3BCKA

Crystal structure of staphylococcus aureus dsba t153v
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
164
structure length
164
Chain Sequence
GKPLVVVYGDYKCPYCKELDEKVMPKLRKNYIDNHKVEYQFVNLAFLGKDSIVGSRASHAVLMYAPKSFLDFQKQLFAAQQDENKEWLTKELLDKHIKQLHLDKETENKIIKDYKTKDSKSWKAAEKDKKIAKDNHIKTVPTAFINGEKVEDPYDYESYEKLLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Disulfide bond protein A
publication title Staphylococcus aureus DsbA Does Not Have a Destabilizing Disulfide: A NEW PARADIGM FOR BACTERIAL OXIDATIVE FOLDING
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Oxidoreductase
total genus 58
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2007-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3bckA00
2FCHA 3VPQA 2IMIA 1MDJA 1ERWA 1MDIA 3IAM2 1G6WA 3GX8A 4ZBDA 1ACVA 3HVXA 3I6AA 5IIZA 4MLYA 1VGLA 1WRYA 2YV7A 1CQHA 2H1AA 2XBIA 3UBKA 2DBCA 3CRTA 5ECQB 4O7HA 3VI5A 4L0UA 3ZREA 3APSA 3DVXA 4K0GA 1UVZA 5ID2A 2FWFA 3MSZA 5GSTA 3U5RE 3GSTA 1RQMA 1EV9A 3IBHA 1X9SB 3RPPA 4IP6A 1T4ZA 2CZ2A 1TK0B 1PX7A 2YJ7A 3GURA 3U6VA 3IV4A 2VD1A 2NBSA 2BJXA 1OC9A 3GKXA 2FA4A 5DVBA 2DJ2A 3FK8A 3TRQA 4WETA 3VFIA 1K3OA 4ECCA 4OD7A 3UMAA 4HU7A 4RQXA 4XCSA 2L6DA 4ZB6A 2HE3A 4HQSA 2VL2A 4GWRA 2GLRA 2IMKA 2REMA 1XWBA 3LYKA 4KA0A 2DJ3A 5ELGA 3GRXA 2GZZA 2YZHA 1B8XA 1M9BA 3IR4A 5JCWA 1SD8A 3IDVA 5AISA 4BVYA 1GRXA 4GCIA 1THXA 3C1SA 5F05A 3FHKA 2GT6A 4IN0A 1FO5A 2FWEA 2GQLA 4L0WA 1M7TA 2LNSA 2A2RA 2CA8A 2CVDA 2CX3A 1ZYQB 3GKKA 5EL8A 5ENUA 3PGTA 1PL1A 1YDKA 2V32A 2YNXA 3P7XA 3HDCA 1ST9A 1X5EA 1EOGA 2JZSA 4POKA 1GSEA 3KD0A 5CRGA 1I5GA 4EUYA 3TJKA 1AQXA 4IVFA 3O76A 2YWIA 2JSZA 1C72A 3LQ7A 1WOUA 4CDOA 1AQWA 1SYRA 5ECPB 1OKDA 3KP9A 4J56E 2VCVA 3W8JA 1N2AA 2X8HA 4TVEA 1Z6NA 4FYUA 1F37A 3TB2A 1GNWA 1K0DA 1K0OA 1TU7A 5L71A 2PERA 1XCCA 6GSVA 19GSA 1SJZA 1GUHA 2YJHA 3Q18A 1YY7A 5HR2A 1GULA 4JR6A 3ZFLA 1GTIA 4FH8A 1GTUA 1WPIA 4CHSA 5ID2B 3UEMA 2V6KA 4IW9A 2C3QA 5ABRA 2YV9A 2FY6A 2OE1A 2QGVA 1ML6A 1USBA 3VWVA 1XBSA 5DAKA 2AV4A 3TKSE 2F51A 1GSFA 3BJ5A 2FGXA 1UN2A 1OC9B 5HFGA 17GSA 4X0XA 5LCZA 1WP0A 3L9VA 4OFTA 2YZUA 4IJIA 2O85A 4NAXA 5IOXA 3SBCA 4JBBA 5B6MA 1K0MA 5GSSA 2Z9SA 3L9SA 3BOAA 3LWAA 1JLVA 3RHCA 4K7NA 1ZMAA 5G31A 4X1UA 3DGQA 4DSSA 3LEFA 1WWJA 1XVWA 1YF1A 4K9ZA 3E0UA 1S3CA 3ME7A 2YN1A 4ECIA 2B3SA 1OKTA 4EO3A 1AC1A 2G2QA 3ZMLA 5CRHA 2DC5A 5IMZA 4MF5A 2O8VB 3A2WA 3P2AA 1M0UA 1OVNA 2H6ZA 2P31A 4KW6A 3FEUA 3LYPA 1ZL9A 3ZTLA 2HRNA 2DMMA 4RUVA 2F8FA 4V1Ap 3D5JA 5HR1A 5JWRB 2YCDA 1QUWA 5A4VA 1DUGA 2LTKA 3TKQA 1EZKA 1EV4A 4K0NA 2JACA 1T4YA 3Q6OA 5F07A 4YAPA 2J9HA 1GUMA 2X8CA 2XC2A 22GSA 4K8MA 4HZ4A 1ZZYA 3KH7A 2X99A 4L8EA 1YEPA 4NPBA 3CSJA 4JEDA 5G5FA 1V58A 3H4KA 1JZOA 3DRNA 5A4WA 3F0IA 2LRTA 2K9FA 4EE0A 2AHEA 5KN2A 3CSHA 1V98A 5H5SA 1X0RA 1XWGA 2I3YA 1SKSB 3VWXA 2C0DA 4E8HA 2GDRA 3J7Yk 1FAAA 3MDKA 3GSSA 2XPDA 2LRCA 1PKZA 4GF0A 3IRAA 3S9FA 2H1DA 1O81A 4E8EA 3G7JA 2WDUA 4BA7A 2HYXA 5DAKB 9GSSA 4N30A 4XIHA 2KP2A 1PD21 3CBUA 3ED3A 2C8UA 2FD3A 1XOBA 2HZFA 4EC0A 1PQNA 3TJBA 1TRUA 2ALBA 2JADA 2MMOA 2N5BA 5G2ZA 1TI3A 2RIIA 4WR5A 3CYNA 4RI6A 1ABAA 1BEDA 4TOPA 5CNWA 3DMLA 4DSSB 2CV4A 2H72A 2JSYA 4WF5A 2KUCA 2OJLA 4GRFA 3ZVJA 4LMVA 4ML1A 2V41A 2NDOA 1XOAA 1R5AA 1TRWA 2IFQA 2QC7A 1PKWA 1OC3A 3EVIA 2H30A 1WE0A 4GSSA 1AUCA 4PQIA 1V9WA 5D9XA 1YJ6A 3MNGA 3GYKA 1GL8A 5D9TA 5JWQB 5B8AA 1GSSA 2BTOT 3RBTA 3CTGA 2YWNA 1MEKA 3GIXA 4TRXA 3A2VA 3ZITA 1GSUA 3UBLA 3SWLA 3TDGA 3F6DA 2TIRA 3TUEA 2OA7A 5D93A 5DDLA 3MAKA 4ZL9A 1GWCA 1R7HA 1KTEA 3TKSC 2MBSA 5D9WA 4KSMA 3EWLA 2F3MA 3LSZA 5HFKA 4NV2A 2IMEA 4HOJA 4ZL7A 2FWHA 2ES7A 2HZEA 1K0NA 1LJRA 3DVWA 4V2MA 2H75A 16GSA 1SU9A 3P8WA 1M2DA 3C7MA 3TKRA 4O92A 1PSQA 2EC4A 1JLWA 2H66A 14GSA 4OFMA 1GNEA 1TRVA 4MJAA 2IL3A 2DMLA 2H0IA 3GKNA 4IQAA 5JWOB 1UC7A 3TOUA 5ECHB 1A8YA 1HYUA 1SK0A 3VK9A 4IKHA 4YQVA 10GSA 3I43A 2VLTA 2H71A 1A23A 1Z7PA 4ILFA 1FB6A 3RPNA 3ZVJD 1H4OA 2DIYA 3G7IA 4IQ1A 2LSTA 1FG4A 3GH6A 5D9VA 1XW6A 3C71A 1SK2A 2L59A 8GSSA 2G0FA 3LGCA 1NSWA 3ZRDA 4HJ2A 5KN1A 1TK8B 1T1VA 2DJ1A 5AGYA 4PNFA 4G2EA 1YKCA 2DSAA 1EEMA 2R37A 4KCAA 2VM1A 3C1RA 4MJBA 3EU3A 1OE8A 3IHQA 2DIZA 1RW1A 5IMAA 1XXUA 3HZ8A 2GVPA 3HYPA 2RM5A 3LJRA 2C3NA 2IFQB 2A2SA 1X5CA 4EDZA 2LV3A 5H5QA 4EVMA 3QPMA 3EE2A 4KDYA 4EL1A 1SD9A 3V1WA 3C73A 5CO3A 2CX4A 1GLQA 3KCMA 3KTBA 3VPTA 3KMNA 3F4RA 2JL4A 2E0QA 1B48A 1PX6A 4ISDA 3EURA 4DVCA 4XRDA 3ZZXA 2IPAA 2JZRA 1XWAA 4V2NA 1QMVA 4HEA2 2C80A 3IXRA 3HY2A 3IA1A 3TJJA 3M0FA 1A2JA 4EXJA 2ON5A 4KUNA 1B9YC 1O8XA 2PVOC 2X8GA 4D73A 3HJOA 3GH9A 3HHVA 2XBQA 1UA5A 2HZEB 1AAZA 5JCUA 2GS3A 3M9JA 2DLXA 2LNTA 4PX1A 3KM6A 1Z5YE 2MBTA 3R2QA 3P90A 4CW9A 1EGRA 4JE1A 5G1LA 2V1MA 2VCTA 4H86A 2RUFA 2PMTA 2M72A 2GZYA 1B4QA 3KIJA 3KP8A 3HCZA 1B4PA 2C3TA 2NVLA 4GLTA 3KTLA 11GSA 4BWQA 3UVHA 3Q74A 1EEJA 1EGOA 4ECBA 4BWSA 5FHIA 5IMDA 1X9MB 4AGSA 5GAND 1TRSA 1Z3EA 2K8SA 2L5LA 3F4TA 2PUKC 1F3AA 5CP1A 1AQVA 1Z9HA 4Q5QA 5FWGA 5IM9A 4GSNA 1SYXA 6GSWA 4QQ7A 1SK1A 4NHZA 1TK5B 3O3TA 2LQOA 3J7Yb 3MWHA 1V2AA 3QD9A 5JCGA 1OE7A 1K0BA 5DQSA 3HXSA 1THOA 2K8VA 1QGVA 3TGZA 1GSQA 1LBKA 2X64A 2H6YA 5HFIA 1PRXA 2H1BA 2CQ9A 4LA1A 3H79A 1TDIA 1M2AA 5IQYA 3EC3A 5IMVA 3ZIVA 5G30A 2HSYA 1XVQA 2RUEA 2I9HA 2FA8A 2N5FA 3JCML 4ZB9A 3QFBC 3DYRA 4KDUA 2L4QA 3A2XA 4D73B 2B6MA 3UL3A 3M8NA 4GQCA 3ZIJA 4AJ7A 3LORA 1GH2A 5ELAA 3ZFBA 2R4VA 2VAFA 4KDXA 4MH2A 3GTUA 1EOHA 2TRXA 2H0GA 4XS1A 2HXKA 2R5GA 2DJJA 2FWGA 5F06A 3APOA 1R4WA 2YANA 4WEYA 2HRFA 1KNGA 3D4MA 3F8UA 4NV5A 2L5OA 4OWYA 4ULXA 2JU5A 2F8AA 2WS2A 1Y6EA 5F8BA 4LL4B 4JR4A 1PL2A 4FO5A 3TRXA 1F3BA 3GKMA 1S3AA 4V2LA 1A2MA 4IGJA 1QQ2A 3F4SA 4NWYA 2R2JA 1R26A 2HT9A 1J08A 3UJ1A 1JFUA 3QFAC 5CRWA 2VL3A 2KLXA 5D73A 1FOVA 1TP9A 5CAXA 5AIVA 4MJCA 2H6XA 5D8IA 3KMOA 5DCHA 4DSRA 4JU5A 1TJDA 2MZCA 1Z7RA 2WRTA 2B7KA 1SL2B 2J23A 2FNOA 1HNAA 5FT3A 3WGXA 1ON4A 4OFNA 2H76A 3H1NA 1K3YA 6GSTA 4O5RA 20GSA 2P5QA 3L9UA 1DBYA 2H73A 3HZ4A 1U87A 3KJYA 4OO5A 2AJQB 3NIVA 1XWCA 4Z7XA 2FHEA 2WJUA 5EVOA 3KGKA 3BCKA 4MF6A 2B5EA 2EIQA 2P0GA 1LU4A 3IC4A 5A4UA 3ZL5A 4TXOA 4F0BA 2C1YA 1YQ1A 1TU8A 2VD0A 1QFNA 3EMXA 4AJ8A 5J3RA 5HR0A 3AY8A 2MMNA 1HNCA 2PU9C 3WYWA 2VCQA 4ZB8A 2M80A 1M2BA 1U6TA 1K3LA 2C4JA 3EINA 2KHPA 2XPEA 4ZL8A 1BG5A 1FVJA 1A2LA 4POMA 1ERVA 1GLPA 1YEXA 4Q5RA 5J4UA 1F9MA 5ECSA 1ERTA 2HFDA 3TCOA 4PUAA 4G10A 3EU4A 4TKYA 3TRPA 1XPVA 4PUFC 3H93A 3GTUB 5ECRB 4BPYA 3K8NA 1MTCA 4K2DA 2CZ3A 2JZTA 2OACA 4LLRA 3KZQA 4OCEA 2B5YA 4KAEA 1XIYA 5CRDA 3QR6A 2DJ0A 3HVSA 5ECNB 1X9WB 3D0ZA 5AIXA 4XS4A 3W6GA 1BQ7A 4AF2A 3L4NA 4RI7A 4MJEA 2I81A 1WMJA 5CREA 1JZDA 5E59A 3A5WA 4N0ZA 2CAQA 5J9BA 3US3A 4AJ6A 5GAPD 3IAS2 4HI7A 1W89A 4WKWA 2C0EA 4KGIA 4PGTA 1U88A 3ZYWA 1VF1A 2CVKA 4KSOA 3ZLPA 2O89A 4MK3A 2YWMA 3FZ5A 4G9HA 2PBJA 2EIRA 3WGDA 1ILOA 4YAVA 3OR5A 3FR6A 1T8EB 1YKAA 1KBNA 4XTSA 2VM2A 3HD5A 1URMA 1XFLA 3M9KA 3FZAA 2PWJA 4POBA 2VL9A 5LD0A 1Q4JA 4KNDA 4F0CA 3PR8A 1DE2A 4BL7A 2M46A 3LXZA 5ECIB 2O7KA 3WT1A 2VL2C 4TR1A 1Q98A 4TW5A 2GSTA 4O32A 2WZ9A 3ME8A 1O7UA 1PMTA 2HLSA 2YP6A 3WD6A 6GSSA 4TXOB 1AW9A 1J9BA 4NMUA 3FY7A 1JZWA 2V2GA 3DIEA 4TN8A 4MABA 5ECOB 4G19A 3TOTA 4ACSA 1SKRB 3G9BA 1T00A 5IO2A 2VCXA 4MF7A 2C0GA 4K6XA 1HQOA 3RAZA 5LNKe 2AB6A 4L5OA 2O87A 6GSUA 2VCZA 4ZILA 1HD2A 3GL3A 4GSTA 3G7YA 3GHAA 1T7PB 1BX9A 2OKAA 4QL9A 5CYYA 5IMCA 4PNGA 2LJAA 2XHFA 3QAVA 4PURA 1DE1A 4GXZA 1I9DA 3TKSA 1W4VA 2GT5A 5IO0A 4EF0A 5J9CA 5KEJA 2OE3A 5DJMA 4XS4B 3NOFA 4TXVA 1U3IA 2BMXA 2YPMA 1Z6MA 3IK7A 4N0VA 2VLUA 3W8SA 4LMWA 4EKZA 2DJKA 2YOIA 5ECLB 3GA4A 2D2ZA 2B5XA 2L4CA 3EYTA 5INYA 3F3RA 3CMIA 2R6KA 3GX0A 4WBJA 4IBPA 2E2MA 3IE3A 3WT2A 1VRSD 4Q5FA 1Y25A 3FZ4A 4IHUA 5DJLA 2IMFA 1S3DA 4HUAA 4I8BA 3L0HA 2OBKA 2H0HA 1G7EA 1QXHA 1V40A 1J0FA 2A4VA 5C04A 1FB0A 5EY6A 4FYBA 3APQA 2IMDA 3QAGA 1SENA 3QDNA 4GTUA 2H19A 1HNBA 3WGEA 3ERFA 2GSQA 4HU9A 1H75A 4WXTA 4PXOA 1ZCPA 2N5AA 1K0AA 3LXTA 4TR1B 2H74A 2LS5A 3HJMA 2FUG2 3E3EA 1SJIA 4WR4A 2ZNMA 5E4WA 1X5DA 1GTAA 3GV1A 5DQYA 1TTZA 3NZNA 4WF4A 1O85A 2MYGA 3RHBA 5DBQA 3N5OA 4I6XA 2I1UA 4XS6A 2WB9A 2NTOA 4IP1A 4MPFA 4TR0A 3F9UA 4KE3A 3GN3A 1TI1A 4XRAA 3UIWA 4WBRD 3CTFA 1GSDA 2R3XA 1ZOFA 2PN8A 2LJRA 5F0GA 2EIOA 3F6FA 2YWOA 6GSYA 5J41A 1G0TA 1AXDA 3VLNA 2OADA 1K0CA 4IS0A 1DSBA 2FLSA 2VO4A 2H1GA 3CXGA 18GSA 5J5NA 3QAWA 1O6JA 3Q19A 4GQFA 1R5PA 4J57E 2GQKA 2CT6A 3UAPA 1M99A 4FYCA 4HZ2A 1TW9A 3VURA 4KCEA 4V1Ag 3RDWA 3A3TA 1GP1A 4NHWA 2PVQA 2B1LA 12GSA 2LQQA 2VOCA 4MZBA 2V6OA 3M1GA 1SL1B 5IMFA 2LJKA 1PN9A 2C0FA 3O6TA 3GUSA 1NHYA 4I5QA 1EWXA 2WGRA 3KEBA 1XW5A 2AYTA 3ISOA 2MMAA 1SL0B 3E9JB 4MA9A 2PGTA 1GUKA 1A8LA 2NPBA 5IOWA 4ML6A 3L78A 3TKPA 2AUVA 1NM3A 1U3AA 1GSYA 4ZBAA 4IELA 3ERWA 1RK4A 5AN1A 3I69A 3LFLA 2TRCP 2GSSA 2KOKA 3N9JA 3KXOA 4HS1A 2F9SA 1OC8A 2K6VA 3TJFA 1E2YA 4OMVA 3GMFA 2GZPA 2KP1A 5D96A 2VCWA 3IPZA 1MDKA 3IOSA 3UARA 1CQGA 2IN3A 2AAWA 2L6CA 4MDCA 4I2UA 1FHEA 1BJXA 1WIKA 4K7OA 4MP4A 5KN0A 5B8BA 2P5RA 3UVTA 5C00A 5G1KA 3TJGA 4OO4A 2B7JA 3PH9A 2RM6A 4HQZA 4QL7A 2B1KA 6GSXA 3QMXA 4LL1B 2ZUPA 3LG6A 3PINA 5A5KA 2LUSA 3D6IA 5DCGA 3H8QA 2GQMA 4K1FA 4HDEA 4HJMA 4XHMA 3C8EA 4J2FA 2CVBA 3HA9A 2H8LA 4MPGA 4JZQA 4MZCA 5H5RA 1E6BA 4RQRA 2OE0A 1JHBA 3KH9A 3GNJA 3BCIA 1JZRA 1IYHA 4YQUA 1AIUA 1ERUA 3DXBA 4ID0A 3FR9A 1BAYA 1XZOA 5DALA 3VI7A 1NHOA 5IPGA 1B9XC 1ZGNA 3F3QA 5GZZB 5G5EA 1QK8A 1WJKA 2VIMA 4F03A 1O73A 1NW2A 2E7PA 2IJYA 3QCPA 3FW2A 5B6NA 3F63A 2E2GA 4ZIJA 3FZ9A 1T3BA 2HI7A 1A24A 1VF2A 4KH7A 3FYGA 3VWUA 4KB3A 1O8WA 2L57A 1MD3A 2OBIA 7GSSA 1VF4A 4N11A 2HNLA 1EP8A 3ZMKA 4BVXA 4YH2A 2MMZA 5EPFA 2WFCA 3FRCA 1V57A 2K18A 4JRRA 5ECMB 4MCUA 1G7OA 1ZYEA 3FKFA 2WCIA 3DEXA 2VLVA 1A0RP 4YQMA 4MMMA 4ZBBA 1SKWB 1TOFA 1F6MC 1IYIA 2H70A 3CRUA 2LRNA 4FIWA 1PGTA 2LEGA 4IJ3A 3BBYA 4K7IA 3IK9A 1M9AA 4PQHA 5B7CA 3QOUA 3M3MA 3FR3A 1SJ6A 5KN3A 1YZXA 2H01A 2LKUA 1OYJA 3ERGA 4NXIA 4DEJA 1XWKA 1TXXA 2VUPA 5HQPA 4POLA 4MZWA 4F9ZA 2IIYA 3D4TA 4MH3A 1TKDB 1YF0A 2WULA 3GL5A 4N10A 2RLIA 3DD3A 3I9V2 4I97A 2GTUA 3DWVA 1FW1A 2IWTA 2QSIA 1MD4A 4P3YB 4Q5NA 4ECJA 1F2EA 5ECKB 3HJPA 2GGTA 4I2TA 4TR4A 1VF3A 3EMPA 2GSRA 13GSA 1GTBA 1FVKA 4TR3A 3BD2A 2ON7A 4L5LA 2CAIA 4F82A 4F2IA 3UOMA 4PQ1A 2ZCTA 1A0FA 4KX4A 3HVVA 5IPHA 2PPTA 3HKRA 1XW9A 3GFKA 3D21A 1BYEA 4X43A 1G6YA 5COHA 1OAZA 4OCFA 3VWWA 1PA3A 5HR3A 1EP7A 5DALB 4EDYA 3D22A 1N8JA 1KEBA 2HSHA 3DKSA 2I4AA 4ZXGA 4DSQA 2QKEA 3CSIA
