1FNLA 1KENL 5JBDA 3BZEA 2A2QT 5K5YA 2DQTL 1QUPA 3W00A 1CBJA 1MLCA 1PLGL 1ADWA 3NAAH 5LQBH 5C8JA 2OM5A 2NY1D 5ALBH 5HTSA 3ID7A 3UT0A 1G6RH 3E2RA 2WOBA 4X42A 1FE8L 1IBDA 4XP4L 5A3ID 4AGLA 3M0HA 3U0HA 4D0CA 4GG8B 4FG0A 3BV7A 1P7QD 1FQ9C 1DQDH 4YNYA 1ES0B 4BK5A 3KPNA 1XAUA 5J13C 2B4GA 2XBDA 4KDTA 1D7FA 1FWJC 4A4AA 5I2UA 3CC7B 2W9DH 3IKCA 1SQ7A 4XBEL 4HT1H 3SJPA 1RJPA 4ANWA 4X5XA 4J5NA 3MRFA 1MJJB 2PXYB 4WHYH 1CDJA 4KQ0A 4AEFA 2ORBH 1KC7A 1QGAA 2YPKA 2YL8A 3FUKA 1D9EA 3NK3A 4JFHD 3PXLA 4FQXD 5DMYA 3FU9A 5HGAA 5EIIA 1GOXA 2A3HA 2A1WL 3U2CA 5K1NA 4MS8D 2Y1VA 4J28A 2AKRA 3NEEA 2YL9A 4L5FE 4YK4B 4W1TA 3M5ZA 4MCZA 3ZQ9A 1IXQA 4K7PX 1PVHA 1RMFH 1GTEA 4MDIA 2XPYA 4CEUC 4WY0A 3NGBC 3QJFB 4UILL 3D2TA 1RBAA 3AISA 4EF3A 3H3KA 3QVAA 5FUZL 4YDLC 3ENEA 1T0MB 4OLYH 1BD0A 1RZGB 4W8LA 5CHNB 1NBZA 3GXNA 3IUHA 1I1RA 2FO1A 5K39A 4ODUA 1NDZA 2V7HA 5DQ9B 4CAGA 2L7EA 2ICEA 1EHLH 4NNAA 5TIMA 2G3JA 5E6TA 5IW1A 1TSIA 3FO1B 3PP4H 4XVJL 5DURD 1HEHC 3WS6C 2KS0A 5DD0L 3UP8A 2O5YH 2X2YA 4H7ZA 5EU6B 3JWNE 3DYOA 5B8CB 1KG0B 1MY5A 4CNIB 4OFQA 3V0SA 3TBVB 3G77A 4AC7C 4Y2NA 3OAYH 2PGEA 1TZ7A 1XR8B 3EO9L 4P5SA 1T2XA 2L7QA 4PMRA 1H8OA 4OD1L 4X9GA 2QVKA 5B8CC 4ATWA 5D7LD 4S2BA 4NQXA 3T0EC 3HO8A 4EDXB 4G43B 1W37A 5D09A 2EO9A 4E41D 3D26A 1T4KB 3L3KA 3QDJE 5GGRA 1ZBCA 1W80A 3M7FB 1EXUB 3OQRA 4W9CC 5CKGA 4KEMA 1HSAA 4JTDA 3WE6B 3PPHA 1Q9LA 4ZO8A 5CC7A 3Q6GH 3PJSA 4LMQE 4PG9B 4YDLB 4ZPTA 4NL1A 3P4MA 3ZTJG 3G71B 2V7TA 3C6CA 1A50A 4GRLB 1EUNA 2FYMA 1EAPA 2P1YA 3WMQA 3P73A 1QKZH 2JTDA 1DQML 3FMGL 2Z8RA 3EGXB 5CIPB 5IMLB 5KJRL 3GZQA 2HTLD 2FZ3B 2WWMD 2OR9H 1P6BA 3W75A 3N34A 3P8IA 3S2CA 4OLWH 1PY4A 2RR3A 4KBPA 1E28A 2YBRB 1UMLA 2Q02A 3SCQA 3V6ZA 4TMWA 3W9DA 4LVHB 5DD0H 4WW1B 4MUZA 2BVPB 1DQLL 5CUSL 3BIAX 1PAMA 3WD0A 3NPWA 1GR7A 7CGTA 1TENA 3LV3B 2D9QB 4OF8A 4CMMB 3VXUA 1QWKA 2A7PA 4H88H 2GQFA 2XN9D 4O51A 4OAWB 4FLHA 4OZHB 4XCEA 5C09B 1SJVA 4AVJA 3CCQB 1OGBA 1BYAA 4BHYA 4GRLC 1GVIA 4H0IA 2J75A 3FKSA 1G4PA 1PIFA 3HZYA 3R7QA 4P5TA 1KC5H 2NR6C 4UT7L 1B9KA 1RMFL 1MWAA 3CPXA 3DX1A 2XRAL 5EORH 3VGEA 3TF4A 3ITOA 2PLTA 1MFDL 3AQDA 5EV7A 3P11L 2AITA 4XVTH 1R5IB 2P8PA 4HEPA 1QLEL 4JHWH 1YUKB 1VADA 3DXAE 4IKKA 3DMMB 1SUXA 1UHVA 1BZEA 2Y5TB 2ZX9A 4MX7A 4LOVA 3UEZA 5IOKA 1AGFA 1FGNL 3WJLA 4U6XB 2VR3A 4B7IA 5F4OA 4MWFA 1HJWA 3VKBA 1QZ1A 4LF1A 1SEBB 3H2FA 3W25A 3ZQXA 2V5TA 4B5EA 4ODSH 5DHMC 1KCXA 1UXWB 1F6YA 4IRJD 2VDKB 3ATZA 1PCXA 3WG6A 1RZIA 3WKZA 3U83A 2VMJA 5AEAA 1U58A 5MI0B 3G1SA 2CDFB 3QQ9C 1HOEA 4Z7NF 4N2CA 3O0KA 3MRLB 5HYFA 2EVJA 1HKJA 4OQTH 1FFNB 2EYSB 1IB5A 3PYCA 5ALBL 3CZFA 1A5AA 3S6CA 4W4OA 4OJEH 3DRTA 1D2OA 3N50A 1E9YB 2FEJA 4QNEA 3UTPE 2GFTA 3IV3A 4YE0A 5T1KB 4K71C 4R7JA 