3BCWA

Crystal structure of a duf861 family protein with a rmlc-like cupin fold (bb1179) from bordetella bronchiseptica rb50 at 1.60 a resolution
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
118
structure length
118
Chain Sequence
HDKSRLVRIDTGPMINPVAGKPSRPIAGDASFRTVTAFEGGQGKVESGVWESTSGSFQSNTTGYIEYCHIIEGEARLVDPDGTVHAVKAGDAFIMPEGYTGRWEVDRHVKKIYFVTHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of domain of unknown function with a RmlC-like cupin fold (NP_887725.1) from Bordetella bronchiseptica at 1.60 A resolution
rcsb
molecule keywords Uncharacterized protein
source organism Bordetella bronchiseptica rb50
molecule tags Unknown function
total genus 22
structure length 118
sequence length 118
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05899 Cupin_3 Protein of unknown function (DUF861)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3bcwA01
1OFNA 1Q3EA 4Q0QA 5AVPA 4HSJA 3SCHA 3NJZA 4QXKA 1H1MA 5EFUA 3U11A 5LEKA 3I59A 3E6DA 3PLQA 3WW1A 1O7FA 4QX5A 5JCTA 4MZUA 1CAUA 2XL9A 1PMIA 1UPIA 5FLJA 2IXIA 3TNPB 3L2HA 1UIKA 1XE8A 4QMAA 2KXLA 2VQAA 5KBFA 2QVSB 4MX3A 3S7IA 5J7MA 1WA4A 1SEFA 3LA3A 1WGPA 4QGNA 1CAXA 5C6CA 1Q5OA 2BEOA 2CGPA 4I2OA 4KL1A 2IXCA 3H7YA 4QM9A 3E5QA 3FE5A 4HZFA 3TNQA 3OCPA 4LLOA 2UY8A 4KWLA 3DN7A 3EHKA 1DZTA 3S0MA 3LA7A 5LRSA 2N7GA 4QGMA 3I54A 3KGLA 2XGXA 1ZRRA 4GULA 3GBFA 5JSOA 5HI0A 4QGLA 4IEXA 1YFYA 3VHRA 2GC1A 3EQEA 4LA2A 3LWCA 4RD7A 2XHKA 3RNSA 4EWAA 5J3UA 2ZCWA 1ZX5A 3UKNA 1NZCA 4I3PA 2B8MA 4N9IA 4MGZE 1X7NA 2ET1A 4YARA 5FLIA 4AQ2A 3U10A 3B02A 3HT1A 4BHPA 1CAVA 4PIYA 1X82A 2K0GA 4ONUA 4XF0A 2WFPA 1O3SA 3E6BA 1ZRCA 1QWRA 3CEWA 3PNAA 1OI6A 1YFXA 4HVRA 1CX4A 1FXZA 2GH2A 5I0SA 1ZREA 1RGSA 2EVXA 3C3VA 4KU8A 3BB6A 4WBBA 3UKVA 3CLPA 2GZWA 3OD0A 3ACLA 4LUMA 4ORFA 4MGKE 3H1WA 1FT9A 2UYAA 3KSCA 3MDPA 5FLHA 5KHKA 4ZU5A 1V70A 2D5HA 3H1YA 1UW8A 1WLTA 2GC2A 3RYRA 4FBFA 4KWKA 2MNGA 2Z2SB 2OA2A 4HVOA 4LULA 3CL1A 4IEVA 1ZZ7A 2EA7A 4IEOA 5FPXA 1LB2A 5FDBA 2ET7A 4HMZA 4XF4A 3MPBA 1O4TA 4MV2A 1GQHA 4XETA 3E5XA 2XKPA 3HT2A 5KHGA 1NXMA 5CVRA 4FAGA 2B9UA 1ZZBA 1YFUA 4E2GA 2Q1ZB 1TQ5A 1J3RA 4ZU7A 4WVZA 1ZZ9A 2PTMA 3H50A 2WC2A 2PFWA 5FCCA 2CAVA 2OPKA 1Q43A 3D0SA 1IPKA 2H0VA 3FJSA 3SHRA 5CADA 5I0RA 3SMHA 4XEZA 4LUKA 5J48A 1JUHA 3UKTA 3D0JA 2O1QA 4HLTA 4IEWA 3CF6E 5JSPA 3SCGA 2OZ6A 3RYKA 4R52A 4P9GA 4H7LA 3FFQA 3DKWA 2Q4SA 2I45A 5KHHA 3USSA 2IXLA 1U12A 5EZWA 1RC6A 4B29A 4HN0A 4KU7A 4BIFA 5I0TA 1X8MA 1O3QA 1ZNPA 3KMHA 4JTOA 4MGYE 4WZCA 2XLAA 5I93A 4IEPA 3U0ZA 5I91A 2GC3A 4XFBA 2MPFA 1GQGA 5FPZA 3E97A 3FX3A 4I0BA 1EYBA 1CAWB 1UIJA 3OGJA 1DGWA 2D93A 4HBNA 1G6NA 3RPQA 4MH0E 4XF3A 4UBHA 3BALA 5KHIA 5I8SA 3EO6A 4YYOA 3QOPA 1YWKA 1YLLA 4HN1A 2PHLA 3OTFA 3NKTA 4XFCA 3BCWA 1QY4A 1EPZA 3O14A 4HVQA 3N4MA 3M70A 2IXHA 3SCFA 4OLLA 3IWZA 3OF1A 2ETEA 3M3IA 3MYXA 5C8WA 1RL3A 5FQ0B 3CO2A 3RDIA 1ZZ6A 4XFGA 4D7SA 4XF9A 4TLFA 1EP0A 1LRHA 1ZRFA 3H3ZA 3ETQA 3NL1A 4L2NA 4Q0SA 3H9AA 2B5HA 3ES1A 5JSRA 3NW4A 2V09A 5E1RA 4MUVA 3CJXA 4XFIA 1Y3TA 3G7DA 1YFWA 4I09A 2EAAA 4EWEA 4UBGA 4FT8A 4PIZA 2MHFA 4IERA 3JZVA 4IESA 1XE7A 1ZVFA 2GC0A 2ATFA 3D82A 1EY2A 4KWJA 4J1XA 2VECA 5CU1A 4I02A 3H8UA 4AQ6A 1L3JA 2XLFA 4F7ZA 3PVBB 1VR3A 2K9ZA 5I0UA 1RUOA 3ELNA 4PJYA 5BPXA 3NVCA 4HSLA 2OZJA 4CYDA 5BY5A 1O5LA 2QNKA 3I7DA 4Q0VA 2Z69A 3HIFA 2BNMA 3ZDSA 5T3NA 5D1IA 1LR5A 2FMYA 4JTNA 2BNOA 4AXOA 2C0ZA 3I59B 2PAKA 3H3UA 2IC1A 3EJKA 3BPZA 1HW5A 2BNNA 1CAUB 4OFGA 3WW3A 4PIXA 1UCXA 2F4PA 2H6CA 1OD5A 1H1IA 2VPVA 5I8YA 3E5UA 1QXRA 5BV6A 3FWEA 2QDRA 1PM7A 3FZ3A 3IDBB 4Z82A 4E2QA 2QJVA 3S7EA 3ST7A 2Q0AA 3EBRA 4BYYA 2PA7A 4FAHA 3LZZA 3NSTA 1NYWA 1J3QA 4XFFA 2HKXA 1CAXB 5K8SA 4F8AA 1CGPA 4I0AA 2PQQA 2IXJA 5BXXA 4JV4A 3H7JA 2IXKA 5LEJA 4A2UA 4IEUA 4DINB 3IBMA 3R6SA 4L11A 1YUDA 4D7TA 1I5ZA 3FHIB 4X6QB 4YNIA 4Q0PA 3WW2A 3LA2A 1ZZ8A 4K8FA 1IPJA 1DZRA 4R8HA 4EWDA 5F1RA 4QM8A 1I6XA 2FQPA 2D40A 4EROA 1CAWA 1Y9QA 2Q30A 2DCTA 2GU9A 3RYPA 1VP6A 2H6BA 2GAUA 2UY9A 2UYBA 1QXJA 5JAXA 3RZZA 3SXWA 1ZZCA 5KHJA 4IEYA 3H1MA 3HQXA 1VJ2A 1J59A 1CAVB 4YRDA 1O3RA 4J1WA 2BYVE 3DV8A 1J1LA 4NVPA 3ES4A 3KGZA 1FI2A 4LA3A 5JR7B 1SQ4A 4BH9A 4I01A 2CAUA 4XFHA 1LKNA 1RTVA 5FQ0A 3MZHA 4XFAA 4YSFA 1RUNA 4LTAA 3BU7A 3DL3A 3LAGA 2XLGA 2CV6A 1NE4A 1J58A 3E6CC 1ZRDA 4ZU4A 3LOIA 2OYZA 5BUVA 4AVCA 1O3TA 1UD1A 4IEQA 4IETA 1DGRA 4X6RB 2PYTA 2PHDA 4META 4IEZA 5E16A 3ROUA 3KCCA 4Q0UA 4LEJA 2P17A 4O9EA 4AVBA 5I8TA 1OMIA 2PAEA 1X8EA 2XL7A 4MGIE 3WW4A 2HJIA 2ZKLA 4Z07A 4JVAA 2PAMA 3QACA 1XRUA 4XF1A 4E2SA 1SFNA 2D5FA 4AVAA 2O8QA 4N9HA 4O9GA 2BGCA 1YHFA 4Q29A 2Y0OA 1NE6A 3GYDA 1J3PA 3IDCB 2E9QA 2QCSB 3IIAA 2XKOA 4EV0A 4UXAA 5LRRA 1O5UA
chains in the Genus database with same CATH superfamily
