3BCFA

Alpha-amylase b from halothermothrix orenii
Total Genus 198
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
198
sequence length
585
structure length
585
Chain Sequence
b'SLFLIESEPSTGASVSKNLTEIILIFSNDINKVSQLALTDLITDSDIQGIDYNIEGNKVIINNFSLEPTCNYRLSYEVIDIYDNHLQGYIEFLVNQSNYPQIPDQEVNHTILQAFYWEMNTGEYATEHPEEANLWNLLAERAPELAEAGFTAVWLPPANKGMAGIHDVGYGTYDLWDLGEFDQKGTVRTKYGTKGELENAIDALHNNDIKVYFDAVLNHRMGADYAETVLLDENSRDKPGQYIKAWTGFNFPGRNGEYSNFTWNGQCFDGTDWDDYSKESGKYLFDEKSWDWTYNWDEDYLMGADVDYENEAVQNDVIDWGQWIINNIDFDGFRLDAVKHIDYRFIDKWMSAVQNSSNRDVFFVGEAWVEDVDDLKGFLDTVGNPDLRVFDFPLRSFFVDMLNGAYMADLRNAGLVNSPGYENRAVTFVDNHDTDRDEGSYTVSIYSRKYQAYAYILTRAEGVPTVYWKDYYIWEMKEGLDKLLTARRYYAYGPGYEVDNNDADIYSYVRSGFPDVAGDGLVLMISDGTSGNVAGKWINSRQPDTEFYDLTGHIKEHVTTDSEGYGNFKVIKSEDKGWSIWVPVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Alpha amylase, catalytic region
publication title Crystal Structure of the Polyextremophilic alpha-Amylase AmyB from Halothermothrix orenii: Details of a Productive Enzyme-Substrate Complex and an N Domain with a Role in Binding Raw Starch
pubmed doi rcsb
source organism Halothermothrix orenii
molecule tags Hydrolase
total genus 198
structure length 585
sequence length 585
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2007-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF09154 DUF1939 Domain of unknown function (DUF1939)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.140 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 3bcfA03
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3bcfA04
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3bcfA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3bcfA02
5AY7A 4X0NA 4RL3A 3GH7A 3VSUA 1UKSA 5LA1A 2G8ZA 4AYGA 1CBGA 2F61A 2VCAA 4PUDA 4QLLA 3ZO9A 3W24A 2E9LA 2ZX9A 2ZUUA 3PZIA 4AZ6A 3E1F1 1IX2A 4HZ6A 4GO8A 5A95A 6TAAA 3ZQ9A 5E09A 4L4OA 1UH4A 4CKQA 4P7QA 4MDOA 3WUGA 3QHOA 4GZJA 2BVDA 2ZX7A 1R87A 4PCTA 5I6SA 3HN3A 2DSKA 4TXEA 5BXSA 3WY2A 3FXYA 3AOFA 1KWKA 3PTKA 3EYPA 1J01A 2PC8A 2OSWA 4ZE5A 4UNIA 5BXTA 1JFHA 2EQDA 1GPFA 1WZLA 1O6TA 1BFNA 1RH9A 3WDJA 1WDSA 1GOIA 1BF2A 1HJUA 3D52A 5BYWA 3U5UA 2W61A 4KWUA 2J8FA 4N0RA 3GBDA 1PPIA 3VGDA 1EDGA 4P8WA 4PSPA 2Y4SA 3A4AA 3VM5A 3W37A 3L2LA 5AC4A 2A3CA 1EIBA 3SCWA 1CTNA 3A47A 1BGAA 3U7BA 3PZOA 4AIOA 6CGTA 2PWFA 1JDDA 4PMQA 4HU8A 1M04A 2GJXA 4CC4A 2J7HA 1VJSA 2W5FA 5I5RA 2XVPA 2GDVA 3UR8A 3ZJKA 4LPCA 5BXRA 1JZ4A 3VD9A 2EPOA 2Q8XA 4N42A 1PS3A 3B9DA 4Q22A 1RPKA 1J9YA 1J11A 3L4WA 1JNEA 3OZPA 3AMCA 1CXEA 4JCLA 3U7VA 2XTKA 3WD1A 2ZUTA 2VRJA 4XB3A 1HVXA 4B3KA 1M7XA 4AMWA 2EJ1A 4TX8A 1GOQA 5D9PA 2OMXA 5IHSA 3PN8A 2D23A 2D1ZA 4AIUA 1FH8A 2WMKA 7CGTA 3TTQA 2UWFA 1QI0A 3CZEA 1BLIA 4GZEA 1GW1A 1HKMA 4PMXA 1P6WA 4D6FA 3AMKA 4PRWA 1E0WA 1R86A 3RILA 1BYAA 2C9QA 1W2VA 1HN1A 4PYSA 3NSNA 4TX6A 1V3KA 4LGXA 4FNPA 1WB0A 4NF7A 3ARWA 3MV01 2VVSA 3GXNA 3DX4A 2G41A 3L2MA 2FDMA 2WZHA 1BVZA 2WMIB 1LL7A 5JBEA 4KMQA 3BSHA 2X2YA 4CD6A 1MYRA 1VEOA 1PX8A 3SIMA 1TMQA 1UWRA 1TCMA 1QBBA 3VGFA 3FY1A 4CN6A 4HOWA 3CLWA 2VOTA 3CTTA 4LYRA 2XN2A 3AS0A 4PTXA 4S3KA 4FMVA 4CD8A 5DF0A 4UFKA 3TP4A 1BGGA 1SMDA 4P8UA 1C3FA 3BAWA 1FP8A 1GHRA 3K4AA 1OT1A 2WMFA 3WMBA 4WF7A 5GNXA 2UY5A 3L4UA 1HJXA 3SCPA 4JCMA 3OGSA 4V28A 4U31A 4JAWA 1HL9A 4ATDA 3ARVA 2GK1B 2C7FA 1UQYA 3OLGA 1V3IA 1ECEA 4CC4C 1CXHA 3AIUA 5I23A 2F7RA 1HKKA 3CIVA 5CG0A 1JGIA 4JIEA 1NOWA 3MUY1 1KXTA 4XV0A 2ZXDA 1ODZA 4J27A 1O6SA 3GXDA 1IT0A 3A22A 3EBVA 2DEPA 1OB0A 5E70A 1JAEA 2JIEA 4WIWA 1UH2A 1WCGA 2NT0A 3N17A 1ZBKA 1EH9A 4U3AA 4JHZA 3NJ3A 1AMYA 3VSTA 4A3YA 4QAWA 3VGBA 3MMDA 3IJ7A 1V03A 1VFUA 2XGBA 2YJQA 4AMCA 1WPCA 3IJ9A 1JFXA 2WHKA 1J0JA 1G5AA 3N04A 3OA5A 2JE8A 4ML4A 1B0IA 1JYWA 2YDQA 3BUBA 1CGYA 4UZUA 4AYSA 5C8BB 5FOOA 2J7EA 3POHA 1BYDA 3AIBA 1K9FA 1LLOA 2OMVA 4JFSA 4CU6A 4J3TA 1Q6CA 4AD4A 5JIWA 3RJXA 1QNPA 3VDHA 1CPUA 2WKLA 4M8UA 2WQWA 1E1EA 2EPLX 2J77A 1E6XM 1NM9A 2FHBA 1NOUA 2BY0A 2XVLA 1OT2A 1E6NA 4WKHA 1V6WA 2D73A 4PEEA 1XH0A 1V02E 5A8OA 1HXJA 5A6LA 2CPUA 1OSEA 2GUYA 2J47A 3RM4A 3VMOA 2WMIA 3SCUA 1VFOA 4XUYA 1D3CA 3AISA 1O7DC 3U57A 2O9OA 2DIEA 4PTMA 5AYBA 1QHPA 1QNSA 1PIGA 3LX9A 2DSUA 4V27A 4GI9A 3WDHA 5ABFB 3ZJ7A 4ZXLA 1W9DM 2EO7A 3WY4A 2F18A 1AQHA 4UQBA 4J3WA 1NP0A 1VEMA 1CGVA 2V3FA 3ARZA 2VT0A 1B3VA 4UQEA 2D3LA 2GSJA 3WF1A 5DMYA 3M6DA 3ALFA 4FLOA 1B31A 1UKOA 2F7QA 5EFFA 3HG4A 2J4GA 1R8LA 4WKFA 3SCOA 2VR5A 4W85A 1B3WA 2WB5A 3I3DA 4RE4A 2DSVA 1N82A 2FE0A 1CXKA 5A6AA 3DYOA 2EPMX 2TAAA 4AEFA 2WPGA 1AQ0A 2G3NA 3UCQA 3CUJA 1D7FA 3AICA 3EDFA 2VX6A 3AIWA 3EMZA 4QDMA 3A4WA 2X05A 2EPKX 3AROA 4EK7A 4BCEA 1MQPA 2VRQA 1UYQA 2B31A 3T08A 1W9PA 4XX6A 1E6PA 3IANA 1J0KA 2E40A 2JIWA 2E0PA 3D4ZA 2D0FA 2VZUA 1VAHA 3VD7A 1W9VA 1NWRA 5JBFA 1UR0A 4AZBA 3KWXA 1M9SA 1J0IA 3RO8A 4CCCA 4W7VA 1W1PA 5KZ6A 4J3VA 1UASA 1OIFA 1KXQA 2VZVA 4X0VA 2D24A 1XYFA 1X6NA 3AZRA 5A1AA 3BVXA 3QOMA 4FNSA 5EFDA 5DEZA 5M5DA 5EMYA 3GXIA 4AZCA 3NDYA 3NYDA 2WCSA 4NXKA 3TTSA 5CPSA 2J7FA 4UTFA 3BLPX 4D72A 1JD9A 2WBGA 1W3KA 3WELA 2IGTA 1L8NA 1V3JA 2C9RA 4AD2A 3WMCA 5FL1A 1AQMA 1MXGA 3ARRA 1C91A 2OMTA 2YIHA 5A6SA 1CNVA 1DHKA 4A4AA 4PBGA 3HMCA 1HF6A 1E3XA 4KGLA 4ZEPA 1KQZA 4Z2JA 4M1RA 4OZOA 