1O7DE 4FQQB 3MKKA 1L0YA 4NCC1 5DRNA 5L4MA 2I5YH 3PG8A 4RAUB 2JKWA 4P2OB 1AXSA 4ADJA 5CH9A 3S5LB 1GY1A 3G9VA 4KFNA 4LUSB 35C8H 1K4CA 2OS7A 2LAGB 3QEHA 4Y7OC 1JI1A 1JYVA 3CUFA 3ZVHA 2R8SH 3PWLB 1Q94B 3LD8B 3TNNA 4L3ED 1WBZA 2RH0A 5I6LA 2IWKA 1R2RA 2HCJB 3NQGA 5AKSA 2AQTA 4HIBA 3PXJA 1ZLVK 1GVQA 3UTSD 5J6GB 4DPBX 3CC4B 1JHTB 1EP2A 2WKJA 2DQDH 2R0KH 5LNRA 5D6DA 1R47A 2F61A 2FQFA 3G6AB 4JKLA 4AL8L 3CMJA 3IS0X 4J40A 1A3RL 1LO5B 5KYXB 3D05A 1F90H 4UIMB 1PCWA 3TP4A 3S97C 4JTAA 1KB3A 2ZKHL 2XTJB 3JU2A 1MAML 3IDXL 1I9EA 3RY4A 4KTGA 4C60A 4P99A 2WZPA 1JXGA 2OCZA 3VOCA 2E27L 4GUPB 4QRTA 1TO3A 4DJDA 3KJ4B 1P4MA 4PRDA 5K9KB 2DY1A 2VWEC 2VWSA 5DRXA 1ALDA 4AKQA 4HU0A 3TT1L 2CCWA 3VWKB 1G4RA 4ZFOA 4XD4A 2D9RA 2Z6JA 4FA3A 2V2WA 3AGVA 4DK6A 2XYBA 4EN3D 3MA8A 2YCLB 4LBUA 1E1RA 4GJIA 4UR8A 4O0KA 2UUDH 3FCTA 2AVFA 3V0WH 3B9KC 4YFEA 1NSJA 1TQJA 3C2SA 4ONFH 1PX3A 4PBGA 1XYBA 2A6KA 1PF3A 3EFFB 3FYEB 5DI8B 3KBSA 3S6OA 4L6DA 1KK0A 1HJSA 2BPOA 5L9FA 3ZTNL 5I7GA 5EZOH 3SKMA 1S2TA 3NVDA 2BVOB 2OQJB 5AYQA 4LSUL 4ZXBB 3SO5A 3TO4C 5BZDB 2CLMA 3MCOA 5CLWA 1J9YA 3BL3A 5IROA 1VHOA 1SYVB 1TA3A 3CCJB 1CS6A 2UXFA 2G3IA 4YJ5A 5IBXC 3LHTA 1CGWA 1GJPA 2PYFB 1SN5A 3TPUB 3R8HA 1T20A 3KPSA 3V1PA 3C3NA 3BQJA 4ZOBA 3UJRA 2EXTA 1HJUA 3VKJA 3HNTL 3O81A 2BLFA 1POKA 1XCFA 3RVWD 4XZLX 2FUTA 1TVDA 3KYKL 4RLDA 3VI3F 1II4E 1XB3A 1GYUA 4JKMA 2NNFA 1AFVL 4MKTA 4ZJ9A 4Z7IA 1YYAA 4O4WA 1S7TA 2EDQA 2NXZD 3FCPA 2VDMB 4M43L 3GHEH 5BNXD 4Q2ZA 4XN9A 1V02A 4IPJA 4Z2GA 3VXQA 5T1JA 1DBML 4HULB 1G1YA 1E0VA 3LVBA 2FZNA 4Z76A 2AAMA 3WNJA 3CFUA 4B7LA 1RHCA 3KTXA 3SR7A 1PKLA 4TMBA 4JE0A 1L5GB 3UZ5A 2WAQA 3TV8A 1GOMA 5AC6A 1BQGA 1PHQA 1HW6A 3PWPA 2A9MH 3HBQA 4PB5A 1JZHA 1FO0B 3FJ6A 3QI9D 4RZ5A 4C1LA 3C5ZD 4OZGE 5B1KA 1HIMH 3RPIB 4UAJA 4QHLA 4Y2DA 4F3FB 4Q9CA 1I8LA 3BWZA 4M7JH 4HU3A 1W6LA 1JPGA 1MCHA 1ORSB 2FO4B 2J8UF 4DGYH 5LXGL 2BBFA 2H6PA 5FJUA 2GTZB 2X2UA 1GS7A 1HKWA 2F2HA 2JIEA 1TLMA 1PKMA 2H45A 1UFUA 2MEJB 1N67A 3OVGA 1E56A 3PTMA 3SDXB 2OYKA 2H3KA 2AANA 3UC2A 1FWIC 2DVTA 2EKGA 3FB8B 3OMNB 4LXFA 3VKDA 4JL1A 4GBXA 3F4WA 2KMWA 2QPDB 2OELA 3VKCA 2CK0L 2F18A 1Q81D 2AW2A 2QPUA 3R0NA 4ZTOH 3B40A 3T07A 2F7QA 1GY2A 4PGBB 2D7NA 1NPNA 3VYLA 4Q9BA 4TVPL 4KOCA 5T1MA 2GY7B 5FA4B 4ZZKA 5IQ7L 2VXQL 1I9CB 2EPLX 4FI8A 2Y89A 3T42A 1G4EA 3HHSA 4K1XA 3ZZQA 1FQ0A 1BAWA 4APQC 4G6JL 3QRBA 5KUMA 1ZPUA 1S7SA 4Y7CA 2W0PA 1UWXK 3NP4A 1KTDA 4FZ8L 3KL9A 3GNDA 1C91A 4CKQA 2HT2D 3F8UB 2VO8A 3I50H 1I8JA 4X6CA 2UX6A 3DO4A 4EF8A 4D3CH 3A9IA 4UDTA 3AGQA 4HHHA 5I66B 4KVCL 4MBOA 1JZIA 4HXAH 1JXFA 4AX6A 1D5IH 5K2ZA 3WQVA 2HPIA 4P46C 5DHDA 2WNQA 3QRHA 2XZPA 2ZCHH 4OUUB 3UAFA 1FFOA 4U6VH 5J56B 5I3JA 2A3CA 1I9JH 1GG1A 