chains in the Genus database with same CATH superfamily
2FCHA 3VPQA 2IMIA 1MDJA 1ERWA 1MDIA 3IAM2 1G6WA 3GX8A 4ZBDA 1ACVA 3HVXA 3I6AA 4BVXB 5IIZA 4MLYA 1VGLA 1WRYA 2YV7A 1CQHA 2H1AA 2XBIA 3UBKA 2DBCA 3CRTA 5ECQB 4O7HA 3VI5A 4L0UA 3ZREA 3APSA 3DVXA 4K0GA 1UVZA 5ID2A 2FWFA 3MSZA 5GSTA 3U5RE 3GSTA 1RQMA 1EV9A 3IBHA 1X9SB 3RPPA 4IP6A 1T4ZA 2CZ2A 1ZYNA 1TK0B 4EIQA 1PX7A 2YJ7A 3GURA 3U6VA 3IV4A 2VD1A 2NBSA 2BJXA 1OC9A 3FMWA 3GKXA 2FA4A 5DVBA 2DJ2A 3FK8A 3TRQA 4WETA 3VFIA 1K3OA 4ECCA 4OD7A 3UMAA 4HU7A 4RQXA 4XCSA 2L6DA 4ZB6A 2HE3A 4HQSA 2VL2A 4GWRA 1XG8A 2GLRA 2IMKA 2REMA 1XWBA 3LYKA 4KA0A 2DJ3A 5ELGA 3GRXA 2GZZA 2YZHA 1B8XA 1M9BA 3IR4A 5JCWA 1SD8A 3IDVA 5AISA 4BVYA 1GRXA 4GCIA 1THXA 3C1SA 5F05A 3FHKA 2GT6A 4IN0A 1FO5A 2FWEA 2GQLA 4L0WA 2UZ8A 1M7TA 2LNSA 2A2RA 2CA8A 2CVDA 2CX3A 1ZYQB 3GKKA 5EL8A 5ENUA 3PGTA 1PL1A 1YDKA 2V32A 4Z2TA 2YNXA 3P7XA 3HDCA 1ST9A 1X5EA 1EOGA 2JZSA 4POKA 1GSEA 3KD0A 5CRGA 1I5GA 4EUYA 2QA1A 3TJKA 1AQXA 4IVFA 3O76A 2QA2A 3HVNA 2YWIA 2JSZA 1C72A 3LQ7A 1WOUA 4CDOA 1AQWA 1SYRA 4O5QA 5ECPB 1OKDA 3KP9A 4J56E 2VCVA 3W8JA 1N2AA 2X8HA 4TVEA 1Z6NA 4FYUA 1F37A 3TB2A 1GNWA 1K0DA 1K0OA 1TU7A 5L71A 2PERA 1XCCA 6GSVA 19GSA 1SJZA 1GUHA 2YJHA 3Q18A 1YY7A 5HR2A 1GULA 4JR6A 3ZFLA 1GTIA 4FH8A 1GTUA 1WPIA 4CHSA 5ID2B 3UEMA 2V6KA 4IW9A 2C3QA 5ABRA 2YV9A 2FY6A 2OE1A 4HSCX 2QGVA 1ML6A 1USBA 3VWVA 1XBSA 5DAKA 2AV4A 3TKSE 2F51A 4X4JA 1GSFA 3BJ5A 2FGXA 1UN2A 1OC9B 5HFGA 17GSA 4X0XA 5LCZA 1WP0A 3L9VA 4YKFA 4OFTA 2YZUA 4IJIA 2O85A 4NAXA 5IOXA 3SBCA 4JBBA 5B6MA 1K0MA 5GSSA 2Z9SA 2R0GA 3L9SA 3BOAA 3LWAA 1JLVA 3RHCA 4K7NA 1ZMAA 5G31A 4X1UA 3DGQA 4DSSA 3LEFA 1WWJA 3LW9A 1XVWA 1YF1A 4K9ZA 3E0UA 1S3CA 3ME7A 2YN1A 4ECIA 2B3SA 4BVYB 1OKTA 4EO3A 1AC1A 2G2QA 3ZMLA 5CRHA 2DC5A 5IMZA 4MF5A 1M3IA 2O8VB 4O5UA 3A2WA 3P2AA 1M0UA 1OVNA 2H6ZA 2P31A 4KW6A 3FEUA 3LYPA 1ZL9A 3ZTLA 2HRNA 2DMMA 4RUVA 2F8FA 4V1Ap 3D5JA 5HR1A 5JWRB 2YCDA 1QUWA 5A4VA 1DUGA 2LTKA 3TKQA 1EZKA 1EV4A 4K0NA 2JACA 1T4YA 3Q6OA 5F07A 4YAPA 2J9HA 1GUMA 2X8CA 2XC2A 22GSA 4K8MA 4HZ4A 1ZZYA 3KH7A 2X99A 4L8EA 1YEPA 4NPBA 3CSJA 4JEDA 5G5FA 1V58A 3H4KA 1JZOA 4CY6A 3DRNA 5A4WA 3F0IA 2LRTA 2K9FA 4EE0A 2AHEA 5KN2A 3CSHA 1V98A 5H5SA 1X0RA 1XWGA 2I3YA 1SKSB 3VWXA 2C0DA 4E8HA 2GDRA 3J7Yk 1FAAA 3MDKA 3GSSA 2XPDA 2LRCA 1PKZA 4GF0A 3IRAA 3S9FA 2H1DA 1O81A 4E8EA 3G7JA 2R0CA 2WDUA 4BA7A 2HYXA 5DAKB 9GSSA 4N30A 4XIHA 2KP2A 1PD21 3CBUA 3ED3A 2C8UA 2FD3A 1XOBA 2HZFA 4EC0A 1PQNA 3TJBA 1TRUA 4YKGA 2ALBA 2JADA 2MMOA 2N5BA 5G2ZA 1TI3A 2RIIA 4WR5A 3CYNA 4RI6A 1ABAA 1BEDA 4TOPA 5CNWA 3DMLA 4DSSB 2CV4A 2H72A 2JSYA 4WF5A 2KUCA 2OJLA 4GRFA 3ZVJA 4LMVA 4ML1A 2V41A 2NDOA 1XOAA 1R5AA 1TRWA 2IFQA 2QC7A 1PKWA 1OC3A 4ICYA 3EVIA 2H30A 1WE0A 4GSSA 1AUCA 4PQIA 1V9WA 5D9XA 1YJ6A 3MNGA 3GYKA 1GL8A 5D9TA 5JWQB 5B8AA 1GSSA 2BTOT 3RBTA 3CTGA 2YWNA 1MEKA 2HRKA 3GIXA 4TRXA 3A2VA 3ZITA 1GSUA 3UBLA 3SWLA 3TDGA 3F6DA 2TIRA 3TUEA 2OA7A 5D93A 5DDLA 3MAKA 4ZL9A 1GWCA 1R7HA 1KTEA 3TKSC 2MBSA 5D9WA 4KSMA 3EWLA 2F3MA 3LSZA 5HFKA 4NV2A 2IMEA 4HOJA 4ZL7A 4G0IA 2FWHA 2ES7A 2HZEA 1K0NA 1LJRA 3DVWA 4V2MA 2H75A 16GSA 1SU9A 3P8WA 1M2DA 3C7MA 3TKRA 4O92A 1PSQA 2EC4A 1JLWA 2H66A 14GSA 4OFMA 1GNEA 1TRVA 4MJAA 2IL3A 2DMLA 2H0IA 3GKNA 4IQAA 5JWOB 1UC7A 3TOUA 5ECHB 1A8YA 1HYUA 1SK0A 3VK9A 4IKHA 4YQVA 10GSA 3I43A 2VLTA 2H71A 1A23A 1Z7PA 4ILFA 1FB6A 3RPNA 3ZVJD 1H4OA 2DIYA 3G7IA 4IQ1A 2LSTA 1FG4A 3GH6A 5D9VA 1XW6A 3C71A 1SK2A 2L59A 8GSSA 2G0FA 3LGCA 1NSWA 3ZRDA 4HJ2A 5KN1A 1TK8B 1T1VA 2DJ1A 5AGYA 4PNFA 4G2EA 1YKCA 2DSAA 1EEMA 2R37A 4KCAA 2VM1A 3C1RA 4MJBA 3EU3A 1OE8A 3IHQA 2DIZA 1RW1A 5IMAA 1XXUA 3HZ8A 2GVPA 3HYPA 2RM5A 4K5SA 3LJRA 2C3NA 2IFQB 2A2SA 1X5CA 4EDZA 2LV3A 5H5QA 4EVMA 3QPMA 3EE2A 4KDYA 4EL1A 1SD9A 3V1WA 3C73A 5CO3A 2CX4A 1GLQA 3KCMA 3KTBA 3VPTA 3KMNA 3F4RA 2JL4A 2E0QA 1B48A 1PX6A 4ISDA 3EURA 4DVCA 2X49A 4XRDA 3ZZXA 2IPAA 2JZRA 1XWAA 4V2NA 1QMVA 4HEA2 2C80A 3IXRA 3HY2A 3IA1A 3TJJA 3M0FA 1A2JA 4EXJA 2ON5A 4KUNA 1B9YC 1O8XA 2PVOC 2X8GA 4D73A 3HJOA 3GH9A 3HHVA 2XBQA 4EIPA 1UA5A 2HZEB 1AAZA 5JCUA 2GS3A 3M9JA 2DLXA 2LNTA 4PX1A 3KM6A 1Z5YE 2MBTA 3R2QA 3P90A 4CW9A 1EGRA 4JE1A 5G1LA 2V1MA 2VCTA 2X4AA 4H86A 2RUFA 2PMTA 2M72A 2GZYA 1B4QA 3KIJA 3KP8A 3HCZA 1B4PA 2C3TA 2NVLA 4GLTA 2A2PA 3KTLA 11GSA 4BWQA 3UVHA 3Q74A 1EEJA 1EGOA 4ECBA 4BWSA 5FHIA 5IMDA 1X9MB 4AGSA 5GAND 1TRSA 1Z3EA 2K8SA 2L5LA 3F4TA 2PUKC 1F3AA 5CP1A 1AQVA 1Z9HA 4Q5QA 4Z2UA 5FWGA 5IM9A 4GSNA 1SYXA 6GSWA 4QQ7A 1SK1A 4NHZA 1TK5B 3O3TA 2LQOA 3J7Yb 3MWHA 1V2AA 3QD9A 5JCGA 1OE7A 1K0BA 5DQSA 3HXSA 1THOA 2K8VA 1QGVA 3TGZA 1GSQA 1LBKA 2X64A 2H6YA 5HFIA 1PRXA 2H1BA 2CQ9A 4LA1A 3H79A 1TDIA 1M2AA 5IQYA 3EC3A 5IMVA 5KOXA 3ZIVA 5G30A 2HSYA 5BMUA 1XVQA 2RUEA 4G0LA 2I9HA 2FA8A 2N5FA 3JCML 4ZB9A 3QFBC 3DYRA 4KDUA 2L4QA 3A2XA 4D73B 2B6MA 3UL3A 3M8NA 4GQCA 3ZIJA 4AJ7A 3LORA 1GH2A 5ELAA 3ZFBA 2R4VA 2VAFA 4KDXA 4MH2A 3GTUA 1EOHA 2TRXA 2H0GA 4XS1A 2HXKA 2R5GA 2DJJA 2FWGA 4PTSA 5F06A 3APOA 1R4WA 2YANA 4WEYA 2HRFA 1KNGA 3D4MA 3F8UA 4NV5A 2L5OA 4OWYA 4ULXA 2JU5A 2F8AA 2WS2A 1Y6EA 5F8BA 4LL4B 4JR4A 1PL2A 4FO5A 3TRXA 1F3BA 3GKMA 1S3AA 4V2LA 1A2MA 4IGJA 1QQ2A 3F4SA 4G0KA 4NWYA 2R2JA 1R26A 2HT9A 1J08A 3UJ1A 1JFUA 3QFAC 5CRWA 2VL3A 2KLXA 5D73A 1FOVA 1TP9A 5CAXA 5AIVA 4MJCA 2H6XA 1PFOA 5D8IA 3KMOA 5DCHA 4DSRA 4JU5A 1PN0A 1TJDA 2MZCA 1Z7RA 2WRTA 2B7KA 1SL2B 2J23A 2FNOA 1HNAA 5FT3A 3WGXA 3MYDA 1ON4A 4OFNA 2H76A 3H1NA 1K3YA 6GSTA 4O5RA 20GSA 2P5QA 3L9UA 1DBYA 2H73A 3HZ4A 1U87A 3KJYA 4OO5A 2AJQB 2DKHA 3NIVA 1XWCA 4Z7XA 2FHEA 2WJUA 5EVOA 3KGKA 3BCKA 4MF6A 2B5EA 2EIQA 2P0GA 1LU4A 3IC4A 5A4UA 3ZL5A 4TXOA 4F0BA 1ZYPA 2C1YA 1YQ1A 1TU8A 2VD0A 1QFNA 3EMXA 4AJ8A 5J3RA 5HR0A 3AY8A 2MMNA 1HNCA 2PU9C 3WYWA 2VCQA 4ZB8A 2M80A 1M2BA 1U6TA 1K3LA 3IHGA 2C4JA 3EINA 2KHPA 2XPEA 4ZL8A 1BG5A 1FVJA 1A2LA 4POMA 1ERVA 1GLPA 1YEXA 4Q5RA 5J4UA 1F9MA 5ECSA 1ERTA 2HFDA 3TCOA 4PUAA 4G10A 3EU4A 4TKYA 3TRPA 1XPVA 4PUFC 3H93A 3GTUB 5ECRB 4BPYA 3K8NA 1MTCA 4K2DA 2CZ3A 2JZTA 2OACA 4LLRA 3KZQA 3R3EA 4OCEA 2B5YA 4KAEA 1XIYA 5CRDA 3QR6A 4Z2RA 5BRTA 2DJ0A 4USSA 3HVSA 5ECNB 1X9WB 3D0ZA 5AIXA 4XS4A 3W6GA 1BQ7A 4AF2A 3L4NA 4RI7A 4MJEA 2I81A 1WMJA 5CREA 1JZDA 5E59A 3A5WA 4N0ZA 2CAQA 5J9BA 3US3A 4AJ6A 2HSMA 5GAPD 3IAS2 4HI7A 1W89A 4WKWA 2C0EA 4KGIA 4PGTA 1U88A 3ZYWA 1VF1A 2CVKA 4KSOA 3ZLPA 2O89A 4MK3A 2YWMA 3FZ5A 4G9HA 4A5PA 2PBJA 2EIRA 3WGDA 1ILOA 3OR5A 4YAVA 3FR6A 1T8EB 1YKAA 1KBNA 4XTSA 2VM2A 3HD5A 1URMA 1XFLA 3M9KA 3FZAA 2PWJA 4POBA 2VL9A 5LD0A 1Q4JA 4KNDA 4F0CA 3PR8A 1DE2A 4BL7A 2M46A 3LXZA 5ECIB 2O7KA 3WT1A 2VL2C 4TR1A 1Q98A 4TW5A 2GSTA 4O32A 2WZ9A 3ME8A 1O7UA 1PMTA 2HLSA 2YP6A 3WD6A 6GSSA 4TXOB 1AW9A 1J9BA 4NMUA 3FY7A 1JZWA 2V2GA 3DIEA 4TN8A 4MABA 5ECOB 4G19A 3TOTA 4ACSA 1SKRB 3G9BA 1T00A 5IO2A 2VCXA 4MF7A 2C0GA 4K6XA 1HQOA 3RAZA 5LNKe 2AB6A 4L5OA 2O87A 6GSUA 2VCZA 4ZILA 1HD2A 3GL3A 4GSTA 3G7YA 3GHAA 1T7PB 1BX9A 2OKAA 4QL9A 3CQFA 5CYYA 5IMCA 4PNGA 2LJAA 2XHFA 3QAVA 4PURA 1DE1A 4GXZA 1I9DA 3TKSA 1W4VA 2GT5A 5IO0A 4EF0A 5J9CA 5KEJA 2OE3A 5DJMA 4XS4B 3NOFA 4TXVA 1U3IA 2BMXA 2YPMA 1Z6MA 4MNNA 3IK7A 4N0VA 2VLUA 3W8SA 4LMWA 4EKZA 2DJKA 2YOIA 5ECLB 3GA4A 2D2ZA 2B5XA 2L4CA 3EYTA 5INYA 3F3RA 3CMIA 2R6KA 3GX0A 4WBJA 4IBPA 2E2MA 3IE3A 3WT2A 1VRSD 4Q5FA 1Y25A 3FZ4A 4IHUA 5DJLA 2IMFA 1S3DA 4HUAA 4I8BA 3L0HA 2OBKA 2H0HA 1G7EA 1QXHA 1V40A 1J0FA 2A4VA 5C04A 1FB0A 5EY6A 4FYBA 3APQA 2IMDA 3QAGA 1SENA 3QDNA 4GTUA 2H19A 1HNBA 4FQUA 4BL7B 3WGEA 3ERFA 2GSQA 4HU9A 1H75A 4WXTA 4PXOA 1ZCPA 2N5AA 1K0AA 3LXTA 4TR1B 2H74A 2LS5A 3HJMA 2FUG2 3E3EA 1SJIA 4WR4A 2ZNMA 5E4WA 1X5DA 1GTAA 1M3JA 3GV1A 5DQYA 1TTZA 3NZNA 4WF4A 1O85A 2MYGA 3RHBA 5DBQA 3N5OA 4I6XA 2I1UA 4XS6A 3EPTA 2WB9A 2NTOA 4IP1A 4MPFA 4TR0A 3F9UA 4KE3A 3GN3A 1TI1A 4XRAA 3UIWA 4WBRD 3CTFA 1GSDA 2R3XA 1ZOFA 4K2XA 2PN8A 2LJRA 5F0GA 2EIOA 3F6FA 2YWOA 6GSYA 5J41A 1G0TA 1AXDA 3VLNA 2OADA 1K0CA 4IS0A 2HRAA 1DSBA 2FLSA 2VO4A 2H1GA 3CXGA 18GSA 5J5NA 3QAWA 1O6JA 3Q19A 4GQFA 1R5PA 4J57E 5KOWA 2GQKA 2CT6A 3MIXA 3UAPA 1M99A 4FYCA 4HZ2A 1TW9A 3VURA 4KCEA 4V1Ag 3RDWA 3A3TA 1GP1A 4NHWA 2PVQA 2B1LA 12GSA 2LQQA 2VOCA 4MZBA 2V6OA 3M1GA 1SL1B 5IMFA 2LJKA 1PN9A 2C0FA 3O6TA 3GUSA 1NHYA 4I5QA 1EWXA 2WGRA 3KEBA 1XW5A 2AYTA 3ISOA 2MMAA 1SL0B 3E9JB 4MA9A 2PGTA 1GUKA 1A8LA 2NPBA 5IOWA 4ML6A 3L78A 3TKPA 2AUVA 1NM3A 1U3AA 1GSYA 4ZBAA 1S3RA 4IELA 3ERWA 1RK4A 5AN1A 3I69A 3LFLA 2TRCP 4BIKA 2GSSA 4CY8A 2KOKA 3N9JA 3KXOA 4HS1A 