3GM8A 2NT1A 1E0XA 3A4XA 4DO4A 1JDAA 1UWQA 3VPLA 2YL6A 4B15A 3FN9A 1V0KA 3SUWA 3IAPA 3VSVA 4BQ4A 2YL8A 3B9AA 4DUWA 2ZX8A 1WE5A 1UWTA 3MUZ1 3POCA 1OCQA 3PZTA 1QW8A 3ZT7A 4H04A 4UR9A 2X2HA 4BA0A 1DEDA 5TD4A 1HWWA 2XFRA 3VDCA 4LYPA 1KB3A 1MW3A 3KLLA 4BQ2A 2ZUNA 2CEQA 3VIFA 2Y5EA 4IISA 1Q6FA 4B9ZA 3EJPA 1OM0A 3CZNA 1X1NA 2QV4A 3NDZA 2AAAA 1ISYA 1EHNA 3T2OA 4CU7A 1TQTA 4D6HA 1BYCA 4E2OA 1WDQA 1E3ZA 2Y2WA 2VL4A 1ISXA 4F79A 2D0HA 4Q7NA 4AD1A 2OWCA 3NUKA 4U5KA 2DT1A 3BXWA 1ZS2A 2PI6A 5A2CA 4OKDA 1NWSA 1CXIA 2GJXB 2VI0A 4CGTA 2IXUA 2VURA 2E9MA 2EACA 2PBOA 2AMGA 4S3JA 4J3XA 2F1AA 1FP9A 1E55A 1MQRA 1JZ8A 3CUGA 1J10A 2DDXA 5I79A 3IJ8A 1V0MA 3OBAA 1GZJA 2XWEA 3AMLA 2EADA 2O9RA 3WEMA 1J18A 1GOKA 5A3HA 5FD0A 1Z32X 3ZJ8A 2FHFA 3UG5A 3AZTA 3L4XA 1UWIA 4ZFMA 1DWIM 1MQQA 1C92A 2W92A 4MNJA 4GZIA 1UKPA 5JUVA 4AISA 4QFUA 1KXHA 2YA0A 1I1XA 2J74A 2OWXA 3VD4A 3MKKA 1TVNA 5ABEA 3PZUA 3AMGA 3PZNA 3AXIA 3WD3A 4MJ2A 2E8YA 1OT4A 3CBWA 1V6UA 1X6LA 2CESA 2VO5A 1E1FA 4P7OA 4LXFA 3VNZA 4MB5A 3BVVA 1BSIA 3EDKA 2WZIA 1EGZA 2OW6A 1JZ7A 3BUIA 1UWUA 4IM4A 4UFLA 3ZSTA 4TVDA 5JIPA 3H53A 4AZ5A 3D5HA 2D22A 3F5KA 4GQRA 4HA3A 1J12A 3CC1A 2X1IA 4H8HA 1HNYA 1HT6A 1H1NA 1HXKA 2VQTA 3VX0A 2WCAA 3F5LA 8CGTA 1JDCA 3A21A 1W9BM 1JZ2A 1KWGA 1M01A 1E4LA 1OD8A 4MPKA 3MO4A 3WENA 4JL1A 2XSAA 4GIAA 1Q6DA 2CCRA 3AHTA 5CZKA 1E5NA 1GQJA 4XZWA 5IDIA 4NZCA 1GQLA 3O6AA 1DWJM 2WM0A 5GPRA 1JI2A 3W26A 3ARPA 4AIEA 3QHNA 4QLKA 3A24A 2J7CA 3WNPA 3EDJA 2W4XA 2DT2A 2XIIA 3N1AA 5A2AA 1GNXA 4UFJA 2ZUWA 3S2CA 1PIFA 3UEQA 3VMNA 3S5ZA 3AQUA 1WKYA 4EE9A 1IV8A 1U2YA 3WD2A 1QNQA 2YFNA 1EO5A 4P8XA 2IXVA 1EOMA 2CETA 1WZMA 3I3BA 3IGUA 4FLRA 1OIMA 1UH3A 2BXZA 3ZT6A 4FLQA 3QR3A 5FIPA 3WQ8A 1LL6A 5I78A 1ZBVA 3WQ5A 1GVIA 1DWGM 1UG6A 1H5VA 2A3HA 1KCKA 5HOSA 2NW0A 2OYMA 1OD0A 5FCZA 1J0YA 3WNMA 1UOKA 1Q6EA 2J7DA 2O9TA 4MDPA 1BPLB 4AEEA 4D71A 3D3AA 1ITCA 2E9BA 4NRSA 1XRVA 2ZOXA 3W27A 3UG4A 1BTCA 3CHEA 1W3LA 3WDIA 2V5CA 3VGHA 1Q6GA 2FH6A 4RE2A 2UY4A 1QX1A 1NOFA 4UOQA 3DC0A 3RMEA 2QPUA 2ZIDA 2F2HA 3WFZA 1JAKA 4IPLA 2XJ7A 1GJUA 4PMDA 2OSXA 3WH9A 4W8BA 3W6MA 4MB4A 1E73M 2OWWA 3BSGA 3GXFA 1UD6A 5F7UA 1WDPA 3DX2A 5ECUA 4TTUA 2WMGA 2BY3A 2A3BA 1SZNA 3W28A 2J7BA 3VO0A 2CBJA 1W32A 3W38A 1GORA 1UZ1A 2CBVA 3VDAA 4X9YA 3WNLA 3WH5A 1DWHM 2ZE0A 4OBSA 2VNCA 3U5YA 2DSZA 3DHPA 1EOKA 2Y5QA 3BUPA 4M29A 8A3HA 1M42A 1WP6A 2BV9A 3A5VA 5M3WA 2QPSA 3WQ6A 5D8ZA 4GI8A 1QOXA 3GXMA 4MADA 4B16A 4AXNA 2VR4A 1VBRA 3CHDA 1C7TA 1UR8A 4JFTA 4TOQA 3K8KA 2D3NA 4W87A 2PB1A 3BVWA 2PWGA 2BVTA 5ABGA 1FA2A 3CHFA 5BCAA 4W8AA 1QWUA 4U2YA 3VU2A 4OJYA 3CZGA 4P7LA 4TUFA 1UWSA 4UFMA 7A3HA 2CBIA 3LXCA 3VM7A 1ZJBA 1R85A 3OGRA 2E3ZA 5CPQA 1QWNA 1K9TA 1HVQA 5A2BA 3MANA 3GDBA 1VB9A 2YA1A 3CPUA 3EDEA 2WBKA 3PZ9A 1MWOA 3TOPA 4HPHA 2C9PA 4WK9A 3BAIA 3D51A 1E72M 4D6EA 3CGTA 4LYQA 1EHAA 1RP9A 5IXEA 3FHQA 3GH4A 4R5EA 1HJSA 1B3XA 3DECA 3WDQA 5E6YA 2XWDA 5D8WA 3VNYA 4UOZA 4DUXA 2GJPA 1JF6A 2CERA 5KEZA 1CLVA 2V3GA 4B9YA 3FAXA 3LPFA 3WUEA 1BPLA 2WSKA 3VMPA 4Y7EA 1V08A 4AY1A 2WANA 3W81A 1QI3A 1QHOA 2J75A 1H49A 1XC6A 4W7WA 1LL4A 4UQAA 3GXPA 5E0CA 3ARSA 4HZ7A 4JFUA 4AZCB 2XPKA 4NX0A 4CD4A 2ZICA 5JBDA 2VQUA 1UR1A 4FNRA 4MB1A 4UFHA 1C8XA 5HXMA 3VILA 1L0PA 3OB8A 2CYGA 1MXDA 4W89A 1SR0A 3OGVA 3WN6A 3W6LA 1WDRA 4D1IA 3T2QA 3AS2A 2OMYA 3A23A 1HKJA 3MSDA 4DWSB 1HKIA 4D6CA 1ZU8A 3CZLA 1ZBWA 4HU0A 3PBGA 3VIGA 4J3SA 3AIEA 3EJUA 5CLTA 3MU7A 1F4AA 1V02A 3LRMA 4CUCA 1B1YA 1OINA 5C71A 4TVUA 3WSUA 1VEPA 2VRKA 4TTGA 1VIWA 1LF1A 1YHTA 3NSXA 3VIMA 1SMAA 5LA2A 5HDRA 1GQIA 3AYRA 2XVGA 7TAAA 1HX0A 1JXKA 2CBUA 5BWFA 3BLKA 4D1JA 2YLLA 3GNRA 1FHDA 4AWEA 1ZB5A 3WEZA 4YHEA 2ZX5A 4R27A 1V0NA 3S6TA 2YOCA 2AOSA 3PZQA 1JD7A 3HJEA 2EAEA 3KE0A 2ZWYA 2JF7A 3UETA 1VFFA 4EKJA 3LXAA 1XHGA 1JYNA 1V0LA 1R33A 1JNDA 1EDTA 2ZXBA 1XD1A 3B8SA 4CD7A 4PMNA 3OG2A 3WQWA 4QLJA 2UZYA 3VOCA 1XV8A 2CKSA 4W84A 3AS1A 1JIBA 5DO8A 1HJWA 2WVVA 3ZM8A 1TG7A 1H4PA 4NRRA 1UD8A 2DPEA 4B3LA 4JHOA 1CIUA 1GJWA 4FNQA 1JF5A 3QHMA 4W8LA 1XCXA 4LX4A 3MS8A 3RIKA 1OGSA 4U2ZA 4PN2A 3UR7A 4NZJA 1VENA 3WUBA 1UKTA 4AD0A 1G1YA 3DX1A 3O2LA 2CITA 1KGXA 3CUIA 3MI6A 1JYXA 3ARXA 1R46A 2DT3A 4HA1A 2WVTA 1E4MM 4HTYA 2WHMA 4AZ7A 2VVNA 1W9UA 3S5YA 5EB8A 2W62A 2WMJA 1M53A 2BHUA 3DX0A 3ALGA 3DDGA 1E71M 2VTFA 2CXGA 3SUSA 1T0OA 1GCYA 1C90A 4W86A 1W1TA 2WMHA 3LMYA 3HG3A 4H8VA 3CZKA 1C93A 2QMJA 2ZUMA 5E6ZA 3AIQA 4KRTA 2WZEA 5ABHA 1UA3A 2A3AA 5M17A 3GNPA 3VD5A 3W4RA 3PTQA 3ZSSA 4DWSA 3W29A 2W66A 3MMUA 5I3DA 4GO9A 3L4TA 3AMDA 3LXBA 1CGTA 3CHCA 4IUGA 2FYVA 1LG1A 4H41A 3WY3A 3EMCA 4CCEA 4DUVA 2OYLA 3VIJA 1W1YA 4PSRA 1E0VA 4MJ4A 3RM8A 3B9EA 2PF0A 1KGUA 4OIFA 2CKRA 4XZBA 2Z1KA 4V2XA 4E8CA 3WF3A 3FNDA 1W3JA 3SUTA 1TE1A 4F66A 1TVPA 4F8XA 3VVGA 3PZGA 2WQXA 1IZJA 1V6XA 2QMKA 1UQZA 2J79A 2Z1SA 2GFTA 2DH2A 1DWAM 1H09A 1A47A 3BAYA 3K4DA 4ZE4A 2FHCA 2E4TA 4P8VA 1JXJA 4FK9A 2JALA 3VDBA 1GONA 1VFMA 2WCGA 3AXHA 2J78A 1ISVA 3MSGA 3H54A 4UQCA 3OLEA 4M81A 3SUVA 2WWDA 3CZSA 3BMVA 1XD0A 2QLYA 4UQDA 1UR2A 2XUCA 1CYGA 2V5DA 3ZR5A 4FLSA 1E15A 1CLXA 1MVYA 1E4IA 3TTYA 2VX5A 1UR9A 2DQXA 4DO5A 1VBUA 5LA0A 4ZENA 4FF5A 4BS0A 2WQUA 1QHZA 3N18A 2J62A 1HL8A 3BAXA 5D4YA 2OLHA 3PTMA 3N11A 2UY3A 2X0HA 4KRUA 4W88A 2OSYA 2F8QA 4YPJA 2ZUVA 1UZ4A 