4YR6A 3CE1A 1XR9A 3PJLA 3KEDA 3Q8AA 3W57A 4N9EA 1Q2RA 1F8IA 5GJMA 4ODUB 4Z6AT 1RXOB 4XP1L 3W7IA 4I3GA 2XFXB 2ICEB 2O9RA 3EEGA 5IW1B 3AREC 3EWZA 3SE3A 2J7LA 5JW4R 1KCSH 3PS7A 2C26A 4YHBA 4YXLH 2ZICA 4RIRA 1Z6KA 4YCPA 5DJZB 1FFTB 3BJTA 4K55A 1FKWA 1LBMA 5KSWA 3AJ7A 3ZR6A 1I60A 3P3SA 2VD8A 3EBAA 4NZJA 4LKXB 1L3NA 3OYXA 2YCKX 5A7EA 4CD7A 1PZ0A 4RR4A 3MCNA 3HGJA 4QX4A 4CQAA 1OC5A 2I9LA 3TCLB 3ZM8A 4DNHA 5AD0B 1FAKT 3SN1A 4HNVA 1E8WA 1TZ8A 2WCPA 4GXUM 2WLNA 4NUGL 4PS8A 4S2SA 1S2UA 3KLLA 1A1MB 2PWGA 1Z5HA 5KITA 1IHMA 4XHJD 4OZOA 3RITA 1JZ5A 3EOBB 3NGFA 4QDGA 3AVYA 5JTWA 1WDDA 1EAPB 1BXVA 5EBWB 3RUGE 4TMPA 2B7PA 2A9DA 4R26L 1YO4A 5EA0H 3UAJC 3DX9A 4RLZA 4C59B 4BZYA 5LDUA 3BK0A 3E0FA 2VDGA 5F8RC 3FPXA 4OE7A 4ZUWB 1G9MC 4FHKA 1OP3H 1G7CA 1FNGA 3WO8A 2PPAA 1H7NA 1IFHH 1W0JA 2OFQA 5K1VA 1AJZA 4LWWA 1EDYA 3PAYA 2PTTB 2Z2AA 2ICWJ 3IMWA 3UJSA 3E2HB 3ZZTA 5DJCB 2QADD 2VN7A 4XNBA 1EHXA 2YFOA 1M41A 1VFBA 2YW4A 9XIMA 4WQMA 5E1AB 4LHJB 2WQDA 4GMSL 5C9ZA 4PJEB 4UCFA 3S36H 5A8OA 1XBZA 2Y0FA 1A4KA 2NY7H 1AFSA 4AVKA 1W5QA 2B0SL 2NSXA 4WEVX 3IETA 4G9DB 1P7KA 2IQAB 1A14L 1ML0A 1U92B 1U8HA 5ID0A 3SDDB 1FFPB 1NGWA 5ESAA 4FQPA 3CV2A 1KM1A 2I57A 1D9KD 3P77B 1BMFA 4P23C 3PGCA 3PQYD 1XXFC 1F3WA 1RVKA 1Y65A 5FEXA 1V02E 4OF3A 4KJQC 1KA9F 1RY7B 2G60L 3WD5L 1HHGA 1B4LA 1QFPA 4AXWA 5MENB 1ZRQA 3H21A 5HNRA 3MZGB 4H8QA 2OG9A 2Z1VA 2GQ8A 1Q0EA 3UQNA 1IL1B 4X4KA 4DP7X 4P2NA 3MRIB 2DYPA 5T3XD 2J78A 3Q94A 5D7IE 3APNA 4M8RA 1E90A 1H6UA 4K3HA 4YDVB 5DMGD 1BF8A 2PDWA 3H7UA 4FIRA 3ULUF 5AB1A 3H3PL 5F7LB 1WCQA 4D1IA 1XIWA 3VUPA 4YHOL 2VXUL 1R3IH 5IMKA 1HHIA 4NP9A 4NP4H 2DUAA 3WH5A 3U7WH 4CQDA 2ZRUA 4TTDD 1XZ0B 4ETYA 1Z3GL 1NAMH 2EDNA 3U2SA 1HJXA 3M0XA 3WEAA 4LUSA 2G5BB 3AB0C 3CQQA 3WTVA 3RKDC 3NQ2A 4JY8A 1E9OA 1YEIH 2C9UA 3FRUB 5EO1B 3SYPA 4CEXC 3U30C 1EHNA 2BXYA 2CETA 1TTRA 3KYAA 2ISWA 1G67A 3A3WA 1WBZB 1MELA 2X4UB 1IGYA 3OGVA 4HGMA 4L1GA 2Y7MA 3WUEA 2VZ1A 1V10A 1E79A 1F7BA 1CXIA 1BX2B 2FJHB 2WMPB 4X9HA 3VD7A 3SDXF 4YSCA 1AQDB 3S83A 4M24A 4MJIB 3BVVA 2XTJD 3G5YB 2Q8AH 3WYAA 5I5RA 3W7GA 4X83A 3RPKA 3B8TA 3EAKA 1ZHKB 2E1BA 2DP3A 3F7JA 4N3GA 1UKPA 4J12A 2QUUA 4P59L 4P25A 1KELL 3T2NL 4PRDB 2RBLA 3O3AB 4CBZA 1BBJA 4LT7A 3GSRA 5JIQA 5K9KA 3BUYA 5J57B 3VG9B 4L8BB 3FFCB 3QUGA 1RBOB 3GJFA 1FZKA 2BOCA 5FYKL 5JVLA 5IW6B 5DUBB 5ETUB 1UR3M 1LO0H 1TKWB 4ZUUA 4M5SA 4YWGH 5DN6A 3QUZB 2YGYA 1UD8A 3MBEB 1Z3RA 3QWRA 5E8PB 4N3UA 1NSNL 5HGGS 5L7XH 4XZWA 4HHAB 1S7QB 4CDHA 3E5PA 4Q4QA 3KJ6L 4X7EA 2HFEB 1AY1L 3ZYJA 3US1A 3GSIA 4IMGA 5B7EA 3GIPA 2JKSA 3P9MB 1BXAA 3QG6B 5IYPA 4FAMA 3O6LL 1F3DH 1UWYA 2VAAB 3W2DH 4IIBA 4N5ED 4XPAH 3DPBB 3EYSL 3KPLA 5F0PB 1KPVA 3HE7D 5DHXB 3T77B 2Z7YA 3HOJA 