1JU4A 3NAPA 1SPPA 4YM1A 4JC1A 1H1MA 3X29B 5LEKA 3VHNA 1ENQA 4WM8C 3I3EA 5FZ3A 5T52A 2HWC1 3DECA 3OGRA 5A7SA 3J4UH 1PGW2 1OOPB 2VOWA 4XXAA 1CAUA 1PVXA 4NROA 3EXUA 5LBCA 2PELA 2FDGA 2VD7A 4LPLA 5T5PA 1S2KA 2WO2A 4L92A 2NMNA 1O4YA 1UIKA 1HDKA 2LRPA 2QZ2A 3CJIC 3OY8B 1ODNA 3VDDB 4AK3A 5B2GB 3UT0A 3AKPA 2NQYA 3C7GA 3KS7A 1CX1A 3LPGA 1ZRIA 3HOBA 2QVSB 4R4ZA 3LEMA 1O91A 4A7YA 5CKNA 5J7MA 3ILFA 1VBC3 2VZ1A 5FP3A 1WW5A 1SEFA 3DYMA 1CAXA 3GZAA 3D3AA 5FYTA 1WLDA 3R4DB 4NO4A 4URTA 2IUWA 1AL21 3DCQA 3CHXA 2WN2A 1XNDA 3RZMA 3H7YA 4JQTA 1SLBA 5DZFA 2D6KA 3MIBA 3H8XA 4LE3A 2R062 5KWRA 5FUNA 5IFPA 2RV9A 5A7WA 1DDLA 1REDA 2UY8A 3PL0A 4GALA 5FTTC 1QIQA 3ACFA 3U78A 1TNRA 3EHKA 1COV3 2AUYA 4QPWA 4RGKA 4X8NA 5FK7A 2CWMA 1A8MA 3KGLA 1XNCA 3CJIB 1ZRRA 2VW1A 1WW6A 1QQP1 5C8CA 5HV4A 2G19A 4PDWB 1TEIA 4QGLA 2GC1A 3DYPA 4LHKA 5LASA 3MUY1 2YBKA 3HEIA 5A3WA 2ZGPA 4URAA 1SLLA 1AYN1 1NCQC 2J1SA 2W1UA 3LE0A 3RNSA 4EWAA 2WIIB 3IN9A 2ZCWA 4XOGA 2BV4A 5IVVA 1TMF3 3D8CA 4MOAA 4QHBA 4COWA 1HRV1 4YLZA 5CZKA 1X7NA 3ZN6B 2A3WA 4H3WA 1OLQA 2R6QA 4AQ2A 2R0HA 1SLAA 1DQ0A 2YFZA 3B02A 4LBJA 4QKFA 1V6IA 3U10A 2X5IB 5A33A 3VZNA 4EQVA 1V6JA 1X82A 1YQ2A 4CCCA 4ONUA 3JB4C 2RS12 2WFPA 3NRUA 1O3SA 3AM2A 3CEWA 3WY6A 3D4KA 4C0HA 1B35A 5I0SA 1DIWA 1ASJ3 1W0NA 1REFA 2P3IA 2VOVA 4JDMA 2ZGNA 4AW7A 3ZDVA 1UY3A 4DRVA 5F8PA 3KHCA 1POQA 3NV2A 4XACA 3WG1A 5FY8A 4ZXEA 5LY1A 3BB6A 1MS8A 2GZWA 1RUG2 2W9XA 4LUMA 4COYA 3ZKYA 5F32A 2UYAA 3OJBA 1UZ0A 2SLIA 3VL9A 4ZU5A 5GLVA 4LKFA 5LWBA 1RUI3 2Z79A 5DDJ2 4SLIA 2YBSA 2WL1A 4KWKA 3TOJA 1Z0HA 2MNGA 2QFEA 2Z2SB 3PUQA 4NRMA 1MR5A 2O14A 2OA2A 4XJ9A 3SEEA 2HWC3 2Q1FA 4BU2A 3W59A 1QXPA 1AR61 1XBFA 2YC2A 5A7OA 3MLLA 4M4PA 4IEOA 3OUHA 3ZSEA 3MUZ1 3V0BA 4MVTA 2YDEA 4GKXA 1H2LA 3B5LB 3GBWA 5GLZA 1UMHA 2W1SA 3MPBA 4XF4A 1BQPA 3M8LA 2W87A 2I07B 3VBFB 5BNQA 2VTFA 1W90A 3I2KA 1W6NB 2W5FA 1AR91 1WMXA 2YU1A 4QKBA 3HT2A 4TXWA 3WNOA 5BNOC 1ZZBA 2A71A 2JDPA 1VLNA 2Q1ZB 1RMU2 1MEC3 1TQ5A 1YI9A 5F39A 4ZU7A 2Y38A 1ZZ9A 5FO9B 2PTMA 3H50A 4BQXA 2YXSA 2WKKA 2WC2A 5FCCA 1SCRA 1WKYA 1IZ3A 3S5QA 3V56A 1V6KA 2CGOA 1QJX3 3T1MA 2IVIB 1GOFA 1FX5A 3ASIA 3RG0A 4A4AA 1C3HA 1K5MC 3FJSA 1K3IA 3U37A 1JS9A 5EJZB 4XEZA 4QD2A 3R4SA 3RMYA 3UKTA 1XNKA 3N9NA 3C2UA 3T30A 2VNVA 1RVF1 2V5YA 4YG0A 3WNXA 3ZFGC 4BDVB 3N7MA 4IEWA 5T54A 2WT0A 1IS5A 1BJQA 2WS93 4Q4X3 1CZVA 1N3PA 3RYKA 5IYYA 1N3QA 1OA2A 3WUDA 1QDOA 1QJU2 3J8F1 1MACA 1AZDA 1HRI2 1K5JA 5IVEA 4NRQA 1RUE2 3MIDA 5BNNA 1Q8OA 4CCKA 1JTZX 2ZGTA 3BGAA 3VBOC 5KHHA 4BQ5A 4CDXC 3U1XA 3PJYA 4K1YA 3ZFFB 1TME1 5I0TA 4AL9A 2XLAA 3OEAA 2D6NA 3M3EA 1CPMA 1FOD3 3HMYA 4C0BA 4P00B 2WRAA 1DGWX 3AYCA 1F4AA 3OGGA 1HRV3 3N9QA 4W4ZA 4XFBA 5ABJA 3K48A 4N43C 2F6BA 4WV8A 3JD72 1RUD3 4DXTA 2VMCA 2Q8OA 1OBNA 1YYNA 1J83A 2WFF3 3OGJA 1UZZA 2VQTA 2WZPP 1RUJ1 3KT1A 1ACCA 5J37A 2XJVA 4YW5A 5KHIA 3TN93 5I8SA 2JG8A 2W94A 3TB0A 3EO6A 4YYOA 2WNUC 1GYKA 1W2OA 2OUHA 4LBQD 4M0HA 5F5QA 4BQ1A 4J6GA 4GKYA 4LE4A 1Z7S1 2VBDA 4JHTA 5LATA 3ECQA 3BCWA 1QY4A 1EPZA 3O14A 3VZJA 1FNZA 1DBNA 3NV3A 2LUWA 5TSWA 4AE2A 1N3OA 2NMOA 3N7JA 3RWNA 3VD5A 4BLJA 1UZYA 3N35A 5A6ZA 1HXS1 4Y5TA 2ETEA 2NLRA 4UFJA 4AG4A 3LEIA 2YFUA 2XVLA 5C8WA 3P5BA 4GH4B 3CO2A 4N43B 3IDAA 4RS5C 4OQ9A 3M1HA 2YY1A 1FV2A 3KD4A 3DXUA 1KDMA 3A22A 2VTXA 2DFBA 2JICA 3AKRA 1APNA 3H3ZA 1ZRFA 2CU5A 2D7FA 3IPVA 3NL1A 4L2NA 4Q0SA 2DCZA 5L7OA 4QB2A 1KRIA 4FPJA 3KVAA 4FPFA 3CJXA 1AR93 4G3YC 2VQUA 4XFIA 2PHXA 2JG9B 4ES8A 2RJKA 2WNUB 1R1A3 1DYOA 3G7DA 3JQXA 1VBD1 3MF9A 4GWNA 4HETA 1RUH1 1BVVA 4CRQA 4Q5OA 5A32A 4P9JA 4TTGA 3B7MA 1G9FA 3U4SA 4IESA 1XE7A 3M2MA 1AL22 1DLCA 2C5DA 4ZHNA 2ATFA 3D82A 4RN5A 2RS31 1EY2A 4AFMA 5LA1A 4CVUA 3FUOA 5CU1A 4R4XA 5IK8A 2C1FA 4RGGA 2HYKA 2RM23 1H0BA 1PZ7A 5FWEA 5K4LA 5GZEA 1AXZA 5I0UA 2R041 2VMDA 5ANNA 4P9LA 1GZTA 4IE5A 4UOJA 1OH3A 4PBPA 3VBRB 1V9U1 5DXDA 4AEMA 4ET7A 4XBNA 1F35A 3ZN5A 3K3NA 1JUIA 2IWGB 2QNKA 3C7EA 4UFLA 4Q0VA 2P4EA 1QQP2 2DURA 5FMOL 4AHZA 3V0AA 1OQEA 3LF7A 3LQCA 2EXJA 3FHQA 1NA1A 1V6OA 5J1XA 5FZOA 3ZOIA 5E8AA 2FMYA 2XJSA 3NAPB 1SPPB 3V64A 1AYN2 4XIOA 3WOGA 2JDZA 5EIYB 2GDFA 4LBNA 4QQLA 2Y33A 2ZXQA 2D6PA 3EJKA 4XVHA 4OFGA 1CAUB 2IVJA 3LIGA 4MYEA 3K4DA 2VZ3A 5FBJA 1OD5A 2W3JA 4Z1VA 1HLCA 2WNOA 3KLSA 3WP6A 4P08A 5I8YA 1QXRA 1W03A 3BPSA 1XB9A 1H2MA 4BMEA 2E53A 3ILNA 1GOHA 4CEWC 4DUXA 5C70A 1ND3C 2DVGA 3LZZA 3JUUA 1S0CA 1W8HA 3VHPA 3WG2A 1HV1A 2OKXA 1KJRA 1RHI1 1XSQA 2YGLA 1G9CA 1CAXB 1Z7S3 4LKDA 5A6QA 4ISQA 2HEVF 2J1RA 4N8MA 2P6CA 5DUXA 3WX5A 4F8AA 4I0AA 5CG9A 1QOSA 2I74A 1QOOA 1GP6A 2DVDA 4Y33A 2VL4A 4GWJA 1OVSA 1BBT1 1Q8SA 5A7WB 3FN9A 4AI1A 4QWNA 4XQDA 4QB6A 1AR62 4L11A 5FFOC 4EYUA 1JOPA 4RQPA 4ZZ5A 2K46A 2C24A 1AR71 1UOJA 2A6XA 1Y43B 3AMQA 5FAXA 1O4ZA 2QQOA 3LA2A 1UAIA 4BQWA 4K8FA 3VBUA 1DZRA 4LJHA 4RFRB 4DEVA 3H8OA 4XCBA 5C8CB 4XUNA 1AR92 5FIXA 2NYYA 3W58A 1HJGA 4QM8A 4XAEA 4QXBA 1G9BA 3WSOA 3SLIA 1OF4A 2GU9A 3NMBA 3RYPA 1G7YA 1VP6A 1I5PA 2EIEA 5DPNA 1VBA3 1BEV3 5FJKA 3I2OA 2UY9A 2QQKA 2UYBA 1UY0A 5H9PA 1UF2C 5LY2A 5BNPA 2VU9A 3RRDA 2RE9A 1DGLA 5KHJA 3UYJA 5HCFA 3WQ1A 3J7NA 3OPTA 3KB5A 3H1MA 1O8PA 3LGRA 4AEDA 3HQXA 4QX0A 4CA9A 4CPBA 1X33A 2XQRA 4J25A 2JD4A 1GWLA 5A33B 5L73A 1O3RA 4GWMA 1QJFA 2BYVE 1MVEA 3DV8A 3SNMA 1RVF2 1R091 1NQDA 3IM0A 4M0NA 1B35B 5C33A 3O1VA 3WF2A 1FI2A 2G9FA 1J84A 1QOTA 3POEA 3PURA 4NIGA 4I01A 3VBSA 3D6EA 2AZ5A 1GQPA 3AL6A 2DCJA 2P34A 5FQ0A 3J8F2 3VGIA 3MZHA 1FNYA 1DQ2A 3IMMA 4LTAA 1V00A 3RWKX 3DL3A 1RUNA 5A1LA 1DYPA 4XBQA 1CJDA 4UFIA 2YC4A 1LHUA 5CYYA 1J58A 1G86A 3FFZA 3NJYA 1H2NA 4GXLA 4RL7A 1TME2 