3LRKA 2VMFA 3BVUA 1QBAA 3AHZA 1R34A 1BQCA 4AQ1A 4D6GA 2ZXAA 3WF4A 1KGWA 4GINA 1TUXA 4DWSD 4Z2GA 3LPPA 4DWSC 3T0DA 4EAMA 3CZ8A 1TA3B 3WL0A 4NSBA 1C8QA 3L4YA 2UZXA 2BHZA 4ZXOA 4EANA 2ZX6A 1U30A 1MW0A 1XH2A 2BXYA 3L4ZA 2OMUA 1V3LA 5A6KA 3AI0A 1DTUA 3ARUA 4MTVA 1E9LA 1UD4A 3ZMRA 3WMSA 1W3HA 2XN1A 4U33A 1PZ2A 5C70A 4WLCA 5A6BA 4Z2IA 3CO4A 3PZMA 2XVKA 3FHAA 4PMUA 1E43A 2CHOA 1UUQA 2JFEX 1PAMA 4OOUA 3LPGA 3BVTA 1HIZA 2VX4A 2QF8A 2BNJA 1R75A 3VGGA 3DHUA 4BQ3A 3ZR6A 3W53A 4HMCA 3SURA 2OYKA 1H3GA 1H2JA 3K8MA 3HZ3A 1US3A 2Y24A 2XFYA 1U33A 4NXSA 2XM2A 1B30A 4URIA 1KXVA 5CGMA 1PBGA 1QI5A 1H0GA 4Z2LA 3SCNA 4QCFA 3BAJA 4W5UA 5BROA 1NWUA 4AMXA 2V38A 4D6JA 5M03A 1ZBCA 4PMYA 2CIPA 2CHNA 3CUHA 1RD6A 4OOZA 4YHGA 4QCEA 1BVNP 1K6AA 3K1DA 2ESCA 2EPNA 2WNWA 2XN0A 2BHYA 3WQVA 2DH3A 4BQ5A 1XYZA 1UR4A 1OGGA 2YL5A 2EXOA 3AS3A 1JL8A 1E6SM 1BG9A 2X2JA 3II1A 1UD2A 4WSKA 1WNOA 5I77A 1GOWA 1US2A 1QNOA 4E4PA 2EBNA 4ACZA 4P7NA 5E1QA 1KTBA 2RA1A 3KL5A 3WL1A 2WVUA 3BGAA 5A69A 3MUAA 5A6JA 5CGTA 4JKMA 3WD0A 5CQ1A 3VTRA 4U3CA 3CZJA 2VZTA 1I1WA 4M80A 2PWDA 1Y7VA 4GQQA 2JEQA 4PMVA 3HU7A 4GI6A 4J28A 1EA9C 1GQKA 3WDRA 1TA3A 1VRXA 4MNLA 1ODUA 3SCSA 5A6BD 2Y8KA 3OZOA 3BUDA 4PMRA 2XYLA 2D0GA 4W7UA 4CVUA 4PTWA 4HOXA 3AIRA 3BUQA 3DX3A 3GZAA 4AZGA 3PHAA 3WBAA 3AYSA 4A3HA 1OBAA 2RGMA 3KL3A 4HPGA 3THCA 4CN4A 1SFSA 3WH7A 3LRLA 2FGLA 1TQSA 4DM1A 1KFWA 2VZSA 3VGEA 1GVYA 2C0HA 4P7RA 3UESA 1I75A 2XM1A 3GNOA 2FH8A 1R7AA 3N15A 2JF6A 1BAGA 3AXXA 2NSXA 2PWHA 1W91A 2O9PA 4JZ5A 4DO6A 2GDUA 3D4YA 3WFLA 1E5JA 1H0IA 4HMEA 4H8UA 5IHRA 5I0DA 2WHLA 1O6VA 1LG2A 3WY1A 3OLDA 1D2KA 3OIHA 4FNUA 1K9DA 3WF0A 1LQ0A 1CEOA 1H41A 2GVYA 1B3ZA 4AC1X 2WVSA 1W9XA 4GPNA 1G0CA 1E6ZA 3AHVA 3SCTA 2WW5A 3WKZA 2IUZA 2UY2A 2WSPA 2OMZA 2J8GA 2WLYA 2WYSA 5CPTA 3WDPP 1ISZA 5A8NA 1E6QM 5E0FA 2XG9A 5IFTA 3BC9A 2VJXA 1Q4NX 3J7HA 5EBAA 5HNNA 1NH6A 2CNCA 2ZWZA 5CLWA 3ZOAA 1J0HA 3O9NA 1IZKA 2EEXA 2HVMA 1CGWA 1NQ6A 1OWQA 2HISA 3SUUA 3AIVA 2WVVB 4CVWA 1EDQA 4JKLA 4U5IA 5A8PA 1TZ7A 4MNMA 3BMWA 2VX7A 2ALWA 1DWFM 4BF7A 1EXPA 1GOMA 4AD3A 1LWJA 4OGZA 3ARQA 3DYMA 2BY1A 1E70M 1UA7A 3NCOA 5CSUA 2WXDM 3I3EA 4JFWA 5IFPA 1B2YA 3ECQA 3AFBA 1G94A 4NI3A 1LYQA 1H6TA 3VX1A 3EJRA 4W5ZA 4TVCA 4AZIA 1A3HA 1G9HA 3KL0A 3N13A 2X0YA 4C7GA 1VF8A 3N9KA 1ESWA 1GHSA 3RJYA 3BCDA 5DT5A 2WK2A 2WC7A 1CXFA 1YQ2A 3W25A 1ISWA 4HMDA 1XCWA 3M07A 4KGJA 3DYPA 4CD5A 4HZ8A 4H2CA 3TA9A 2BS9A 3A3HA 2DGAA 3GYCA 3WF2A 4AW4A 3VKKA 3VUPA 4AW7A 2XSBA 5AC5A 3OLIA 3APGA 4KH2A 1FOBA 3MV11 1JZ6A 5A6MA 1ZL1A 4D6DA 3WD4A 3F5JA 3T0BA 3WIJA 1H11A 5CJ5A 2FGZA 1BYBA 1JYVA 1W1VA 3VIPA 1XEUA 2ZXQA 4PMZA 4F9JA 1KCLA 3T0AA 1BHGA 1WZAA 2BY2A 1CZ1A 5FKYA 2YDRA 3SCVA 2YLAA 1O6IA 1W2PA 2VC9A 1E40A 1V6YA 2EABA 3PZVA 4UCFA 4YN5A 2F1BA 1PX3A 2DIJA 5A8QA 2F7PA 2G3IA 2MANA 3WUFA 5BXPA 1V3HA 2ZUSA 2YL9A 3FAWA 1CENA 3BCFA 5GNZA 2G3MA 2XVNA 3KEHA 3WNNA 2J25A 1WO2A 2G3JA 2X2IA 3WBEA 5DFAA 3WH6A 5D9MA 1O7AA 3ZT5A 2WWCA 5HPOA 5ICUA 3G6LA 1HJQA 1JZ5A 2XGIA 1QPKA 4WSJA 1LWHA 2V3EA 3EJSA 1C7SA 1TFVA 3M46A 4K68A 4IPNB 1ITXA 1KR0A 4FNTA 3SEPA 3D50A 3FW6A 5CXPA 1WAWA 5CSYA 5HBFA 4HP5A 3CH9A 3BLBA 4NZFA 3NSMA 4UQ9A 1FFRA 1PEZA 1H6UA 3EJQA 2GK1A 4HOZA 1M03A 3VIKA 1G01A 1PZ3A 1UKQA 1HJVA 3QGVA 3WQ4A 3CV5A 4Z2HA 1CGUA 1MFUA 3WEOA 2WKGA 4H7VA 3EMQA 2X8RA 2YA2A 4AZHA 3NIYA 3GBEA 5D9NA 1HP5A 3WNOA 1NARA 3HG2A 5I24A 2YBTA 2OMWA 5GQBA 4C7FA 3KLKA 1B90A 3W82A 3SCRA 1MFVA 1TQUA 1CWYA 3VIIA 1DP0A 4F9DA 1NP2A 1R7OA 1QW9A 2W63A 3BAKA 5LYRA 5A8MA 4ATLA 5D9OA 3RDKA 1F4HA 1JG9A 1EQPA 3RM9A 3N12A 3TV8A 3HG5A 1V6VA 2G4FA 3ZIZA 3GXTA 4JL2A 4MAZA 5FL0A 1MW1A 1C8YA 2VCBA 3M7SA 3JUGA 4MNKA 2D2OA 2JEPA 2XIBA 2WLZA 9CGTA 2BFGA 1PX4A 1B3YA 1NWTA 2WHJA 3DDFA 4L4PA 3THDA 3UERA 5AYIA 3VIHA 5E9AA 1EQCA 6A3HA 1GOOA 4UZSA 4PTVA 1CXLA 2V3DA 4CU8A 1XH1A 5BRPA 4CN1A 1JZ3A 3AHXA 4RE3A 2W67A 3F4VA 3VIOA 1QI4A 2XHYA 3MUIA 1MW2A 3ZJ6A 3WNKA 2BVYA 4WKAA 5ABFA 4CILA 1PJ9A 2VZOA 1KBBA 2VCCA 3IAQA 4M82A 3K46A 4GXPA 4AD5A 2F7OA 3GH5A 3TONA 3CMGA 4Z2KA 1JI1A 1SYTA 3ARYA 1EO7A 1KTCA 1XSJA 4LQ1A 4E8DA 1TQWA 4HA4A 3K8LA 3TTOA 1KBKA 2YFOA 2PWEA 2OW7A 3AJ7A 1HP4A 3KZSA 1KQYA 4BZYA 4MB3A 2YKKA 2J7GA 4GKLA 2YBUA 1KR1A 1J0ZA 1TQVA 4PMOA 4C7DA 1V3MA 3VD3A 1CGXA 3VINA 3RPMA 4M24A 4ATWA 3SCQA 3UG3A 2WC4A 1CECA 5HPCA 2C8NA 1K9EA 3L4VA 1LJYA 2X09A 3GTNA 1FH9A 2A3EA 4MAVA 3EJTA 3BZ5A 3AZSA 4DM2A 1FHLA 4PCSA 1UHVA 4J7RA 5A94A 1NM4A 4JFVA 3IK2A 2W91A 2QHAA 3CUFA 4ACZB 1AVAA 1QNRA 1B9ZA 4ACYA 1XSKA 1QVBA 2PBGA 3A6OA 4D6IA 3WH8A 3BH4A 5I2UA 3AHYA 4QP0A 2O92A 1UD5A 1E56A 2DT0A 4JKKA 4W93A 1HTYA 1BG4A 4OBRA 4OUEA 3ARTA 1XGZA 1OGBA 5BRQA 1RP8A 2YDSA 4PUEA 1GUVA 1ZJAA 3T2PA 3G6MA 1XSIA 4J3UA 1E4NA 2WC3A 2WQVA 1R47A 2E8ZA 3CMJA 1FFQA 2XFFA 1S46A 4UFIA 2VUYA 2GJRA 3MMWA 5GNYA 1QI2A 3RCNA 2DSWA 3T09A 1WZKA 1FH7A 4UOJA 1CDGA 2Y8VA 3EDDA 5DT7A 3W0KA 1UD3A 2RGLA 1VJZA 1TR1A 3LPOA 4M56A 3H55A 4WJXA 4CCDA 2D20A 3QOKA 1E6RA 2WAGA
chains in the Genus database with same CATH superfamily