5HINA 2FDBP 3KHOA 5F9DC 3V55A 2PCYA 2X1TA 1UT1A 2Q7YA 3G1HA 2E5BA 3LRSA 2WMHA 2VE6A 4OCWL 5CSBA 3FRPB 3DEQA 5JIKA 4KK5D 2HFGH 3O2VL 5C09E 5HZAA 2PCPA 1EOMA 2XHYA 3HPFA 4CNTA 2A3TA 3QS2A 4LSQH 1DSFL 3ISXA 3GSNL 3G2GA 3LH9A 3NE5B 2FHCA 1MW0A 2FB4H 2N7SA 3DUSB 2VZ3A 3QDGA 2CWXA 4L8DB 1EC9A 4IJ3C 5D33A 1R5WA 3OAUH 4PRHD 1NEZG 4AJYV 5CJOL 2XX0A 2J66A 3JS3A 4QNPF 2ASHA 1L5GA 4ZGQB 2VTFA 1Q9KA 5T33H 4WNJA 3SGEI 1UASA 1SHMA 3ZBTA 5A8AA 2IPKB 1B4JL 3GSOB 4C6PA 2PPFA 4HJUA 3SDCA 4KFPA 3QXDA 4RESB 4K9EC 4KO7A 3VQLA 5KVFE 3K91A 2J1YA 3BDYH 4JY5H 1J9TA 2XN9B 4ZFGL 4TV5A 1WIPA 1PZSA 5L88H 4ZNEA 4ZI8A 3O2DA 5DZOA 4G9FE 1A0CA 3DIDA 1MQKH 3L2NA 1CFSB 4AG4L 2J7FA 1QNVA 3P0VL 2XA8L 4BQ6A 4YU1A 4NOFA 4HC1L 4A2MA 3IDJB 5AECA 3VGAC 5BUGA 2FGZA 1AC0A 1EEQA 1NMAL 2XWJB 4IHOA 3WH7A 2XVGA 2INEA 3BJ91 3OR6A 3ZE0B 5HJXA 4JXCA 1NWPA 4DCQB 1AQ8A 1YEGL 4RFEB 1R3VA 4AZ5A 3IVUA 1Y18B 2GIXA 4NUJB 1ZHLB 5EUOF 5FA4A 3WKMH 4U6YA 1XKYA 4A8IA 1G7MB 3RWGA 2BSDA 4FEIA 1JFHA 3AU6A 1C9WA 2OQLA 3MC0A 3NR0A 5FIUA 4AH7A 3OVUB 3K71B 1X5IA 2BSTB 4HSNA 5B38A 3DGGB 4XPBH 1Q45A 3F4NA 2YOAA 4HCHA 5JYLA 3MJ9L 1RUPL 2CHNA 4M61A 4E9WA 2FBRA 1YEKL 1BX0A 2CALA 2H6UA 4F24A 3VMOA 2GSEA 4R85A 4R3UA 5BPPA 5I66A 1PLAA 3APFA 4PVMA 3O6FA 1WU8A 1DLHB 3QR3A 3HFYA 3VB9A 2X6MA 3XINA 1OCZB 3USZA 2WQWA 3W0WD 3X14B 1FYHB 4PRAB 2BM1A 2HKFL 2Z27A 4AJWA 3T0XA 3NCYP 1KYOK 3AB0B 3TC7A 4WJ5A 4U7KA 1OK4A 1WRFA 3W4RA 5I1HL 4A3RA 1X5GA 2HJLA 2GJ6A 4DP5X 3VIKA 3B6SB 4YSEA 4XAWH 2AEWA 2VERA 1B5TA 3RNKB 4DUXA 1A0QL 1MCPH 1AW5A 1ONRA 1MLBB 3ARFA 3I9IA 4B3EA 1LUCB 1W5PA 2GK1B 4GUJA 2WXRA 1CBGA 2OR2A 3BPCB 1U8CB 4Q4OA 3N3MA 4C65A 4FHAA 3M0MA 3CAFA 1YNPA 4RIRB 3N2XA 3WN5B 4BQ8A 3NCMA 3E3HA 4XCFH 1NH6A 1NC2A 2Y07H 1AZ2A 3MYJA 1DBKL 2R15A 5ANMB 3WY2A 4DEWA 5CR8A 2AK1H 3ARVA 2XZAL 4FNRA 1OAQH 4HUNB 5CD5C 4R4BB 4MMXB 2RC6A 2AXFB 4YHIB 5AQ0A 1VPXA 1NCTA 4DFIA 4K5LA 4GY1A 2I9LB 4HCRA 1V3LA 2EP6A 3WTWA 5I6NA 2A0LC 3LKSA 5IOPA 3E0VA 3Q45A 1UQZA 2H2SC 1DBTA 3NCCB 1LD9B 2X42A 4C4KO 2FECL 1MFCH 3O6KL 1ICPA 1TV3A 1DQKA 1TPUA 5D93B 5B3SB 3ASPA 2W0FB 2O9TA 3DJZA 1W31A 1MHEB 1XAKA 4OLZL 4HWZA 4L0ZA 43C9A 3BT2L 4UANA 1QNIA 3OJMB 3BVXA 4HUUA 2AEPL 4LMQI 4Y4FB 4AZGA 2HDJA 2R1MA 5DMGC 5DHYA 1PLBA 4JRWA 5AYUH 3IJEB 1KEGL 4HUXB 2J62A 4KV5E 1E9PA 3FJOA 2VDQL 3LKNB 3WLWD 3L16A 3T09A 1FNGB 2MKWA 2YRLA 2OWWA 1F3RB 1UR4A 4AH2A 1ODZA 3I9GH 2CHWA 4NGHH 4JZ5A 4S3CA 2EEBA 1E5UI 4IOTA 4JR5A 5FECA 2BGNE 1QWUA 4Z3EA 4XVEA 2ZF9A 4I13B 1UIOA 3AACA 3GMLA 3DG3A 1RH8A 1VQ5B 3X1GA 4B9JA 4WSHA 2FZ9A 1Z0NA 2FJGA 1ZV9A 3U9UA 4X9BA 4XMXA 4A2DA 3EX4A 2KVOA 4FPSA 3ZTEA 3E49A 3QFJA 1A4KB 4HZ1A 4HK6A 2IKJA 3L3DB 5C7ZA 3WUFA 3EYPA 2J7GA 2FTYA 3S1XA 