2F9SA 1OC8A 2K6VA 3TJFA 1E2YA 4OMVA 3GMFA 2GZPA 2KP1A 5D96A 2VCWA 3IPZA 1MDKA 3IOSA 3UARA 1CQGA 2IN3A 2AAWA 2L6CA 4MDCA 4KF9A 4I2UA 1FHEA 1BJXA 1WIKA 4K7OA 4MP4A 5KN0A 5B8BA 2P5RA 3UVTA 5C00A 5G1KA 3TJGA 4OO4A 2B7JA 3PH9A 2RM6A 4HQZA 4QL7A 2B1KA 6GSXA 3QMXA 4LL1B 2ZUPA 3LG6A 3PINA 5A5KA 2LUSA 3D6IA 5DCGA 3H8QA 2GQMA 4K1FA 4HDEA 4HJMA 4XHMA 3C8EA 4J2FA 2CVBA 3HA9A 2H8LA 4MPGA 4JZQA 4MZCA 5H5RA 1E6BA 4RQRA 2OE0A 4K5RA 1JHBA 3KH9A 3GNJA 3BCIA 1JZRA 1IYHA 4YQUA 1AIUA 1ERUA 3DXBA 4ID0A 3FR9A 1BAYA 1XZOA 5DALA 3VI7A 1NHOA 5IPGA 1B9XC 1ZGNA 3F3QA 5GZZB 5G5EA 1QK8A 1WJKA 2VIMA 4F03A 1O73A 1NW2A 2E7PA 2IJYA 3QCPA 3FW2A 5B6NA 3F63A 2E2GA 4ZIJA 3FZ9A 1T3BA 2HI7A 1A24A 1VF2A 4KH7A 3FYGA 3VWUA 4KB3A 1O8WA 1FOHA 2L57A 1MD3A 2OBIA 7GSSA 1VF4A 4N11A 2HNLA 1EP8A 3ZMKA 4BVXA 4YH2A 3A5IA 2MMZA 5EPFA 2WFCA 3FRCA 1V57A 2K18A 4JRRA 5ECMB 4MCUA 1G7OA 1ZYEA 3FKFA 2WCIA 3DEXA 2VLVA 1A0RP 4YQMA 4MMMA 2A4HA 4ZBBA 1SKWB 1TOFA 1F6MC 1IYIA 2H70A 3CRUA 2LRNA 4FIWA 1PGTA 2LEGA 4IJ3A 3BBYA 4K7IA 3IK9A 1M9AA 4PQHA 5B7CA 3QOUA 3M3MA 3FR3A 1SJ6A 5KN3A 1YZXA 2H01A 2LKUA 1OYJA 3ERGA 4NXIA 4DEJA 1XWKA 1TXXA 2VUPA 5HQPA 4POLA 4MZWA 2R0PA 4F9ZA 2IIYA 3D4TA 4MH3A 1TKDB 1YF0A 2DKIA 2WULA 3GL5A 4N10A 2RLIA 3DD3A 3I9V2 4I97A 2GTUA 3DWVA 1FW1A 2IWTA 2QSIA 1MD4A 4P3YB 4Q5NA 3PPUA 4ECJA 1F2EA 5ECKB 3HJPA 2GGTA 4I2TA 4TR4A 1VF3A 3EMPA 2GSRA 13GSA 1GTBA 1FVKA 4TR3A 3BD2A 2ON7A 4L5LA 2CAIA 3IC8A 4F82A 4F2IA 3UOMA 4PQ1A 2ZCTA 1A0FA 4KX4A 3HVVA 5IPHA 2PPTA 3HKRA 1XW9A 3GFKA 3D21A 1BYEA 4X43A 1G6YA 5COHA 1OAZA 4OCFA 3VWWA 1PA3A 5HR3A 1EP7A 5DALB 4EDYA 3D22A 1N8JA 1KEBA 2HSHA 3DKSA 2I4AA 4ZXGA 4DSQA 2QKEA 3CSIA
chains in the Genus database with same CATH topology
2FCHA 3VPQA 2IMIA 1MDJA 1ERWA 1MDIA 3IAM2 1G6WA 3GX8A 4ZBDA 1ACVA 3HVXA 3I6AA 4BVXB 5IIZA 4MLYA 1VGLA 1WRYA 2YV7A 1CQHA 2H1AA 2XBIA 3UBKA 2DBCA 3CRTA 5ECQB 4O7HA 3VI5A 4L0UA 3ZREA 3APSA 3DVXA 4K0GA 1UVZA 5ID2A 2FWFA 3MSZA 5GSTA 3U5RE 3GSTA 1RQMA 1EV9A 3IBHA 1X9SB 3RPPA 4IP6A 1T4ZA 2CZ2A 1ZYNA 1TK0B 4EIQA 1PX7A 2YJ7A 3GURA 3U6VA 3IV4A 2VD1A 2NBSA 2BJXA 1OC9A 3FMWA 3GKXA 2FA4A 5DVBA 2DJ2A 3FK8A 3TRQA 4WETA 3VFIA 1K3OA 4ECCA 4OD7A 3UMAA 4HU7A 4RQXA 4XCSA 2L6DA 4ZB6A 2HE3A 4HQSA 2VL2A 4GWRA 2GLRA 2IMKA 2REMA 1XWBA 3LYKA 4KA0A 2DJ3A 5ELGA 3GRXA 2GZZA 2YZHA 1B8XA 1M9BA 3IR4A 5JCWA 1SD8A 3IDVA 5AISA 4BVYA 1GRXA 4GCIA 1THXA 3C1SA 5F05A 3FHKA 2GT6A 4IN0A 1FO5A 2FWEA 2GQLA 4L0WA 2UZ8A 1M7TA 2LNSA 2A2RA 2CA8A 2CVDA 2CX3A 1ZYQB 3GKKA 5EL8A 5ENUA 3PGTA 1PL1A 1YDKA 2V32A 4Z2TA 2YNXA 3P7XA 3HDCA 1ST9A 1X5EA 1EOGA 2JZSA 4POKA 1GSEA 3KD0A 5CRGA 1I5GA 4EUYA 2QA1A 3TJKA 1AQXA 4IVFA 3O76A 2QA2A 2YWIA 2JSZA 1C72A 3LQ7A 1WOUA 4CDOA 1AQWA 1SYRA 4O5QA 5ECPB 1OKDA 3KP9A 4J56E 2VCVA 3W8JA 1N2AA 2X8HA 4TVEA 1Z6NA 4FYUA 1F37A 3TB2A 1GNWA 1K0DA 1K0OA 1TU7A 5L71A 2PERA 1XCCA 6GSVA 19GSA 1SJZA 1GUHA 2YJHA 3Q18A 1YY7A 5HR2A 1GULA 4JR6A 3ZFLA 1GTIA 4FH8A 1GTUA 1WPIA 4CHSA 5ID2B 3UEMA 2V6KA 4IW9A 2C3QA 5ABRA 2YV9A 2FY6A 2OE1A 2QGVA 1ML6A 1USBA 3VWVA 1XBSA 5DAKA 2AV4A 3TKSE 2F51A 4X4JA 1GSFA 3BJ5A 2FGXA 1UN2A 1OC9B 5HFGA 17GSA 4X0XA 5LCZA 1WP0A 3L9VA 4YKFA 4OFTA 2YZUA 4IJIA 2O85A 4NAXA 5IOXA 3SBCA 4JBBA 5B6MA 1K0MA 5GSSA 2Z9SA 2R0GA 3L9SA 3BOAA 3LWAA 1JLVA 3RHCA 4K7NA 1ZMAA 5G31A 4X1UA 3DGQA 4DSSA 3LEFA 1WWJA 3LW9A 1XVWA 1YF1A 4K9ZA 3E0UA 1S3CA 3ME7A 2YN1A 4ECIA 2B3SA 4BVYB 1OKTA 4EO3A 1AC1A 2G2QA 3ZMLA 5CRHA 2DC5A 5IMZA 4MF5A 4O5UA 2O8VB 3A2WA 3P2AA 1M0UA 1OVNA 2H6ZA 2P31A 4KW6A 3FEUA 3LYPA 1ZL9A 3ZTLA 2HRNA 2DMMA 4RUVA 2F8FA 4V1Ap 3D5JA 5HR1A 5JWRB 2YCDA 1QUWA 5A4VA 1DUGA 2LTKA 3TKQA 1EZKA 1EV4A 4K0NA 2JACA 1T4YA 3Q6OA 5F07A 4YAPA 2J9HA 1GUMA 2X8CA 2XC2A 22GSA 4K8MA 4HZ4A 1ZZYA 3KH7A 2X99A 4L8EA 1YEPA 4NPBA 3CSJA 4JEDA 5G5FA 1V58A 3H4KA 1JZOA 4CY6A 3DRNA 5A4WA 3F0IA 2LRTA 2K9FA 4EE0A 2AHEA 5KN2A 3CSHA 1V98A 5H5SA 1X0RA 1XWGA 2I3YA 1SKSB 3VWXA 2C0DA 4E8HA 2GDRA 3J7Yk 1FAAA 3MDKA 3GSSA 2XPDA 2LRCA 1PKZA 4GF0A 3IRAA 3S9FA 2H1DA 1O81A 4E8EA 3G7JA 2R0CA 2WDUA 4BA7A 2HYXA 5DAKB 9GSSA 4N30A 4XIHA 2KP2A 1PD21 3CBUA 3ED3A 2C8UA 2FD3A 1XOBA 2HZFA 4EC0A 1PQNA 3TJBA 1TRUA 4YKGA 2ALBA 2JADA 2MMOA 2N5BA 5G2ZA 1TI3A 2RIIA 4WR5A 3CYNA 4RI6A 1ABAA 1BEDA 4TOPA 5CNWA 3DMLA 4DSSB 2CV4A 2H72A 2JSYA 4WF5A 2KUCA 2OJLA 4GRFA 3ZVJA 4LMVA 4ML1A 2V41A 2NDOA 1XOAA 1R5AA 1TRWA 2IFQA 2QC7A 1PKWA 1OC3A 4ICYA 3EVIA 2H30A 1WE0A 4GSSA 1AUCA 4PQIA 1V9WA 5D9XA 1YJ6A 3MNGA 3GYKA 1GL8A 5D9TA 5JWQB 5B8AA 1GSSA 2BTOT 3RBTA 3CTGA 2YWNA 1MEKA 2HRKA 3GIXA 4TRXA 3A2VA 3ZITA 1GSUA 3UBLA 3SWLA 3TDGA 3F6DA 2TIRA 3TUEA 2OA7A 5D93A 5DDLA 3MAKA 4ZL9A 1GWCA 1R7HA 1KTEA 3TKSC 2MBSA 5D9WA 4KSMA 3EWLA 2F3MA 3LSZA 5HFKA 4NV2A 2IMEA 4HOJA 4ZL7A 4G0IA 2FWHA 2ES7A 2HZEA 1K0NA 1LJRA 3DVWA 4V2MA 2H75A 16GSA 1SU9A 3P8WA 1M2DA 3C7MA 3TKRA 4O92A 1PSQA 2EC4A 1JLWA 2H66A 14GSA 4OFMA 1GNEA 1TRVA 4MJAA 2IL3A 2DMLA 2H0IA 3GKNA 4IQAA 5JWOB 1UC7A 3TOUA 5ECHB 1A8YA 1HYUA 1SK0A 3VK9A 4IKHA 4YQVA 10GSA 3I43A 2VLTA 2H71A 1A23A 1Z7PA 4ILFA 1FB6A 3RPNA 3ZVJD 1H4OA 2DIYA 3G7IA 4IQ1A 2LSTA 1FG4A 3GH6A 5D9VA 1XW6A 3C71A 1SK2A 2L59A 8GSSA 2G0FA 3LGCA 1NSWA 3ZRDA 4HJ2A 5KN1A 1TK8B 1T1VA 2DJ1A 5AGYA 4PNFA 4G2EA 1YKCA 2DSAA 1EEMA 2R37A 4KCAA 2VM1A 3C1RA 4MJBA 3EU3A 1OE8A 3IHQA 2DIZA 1RW1A 5IMAA 1XXUA 3HZ8A 2GVPA 3HYPA 2RM5A 4K5SA 3LJRA 2C3NA 2IFQB 2A2SA 1X5CA 4EDZA 2LV3A 5H5QA 4EVMA 3QPMA 3EE2A 4KDYA 4EL1A 1SD9A 3V1WA 3C73A 5CO3A 2CX4A 1GLQA 3KCMA 3KTBA 3VPTA 3KMNA 3F4RA 2JL4A 2E0QA 1B48A 1PX6A 4ISDA 3EURA 4DVCA 2X49A 4XRDA 3ZZXA 2IPAA 2JZRA 1XWAA 4V2NA 1QMVA 4HEA2 2C80A 3IXRA 3HY2A 3IA1A 3TJJA 3M0FA 1A2JA 4EXJA 2ON5A 4KUNA 1B9YC 1O8XA 2PVOC 2X8GA 4D73A 3HJOA 3GH9A 3HHVA 2XBQA 4EIPA 1UA5A 2HZEB 1AAZA 5JCUA 2GS3A 3M9JA 2DLXA 2LNTA 4PX1A 3KM6A 1Z5YE 2MBTA 3R2QA 3P90A 4CW9A 1EGRA 4JE1A 5G1LA 2V1MA 2VCTA 2X4AA 4H86A 2RUFA 2PMTA 2M72A 2GZYA 1B4QA 3KIJA 3KP8A 3HCZA 1B4PA 2C3TA 2NVLA 4GLTA 2A2PA 3KTLA 11GSA 4BWQA 3UVHA 3Q74A 1EEJA 1EGOA 4ECBA 4BWSA 5FHIA 5IMDA 1X9MB 4AGSA 5GAND 1TRSA 1Z3EA 2K8SA 2L5LA 3F4TA 2PUKC 1F3AA 5CP1A 1AQVA 1Z9HA 4Q5QA 4Z2UA 5FWGA 5IM9A 4GSNA 1SYXA 6GSWA 4QQ7A 1SK1A 4NHZA 1TK5B 3O3TA 2LQOA 3J7Yb 3MWHA 1V2AA 3QD9A 5JCGA 1OE7A 1K0BA 5DQSA 3HXSA 1THOA 2K8VA 1QGVA 3TGZA 1GSQA 1LBKA 2X64A 2H6YA 5HFIA 1PRXA 2H1BA 2CQ9A 4LA1A 3H79A 1TDIA 1M2AA 5IQYA 3EC3A 5IMVA 5KOXA 3ZIVA 5G30A 2HSYA 5BMUA 1XVQA 2RUEA 4G0LA 2I9HA 2FA8A 2N5FA 3JCML 4ZB9A 3QFBC 3DYRA 4KDUA 2L4QA 3A2XA 4D73B 2B6MA 3UL3A 3M8NA 4GQCA 3ZIJA 4AJ7A 3LORA 1GH2A 5ELAA 3ZFBA 2R4VA 2VAFA 4KDXA 4MH2A 3GTUA 1EOHA 2TRXA 2H0GA 4XS1A 2HXKA 2R5GA 2DJJA 2FWGA 4PTSA 5F06A 3APOA 1R4WA 2YANA 4WEYA 2HRFA 1KNGA 3D4MA 3F8UA 4NV5A 2L5OA 4OWYA 4ULXA 2JU5A 2F8AA 2WS2A 1Y6EA 5F8BA 4LL4B 4JR4A 1PL2A 4FO5A 3TRXA 1F3BA 3GKMA 1S3AA 4V2LA 1A2MA 4IGJA 1QQ2A 3F4SA 4G0KA 4NWYA 2R2JA 1R26A 2HT9A 1J08A 3UJ1A 1JFUA 3QFAC 5CRWA 2VL3A 2KLXA 5D73A 1FOVA 1TP9A 5CAXA 5AIVA 4MJCA 2H6XA 5D8IA 3KMOA 5DCHA 4DSRA 4JU5A 1PN0A 1TJDA 2MZCA 1Z7RA 2WRTA 2B7KA 1SL2B 2J23A 2FNOA 1HNAA 5FT3A 3WGXA 3MYDA 1ON4A 4OFNA 2H76A 3H1NA 1K3YA 6GSTA 4O5RA 20GSA 2P5QA 3L9UA 1DBYA 2H73A 3HZ4A 1U87A 3KJYA 4OO5A 2AJQB 2DKHA 3NIVA 1XWCA 4Z7XA 2FHEA 2WJUA 5EVOA 3KGKA 3BCKA 4MF6A 2B5EA 2EIQA 2P0GA 1LU4A 3IC4A 5A4UA 3ZL5A 4TXOA 4F0BA 1ZYPA 2C1YA 1YQ1A 1TU8A 2VD0A 1QFNA 3EMXA 4AJ8A 5J3RA 5HR0A 3AY8A 2MMNA 1HNCA 2PU9C 3WYWA 2VCQA 4ZB8A 2M80A 1M2BA 1U6TA 1K3LA 3IHGA 2C4JA 3EINA 2KHPA 2XPEA 4ZL8A 1BG5A 1FVJA 1A2LA 4POMA 1ERVA 1GLPA 1YEXA 4Q5RA 5J4UA 1F9MA 5ECSA 1ERTA 2HFDA 3TCOA 4PUAA 4G10A 3EU4A 4TKYA 3TRPA 1XPVA 4PUFC 3H93A 3GTUB 5ECRB 4BPYA 3K8NA 1MTCA 4K2DA 2CZ3A 2JZTA 2OACA 4LLRA 3KZQA 3R3EA 4OCEA 2B5YA 4KAEA 1XIYA 5CRDA 3QR6A 4Z2RA 5BRTA 2DJ0A 4USSA 3HVSA 5ECNB 1X9WB 3D0ZA 5AIXA 4XS4A 3W6GA 1BQ7A 4AF2A 3L4NA 4RI7A 4MJEA 2I81A 1WMJA 5CREA 1JZDA 5E59A 3A5WA 4N0ZA 2CAQA 5J9BA 3US3A 4AJ6A 2HSMA 5GAPD 3IAS2 4HI7A 1W89A 4WKWA 2C0EA 4KGIA 4PGTA 1U88A 3ZYWA 1VF1A 2CVKA 4KSOA 3ZLPA 2O89A 4MK3A 2YWMA 3FZ5A 4G9HA 4A5PA 2PBJA 2EIRA 3WGDA 1ILOA 4YAVA 3OR5A 3FR6A 1T8EB 1YKAA 1KBNA 4XTSA 2VM2A 3HD5A 1URMA 1XFLA 3M9KA 3FZAA 2PWJA 4POBA 2VL9A 5LD0A 1Q4JA 4KNDA 4F0CA 3PR8A 1DE2A 4BL7A 2M46A 3LXZA 5ECIB 2O7KA 3WT1A 2VL2C 4TR1A 1Q98A 4TW5A 2GSTA 4O32A 2WZ9A 3ME8A 1O7UA 1PMTA 2HLSA 2YP6A 3WD6A 6GSSA 4TXOB 1AW9A 1J9BA 4NMUA 3FY7A 1JZWA 2V2GA 3DIEA 4TN8A 4MABA 5ECOB 4G19A 3TOTA 4ACSA 1SKRB 3G9BA 1T00A 5IO2A 2VCXA 4MF7A 2C0GA 4K6XA 1HQOA 3RAZA 5LNKe 2AB6A 4L5OA 2O87A 6GSUA 2VCZA 4ZILA 1HD2A 3GL3A 4GSTA 3G7YA 3GHAA 1T7PB 1BX9A 2OKAA 4QL9A 5CYYA 5IMCA 4PNGA 2LJAA 2XHFA 3QAVA 4PURA 1DE1A 4GXZA 1I9DA 3TKSA 1W4VA 2GT5A 5IO0A 4EF0A 5J9CA 5KEJA 2OE3A 5DJMA 4XS4B 3NOFA 4TXVA 1U3IA 2BMXA 2YPMA 1Z6MA 4MNNA 3IK7A 4N0VA 2VLUA 3W8SA 4LMWA 4EKZA 2DJKA 2YOIA 5ECLB 3GA4A 2D2ZA 2B5XA 2L4CA 3EYTA 5INYA 3F3RA 3CMIA 2R6KA 3GX0A 4WBJA 4IBPA 2E2MA 3IE3A 3WT2A 1VRSD 4Q5FA 1Y25A 3FZ4A 4IHUA 5DJLA 2IMFA 1S3DA 4HUAA 4I8BA 3L0HA 2OBKA 2H0HA 1G7EA 1QXHA 1V40A 1J0FA 2A4VA 5C04A 1FB0A 5EY6A 4FYBA 3APQA 2IMDA 3QAGA 1SENA 3QDNA 4GTUA 2H19A 1HNBA 4FQUA 4BL7B 3WGEA 3ERFA 2GSQA 4HU9A 1H75A 4WXTA 4PXOA 1ZCPA 2N5AA 1K0AA 3LXTA 4TR1B 2H74A 2LS5A 3HJMA 2FUG2 3E3EA 1SJIA 4WR4A 2ZNMA 5E4WA 1X5DA 1GTAA 3GV1A 5DQYA 1TTZA 3NZNA 4WF4A 1O85A 2MYGA 3RHBA 5DBQA 3N5OA 4I6XA 2I1UA 4XS6A 3EPTA 2WB9A 2NTOA 4IP1A 4MPFA 4TR0A 3F9UA 4KE3A 3GN3A 1TI1A 4XRAA 3UIWA 4WBRD 3CTFA 