3BD9A

Human 3-o-sulfotransferase isoform 5 with bound pap
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
262
structure length
258
Chain Sequence
SHMQQLPKAIIIGVRKGGTRALLEMLNLHPAVVKASQEIHFFDNDENYGKGIEWYRKKMPFSYPQQITIEKSPAYFITEEVPERIYKMNSSIKLLIIVREPTTRAISDYTQVLEGKERKNKTYYKFEKLAIDPNTCEVNTKYKAVRTSIYTKHLERWLKYFPIEQFHVVDGDRLITEPLPELQLVEKFLNLPPRISQYNLYFNATRGFYCLRFNEIFNKCLARIHPEVDPSVITKLRKFFHPFNQKFYQITGRTLNWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineering sulfotransferases to modify heparan sulfate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Heparan sulfate glucosamine 3-O-sulfotransferase 5
total genus 84
structure length 258
sequence length 262
ec nomenclature ec 2.8.2.23: [Heparan sulfate]-glucosamine 3-sulfotransferase 1.
pdb deposition date 2007-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3bd9A00
4DDTA 1QBKC 3AF0A 3ZZTA 3CPEA 4JLAA 2NG1A 1YR6A 3IPXA 3U2QA 2G9NA 3GLGB 4HYYA 2NO7A 3AKCA 4BZPA 1ZINA 4JLVA 1UAAA 4J0QA 1PZNA 3CF0A 1N6OA 1YKSA 1U8ZA 4EKDA 1SKYB 3NBXX 1TNDA 3JVUA 3O8RA 1NMYA 2AK2A 4C7OA 3WYFA 1NBMA 4IKEA 5EE0A 1I2DA 1W1WA 3M4YA 2ZR9A 1GNQA 1U90A 3TIFA 4FWIB 2A30A 4LX0A 1NKTA 2A5GA 2ZJ5A 4KBGA 4EQ6B 1S4QA 3D8BA 4KHZA 3SHFA 1XTRA 4NP6A 2OHFA 4PC7A 3U3MA 3I5YA 3FPAA 4OI2A 3KQNA 2G0NA 3V4RA 1MABB 2C78A 3OEEA 1GSIA 3Q7PA 1CR2A 3PUVA 4LRWA 1E9BA 2ZS9A 3RABA 2JGNA 1WQ1R 2AX4A 2GCNA 2QM7A 4ZO4A 1L8QA 5FL7D 4IVPA 3CR8A 4ZPXA 4K46A 2CVFA 2XZOA 2QMUA 4MDEA 1S96A 2WV9A 2ZJOA 2O52A 1IN7A 2E1RA 2IC5A 2WMNB 2F3RA 3IHLA 4QGGA 4CEHB 3R9WA 2AK3A 4A1FA 1E2MA 2ZXUA 4BZXA 2MSDB 4DEYA 2H18A 2ZRGA 2CK3D 3BAFA 3BJIC 5C4MA 1NG1A 2OESA 3TQCA 1XJQA 1N3BA 3EASA 2QROA 3FKQA 2A2ZA 3OE7A 1OYYA 2PT7A 3SJBA 1F2UA 4MRSA 3WNDA 3B9QA 1FL9A 3NDBB 2ZYVX 1HTWA 5JSZB 2HDNB 3RHFA 1ZNWA 1P2TA 4D0GA 4OK6A 4OJKA 4A8JC 1T5LA 4RJLA 4F92B 2FZLA 4S2EA 3KFVA 2C95A 4POAA 1M7HA 1ZNZA 