3THTA 1A34A 1VRH1 4ZU4A 3KM5A 3LOIA 2OYZA 4QPGA 5BUVA 1IS6A 5CG8A 2AYHA 2RR13 4FPLA 5KXDA 5FMOS 1H8TC 2DCYA 3T4VA 5DAPA 3I8TA 1WMFA 1BLZA 3AJYA 1PK6A 3L9JT 3VZMA 4K6BA 3ZYIB 3V0BB 5CFCA 4XUQA 4GIQA 5DQ0A 5L19A 3BKZA 3RJRA 2XL7A 1X8EA 3USUA 3QD6A 4CEYA 2PHUA 1RUJ2 2R49A 3BVCA 3THPA 5DUUA 3PTRB 4CZSA 1DGRN 2PAMA 4A7ZA 4C90A 5BNNC 2VG9A 3PIGA 4XF1A 1XJAA 1AL0G 1H6YA 5FZCA 2O8QA 1N1SA 1NAEA 3AKQA 3QBQA 2EIGA 4N9HA 5FRAA 4CU9A 4DMIA 1Z7S2 4EN7B 5C3QA 3UESA 4AEJA 3I3MA 1F5JA 2Y0OA 1NE6A 1VE0A 1AX1A 1MZ5A 1A78A 2EAKA 1J3PA 1US2A 1T2XA 1W05A 2DFCA 2P6HA 2ZMNA 1JYTA 1Q8QA 2HWB1 3OBRA 3POBA 4XQWA 4DB5A 1UU5A 1DP0A 5T5LA 2QCSB 1HXS2 2Q5TA 4EV0A 3SC7X 4MGSA 5LRRA 3T08A 3ZM8A 1FPN1 3NO8A 1AYM3 2FDKA 4X8PA 5EFUA 3U11A 3O0VA 3T0DA 4B4QA 3E6DA 3WW1A 1CR7A 1S0FA 2HEWF 2XJUA 3IAPA 1UU4A 5JCTA 2JG8C 3GNEA 4DY5A 2ORZA 2XL9A 2A70A 2VJXA 4QX8A 5JOXA 1D4M3 1CPNA 3PHMA 2WNEA 3OGSA 5FPVA 1YO8A 5BNNB 5F2SA 1NUKA 1UPIA 1YQ8A 1LHOA 5CNAA 5FLJA 2OS2A 4NHXA 5E88A 1H30A 4FOVA 1VBD2 3AVSA 3ZYPA 4D0QA 1RUH2 2G9GA 1XE8A 1JZ4A 1QNYA 1W8ZA 3OSDA 4CCDA 4XHXA 1C1FA 4K7JA 3VB9A 5KBFA 1JZ2A 1C5IA 5LCWL 2A6ZA 2ZX1A 3LFMA 2RS32 2W52A 5ABJB 1QJY3 1UX6A 1JZ8A 2CDPA 5C6CA 1BZWA 2BEOA 1Y4WA 2NZ9A 4I2OA 1W6QA 2P5BA 1KEXA 2R042 3OBZA 3RMXA 2IXCA 2QQLA 2MEV1 4LLFA 4QM9A 4TYSA 4YM2A 3A0NA 1S4CA 1VBB3 1LHWA 2VZOA 5L7OC 1XSRA 3FE5A 4DO0A 1V9U2 2Y6KA 3Q8CA 1GWKA 3OCPA 1LULA 3BTYA 5EJ3A 4CU7A 4LLOA 5IK7A 2HWD3 3WNNA 4KWLA 3MIGA 4XUOA 4B7KA 2OT7A 3DN7A 1HN0A 5H9RA 5HV0A 2KD7A 3S0MA 5LRSA 1W8NA 3POFA 2N7GA 4QGMA 4YG6A 1MZ6A 1VBC1 2XGXA 2BVVA 4AVTA 2NPIA 1EPWA 2J1VA 5FUPA 1LECA 2HWF2 4L0PA 4CXYA 5F3EA 1W9YA 1ZYBA 1NT0A 1PIV3 5FXZA 2B46X 3OUIA 3W9AA 4DUWA 4Q26A 1VB4A 1B09A 1ULFA 5EWSA 5D21A 5J3UA 3RZLA 1S0EA 4RFT0 3AMHA 1WLWA 2XPJA 2QBXA 1NZCA 1LGNA 3IPVB 4N9IA 1HIXA 4MGZE 5L7OB 4CP9A 4BZ4A 4BXFA 5FLIA 4YARA 1COV1 3K4ZA 4CCLA 4ZS2A 4PIYA 2WN3A 1NA1C 4CDUC 4XF0A 1ENXA 3E6BA 4LBOA 3LDKA 2X09A 1OI6A 1A3KA 3POGA 2VMFA 1RHI2 5A32B 3ZMNA 1JBCA 5FV3A 4K40A 1VAVA 5C71A 1FMD1 2XB6C 3KVBA 4CE8A 3POJA 1IQAA 5F7UA 4FP3A 2W68A 2XBO3 3K2OA 3T09A 4K3UA 2VZTA 1BBT2 4HONA 4ASLA 3Q8EA 4AGGA 3H1WA 5FZ0A 2B42B 4JGYB 5F3CA 2WQ8A 3KSCA 3MDPA 1SCSA 1TMF1 1SZBA 1UNBA 2W08A 2D5HA 3AP4A 3H1YA 4UFKA 1AR72 1UW8A 4QKDA 4COUA 3P1IA 3RYRA 1MVQA 2ZX0A 3M3CA 1YC61 2FDJA 4LULA 4XC9A 2DCKA 4L99A 1V6MA 2JWPA 1ZZ7A 2VM9A 2YUEA 3GZEA 3T4HB 1JZ3A 3V0AB 1LB2A 5C5UA 1ASJ1 2XH6A 2ZEWA 4UYBA 1NA1B 2ET7A 4LK7A 4HMZA 5FZOB 4GA9A 5IW0A 4CXXA 2ARAA 2ZBJA 3Q8AA 4NRPA 4MV2A 1GQHA 1D4VB 3E5XA 1XE0A 1K45A 2Q1MA 1S0BA 1XU2A 2YROA 2ZEZA 2B9UA 1KFXL 5DAQA 3U14A 2D3PA 3MPPG 4FFIA 4KGQA 3RZGA 2AR6A 1RYYA 4BK4A 1JYIA 4FPCA 2YB7A 4WVZA 1RUI1 3IAQA 4P5YA 2QDNA 4RQPC 2OQ7A 3K77A 2AENA 2OPKA 2BP6A 4MG2A 4GD4A 4HANA 3D0SA 3DPRA 5KXBA 2XJRA 3A7QA 2J1UA 2A3XA 1R092 2MEV3 2R1BA 4XUPA 5F6LB 3I2JA 3ZMOA 3SHRA 1RJ8A 2XVKA 1ENSA 2DV9A 2UWBA 4Q4V3 4V2VA 1EUUA 2ZX4A 3KCXA 1OPMA 2JE9A 5FY4A 4HLTA 5HCHA 1DQ5A 4XW3A 4I30A 3SCGA 1LOGA 2VO5A 5FKCA 2OZ6A 3DEMA 1W04A 2JIJA 3OUJA 4R52A 4PDWC 5BNPC 1LGBA 5FK8A 1MEC1 4XIKA 4COZA 1VRH2 2E7AA 1HKDA 2JDNA 2RMU3 2XUMA 1UOFA 4U2AA 2ZMLA 3QLQA 2AC1A 5IAVA 3LSEA 1QJX1 2Y6HA 2IXLA 1U12A 5EZWA 1RC6A 4V1PA 4YZ4A 4OVEA 2EXKA 4A3XA 4C8DA 3AJZA 1X8MA 4PF5A 3U75A 1ZNPA 4RQPB 4JTOA 4MGYE 3PDQA 4YVSA 3U0ZA 3JBG1 5F37A 2ZPXA 5A80A 5FR3A 3APBA 3VBSC 4B4PA 2O8OA 4H2AA 5JPMB 4D69A 3VBUB 2X5IC 2AGSA 2WSUA 5JVVA 4QQPA 1XNTA 3TWIA 1XXNA 3INAA 2D6OX 4XZPA 5FPZA 2D44A 3WP5A 4OYUA 2WS91 4UF0A 4Q4X1 4CUCA 2GN7A 2JKBA 1QH6A 3PUAA 1JMUB 4BJ0A 1UIJA 2P3YA 5LBEA 4XYXA 5L36A 5IVBA 4AFBA 3WNMA 3OB8A 3T2TA 5BNPB 5IT6A 3OOXA 3O1RA 3QOPA 1QGLA 1FMD3 1YLLA 2AEZA 4WM7A 4HN1A 5DZEA 5EYXA 2PHLA 2ARCA 3OTFA 4DXZA 5A3UA 1L7RA 2HWB2 4AEDB 4NJ4A 1PO23 3WDTA 2D97A 1FOD1 5CFCC 5C3SA 5DMYA 3HQUA 3M70A 1FPN2 2KA3A 2BGPA 2IXHA 2RVAA 3HAGA 3LIHA 4RGAA 1UXXX 4AR2A 4CEYC 3SCFA 1IS3A 3BTAA 1RUD1 3H3LA 2W2IA 3EYPA 3LCPA 3VBSB 5I0DA 3MYXA 4ZKTB 1EAH3 2WFF1 1MS3A 3TEYA 4CU6A 1NLRA 5FQ0B 3I2GA 3VBFC 4EZHA 1GOGA 2PHFA 4XF9A 1F9KA 2ZA9A 4TLFA 2WLQA 3HN3A 1EP0A 4NWVA 3ZXGA 1LRHA 3TN91 5SV5A 3KHBA 2K2SA 4LKEA 1J1TA 1PVC3 3M4FA 2B5HA 1T6GC 1MS9A 5F9TA 2VR4A 1WW4A 2V09A 2WSVA 4L97A 3AMMA 4MUVA 1KXGA 2DVBA 4QPGB 1NXD1 1DZQA 4Q4Y3 4FTEA 4O65A 2VW2A 4CUGA 2X29A 1LOAA 1O6UA 4FPOB 1PK6B 1GV9A 3GJAA 4IERA 5CFCB 3HJRA 3H42B 4QXHA 3W21A 3USUB 4BIOA 2BBAA 4KWJA 3SH3A 4J1XA 4CEYB 3NNJA 1W28A 1OLMA 1YJKA 4YGDA 3ZPOA 2DUOA 3H8UA 4MSVA 1GZWA 4QQHA 2XDVA 1ZA4A 1W6OA 1ZBE3 1D0HA 1VR3A 3VD4A 3VZLA 1JYXA 1M06G 1RUOA 3ELNA 4PJYA 3B9CA 3NVCA 2OZJA 3ZXEA 5L9BA 5FP9A 2G1MA 4A7KA 4W8JA 4OZOA 4QQ2A 1R1A1 4CU8A 1VBC2 3B94A 3P6BA 2V4AA 2VZUA 2WO3A 4D7YA 5A1AA 2YU2A 3ZFFC 2Z69A 2X10A 3HIFA 3JXSA 5FZLA 4AFDA 5FOBB 1POV3 1RINA 3I2HA 1ODMA 3WZ1A 1LR5A 4JHZA 4AI8A 2J1TA 3ZKUA 1YJLA 3BIEA 3ZYFA 4RA0A 2I2SA 2RM21 2PAKA 1GSLA 3JBG3 5JR2A 2VVEA 3BPZA 1HW5A 4FOYA 1DFQA 1WA6X 3LEGA 4BXSV 2IZWA 2F4PA 3WXPA 3HQRA 4E4HA 2JXAA 4XMIA 1QEXA 5A3LA 1COV2 3RVHA 4CDQA 1W0OA 2JEMA 3E5UA 1YCIA 3FWEA 4CCOA 1PM7A 4YW3A 1LOEA 3ZLIA 2DBNA 1VMJA 2WLPA 5J98B 2Q0AA 1AR83 2PA7A 