1GSDA 2R3XA 1ZOFA 4K2XA 2PN8A 2LJRA 5F0GA 2EIOA 3F6FA 2YWOA 6GSYA 5J41A 1G0TA 1AXDA 3VLNA 2OADA 1K0CA 4IS0A 2HRAA 1DSBA 2FLSA 2VO4A 2H1GA 3CXGA 18GSA 5J5NA 3QAWA 1O6JA 3Q19A 4GQFA 1R5PA 4J57E 5KOWA 2GQKA 2CT6A 3MIXA 3UAPA 1M99A 4FYCA 4HZ2A 1TW9A 3VURA 4KCEA 4V1Ag 3RDWA 3A3TA 1GP1A 4NHWA 2PVQA 2B1LA 12GSA 2LQQA 2VOCA 4MZBA 2V6OA 3M1GA 1SL1B 5IMFA 2LJKA 1PN9A 2C0FA 3O6TA 3GUSA 1NHYA 4I5QA 1EWXA 2WGRA 3KEBA 1XW5A 2AYTA 3ISOA 2MMAA 1SL0B 3E9JB 4MA9A 2PGTA 1GUKA 1A8LA 2NPBA 5IOWA 4ML6A 3L78A 3TKPA 2AUVA 1NM3A 1U3AA 1GSYA 4ZBAA 4IELA 3ERWA 1RK4A 5AN1A 3I69A 3LFLA 2TRCP 2GSSA 4CY8A 2KOKA 3N9JA 3KXOA 4HS1A 2F9SA 1OC8A 2K6VA 3TJFA 1E2YA 4OMVA 3GMFA 2GZPA 2KP1A 5D96A 2VCWA 3IPZA 1MDKA 3IOSA 3UARA 1CQGA 2IN3A 2AAWA 2L6CA 4MDCA 4KF9A 4I2UA 1FHEA 1BJXA 1WIKA 4K7OA 4MP4A 5KN0A 5B8BA 2P5RA 3UVTA 5C00A 5G1KA 3TJGA 4OO4A 2B7JA 3PH9A 2RM6A 4HQZA 4QL7A 2B1KA 6GSXA 3QMXA 4LL1B 2ZUPA 3LG6A 3PINA 5A5KA 2LUSA 3D6IA 5DCGA 3H8QA 2GQMA 4K1FA 4HDEA 4HJMA 4XHMA 3C8EA 4J2FA 2CVBA 3HA9A 2H8LA 4MPGA 4JZQA 4MZCA 5H5RA 1E6BA 4RQRA 2OE0A 4K5RA 1JHBA 3KH9A 3GNJA 3BCIA 1JZRA 1IYHA 4YQUA 1AIUA 1ERUA 3DXBA 4ID0A 3FR9A 1BAYA 1XZOA 5DALA 3VI7A 1NHOA 5IPGA 1B9XC 1ZGNA 3F3QA 5GZZB 5G5EA 1QK8A 1WJKA 2VIMA 4F03A 1O73A 1NW2A 2E7PA 2IJYA 3QCPA 3FW2A 5B6NA 3F63A 2E2GA 4ZIJA 3FZ9A 1T3BA 2HI7A 1A24A 1VF2A 4KH7A 3FYGA 3VWUA 4KB3A 1O8WA 1FOHA 2L57A 1MD3A 2OBIA 7GSSA 1VF4A 4N11A 2HNLA 1EP8A 3ZMKA 4BVXA 4YH2A 3A5IA 2MMZA 5EPFA 2WFCA 3FRCA 1V57A 2K18A 4JRRA 5ECMB 4MCUA 1G7OA 1ZYEA 3FKFA 2WCIA 3DEXA 2VLVA 1A0RP 4YQMA 4MMMA 2A4HA 4ZBBA 1SKWB 1TOFA 1F6MC 1IYIA 2H70A 3CRUA 2LRNA 4FIWA 1PGTA 2LEGA 4IJ3A 3BBYA 4K7IA 3IK9A 1M9AA 4PQHA 5B7CA 3QOUA 3M3MA 3FR3A 1SJ6A 5KN3A 1YZXA 2H01A 2LKUA 1OYJA 3ERGA 4NXIA 4DEJA 1XWKA 1TXXA 2VUPA 5HQPA 4POLA 4MZWA 2R0PA 4F9ZA 2IIYA 3D4TA 4MH3A 1TKDB 1YF0A 2DKIA 2WULA 3GL5A 4N10A 2RLIA 3DD3A 3I9V2 4I97A 2GTUA 3DWVA 1FW1A 2IWTA 2QSIA 1MD4A 4P3YB 4Q5NA 3PPUA 4ECJA 1F2EA 5ECKB 3HJPA 2GGTA 4I2TA 4TR4A 1VF3A 3EMPA 2GSRA 13GSA 1GTBA 1FVKA 4TR3A 3BD2A 2ON7A 4L5LA 2CAIA 3IC8A 4F82A 4F2IA 3UOMA 4PQ1A 2ZCTA 1A0FA 4KX4A 3HVVA 5IPHA 2PPTA 3HKRA 1XW9A 3GFKA 3D21A 1BYEA 4X43A 1G6YA 5COHA 1OAZA 4OCFA 3VWWA 1PA3A 5HR3A 1EP7A 5DALB 4EDYA 3D22A 1N8JA 1KEBA 2HSHA 3DKSA 2I4AA 4ZXGA 4DSQA 2QKEA 3CSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCH A;  3VPQ A;  2IMI A;  1MDJ A;  1ERW A;  1MDI A;  3IAM 2;  1G6W A;  3GX8 A;  4ZBD A;  1ACV A;  3HVX A;  3I6A A;  5IIZ A;  4MLY A;  1VGL A;  1WRY A;  2YV7 A;  1CQH A;  2H1A A;  2XBI A;  3UBK A;  2DBC A;  3CRT A;  5ECQ B;  4O7H A;  3VI5 A;  4L0U A;  3ZRE A;  3APS A;  3DVX A;  4K0G A;  1UVZ A;  5ID2 A;  2FWF A;  3MSZ A;  5GST A;  3U5R E;  3GST A;  1RQM A;  1EV9 A;  3IBH A;  1X9S B;  3RPP A;  4IP6 A;  1T4Z A;  2CZ2 A;  1TK0 B;  1PX7 A;  2YJ7 A;  3GUR A;  3U6V A;  3IV4 A;  2VD1 A;  2NBS A;  2BJX A;  1OC9 A;  3GKX A;  2FA4 A;  5DVB A;  2DJ2 A;  3FK8 A;  3TRQ A;  4WET A;  3VFI A;  1K3O A;  4ECC A;  4OD7 A;  3UMA A;  4HU7 A;  4RQX A;  4XCS A;  2L6D A;  4ZB6 A;  2HE3 A;  4HQS A;  2VL2 A;  4GWR A;  2GLR A;  2IMK A;  2REM A;  1XWB A;  3LYK A;  4KA0 A;  2DJ3 A;  5ELG A;  3GRX A;  2GZZ A;  2YZH A;  1B8X A;  1M9B A;  3IR4 A;  5JCW A;  1SD8 A;  3IDV A;  5AIS A;  4BVY A;  1GRX A;  4GCI A;  1THX A;  3C1S A;  5F05 A;  3FHK A;  2GT6 A;  4IN0 A;  1FO5 A;  2FWE A;  2GQL A;  4L0W A;  1M7T A;  2LNS A;  2A2R A;  2CA8 A;  2CVD A;  2CX3 A;  1ZYQ B;  3GKK A;  5EL8 A;  5ENU A;  3PGT A;  1PL1 A;  1YDK A;  2V32 A;  2YNX A;  3P7X A;  3HDC A;  1ST9 A;  1X5E A;  1EOG A;  2JZS A;  4POK A;  1GSE A;  3KD0 A;  5CRG A;  1I5G A;  4EUY A;  3TJK A;  1AQX A;  4IVF A;  3O76 A;  2YWI A;  2JSZ A;  1C72 A;  3LQ7 A;  1WOU A;  4CDO A;  1AQW A;  1SYR A;  5ECP B;  1OKD A;  3KP9 A;  4J56 E;  2VCV A;  3W8J A;  1N2A A;  2X8H A;  4TVE A;  1Z6N A;  4FYU A;  1F37 A;  3TB2 A;  1GNW A;  1K0D A;  1K0O A;  1TU7 A;  5L71 A;  2PER A;  1XCC A;  6GSV A;  19GS A;  1SJZ A;  1GUH A;  2YJH A;  3Q18 A;  1YY7 A;  5HR2 A;  1GUL A;  4JR6 A;  3ZFL A;  1GTI A;  4FH8 A;  1GTU A;  1WPI A;  4CHS A;  5ID2 B;  3UEM A;  2V6K A;  4IW9 A;  2C3Q A;  5ABR A;  2YV9 A;  2FY6 A;  2OE1 A;  2QGV A;  1ML6 A;  1USB A;  3VWV A;  1XBS A;  5DAK A;  2AV4 A;  3TKS E;  2F51 A;  1GSF A;  3BJ5 A;  2FGX A;  1UN2 A;  1OC9 B;  5HFG A;  17GS A;  4X0X A;  5LCZ A;  1WP0 A;  3L9V A;  4OFT A;  2YZU A;  4IJI A;  2O85 A;  4NAX A;  5IOX A;  3SBC A;  4JBB A;  5B6M A;  1K0M A;  5GSS A;  2Z9S A;  3L9S A;  3BOA A;  3LWA A;  1JLV A;  3RHC A;  4K7N A;  1ZMA A;  5G31 A;  4X1U A;  3DGQ A;  4DSS A;  3LEF A;  1WWJ A;  1XVW A;  1YF1 A;  4K9Z A;  3E0U A;  1S3C A;  3ME7 A;  2YN1 A;  4ECI A;  2B3S A;  1OKT A;  4EO3 A;  1AC1 A;  2G2Q A;  3ZML A;  5CRH A;  2DC5 A;  5IMZ A;  4MF5 A;  2O8V B;  3A2W A;  3P2A A;  1M0U A;  1OVN A;  2H6Z A;  2P31 A;  4KW6 A;  3FEU A;  3LYP A;  1ZL9 A;  3ZTL A;  2HRN A;  2DMM A;  4RUV A;  2F8F A;  4V1A p;  3D5J A;  5HR1 A;  5JWR B;  2YCD A;  1QUW A;  5A4V A;  1DUG A;  2LTK A;  3TKQ A;  1EZK A;  1EV4 A;  4K0N A;  2JAC A;  1T4Y A;  3Q6O A;  5F07 A;  4YAP A;  2J9H A;  1GUM A;  2X8C A;  2XC2 A;  22GS A;  4K8M A;  4HZ4 A;  1ZZY A;  3KH7 A;  2X99 A;  4L8E A;  1YEP A;  4NPB A;  3CSJ A;  4JED A;  5G5F A;  1V58 A;  3H4K A;  1JZO A;  3DRN A;  5A4W A;  3F0I A;  2LRT A;  2K9F A;  4EE0 A;  2AHE A;  5KN2 A;  3CSH A;  1V98 A;  5H5S A;  1X0R A;  1XWG A;  2I3Y A;  1SKS B;  3VWX A;  2C0D A;  4E8H A;  2GDR A;  3J7Y k;  1FAA A;  3MDK A;  3GSS A;  2XPD A;  2LRC A;  1PKZ A;  4GF0 A;  3IRA A;  3S9F A;  2H1D A;  1O81 A;  4E8E A;  3G7J A;  2WDU A;  4BA7 A;  2HYX A;  5DAK B;  9GSS A;  4N30 A;  4XIH A;  2KP2 A;  1PD2 1;  3CBU A;  3ED3 A;  2C8U A;  2FD3 A;  1XOB A;  2HZF A;  4EC0 A;  1PQN A;  3TJB A;  1TRU A;  2ALB A;  2JAD A;  2MMO A;  2N5B A;  5G2Z A;  1TI3 A;  2RII A;  4WR5 A;  3CYN A;  4RI6 A;  1ABA A;  1BED A;  4TOP A;  5CNW A;  3DML A;  4DSS B;  2CV4 A;  2H72 A;  2JSY A;  4WF5 A;  2KUC A;  2OJL A;  4GRF A;  3ZVJ A;  4LMV A;  4ML1 A;  2V41 A;  2NDO A;  1XOA A;  1R5A A;  1TRW A;  2IFQ A;  2QC7 A;  1PKW A;  1OC3 A;  3EVI A;  2H30 A;  1WE0 A;  4GSS A;  1AUC A;  4PQI A;  1V9W A;  5D9X A;  1YJ6 A;  3MNG A;  3GYK A;  1GL8 A;  5D9T A;  5JWQ B;  5B8A A;  1GSS A;  2BTO T;  3RBT A;  3CTG A;  2YWN A;  1MEK A;  3GIX A;  4TRX A;  3A2V A;  3ZIT A;  1GSU A;  3UBL A;  3SWL A;  3TDG A;  3F6D A;  2TIR A;  3TUE A;  2OA7 A;  5D93 A;  5DDL A;  3MAK A;  4ZL9 A;  1GWC A;  1R7H A;  1KTE A;  3TKS C;  2MBS A;  5D9W A;  4KSM A;  3EWL A;  2F3M A;  3LSZ A;  5HFK A;  4NV2 A;  2IME A;  4HOJ A;  4ZL7 A;  2FWH A;  2ES7 A;  2HZE A;  1K0N A;  1LJR A;  3DVW A;  4V2M A;  2H75 A;  16GS A;  1SU9 A;  3P8W A;  1M2D A;  3C7M A;  3TKR A;  4O92 A;  1PSQ A;  2EC4 A;  1JLW A;  2H66 A;  14GS A;  4OFM A;  1GNE A;  1TRV A;  4MJA A;  2IL3 A;  2DML A;  2H0I A;  3GKN A;  4IQA A;  5JWO B;  1UC7 A;  3TOU A;  5ECH B;  1A8Y A;  1HYU A;  1SK0 A;  3VK9 A;  4IKH A;  4YQV A;  10GS A;  3I43 A;  2VLT A;  2H71 A;  1A23 A;  1Z7P A;  4ILF A;  1FB6 A;  3RPN A;  3ZVJ D;  1H4O A;  2DIY A;  3G7I A;  4IQ1 A;  2LST A;  1FG4 A;  3GH6 A;  5D9V A;  1XW6 A;  3C71 A;  1SK2 A;  2L59 A;  8GSS A;  2G0F A;  3LGC A;  1NSW A;  3ZRD A;  4HJ2 A;  5KN1 A;  1TK8 B;  1T1V A;  2DJ1 A;  5AGY A;  4PNF A;  4G2E A;  1YKC A;  2DSA A;  1EEM A;  2R37 A;  4KCA A;  2VM1 A;  3C1R A;  4MJB A;  3EU3 A;  1OE8 A;  3IHQ A;  2DIZ A;  1RW1 A;  5IMA A;  1XXU A;  3HZ8 A;  2GVP A;  3HYP A;  2RM5 A;  3LJR A;  2C3N A;  2IFQ B;  2A2S A;  1X5C A;  4EDZ A;  2LV3 A;  5H5Q A;  4EVM A;  3QPM A;  3EE2 A;  4KDY A;  4EL1 A;  1SD9 A;  3V1W A;  3C73 A;  5CO3 A;  2CX4 A;  1GLQ A;  3KCM A;  3KTB A;  3VPT A;  3KMN A;  3F4R A;  2JL4 A;  2E0Q A;  1B48 A;  1PX6 A;  4ISD A;  3EUR A;  4DVC A;  4XRD A;  3ZZX A;  2IPA A;  2JZR A;  1XWA A;  4V2N A;  1QMV A;  4HEA 2;  2C80 A;  3IXR A;  3HY2 A;  3IA1 A;  3TJJ A;  3M0F A;  1A2J A;  4EXJ A;  2ON5 A;  4KUN A;  1B9Y C;  1O8X A;  2PVO C;  2X8G A;  4D73 A;  3HJO A;  3GH9 A;  3HHV A;  2XBQ A;  1UA5 A;  2HZE B;  1AAZ A;  5JCU A;  2GS3 A;  3M9J A;  2DLX A;  2LNT A;  4PX1 A;  3KM6 A;  1Z5Y E;  2MBT A;  3R2Q A;  3P90 A;  4CW9 A;  1EGR A;  4JE1 A;  5G1L A;  2V1M A;  2VCT A;  4H86 A;  2RUF A;  2PMT A;  2M72 A;  2GZY A;  1B4Q A;  3KIJ A;  3KP8 A;  3HCZ A;  1B4P A;  2C3T A;  2NVL A;  4GLT A;  3KTL A;  11GS A;  4BWQ A;  3UVH A;  3Q74 A;  1EEJ A;  1EGO A;  4ECB A;  4BWS A;  5FHI A;  5IMD A;  1X9M B;  4AGS A;  5GAN D;  1TRS A;  1Z3E A;  2K8S A;  2L5L A;  3F4T A;  2PUK C;  1F3A A;  5CP1 A;  1AQV A;  1Z9H A;  4Q5Q A;  5FWG A;  5IM9 A;  4GSN A;  1SYX A;  6GSW A;  4QQ7 A;  1SK1 A;  4NHZ A;  1TK5 B;  3O3T A;  2LQO A;  3J7Y b;  3MWH A;  1V2A A;  3QD9 A;  5JCG A;  1OE7 A;  1K0B A;  5DQS A;  3HXS A;  1THO A;  2K8V A;  1QGV A;  3TGZ A;  1GSQ A;  1LBK A;  2X64 A;  2H6Y A;  5HFI A;  1PRX A;  2H1B A;  2CQ9 A;  4LA1 A;  3H79 A;  1TDI A;  1M2A A;  5IQY A;  3EC3 A;  5IMV A;  3ZIV A;  5G30 A;  2HSY A;  1XVQ A;  2RUE A;  2I9H A;  2FA8 A;  2N5F A;  3JCM L;  4ZB9 A;  3QFB C;  3DYR A;  4KDU A;  2L4Q A;  3A2X A;  4D73 B;  2B6M A;  3UL3 A;  3M8N A;  4GQC A;  3ZIJ A;  4AJ7 A;  3LOR A;  1GH2 A;  5ELA A;  3ZFB A;  2R4V A;  2VAF A;  4KDX A;  4MH2 A;  3GTU A;  1EOH A;  2TRX A;  2H0G A;  4XS1 A;  2HXK A;  2R5G A;  2DJJ A;  2FWG A;  5F06 