5TY0A 4E07A 2EW1A 4O0MA 4RY2A 5C2JB 2FFAA 3MJRA 1AIPA 1G18A 4NCNA 2GDJA 3W8NA 5L3QB 3TE6A 5TXGA 2IF0A 4YLGA 2ZRCA 1OXSC 1VHTA 1G4UR 5BQ5A 4YMTA 1GKYA 1RKBA 3KXIA 2REOA 4Q9IA 3V9PA 3R9XA 3CLVA 4P4TA 1YRBA 1OFIA 4NYJQ 4ZI2A 4XH9B 1UBFA 3OHMA 1ZRHA 3LXRA 3Q85A 1NVVR 3O8DA 1UBCA 4FMBB 1F60A 3EA5A 3HYTA 2CJWA 4ZDIA 4FN5A 2MSEB 3OAAD 1G20E 3QKSA 1P9NA 5L3VA 2G3YA 1EGAA 1Q44A 2R6FA 1EG7A 1OW3B 2SHKA 2C04A 1ZBDA 1Z8FA 3CBQA 5AUOB 3U7FB 1HE1C 3PUXA 5H1YA 2X2EA 1AKEA 4TQ9A 1AGPA 2J0QA 2Q3HA 4O25A 1D2NA 3L0IB 4E03A 5F9FA 4DT1B 1KO7A 1IXSB 4I1OA 4KAXA 1W0JD 1S8FA 1SVKA 2QQEA 3AKDA 4AG5A 4TMZA 3BIFA 4A9AA 4XVUA 3QKSB 1SVWA 2C9YA 2J0VA 3X1ZA 4W9MC 1IBRA 4L4UA 4QHYA 1CJVC 3AGPA 3TKLA 4KJZA 4JSTA 2A3RA 4B6EA 4IOJA 5FPYA 3R7WA 1E1QA 2GVZC 4LV6A 3KQKA 1KI8A 4AKIA 2V1UA 1CTQA 4P33A 3MRSA 4QL3A 4I4LA 1MV5A 4EQ6A 2XXAB 4MGZR 5CK4A 3TR0A 4QBFA 4TMTA 1M7GA 3U4QA 4Q4AB 1OXTA 4M9ZA 3SR0A 4TMKA 2OV2A 5BXQC 1G1MA 4C30A 5JS8A 5KUTA 1G5RA 1TTTA 4URUR 2H57A 2Q3MA 2CE2X 1W7AA 3RLFA 3X1XA 1IN8A 2XTZA 1T91A 1NKSA 3ZD7A 4QJ3A 1BIFA 4RD6A 4WZBE 521PA 3NC0C 4EFNA 1S0UA 1TX4B 3CWQA 3GJ3A 4ARZA 1UPTA 3CONA 3RNLA 3SFZA 1KJYA 4D2IA 1WBDA 2R9VA 3PENA 4A0RA 2D06A 1N6LA 3CX8A 3QG1A 1G7SA 1XZQA 4ABYA 1VTKA 2AWNA 1XXHA 3TSOA 4W5WA 3G5UA 4Q00A 4TL7A 1P6XA 1DVRA 3KDSE 4CZ2A 1I4DD 4B2PA 3KX2A 3GLHB 2PEZA 2H8KA 3C4JA 1DPFA 1Z5ZA 3TBKA 1KI7A 2D3WA 3DZ8A 3NXSA 4ZIRA 1JBKA 1VYUA 2HLDD 4YXWD 2IYUA 3NTUA 4KFRA 1GKUB 4US0R 4Q4JB 1RRGA 4KFSA 3SDZA 5HKKD 2HLDA 4FINA 2ODEA 4JLDA 4V0NA 1G7RA 2GCPA 2CCKA 1OJLA 4PTLA 4TTPA 1AQYA 2EQBA 4GFDA 1S3SA 4XWOA 2W58A 4I1SA 3LY5A 1TL7C 4C0LA 2UVQA 1KMHA 3NDPA 1G3MA 3BH6A 5LBIA 1XXHE 3LA6A 3RS2A 3ZJYA 1OIVA 1IJEA 1CR0A 1XWIA 2PX3A 4TMXA 2XITA 4Z1MA 4BFTA 1Q12A 1AK2A 3CH5A 3OFNA 1FTSA 2JCSA 2Z4SA 1T3HA 1R5BA 1XTIA 4M9SA 4P4SA 4OK5A 2HF9A 4GNKA 2P67A 2J59A 1KO4A 2KE5A 3NG1A 3VU9B 2FSHA 4N3NA 2RH5A 