3A21A 5FZAA 1MZEA 2HLEA 4GB33 3ZXLA 2E26A 3CDZB 2Q8CA 1H4GA 4TZDA 2PN5A 1VAMA 1ALYA 3SEPA 4FQZA 1ZRCA 5FYYA 2A7AA 3ON7A 5C4WA 1IQDC 4BE3A 1X9PA 1TMF2 1W6QB 3FLTA 3LB9A 3N3HA 3ZYHA 2YV8A 2R32A 2WDBA 2UURA 2IXJA 2PLV3 3I3QA 4K9SA 4GH4C 4WZFA 4DOUA 4JV4A 5AFBA 1D0GA 2IXKA 4PQQA 1OKQA 4LHLA 4UW3A 3IBMA 2XXZA 2R073 1CIYA 1QF3A 1YUDA 2VY0A 5ANQA 5GZCA 1OLME 1LOFA 1AUYA 5A6YA 2V72A 4XUTA 1I5ZA 3FHIB 3C7HA 1ASJ2 1JYCA 4YNIA 2E7TA 2GALA 4CCNA 2BERA 5A7PA 5A3PA 3WT3A 1ZZ8A 2O0OA 1JN2P 1YQ6A 2OW4A 2JG9C 4JRLA 3TEXA 2E6VA 2B4KA 2Z4FA 5F1RA 1MQTA 1TVGA 4AI0A 1UYZA 3MICA 4RR3A 4IE7A 2ZMKA 1KDKA 1NLSA 4PI2A 2GMEA 4GAZA 5FWJA 3RZHA 2H0BA 5DAWA 2ZGSA 4FPEA 3H8RA 2LROA 1RUI2 2H6BA 5DUWA 1JU3A 4IV3B 4OMCA 3VV1A 1L7LA 4QU2A 4ZPIA 5JAXA 2JDKA 2HWC2 2E7QA 2LALA 2DTYA 3RZZA 4MXWA 5AC93 2J7MA 4IEYA 2EIBA 1CD3G 3KF5A 4KGGA 2LTNA 4RHV3 1JYVA 4CP9B 2ARBA 1VJ2A 4HXCA 1ZM1A 3DGTA 1IG3A 1D7PM 4BQYA 4YRDA 3VBRC 5A3OA 4ITCA 1QJEA 3J7MA 2Z5WA 5C9AA 1QNWA 2XWBB 4DXSA 2GH8A 1J1LA 2WA4A 4U36A 5DAXA 3ZPYA 4E4ZA 4O7XA 4YGCA 2ZTNA 2VZQA 1SFYA 4FFHA 2CAUA 4YFWA 5IJRA 1OURA 4XFHA 3IT8A 1R083 1JYNA 1UO9A 1MEC2 1OPOA 3PJQA 2FD8A 3DUIA 4XFAA 4XDQA 1VBA1 1BEV1 3LAGA 3NAPC 4BCUA 1VIWB 1NE4A 3W20A 1QJX2 3HR9A 5F3GA 1US3A 1ZRDA 1D2QA 3BOPA 1TNFA 3DPRC 4IGQA 1PZ9A 1OXCA 4Y5Z0 4H14A 2FDHA 2CTVA 3FHAA 1D2SA 1UD1A 2NN8A 3BODA 4JGYA 4ATFA 5JMCA 3UJOA 1DGRA 2YBPA 4X6RB 5E16A 3OD4A 5FYZA 2JDAA 3ROUA 1F8VA 4R9AA 3PTYA 2YGMA 3MO4A 4LEJA 3KV6A 2P17A 2WS92 4EE2A 4PCRA 4O9EA 4IXLA 4Q4X2 2PAEA 1W8UA 3K51A 3RZKA 4A45A 3WW4A 2D43A 3VZKA 2VNRA 2SBAA 3ZXDA 4FOQA 2HJIA 2ZKLA 5JPNB 4Z07A 5JXIA 1OA4A 2GP5A 1LOCA 1G8WA 3B9IA 4IGPA 4N7IA 4Q1RA 4P02B 1NZIA 4E2SA 4CUBA 2D5FA 4AVAA 5H9SA 4AGRA 1GBGA 4O9GA 4C1XA 2BGCA 1GANA 1LU1A 4IV1A 1YHFA 4Q29A 5FYUA 4QX2A 4CUAA 2R16A 2RR11 4W65A 1FOD2 2WWSA 4FFFA 3NV4A 3ZSMA 5ISLA 2ERFA 3DPRB 3E1F1 5JOZA 1RXFA 3TRSB 3PVOA 1HRV2 4AI2A 1S0DA 3SQOA 3IDCB 1RUD2 5GALA 4Q27A 4W50A 5LB6A 2OXBA 1RUF1 1HJFA 1FV3A 1OFSA 4OHWA 5CISA 4UXAA 5T50A 1O5UA 1OFNA 2WFF2 3O0XA 2C26A 2WO1A 4Q0QA 3SCHA 2L9LA 1SLCA 3NJZA 4QXKA 4OCTA 2BOJA 4FPGA 4UFHA 1XNBA 3PLQA 4Z2WA 5LA2A 4A3ZA 5C8CC 3TN92 4NUBA 1O7FA 4YZ2A 4PQ9A 4LXLA 2HBUA 1SMVA 1OF3A 2QQMA 4WM7C 3TYJA 2KM2A 3ZXAC 1GR3A 4S2DA 2WQZC 4WVWA 3ZSLA 1PMIA 5J36A 1ENRA 2LS6A 2WZ8A 1I3HA 2A6VA 3MLKA 3M7AA 3TNPB 2YPDA 3GBGA 3L2HA 3I2IA 3S30A 1NG0A 4FPYA 5KR7A 1UZVA 4QMAA 2BTVC 2KXLA 1OC1A 3THDA 4YVSB 2BRTA 4JAAA 4LOTA 1CZSA 4Y22A 4YFZA 4AHYA 1LNSA 4LNVA 3SKJE 1AYM1 1WA4A 3Q9OA 4A6OA 3LA3A 1WGPA 1REEA 2GN3A 1G9DA 4QGNA 5EP9A 4HKWA 1JH5A 2NP0A 1B35C 4UF0B 2CGPA 2V5DA 4KL1A 4L9BA 4UWDA 3GCXA 3ETPA 2CGNA 1JZ7A 5F5IA 3SH4A 3T0BA 1IPSA 2QQVA 2ZGLA 1D4M1 4KBZA 1GICA 1LHVA 1ULOA 1UXZA 1N1VA 2WINB 3TNQA 1LAJA 2FMDA 1CQ9A 1R1A2 3CQOA 4B3NA 3FL7A 4WM7B 1HQWA 3QH6A 3MW4A 3I3DA 4UW4A 3O1MA 2VMIA 1A6CA 4Y4YA 2XWJB 3T1LA 3R0RA 5F5CA 4ASMB 1YI7A 2GNDA 1XNAA 2W0XA 1UYYA 2XOMA 2JDYA 4WM8A 1T6BX 2VVDA 4LBQA 5FBZA 4DUVA 5BYNA 4MLOA 1HV0A 1Q8PA 1DQ6A 1QJY1 4GULA 3U4XA 2RDSA 5JSOA 5HI0A 2RM22 1YFYA 4LQRA 4E4DX 3HBZA 3EQEA 5FZKA 3JQWA 3FLPA 2CSGA 3LWCA 3VHOA 3VLBB 2DTWA 2ORXA 3RGBA 4AHWA 1VBB1 2ZEXA 2XHKA 3AP7A 1VB2A 3AZVA 3KWVA 3NNLA 4JCKA 4YGEA 5CFDA 3UGHA 1SBEA 2XQXA 2HWE3 2EALA 2BFUS 4WVMA 3ZYBA 2Y6GA 3UKNA 4MHUA 4I3PA 2VMGA 1C4RA 3O1PA 2HWD1 5FUIA 1Q56A 2ZEYA 2ET1A 4XHBA 1SACA 4E8DA 1GFF2 4P9XA 2VZVA 3RZJA 1MPXA 4QU1A 1S2EA 4YW2A 4BHPA 3ACIA 4DZGA 4OI0A 1CWPA 3A4UA 3C7FA 2HH9A 1QWRA 4FTBA 2W47A 3AB0A 5LBFA 1CX4A 4PHZA 2VH9A 1ULDA 3NKGA 3O12A 3LFIA 4YZ1A 2BGOA 5K0UB 1PO13 2WWJA 4LO4B 3THCA 1VRBA 4C1WA 1ZBA3 1RGSA 4BQ4A 5A6XA 5K7PA 3EMRA 2A1XA 1W8TA 2ZZQA 1PIV1 1CESA 2ZGMA 4KU8A 4N7UA 4FPKA 3A23A 4QPIA 2F17A 4B1MA 3POIA 5AVAA 2LM3A 4EZ4A 1C8M3 1DCSA 2WR9A 4ORFA 1GZWB 4WVVA 4ZS3A 1E57A 1W6OB 1FT9A 4BPZA 4ES9A 5FLHA 4Q4W3 1R1ZA 4CCJA 5KHKA 1RUF3 4GMP1 3RSJA 3CZUA 1E5RA 1V70A 2YC0A 5T5OA 3U07A 5KC6A 2ZHLA 4UAPA 3N9LA 3IKWA 2GC2A 4HT1T 4YW7A 2W91A 4QHZA 5IK5A 5FZMA 2WZR3 3ZVXA 1WCDJ 1JHNA 4IEVA 2EA7A 3FUQA 4OI2A 1GUIA 5JI9A 2F4LA 5FPXA 3I49A 1SLIA 2OVUA 3MIHA 1NCQA 5F2WA 1BXHA 4B4RA 1O4TA 4CSWA 1HN1A 1AXKA 2CNAA 4XJUA 2XBO1 2ZAAA 4HKOA 4XETA 4AVSA 2XKPA 5KHGA 1W8OA 4ASKA 1NXMA 5CVRA 5ABJC 3HNBM 4FAGA 3BI3A 1YIFA 1KD7A 3LKJA 2ZHNA 1IKPA 5EQUA 5GJ6A 1E5IA 4ZXKA 4D6RA 4CCMA 4E2GA 1XU1A 3T3YA 3QH7A 2PHRA 1W6MB 4SBVA 1JW6A 2ZOEB 3FBYA 4JGZA 1LOFC 4ISRA 1PGSA 4CDQB 4LOSA 2VOXA 3UGFA 1Q43A 2FZ1A 3LD8A 1F4HA 2A6WA 1P8JA 3O7OA 1OQ1A 4KH9A 1EUTA 1LTEA 1JHJA 1ULEA 5JDBA 2YG0A 3OG2A 3SMHA 1UU6A 5GLWA 4LUKA 4K1ZA 4E8CA 4K20A 4RR3C 2TEPA 3D0JA 1NX9A 4PF1A 1UYPA 1Z78A 1IGOA 3MFCA 1LEDA 3WF0A 1EV13 2ZGKA 3MF6A 4MADA 2O1QA 3O1SA 4PLOA 3VN4A 3CF6E 4MGQA 3BTXA 1VBA2 1BEV2 4KBBA 4ATEA 2AEYA 5FPAA 4Z8BA 4DS0A 5C4WB 2BQPA 4P9GA 3FFQA 3FLRA 4CP0A 3AFKA 1GNYA 2BJSA 4P9WA 3HNYM 2XONA 4D94A 4N53A 2NM1A 2Q4SA 3M3OA 4XXPA 3WNKA 3WDXA 5B4NA 1RUC3 1C28A 1JOJA 1W2AX 4YPJA 1PGL1 3ZSKA 4B29A 1QKQA 2RDRA 4HN0A 2R30A 4KU7A 4S2HA 4BIFA 2B45X 5FREA 3KMHA 5I93A 4JRAA 4IEPA 3TEZA 2VC9A 4XQ4A 4AQSA 5FY5A 4YVWA 3L2YA 2VZRA 4Q4V1 4YGBA 5I91A 1UPSA 2GC3A 