A;  3APO A;  1R4W A;  2YAN A;  4WEY A;  2HRF A;  1KNG A;  3D4M A;  3F8U A;  4NV5 A;  2L5O A;  4OWY A;  4ULX A;  2JU5 A;  2F8A A;  2WS2 A;  1Y6E A;  5F8B A;  4LL4 B;  4JR4 A;  1PL2 A;  4FO5 A;  3TRX A;  1F3B A;  3GKM A;  1S3A A;  4V2L A;  1A2M A;  4IGJ A;  1QQ2 A;  3F4S A;  4NWY A;  2R2J A;  1R26 A;  2HT9 A;  1J08 A;  3UJ1 A;  1JFU A;  3QFA C;  5CRW A;  2VL3 A;  2KLX A;  5D73 A;  1FOV A;  1TP9 A;  5CAX A;  5AIV A;  4MJC A;  2H6X A;  5D8I A;  3KMO A;  5DCH A;  4DSR A;  4JU5 A;  1TJD A;  2MZC A;  1Z7R A;  2WRT A;  2B7K A;  1SL2 B;  2J23 A;  2FNO A;  1HNA A;  5FT3 A;  3WGX A;  1ON4 A;  4OFN A;  2H76 A;  3H1N A;  1K3Y A;  6GST A;  4O5R A;  20GS A;  2P5Q A;  3L9U A;  1DBY A;  2H73 A;  3HZ4 A;  1U87 A;  3KJY A;  4OO5 A;  2AJQ B;  3NIV A;  1XWC A;  4Z7X A;  2FHE A;  2WJU A;  5EVO A;  3KGK A;  3BCK A;  4MF6 A;  2B5E A;  2EIQ A;  2P0G A;  1LU4 A;  3IC4 A;  5A4U A;  3ZL5 A;  4TXO A;  4F0B A;  2C1Y A;  1YQ1 A;  1TU8 A;  2VD0 A;  1QFN A;  3EMX A;  4AJ8 A;  5J3R A;  5HR0 A;  3AY8 A;  2MMN A;  1HNC A;  2PU9 C;  3WYW A;  2VCQ A;  4ZB8 A;  2M80 A;  1M2B A;  1U6T A;  1K3L A;  2C4J A;  3EIN A;  2KHP A;  2XPE A;  4ZL8 A;  1BG5 A;  1FVJ A;  1A2L A;  4POM A;  1ERV A;  1GLP A;  1YEX A;  4Q5R A;  5J4U A;  1F9M A;  5ECS A;  1ERT A;  2HFD A;  3TCO A;  4PUA A;  4G10 A;  3EU4 A;  4TKY A;  3TRP A;  1XPV A;  4PUF C;  3H93 A;  3GTU B;  5ECR B;  4BPY A;  3K8N A;  1MTC A;  4K2D A;  2CZ3 A;  2JZT A;  2OAC A;  4LLR A;  3KZQ A;  4OCE A;  2B5Y A;  4KAE A;  1XIY A;  5CRD A;  3QR6 A;  2DJ0 A;  3HVS A;  5ECN B;  1X9W B;  3D0Z A;  5AIX A;  4XS4 A;  3W6G A;  1BQ7 A;  4AF2 A;  3L4N A;  4RI7 A;  4MJE A;  2I81 A;  1WMJ A;  5CRE A;  1JZD A;  5E59 A;  3A5W A;  4N0Z A;  2CAQ A;  5J9B A;  3US3 A;  4AJ6 A;  5GAP D;  3IAS 2;  4HI7 A;  1W89 A;  4WKW A;  2C0E A;  4KGI A;  4PGT A;  1U88 A;  3ZYW A;  1VF1 A;  2CVK A;  4KSO A;  3ZLP A;  2O89 A;  4MK3 A;  2YWM A;  3FZ5 A;  4G9H A;  2PBJ A;  2EIR A;  3WGD A;  1ILO A;  4YAV A;  3OR5 A;  3FR6 A;  1T8E B;  1YKA A;  1KBN A;  4XTS A;  2VM2 A;  3HD5 A;  1URM A;  1XFL A;  3M9K A;  3FZA A;  2PWJ A;  4POB A;  2VL9 A;  5LD0 A;  1Q4J A;  4KND A;  4F0C A;  3PR8 A;  1DE2 A;  4BL7 A;  2M46 A;  3LXZ A;  5ECI B;  2O7K A;  3WT1 A;  2VL2 C;  4TR1 A;  1Q98 A;  4TW5 A;  2GST A;  4O32 A;  2WZ9 A;  3ME8 A;  1O7U A;  1PMT A;  2HLS A;  2YP6 A;  3WD6 A;  6GSS A;  4TXO B;  1AW9 A;  1J9B A;  4NMU A;  3FY7 A;  1JZW A;  2V2G A;  3DIE A;  4TN8 A;  4MAB A;  5ECO B;  4G19 A;  3TOT A;  4ACS A;  1SKR B;  3G9B A;  1T00 A;  5IO2 A;  2VCX A;  4MF7 A;  2C0G A;  4K6X A;  1HQO A;  3RAZ A;  5LNK e;  2AB6 A;  4L5O A;  2O87 A;  6GSU A;  2VCZ A;  4ZIL A;  1HD2 A;  3GL3 A;  4GST A;  3G7Y A;  3GHA A;  1T7P B;  1BX9 A;  2OKA A;  4QL9 A;  5CYY A;  5IMC A;  4PNG A;  2LJA A;  2XHF A;  3QAV A;  4PUR A;  1DE1 A;  4GXZ A;  1I9D A;  3TKS A;  1W4V A;  2GT5 A;  5IO0 A;  4EF0 A;  5J9C A;  5KEJ A;  2OE3 A;  5DJM A;  4XS4 B;  3NOF A;  4TXV A;  1U3I A;  2BMX A;  2YPM A;  1Z6M A;  3IK7 A;  4N0V A;  2VLU A;  3W8S A;  4LMW A;  4EKZ A;  2DJK A;  2YOI A;  5ECL B;  3GA4 A;  2D2Z A;  2B5X A;  2L4C A;  3EYT A;  5INY A;  3F3R A;  3CMI A;  2R6K A;  3GX0 A;  4WBJ A;  4IBP A;  2E2M A;  3IE3 A;  3WT2 A;  1VRS D;  4Q5F A;  1Y25 A;  3FZ4 A;  4IHU A;  5DJL A;  2IMF A;  1S3D A;  4HUA A;  4I8B A;  3L0H A;  2OBK A;  2H0H A;  1G7E A;  1QXH A;  1V40 A;  1J0F A;  2A4V A;  5C04 A;  1FB0 A;  5EY6 A;  4FYB A;  3APQ A;  2IMD A;  3QAG A;  1SEN A;  3QDN A;  4GTU A;  2H19 A;  1HNB A;  3WGE A;  3ERF A;  2GSQ A;  4HU9 A;  1H75 A;  4WXT A;  4PXO A;  1ZCP A;  2N5A A;  1K0A A;  3LXT A;  4TR1 B;  2H74 A;  2LS5 A;  3HJM A;  2FUG 2;  3E3E A;  1SJI A;  4WR4 A;  2ZNM A;  5E4W A;  1X5D A;  1GTA A;  3GV1 A;  5DQY A;  1TTZ A;  3NZN A;  4WF4 A;  1O85 A;  2MYG A;  3RHB A;  5DBQ A;  3N5O A;  4I6X A;  2I1U A;  4XS6 A;  2WB9 A;  2NTO A;  4IP1 A;  4MPF A;  4TR0 A;  3F9U A;  4KE3 A;  3GN3 A;  1TI1 A;  4XRA A;  3UIW A;  4WBR D;  3CTF A;  1GSD A;  2R3X A;  1ZOF A;  2PN8 A;  2LJR A;  5F0G A;  2EIO A;  3F6F A;  2YWO A;  6GSY A;  5J41 A;  1G0T A;  1AXD A;  3VLN A;  2OAD A;  1K0C A;  4IS0 A;  1DSB A;  2FLS A;  2VO4 A;  2H1G A;  3CXG A;  18GS A;  5J5N A;  3QAW A;  1O6J A;  3Q19 A;  4GQF A;  1R5P A;  4J57 E;  2GQK A;  2CT6 A;  3UAP A;  1M99 A;  4FYC A;  4HZ2 A;  1TW9 A;  3VUR A;  4KCE A;  4V1A g;  3RDW A;  3A3T A;  1GP1 A;  4NHW A;  2PVQ A;  2B1L A;  12GS A;  2LQQ A;  2VOC A;  4MZB A;  2V6O A;  3M1G A;  1SL1 B;  5IMF A;  2LJK A;  1PN9 A;  2C0F A;  3O6T A;  3GUS A;  1NHY A;  4I5Q A;  1EWX A;  2WGR A;  3KEB A;  1XW5 A;  2AYT A;  3ISO A;  2MMA A;  1SL0 B;  3E9J B;  4MA9 A;  2PGT A;  1GUK A;  1A8L A;  2NPB A;  5IOW A;  4ML6 A;  3L78 A;  3TKP A;  2AUV A;  1NM3 A;  1U3A A;  1GSY A;  4ZBA A;  4IEL A;  3ERW A;  1RK4 A;  5AN1 A;  3I69 A;  3LFL A;  2TRC P;  2GSS A;  2KOK A;  3N9J A;  3KXO A;  4HS1 A;  2F9S A;  1OC8 A;  2K6V A;  3TJF A;  1E2Y A;  4OMV A;  3GMF A;  2GZP A;  2KP1 A;  5D96 A;  2VCW A;  3IPZ A;  1MDK A;  3IOS A;  3UAR A;  1CQG A;  2IN3 A;  2AAW A;  2L6C A;  4MDC A;  4I2U A;  1FHE A;  1BJX A;  1WIK A;  4K7O A;  4MP4 A;  5KN0 A;  5B8B A;  2P5R A;  3UVT A;  5C00 A;  5G1K A;  3TJG A;  4OO4 A;  2B7J A;  3PH9 A;  2RM6 A;  4HQZ A;  4QL7 A;  2B1K A;  6GSX A;  3QMX A;  4LL1 B;  2ZUP A;  3LG6 A;  3PIN A;  5A5K A;  2LUS A;  3D6I A;  5DCG A;  3H8Q A;  2GQM A;  4K1F A;  4HDE A;  4HJM A;  4XHM A;  3C8E A;  4J2F A;  2CVB A;  3HA9 A;  2H8L A;  4MPG A;  4JZQ A;  4MZC A;  5H5R A;  1E6B A;  4RQR A;  2OE0 A;  1JHB A;  3KH9 A;  3GNJ A;  3BCI A;  1JZR A;  1IYH A;  4YQU A;  1AIU A;  1ERU A;  3DXB A;  4ID0 A;  3FR9 A;  1BAY A;  1XZO A;  5DAL A;  3VI7 A;  1NHO A;  5IPG A;  1B9X C;  1ZGN A;  3F3Q A;  5GZZ B;  5G5E A;  1QK8 A;  1WJK A;  2VIM A;  4F03 A;  1O73 A;  1NW2 A;  2E7P A;  2IJY A;  3QCP A;  3FW2 A;  5B6N A;  3F63 A;  2E2G A;  4ZIJ A;  3FZ9 A;  1T3B A;  2HI7 A;  1A24 A;  1VF2 A;  4KH7 A;  3FYG A;  3VWU A;  4KB3 A;  1O8W A;  2L57 A;  1MD3 A;  2OBI A;  7GSS A;  1VF4 A;  4N11 A;  2HNL A;  1EP8 A;  3ZMK A;  4BVX A;  4YH2 A;  2MMZ A;  5EPF A;  2WFC A;  3FRC A;  1V57 A;  2K18 A;  4JRR A;  5ECM B;  4MCU A;  1G7O A;  1ZYE A;  3FKF A;  2WCI A;  3DEX A;  2VLV A;  1A0R P;  4YQM A;  4MMM A;  4ZBB A;  1SKW B;  1TOF A;  1F6M C;  1IYI A;  2H70 A;  3CRU A;  2LRN A;  4FIW A;  1PGT A;  2LEG A;  4IJ3 A;  3BBY A;  4K7I A;  3IK9 A;  1M9A A;  4PQH A;  5B7C A;  3QOU A;  3M3M A;  3FR3 A;  1SJ6 A;  5KN3 A;  1YZX A;  2H01 A;  2LKU A;  1OYJ A;  3ERG A;  4NXI A;  4DEJ A;  1XWK A;  1TXX A;  2VUP A;  5HQP A;  4POL A;  4MZW A;  4F9Z A;  2IIY A;  3D4T A;  4MH3 A;  1TKD B;  1YF0 A;  2WUL A;  3GL5 A;  4N10 A;  2RLI A;  3DD3 A;  3I9V 2;  4I97 A;  2GTU A;  3DWV A;  1FW1 A;  2IWT A;  2QSI A;  1MD4 A;  4P3Y B;  4Q5N A;  4ECJ A;  1F2E A;  5ECK B;  3HJP A;  2GGT A;  4I2T A;  4TR4 A;  1VF3 A;  3EMP A;  2GSR A;  13GS A;  1GTB A;  1FVK A;  4TR3 A;  3BD2 A;  2ON7 A;  4L5L A;  2CAI A;  4F82 A;  4F2I A;  3UOM A;  4PQ1 A;  2ZCT A;  1A0F A;  4KX4 A;  3HVV A;  5IPH A;  2PPT A;  3HKR A;  1XW9 A;  3GFK A;  3D21 A;  1BYE A;  4X43 A;  1G6Y A;  5COH A;  1OAZ A;  4OCF A;  3VWW A;  1PA3 A;  5HR3 A;  1EP7 A;  5DAL B;  4EDY A;  3D22 A;  1N8J A;  1KEB A;  2HSH A;  3DKS A;  2I4A A;  4ZXG A;  4DSQ A;  2QKE A;  3CSI A; 
#chains in the Genus database with same CATH topology
 2FCH A;  3VPQ A;  2IMI A;  1MDJ A;  1ERW A;  1MDI A;  3IAM 2;  1G6W A;  3GX8 A;  4ZBD A;  1ACV A;  3HVX A;  3I6A A;  4BVX B;  5IIZ A;  4MLY A;  1VGL A;  1WRY A;  2YV7 A;  1CQH A;  2H1A A;  2XBI A;  3UBK A;  2DBC A;  3CRT A;  5ECQ B;  4O7H A;  3VI5 A;  4L0U A;  3ZRE A;  3APS A;  3DVX A;  4K0G A;  1UVZ A;  5ID2 A;  2FWF A;  3MSZ A;  5GST A;  3U5R E;  3GST A;  1RQM A;  1EV9 A;  3IBH A;  1X9S B;  3RPP A;  4IP6 A;  1T4Z A;  2CZ2 A;  1ZYN A;  1TK0 B;  4EIQ A;  1PX7 A;  2YJ7 A;  3GUR A;  3U6V A;  3IV4 A;  2VD1 A;  2NBS A;  2BJX A;  1OC9 A;  3FMW A;  3GKX A;  2FA4 A;  5DVB A;  2DJ2 A;  3FK8 A;  3TRQ A;  4WET A;  3VFI A;  1K3O A;  4ECC A;  4OD7 A;  3UMA A;  4HU7 A;  4RQX A;  4XCS A;  2L6D A;  4ZB6 A;  2HE3 A;  4HQS A;  2VL2 A;  4GWR A;  1XG8 A;  2GLR A;  2IMK A;  2REM A;  1XWB A;  3LYK A;  4KA0 A;  2DJ3 A;  5ELG A;  3GRX A;  2GZZ A;  2YZH A;  1B8X A;  1M9B A;  3IR4 A;  5JCW A;  1SD8 A;  3IDV A;  5AIS A;  4BVY A;  1GRX A;  4GCI A;  1THX A;  3C1S A;  5F05 A;  3FHK A;  2GT6 A;  4IN0 A;  1FO5 A;  2FWE A;  2GQL A;  4L0W A;  2UZ8 A;  1M7T A;  2LNS A;  2A2R A;  2CA8 A;  2CVD A;  2CX3 A;  1ZYQ B;  3GKK A;  5EL8 A;  5ENU A;  3PGT A;  1PL1 A;  1YDK A;  2V32 A;  4Z2T A;  2YNX A;  3P7X A;  3HDC A;  1ST9 A;  1X5E A;  1EOG A;  2JZS A;  4POK A;  1GSE A;  3KD0 A;  5CRG A;  1I5G A;  4EUY A;  2QA1 A;  3TJK A;  1AQX A;  4IVF A;  3O76 A;  2QA2 A;  3HVN A;  2YWI A;  2JSZ A;  1C72 A;  3LQ7 A;  1WOU A;  4CDO A;  1AQW A;  1SYR A;  4O5Q A;  5ECP B;  1OKD A;  3KP9 A;  4J56 E;  2VCV A;  3W8J A;  1N2A A;  2X8H A;  4TVE A;  1Z6N A;  4FYU A;  1F37 A;  3TB2 A;  1GNW A;  1K0D A;  1K0O A;  1TU7 A;  5L71 A;  2PER A;  1XCC A;  6GSV A;  19GS A;  1SJZ A;  1GUH A;  2YJH A;  3Q18 A;  1YY7 A;  5HR2 A;  1GUL A;  4JR6 A;  3ZFL A;  1GTI A;  4FH8 A;  1GTU A;  1WPI A;  4CHS A;  5ID2 B;  3UEM A;  2V6K A;  4IW9 A;  2C3Q A;  5ABR A;  2YV9 A;  2FY6 A;  2OE1 A;  4HSC X;  2QGV