4U5XA 1DG3A 4B43A 5KNCA 5CJPA 1ZCBA 1E3MA 1HEIA 1E4YA 4YXWA 2GZHA 4MITA 4Q19A 4PQFA 4L8GA 4DCNA 2P0EA 2HCBA 4Q9JA 2K5UA 2VQSA 3VKGA 1UBGA 1GP2A 1E2EA 3GLIB 1KDPA 5CB8A 3IIKA 2X2FA 1SQ5A 2RGNA 1PLKA 2ZI6A 3B60A 1KKMA 2BKEA 5JS7A 1ZM4A 2OUKA 3SQXA 2JJ2D 2O0KA 4L16A 3I5XA 3IO3A 1ESNA 4HB3A 4Q66C 4BLSA 4BE7B 1WF3A 2DFNA 3OFND 4UNNA 4ZKDA 2H92A 3SBEA 3TAUA 3LVQE 3MLEA 1R2QA 5DHAA 2AFHE 3NBZC 1F5NA 4URZR 2JATA 4URXR 1SHZA 3PEYA 2R6AA 1RPZA 4IDHA 3ASZA 4UQOA 3KJEA 1M1YE 1YZGA 5TV2A 4LSGA 5CJ2A 2H7VA 1OIXA 5CIQA 2VP5A 5HZHA 4CEJA 3REGA 2J87A 1OXXK 2IYSA 3HPRA 2ZE7A 1Q1QA 3SQWA 2E87A 1KIMA 1SVMA 3BE4A 4IOLA 1RYHA 1XX6A 1P62B 3U3RA 1W2HA 2ZUCA 1WDTA 5KYKA 4M8NE 1XD8A 4L5BA 4R2IA 1P60A 1ZP6A 2IYQA 3QENA 1LW7A 1COWA 4IOMA 2R65A 1P75A 2VF7A 4O2LA 3KL4A 1W48A 1E0KA 1E1RA 1HUQA 1OKKA 2HYDA 1E2NA 1JAIA 4FD2A 3IEUA 3VHXA 4ZCIA 4OHXA 2WWFA 2VL7A 4TLDA 4HUQA 3U3OA 5ELXA 2P3SA 4IDQA 2ZR0A 2NO6A 1KGDA 2PJZA 3KKNA 3GJ0A 3GLFA 4MGKR 2GAAA 4YDHB 2RGCA 1M34E 3MFYA 2BDTA 4GZMA 4B34A 3VR4A 4DIEA 5DI3B 1ZW6A 3B1XA 4JVLA 1Q1BA 1W0KA 2ZSEA 4MYHA 3P20A 2GF9A 1E2LA 4PZYA 1O3YA 1N0VC 3W6NA 1XEWX 3JVVA 1EXMA 3C5HA 4PC2A 5FBWB 4CF7A 5HR5A 3FMPB 2QTHA 4RD2A 2R6CA 5JI2E 2YWEA 3P27A 4OYHA 2ZU0C 3THXA 1JAHA 1R0YA 4G5SA 4JT4A 5A0FA 4NZYA 1VYVA 1W5TA 2WHXA 1VECA 2F1HA 2Q0HA 3A1SA 3CNOA 2IL1A 4TL9A 1KK3A 2JLXA 2QAGB 3P32A 2X77A 2KWIA 1D9XA 1OE0A 2PMKA 2XB4A 3AVYA 2YV5A 4HLUC 2ZYTX 4D25A 1MR3F 2O8DB 4HLDA 3T61A 1ESMA 1NF3A 1W47A 2ZRLA 5FUWA 2CDNA 1UKEA 4OHVA 1G5PA 4IW3B 1YU9A 1QHSA 4MYUA 1KDOA 5K8UA 1XMJA 2OBLA 5G53C 5KNBA 3GP8A 3ZIAD 1RIFA 4DIDA 3I73A 3FMOB 2WJYA 1KAGA 2Q9AA 1G8YA 3MJHA 3ONWA 1KSJA 1LNZA 2A9KA 3G0HA 3EC1A 5G3YA 2WPDD 3LW7A 1QVAA 2VP6A 3IBYA 4NE2A 1NMZA 3K70D 2IXFA 3Q5DA 2D7CA 4C0AC 2F1RA 3NWJA 2OZEA 3TLXA 5F2EA 4C2TA 4UNQA 2EFDB 2R6GA 3HDTA 4LHYA 4DDUA 1Q3TA 1X3SA 2GEDA 4EAQA 5DN6A 2C5LA 1DTSA 2W83A 