2BZDA 4CDWA 5BNOA 5ACA3 4YG3A 2JENA 4Y24A 3WNLA 1MQTB 4BISA 4RR3B 1W6PA 2C9KA 4XCAA 1RITA 3FX3A 2QE3A 5SV8A 5LA0A 2Y64A 4I0BA 3VD9A 5FYBA 5FYMA 1DGWA 2E63A 2VCBA 2ZS6B 2V4VA 4DFSA 2D93A 2RMU1 1G6NA 1DYKA 2VCMA 3B01A 3GXUA 4HBNA 2XG3A 4MH0E 4XF3A 4UBHA 3BALA 2W1QA 3JCIA 4CCEA 2RR12 2P1BA 4OHVA 4YM0A 1W2NA 1BYHA 1WBFA 4P5HA 3T0AA 1K5MA 1YWKA 4JGYC 4MXWB 5HXMA 1BKZA 1OVPA 1HB1A 2WA3A 3ZO0B 4IV3A 5EPAA 2VGDA 1UWWA 1KFUL 1RUF2 2CYFA 1KS4A 3AVRA 1UZWA 4IE0A 2QKDA 5C9AB 3BOWA 1UOGA 4GMP3 5CKQA 1OSGA 4AF9A 1GZ9A 4HKLA 4XE9A 5FDBA 3J9SA 3IWZA 4OLLA 1PMHX 1OHFA 1TZOA 2DU1A 3M3IA 4LBKA 5HPOA 5APAA 1RL3A 1TE1B 1W9FA 3RDIA 4LT5A 1H1AA 1UL9A 2VMEA 3HNMA 4CDXA 4LMFA 1X36A 5CIRA 3MFAA 4D8MA 4IV1C 2BU9A 3H9AA 1RJ7A 2VCAA 3ES1A 5FZIA 3J7HA 2VBPA 3MHZA 5FYVA 2OX0A 5JSRA 5E1RA 2R063 5JIAA 3KQ4B 4FOWA 4HFSA 2WO7A 4OHXA 4LBLA 5H9QA 4BWOA 4YW6A 1R64A 1PO21 3RS6A 2B7YA 4W6WA 4DRRA 4I09A 4EWEA 1AYM2 4UBGA 1W3VA 4PIZA 2P3KA 3UETA 2Q8DA 1LOBA 3JZVA 2YZ4A 1W99A 2DF7A 1UMIA 2UU8A 2VZPA 4GMP0 3TBDA 1EAH1 3T2QA 2BVBA 2EXIA 1VALA 4IE4A 4TLGA 5JMOA 5IAXA 4NE9A 1C1LA 1D4M2 1FATA 1GLHA 2PHWA 3ATGA 4GQ7A 4HK8A 4HPKA 4I02A 3WINE 2XLFA 3LOBA 4N90A 4F7ZA 4O61A 1ST8A 1PVC1 2EIDA 2QTWB 3AFGA 1V6LA 3BU0A 2HEYF 4IW3A 1WCKA 1QH7A 1UQXA 1CONA 4HG6B 4IV1B 5JZGB 4R9DA 3AXDA 2CDOA 1LHNA 4G9SB 4E9KA 4Q4Y1 3BUCA 1O5LA 3I7DA 3LDBA 4NWWA 3HBKA 5C7GA 4A44A 1WCSA 1GU3A 2VUJA 3D5OA 1QJY2 2ID4A 3WCRA 2YYOA 2OUJA 1UYXA 3VDAA 5T3NA 4XAAA 5C3OA 2RS13 2PMWB 4RS5A 3ZXJA 4JTNA 5EYYA 3AZZA 3N36A 4Y26A 1VBB2 5FYCA 3VBUC 4P14A 4RSUA 4LO7A 4AXOA 2C0ZA 2ZX2A 1ZBE1 2DUPA 1E5HA 2IC1A 5LK7B 4CP2A 2BNNA 2CL2A 4PIXA 3WW3A 1LENA 2HWD2 2H6CA 1PZ8A 1RUG3 3VD7A 3ALQA 1H1IA 3PVEA 4LO6B 1DQ4A 2VPVA 4R9CA 1X9TA 2ZGQA 3I4IA 4OHZA 2WAOA 1W2UA 5BV6A 3O1UA 2XR4A 3IDBB 4S2GA 5G04L 5DDJ3 3MI8A 2DWRA 1CZTA 1O8SA 4MHRA 3S7EA 3EBRA 1H9WA 3ST7A 4AZZA 4BYYA 3UGGA 4XMAA 1POV1 1JXNA 4NMIA 2RJ2A 4Q8LA 3SKVA 4Y22B 4AEDC 3NSTA 4NAMA 4W6YA 5A7QA 1PIV2 3WUCA 3ZN4A 3POSA 1GNZA 4XFFA 5IVCA 2HKXA 5FXVA 5CKMA 1S0JA 1SDWA 4KI5M 4M01A 4LHNA 5CFDC 5K8SA 5IWFA 4CXWA 4DNYA 4D6QA 1ULGA 5E89A 4XPVA 3AYEA 2X8KA 2PQQA 3VDCA 2WYFA 1OUSA 2QUOA 3ZXFA 4F3JA 4JQRA 4NPMA 3UL2A 3DKQA 5LEJA 4A2UA 4IEUA 2XJQA 1RMU3 1AHSA 3K46A 4NIIA 2VXRA 3AP5A 3BN6A 2WQ4A 3WD5A 4DY3A 1YQCA 1PNFA 1AR81 1SG3A 4Q0PA 3NJXA 1Q8VA 4XTMA 3CIHA 5C5TA 5CEHA 3DF0A 4GB31 4LK6A 4D6SA 1IPJA 4QPGC 1AJKA 1RXGA 2XBO2 4R8HA 2JDMA 4WM8B 2QQIA 3MLJA 4LBQB 5DG2A 4EWDA 4QPIC 2Y8KA 1LESA 4JZRA 3LPFA 4IL7A 2FQPA 1PK6C 2FDFA 4QHOA 4BM8A 3ILRA 1WD4A 3GZTB 4KG8A 4EROA 1L7QA 1CAWA 1WCUA 1YEWA 2FCVA 2OIIA 2DCTA 1WWYA 3PMEA 4IUGA 2VNOA 1SFPA 5FO7B 5C3PA 2GAUA 2J1AA 5FY9A 2PLV1 5CFDB 2WNVA 5FZFA 5K9YA 4FXKB 4LIVA 3RQ0A 4WVMB 5JXHA 3WF3A 3N9MA 1SDDB 1QJU3 2VQ0A 2R071 1HRI3 4CEWA 3R4UA 3AL5A 1RUE3 3OYWA 5FP4A 1ND3A 3AKTA 4Y5SA 4OULA 1F2NA 1NCRA 4J1WA 1QHDA 2JB8A 2RS51 3V65A 4OHYA 1SBDA 5LA9A 1NLQA 5FPUA 3C8XA 2CY6A 4HK9A 3KGZA 4LA3A 5JR7B 5E6HA 1C8NA 4E27A 3KT4A 4BLIA 1W9SA 1MS4A 4E4SA 3WV6A 1FAYA 3AZWA 4OMDA 4QPIB 4YSFA 4P9IA 1KJLA 1PX4A 3BU7A 3JD73 1OQDA 2J22A 3ZFEA 4BQ3A 5HCAA 2ENRA 4JGZC 4JKMA 5K0UA 2XLGA 2CV6A 2JE8A 3IB3A 3NNMA 1PGL2 3PU8A 3WG3A 1M4WA 1S1AA 1W06A 1W39A 1VAKA 5AC91 2FCUA 4Y3OA 1NQJA 2GSYA 2MEV2 3A0KA 4PLNA 4RHV1 3IMNA 4Y4RA 3ZYGA 5FZ4A 3O1OA 3AP9A 4AVCA 1LU2A 4GZ9A 1WLCA 1WMEA 1OKOA 4Q4V2 2A73B 3HD8B 3WQ7A 2PHDA 1LCLA 5JLVA 4META 2B9VA 2WT2A 2D3SA 3R05A 4Y1XA 2VOKA 1CN1A 3KF3A 4UI9L 4DEQA 2JIGA 5FMDA 1NCQB 1OLRA 1PNGA 1R081 4NHLA 4JKLA 5I8TA 4Y1VA 4MO3M 2YHJA 1VPHA 1XC6A 1OH4A 2XJPA 4MGTA 5FZ8A 2RMU2 4N53C 4XJAA 5F3IA 2RHPA 3QACA 3KCYA 1SHWB 3AXEA 2DVAA 3WG4A 4Y20B 3O1TA 3ZSJA 4NHMA 4JGZB 5D2AA 2P37A 4ZY9A 2JKXA 1BMV1 5A70A 3WR0A 2J1EA 3GYDA 4QDRA 5HXVA 4YVWC 1I1EA 1U5XA 1K12A 1ULCA 2W95A 1K42A 3F2ZA 3ORJA 1W6MA 4CDWC 1UMZA 2D6MA 3WDYA 3O0WA 2FHRA 4AFCA 4CTEA 5FMCA 1J59A 2BWCA 3BTZA 2BPA2 1Q3EA 2Y6JA 1BHGA 1VMFA 2EXHA 1TG7A 4HSJA 4KG0A 5AVPA 5CA6A 2DUQA 4QX1A 4FTSA 2VUDA 3FC0A 3I59A 5A3NA 5A7NA 1AL23 5KXEA 4QX5A 4MZUA 2UWCA 1ND2A 3W5NA 1FMD2 4B1LA 5FZ6A 3SISA 4AVVA 3VBHA 4N53B 1POV0 3GALA 1H8TA 3IIIA 5G05L 3S6PA 4EN8B 4TSVA 1PO22 4IV3C 2BW8A 2IXIA 1GNHA 5IATA 1V6NA 4I0WB 2ZHKA 3MGUA 4EN0A 2VQAA 2VTXJ 2VZSA 3CBNA 3OEBA 4MX3A 4NHKA 4YVWB 3S7IA 1LJ7A 1FYUA 5LBBA 1EAH2 1QQP3 4CDWB 3I3BA 5BNOB 1SLTA 3EB7A 1WD3A 1Q5OA 2VUAA 4AGVA 4XJ8A 4OQ8A 2YPJA 1W6PB 1UY1A 1GWMA 3MBWA 1N47A 3OPZA 4OZXA 4ARXA 3ZR6A 1PVC2 2OPWA 1AYN3 3E5QA 2RS53 4QT6A 5IVJA 2DDUA 1Y9GA 4HZFA 5JXGA 2QQNA 4COVA 4Q4Y2 4LORA 1ZA7A 1WZXA 1K5MB 3WLUA 1F31A 2GNBA 3AYDA 1DZTA 2ARXA 1AX2A 3LA7A 5M0TA 3ZFGB 3I54A 5J96B 1IS4A 4M3CA 2D6LX 2WT1A 3GBFA 5FY7A 3ZIWA 3BIWE 3I97A 1RIRA 4IEXA 3VHRA 1ZBE2 3CNAA 4LA2A 4FI9A 4HOOA 4OUMA 5LW9A 4FFGA 5FYIA 1URXA 1OA3A 2DVFA 1C57A 1H4HA 1ONAA 3KZ4C 4FCAA 4RD7A 4QX3A 3VBOB 4CDXB 4CPBD 5DZGA 4AI3A 3WHTA 1S2BA 1ZX5A 4Z2AA 1XYPA 3CU7A 3MV01 1GP5A 2B8MA 2BUKA 3HPNA 4IDZA 4YZ3A 3HWJA 4FXGB 2X05A 1UN1A 5A3MA 1RB8G 3G6JB 2C4XA 3HT1A 3WHUA 2A5ZA 1CAVA 4XABA 2V73A 1XOYA 2K0GA 4B7EA 1AR63 1BCXA 3KV5A 4JX0A 3GCWA 4KQ7A 2VUCA 3Q8FA 4HVRA 3PNAA 