A;  1ML6 A;  1USB A;  3VWV A;  1XBS A;  5DAK A;  2AV4 A;  3TKS E;  2F51 A;  4X4J A;  1GSF A;  3BJ5 A;  2FGX A;  1UN2 A;  1OC9 B;  5HFG A;  17GS A;  4X0X A;  5LCZ A;  1WP0 A;  3L9V A;  4YKF A;  4OFT A;  2YZU A;  4IJI A;  2O85 A;  4NAX A;  5IOX A;  3SBC A;  4JBB A;  5B6M A;  1K0M A;  5GSS A;  2Z9S A;  2R0G A;  3L9S A;  3BOA A;  3LWA A;  1JLV A;  3RHC A;  4K7N A;  1ZMA A;  5G31 A;  4X1U A;  3DGQ A;  4DSS A;  3LEF A;  1WWJ A;  3LW9 A;  1XVW A;  1YF1 A;  4K9Z A;  3E0U A;  1S3C A;  3ME7 A;  2YN1 A;  4ECI A;  2B3S A;  4BVY B;  1OKT A;  4EO3 A;  1AC1 A;  2G2Q A;  3ZML A;  5CRH A;  2DC5 A;  5IMZ A;  4MF5 A;  1M3I A;  2O8V B;  4O5U A;  3A2W A;  3P2A A;  1M0U A;  1OVN A;  2H6Z A;  2P31 A;  4KW6 A;  3FEU A;  3LYP A;  1ZL9 A;  3ZTL A;  2HRN A;  2DMM A;  4RUV A;  2F8F A;  4V1A p;  3D5J A;  5HR1 A;  5JWR B;  2YCD A;  1QUW A;  5A4V A;  1DUG A;  2LTK A;  3TKQ A;  1EZK A;  1EV4 A;  4K0N A;  2JAC A;  1T4Y A;  3Q6O A;  5F07 A;  4YAP A;  2J9H A;  1GUM A;  2X8C A;  2XC2 A;  22GS A;  4K8M A;  4HZ4 A;  1ZZY A;  3KH7 A;  2X99 A;  4L8E A;  1YEP A;  4NPB A;  3CSJ A;  4JED A;  5G5F A;  1V58 A;  3H4K A;  1JZO A;  4CY6 A;  3DRN A;  5A4W A;  3F0I A;  2LRT A;  2K9F A;  4EE0 A;  2AHE A;  5KN2 A;  3CSH A;  1V98 A;  5H5S A;  1X0R A;  1XWG A;  2I3Y A;  1SKS B;  3VWX A;  2C0D A;  4E8H A;  2GDR A;  3J7Y k;  1FAA A;  3MDK A;  3GSS A;  2XPD A;  2LRC A;  1PKZ A;  4GF0 A;  3IRA A;  3S9F A;  2H1D A;  1O81 A;  4E8E A;  3G7J A;  2R0C A;  2WDU A;  4BA7 A;  2HYX A;  5DAK B;  9GSS A;  4N30 A;  4XIH A;  2KP2 A;  1PD2 1;  3CBU A;  3ED3 A;  2C8U A;  2FD3 A;  1XOB A;  2HZF A;  4EC0 A;  1PQN A;  3TJB A;  1TRU A;  4YKG A;  2ALB A;  2JAD A;  2MMO A;  2N5B A;  5G2Z A;  1TI3 A;  2RII A;  4WR5 A;  3CYN A;  4RI6 A;  1ABA A;  1BED A;  4TOP A;  5CNW A;  3DML A;  4DSS B;  2CV4 A;  2H72 A;  2JSY A;  4WF5 A;  2KUC A;  2OJL A;  4GRF A;  3ZVJ A;  4LMV A;  4ML1 A;  2V41 A;  2NDO A;  1XOA A;  1R5A A;  1TRW A;  2IFQ A;  2QC7 A;  1PKW A;  1OC3 A;  4ICY A;  3EVI A;  2H30 A;  1WE0 A;  4GSS A;  1AUC A;  4PQI A;  1V9W A;  5D9X A;  1YJ6 A;  3MNG A;  3GYK A;  1GL8 A;  5D9T A;  5JWQ B;  5B8A A;  1GSS A;  2BTO T;  3RBT A;  3CTG A;  2YWN A;  1MEK A;  2HRK A;  3GIX A;  4TRX A;  3A2V A;  3ZIT A;  1GSU A;  3UBL A;  3SWL A;  3TDG A;  3F6D A;  2TIR A;  3TUE A;  2OA7 A;  5D93 A;  5DDL A;  3MAK A;  4ZL9 A;  1GWC A;  1R7H A;  1KTE A;  3TKS C;  2MBS A;  5D9W A;  4KSM A;  3EWL A;  2F3M A;  3LSZ A;  5HFK A;  4NV2 A;  2IME A;  4HOJ A;  4ZL7 A;  4G0I A;  2FWH A;  2ES7 A;  2HZE A;  1K0N A;  1LJR A;  3DVW A;  4V2M A;  2H75 A;  16GS A;  1SU9 A;  3P8W A;  1M2D A;  3C7M A;  3TKR A;  4O92 A;  1PSQ A;  2EC4 A;  1JLW A;  2H66 A;  14GS A;  4OFM A;  1GNE A;  1TRV A;  4MJA A;  2IL3 A;  2DML A;  2H0I A;  3GKN A;  4IQA A;  5JWO B;  1UC7 A;  3TOU A;  5ECH B;  1A8Y A;  1HYU A;  1SK0 A;  3VK9 A;  4IKH A;  4YQV A;  10GS A;  3I43 A;  2VLT A;  2H71 A;  1A23 A;  1Z7P A;  4ILF A;  1FB6 A;  3RPN A;  3ZVJ D;  1H4O A;  2DIY A;  3G7I A;  4IQ1 A;  2LST A;  1FG4 A;  3GH6 A;  5D9V A;  1XW6 A;  3C71 A;  1SK2 A;  2L59 A;  8GSS A;  2G0F A;  3LGC A;  1NSW A;  3ZRD A;  4HJ2 A;  5KN1 A;  1TK8 B;  1T1V A;  2DJ1 A;  5AGY A;  4PNF A;  4G2E A;  1YKC A;  2DSA A;  1EEM A;  2R37 A;  4KCA A;  2VM1 A;  3C1R A;  4MJB A;  3EU3 A;  1OE8 A;  3IHQ A;  2DIZ A;  1RW1 A;  5IMA A;  1XXU A;  3HZ8 A;  2GVP A;  3HYP A;  2RM5 A;  4K5S A;  3LJR A;  2C3N A;  2IFQ B;  2A2S A;  1X5C A;  4EDZ A;  2LV3 A;  5H5Q A;  4EVM A;  3QPM A;  3EE2 A;  4KDY A;  4EL1 A;  1SD9 A;  3V1W A;  3C73 A;  5CO3 A;  2CX4 A;  1GLQ A;  3KCM A;  3KTB A;  3VPT A;  3KMN A;  3F4R A;  2JL4 A;  2E0Q A;  1B48 A;  1PX6 A;  4ISD A;  3EUR A;  4DVC A;  2X49 A;  4XRD A;  3ZZX A;  2IPA A;  2JZR A;  1XWA A;  4V2N A;  1QMV A;  4HEA 2;  2C80 A;  3IXR A;  3HY2 A;  3IA1 A;  3TJJ A;  3M0F A;  1A2J A;  4EXJ A;  2ON5 A;  4KUN A;  1B9Y C;  1O8X A;  2PVO C;  2X8G A;  4D73 A;  3HJO A;  3GH9 A;  3HHV A;  2XBQ A;  4EIP A;  1UA5 A;  2HZE B;  1AAZ A;  5JCU A;  2GS3 A;  3M9J A;  2DLX A;  2LNT A;  4PX1 A;  3KM6 A;  1Z5Y E;  2MBT A;  3R2Q A;  3P90 A;  4CW9 A;  1EGR A;  4JE1 A;  5G1L A;  2V1M A;  2VCT A;  2X4A A;  4H86 A;  2RUF A;  2PMT A;  2M72 A;  2GZY A;  1B4Q A;  3KIJ A;  3KP8 A;  3HCZ A;  1B4P A;  2C3T A;  2NVL A;  4GLT A;  2A2P A;  3KTL A;  11GS A;  4BWQ A;  3UVH A;  3Q74 A;  1EEJ A;  1EGO A;  4ECB A;  4BWS A;  5FHI A;  5IMD A;  1X9M B;  4AGS A;  5GAN D;  1TRS A;  1Z3E A;  2K8S A;  2L5L A;  3F4T A;  2PUK C;  1F3A A;  5CP1 A;  1AQV A;  1Z9H A;  4Q5Q A;  4Z2U A;  5FWG A;  5IM9 A;  4GSN A;  1SYX A;  6GSW A;  4QQ7 A;  1SK1 A;  4NHZ A;  1TK5 B;  3O3T A;  2LQO A;  3J7Y b;  3MWH A;  1V2A A;  3QD9 A;  5JCG A;  1OE7 A;  1K0B A;  5DQS A;  3HXS A;  1THO A;  2K8V A;  1QGV A;  3TGZ A;  1GSQ A;  1LBK A;  2X64 A;  2H6Y A;  5HFI A;  1PRX A;  2H1B A;  2CQ9 A;  4LA1 A;  3H79 A;  1TDI A;  1M2A A;  5IQY A;  3EC3 A;  5IMV A;  5KOX A;  3ZIV A;  5G30 A;  2HSY A;  5BMU A;  1XVQ A;  2RUE A;  4G0L A;  2I9H A;  2FA8 A;  2N5F A;  3JCM L;  4ZB9 A;  3QFB C;  3DYR A;  4KDU A;  2L4Q A;  3A2X A;  4D73 B;  2B6M A;  3UL3 A;  3M8N A;  4GQC A;  3ZIJ A;  4AJ7 A;  3LOR A;  1GH2 A;  5ELA A;  3ZFB A;  2R4V A;  2VAF A;  4KDX A;  4MH2 A;  3GTU A;  1EOH A;  2TRX A;  2H0G A;  4XS1 A;  2HXK A;  2R5G A;  2DJJ A;  2FWG A;  4PTS A;  5F06 A;  3APO A;  1R4W A;  2YAN A;  4WEY A;  2HRF A;  1KNG A;  3D4M A;  3F8U A;  4NV5 A;  2L5O A;  4OWY A;  4ULX A;  2JU5 A;  2F8A A;  2WS2 A;  1Y6E A;  5F8B A;  4LL4 B;  4JR4 A;  1PL2 A;  4FO5 A;  3TRX A;  1F3B A;  3GKM A;  1S3A A;  4V2L A;  1A2M A;  4IGJ A;  1QQ2 A;  3F4S A;  4G0K A;  4NWY A;  2R2J A;  1R26 A;  2HT9 A;  1J08 A;  3UJ1 A;  1JFU A;  3QFA C;  5CRW A;  2VL3 A;  2KLX A;  5D73 A;  1FOV A;  1TP9 A;  5CAX A;  5AIV A;  4MJC A;  2H6X A;  1PFO A;  5D8I A;  3KMO A;  5DCH A;  4DSR A;  4JU5 A;  1PN0 A;  1TJD A;  2MZC A;  1Z7R A;  2WRT A;  2B7K A;  1SL2 B;  2J23 A;  2FNO A;  1HNA A;  5FT3 A;  3WGX A;  3MYD A;  1ON4 A;  4OFN A;  2H76 A;  3H1N A;  1K3Y A;  6GST A;  4O5R A;  20GS A;  2P5Q A;  3L9U A;  1DBY A;  2H73 A;  3HZ4 A;  1U87 A;  3KJY A;  4OO5 A;  2AJQ B;  2DKH A;  3NIV A;  1XWC A;  4Z7X A;  2FHE A;  2WJU A;  5EVO A;  3KGK A;  3BCK A;  4MF6 A;  2B5E A;  2EIQ A;  2P0G A;  1LU4 A;  3IC4 A;  5A4U A;  3ZL5 A;  4TXO A;  4F0B A;  1ZYP A;  2C1Y A;  1YQ1 A;  1TU8 A;  2VD0 A;  1QFN A;  3EMX A;  4AJ8 A;  5J3R A;  5HR0 A;  3AY8 A;  2MMN A;  1HNC A;  2PU9 C;  3WYW A;  2VCQ A;  4ZB8 A;  2M80 A;  1M2B A;  1U6T A;  1K3L A;  3IHG A;  2C4J A;  3EIN A;  2KHP A;  2XPE A;  4ZL8 A;  1BG5 A;  1FVJ A;  1A2L A;  4POM A;  1ERV A;  1GLP A;  1YEX A;  4Q5R A;  5J4U A;  1F9M A;  5ECS A;  1ERT A;  2HFD A;  3TCO A;  4PUA A;  4G10 A;  3EU4 A;  4TKY A;  3TRP A;  1XPV A;  4PUF C;  3H93 A;  3GTU B;  5ECR B;  4BPY A;  3K8N A;  1MTC A;  4K2D A;  2CZ3 A;  2JZT A;  2OAC A;  4LLR A;  3KZQ A;  3R3E A;  4OCE A;  2B5Y A;  4KAE A;  1XIY A;  5CRD A;  3QR6 A;  4Z2R A;  5BRT A;  2DJ0 A;  4USS A;  3HVS A;  5ECN B;  1X9W B;  3D0Z A;  5AIX A;  4XS4 A;  3W6G A;  1BQ7 A;  4AF2 A;  3L4N A;  4RI7 A;  4MJE A;  2I81 A;  1WMJ A;  5CRE A;  1JZD A;  5E59 A;  3A5W A;  4N0Z A;  2CAQ A;  5J9B A;  3US3 A;  4AJ6 A;  2HSM A;  5GAP D;  3IAS 2;  4HI7 A;  1W89 A;  4WKW A;  2C0E A;  4KGI A;  4PGT A;  1U88 A;  3ZYW A;  1VF1 A;  2CVK A;  4KSO A;  3ZLP A;  2O89 A;  4MK3 A;  2YWM A;  3FZ5 A;  4G9H A;  4A5P A;  2PBJ A;  2EIR A;  3WGD A;  1ILO A;  3OR5 A;  4YAV A;  3FR6 A;  1T8E B;  1YKA A;  1KBN A;  4XTS A;  2VM2 A;  3HD5 A;  1URM A;  1XFL A;  3M9K A;  3FZA A;  2PWJ A;  4POB A;  2VL9 A;  5LD0 A;  1Q4J A;  4KND A;  4F0C A;  3PR8 A;  1DE2 A;  4BL7 A;  2M46 A;  3LXZ A;  5ECI B;  2O7K A;  3WT1 A;  2VL2 C;  4TR1 A;  1Q98 A;  4TW5 A;  2GST A;  4O32 A;  2WZ9 A;  3ME8 A;  1O7U A;  1PMT A;  2HLS A;  2YP6 A;  3WD6 A;  6GSS A;  4TXO B;  1AW9 A;  1J9B A;  4NMU A;  3FY7 A;  1JZW A;  2V2G A;  3DIE A;  4TN8 A;  4MAB A;  5ECO B;  4G19 A;  3TOT A;  4ACS A;  1SKR B;  3G9B A;  1T00 A;  5IO2 A;  2VCX A;  4MF7 A;  2C0G A;  4K6X A;  1HQO A;  3RAZ A;  5LNK e;  2AB6 A;  4L5O A;  2O87 A;  6GSU A;  2VCZ A;  4ZIL A;  1HD2 A;  3GL3 A;  4GST A;  3G7Y A;  3GHA A;  1T7P B;  1BX9 A;  2OKA A;  4QL9 A;  3CQF A;  5CYY A;  5IMC A;  4PNG A;  2LJA A;  2XHF A;  3QAV A;  4PUR A;  1DE1 A;  4GXZ A;  1I9D A;  3TKS A;  1W4V A;  2GT5 A;  5IO0 A;  4EF0 A;  5J9C A;  5KEJ A;  2OE3 A;  5DJM A;  4XS4 B;  3NOF A;  4TXV A;  1U3I A;  2BMX A;  2YPM A;  1Z6M A;  4MNN A;  3IK7 A;  4N0V A;  2VLU A;  3W8S A;  4LMW A;  4EKZ A;  2DJK A;  2YOI A;  5ECL B;  3GA4 A;  2D2Z A;  2B5X A;  2L4C A;  3EYT A;  5INY A;  3F3R A;  3CMI A;  2R6K A;  3GX0 A;  4WBJ A;  4IBP A;  2E2M A;  3IE3 A;  3WT2 A;  1VRS D;  4Q5F A;  1Y25 A;  3FZ4 A;  4IHU A;  5DJL A;  2IMF A;  1S3D A;  4HUA A;  4I8B A;  3L0H A;  2OBK A;  2H0H A;  1G7E A;  1QXH A;  1V40 A;  1J0F A;  2A4V A;  5C04 A;  1FB0 A;  5EY6 A;  4FYB A;  3APQ A;  2IMD A;  3QAG A;  1SEN A;  3QDN A;  4GTU A;  2H19 A;  1HNB A;  4FQU A;  4BL7 B;  3WGE A;  3ERF A;  2GSQ A;  4HU9 A;  1H75 A;  4WXT A;  4PXO A;  1ZCP A;  2N5A A;  1K0A A;  3LXT A;  4TR1 B;  2H74 A;  2LS5 A;  3HJM A;  2FUG 2;  3E3E A;  1SJI A;  4WR4 A;  2ZNM A;  5E4W A;  1X5D A;  1GTA A;  1M3J A;  3GV1 A;  5DQY A;  1TTZ A;  3NZN A;  4WF4 A;  1O85 A;  