2N7SA 1FHVA 2C4TA 1UKSA 4Q33A 3MNVA 1AZRA 4QLLA 4Z0BL 5I18H 1OGTA 2EC9U 3I7RA 2CLLA 2WXHA 1U2HA 5KVDH 3LKNB 1AE6H 1B57A 4MDOA 1G6VK 4PCTA 3L23A 1E7UA 4Y1AB 1WV2A 5F1UA 1HILB 3S5OA 4QRRE 1T20A 2GJ6E 2WY3B 3GMOB 4KXAA 4XI5C 4LOVA 5JOPD 4JANB 4UT7H 1JPGB 2JF1A 2ZCGA 5BYWA 2Z7GA 5JHLH 1U3HD 1SY6A 4F92B 4YHZL 4B92A 1EIBA 4BKSC 3HZKA 5TGBA 4HULB 3PZOA 2L7UA 1BJ8A 1XJBA 4CJ0A 4UIKH 2NV1A 5HATA 4OFKA 1K9MD 12E8H 4IYKA 4N68A 4MKVA 4N42A 3GK0A 2F68X 1TVLA 3U7VA 1KBIA 1I2RA 3C5ZC 5DRWB 3QG7L 4B3KA 4G8FB 4UTKA 2KDGA 3PQYB 2ZTNA 4GG8B 1IBZA 3G5YA 4PRPD 1KIQB 2J8OA 4P4KA 2ZXGA 4XB8A 1GW1A 4TV5A 5KYWA 2XGZA 4O12A 3S9ZA 2OMNA 3MXWH 1YQVL 3NSNA 1WC7B 2FMNA 3BZJA 4LBSA 5AB1A 3X14B 1IVTA 5JORA 4H25A 4A6YB 4I5UA 1PFCA 3V5FA 4YDKL 2BNQB 2PCPA 1TMQA 3A0OA 5AALA 1HXMB 2L0DA 3NA4A 2AVFA 4S3KA 2I27N 5SWSB 3E0WA 3MUCA 3ECBB 4Z7VB 3TP4A 1SEBA 1UA6H 1SJVA 5DK0A 4AVZA 2OL3A 1F5WA 2H1PL 5B7YA 3UTSB 2CKBA 2UY5A 3BN9D 4ATDA 3QIWC 4P2QD 1V3IA 2ATKB 2ICWA 4OLEA 4TUUA 5C07B 2P8PA 5A5WA 1P1MA 2DI9A 3RHWK 1NOWA 2C3WA 3WXWH 3L45A 3I6SA 4IRJC 3LB6C 4PJCF 2QQKL 5D7JA 5ES4B 3C2YA 2IQTA 4EXKA 3ASWA 3EBVA 1F90H 3HZYB 3G6JE 4LLQB 5HJGA 3N17A 4XZLX 1EH9A 3NJ3A 2NX5D 4LCSA 3O4LE 2WNNA 4DQLA 4AQEB 4NZ1A 4PJBA 5C0CB 4UT9A 3MJ9L 4X22A 2J5WA 5I5MA 1A50A 3QDMB 3V5HB 4E9TA 5FYLE 1BYDA 4Y2DA 3AFLA 2XG5B 4A2DA 4QXIA 3H8NA 3SGDH 1E1EA 3KPRA 3VWJC 3RWDA 3NTYA 4LARL 1HXJA 4Z1MA 4G56A 1BGXH 1X5YA 1WD8A 2I9LB 1V5VA 3RZWA 2O9OA 3GU9A 1KJVB 3H4WA 1F74A 2VENA 3MKGA 4ZT1A 1BQEA 1QBLL 5F9JA 3ZZ1A 1CZ8L 3M8OH 1B3VA 4MCYA 3I1FA 2GSJA 3GJEA 3D4CA 1OFAA 4HCLA 1XISA 3WF1A 3ALFA 1B31A 3PDGA 5LB1A 5LBVA 2ZOOA 4IEFA 3IRCA 3SCOA 3TCLA 4R53A 3AUWB 2ONEA 5F4XA 1F45A 3EFDH 2A0NA 1N5AA 3KPQA 4P59H 4HCDA 3DO7B 3H2FA 3MBXH 3JTTA 2OK8A 4EI5D 2K8MA 5H4ZA 5DC9B 4KZEH 3E20A 4KERA 4X9BA 1CC3A 3EMZA 3TCEA 1BVLB 3AZUA 5I3JA 1TFHA 5C0ND 5IT2L 1K6WA 3GDTA 4Z7UF 4DKEH 4HZ1A 3KGUA 4L1LA 2VZUA 3ISWA 4KQ4H 1RZJC 3VD7A 5D1QB 4XLHA 3O2DL 2PCEA 4N2CA 4GIPD 4QTHA 5HI4C 2E76C 1EPXA 3EOTH 4J3VA 1OIFA 2INEA 1T7ZA 2YK1H 5EMYA 4CBPA 1OAYL 2V2DA 3C6LB 4YTTA 4HCGA 2X42A 1R2TA 1LCOA 4RAUB 4PBGA 5G1MA 4E2VA 3GSVA 4B44A 1MI5B 3K6SB 4OFCA 4OZOA 3G2GA 2XXMB 1CB4A 1JNYA 4JX6A 1CR9L 5LCVL 1NDMB 1FUYA 1J5SA 1YO4A 3ME0B 1TQJA 4DUOA 3PBYA 4PLNC 2XV6B 3PZTA 1ICPA 1LOQA 4M62L 5KETA 5TD4A 3TO4C 3LBCA 1M9WA 2XFRA 2QCCA 1KFKA 2B4CC 3IJYA 1I8MA 1MJ7H 1UJ3A 4PYHA 2RKXA 4HE6A 3GMQB 2G5RA 3U4BL 1N0LB 2BINA 4J39A 1E27A 3PS7A 1R0AH 3T8QA 1WCBA 4JO4L 2H2SD 1QFHA 2NWRA 4WO0A 2I14A 4OB5H 1A49A 3V16A 3CWNA 2EACA 3V4UL 2PBOA 2IAAC 4JFPA 5DD3L 5IG7A 2YPVA 2W07A 4APXA 4I48B 3F7PC 4EIBA 5CIPA 3DV4A 3AMLA 1OANA 4XM3A 2C3XA 3U7YL 2W0FB 3BIKA 4W9JC 4M43H 3ZJ8A 2GSGA 3AZTA 1F4WH 5LKNA 2OR2A 3QEHB 2WO5A 3LZRA 3N1PC 2XA8L 3AMGA 4JRFA 2J71A 2VGLM 3B7SA 1OT4A 4OLXH 4D9LH 4ZW5A 3BUIA 1VFTA 4NC2B 3ES8A 2X70B 1S3HA 4F24A 4GABA 3IDMB 3N41F 5A6TC 3TFXA 5C0JA 4ADUA 1LDPH 1HSBA 2XXFA 1CQKA 3LIZL 5HANA 2WMPB 4EZJA 4YSAA 3LKOB 4CEUC 5F89B 1MREL 3SFWA 4LPTA 2Y0FA 4YFDB 3ZZ0A 2VUNA 3QDHA 4Q8OA 3P0GB 4WZTA 5D9SB 4RMTA 3VMNA 2LW3A 2F0CA 1PKQE 1RPXA 1H3TA 2PODA 1QO3A 3UJJL 4UNKA 5BO1L 1VQ8B 4HH9B 4RD2A 3IJIA 3QR3A 2YQBA 1ZA3A 1ZBVA 4XE5B 5HOSA 4H26B 1XB6A 3O4OC 5H37G 3O41B 3GMPA 2ODOA 1AG1O 1YLOA 1T7LA 4PJ8C 5GGTA 5LXEA 3GEFA 1AQFA 4NQQA 1CLZL 3HE7B 2ZOXA 1MJUH 4L3ED 4A04A 4HT3A 3UG4A 1CFNA 3FUIA 3WDIA 3PP4L 3QJUB 4QJ5B 4L8DA 3RMEA 2QPUA 3GR8A 5D2WA 5HINA 4F5CE 1HO4A 1XWYA 4KU1A 3W6MA 4FHBD 5IBLD 4UBDC 3OZVA 3GXFA 1SFHA 3VXNB 1C9DA 3TN6A 2YWYA 4TSAL 1NGYA 4K5LA 3ZE1F 3LGGA 4YWGL 4V1XA 3VDAA 3RVWD 5I0VA 3IU4H 4RPPA 4HV8B 3HVDA 2ALDA 1DDGA 2BV9A 3WQ6A 4QRRD 2PDWA 2EH7H 1GGOA 2GJ6D 3OAAA 3T0VA 3VU2A 1JA1A 2EEFA 1C5BL 1ZJBA 3I7QA 4AV0A 5CPQA 3O1NA 1HVQA 1FRNA 3WTYA 4FJZA 5LDSA 5FC9A 1OG6A 3QKZA 3QARA 4P9MH 1S7SA 5A40E 5IXEA 4U3SA 4F7CB 2NSOA 2DYPD 3WDQA 1M2VA 2Z91A 3RA7H 1FNDA 4P12A 2OXGA 3S88H 4QMEA 3N43B 1QI3A 3NSYA 4JQIH 4KK5D 4EN2A 2JBMA 3TJLA 3IEBA 2AEPH 3CMOL 4X2PA 3N6JA 1LNUA 2E77A 5FLUA 3GLDA 3KNBA 4UFHA 2KZ1B 1PZSA 4MMZA 3T4WA 2UXGA 5GGRB 1GTHA 1WDRA 2A9MH 4JDVA 2B0SL 2E5BA 2PRLA 5EPDA 2XZQL 5HJ3B 3V4BA 4ABQA 3LRMA 1B1YA 3WXVL 1OINA 5AHFA 1E4KA 5A88A 3URBA 3IRSA 3WK2A 4P9HC 1FHDA 4IQHA 2QVHA 4O1CA 2YOCA 6PAZA 1J05A 4KO7A 1OWWA 3DTXA 3LXAA 1R33A 1JNDA 2HJPA 2Z2BA 4IIQA 1OAXL 1TO4A 5ACZB 3G3MA 3W7OA 1K73D 4RPDA 4KKCC 2BC4B 3BWSA 4MFHA 2FX8H 3B3BA 1H3XA 4ZMOA 2VLLA 3C2AH 1SJAA 2DLFH 2DAVA 1JYXA 5MENB 4FHKA 1W87A 4UUJB 2V7QA 2WVTA 3UO1H 3F2CA 2WHMA 5FYLD 3AACA 1ROCA 5D2LF 1WU8A 1G9NC 1XUZA 2VTFA 1KLFB 4M7KL 4RD6A 3RGHA 3ZHFA 1RZQA 2OLAA 2X1TA 4BRJA 3A8JA 4MHBA 4PRBA 3M16A 2A3AA 4K94C 1VH7A 3W70A 3G5XB 4OCWL 3F6LA 1G7UA 3QISA 3WY3A 1QYGL 3JXAA 1ZENA 3TM6A 4Z4YA 4AYEC 3FXIC 4ZD3H 5TAOA 4Q6IA 1PIIA 3DI1A 1MHEA 1XGRA 3FNDA 2VSKB 2NXHA 1Z69A 2X6WA 1QOPA 3W00A 4RDYA 3CBRA 4R6UA 3S3CB 1JK8A 5TBOA 5I0WA 2ZRUA 2ZSWA 3UYCA 4DP7X 2J24A 1ZM4A 3VDBA 1UUNA 5HXBA 3EUDA 4L3CA 3ZZTA 1P7QD 4PWEA 4Y88A 2EDYA 4JN1H 2IDFA 1KB5H 3CZSA 3EA2A 2EE2A 2BVNA 4NSKB 2V5DA 3NE5B 2VX5A 1W16A 1I1RA 4ADIA 2Z7YA 3NFPB 3RWGB 2Y89A 4MLRA 3SEJA 3B5TA 5SWQA 2W60A 3N11A 3WD5H 4LZKA 1PDYA 1R19A 1UZ4A 5DK2A 3MTWA 2CO7B 4XCYA 2X1RA 2IPUK 4HFUL 6REQB 3B8WA 5FYKH 4DWSC 3G1XA 4OGQC 2XZZA 4PJEB 3B82A 1FL5B 1XLHA 4Y19A 4Z0SA 2NV4A 3NJGA 3Q65A 3TVMA 2X4QA 3F7RA 4L6DA 2LU3A 4HUXA 1KLUA 1VYPX 4WJ8A 2VDML 2NUPA 3WTUA 2AF2A 2A1WH 3RRXA 3DIFB 1A5MC 3B7YA 3VFMA 1QPNA 2QF8A 4MWAE 4N90E 3HPSA 2FAUA 3QPYA 