4L37B 4XRCB 3L3JB 2VN3A 3QUKA 4I0PC 4J3OH 4Y9RA 3VH8B 5C3IA 3IIPA 4FALA 3S88H 3QIBB 4G2AA 1ACYL 1WWBX 4XTIA 3ETBF 4NJ9H 1GOIA 2CEQA 5KANG 1JTOA 2IDTA 5IFHH 1P1VA 2K9FB 4X98A 1FX6A 2ACRA 3PB2A 3E1F1 1F8TH 3T4YA 3JV4A 5MP6H 2V2CA 1TXKA 3NA4A 7ENLA 1DO5A 3I6GA 1OFRA 1S9WB 4Z7AA 2WCSA 4LHUA 2NY4B 4YGVB 1FL5B 4JLRA 2O61B 1Q6OA 3IIOA 3SM0A 2NW3B 3I9GL 1ZLEA 1DVFB 2ZOOA 3BLKA 3DETC 1BOGB 4U1GC 3BPNB 4OD3H 1CEOA 1O1HA 4GISA 3JQQA 3GG7A 3VWJC 3RFZB 2ZDSA 4I7WA 4EQ3A 2EIZB 1J4EA 3CQJA 3QA3A 2E9GA 5E6IB 5EF3A 4D8PA 3ZDXF 1XIWB 4WZTA 4NBSA 1FG9C 2AEPH 2WHKA 3S0PA 4GRSA 4A68A 3OKMB 3QUXB 3FKRA 3V7AG 2PLKA 1J05A 1I3VA 1AHWA 3NIFB 1IV8A 1MEXH 4ZUVB 1W72H 4AL8C 4BI6A 5D7LA 4W85A 1WZ1H 4IIDA 5FYLL 3G8EA 1H0DA 4EN3B 4OQTA 3AU2A 2YQ3A 4UQCA 2YWFA 3ARED 1A8ZA 1QPQA 1HU8A 2Y1ZA 3S36X 4LQFL 3C86A 3WFCH 4ONHB 3RVUD 2PRMA 3D18A 4JHMA 3KGUA 1T41A 3L23A 2V17H 2A77L 4HUMB 2VT0A 4M9OA 5CP3A 4DKEH 4KZCA 3W70A 4MDRA 1I7ZB 4D2NA 3D6NA 1XIHA 4KESA 1ZUAX 5C5YA 4E5XA 4AUJA 4II2A 2DWDA 3G5ZB 4QOKB 4JFYB 5HI3D 1PFCA 1A4BA 4EKXA 1FDYA 2PFHA 5I23A 4N42A 3CK0L 5CEZL 4P7RA 5L0QB 4QAWA 2CG9X 4NNPL 4G6IA 3GSQB 2A5UA 1U8MB 1JD7A 1SJAA 3QRGH 1BBJB 4UV7H 1G9EA 1A0QH 1MCPL 4BGDA 2X40A 1N8WA 2F5AL 4R7NA 3QUYC 4HCIA 5FEPA 1XTMA 3A6OA 4XAWL 1MRAA 4OIBA 2FQEA 3Q2LA 4MS6A 4W6XB 4K94C 5DVOA 3W7MA 1CFTB 2MHAA 3OF6D 1B4RA 2WJDA 4L4TE 2JKAA 3DC8A 3GUWA 3HN3A 3RNQA 2VEIA 3TBYA 3ABSA 3T1GA 1UZ6E 4DOHB 2NOYA 5EWIL 2ON3A 4HHAA 1U8KB 4ZX6A 4R2GB 2VLLA 1BXBA 1WIOA 2DWSA 2PYEE 3HS9A 5E4AA 3ASWA 4IKLA 1X1NA 1S7XA 4LP8A 4XXCC 3QAZB 5I3GA 4OKVB 4U2YA 3QUZD 5E0QA 1B3XA 5A2FA 1FC2D 2R56H 4HMNA 4Z7QF 3VD4A 2P24A 1NAMB 5SWSD 5LBSH 1XDTT 2QR6A 1ADQL 4K68A 4LAKA 1HKMA 5HQLA 1V5JA 5HSFA 1QMLA 4NQ1A 4W9TA 3I85A 1XL6A 4X60A 4U1IA 5FUCC 4WDXA 5BXRA 1O5PA 1TSHA 4LPVA 4MAYA 1OQFA 3QEZA 3TFXA 3L7FB 4MYTA 1NCGA 1X5YA 2X6UA 2Y6TE 4PTTA 1VQ4B 1KM0A 3GFYA 4GC4A 5I5JA 1TJGL 2DQUH 2VBTA 4LESA 2BCKB 1BQHB 5TQLA 4CU6A 3V4PL 3MDJA 2PTDA 4XAGA 2BMKB 3AU1B 4C83A 3EH4B 2EGZA 3CUIA 2OB3A 2F7IA 5G4NA 4AD2A 5C0EA 3OW1A 4V28A 2X6VA 4JTRA 3MRHA 4XKMA 2QVIA 5KBMA 4K3JH 5T1LB 4OLVH 4LLVB 1MIMH 3NIDE 3GF8A 3MV9E 5D4IA 3UG3A 3CU2A 3QPYA 4HHPA 4N2AA 4IRSA 4HK5A 4L4VA 3EO1A 4ZAKA 3LMYA 3EHBC 3IFLH 5J04A 1G9ML 5KVDL 3J7HA 1BVKB 3HC4L 1OX6A 3EF7A 2WXGA 4HX1B 1Y6NR 4YHGA 4HU4A 1LCOA 4ZUSA 1BEYL 1KIPB 3CFKB 1Q2SA 2R0ZL 2PDQA 1B4JH 1QATA 4E0RA 4ZDHA 5M17A 4RAVA 4IL0A 4EI5B 3VTAA 4DAFA 4CJ1A 1I2RA 1AACA 1PZDA 4J1UA 5EPMB 3A21A 3WUWA 4W4QA 2AV7A 3THAA 2CK2A 5C8JB 1RKRA 2HH0H 3IDJA 4JDZB 3LKRA 3BQUA 5ESQA 1JGIA 3LZ3A 4AK1A 4KUCF 1VKXB 1F4WH 5H35B 3WF3A 1J9QA 2ADGA 3MRJB 4ODHH 4LVGA 3ARGB 3JZEA 2HFGL 3BQVA 3D0LB 3O2VH 4HJ1A 