5KDDA 3FHTA 4TZ0A 5GJCA 1UJ2A 1E2QA 5DO9A 3GLHA 1DEKA 1OH8A 1EX7A 1E9EA 4M4SA 5SZKB 2PCJA 3QKRA 4TYPA 3AM1A 3LW8A 2HV8A 3ECCA 3UWOA 3X2SA 3HU2A 1NN0A 4LGMA 4LHWA 4YMVA 4NKRA 2KJQA 4DUGD 1A5TA 4WZ6A 2V6JA 5FL3A 1ZM7A 5GJWC 2P5SA 3NBYC 3GLIE 2G1JA 2D4HA 5AJYA 4TYQA 4AC9A 4BEJA 2YKGA 2VYFA 1S9HA 1F2TB 4O2RA 2QA5A 4QFMA 4JBWA 2ANCA 4V0OA 3NKVA 3L82B 1MOZA 4ERNA 1Z0AA 5JMTA 1KMHB 1A4RA 5JWHA 3SJZA 1X8KA 2CL0X 2XSZD 4TYWA 1B23P 1CJKC 1X86B 4HI0E 3RS3A 2ZRMA 1R6BX 4Q9LA 4C0QC 3ADBA 4JMPA 2QN6A 1E99A 4A8JA 1GM5A 5TVKA 2VHUA 3FE2A 4OKSA 1W46A 4HB0A 1U0JA 2NO0A 2P2LA 2RGDA 3RS0A 3SS8A 2ZI4A 3OEHD 4HAUA 2QRNA 1X8JA 1G4AE 1N5IA 4DDWA 4LYFA 2GBLA 4PHTA 5KDOA 4MH0R 3ZZ0A 2QBYB 4XD7D 1GFIA 1N5KA 4IDPA 2PMDA 1TF2A 4BASA 4JVSB 3BB4A 1Z22A 3T06B 3WP1B 4JS0A 4ZCLA 4JVNA 1EK0A 3LLUA 3LRPA 4TYNA 5EP1A 2IA5A 2WKQA 3B1WA 2OFWA 2GESA 5J4YA 1XEWY 2CEAA 5KSOA 3I32A 3QKUA 3WRXC 3DOEA 1E9DA 3ZZUA 3J81k 3THXB 2Q9BA 2OBMA 4HUQB 1IONA 1OLOA 2DWOA 4I1UA 2PBRA 4EPYA 1RRCA 4DXAA 4D0LB 1JJ7A 1U2RA 2QGZA 1WP9A 2C99A 4NTZA 4DLVA 5FR2A 5SZIA 1R4AA 2F1JA 3MG9A 5BN4A 1QG2A 3E2IA 2RB4A 2BBOA 4L9SA 2XOKA 3NEJA 4ILEA 4KV9A 2FU5C 5BYKA 2D2FA 2OCYC 2WICA 1YZNA 3RS7A 1KI6B 5D3MB 2EWWA 5BW8A 4MRVA 1CKEA 3C7KA 4EUNA 3PEWA 4OI1A 1MO5A 5CLLA 1DELA 4GMDA 4FWTA 1KY3A 5FL7A 1S3GA 3LX8A 4JIMA 1G7TA 1XFAA 1YE8A 5EUMA 2EYQA 3OEED 1G64A 4B35A 4OL0A 3CB4A 1EFHA 4BFYA 5CK5A 4MDFA 1GRNA 1TF7A 3KB2A 5KO2A 4CVNA 2B6HA 2J0UB 2D62A 3AF2A 3IEVA 3VKHA 1JR3A 2F9LA 2IT1A 2ERYA 4BFSA 1RVDA 4NCJA 1TUIA 3UPUA 1GG2A 3U6KA 3TVDA 1II8A 1ZNXA 1MH1A 2G77B 2G88A 2ZI9A 2FEMA 3K0FA 4NPHA 1LS6A 1VCMA 5DN6D 5L8VA 1W36D 4NYIR 4DB2A 2P6RA 2ASEA 1M8PA 4LJ6A 3GEEA 4FCVA 2ORIA 4MQBA 3ZVMA 4NU0A 2BEJA 5E7JA 2WOOA 4KCGA 4HSEA 4G5OA 4JL8A 2OXCA 2ZAOA 3QNUA 4F4IA 5L3SB 1N6HA 4X8MA 2GZAA 4QXAA 2OCPA 4CEHA 4UJ5A 4NH0A 4Q4JA 3Q5EA 2JIZD 4PHFA 1CF4A 4ON9A 1VCIA 1GRRA 