3Q45A 4IOFD 3QHFL 4NXSA 4LLVA 3P60A 1UEYA 4FJ6A 2BMWA 2E6QA 3IS1X 4QEEA 4N8VA 2Z1WA 4YFLF 1DUZA 2VGBA 1SPDA 1XYZA 1T21B 2EXOA 2Y7QA 3L3HA 5I71B 2X2JA 3II1A 4WSKA 3PHOA 1FLRH 5KVFE 3ZUCA 4GG6F 4IIDA 4O4WA 3UP6A 5INDA 4JEJA 5GS3A 4PV1C 1FYTE 2I9TB 5EB9A 4N6RA 3W9DB 3FTWA 2PPDA 2Q02A 1CF8H 4RZCB 5DD0H 3BUDA 4JJOA 2Z8SA 2ODHA 3I9PA 4JDTH 5LGXA 1OBAA 2VDQH 4ZMVA 1A3LH 2BBFA 3RRAA 4NHCL 1GVYA 2Q76B 4OLWH 3CU1A 2IDUA 1UBPC 4XHJD 3AWGA 1WUEA 4J3BA 2NSXA 5AC8A 1GZQB 5KSVA 3OAYH 3RGVB 2Q87A 5IHRA 1SR9A 2X53A 3OLDA 3ZPDA 5KS9A 2GPTA 5LIWX 5CZVL 4MA8H 3ARFB 4G42B 2MFNA 1CD1B 4ZPVB 2J8GA 3H4GA 1F1GA 3QXTA 1EHXA 2R1XB 2KH2B 1Q4NX 5G1TA 1N8FA 2EICA 2IPWA 1KPVB 4H8WC 5CLWA 3GU2A 2IGFH 1O5DT 4QRPE 3CDFA 7PAZA 3OZ9H 2PXYA 4ALDA 5FA4B 4WUUA 5HHNA 1EXPA 3ARQA 3SBRA 3MVTA 5HYJB 1OP5H 5TR9A 1OTSC 5JIKA 1DBTA 1LYQA 1MQKL 3ZKMD 3EJRA 3ARDC 4TVCA 3KOZA 3RJYA 3QE2A 4EIVA 1HHHB 4TNVF 1YEHH 1JRHL 1LEIA 4MJMA 3KCPB 2MCMA 4HHWA 5FUOL 2X8KA 1FO0L 3QBUA 3OLIA 4KH2A 5IM51 3SE3A 5E2UL 5HWJA 2V7UA 5I03A 2CO2A 4WI6A 3NZ8A 4KHXH 2BY2A 2DM3A 1EXBA 3GTXA 4UB9A 3KLAA 5JH2A 3O6YX 4L4VE 4CNIB 4X7FC 4PS7A 2IC2A 3F7QA 1L7TH 8PAZA 4ODVL 4IX2A 3WUFA 4PJIF 2YL9A 3ZTEA 2TPSA 4ALAC 2XVNA 3QMRA 4LUSA 4S11A 1IXQA 2XIDA 1TNMA 5FDYA 1VZHA 3TA6A 5ELIA 3CUXA 4U05A 1HL5A 1CFQB 1WD9A 3KRSA 4G9DB 3RWCA 4K68A 1ITXA 2Y25A 5D2YA 2X7LB 3ZO0A 4WHYG 5CXPA 3QG7H 1UR3M 2Y72A 3AU1B 1HJVA 3EYVA 3MYJB 5BMFH 5JUEH 1SUHA 2PO6B 5D1ZD 5MHBA 5IIEA 4JFDA 3UW6A 1M90D 1A1OB 2R8WA 4X3ZA 1YQVH 3DESA 2AL2A 4KWWA 2DLTA 4LH8A 2BSAA 4K5PA 1IGTA 2OMWA 1BYOA 4MDIB 3WUWB 1B6DA 3AWOA 4WDWA 4X5XB 3TZVB 4S2BA 4I2XB 5J6HA 4MMYA 3SZKC 3D6NA 2Q86B 5FUCE 3HG5A 3EWXA 3GXTA 2H1PH 1ERNA 5REQB 3QJZA 3WIHA 4DFIA 2C1GA 4P07A 4ODHL 1NWTA 3UZVA 1FWCC 1MEXL 1CXLA 2DL9A 4N02A 3GBNL 5G4OA 3MZ2A 4LPYA 1EHKB 4HLZG 3W7NA 1U1UA 1S9WA 1DQTA 3CHRA 3ABRA 2Z4QB 1QI4A 2QQKH 3P3TA 3X13B 2D4FA 3KLDA 1GHFL 1PJ9A 3VKBA 3NAAL 4LSVL 2ZCKL 2CZFA 5BW7A 4LQ1A 3SYOA 3TTEA 1TQWA 4HA4A 1I1AA 3K8LA 2JWYA 2J1KA 2BNUB 4FAMA 1P5VA 4D0CB 4GKLA 1QA9A 2X7VA 1XAKA 5IYRA 4BKLA 3VD3A 1CGXA 3F58H 1UZ6F 4FFZA 2A5HA 4JQXC 4Q9CA 1CECA 1SJHA 2X09A 4MAVA 4K3JL 5J5DA 2XI9A 2LLNA 4NQDA 4YIQB 1Z9SA 1P0EA 2FIRT 3SPJA 3SRKA 2DPKA 5F70A 1J8SA 1KTKE 3DAQA 3ZUGA 3KFTA 4ZX4A 5HNUA 5E4OA 4JIRA 1SJXA 5J4MA 4ZAKA 3GSNL 3VH8G 2ICWI 1SYVA 3DFTA 1RERA 1GUVA 3VA6A 4N3UA 1JWUA 3D3VB 4UTTA 4Y4KC 4NN5C 1NCNA 3TFKC 1CZ8H 4PJDA 3RCNA 3RQ3A 1UG9A 5JIIA 2J5LC 3A64A 4FYRA 1XIBA 4C8XA 4JN2A 4DZHA 5EMKA 1LRTA 1F13A 4XIMA 5IR1A 1J6PA 1DIDA 5EBLA 2IALA 5I9QB 1XH3A 4CCDA 4E0RA 2EH8L 4X98A 3PAUA 4WVXA 4B3EA 3L2IA 3GH7A 4TV3A 2NX3A 4B47A 4AYGA 2OT0A 2OPJA 1GGUA 4WI0A 3ZO9A 4EAEA 4LYKA 2ETWA 1CBJA 1HHGB 4NPYB 3G04B 3WFHB 1DJHA 2R0KL 3AGWA 4MXWL 2ZX7A 4QD2E 1BSLA 1SJBA 5EZOH 2RJHA 3B2XA 4U1IB 3O2DH 3D0VB 1KWKA 3K74B 1XYLA 3SSGA 4NQSB 1FN4A 1LQBC 1IM3A 4OECA 3D52A 4FMFA 3BQUD 2NUWA 5DFVC 3GBDA 35C8L 1PXGA 3MREA 4K15A 3EOUA 1NCIA 5AC4A 4BWTA 3SCWA 2KLTA 4Y5YC 2AERT 3A47A 2VL5B 1JDDA 2HVBA 4HU8A 3SHSA 5CEYB 5E93A 2W5FA 4D2JA 3CZFA 1COBA 4LPCA 3NSDA 1WFMA 4C58B 3AREC 4QS5A 4KNTA 4XGZB 4QNWA 4Y16B 1CR9H 3WD1A 4TKOB 4GH3A 3G05A 1KRAC 2YWZA 1HVXA 4PB9H 3H7LA 5AVRB 3PN8A 4ACBA 2FT6A 2K70A 5HDBE 2R1KA 2UWFA 2VHLA 1NLBH 4F7EB 4NT0A 2C3HA 2NXYB 4N9EA 5BRBA 3IMTA 5I1AB 4FG6D 4YBQD 2E56A 4YDJA 4M4SA 2RALA 4YVUA 4RFNC 4MWAD 1V3KA 4AENB 3IIOA 1OHQA 3C60D 2NW3A 4JM2D 3KJ4C 1ZY9A 1UWAA 1LJMA 2G41A 4A2LA 1TZIB 3EPOA 1LL7A 2GK0B 3CH1B 4Y0GA 4X7CC 1EX0A 3UBHA 5IB4A 4ODUA 4H20L 2VOTA 2HKFL 2ZL6A 5DD3H 2QADC 4KEZA 4JFFD 4R9HA 3KVKA 2DI7A 1V77A 2D2CC 1ZHNB 1LP9A 3UIZA 4Q3MA 4BINA 3H2PA 2QHLA 1JPKA 2QGHA 7ODCA 2GK1B 3IXTA 3KTCA 3M4HA 4TIMA 1CXHA 3AIUA 5EBWB 2A9CA 5PAZA 3BWWA 1M6JA 4NKCA 5EU9A 2XA8H 1OF6A 5D8JH 4JFOA 4IBYA 3UTQB 3TLQA 3X12A 4V1YA 1FYTD 3SPCA 1EGJA 3GXDA 3WLIA 4RCAA 3A22A 1D1NA 2IBZY 3EFFA 2ACSA 3VSTA 2BGJA 3GLAA 2VLKB 1F11B 4WV1C 1PYWA 4MMXB 1OM3H 4FFTA 4ORZC 3L54A 1AODA 2J1ZA 1FVCB 3ELQA 4UZUA 1M6OB 4AYSA 5CGBA 2VIRB 3POHA 1MREH 2JB6A 1JXFA 2OMVA 4AGNA 4PEKA 4JY6A 2DKMA 2KPWA 3OAUL 4E42A 3KRZA 1CPUA 4E9QA 4FJYA 3OQ8A 3ORWA 1OT2A 2WWMD 3HQOA 4MCMA 3Q4DA 5ESVB 1OSEA 4LASH 1T3FB 4Z18A 5L6UA 4ONGH 1KFEA 2X89A 3UJIL 4OV4A 3IFOB 1PIGA 1FNEB 2IH3A 2O30A 2XJLA 4X99B 5H5JA 3US1A 3R4IA 3EB3A 1HYSD 2F15A 1NFIA 5E5CA 3ZBMA 4QRPD 2J8UB 1AXSA 4PCYA 2ESVA 3SYCA 3L13A 2DTSA 3BSZL 3PWPB 3ULUL 5DGRA 4YHPB 3PP4H 5EIIG 4OCMC 4WGWB 4GUJA 3FDWA 2WZ5A 3OKMB 2FTAA 4HKXB 3PY2A 4L1TA 4NO5B 1AKJA 5FYKE 2X05A 2XSXA 3T08A 4E41E 3SKOA 2EXWC 4LS2A 1OG0A 1ES0B 1MMFA 1BJ1J 2JN9A 1W9VA 3DK0A 5EOQH 3WK3A 1QWGA 4HAFA 3RO8A 4J5NA 4X0VA 4MAYC 3MPGA 3LZFL 3LV3B 2JH2A 3OVGA 3BVXA 1L9SA 2ZUQC 3AO0A 4P2OA 4ZG1A 1V7ML 1S8DA 2DTMH 3DFOA 3LD5A 2X1SA 2DQCL 3WELA 1C5BH 2IV9A 2YMTA 4J6RL 2C9RA 5DR5L 1BVKB 4O13A 5FYLH 3F4NA 4A4AA 1XDJA 1ZAJA 4R90L 4X8XA 5G2HA 3E1ZA 3W2FA 1FVEA 1EX5A 1OGTB 1YEEH 5ECGA 4WOZA 1A4KB 4ZO6A 3PWLA 3C0JA 1N10A 1SYSA 4DKFL 3TVAA 1AGDA 3EAUA 4OZGE 1UROA 5L2KA 3DXIA 1WTGT 1I8AA 3CMOH 1WVZA 1QVOB 2BP5M 3SRHA 2BODX 3QV8A 1WA3A 1PZCA 3QEZA 2N0MA 1OFEA 1A4MA 4Q7NA 3HZKB 5I1KL 5FSDC 5TGBB 1KT2B 1EWYA 4OKDA 5JOPE 4S10A 5MEQA 3HAEA 2K3HA 4PTTA 3OKEB 3MJ7A 4NPKA 4X5WB 5EFIB 