4OOZA 1AD9A 4OJCA 5ERWB 2BJML 1X6LA 2NYZA 1OGSA 1UWUA 4XMTA 3G6MA 5XINA 4X5XB 3R4DA 2B20A 1AZVA 1FGVH 3EBHA 3HRZA 4R7VA 2PPEA 4LVOB 4XN5A 3VFWA 1VLIA 5E09A 3U2EA 2MWCA 1M42A 3EYSH 5F9JB 5D2LA 1IFGA 2ZCKH 1XCWA 5DZPA 2FYYA 5MERB 3VRIB 1TTIA 1WCGA 4X99A 5HNTA 1TZIB 1AMXA 3HZMB 5AOJA 4S1RH 5BS0E 1JWSB 4W70A 5DZAA 4N2MA 2GLKA 1E0OB 3U4EA 4Z5RA 3UROR 2GYIA 3RAJH 5FEWA 1EDTA 4G1BA 5BUPA 2NCMA 1NRKA 2YAPA 3KBFA 1DHPA 4IP4A 4S1SL 4NBXB 4JN6A 1I7RA 2HAZA 5DVMA 4WKAA 4YSQA 3O06A 4Z1YA 5DURB 1FCQA 3MUUA 3W1ZA 1K9EA 4JZJB 3EOTH 4CN1A 3U30B 5J11B 1L7IL 2K70A 3SE6A 2LV4A 2G3NA 5DY2A 3WQEA 4YELA 4K71B 2A9NH 1T5WB 2WZ0A 2WXFA 3OAWA 1VGEH 2PDFA 5LKYA 3IGUA 5A2CA 5AHFA 1E4WL 5DLMH 4CNIA 2FTWA 2H2PC 3DZ1A 1CGTA 1KIQA 1NIUA 2FD6H 3QNFA 3TAOA 2E7CA 3L5WB 4LPTA 2D3LA 4EI6B 5F89B 3GYCA 1EDGA 3P62A 3WLNA 5JBEA 2JJ2A 4ZMLA 2ENJA 4PR4A 2APVA 1AXTL 4ZFQA 2VHLA 1XSIA 4GSXA 4M8QA 4X5WA 5FM5O 4TMXA 4AQAB 1JTTA 5BRZB 1QRNE 4G43A 3LNDA 3QYNA 1P4IL 1BF6A 4EF9A 1HNYA 3N4AA 4FXJA 4WDIA 5GGRB 2X09A 4LCSA 2EABA 2ISSA 3G0UA 4XZIA 2WSQA 4CNPA 4GP4B 4MNHA 3DRQB 5TGBA 4QSHA 4JO4H 5EC1B 4RD2A 4W7VA 1KPUB 4RGNE 3W2IA 3IGKA 4GG6A 4X7SL 3UTQA 1QLEB 5IFAH 2GBVA 3BLBA 4KRMB 1PKNA 3NJMA 4E0CA 1UVQB 2O4EA 2VXUH 4XLFA 2CBVA 4DQKA 4RQQA 4IH3A 5FSDC 3KPMA 4FRWA 1N5AB 1AO7A 2LFGA 5ECUA 1M7DB 2XZOA 1JPSL 1UOKA 1C5DB 3NYKA 4HUXA 5FF6B 4F57H 3CLMA 5EGRA 2ZUWA 4EK7A 1UWEH 1FPTL 1W3TA 3B78A 3WIHL 4TNWF 2WJZA 1U36A 5AB9A 3IGSA 1F74A 4JTIA 2PUZA 4F7PB 4WUIA 1JPHA 1P5VA 2LU5A 5AL0A 3NGJA 2XNAA 1KGCE 1PJ7A 3N1MC 3E6HA 1R7AA 2J44A 3B56A 1UUOA 5HHXH 1THCA 5BROA 2OK0H 2J7DA 3VD5A 2V7NA 3S4SB 3VUAA 3GDTA 3QGAC 2EDOA 1KEMH 3K5XA 2ZJSL 3EJPA 2AP2A 3MRNA 3MACH 4OW6A 4ZFFB 1KLZA 2WHVA 5GRJH 4IOFC 3OPUA 4FFVC 4I9XA 6PAZA 3GUTB 2DQCH 3L3DA 2VBVA 4XNZB 2CLOA 2GJLA 1NGPH 3AIVA 3W7OA 4D6HA 3FT4A 4FEZA 2CLVA 2WBGA 4JVUA 1KGUA 4WTXA 4QJ4B 2PDHA 3LXUX 1GVEA 4MTMA 1MEWA 2BHZA 4OUOA 3ROOB 2R2HA 2C78A 4X7DA 2PNDA 5IIEA 2AJ3A 1A7QL 1AP2A 3GXFA 3BJFA 3I84A 3ARSA 3RBSA 3HM7A 4MWFB 4IZGA 4PB9L 4AITA 4GMSH 4AIXA 1XQLA 4XO7A 1KXVC 2DBJA 1MFAH 1HJCA 1K6AA 2BWQA 2P5WA 5ABAA 1XCTB 4EAEA 3MBXL 2PPGA 3FB6A 2YAHA 1DJWA 4Y2OB 3LZQA 3D85D 7REQA 1ED3A 1SEQH 1LWRA 2HTLC 2W61A 4M51A 4OU1A 2PPCA 4U33A 3BESR 3PG2A 3TUUA 1IE5A 4G8GA 3GMOB 4R26H 1V0EA 1TZAA 3MLWL 2XFWA 5AAPA 4AIEA 3OGSA 4GAGH 1MCQA 2B4CH 3QUXA 5E0CA 2APWA 1E4NA 3HE6A 4N9DA 3SD5A 3WIIH 1KV5A 4PYSA 1E8XA 3HHRB 1REIA 4RPPA 5CPNA 1A5FL 3FOMA 1J9ZA 2IAMB 2CBIA 2WCGA 3SCRA 4HPHA 3GS7A 2O6CA 4LAOA 3WLLA 2QV4A 1JYNA 1N70A 4O1CA 2LU7A 4OGAC 5FOOA 4ZCMA 2HB0A 3CVBA 4J3UA 3ARRA 3WY1A 5FAJA 1AGBB 1O6SB 5C0ND 4KEUA 5ICUA 4PG2C 1AQHA 3JWDC 5J6GA 3QJVB 3RDJA 