4OI4A 1YFXA 4OUSA 1FXZA 2GH2A 1V0AA 1ZREA 2JX9A 2BFUL 2GNTA 5T5JA 1YXWA 5GZFA 5FPLA 3JBG2 4Q2FA 2EVXA 3UNPA 3CMGA 3C3VA 3H0OA 1UY2A 3MIEA 3OGVA 3AZYA 1W9TA 4QQOA 4WBBA 3UKVA 1A8DA 3CLPA 4OI1A 2BBVA 3OD0A 2HBTA 3ACLA 5B4XA 1NOVA 4HPKB 4MGKE 4QX7A 4AFAA 2HWE1 5D8AA 5GZGA 2B39A 2Y34A 3WCSA 4BA6A 3RI8A 5IHRA 1PM4A 5LK5A 1WLTA 2VXJA 5FXXA 2W39A 4FBFA 5L9VA 2ZZJA 1AR82 4AHXA 4V2WA 4NHYA 4GB32 4HVOA 5JIUA 5EJ1B 5EXOA 3CL1A 4Q8KA 1GP4A 2ES3A 1H2KA 1YRZA 1JODA 1PO11 2A75A 2GMMA 1IOAA 2JD9A 1C5HA 1ZBA1 4LO8A 4PT6A 4NIAA 2ZABA 5JZGA 2Y26A 4YVSC 4DIQA 1DU3D 4RS5B 4XDOA 3UJQA 4A41A 1RVF3 1NY71 1WCQA 4AYUA 2P2KA 3RI9A 4KNCA 2XVGA 1C8M1 2PLV2 4A42A 2JDUA 3MW3A 5FYSA 1YFUA 2WYSA 4Q4W1 2VULA 1J3RA 2R072 3J8F3 4M3CE 3N9PA 1E5SA 4W6XA 5GKAC 4CDUA 1WUVA 3ZXKA 1U5ZA 2PFWA 2CAVA 3DYOA 1H6XA 3Q8BA 3S5AA 4D3WA 2WZR1 1W8WA 3I2DA 3J7LA 3WF1A 3WNPA 1TME3 2RS52 4FPHA 2W1WA 1WMDA 1UX7A 4M00A 1W9WA 3KT7A 1IPKA 4XZUG 2X53S 4AAPA 2PHTA 4LITA 4BQ2A 2H0VA 2HWF1 5CADA 2VOTA 1OUXA 5I0RA 3S57A 3WDWA 2Y60A 1JUHA 2E32A 4LO5B 2AH2A 4QPYA 5J48A 4Z92B 5FOJB 4FP2A 1S0GA 1OT5A 3P3NA 5JSPA 2RJLA 3ZYJB 1PMJX 2XHNA 1S55A 5IVYA 1OOPA 1AVBA 2WNVC 2ZX3A 4UT5A 5FZBA 2DU0A 1HB2A 4H7LA 1DG6A 5AC92 1DLLA 3DKWA 2ZHMA 3RJ2X 1RUJ3 4HL0A 4RHV2 2I45A 3GHNA 1QJZA 2VE1A 2ZJCA 3USSA 1W3XA 2VCCA 4NPRA 2JB4A 2VMHA 1KITA 1NCRC 1PX3A 3ENRA 4GJYA 3VDDA 1O3QA 3OY8A 1CJPA 5A3TA 4WZCA 4G4FA 4QDQA 4PLMA 1S0IA 1IHMA 5LZ6A 1R082 2WUHA 4LIUA 4DXRA 2DBIA 4NIDA 1EV11 2Y0IA 4K21A 2WWUA 2JE7A 2MPFA 3CZJA 5FY1A 5FXWA 4QKNA 2ZAHA 1GQGA 3P3PA 4BK5A 3ZFEC 1HXS3 3E97A 5K0UC 3MV11 3AX4A 3WVJA 2UWAA 1EYBA 3AYAA 1CAWB 2Y6LA 1XYOA 3IDEA 5IFTA 5JOWA 2WABA 1BVP1 3RPQA 4H55A 5HBAA 2WAAA 3VKLA 1WBLA 1BMV2 2WNVB 1RUC1 3K4AA 2YMZA 4ZONA 1UKGA 4F83A 4EJRA 2E33A 3GF6A 3GZUC 3NKTA 4OUEA 4CEWB 2HYXA 5GLTA 3OYWB 3K3OA 4YW1A 1ND3B 4XFCA 3AP6A 3TAYA 4LKSA 5JOYA 2RG4A 3GJBA 1HX6A 1YIPA 1WW7A 4Y1YA 1NCRB 4HVQA 3N4MA 1VBD3 1JOBA 2P3JA 1Y9MA 1RUH3 3CJIA 3FMGA 3WQ0A 4EN6B 5JXJA 5DABA 1VBE1 3SITA 5ACA1 5CBLA 5FMBA 4PDWA 3MEPA 3VKOA 3OF1A 5A1FA 2AACA 1AJOA 3M3QA 1AX0A 2RS33 4IQPA 1U0AA 1ZZ6A 2D3RA 4XFGA 3ZR5A 4D7SA 4FSJA 4RYDA 2ZGUA 2Q8EA 2R7EB 3ZFEB 4YM3A 1VMHA 1PGW1 5KC5A 2R043 3ETQA 5J09A 2XUEA 3ZN6A 1OD3A 3NW4A 5GLUA 4BOWA 4CP1A 4YZ5A 2IFWA 4BB3A 1G9AA 3VZOA 2DYCA 1V9U3 1U5YA 3CKHA 2X5IA 5FZEA 3JU9A 4UW5A 5F5AA 3I2FA 3ZYRA 1Y7BA 2J42A 2CWSA 1Y3TA 5JUVA 1YFWA 4CDQC 1JYWA 2EAAA 2RDNA 4C91A 3WP4A 1MS5A 1W0PA 4NOTA 3B69A 3AK0A 4FT8A 4KWUA 1KGYA 2D98A 2MHFA 4FVVA 5L9RA 3ZIXA 5T55A 1ZVFA 1PHMA 2G9ZA 1H9PA 3QCWA 2GC0A 2R1DA 3BYWA 3NQHA 5CB7A 3ACGA 4L8QA 1ND2C 1KQRA 2VECA 3B00A 1JZ5A 4NR1A 2ADEA 3VBHC 1F5FA 4AQTA 1L3JA 2HWF3 3N9OA 2VBBA 4YW4A 3O5SA 4AQ6A 2RDQA 3OBAA 5FO8B 3PVBB 2K9ZA 2BDRA 2EF6A 1CVNA 3B3QE 3VUOA 4XDPA 5FZGA 4AEKA 3KQRA 5C4WC 2ZACA 5BPXA 4HSLA 2R061 1XQNA 5JWPA 4QAWA 2TNFA 4MXVA 4Y1UA 1LODA 4CYDA 3W5MA 5BY5A 4XURA 3MW2A 3ZX7A 4NIHA 1QMJA 2W46A 4PBOA 4Y20A 1DF0A 3GGLA 2BNMA 3ZDSA 2GNMA 5D1IA 3GDBA 3VBFA 3KV4A 5F6KA 3NWKA 5FJHA 5IK4A 1W6NA 1GMMA 1RHI3 4K8RB 2BNOA 2Z42A 5IUQA 3I59B 2C6SA 3T2PA 3H3UA 1MQTC 2CHHA 1ND2B 5C3RA 3NJVA 3PUSA 2VAUA 2Y6FA 1UCXA 2JECA 3VBHB 1BBT3 3OBTA 1JI6A 1H8TB 3J26N 4XJWA 5FYHA 1JZ6A 2FZ2A 2QDRA 2WJSA 3FZ3A 3OPWA 2FDIA 1HQNA 1YQ5A 4Z82A 3WDUA 4E2QA 3AKSA 1BK0A 1AR73 2QJVA 2XMLA 3DXTA 4UFMA 5FY0A 3VL8A 2GP3A 3PU3A 5EHDA 4AWDA 4FAHA 5FZ7A 1XPWA 2RS11 1NYWA 3NNGA 5FZ9A 3SH5A 1J3QA 1YNAA 1MS0A 3POYA 1F15A 5C9AC 2ZKNA 2WBKA 1QU0A 4AOCA 2HWE2 3AMPA 1CGPA 1QDCA 3POWA 4JKKA 1CIWA 1N1YA 3N7KA 5ERLA 3UV9A 1UKRA 5GZDA 1RUG1 1UOBA 1VBE3 5BXXA 4YWAA 5DN2A 1ULPA 3H7JA 4BMBA 1SBFA 3ACHA 4PI0A 4DINB 3ZFFA 2WZEA 1H8VA 4Q1PA 4TN7A 3R6SA 3PUHA 4D7TA 5DDJ1 2BWAA 2QQPA 4ARYA 3JB8A 3HN1A 4X6QB 4XBLA 1PO12 2VW0A 4S2FA 3WW2A 1ZBA2 2E51A 2R0FA 3FBMA 1BK1A 1LGCA 1NY72 1R093 1MZFA 2A6YA 2ILMA 3GM8A 3ITQA 1O59A 4JDNA 4M3CB 4UW6A 4GWIA 1C8M2 2VVFA 3VD3A 2E31A 1I6XA 2JG8B 4A6SA 5DAVA 2VNGA 5KXCA 1AF9A 5D8AC 4Q4W2 2D40A 1W8FA 3ZFGA 1Y9QA 2Q30A 4NPLA 4NN0A 3LDRA 3WF4A 1DQ1A 3AMNA 1UY4A 2QZ3A 1QXJA 1U5IA 2AREA 2WZR2 1GKBA 2QQJA 1RMU1 3IZOA 5EV7A 3SXWA 1ZZCA 2PXJA 4M4RA 1VRH3 3LEKA 4INDA 3VBOA 1HB3A 2IFRA 5DG1A 5IVFA 1CAVB 3URFA 5JZGC 4TWTA 1MS1A 4JDOA 5FZHA 4I3GA 2FCTA 4NVPA 2XJTA 3ES4A 3UK9A 3K75B 1SQ4A 2PQSA 4IGOA 3WDVA 4BH9A 2TBVA 3VDBA 1LKNA 3WP3A 1HQLA 3AZXA 4AAXA 4DPNA 3AC0A 4QB1A 5FZDA 1RTVA 4AI9A 4GH4A 4DQAA 3PVNA 4N43A 5FPBA 4ZZ8A 2ZGRA 2ZGOA 2EICA 5D8AB 3TEWA 1GZCA 1HB4A 1NKGA 4P9YA 1QJU1 3E6CC 4FQ4A 5FP8A 2JDHA 2KR2A 3KV9A 1HRI1 4XILA 1RUE1 2FBEA 3T2OA 2W92A 1O3TA 1N1TA 2JG9A 3VKFC 3MIFA 1STMA 1IG0A 2WNUA 3PUIA 3LSDA 3N7LA 5FZ1A 3VKMA 4IEQA 4IETA 5AFEA 4LR4A 4XTPA 1EV12 2PYTA 3NV1A 1X50A 4Y1ZA 4FO9A 4IEZA 3HVDA 4GJZA 3GHMA 4QXCA 2HWB3 1LEMA 3KCCA 4H7MA 4Q0UA 1KS5A 3B93A 2GMPA 2QQWA 4AVBA 1OMIA 4MGIE 1XYNA 1OOPC 5GM0A 1FPN3 5JI7A 1AXYA 5DUVA 3F95A 3JD71 4JVAA 4KMQA 3C7OA 2A3YA 1RUC2 1XRUA 4B8EA 3ABZA 5CAZA 4EN9B 1SFNA 4R9BA 3VDDC 4IE6A 4QDSA 3VBRA 4CDUB 5HCBA 3PMSA 3RFRA 1DHKB 3WQBA 4LHSA 4M3CF 2G4IA 4LBMA 4XJZA 3ME2A 5FP7A 3WEZA 4NAOA 1IKQA 3PIJA 1VBE2 5ACA2 1W2TA 2ADDA 2OQ6A 3VKNA 2E9QA 3NNFA 2JJ6A 2TUNA 2LW8A 2C9AA 1I9RA 2XKOA 3IIAA 2QQUA 2BOIA 5FKBA