2AC0A 5C2XA 3WXVH 1MEIA 1J18A 1CS6A 3Q2VA 1KFJA 4JO3H 2PCXA 2O7QA 4NI6A 3OGCA 1QSVA 2ZCHL 1E5ZA 1SDAB 4MNJA 3Q8BA 2PIAA 3NESA 3RTQB 2CNDA 2OWXA 4LALA 4AX3A 4NENA 1REQA 3Q01A 3C5ZA 5KYWB 5KSBF 1DXEA 3H4XA 1OHLA 1POJA 1OAXH 4LCYA 2FLIA 1JUBA 4GW1A 5LN4A 4YNYA 1ZP4A 3UZQB 5JHDE 4HIBA 4GQRA 3OJWA 1YLVA 1RZ8A 2PTZA 4DJDC 2OZ4L 1BD0A 1SSDA 3BGJA 1IU1A 3G5VA 2P88A 2JLPA 2A6DB 4N85A 4MD4A 1RBAA 1SEBB 4OI9A 2ZNWA 2JJUA 5IHLB 1S2TA 3R0MA 3ABZA 3DUHA 3T81A 4GIAA 2JCCF 2JKEA 4N86A 3QXDA 4Q9RH 1S78C 2O26U 3T0EC 4G9FE 2FTPA 3P7YA 2P8PB 4XH2A 4XAFA 2DT2A 1U8CA 1IE4A 4Y9RA 2NDFA 4P2QE 4A38A 2DBLL 2VMEA 2BXZA 3CXHK 1QZNA 1QYGH 4AXKA 3WQ5A 2W9MA 4KDWA 3ETBJ 3KL9A 3DVFA 4AKPA 5FOJA 4JNXA 3TW7A 5D37A 1UOKA 3HKZA 2C91A 4UWQB 1BPLB 5HR6A 3COTA 8FABA 1FAKT 1NCHA 1VFAB 3C8KA 3F7KA 1DPMA 2APFA 4Y2DB 4UIMA 5IK3A 1FNHA 1ZCRA 3ARBA 3W7RA 2VDLH 1OPGH 5CEXA 3HBQA 3KPRB 3RWDB 1RQBA 3WQDA 3HB3C 1YMMA 1ZDQA 4QAMB 2ZD0A 2A3BA 2CR0A 5E8EB 4WR3A 3PHQA 2BPOA 3CLMA 4HCHA 4POZD 3WH5A 2ZE0A 4OM0H 3DHPA 4N2OA 5GGSB 4M29A 1BVOA 5DJCA 5F9JB 2QPSA 3N6YA 4M7LT 1HHJA 1DBKL 4JFTA 3QFCA 2E6PA 4PP1C 1A4BA 3S35X 2AKZA 2VR9A 3EIFA 4IEFB 5HD8D 3VZZA 5DZAA 2POZA 3TCLB 5DUBB 3LCXA 1I1FA 4PLOB 3TH2T 3QJOA 3QH3B 3JTTB 1L5GA 1RIUL 1MWOA 1COWA 3IDIA 4A6YL 1X5ZA 5KW9A 3QNXA 5D2NC 1I7TA 1MCKA 4JTSA 1T5WB 4DUXA 1IHIA 2RAMA 1CLVA 2ZP8A 1AY1H 3CFDB 2E74C 4QTHB 2PZNA 3RPIA 4BSJA 1EIXA 1XC6A 4PLJD 4YALA 1INDH 1T22B 3QHFH 2XPKA 5DJYB 3OVUB 4IIEA 5LVEA 3VILA 2CYGA 3NACL 3TIMA 1TSRA 4D1IA 4R7DB 2ZBVA 4Y5VA 2F53A 3L6FA 5KZCB 1PLGH 1ZBWA 2PCYA 3T05A 4B3ZA 3PBGA 1OOWA 3LTYA 3US9A 3NQKA 2OQLA 1MDRA 4QG6A 4XKMA 2IXQB 2JIXA 4L4TE 4KY2A 3JWOL 4F7TB 2E6JA 3MMPA 3ZMNA 5BWFA 1AGEB 3EJZD 4WW1A 2V7NA 4EI0A 2ENJA 3MCG1 2C1PB 3KE0A 2HSAA 1FLTX 1PQZA 4FTVA 4GKZB 4MS8C 1D7KA 4LNRA 1UJ3B 2X4TB 4H88H 3B8SA 1UOVA 1YJDL 2CKSA 4HQQH 1J7VR 1WOPA 1HJWA 1E27B 4XBPA 5DJ2B 4JHOA 2HRPL 3CCEB 4FNQA 1H8SA 4PUUA 2WXGA 4NHCH 3MRBB 3PQYD 1TYRA 1UFUA 2A79A 4X9FA 1U91A 3WO3B 4JFPB 5IG7B 1GS7A 1CE6B 5HI3C 3NQ2A 1FSKB 2W07B 1ZE3H 3U1PA 2H32B 5JDJA 2PPEA 1IILE 5CIPB 4O8AA 2GT9A 3B8UA 5GS2D 1KO0A 3BZ4B 4N3NA 5GIRA 1NJ9A 5DGQA 4KY1L 1OTUD 3SUSA 1KZYA 5FEPA 3NMEA 3GHSA 2O55A 4O9HL 2DY1A 4PH6A 1X5JA 5KBPA 2OMUB 1LDCA 4M3HA 4PY7B 4LLMB 1FI8C 3W29A 4MASA 5I82A 5DEJA 1CGTA 2FYVA 1BWWA 4MJ4A 5C0JB 1I3RA 1XFBA 2MHAA 4LT7A 1UM6L 4QPEA 1HSBB 3B0PA 1YEGL 3CXDH 1MQKH 3NCJL 5GISL 3FTSA 2AQQA 5H94A 3EGXA 5HYSG 4KROB 2GFTA 3L7FA 4G6AD 3ZTJG 2G9KA 3BAYA 3K4DA 2FHCA 1JRHH 4ADJA 3Q3GB 1FO0H 4JY4B 4YIWA 4KAQL 1BF8A 5D93C 1MVYA 2G9HA 4GY0A 4WY7L 2ZBUA 4DO5A 3VI3F 4ZENA 7ENLA 4E41D 5IGXL 3GRWL 1Q6OA 4ZTOL 1N7ML 3X11A 5CP7B 5FF6B 2FIQA 3ML9A 3GMPB 3ABGA 4I1NB 3QI9A 4M1BA 4FC3E 2V5KA 4HU4A 4EAMA 4GYPC 1VPXA 5DUML 1JVLA 3PGDA 4EANA 4LSTH 4N22A 1R3WA 4US5D 3GS0A 4DIXA 5J11C 4QJ3B 4O4YL 3MBEC 3OJMB 3BKCH 3MGTA 2BVOA 4L3EE 2XUWA 4U33A 1PZ2A 3NJJA 1NGYB 4YCPA 2H0PA 4JQ4A 1KK2A 4W1TA 2BNJA 2EKSB 3TJIA 2OELA 4Q56A 4LVEA 5DHVH 2QDGA 3CCVB 4NKOB 4MYUA 4F8LA 4RNRB 2Z0BA 4S1QL 1A53A 4NFDA 4NKMA 2HSIA 4AYFA 5CJXC 4R7LA 2AJSL 4DYJA 4KJQD 3KEDA 1NVMA 2FQGA 2QNEA 1RVFH 5F1SA 4N5EC 3ZS4A 5J06A 3UGRA 1OGGA 4AX6A 5E4AA 2YL5A 3SGUA 1Q7MA 4U3SB 1MEXH 2DB8A 4ACZA 1KTBA 2RA1A 2J73A 1M2VB 4YLCA 4O1DA 3WD0A 3HPAA 5FLVA 3T4YA 2BWGA 1U95B 4RUBA 2OXGB 2PF8A 1YADA 3R0UA 2Y70A 3CAKA 2A83B 4X0KA 1GHFH 1XBYA 4HPJA 4LSVH 4MNHB 3WKML 4PE8A 2ZCKH 5B38A 4G43A 2DEXX 1IE7C 4YVXA 1DUYA 4XVDA 3CCJB 4RCZA 1J9QA 3QDGE 4F80A 5JHDD 2BSSA 3KVJA 5HDOA 4PGOA 1UTDA 2GJKA 2Y2YA 4N2YA 2JF6A 1XEDA 2QEXB 2WBXA 3QWQB 3W1MA 3G24A 1H0IA 3QIBC 1Q8JA 2HKAA 2EJAA 1OXYA 1K7EA 2GIMA 4NJJA 5IROA 2WWOA 1QSEA 1C16A 1O7DE 2R23A 4XOBA 1G0CA 3O45B 4PV9B 4LCQA 2WW5A 3WKZA 4G9FD 2ZC1A 3VYPA 3GSNH 2CNCA 2ZWZA 4IIQB 3II2A 1CGWA 1WOAA 4KI5F 5MERA 2HISA 2QQLL 3EZ8A 1P0KA 1EVUA 1S7WA 3R06A 1G6RA 2K9UA 4MNMA 3ATDA 4XC3H 5D03A 1YHQB 5F6HI 2BY1A 1MFMA 4HG4K 4FS0A 1OLZA 1AFSA 4M1KA 1BZ7B 4UIOA 3P3SA 4ZOAA 3KL0A 3NZGA 4C7GA 2FPTA 1Q6QA 5I8KH 4DCQB 3W25A 3FO1B 4NAFA 3GRBA 4H4NA 4NERA 4ZFFA 4AW4A 5ALCH 3A6CL 4AW7A 5KVFH 4H19A 2R0KH 1S5NA 5JVLA 1H8LA 3FN0L 2HCVA 2IANE 3TEVA 1DZ0A 4HK3J 4B3VA 4PMZA 4WY0F 3IAGC 1GS8A 5CCKL 3W5NA 2Z00A 3WKYA 5CWSB 3PBVA 3G8RA 5BS0A 3FT1A 3V55A 4Q6IB 2D4DA 3O6DA 3W5VA 3GKFA 3H7VA 3KBJA 3HFMH 3ZU8A 5JPMC 2WWCA 1JK8B 3WFBL 2XGIA 1VLXA 1MRZA 1LWHA 1ZTMA 2ZWKA 2ZSWB 4PL1A 1B88A 2XNCA 2ADYA 4FNTA 3G8EA 1LEGB 2O0TA 5D02A 1FFRA 1PEZA 3EJQA 2GK2A 2WP3O 4WZ9A 3CC2B 3PAYA 1GYUA 4KW2A 3P3YA 1ONWA 4ANXA 2CLMA 3WEOA 1OD9A 3S3PA 4H7VA 1GGBL 4JHUA 1FFOA 2PDGA 2JJSA 3QN3A 4LFHG 4XONA 4AUYA 2JJTC 5DK2B 3HGJA 4FN5A 4QF1A 3OHIA 4GRWH 3EG9B 1D5BB 4XCYB 1EEYA 5GQBA 3CFNA 1B90A 2QXWA 2JELH 5FIUA 1DBMH 3RZCB 4GXUN 2Z6JA 3HMJG 2HKFH 1PKYA 1D6EA 3D0LB 4Y9CA 5D9OA 3ATAA 2KHAA 5LXVA 2VFGA 3KPPB 1D9KB 4Y19B 2OJZH 1AGBB 3QDJB 5I75C 4NLHA 1HZHL 3MNWB 2LHAA 3TVMB 3GJFH 2X4QB 1FV1B 3A1PA 3JWDC 1INQA 5ACMA 4X6DB 3ULVF 1IEQA 3MCKA 4LHQB 4L4TD 2BP0A 5IW3A 2F8XC 2VNIA 1R6VA 4XAYA 4M6PA 3K2IA 2Q8ZA 3VFMB 3M6YA 4RE3A 2BIHA 3QZ6A 3ZJ6A 4O1FA 5FJPA 4WKAA 5ABFA 4JMNA 1AW1A 2BOLA 2J8HA 5ANHA 4GS7B 3LNGA 3QEUA 3C08H 3UA3A 1QSFB 4TS6A 1KBKA 2OW7A 1BZEA 1KQYA 5LNWA 2XYBA 3IDJA 1TPC1 