4JDTH 3SYAA 1CDCA 3GU2A 5G4HC 1XGTB 1IARB 5FWQA 2ZBUA 2A1YA 2P49B 3KPOB 2WC7A 4FTVE 4IS6A 5KWYC 3DHPA 4IG2A 4D9PA 1WDTA 4XL9A 3HPLA 2JK5A 4KGJA 4JN7A 1MRCL 2QVMA 5FO2A 5CGBA 4IBYA 3RPTA 3STBA 3TGXA 4QRTB 1QPNA 4LSVH 5IRPA 3K8MA 2WLLA 4XMYA 5C2BH 4DF9A 1MF2H 2OEKA 1F20A 2DZXA 3LN4B 4XTRC 5F7HA 1QTWA 1UJPA 2DY3A 2ZTKA 1PUDA 1U95A 2MOVA 3NCBB 5DVKA 1D7KA 4LO9A 1XIMA 3LY6A 4P2AA 1P5UB 3MSPA 3NFPA 3LQGA 3ZT6A 4PI0A 2EEAA 3FQYA 5FGBA 3M8OL 2C1PB 4JQ2A 3HGRA 5HDBE 1MCOH 4ERSH 1AD0A 2HTKD 3CFEA 3EFFA 3GVWA 3BG5A 4L64A 1IE4A 4N85A 3IJYB 4WEBH 1OGAB 3E6FB 4K2UH 3FB7B 3OQ3B 3QQNA 1RCOB 2EXYD 3DX8B 4DN3L 2HISA 2LFEA 2B7CA 1W72B 2BS9A 2RALA 4PEEA 5DA0B 3CHEA 1NDVA 4Z4YA 4KJWC 4F5CE 1BZ7A 1CT8B 4H7CA 3I50L 4O5LL 3TEVA 3NPSC 3MO1B 5FGRA 2AMUA 4QTHB 1M5WA 5AC4A 2YAMA 5E5MB 3WK2A 1UJTA 3KPQA 2QSCH 4Y1AA 5DJ6A 5HATA 2EXSA 4UTWC 1OX5A 1SSDA 2QDGA 4P6VF 1BQHA 2KBGA 2WPGA 4YHML 2AJZB 4YE4H 4TXEA 3F1QA 1T6VN 1NDMA 3QDMB 1XDJA 4FABH 1OE3A 2B1HH 1AD1A 2WP3O 2F74A 3EOEA 4IIEA 1JNHB 2FHBA 3A8KA 5U7SA 1V5VA 3BAXA 2A74C 2Y3AA 4E3TA 1QFYA 5LVEA 4PV9B 3MJ7B 4L4VB 2YK1H 3CCRB 3L17A 1RH9A 4PMQA 2OEJA 3UJEA 3SPVA 4HJ0D 3VSUA 2E5CA 2LVCA 3CFIC 2TRHA 4M1CC 1SN0A 4M7JL 5F0LB 3P2VA 2OPJA 3NL5A 1YTDA 4TVDA 3U0PB 5CPLA 2A9ML 4GO8A 2HBVA 2GK6A 3HFTA 4W9KC 3N1QC 3E2SA 1A3ZA 3QKZA 3TJLA 2AJUL 5BOEA 1WBXA 2ALRA 1AK5A 1IWAA 1N10A 4I9WD 3UP6A 3N9KA 4QM1A 1ZP3A 1S5HA 1TPDA 4RD6A 1XD1A 3ZWSA 4U0RB 5EFDA 3LKRB 3X3GH 2RQ8A 5BCAA 5FHBH 2Z24A 4FZEL 3V76A 4KROC 3FYYA 4C6EA 1YEEL 1FNEB 1DANT 4GQQA 1LM8V 4P04A 2JCCB 4S1DD 3GSNB 4G83A 3G6LA 3TXVA 1KG0A 5GGSB 4A3UA 3ALFA 3ULUC 5IMOA 4J3ZA 1NLDL 2C4TA 3F83A 3TBVA 3HHSB 4AZUA 2MSPA 3DHMA 2DTSA 2Q3ZA 1FL3A 2JCCE 1MCDA 1KTVA 5FD0A 3HB3B 1KTDB 3TC3A 1W0KA 4LP5A 4RISH 5EBMB 4DZBA 3MBWA 4TO8A 1TCDA 1UQYA 3VI4A 4I77H 3IMSA 1OPGH 3SDAA 1QO2A 2JIWA 4U0RC 3MV11 1EXUA 3ESOA 1IGMH 1G7JA 3SOBL 1YY8B 3I9PA 3QS3A 1Q9LB 4BUQA 2VITB 3PJSB 5CEZE 2DLFH 4H5SA 5HYEA 1W8OA 2J5LB 1E64A 1ROCA 5I76A 4OUUA 1L6YA 1DFBH 3AQYA 3V0WL 2J6VA 5DY3A 3GC2A 3BP7B 2GQ3A 2MQ3A 2J55A 5C0CB 3LLFA 1T4WA 3ZZUA 5HYSA 3MRDA 1CGUA 2HT3D 4UT9H 3GT6A 5THXA 3V6ZB 4X6BB 4ADIA 1K7XA 1Q8JA 4WW1A 3MRBB 4IX2A 3SCVA 4GKLA 4Z1AA 3YPIA 2R69L 1SLXA 3O11B 2EC8A 3CBKB 5F9AC 5HHVH 2A79A 1BVOA 3G1XA 1JXDA 4WO4B 4ZMTA 3GE7A 3PWVA 4X4ME 1F90L 4XX1G 4LFYA 4GHRA 1A3RH 4LCCC 5EN3A 1W0YT 1KNOB 4EI6A 4FQJL 1FSKB 4FXGC 4OZIB 3C5ZB 1TQVA 2J8TA 2V2XA 4L2YA 1H3PH 1CL7I 4N2EA 5JHLL 2PI6A 4TMTA 2IG2L 2QQ6A 1S8DB 1E5AA 2D9CA 2KZ1B 2BV9A 1UB6A 3Q58A 2KZWA 4HG4K 3LXCA 3FYOA 3AVEA 3J27A 1FX0A 5AKTA 1K8ZA 5IQ9B 4LPUA 4IJRA 4Q0XL 5BVJB 5TGBB 2VC9A 3WTYA 3T9PA 2VDPL 2V2HA 2AXGA 4JPQA 5FA3B 3QI9B 3RZCA 