The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
45
|
sequence length |
146
|
structure length |
146
|
Chain Sequence |
TEDGETVKVFEDLQGFETFIANETEDDDFDHLHCKLNYYPPFVLHESHEDPEKISDAANSHSKKFVRHLHQHIEKHLLKDIKQAVRKPELKFHEKSKEETFDKITWHYGEETEYHGRPFKIDVQVVCTHEDAMVFVDYKTHPVGAN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Unknown function
|
molecule keywords |
Protein YER067W
|
publication title |
Structural and functional study of YER067W, a new protein involved in yeast metabolism control and drug resistance.
pubmed doi rcsb |
source organism |
Saccharomyces cerevisiae
|
total genus |
45
|
structure length |
146
|
sequence length |
146
|
ec nomenclature | |
pdb deposition date | 2007-11-13 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Protein Transport Mog1p; Chain A | Protein Transport Mog1p; Chain A |
#chains in the Genus database with same CATH superfamily 3BCY A; #chains in the Genus database with same CATH topology 4LUQ C; 4N88 B; 4RTH A; 3WA5 B; 4BQ8 C; 3NR5 A; 3BCY A; 4N80 B; 1VR8 A; 4L9H A; 1EQ6 A; 4BQ6 D; 2VU4 A; 2LNJ A; 1JHS A; 3HLZ A; 4L9C A; 1TU1 A; 4N7S B; 3JCU P; 4M5F B; 4RTI A; 3V7B A; 4OUH A; 1V2B A; 2VT8 A; 4ESQ A; 3LYD A; 2XB3 A; 4UI2 D; #chains in the Genus database with same CATH homology 4LUQ C; 4N88 B; 3WA5 B; 3NR5 A; 3BCY A; 4OUH A; 2VT8 A; 4N80 B; 4M5F B; 4L9H A; 4ESQ A; 4L9C A; 4N7S B;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...