chains in the Genus database with same CATH topology
3NAPA 4YM1A 4JC1A 1H1MA 3X29B 5LEKA 3VHNA 1ENQA 4WM8C 5T52A 2HWC1 3J4UH 1PGW2 1OOPB 2VOWA 4XXAA 1CAUA 1PVXA 3EXUA 2PELA 5T5PA 1S2KA 4L92A 2NMNA 1O4YA 1UIKA 1HDKA 2QZ2A 3CJIC 3OY8B 3VDDB 4AK3A 5B2GB 3AKPA 2NQYA 3KS7A 2QVSB 4R4ZA 1O91A 4A7YA 5J7MA 3ILFA 1VBC3 1WW5A 1SEFA 1CAXA 3GZAA 1WLDA 3R4DB 4NO4A 4URTA 1AL21 1XNDA 3H7YA 1SLBA 5DZFA 2D6KA 3MIBA 4LE3A 2R062 5KWRA 1DDLA 1REDA 2UY8A 4GALA 5FTTC 1TNRA 3EHKA 1COV3 2AUYA 4X8NA 2CWMA 1A8MA 3KGLA 1XNCA 3CJIB 1ZRRA 2VW1A 1WW6A 1QQP1 5C8CA 4PDWB 1TEIA 4QGLA 2GC1A 4LHKA 2ZGPA 1SLLA 1AYN1 1NCQC 3RNSA 4EWAA 2WIIB 3IN9A 2ZCWA 4XOGA 1TMF3 3D8CA 4QHBA 4COWA 1HRV1 4YLZA 1X7NA 3ZN6B 2A3WA 4H3WA 1OLQA 2R6QA 4AQ2A 2R0HA 1SLAA 1DQ0A 3B02A 4LBJA 3U10A 1V6IA 2X5IB 5A33A 3VZNA 1V6JA 1X82A 4ONUA 3JB4C 2RS12 2WFPA 1O3SA 3AM2A 3CEWA 3WY6A 3D4KA 4C0HA 1B35A 5I0SA 1DIWA 1ASJ3 2P3IA 1REFA 2VOVA 4JDMA 2ZGNA 4AW7A 4DRVA 3WG1A 3NV2A 3BB6A 1MS8A 2GZWA 1RUG2 4LUMA 4COYA 2UYAA 3OJBA 2SLIA 3VL9A 4ZU5A 5GLVA 1RUI3 2Z79A 5DDJ2 4SLIA 4KWKA 2WL1A 3TOJA 1Z0HA 2MNGA 2QFEA 2Z2SB 1MR5A 4XJ9A 2OA2A 2HWC3 3W59A 1QXPA 1AR61 3MLLA 3ZSEA 4IEOA 3V0BA 4MVTA 2YDEA 4GKXA 1H2LA 3B5LB 3GBWA 5GLZA 4XF4A 3MPBA 1BQPA 3M8LA 2I07B 3VBFB 5BNQA 1W6NB 1AR91 3HT2A 5BNOC 1ZZBA 2A71A 1VLNA 2Q1ZB 1RMU2 1MEC3 1TQ5A 1YI9A 4ZU7A 2Y38A 1ZZ9A 5FO9B 2PTMA 3H50A 2YXSA 2WKKA 2WC2A 5FCCA 1SCRA 3V56A 1IZ3A 1V6KA 2CGOA 1QJX3 3T1MA 1FX5A 3ASIA 3RG0A 1C3HA 1K5MC 3FJSA 4XEZA 4QD2A 3R4SA 3RMYA 3UKTA 1XNKA 3C2UA 1RVF1 2V5YA 4YG0A 3WNXA 3ZFGC 3N7MA 4IEWA 5T54A 2WT0A 1IS5A 1BJQA 2WS93 4Q4X3 1N3PA 3RYKA 1N3QA 1OA2A 3WUDA 1QDOA 1QJU2 3J8F1 1MACA 1AZDA 1HRI2 1RUE2 3MIDA 5BNNA 1Q8OA 1JTZX 2ZGTA 3VBOC 5KHHA 4CDXC 3PJYA 4K1YA 3ZFFB 1TME1 5I0TA 2XLAA 2D6NA 3M3EA 1CPMA 1FOD3 3HMYA 4C0BA 1DGWX 3AYCA 3OGGA 1HRV3 4XFBA 5ABJA 3K48A 4N43C 2F6BA 4WV8A 3JD72 1RUD3 2Q8OA 1YYNA 2WFF3 3OGJA 1UZZA 2WZPP 1RUJ1 3KT1A 5J37A 2XJVA 4YW5A 5KHIA 3TN93 5I8SA 2JG8A 3TB0A 3EO6A 4YYOA 2WNUC 1GYKA 2OUHA 4LBQD 4M0HA 5F5QA 4BQ1A 4J6GA 4GKYA 4LE4A 1Z7S1 3ECQA 3BCWA 1QY4A 1EPZA 3O14A 3VZJA 1FNZA 1DBNA 3NV3A 2LUWA 5TSWA 4AE2A 1N3OA 2NMOA 3N7JA 3RWNA 4BLJA 1UZYA 3N35A 1HXS1 2ETEA 2NLRA 4AG4A 2XVLA 5C8WA 4GH4B 3CO2A 4N43B 4RS5C 3M1HA 2YY1A 1FV2A 3KD4A 1KDMA 2DFBA 2JICA 3AKRA 1APNA 3H3ZA 1ZRFA 2D7FA 3IPVA 3NL1A 4L2NA 4Q0SA 2DCZA 5L7OA 1KRIA 4FPJA 4FPFA 3CJXA 1AR93 4G3YC 4XFIA 2PHXA 2JG9B 4ES8A 2RJKA 2WNUB 1R1A3 3JQXA 3G7DA 3MF9A 1VBD1 4GWNA 4HETA 1RUH1 1BVVA 4CRQA 5A32A 4P9JA 3B7MA 1G9FA 4IESA 1XE7A 3M2MA 1AL22 2C5DA 2ATFA 3D82A 2RS31 1EY2A 4AFMA 3FUOA 5CU1A 4R4XA 5IK8A 2C1FA 4RGGA 2HYKA 2RM23 1H0BA 1PZ7A 5GZEA 1AXZA 5I0UA 2R041 4P9LA 4PBPA 3VBRB 1V9U1 5DXDA 4AEMA 4XBNA 3ZN5A 1JUIA 2IWGB 2QNKA 4Q0VA 1QQP2 2DURA 5FMOL 4AHZA 3V0AA 1OQEA 2EXJA 1NA1A 1V6OA 5E8AA 2FMYA 2XJSA 3NAPB 3V64A 1AYN2 4XIOA 3WOGA 2JDZA 2GDFA 4LBNA 4QQLA 2D6PA 3EJKA 4OFGA 1CAUB 4MYEA 1OD5A 4Z1VA 1HLCA 3KLSA 3WP6A 5I8YA 1QXRA 1H2MA 4BMEA 2E53A 3ILNA 4CEWC 1ND3C 2DVGA 3LZZA 3JUUA 1S0CA 3VHPA 3WG2A 1HV1A 1KJRA 1RHI1 2YGLA 1CAXB 1Z7S3 4ISQA 2HEVF 5DUXA 3WX5A 4F8AA 4I0AA 5CG9A 1QOSA 2I74A 1QOOA 2DVDA 1BBT1 1Q8SA 4AI1A 4XQDA 1AR62 4L11A 5FFOC 4RQPA 1AR71 2A6XA 1Y43B 3AMQA 5FAXA 1O4ZA 3LA2A 1UAIA 4K8FA 3VBUA 1DZRA 5C8CB 1AR92 2NYYA 3W58A 4QM8A 1G9BA 3SLIA 2GU9A 3RYPA 1G7YA 1VP6A 1VBA3 1BEV3 2UY9A 5H9PA 2UYBA 1UF2C 5BNPA 2VU9A 3RRDA 2RE9A 1DGLA 5KHJA 5HCFA 3WQ1A 3KB5A 3H1MA 3LGRA 4AEDA 3HQXA 1X33A 2JD4A 5A33B 1O3RA 5L73A 4GWMA 2BYVE 1MVEA 3DV8A 3SNMA 1RVF2 1R091 1NQDA 3IM0A 4M0NA 1B35B 5C33A 1FI2A 2G9FA 1QOTA 4I01A 3VBSA 3D6EA 2AZ5A 2DCJA 2P34A 5FQ0A 3J8F2 3VGIA 3MZHA 1FNYA 1DQ2A 4LTAA 1RUNA 1V00A 3DL3A 1DYPA 4XBQA 1CJDA 1LHUA 1J58A 1G86A 3FFZA 4GXLA 1H2NA 4RL7A 3THTA 1TME2 1VRH1 4ZU4A 3KM5A 3LOIA 2OYZA 4QPGA 5BUVA 1IS6A 2AYHA 2RR13 4FPLA 5KXDA 5FMOS 1H8TC 2DCYA 3I8TA 1WMFA 3AJYA 1PK6A 3L9JT 3VZMA 4K6BA 3ZYIB 3V0BB 5CFCA 4GIQA 5L19A 3RJRA 2XL7A 1X8EA 3USUA 3QD6A 4CEYA 2PHUA 1RUJ2 2R49A 3THPA 5DUUA 4CZSA 1DGRN 2PAMA 4A7ZA 4C90A 5BNNC 2VG9A 4XF1A 1AL0G 2O8QA 1N1SA 3QBQA 3AKQA 4N9HA 2EIGA 5FRAA 4DMIA 4EN7B 1Z7S2 4AEJA 1F5JA 2Y0OA 1NE6A 1AX1A 1MZ5A 1A78A 1J3PA 2DFCA 2EAKA 2ZMNA 1Q8QA 2HWB1 3OBRA 4XQWA 4DB5A 1UU5A 5T5LA 2QCSB 1HXS2 2Q5TA 4EV0A 5LRRA 1FPN1 3NO8A 1AYM3 4X8PA 5EFUA 3U11A 3O0VA 4B4QA 3E6DA 3WW1A 1CR7A 1S0FA 2HEWF 2XJUA 1UU4A 5JCTA 2JG8C 3GNEA 4DY5A 2XL9A 2A70A 1D4M3 1CPNA 3PHMA 2WNEA 5BNNB 1YO8A 1UPIA 1LHOA 5CNAA 5FLJA 5E88A 1H30A 4FOVA 1VBD2 3ZYPA 1RUH2 2G9GA 1XE8A 1QNYA 4XHXA 1C1FA 4K7JA 5KBFA 1C5IA 2A6ZA 2ZX1A 2RS32 2W52A 5ABJB 1QJY3 1UX6A 5C6CA 1BZWA 2BEOA 2NZ9A 4I2OA 1W6QA 2R042 3RMXA 2IXCA 4TYSA 2MEV1 4LLFA 4QM9A 4YM2A 3A0NA 1VBB3 1LHWA 5L7OC 3FE5A 1V9U2 3OCPA 1LULA 5EJ3A 4LLOA 5IK7A 2HWD3 4KWLA 3MIGA 4B7KA 3DN7A 5H9RA 3S0MA 5LRSA 2N7GA 4QGMA 4YG6A 1MZ6A 1VBC1 2XGXA 2BVVA 4AVTA 2NPIA 1EPWA 1LECA 2HWF2 1ZYBA 1PIV3 2B46X 3W9AA 4Q26A 1VB4A 1B09A 1ULFA 5EWSA 5J3UA 1S0EA 4RFT0 3AMHA 1WLWA 2XPJA 1NZCA 1LGNA 3IPVB 4N9IA 1HIXA 4MGZE 5L7OB 4BZ4A 