2MYG A;  3RHB A;  5DBQ A;  3N5O A;  4I6X A;  2I1U A;  4XS6 A;  3EPT A;  2WB9 A;  2NTO A;  4IP1 A;  4MPF A;  4TR0 A;  3F9U A;  4KE3 A;  3GN3 A;  1TI1 A;  4XRA A;  3UIW A;  4WBR D;  3CTF A;  1GSD A;  2R3X A;  1ZOF A;  4K2X A;  2PN8 A;  2LJR A;  5F0G A;  2EIO A;  3F6F A;  2YWO A;  6GSY A;  5J41 A;  1G0T A;  1AXD A;  3VLN A;  2OAD A;  1K0C A;  4IS0 A;  2HRA A;  1DSB A;  2FLS A;  2VO4 A;  2H1G A;  3CXG A;  18GS A;  5J5N A;  3QAW A;  1O6J A;  3Q19 A;  4GQF A;  1R5P A;  4J57 E;  5KOW A;  2GQK A;  2CT6 A;  3MIX A;  3UAP A;  1M99 A;  4FYC A;  4HZ2 A;  1TW9 A;  3VUR A;  4KCE A;  4V1A g;  3RDW A;  3A3T A;  1GP1 A;  4NHW A;  2PVQ A;  2B1L A;  12GS A;  2LQQ A;  2VOC A;  4MZB A;  2V6O A;  3M1G A;  1SL1 B;  5IMF A;  2LJK A;  1PN9 A;  2C0F A;  3O6T A;  3GUS A;  1NHY A;  4I5Q A;  1EWX A;  2WGR A;  3KEB A;  1XW5 A;  2AYT A;  3ISO A;  2MMA A;  1SL0 B;  3E9J B;  4MA9 A;  2PGT A;  1GUK A;  1A8L A;  2NPB A;  5IOW A;  4ML6 A;  3L78 A;  3TKP A;  2AUV A;  1NM3 A;  1U3A A;  1GSY A;  4ZBA A;  1S3R A;  4IEL A;  3ERW A;  1RK4 A;  5AN1 A;  3I69 A;  3LFL A;  2TRC P;  4BIK A;  2GSS A;  4CY8 A;  2KOK A;  3N9J A;  3KXO A;  4HS1 A;  2F9S A;  1OC8 A;  2K6V A;  3TJF A;  1E2Y A;  4OMV A;  3GMF A;  2GZP A;  2KP1 A;  5D96 A;  2VCW A;  3IPZ A;  1MDK A;  3IOS A;  3UAR A;  1CQG A;  2IN3 A;  2AAW A;  2L6C A;  4MDC A;  4KF9 A;  4I2U A;  1FHE A;  1BJX A;  1WIK A;  4K7O A;  4MP4 A;  5KN0 A;  5B8B A;  2P5R A;  3UVT A;  5C00 A;  5G1K A;  3TJG A;  4OO4 A;  2B7J A;  3PH9 A;  2RM6 A;  4HQZ A;  4QL7 A;  2B1K A;  6GSX A;  3QMX A;  4LL1 B;  2ZUP A;  3LG6 A;  3PIN A;  5A5K A;  2LUS A;  3D6I A;  5DCG A;  3H8Q A;  2GQM A;  4K1F A;  4HDE A;  4HJM A;  4XHM A;  3C8E A;  4J2F A;  2CVB A;  3HA9 A;  2H8L A;  4MPG A;  4JZQ A;  4MZC A;  5H5R A;  1E6B A;  4RQR A;  2OE0 A;  4K5R A;  1JHB A;  3KH9 A;  3GNJ A;  3BCI A;  1JZR A;  1IYH A;  4YQU A;  1AIU A;  1ERU A;  3DXB A;  4ID0 A;  3FR9 A;  1BAY A;  1XZO A;  5DAL A;  3VI7 A;  1NHO A;  5IPG A;  1B9X C;  1ZGN A;  3F3Q A;  5GZZ B;  5G5E A;  1QK8 A;  1WJK A;  2VIM A;  4F03 A;  1O73 A;  1NW2 A;  2E7P A;  2IJY A;  3QCP A;  3FW2 A;  5B6N A;  3F63 A;  2E2G A;  4ZIJ A;  3FZ9 A;  1T3B A;  2HI7 A;  1A24 A;  1VF2 A;  4KH7 A;  3FYG A;  3VWU A;  4KB3 A;  1O8W A;  1FOH A;  2L57 A;  1MD3 A;  2OBI A;  7GSS A;  1VF4 A;  4N11 A;  2HNL A;  1EP8 A;  3ZMK A;  4BVX A;  4YH2 A;  3A5I A;  2MMZ A;  5EPF A;  2WFC A;  3FRC A;  1V57 A;  2K18 A;  4JRR A;  5ECM B;  4MCU A;  1G7O A;  1ZYE A;  3FKF A;  2WCI A;  3DEX A;  2VLV A;  1A0R P;  4YQM A;  4MMM A;  2A4H A;  4ZBB A;  1SKW B;  1TOF A;  1F6M C;  1IYI A;  2H70 A;  3CRU A;  2LRN A;  4FIW A;  1PGT A;  2LEG A;  4IJ3 A;  3BBY A;  4K7I A;  3IK9 A;  1M9A A;  4PQH A;  5B7C A;  3QOU A;  3M3M A;  3FR3 A;  1SJ6 A;  5KN3 A;  1YZX A;  2H01 A;  2LKU A;  1OYJ A;  3ERG A;  4NXI A;  4DEJ A;  1XWK A;  1TXX A;  2VUP A;  5HQP A;  4POL A;  4MZW A;  2R0P A;  4F9Z A;  2IIY A;  3D4T A;  4MH3 A;  1TKD B;  1YF0 A;  2DKI A;  2WUL A;  3GL5 A;  4N10 A;  2RLI A;  3DD3 A;  3I9V 2;  4I97 A;  2GTU A;  3DWV A;  1FW1 A;  2IWT A;  2QSI A;  1MD4 A;  4P3Y B;  4Q5N A;  3PPU A;  4ECJ A;  1F2E A;  5ECK B;  3HJP A;  2GGT A;  4I2T A;  4TR4 A;  1VF3 A;  3EMP A;  2GSR A;  13GS A;  1GTB A;  1FVK A;  4TR3 A;  3BD2 A;  2ON7 A;  4L5L A;  2CAI A;  3IC8 A;  4F82 A;  4F2I A;  3UOM A;  4PQ1 A;  2ZCT A;  1A0F A;  4KX4 A;  3HVV A;  5IPH A;  2PPT A;  3HKR A;  1XW9 A;  3GFK A;  3D21 A;  1BYE A;  4X43 A;  1G6Y A;  5COH A;  1OAZ A;  4OCF A;  3VWW A;  1PA3 A;  5HR3 A;  1EP7 A;  5DAL B;  4EDY A;  3D22 A;  1N8J A;  1KEB A;  2HSH A;  3DKS A;  2I4A A;  4ZXG A;  4DSQ A;  2QKE A;  3CSI A; 
#chains in the Genus database with same CATH homology
 2FCH A;  3VPQ A;  2IMI A;  1MDJ A;  1ERW A;  1MDI A;  3IAM 2;  1G6W A;  3GX8 A;  4ZBD A;  1ACV A;  3HVX A;  3I6A A;  4BVX B;  5IIZ A;  4MLY A;  1VGL A;  1WRY A;  2YV7 A;  1CQH A;  2H1A A;  2XBI A;  3UBK A;  2DBC A;  3CRT A;  5ECQ B;  4O7H A;  3VI5 A;  4L0U A;  3ZRE A;  3APS A;  3DVX A;  4K0G A;  1UVZ A;  5ID2 A;  2FWF A;  3MSZ A;  5GST A;  3U5R E;  3GST A;  1RQM A;  1EV9 A;  3IBH A;  1X9S B;  3RPP A;  4IP6 A;  1T4Z A;  2CZ2 A;  1ZYN A;  1TK0 B;  4EIQ A;  1PX7 A;  2YJ7 A;  3GUR A;  3U6V A;  3IV4 A;  2VD1 A;  2NBS A;  2BJX A;  1OC9 A;  3FMW A;  3GKX A;  2FA4 A;  5DVB A;  2DJ2 A;  3FK8 A;  3TRQ A;  4WET A;  3VFI A;  1K3O A;  4ECC A;  4OD7 A;  3UMA A;  4HU7 A;  4RQX A;  4XCS A;  2L6D A;  4ZB6 A;  2HE3 A;  4HQS A;  2VL2 A;  4GWR A;  2GLR A;  2IMK A;  2REM A;  1XWB A;  3LYK A;  4KA0 A;  2DJ3 A;  5ELG A;  3GRX A;  2GZZ A;  2YZH A;  1B8X A;  1M9B A;  3IR4 A;  5JCW A;  1SD8 A;  3IDV A;  5AIS A;  4BVY A;  1GRX A;  4GCI A;  1THX A;  3C1S A;  5F05 A;  3FHK A;  2GT6 A;  4IN0 A;  1FO5 A;  2FWE A;  2GQL A;  4L0W A;  2UZ8 A;  1M7T A;  2LNS A;  2A2R A;  2CA8 A;  2CVD A;  2CX3 A;  1ZYQ B;  3GKK A;  5EL8 A;  5ENU A;  3PGT A;  1PL1 A;  1YDK A;  2V32 A;  4Z2T A;  2YNX A;  3P7X A;  3HDC A;  1ST9 A;  1X5E A;  1EOG A;  2JZS A;  4POK A;  1GSE A;  3KD0 A;  5CRG A;  1I5G A;  4EUY A;  2QA1 A;  3TJK A;  1AQX A;  4IVF A;  3O76 A;  2QA2 A;  2YWI A;  2JSZ A;  1C72 A;  3LQ7 A;  1WOU A;  4CDO A;  1AQW A;  1SYR A;  4O5Q A;  5ECP B;  1OKD A;  3KP9 A;  4J56 E;  2VCV A;  3W8J A;  1N2A A;  2X8H A;  4TVE A;  1Z6N A;  4FYU A;  1F37 A;  3TB2 A;  1GNW A;  1K0D A;  1K0O A;  1TU7 A;  5L71 A;  2PER A;  1XCC A;  6GSV A;  19GS A;  1SJZ A;  1GUH A;  2YJH A;  3Q18 A;  1YY7 A;  5HR2 A;  1GUL A;  4JR6 A;  3ZFL A;  1GTI A;  4FH8 A;  1GTU A;  1WPI A;  4CHS A;  5ID2 B;  3UEM A;  2V6K A;  4IW9 A;  2C3Q A;  5ABR A;  2YV9 A;  2FY6 A;  2OE1 A;  2QGV A;  1ML6 A;  1USB A;  3VWV A;  1XBS A;  5DAK A;  2AV4 A;  3TKS E;  2F51 A;  4X4J A;  1GSF A;  3BJ5 A;  2FGX A;  1UN2 A;  1OC9 B;  5HFG A;  17GS A;  4X0X A;  5LCZ A;  1WP0 A;  3L9V A;  4YKF A;  4OFT A;  2YZU A;  4IJI A;  2O85 A;  4NAX A;  5IOX A;  3SBC A;  4JBB A;  5B6M A;  1K0M A;  5GSS A;  2Z9S A;  2R0G A;  3L9S A;  3BOA A;  3LWA A;  1JLV A;  3RHC A;  4K7N A;  1ZMA A;  5G31 A;  4X1U A;  3DGQ A;  4DSS A;  3LEF A;  1WWJ A;  3LW9 A;  1XVW A;  1YF1 A;  4K9Z A;  3E0U A;  1S3C A;  3ME7 A;  2YN1 A;  4ECI A;  2B3S A;  4BVY B;  1OKT A;  4EO3 A;  1AC1 A;  2G2Q A;  3ZML A;  5CRH A;  2DC5 A;  5IMZ A;  4MF5 A;  4O5U A;  2O8V B;  3A2W A;  3P2A A;  1M0U A;  1OVN A;  2H6Z A;  2P31 A;  4KW6 A;  3FEU A;  3LYP A;  1ZL9 A;  3ZTL A;  2HRN A;  2DMM A;  4RUV A;  2F8F A;  4V1A p;  3D5J A;  5HR1 A;  5JWR B;  2YCD A;  1QUW A;  5A4V A;  1DUG A;  2LTK A;  3TKQ A;  1EZK A;  1EV4 A;  4K0N A;  2JAC A;  1T4Y A;  3Q6O A;  5F07 A;  4YAP A;  2J9H A;  1GUM A;  2X8C A;  2XC2 A;  22GS A;  4K8M A;  4HZ4 A;  1ZZY A;  3KH7 A;  2X99 A;  4L8E A;  1YEP A;  4NPB A;  3CSJ A;  4JED A;  5G5F A;  1V58 A;  3H4K A;  1JZO A;  4CY6 A;  3DRN A;  5A4W A;  3F0I A;  2LRT A;  2K9F A;  4EE0 A;  2AHE A;  5KN2 A;  3CSH A;  1V98 A;  5H5S A;  1X0R A;  1XWG A;  2I3Y A;  1SKS B;  3VWX A;  2C0D A;  4E8H A;  2GDR A;  3J7Y k;  1FAA A;  3MDK A;  3GSS A;  2XPD A;  2LRC A;  1PKZ A;  4GF0 A;  3IRA A;  3S9F A;  2H1D A;  1O81 A;  4E8E A;  3G7J A;  2R0C A;  2WDU A;  4BA7 A;  2HYX A;  5DAK B;  9GSS A;  4N30 A;  4XIH A;  2KP2 A;  1PD2 1;  3CBU A;  3ED3 A;  2C8U A;  2FD3 A;  1XOB A;  2HZF A;  4EC0 A;  1PQN A;  3TJB A;  1TRU A;  4YKG A;  2ALB A;  2JAD A;  2MMO A;  2N5B A;  5G2Z A;  1TI3 A;  2RII A;  4WR5 A;  3CYN A;  4RI6 A;  1ABA A;  1BED A;  4TOP A;  5CNW A;  3DML A;  4DSS B;  2CV4 A;  2H72 A;  2JSY A;  4WF5 A;  2KUC A;  2OJL A;  4GRF A;  3ZVJ A;  4LMV A;  4ML1 A;  2V41 A;  2NDO A;  1XOA A;  1R5A A;  1TRW A;  2IFQ A;  2QC7 A;  1PKW A;  1OC3 A;  4ICY A;  3EVI A;  2H30 A;  1WE0 A;  4GSS A;  1AUC A;  4PQI A;  1V9W A;  5D9X A;  1YJ6 A;  3MNG A;  3GYK A;  1GL8 A;  5D9T A;  5JWQ B;  5B8A A;  1GSS A;  2BTO T;  3RBT A;  3CTG A;  2YWN A;  1MEK A;  2HRK A;  3GIX A;  4TRX A;  3A2V A;  3ZIT A;  1GSU A;  3UBL A;  3SWL A;  3TDG A;  3F6D A;  2TIR A;  3TUE A;  2OA7 A;  5D93 A;  5DDL A;  3MAK A;  4ZL9 A;  1GWC A;  1R7H A;  1KTE A;  3TKS C;  2MBS A;  5D9W A;  4KSM A;  3EWL A;  2F3M A;  3LSZ A;  5HFK A;  4NV2 A;  2IME A;  4HOJ A;  4ZL7 A;  4G0I A;  2FWH A;  2ES7 A;  2HZE A;  1K0N A;  1LJR A;  3DVW A;  4V2M A;  2H75 A;  16GS A;  1SU9 A;  3P8W A;  1M2D A;  3C7M A;  3TKR A;  4O92 A;  1PSQ A;  2EC4 A;  1JLW A;  2H66 A;  14GS A;  4OFM A;  1GNE A;  1TRV A;  4MJA A;  2IL3 A;  2DML A;  2H0I A;  3GKN A;  4IQA A;  5JWO B;  1UC7 A;  3TOU A;  5ECH B;  1A8Y A;  1HYU A;  1SK0 A;  3VK9 A;  4IKH A;  4YQV A;  10GS A;  3I43 A;  2VLT A;  2H71 A;  1A23 A;  1Z7P A;  4ILF A;  1FB6 A;  3RPN A;  3ZVJ D;  1H4O A;  2DIY A;  3G7I A;  4IQ1 A;  2LST A;  1FG4 A;  3GH6 A;  5D9V A;  1XW6 A;  3C71 A;  1SK2 A;  2L59 A;  8GSS A;  2G0F A;  3LGC A;  1NSW A;  3ZRD A;  4HJ2 A;  5KN1 A;  1TK8 B;  1T1V A;  2DJ1 A;  5AGY A;  4PNF A;  4G2E A;  1YKC A;  2DSA A;  1EEM A;  2R37 A;  4KCA A;  2VM1 A;  3C1R A;  4MJB A;  3EU3 A;  1OE8 A;  3IHQ A;  2DIZ A;  1RW1 A;  5IMA A;  1XXU A;  3HZ8 A;  2GVP A;  3HYP A;  2RM5 A;  4K5S A;  3LJR A;  2C3N A;  2IFQ B;  2A2S A;  1X5C A;  4EDZ A;  2LV3 A;  5H5Q A;  4EVM A;  3QPM A;  3EE2 A;  4KDY A;  4EL1 A;  1SD9 A;  3V1W A;  3C73 A;  5CO3 A;  2CX4 A;  1GLQ A;  3KCM A;  3KTB A;  3VPT A;  3KMN A;  3F4R A;  2JL4 A;  2E0Q A;  1B48 A;  