2CLZA 3AMDA 3ERPA 3UMNA 1PYFA 4GYKA 5BV7L 5A8PA 3BD5A 3GHSA 4K94L 2MQCA 4KNUA 2Y5JA 1SEBA 3K2GA 1GIGL 5HDBB 2XKNA 5CS7A 3P0XA 2HG5A 3QFWA 4FLQA 1A9EA 4X6DA 5E6UB 5ISZE 4YYFA 3PCYA 2ZOKB 3W1LA 5KW9A 4IMLA 3TA4D 1IYXA 3I6SA 1J01A 2Y8KA 5DK0B 4GJTB 2E6PA 4XNXH 3ARDA 1YNLH 4R0LC 2WXQA 5E6IC 3LCGA 2BOEX 2BOBA 5E03A 4XAZA 3W6LA 2DWEA 3RWDB 4M0XA 4F0RA 5HP5A 1WNOA 4ZXBD 3BPNC 1KK3A 5L2JB 4NHUA 1IHIA 4FQQA 2CIKA 2DWTA 3BEVB 4BCYA 1S3KH 2C1HA 3RX9A 4HZLB 4A2HA 1E2VA 1FGNH 2V63A 2VX7A 3BH9A 3MO4A 1XL9A 1IGIL 2HK1A 5MF5A 4QJ3B 5KN5B 3CCSB 1IAIM 3WBJA 2EC9T 2QVTA 4JFZL 3C2FA 4XO8A 1PB0A 4G9DA 2DYPD 4KPHL 4X6DE 5ISZA 1EGJA 2QIWA 1MFDH 2WBJA 4PJHB 4EXKA 4R27A 2X41A 4Z7UB 1W6TA 3EH3B 3SPGA 1H6EA 1P2CA 2Q3XA 2V5CA 3SSJA 4CQ8A 5IVXF 1EP2B 1OCCB 4ORGA 5CNHA 4GLRH 5TE4H 2CWRA 1JDFA 4KWWA 4X07A 1ZT1A 5ABHA 1SYTA 4G70B 3V5HA 5CGYD 5FO8A 3CK5A 1WOAA 3KBWA 4YZFE 4MNMA 3TIDA 2P5WB 4WGVB 1M7OA 1FDRA 1XCTA 4UIKL 5EEXA 3T2QA 1G9NL 4G6ML 3AQZA 3TFKC 1G1KA 3UBHA 1ZNNA 1U8OB 3F58L 3FYPA 3O2DH 4Z7NB 3MOBH 3VCRA 3QXWA 5H94B 2QULA 5D03A 2Z4GA 1IFRA 3VWKA 2BG5A 3EJTA 2XTSA 2GJZA 4L23A 4WI0B 4N2FA 5GISH 2V2WB 3TFCA 1A6ZA 4LLWA 3VKKA 4N0FA 3UO1H 1AI1L 3CCHA 3LIUA 4JPWH 4X9SA 5IMMA 5D30A 3AO0A 3Q1SH 4JANB 2J88A 5L2KA 2R0LH 4PN2A 5IVXB 1CR9H 4AG0A 4OJFH 4LU0A 5FJIA 3PHOB 2WV3A 2I16A 1WWCA 3KVQA 1EDQA 3WHE0 2A83B 3RPMA 4W5ZA 1WDWA 4C8XA 2VNJA 2X4UA 4LBVA 1H63A 4J4PA 1LMIA 3CLFH 1QSFB 1R86A 3VFLA 3OBAA 2WINB 4NQCD 4A2LA 2WGNB 1J2WA 4HGKC 1A6WL 1Q1JL 1H3TA 1TZOA 3JV5A 2ERJB 2UYLB 2ED6A 3S35X 1R1CA 5I6MA 1EZVX 1A80A 1R24A 4GKZA 2OZ4A 1WHPA 2I56A 1EHKB 2VUOA 4ESKA 3I6TA 1T7ZA 4IJCA 2DERA 2FH8A 1GO2A 5KSAC 5AZ1A 4I18A 3RU8L 3VXQB 4S23A 2BSED 3AWGA 1MZHA 1OW0A 3FFCA 4K3ZA 1XRFA 3WF2A 2EDTA 3HE7C 2A85A 1U3HB 3W7LA 3C12A 3NFNA 5JHDD 4OLYL 3SE3C 5FK9B 2VLMD 1KFAL 2JB5H 1RUAL 5FUZH 3NABL 3RFAA 3LQAL 3LHAA 1XC6A 5KYUB 2PZ0A 3RZCD 5BOOA 1YDPA 3MLZH 3OWEA 2MNUA 4JZNA 3RL2A 5HXBA 4N22A 4HE5A 3BP4B 1JWUA 2WLIA 4JPKH 4XCYB 5IESL 1S2CA 1NPJA 3NCWA 1T40A 3N25A 5I77A 2A1WH 1O7DC 1BG4A 2HWZL 3CVHA 1GGOA 2Y7NA 1OCQA 5DS1A 1LRTA 1E40A 1PY9A 2AABH 4M1GH 1N6QH 1QNZL 1OSEA 3MRQB 3HKZA 2D2GA 1P0EA 3ABKB 1URLA 3LNNA 3T08A 4HNOA 1EAJA 3SIKA 2CQVA 2I7GA 1N7KA 4N0RA 3WHXB 2PTVA 1FAIL 3KR3H 2X30A 5GNYA 2N56A 4HUCA 1MXSA 3FA3A 4M6OH 3FRPA 1LF1A 5DQDH 4HJFA 3UL4A 4BEQA 4ZRGA 1TCMA 2B59A 4PBVC 3N14A 1FRBA 3APMA 4EBQH 6FABL 1LL7A 3BICA 2CW6A 2J4WH 4DAGL 5LCVA 3AWOA 2J1WA 3KRSA 4YLBA 3GMQB 3RPBA 1WUFA 1BDYA 3MROB 3SZKC 1CICD 1IU1A 3GC3A 4NKCA 4I5RA 3UPMA 1G6RL 1N8ZA 5T1DH 2DOCA 1ME7A 2P0OA 3DBNA 4X80H 3LTPA 3G5VB 2NDGA 5KSVA 3E0IA 2DQTH 4JUTA 1MH5B 2IDSA 3BQUC 1DE5A 1Q6CA 2IALA 2Y63A 1L6FA