4YARA 5FLIA 1COV1 4PIYA 1NA1C 4CDUC 4XF0A 1ENXA 3E6BA 4LBOA 1OI6A 1A3KA 1RHI2 5A32B 3ZMNA 1JBCA 4K40A 1VAVA 1FMD1 2XB6C 1IQAA 4FP3A 2W68A 2XBO3 4K3UA 1BBT2 4ASLA 4AGGA 3H1WA 2B42B 4JGYB 3KSCA 3MDPA 1SCSA 1TMF1 2W08A 2D5HA 3AP4A 3H1YA 1AR72 1UW8A 4COUA 3RYRA 1MVQA 2ZX0A 3M3CA 4LULA 2DCKA 4L99A 1V6MA 1ZZ7A 2YUEA 3V0AB 1LB2A 1ASJ1 2XH6A 1NA1B 2ET7A 4HMZA 4GA9A 2ZBJA 4MV2A 1GQHA 1D4VB 3E5XA 2Q1MA 1S0BA 1XU2A 2YROA 2B9UA 1KFXL 2D3PA 3MPPG 4KGQA 2AR6A 1JYIA 4FPCA 4WVZA 1RUI1 2QDNA 4RQPC 2AENA 2OPKA 4HANA 3D0SA 3DPRA 5KXBA 2XJRA 2A3XA 1R092 2MEV3 2R1BA 3ZMOA 5F6LB 3SHRA 1RJ8A 2XVKA 1ENSA 2DV9A 2UWBA 4Q4V3 2ZX4A 3KCXA 1OPMA 2JE9A 4HLTA 1DQ5A 4XW3A 4I30A 3SCGA 1LOGA 2OZ6A 4R52A 4PDWC 5BNPC 1LGBA 1MEC1 4XIKA 4COZA 1VRH2 2E7AA 1HKDA 2RMU3 2XUMA 4U2AA 2ZMLA 3QLQA 3LSEA 1QJX1 2IXLA 1U12A 5EZWA 1RC6A 4V1PA 4YZ4A 4OVEA 2EXKA 4A3XA 3AJZA 1X8MA 4PF5A 1ZNPA 4RQPB 4JTOA 4MGYE 4YVSA 3U0ZA 3JBG1 2ZPXA 3APBA 3VBSC 4B4PA 2O8OA 5JPMB 4D69A 3VBUB 2X5IC 2AGSA 2WSUA 5JVVA 4QQPA 3TWIA 1XXNA 3INAA 2D6OX 4XZPA 5FPZA 2D44A 3WP5A 2WS91 4Q4X1 2GN7A 2JKBA 1QH6A 1UIJA 4XYXA 5L36A 4AFBA 3T2TA 5BNPB 5IT6A 3QOPA 1QGLA 1FMD3 1YLLA 5EYXA 4WM7A 4HN1A 5DZEA 2PHLA 3OTFA 4DXZA 2HWB2 4AEDB 3WDTA 1PO23 5CFCC 2D97A 1FOD1 3M70A 1FPN2 2KA3A 2IXHA 3HAGA 4RGAA 4CEYC 3SCFA 1IS3A 3BTAA 1RUD1 3LCPA 3VBSB 3MYXA 4ZKTB 1EAH3 2WFF1 1MS3A 1NLRA 5FQ0B 3VBFC 2PHFA 4XF9A 1F9KA 2ZA9A 4TLFA 2WLQA 1EP0A 4NWVA 3ZXGA 1LRHA 3TN91 5SV5A 2K2SA 1J1TA 1PVC3 3M4FA 2B5HA 1T6GC 1MS9A 5F9TA 1WW4A 2V09A 2WSVA 4L97A 3AMMA 4MUVA 1KXGA 2DVBA 4QPGB 1NXD1 1DZQA 4Q4Y3 4FTEA 2VW2A 2X29A 1LOAA 4FPOB 1PK6B 1GV9A 4IERA 5CFCB 3USUB 4BIOA 4KWJA 3SH3A 4CEYB 4J1XA 4YGDA 1YJKA 2DUOA 3H8UA 4MSVA 1GZWA 4QQHA 1ZA4A 1W6OA 1ZBE3 1D0HA 1VR3A 3VZLA 1M06G 1RUOA 3ELNA 4PJYA 3B9CA 3NVCA 2OZJA 3ZXEA 4A7KA 4QQ2A 1R1A1 1VBC2 3B94A 4D7YA 3ZFFC 2Z69A 4AFDA 3HIFA 5FOBB 1POV3 1RINA 3WZ1A 1LR5A 4AI8A 1YJLA 4RA0A 2I2SA 2RM21 2PAKA 1GSLA 3JBG3 2VVEA 3BPZA 1HW5A 4FOYA 1DFQA 2IZWA 2F4PA 3WXPA 2JXAA 4XMIA 5A3LA 1COV2 4CDQA 1W0OA 2JEMA 3E5UA 1YCIA 3FWEA 1PM7A 4YW3A 1LOEA 2WLPA 5J98B 2Q0AA 1AR83 2PA7A 1MZEA 4GB33 3ZXLA 1H4GA 4TZDA 2PN5A 1VAMA 1ALYA 4FQZA 2A7AA 5C4WA 4BE3A 3FLTA 1TMF2 1W6QB 3LB9A 3N3HA 2YV8A 2R32A 2UURA 2IXJA 2PLV3 4K9SA 4WZFA 4GH4C 4DOUA 5AFBA 4JV4A 1D0GA 2IXKA 1OKQA 4LHLA 4UW3A 3IBMA 2R073 1QF3A 1YUDA 2VY0A 5GZCA 1LOFA 1AUYA 1I5ZA 3FHIB 1ASJ2 1JYCA 4YNIA 2E7TA 2GALA 3WT3A 1ZZ8A 2O0OA 1JN2P 2OW4A 2JG9C 4JRLA 2E6VA 5F1RA 1MQTA 4AI0A 3MICA 4RR3A 2ZMKA 1KDKA 1NLSA 2GMEA 2H0BA 2ZGSA 4FPEA 1RUI2 2H6BA 5DUWA 4IV3B 3VV1A 4QU2A 5JAXA 2HWC2 2E7QA 2LALA 2DTYA 3RZZA 4MXWA 5AC93 4IEYA 1CD3G 4KGGA 4RHV3 2LTNA 2ARBA 1VJ2A 1ZM1A 3DGTA 4YRDA 3VBRC 4ITCA 5C9AA 2Z5WA 1QNWA 2XWBB 2GH8A 1J1LA 2WA4A 4U36A 3ZPYA 4E4ZA 4YGCA 2ZTNA 1SFYA 2CAUA 4YFWA 4XFHA 3IT8A 1R083 1MEC2 1OPOA 3PJQA 3DUIA 4XFAA 4XDQA 1VBA1 1BEV1 3LAGA 3NAPC 4BCUA 1VIWB 1NE4A 1QJX2 3HR9A 1ZRDA 1D2QA 3BOPA 1TNFA 3DPRC 1PZ9A 4Y5Z0 4H14A 2CTVA 1D2SA 1UD1A 2NN8A 3BODA 4JGYA 4ATFA 5JMCA 3UJOA 1DGRA 4X6RB 5E16A 3OD4A 3ROUA 1F8VA 4R9AA 3PTYA 2YGMA 4LEJA 2P17A 2WS92 4PCRA 4O9EA 4IXLA 4Q4X2 2PAEA 3K51A 3WW4A 2D43A 3VZKA 2VNRA 2SBAA 3ZXDA 4FOQA 2HJIA 2ZKLA 5JPNB 4Z07A 1OA4A 1LOCA 1G8WA 3B9IA 4N7IA 4Q1RA 4E2SA 2D5FA 4AVAA 5H9SA 4AGRA 1GBGA 4O9GA 4C1XA 2BGCA 1GANA 1LU1A 4IV1A 1YHFA 4Q29A 2R16A 2RR11 4W65A 1FOD2 2WWSA 3NV4A 3ZSMA 2ERFA 3DPRB 5JOZA 3TRSB 3PVOA 1HRV2 4AI2A 1S0DA 3IDCB 1RUD2 5GALA 4Q27A 4OHWA 1RUF1 1FV3A 1OFSA 4UXAA 5T50A 1O5UA 1OFNA 2WFF2 3O0XA 4Q0QA 3SCHA 3NJZA 1SLCA 4QXKA 4FPGA 1XNBA 3PLQA 4Z2WA 5C8CC 3TN92 1O7FA 4YZ2A 4PQ9A 1SMVA 4WM7C 3TYJA 2KM2A 3ZXAC 1GR3A 4S2DA 2WQZC 4WVWA 3ZSLA 1PMIA 5J36A 1ENRA 1I3HA 2A6VA 3MLKA 3M7AA 3TNPB 3GBGA 3L2HA 3S30A 1NG0A 4FPYA 4QMAA 2BTVC 2KXLA 4YVSB 4JAAA 4Y22A 4YFZA 4AHYA 4LNVA 1AYM1 1WA4A 3Q9OA 3LA3A 1WGPA 1REEA 2GN3A 1G9DA 4QGNA 2NP0A 4HKWA 1JH5A 1B35C 2CGPA 4KL1A 4L9BA 2CGNA 3SH4A 2ZGLA 1D4M1 1GICA 1LHVA 1N1VA 2WINB 3TNQA 2FMDA 1CQ9A 1R1A2 4B3NA 4WM7B 1HQWA 3QH6A 3MW4A 4UW4A 2VMIA 1A6CA 4Y4YA 2XWJB 3T1LA 3R0RA 4ASMB 1YI7A 2GNDA 2W0XA 4WM8A 5FBZA 2VVDA 4LBQA 5BYNA 4MLOA 1HV0A 1Q8PA 1DQ6A 1QJY1 4GULA 3U4XA 5JSOA 5HI0A 2RM22 1YFYA 4E4DX 3HBZA 3EQEA 3JQWA 3FLPA 3LWCA 3VHOA 3VLBB 2DTWA 4AHWA 1VBB1 2XHKA 3AP7A 1VB2A 3AZVA 4JCKA 4YGEA 5CFDA 1SBEA 2HWE3 2EALA 2BFUS 4WVMA 3UKNA 4I3PA 2VMGA 1C4RA 2HWD1 1Q56A 4XHBA 2ET1A 1SACA 1GFF2 4P9XA 4YW2A 4BHPA 4DZGA 4OI0A 3A4UA 1QWRA 4FTBA 3AB0A 1CX4A 2VH9A 1ULDA 3NKGA 3O12A 5K0UB 4YZ1A 1PO13 4LO4B 4C1WA 1ZBA3 1RGSA 5K7PA 2ZZQA 1PIV1 1CESA 2ZGMA 4KU8A 4N7UA 4FPKA 4QPIA 5AVAA 2LM3A 1C8M3 4ORFA 1GZWB 4WVVA 1E57A 1W6OB 1FT9A 4BPZA 4ES9A 5FLHA 4Q4W3 1R1ZA 5KHKA 1RUF3 4GMP1 3RSJA 1V70A 2YC0A 5T5OA 3U07A 5KC6A 2ZHLA 3IKWA 2GC2A 4HT1T 5IK5A 2WZR3 3ZVXA 1WCDJ 1JHNA 4IEVA 2EA7A 3FUQA 4OI2A 5JI9A 5FPXA 1SLIA 2OVUA 3MIHA 1NCQA 4B4RA 1BXHA 1O4TA 1AXKA 2CNAA 4XJUA 2XBO1 2ZAAA 4HKOA 4XETA 4AVSA 2XKPA 5KHGA 1NXMA 5CVRA 5ABJC 4FAGA 1YIFA 1KD7A 3LKJA 2ZHNA 1IKPA 5GJ6A 4E2GA 4ZXKA 1XU1A 3QH7A 2PHRA 1W6MB 4SBVA 1JW6A 2ZOEB 3FBYA 4JGZA 1LOFC 4ISRA 1PGSA 4CDQB 2VOXA 1Q43A 2FZ1A