4R0LA 4HC1H 1Q72L 2PZ0A 4JFYA 1TTAA 4G8TA 1EP3A 2GQHA 2V81A 1ZGLP 1NCJA 3BZ5A 2YX0A 4XVOA 4WJEA 2IKJA 3TF7C 3L3HB 2XIOA 3NQGA 2H3XC 4NBZB 2R82A 3A6OA 4GGBA 3H4FA 1KV7A 5INDB 5JYLA 5I2UA 3GXUB 4O0KA 2O92A 2R9RA 4FX5A 1E56A 4FALA 3BZEA 3H9SE 4N6RB 4E4UA 1HWHB 1E5YA 2WQRA 2NCMA 4NZ5A 3CFEA 1QFWL 3PUNA 3OJ2C 4FCAA 3C0LA 1R47A 5D5MA 3H2EA 3LTVA 1S46A 4QDGA 2GJRA 2DSWA 2BPBA 2R59A 1OEZW 2NV9A 2CA4A 3BSZH 3DU0A 4P3WA 1HSAA 4WO4C 4UR7A 5J3HD 2EE9A 2CC0A 2NZ9C 2LZJA 3VXPB 3S2MA 4JPIA 3QEQD 4JQAA 3Q58A 2FZNA 2GI0A 3VSUA 1TVBA 1UWXK 2GGGA 3O6FC 4ZI8A 1IRAY 4UU9B 4H6EA 4L4OA 3W5UA 4D3CH 5E4IA 4UV7L 2BVDA 1S7QB 2UXVA 4R26L 4UQ3A 4TPRL 1XCQA 1LDSA 1KBLA 1HIML 5HMFA 4RGNC 3ZDYB 1RV8A 3WQOA 2ADIB 1GPFA 2IAMD 4ELDA 1BF2A 4E8GA 1V7MH 3OMZA 5LG6A 4C47A 1AR2A 1BXUA 2DQCH 3HMXA 4DELA 4WI5A 4GC3A 5AVTB 2FGBA 2SEBA 3DKLA 1BGAA 5JDSB 2PD9A 5L0QB 4LHUB 5DR5H 2VJ8A 1I8IB 5D7LE 2ZPKL 4PB4A 1MCHA 4P6VF 3KHJA 4OFYA 4Q22A 4H6QA 5J9PA 2QJNA 5HQEA 3UAJA 3WL9A 1JUEA 3BQJA 2WUCL 1GOQA 1CFSB 2TSYA 5K4ZA 3UTTE 3UGUA 2J56A 4AIUA 4XB7A 2WZ0A 2X40A 1FORL 3NZ8B 3OX8A 4N0UE 1SZEA 2BS71 1IT9H 4GZEA 5DJDA 1BREA 4R96A 4OWGA 3KLAB 3NZPA 3QJSB 5HWMA 4LLAA 1AMXA 4QGCA 3HI6H 2R2HA 4NGHH 4R2GD 3MLUL 1CLYH 5ILTL 1OP4A 5MP6L 4X7FA 2JQMA 2YD1A 4GQPH 3GIQA 1C3FA 1DCEA 4MJIE 3WLTA 1FP8A 1G0YR 3U2CA 4R8WL 1OSYA 5TDPA 5C6TH 4G1MA 1ZWIA 3G6DL 1HJXA 2FO4A 4DNLA 2ZCHH 4KJPD 2AGTA 2AAMA 4HUUB 3EYVB 5T33L 3DARA 4JFDB 3MUY1 2B3IA 4HIJB 2NX1A 5C7XL 2VDGA 4MLSA 1NBCA 1PHQA 5LGJA 2BOCA 4UTBA 5C0BB 4UNVA 4ZFQA 2HTLD 4QLWA 2OZ4H 4HHGA 3O8XA 2YJQA 3Q38A 3IJ9A 4ADGA 1F02I 3QDGD 4YGAB 1PZAA 1QPQA 3SGGA 2EZ0C 3BUBA 4LGPB 1H7RA 1BBJA 2FWLB 2AV7B 3S97C 2F8OA 1RQHA 1NOUA 4QKXB 3MJWA 4PLKD 2PABA 2LR4A 1CWVA 2NY0B 4OQTA 2YD7A 4IGBC 3VMOA 4YXGA 1L9MA 4PTMA 5BVJA 2YZRA 4K7FA 2DICA 1HKWA 4WNQA 2DBLH 4HUKB 3GRGA 5LQBL 1MJJA 4D9PA 4J3WA 1MCFA 6PCYA 4RPBA 4DPQA 1M65A 1F2JA 5C6WH 2AK4E 3GC2A 5AWNL 4BKLB 4CQBA 2F7QA 1AI1L 1SJHB 4RE4A 3IGAA 3LRSA 1N82A 1MRDL 1DO5A 1C9SA 1JFQL 1FC1A 2TAAA 3F7LA 4JXCA 4GRLD 1Z9SB 3GR4A 3NJHA 4DGIL 4AE0A 1QVGB 3EB2A 1JEZA 1QGAA 3FXGA 5IVXF 4MM1A 3BUVA 1IC5L 2XQBH 3EO0A 4FABL 2E40A 3ABSA 3W07A 4KTEH 4IFOA 4LAUA 3RY4A 3FVDA 5HQLA 1ORQB 2IAND 2LLGA 4XNUL 5C9UA 3NNTA 4L48A 1JWUB 4Y9MA 4PJDB 2GTWA 1DBKH 3AZRA 1F58L 3QOMA 2V9TA 3UJSA 2H1LM 4MIMA 5FYJL 5EOCJ 4G8EB 3LDBB 5IDZA 3FSUA 4AJ0A 5F7DA 1I0BA 2QEZA 5IR1B 5I1LB 5EBLB 3TBSA 2H4EA 1BXNA 2QMUA 1XH3B 3RUGA 3BZDA 2PD5A 4F2ME 2E28A 4X98B 2P9RA 4L8BA 4W9IC 1E3XA 5GS2H 3TA3A 3FB7B 1J79A 4KWOA 4KPLA 1QRQA 1E4WH 1RZGB 3KBEA 4WI0B 1BWLA 4OY9A 3A4XA 4A6YH 1JDAA 4WI7A 1AIFB 1YNKH 4I9AA 2V17H 4WK0B 1UWQA 5LXXA 3ONCA 3SUWA 1MLBA 2NY2B 4BEUA 4K7PX 1CGSL 4A22A 1EBHA 3VDCA 2JCWA 2D3JA 2EVHA 1IM3B 4GXWA 2QV4A 5FIEA 4QRQA 1QEXA 2A4CA 1EHNA 4MA3A 4IIBA 5AW7B 2XRAH 3MREB 3A67L 3D07A 1P7TA 1E3ZA 4KXBA 1K85A 2A3TA 1I2OA 2YUZA 2I5QA 3CZFB 3HPXA 1X9UA 1PAZA 1BRLA 1NFDF 3HC2A 2ZF9A 3QXBA 2VO8A 5D4HA 43CAA 2QEJA 3OBAA 1UM4L 3HFTA 4C57C 5SX5K 2ZZ1A 1GWJA 2R1NA 3AREA 4ZS7H 3SDYH 1P6AB 2YMOA 3BWAA 4UCGA 2J74A 3U9PL 3VD4A 3KWSA 2VDPB 4Z6AT 3FOLA 2QCDB 3HHMA 5I73C 1RK5A 5CLZA 2ZZGA 5TNVA 4P7OA 4LXFA 4YDJB 1YJDH 1EGZA 3PGCB 4NNCA 4UXDA 5E9DE 3H53A 2HRPH 3EOBA 3F5KA 4IRZL 2VNKA 4N6QA 2R1WA 4NQEE 4Y4FC 1NAMB 1MVFA 1B4EA 3AVXA 4BHUI 3P9WB 4MPKA 3GZKA 3MO4A 4M0XA 1KCRL 5AZ0A 1KA9F 4OUUB 3LNDA 1LP9B 1R5VA 3ORJA 5MI0B 1SUXA 3KR3H 2J7CA 3WEXA 5D2TA 1T6BX 4S3DA 1JV5A 4O9HH 4JFFE 3UEQA 2YW4A 1E4XL 4KVPA 3T1WA 3HC0A 3VFVB 5DDHB 4YXLL 3C2RA 4OVVA 2YFNA 3CFKB 1YBQA 3H9SD 4NZDA 1YDPB 5DCBA 4WFFD 1OIMA 3TIDB 4JMXA 2XKNB 4MCNA 1OD0A 1G9MC 3E9UA 5GISH 3HB9A 3MMEB 4WI3A 3UYRL 3GZOA 3DFSA 3QUYA 1HE8A 2JB6B 2GY5A 1IGJB 4GP8B 4JY6B 4M6OH 2HQAA 1XF3B 3STFA 4G1NA 3U36A 1M7IA 4HK6A 3K2UH 2MKWA 4W8BA 3FFOA 1ADWA 1PSCA 2ZZFA 4KRMB 2Z92B 4OW6A 4DVBB 1QRNA 1UXSA 3VO0A 3FUDA 5IGXH 2QVFB 3UZEC 5IEHA 3GRWH 3B9OA 1N7MH 4MXVF 2X85A 3T8MA 1KIPA 5EEWA 4GI8A 4TSCL 1T4KB 4I5BB 4W87A 2WWKO 1D3GA 3GNXA 2QHRH 5BCAA 4ZQKA 1QWUA 4U2YA 5AD0A 3I9IA 1PZ5A 1YDYA 5ENWB 1EJFA 1DQJA 2O4QA 1U92B 1HXYB 3G1RA 4Q4EA 3LOWA 4PW9A 3QUKB 3EWUA 4Z1PA 5D7LD 4GRWE 3D51A 2YLHA 2V37A 1YPZF 2VDRB 2IV8A 3SGKC 4G8GA 3H7UA 3INUL 4JTEA 4CNUA 1NCAL 3TYUA 1NY1A 2GJZA 4M5SA 1V8EA 3SKOB 2P80A 1PJ7A 2YEVB 5A3IC 2HCZX 1KULA 1OZMA 2X6XA 5EA9A 3UTTD 4XCFL 2WJFA 5DJ8B 3ILDA 3WUEA 1EC9A 3AVEA 3KDPB 2HFFA 4IBSA 1V6TA 4Z0BH 5JHBA 1AIPA 1ZT4B 2Z8WC 1UWYA 1W31A 3LGEA 2V63A 4A8RA 3RNKB 3NRPA 1ZT1A 5E8PB 1L0PA 3OB8A 4EUPG 5LWYL 4TMZA 1J1OL 3WNDA 2XETA 2AJSH 1VCVA 4HYRA 3RNQA 1HKJA 2QELA 4ZMQA 4YAOA 2YCLA 3NSCA 1QWKA 4GFIA 2P4AB 4PGZA 1FVEB 5DXYA 5D72L 4XOCA 1WBZA 5HY9B 4P5TC 5CZJA 4MJID 4BGLA 4YHZH 3TKFA 1HZEA 4NQVB 1VLIA 4ZZ9A 4NOBA 1GQIA 1AD9A 1GVRA 3QUXC 2VISA 1SZRA 2CBUA 3S0CA 4YHEA 4WZLA 1BFOA 1F3WA 1AGDB 3IJDA 3CU7A 3V0TA 2H6RA 3K72A 3JZEA 5L2KB 3O9WC 4O0QA 1XD1A 1T5KA 4W84A 4AAJA 1JCYA 1FHUA 2DPEA 1AQDB 2ZZQA 3V7AG 3O15A 1XCXA 3RIKA 1OGSA 4PN2A 4KXZI 1TVHB 4C6IA 3WLBB 5MEQB 5CM1A 1VFHA 2NXYD 4IQEA 4JRYA 3WKQA 3H2MA 1P0DA 1NDGA 3GG0A 1BXBA 1DYZA 2BHUA 4DH2A 3OGCB 1SHMA 4YDKH 4HS3A 3ULUE 2WOQA 1E71M 1IKNC 1URIA 2J6EL 5HHME 4HFWB 2Z1VA 2QSTA 1A21A 3PG8A 3HG3A 1EPVA 1NC4D 1XC4A 