1PX6 A;  4ISD A;  3EUR A;  4DVC A;  2X49 A;  4XRD A;  3ZZX A;  2IPA A;  2JZR A;  1XWA A;  4V2N A;  1QMV A;  4HEA 2;  2C80 A;  3IXR A;  3HY2 A;  3IA1 A;  3TJJ A;  3M0F A;  1A2J A;  4EXJ A;  2ON5 A;  4KUN A;  1B9Y C;  1O8X A;  2PVO C;  2X8G A;  4D73 A;  3HJO A;  3GH9 A;  3HHV A;  2XBQ A;  4EIP A;  1UA5 A;  2HZE B;  1AAZ A;  5JCU A;  2GS3 A;  3M9J A;  2DLX A;  2LNT A;  4PX1 A;  3KM6 A;  1Z5Y E;  2MBT A;  3R2Q A;  3P90 A;  4CW9 A;  1EGR A;  4JE1 A;  5G1L A;  2V1M A;  2VCT A;  2X4A A;  4H86 A;  2RUF A;  2PMT A;  2M72 A;  2GZY A;  1B4Q A;  3KIJ A;  3KP8 A;  3HCZ A;  1B4P A;  2C3T A;  2NVL A;  4GLT A;  2A2P A;  3KTL A;  11GS A;  4BWQ A;  3UVH A;  3Q74 A;  1EEJ A;  1EGO A;  4ECB A;  4BWS A;  5FHI A;  5IMD A;  1X9M B;  4AGS A;  5GAN D;  1TRS A;  1Z3E A;  2K8S A;  2L5L A;  3F4T A;  2PUK C;  1F3A A;  5CP1 A;  1AQV A;  1Z9H A;  4Q5Q A;  4Z2U A;  5FWG A;  5IM9 A;  4GSN A;  1SYX A;  6GSW A;  4QQ7 A;  1SK1 A;  4NHZ A;  1TK5 B;  3O3T A;  2LQO A;  3J7Y b;  3MWH A;  1V2A A;  3QD9 A;  5JCG A;  1OE7 A;  1K0B A;  5DQS A;  3HXS A;  1THO A;  2K8V A;  1QGV A;  3TGZ A;  1GSQ A;  1LBK A;  2X64 A;  2H6Y A;  5HFI A;  1PRX A;  2H1B A;  2CQ9 A;  4LA1 A;  3H79 A;  1TDI A;  1M2A A;  5IQY A;  3EC3 A;  5IMV A;  5KOX A;  3ZIV A;  5G30 A;  2HSY A;  5BMU A;  1XVQ A;  2RUE A;  4G0L A;  2I9H A;  2FA8 A;  2N5F A;  3JCM L;  4ZB9 A;  3QFB C;  3DYR A;  4KDU A;  2L4Q A;  3A2X A;  4D73 B;  2B6M A;  3UL3 A;  3M8N A;  4GQC A;  3ZIJ A;  4AJ7 A;  3LOR A;  1GH2 A;  5ELA A;  3ZFB A;  2R4V A;  2VAF A;  4KDX A;  4MH2 A;  3GTU A;  1EOH A;  2TRX A;  2H0G A;  4XS1 A;  2HXK A;  2R5G A;  2DJJ A;  2FWG A;  4PTS A;  5F06 A;  3APO A;  1R4W A;  2YAN A;  4WEY A;  2HRF A;  1KNG A;  3D4M A;  3F8U A;  4NV5 A;  2L5O A;  4OWY A;  4ULX A;  2JU5 A;  2F8A A;  2WS2 A;  1Y6E A;  5F8B A;  4LL4 B;  4JR4 A;  1PL2 A;  4FO5 A;  3TRX A;  1F3B A;  3GKM A;  1S3A A;  4V2L A;  1A2M A;  4IGJ A;  1QQ2 A;  3F4S A;  4G0K A;  4NWY A;  2R2J A;  1R26 A;  2HT9 A;  1J08 A;  3UJ1 A;  1JFU A;  3QFA C;  5CRW A;  2VL3 A;  2KLX A;  5D73 A;  1FOV A;  1TP9 A;  5CAX A;  5AIV A;  4MJC A;  2H6X A;  5D8I A;  3KMO A;  5DCH A;  4DSR A;  4JU5 A;  1PN0 A;  1TJD A;  2MZC A;  1Z7R A;  2WRT A;  2B7K A;  1SL2 B;  2J23 A;  2FNO A;  1HNA A;  5FT3 A;  3WGX A;  3MYD A;  1ON4 A;  4OFN A;  2H76 A;  3H1N A;  1K3Y A;  6GST A;  4O5R A;  20GS A;  2P5Q A;  3L9U A;  1DBY A;  2H73 A;  3HZ4 A;  1U87 A;  3KJY A;  4OO5 A;  2AJQ B;  2DKH A;  3NIV A;  1XWC A;  4Z7X A;  2FHE A;  2WJU A;  5EVO A;  3KGK A;  3BCK A;  4MF6 A;  2B5E A;  2EIQ A;  2P0G A;  1LU4 A;  3IC4 A;  5A4U A;  3ZL5 A;  4TXO A;  4F0B A;  1ZYP A;  2C1Y A;  1YQ1 A;  1TU8 A;  2VD0 A;  1QFN A;  3EMX A;  4AJ8 A;  5J3R A;  5HR0 A;  3AY8 A;  2MMN A;  1HNC A;  2PU9 C;  3WYW A;  2VCQ A;  4ZB8 A;  2M80 A;  1M2B A;  1U6T A;  1K3L A;  3IHG A;  2C4J A;  3EIN A;  2KHP A;  2XPE A;  4ZL8 A;  1BG5 A;  1FVJ A;  1A2L A;  4POM A;  1ERV A;  1GLP A;  1YEX A;  4Q5R A;  5J4U A;  1F9M A;  5ECS A;  1ERT A;  2HFD A;  3TCO A;  4PUA A;  4G10 A;  3EU4 A;  4TKY A;  3TRP A;  1XPV A;  4PUF C;  3H93 A;  3GTU B;  5ECR B;  4BPY A;  3K8N A;  1MTC A;  4K2D A;  2CZ3 A;  2JZT A;  2OAC A;  4LLR A;  3KZQ A;  3R3E A;  4OCE A;  2B5Y A;  4KAE A;  1XIY A;  5CRD A;  3QR6 A;  4Z2R A;  5BRT A;  2DJ0 A;  4USS A;  3HVS A;  5ECN B;  1X9W B;  3D0Z A;  5AIX A;  4XS4 A;  3W6G A;  1BQ7 A;  4AF2 A;  3L4N A;  4RI7 A;  4MJE A;  2I81 A;  1WMJ A;  5CRE A;  1JZD A;  5E59 A;  3A5W A;  4N0Z A;  2CAQ A;  5J9B A;  3US3 A;  4AJ6 A;  2HSM A;  5GAP D;  3IAS 2;  4HI7 A;  1W89 A;  4WKW A;  2C0E A;  4KGI A;  4PGT A;  1U88 A;  3ZYW A;  1VF1 A;  2CVK A;  4KSO A;  3ZLP A;  2O89 A;  4MK3 A;  2YWM A;  3FZ5 A;  4G9H A;  4A5P A;  2PBJ A;  2EIR A;  3WGD A;  1ILO A;  4YAV A;  3OR5 A;  3FR6 A;  1T8E B;  1YKA A;  1KBN A;  4XTS A;  2VM2 A;  3HD5 A;  1URM A;  1XFL A;  3M9K A;  3FZA A;  2PWJ A;  4POB A;  2VL9 A;  5LD0 A;  1Q4J A;  4KND A;  4F0C A;  3PR8 A;  1DE2 A;  4BL7 A;  2M46 A;  3LXZ A;  5ECI B;  2O7K A;  3WT1 A;  2VL2 C;  4TR1 A;  1Q98 A;  4TW5 A;  2GST A;  4O32 A;  2WZ9 A;  3ME8 A;  1O7U A;  1PMT A;  2HLS A;  2YP6 A;  3WD6 A;  6GSS A;  4TXO B;  1AW9 A;  1J9B A;  4NMU A;  3FY7 A;  1JZW A;  2V2G A;  3DIE A;  4TN8 A;  4MAB A;  5ECO B;  4G19 A;  3TOT A;  4ACS A;  1SKR B;  3G9B A;  1T00 A;  5IO2 A;  2VCX A;  4MF7 A;  2C0G A;  4K6X A;  1HQO A;  3RAZ A;  5LNK e;  2AB6 A;  4L5O A;  2O87 A;  6GSU A;  2VCZ A;  4ZIL A;  1HD2 A;  3GL3 A;  4GST A;  3G7Y A;  3GHA A;  1T7P B;  1BX9 A;  2OKA A;  4QL9 A;  5CYY A;  5IMC A;  4PNG A;  2LJA A;  2XHF A;  3QAV A;  4PUR A;  1DE1 A;  4GXZ A;  1I9D A;  3TKS A;  1W4V A;  2GT5 A;  5IO0 A;  4EF0 A;  5J9C A;  5KEJ A;  2OE3 A;  5DJM A;  4XS4 B;  3NOF A;  4TXV A;  1U3I A;  2BMX A;  2YPM A;  1Z6M A;  4MNN A;  3IK7 A;  4N0V A;  2VLU A;  3W8S A;  4LMW A;  4EKZ A;  2DJK A;  2YOI A;  5ECL B;  3GA4 A;  2D2Z A;  2B5X A;  2L4C A;  3EYT A;  5INY A;  3F3R A;  3CMI A;  2R6K A;  3GX0 A;  4WBJ A;  4IBP A;  2E2M A;  3IE3 A;  3WT2 A;  1VRS D;  4Q5F A;  1Y25 A;  3FZ4 A;  4IHU A;  5DJL A;  2IMF A;  1S3D A;  4HUA A;  4I8B A;  3L0H A;  2OBK A;  2H0H A;  1G7E A;  1QXH A;  1V40 A;  1J0F A;  2A4V A;  5C04 A;  1FB0 A;  5EY6 A;  4FYB A;  3APQ A;  2IMD A;  3QAG A;  1SEN A;  3QDN A;  4GTU A;  2H19 A;  1HNB A;  4FQU A;  4BL7 B;  3WGE A;  3ERF A;  2GSQ A;  4HU9 A;  1H75 A;  4WXT A;  4PXO A;  1ZCP A;  2N5A A;  1K0A A;  3LXT A;  4TR1 B;  2H74 A;  2LS5 A;  3HJM A;  2FUG 2;  3E3E A;  1SJI A;  4WR4 A;  2ZNM A;  5E4W A;  1X5D A;  1GTA A;  3GV1 A;  5DQY A;  1TTZ A;  3NZN A;  4WF4 A;  1O85 A;  2MYG A;  3RHB A;  5DBQ A;  3N5O A;  4I6X A;  2I1U A;  4XS6 A;  3EPT A;  2WB9 A;  2NTO A;  4IP1 A;  4MPF A;  4TR0 A;  3F9U A;  4KE3 A;  3GN3 A;  1TI1 A;  4XRA A;  3UIW A;  4WBR D;  3CTF A;  1GSD A;  2R3X A;  1ZOF A;  4K2X A;  2PN8 A;  2LJR A;  5F0G A;  2EIO A;  3F6F A;  2YWO A;  6GSY A;  5J41 A;  1G0T A;  1AXD A;  3VLN A;  2OAD A;  1K0C A;  4IS0 A;  2HRA A;  1DSB A;  2FLS A;  2VO4 A;  2H1G A;  3CXG A;  18GS A;  5J5N A;  3QAW A;  1O6J A;  3Q19 A;  4GQF A;  1R5P A;  4J57 E;  5KOW A;  2GQK A;  2CT6 A;  3MIX A;  3UAP A;  1M99 A;  4FYC A;  4HZ2 A;  1TW9 A;  3VUR A;  4KCE A;  4V1A g;  3RDW A;  3A3T A;  1GP1 A;  4NHW A;  2PVQ A;  2B1L A;  12GS A;  2LQQ A;  2VOC A;  4MZB A;  2V6O A;  3M1G A;  1SL1 B;  5IMF A;  2LJK A;  1PN9 A;  2C0F A;  3O6T A;  3GUS A;  1NHY A;  4I5Q A;  1EWX A;  2WGR A;  3KEB A;  1XW5 A;  2AYT A;  3ISO A;  2MMA A;  1SL0 B;  3E9J B;  4MA9 A;  2PGT A;  1GUK A;  1A8L A;  2NPB A;  5IOW A;  4ML6 A;  3L78 A;  3TKP A;  2AUV A;  1NM3 A;  1U3A A;  1GSY A;  4ZBA A;  4IEL A;  3ERW A;  1RK4 A;  5AN1 A;  3I69 A;  3LFL A;  2TRC P;  2GSS A;  4CY8 A;  2KOK A;  3N9J A;  3KXO A;  4HS1 A;  2F9S A;  1OC8 A;  2K6V A;  3TJF A;  1E2Y A;  4OMV A;  3GMF A;  2GZP A;  2KP1 A;  5D96 A;  2VCW A;  3IPZ A;  1MDK A;  3IOS A;  3UAR A;  1CQG A;  2IN3 A;  2AAW A;  2L6C A;  4MDC A;  4KF9 A;  4I2U A;  1FHE A;  1BJX A;  1WIK A;  4K7O A;  4MP4 A;  5KN0 A;  5B8B A;  2P5R A;  3UVT A;  5C00 A;  5G1K A;  3TJG A;  4OO4 A;  2B7J A;  3PH9 A;  2RM6 A;  4HQZ A;  4QL7 A;  2B1K A;  6GSX A;  3QMX A;  4LL1 B;  2ZUP A;  3LG6 A;  3PIN A;  5A5K A;  2LUS A;  3D6I A;  5DCG A;  3H8Q A;  2GQM A;  4K1F A;  4HDE A;  4HJM A;  4XHM A;  3C8E A;  4J2F A;  2CVB A;  3HA9 A;  2H8L A;  4MPG A;  4JZQ A;  4MZC A;  5H5R A;  1E6B A;  4RQR A;  2OE0 A;  4K5R A;  1JHB A;  3KH9 A;  3GNJ A;  3BCI A;  1JZR A;  1IYH A;  4YQU A;  1AIU A;  1ERU A;  3DXB A;  4ID0 A;  3FR9 A;  1BAY A;  1XZO A;  5DAL A;  3VI7 A;  1NHO A;  5IPG A;  1B9X C;  1ZGN A;  3F3Q A;  5GZZ B;  5G5E A;  1QK8 A;  1WJK A;  2VIM A;  4F03 A;  1O73 A;  1NW2 A;  2E7P A;  2IJY A;  3QCP A;  3FW2 A;  5B6N A;  3F63 A;  2E2G A;  4ZIJ A;  3FZ9 A;  1T3B A;  2HI7 A;  1A24 A;  1VF2 A;  4KH7 A;  3FYG A;  3VWU A;  4KB3 A;  1O8W A;  1FOH A;  2L57 A;  1MD3 A;  2OBI A;  7GSS A;  1VF4 A;  4N11 A;  2HNL A;  1EP8 A;  3ZMK A;  4BVX A;  4YH2 A;  3A5I A;  2MMZ A;  5EPF A;  2WFC A;  3FRC A;  1V57 A;  2K18 A;  4JRR A;  5ECM B;  4MCU A;  1G7O A;  1ZYE A;  3FKF A;  2WCI A;  3DEX A;  2VLV A;  1A0R P;  4YQM A;  4MMM A;  2A4H A;  4ZBB A;  1SKW B;  1TOF A;  1F6M C;  1IYI A;  2H70 A;  3CRU A;  2LRN A;  4FIW A;  1PGT A;  2LEG A;  4IJ3 A;  3BBY A;  4K7I A;  3IK9 A;  1M9A A;  4PQH A;  5B7C A;  3QOU A;  3M3M A;  3FR3 A;  1SJ6 A;  5KN3 A;  1YZX A;  2H01 A;  2LKU A;  1OYJ A;  3ERG A;  4NXI A;  4DEJ A;  1XWK A;  1TXX A;  2VUP A;  5HQP A;  4POL A;  4MZW A;  2R0P A;  4F9Z A;  2IIY A;  3D4T A;  4MH3 A;  1TKD B;  1YF0 A;  2DKI A;  2WUL A;  3GL5 A;  4N10 A;  2RLI A;  3DD3 A;  3I9V 2;  4I97 A;  2GTU A;  3DWV A;  1FW1 A;  2IWT A;  2QSI A;  1MD4 A;  4P3Y B;  4Q5N A;  3PPU A;  4ECJ A;  1F2E A;  5ECK B;  3HJP A;  2GGT A;  4I2T A;  4TR4 A;  1VF3 A;  3EMP A;  2GSR A;  13GS A;  1GTB A;  1FVK A;  4TR3 A;  3BD2 A;  2ON7 A;  4L5L A;  2CAI A;  3IC8 A;  4F82 A;  4F2I A;  3UOM A;  4PQ1 A;  2ZCT A;  1A0F A;  4KX4 A;  3HVV A;  5IPH A;  2PPT A;  3HKR A;  1XW9 A;  3GFK A;  3D21 A;  1BYE A;  4X43 A;  1G6Y A;  5COH A;  1OAZ A;  4OCF A;  3VWW A;  1PA3 A;  5HR3 A;  1EP7 A;  5DAL B;  4EDY A;  3D22 A;  1N8J A;  1KEB A;  2HSH A;  3DKS A;  2I4A A;  4ZXG A;  4DSQ A;  2QKE A;  3CSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...