4WK4B 1REQB 3GC3A 4DK1A 3QSRA 5M17A 3GNPA 2CBTA 4JIQA 2QQLH 4WKZA 1BFSA 1SLXA 4BCXA 1VKXA 4GW1B 3N9GL 3D05A 3PXLA 4GO9A 4AG0A 3D33A 2GIXA 2A1YA 4IUGA 2V9QA 1BEUA 1W1YA 3HS0B 2YGVA 1KGUA 3G5VB 1G4EA 4O18A 1X5GA 2AK4D 1KM1A 4M0LA 4EN3B 2YAPA 4OLYL 4S23A 1AL8A 3QXDB 1D9EA 4E5XA 3VKAA 3LXUX 4XH2B 3NIFF 1SDDB 4APQC 3D12B 2EDEA 2VWSA 1U8CB 1JZIA 3MJ9H 1E15A 4P6YA 3HUJE 4P05A 4B2DA 3M7OA 3NFNA 2BK8A 3SPHA 3QLLA 5CCKH 2EVFA 4K5NA 4LARH 4KPHL 4QHLA 2C3GA 2YYTA 3P14A 1YN6A 4YH6A 4JTCA 5KINA 1VZIA 5H8MA 2YBRA 2CIIB 8FABB 4Z2GA 1GZHC 2FJGB 3C8KB 3CZ8A 3IU3A 3WFBH 3ET9F 4UIMB 5IK3B 1QBLH 1T04B 3NT0A 3KJ6L 5C6PB 3QFDA 3L4ZA 4AMAA 1CU4L 3AI0A 2WYHA 3QXUA 4WHTB 4Y9NA 4R7WA 3DIPA 3GINA 4KKPA 3CV6A 4LNCA 1H15A 1SFDA 1OP9A 4H9UA 3OR7B 1ANUA 4F7PA 2ZOKA 4KKLD 5DQJB 4YL9A 1A14L 4PJHA 2Y24A 1HHJB 4XD6A 4JRWA 4C56B 5IT2H 1P4CA 2VDOB 3TO2A 2ADFL 3CUHA 2WXOA 3EOLA 1I1FB 1TV5A 3NFSL 3OV6A 4N1HB 5I16B 4H9XA 1OAYH 1IWBA 3T1GA 2FLMA 5K33A 3QNXB 1I7TB 2EBNA 4QVJA 2WXKA 1ZDSA 1A80A 4Q74A 4J2XA 1ZCOA 4QXVA 1EC7A 2N0KA 3CZJA 3D0AA 1TTRA 3CPXA 1U3NA 3QWRA 5D2NA 3PWIA 4Z3FA 2Y8KA 5LCVH 5EOTB 3FEQA 3UZJA 4GFXA 3GZAA 5IVOA 3PHAA 3NPZB 3AYSA 1Z9LA 5MHSE 3LEXA 1IR1A 3W86A 5E9DD 4DM1A 1Q86D 4M62H 3L6FB 3CIXA 4DTGL 4Y90A 3T07A 1BAGA 4NQED 1Q9KB 1KXVC 2X1PA 4DO6A 2YD9A 3TSDA 3U4BH 2KAUC 2OTUA 3MRJA 4FPSA 2JIXB 4JO4H 4LPXA 4Y1AE 1GW9A 2POTA 3OE7A 4Y4HD 3V4UH 2IUZA 3VSQA 4H0HB 4PRDB 1AKPA 4XPBL 2XG9A 4I3GA 3O2WL 1U4FA 1E30A 5GRUL 1QFWH 5EGRA 2R0LL 3O9NA 1BIIB 2V7TA 3U7YH 1AQ8A 2VLJA 5E4EC 4RAVA 4XBPB 5AVWB 4TM9A 3OKOA 3KVQA 2HVKB 4BF7A 1HA3A 4U9UA 4KNSA 1E6OL 5F3HA 3PS6A 3I3EA 1U91B 2YSWA 3ECQA 2OJEB 3H9HA 4RD0A 3VX1A 3TCTA 4W5ZA 5JU6A 4HKJA 4TUJB 1WJ3A 3Q6FA 4OZFH 2BCKA 5BZDB 2XDHA 2XCMC 2M2DA 1MNZA 3PQYE 4KKQA 2A99A 4C6MA 2QA4B 3TJEL 3GYCA 2ABBA 5LIXX 4FF7A 1WA2X 3UAFA 3LIZH 4UV7H 1JZ6A 4H40A 2ID5A 4YEEA 4TPRH 4JREB 3SDCC 3HFYA 3T0AA 1OSZB 2QVKA 4BWWA 1NPUA 4F2EA 3RGTA 2WO4A 2C15A 3D3FA 2VR6A 4WU5B 1E42A 2XH7A 2TMDA 2BNQE 1P69B 4FFWD 4DYKA 4TLUA 2MHAB 5SWSE 2X3CA 4Z7VE 4L1BA 1DDHA 3GLEA 3UTSE 5D9MA 3UJJH 5I7GA 3FUHA 4BZ2A 5BO1H 3ZT5A 1JNHA 2GYIA 4AZ8A 1HJQA 2VQ1A 3QFTA 4YDLB 3EJSA 5C07E 1HO1A 5J04A 4F4RA 4UT6A 1ZHBB 5FO7B 4DP5X 2WUCH 3DSNB 2CBQA 4F7MA 1K8ZA 2G9HB 4OFVA 4B5NA 1CLZH 1UKQA 2VN6A 4XBKA 2CLEA 3WQ4A 4M7TA 1FORH 4WEEA 1DJIA 4GBXB 3MLYL 4L1DA 3UJFA 1TZ9A 4PJ5A 4MD5A 4OD1L 2VRAA 5C0CE 4LL9A 4RKAA 4EXQA 2DYSB 4L29A 2EDRA 2ZYFA 1NL0L 4TSAH 5EEUA 3QI9B 3ABMB 3A4FA 3QDME 3JT2A 3PV6B 4K23L 1T96A 3OR6A 1QW9A 4YWGH 4HGWA 2C26A 3ULSA 1BXCA 1EJOL 2ZRYA 4ODTL 3PE9A 3SODB 2REQA 1A5LC 3G6DH 5DURB 5C08B 4GSUA 4L4PA 4NC1C 5T33H 4QWWC 1GOOA 2K4AA 2A73A 4K8GA 1Q9LB 1JZ3A 4B48A 4NLAA 5C7XH 3KS0H 1XWVA 2ERJB 2OLDA 3BO9A 2XFXA 3MZNA 1IJEA 5E56A 2B5OA 3MNVB 1W6TA 4LCWA 4PBEA 2F7OA 3OC8A 3LB0A 5LIKX 1XGEA 2GGIA 4NKMB 3L67A 4AYFB 1T20B 2EGZA 1OAUL 4O11A 3SCQA 2BIIA 3L4VA 1BQHG 1TO3A 4M7ZC 3OMAB 1X7IA 3VW3L 4ACZB 5HGBA 3VKDA 4X9IA 1A2YA 5D1QE 3LNMA 5CP3A 3BH4A 1KD0A 3ULUD 2H8XA 2WZPD 2B0SH 1MIEL 5HHMD 4PUWA 2XZQH 3QQNA 1NBVL 4R3UA 3EOOA 3WLKX 3MNDA 5B38B 4J3UA 5LQBH 4W4OC 4G43B 4H0IA 3VOHA 3G5YB 1E50A 1W3IA 4PAZA 3FV9A 4ONOA 1QT1A 4P4KB 3ATFA 2ZONA 2ZKYA 1MI5E 4CMMA 4R84A 3S37L 4HIIA 1F60A 4JPGA 4GVHA 3LSCA 3QOKA 2GBAA 4KITB 4X6CF 4IMDA 4X0NA 5JORB 1QSEB 3K91A 4H1LG 3I55B 4H25B 1C16B 3GGWA 4N2MA 2FO1A 1VQMB 2E9LA 2PCPB 5GS0C 5E09A 1IC5H 1E9PA 5D7IF 3RWEA 4QHPA 3HN3A 5DK0B 2OL3B 2CKBB 3PTKA 3V8CA 3UH8A 3TQ0A 1J01A 3PJLA 4C90A 4P46C 1G6RB 5K39A 2ICWB 4M7KH 1A5NC 1F58H 3SE8L 5J5EA 3UWZA 4P8WA 3OW7A 1XLEA 3DOHA 3ES9A 4I0PD 3HE6C 2YSSA 4EZLA 5C0QA 3QIWA 4Z1AA 4OCWH 5D7JB 1ZK5A 4P2RD 4N0YL 5A8AA 2EPOA 1HWGB 5AB0A 3AMCA 4IRJA 4JCLA 4PJBB 2H41A 1AP2A 1Y6MR 1NFPA 1RJRA 2EJ1A 4TMCA 1CGSH 4UV4L 3N40F 4PRIA 2QYGA 3OFNA 2E09A 1U1HA 4P9SA 1KLGA 3CZEA 1EJTC 4KCVA 2Y36L 3AMKA 5GV8A 2HLDA 3MTXA 2NQDA 3A67H 1UWGL 3GXNA 4BFGA 4RPQA 3B78A 5C55A 1G7TA 3C9NA 3LHTA 3VWJA 4LYRA 4G1KA 1D7BA 4CD8A 5IBXC 2QGCA 3U4AA 1J8KA 4G7SB 1UM4H 1H5BC 4MCYB 3V5DA 3GJEB 5JPMA 4HFUH 2FYMA 5DK3A 5F1NA 1ECEA 5KYNA 2XYCA 1FNSL 4MYWB 1MCRA 4Z7NF 5CBAA 1E51A 3DEQA 1N5AB 3KPQB 4XV0A 1OABA 1ONXA 4NNJA 1M7UA 4OCNC 3EH3B 2DEPA 1JAEA 1IIKA 2VDMH 4QF1B 4TQ8A 2ZYIA 1EEYB 5T8GA 4TMTA 1BQLL 3ZDZF 4Q7JB 2YAEA 3UWYA 1DIKA 4B5VA 4XIAA 3FO0L 3DHJA 5MHSD 1BQSA 2NY4C 1V7AA 1J0JA 3OKKA 4PRHA 5JR1L 4M61A 4DNHA 2PR9A 3E5PA 3V3WA 1CLCA 1J5TA 2YRLA 1TCRA 1K9FA 4L9LC 3ICJA 4BHUA 4OHQA 1XLCA 1HCYA 4DT2A 1JTOA 3VDHA 3FJNA 2W6JA 4WKHA 2D73A 3ATYA 2BP0B 2GUYA 4KZDL 4Y1AD 4LNYA 3M0JA 4OSUL 3SKNA 1UC5A 2DWYA 5FAGA 4YXLH 3ZHNA 3UNDA 3GSVB 1J2BA 2WIMA 3M1BA 1T1YA 2NY3C 1VRDA 5HKKA 3T65A 5ABFB 4DJEC 1HK6A 1YCSA 4WTZA 5ADOL 3TE9A 3BFWA 1OCNA 1U8NA 3TJHC 3CLEL 5D09A 4R0LB 5C9KA 3UYRH 4UOW0 1EEXA 1OK6A 4Y2WA 2J4GA 1F6KA 4WKFA 2ENQA 1UXLA 3IJYB 1I8MB 1QOQA 5B1JC 4JDEA 1L2UA 3DYOA 4PJCA 2G95A 3NXFA 3M0IA 1AQ0A 4QIRA 1DE5A 1WCBB 3TO4A 3RU6A 2FBOJ 1V0EA 4GAAA 1MUWA 4B96A 1S2UA 2FFCA 3KGTA 5F2FA 3O63A 4QUOA 3BZEB 1UYQA 2B31A 2HS8A 2QJIA 3AW5A 2MNWA 2C13A 4APXB 4PW3A 3ABLB 3CFEB 3DV4B 2VM8A 4N5UA 2DQTL 5ITFA 2EDLA 3BIKB 4OGXL 3H2AA 2OZ3A 2GSGB 4HJWA 1KXQA 5CZVH 3OG6B 1R24A 4IF2A 4MYPA 5DEZA 1YDOA 2BNQD