2VBCA 2CXXA 3HR7A 3DEFA 2A5DA 1XNJA 2CJWB 3TUIC 5DI3A 3REFA 1YR9A 5SZJA 1XJ0A 1GVNB 1EFCA 3W5IA 4Y0AA 2N1BA 1WB9A 2VLIA 4Q1FA 3UMSA 5IRCD 5F98A 2WJVA 1E9FA 1FUUA 1P9WA 1W4BA 5FPSA 4KSBA 5FR1A 4URVR 4A2PA 4IEEA 1CJMA 1ZU4A 3QSYA 1Z0KA 2I3BA 5FOVA 2YOHA 3T1OA 1DG1G 3QBTA 3I8XA 1ETUA 3QXJA 4P4SB 5EXTA 1FW6A 2FGKA 3QPWA 2QBYA 4CGZA 3WNBA 5DYGA 1DBSA 1N2CE 4HZIA 2G0TA 5EE3A 1XTKA 4AWXA 1X8LA 3LQRA 2ZSDA 3Q7QA 1KHTA 4LBZA 2XTNA 3U61B 1GNPA 2ZRIA 1P7CA 4TLCA 1US8B 1KK0A 2VRWA 2WKRA 1VPLA 5HCNA 1G8FA 5KPJA 1E1RD 1OKKD 3A4NA 4ZDKA 2WSSD 4DRZA 4PPGA 5E7IA 1W0JA 2EFEB 3PITA 3GPLA 3MWYW 4JT2A 4MKFA 3BORA 2VTKA 3UMRA 2OFXA 4PX9A 3UG7A 1Z6AA 2IF2A 2GXAA 2CMKA 1IOZA 2N42A 3HWSA 5AR1A 2ZSFA 3TUZC 2WWXA 2J5XA 2BV3A 3H2YA 3IIMA 5B57C 3HPQA 5J4KA 2XB2A 3VR2A 1Q57A 2IXEA 3CRRA 3FTQA 5EUQB 1EESA 5EE5B 2J1LA 1E98A 1KYIA 4B73A 1IXRC 1GITA 4M53A 5TMPA 4QBHA 2GF0A 5CLQA 1AA9A 5TB5A 5EXXA 2ZE6A 4B3BA 1DAMA 4US1R 4IHQA 1I4LD 1YZLA 2W2XA 5B64A 3QUSA 4S35A 1ZUHA 3RRYA 4YQFA 2B21A 3N2IA 3RAPR 4DSUA 3ADCA 4DCSA 3ADDA 4GSYA 3F0TA 1E0SA 4JKIA 1D2MA 2FV8A 4FCTA 1S2MA 2ZRNA 3A37A 2BC9A 2G6BA 1N5LA 3QQ5A 3BD9A 4Z8XA 3A6PC 1T4GA 3X1YA 1BMFA 3HR8A 4DLSA 1DAEA 621PA 2HYIC 4TLBA 4MGYR 4IOKA 3U4QB 4R98A 3FFAA 3T15A 1F2TA 1VG9B 3ZIAA 3CF2A 1BH2A 1DE0A 1OYWA 1YZKA 4QOSA 5LB4A 3NIBA 4RD4A 3WHKA 1AKYA 1KY2A 3IPYA 2BWJA 3EWSA 4X8OA 4UNPA 4V02A 4DLTA 1NLYA 4I1VA 1AQUA 4V0KA 4FW9A 4BUJA 1WA5A 4LDJA 2RGEA 5DLQC 3S1AB 5FPTA 1Q1ZA 3QXCA 1OT3A 3HU1A 2B92A 2XZPA 4W7SA 4LJ8A 1ZM3A 3PV0A 3QEJA 4GOJA 5E4FA 3ASYA 2CBZA 2ZJAA 3A4MA 3AGQA 4GT1A 5EP4A 5CB6A 2VO1A 3A1UA 3SJCA 2QTVB 2ZRAA 1JI0A 1XTJA 2XZLA 2VHCA 4RZXA 1NNEA 3B9PA 4D81A 5JLJA 2FFBA 5FBLB 1IQPA 4WXRA 3CZPA 1OPXA 3EZ9A 3CF6R 3AP1A 3KKPA 5FFMA 1W36B 1EWRA 2DBYA 4G5GA 2HEIA 1OHHA 3GD7A 1KMQA 1CIPA 1T9HA 3ND8A 1NN5A 1GWNA 4HAVA 3BS4A 4Z1MD 2F7SA 2FMXA 3LFUA 5EXPA 1J2JA 2C8VA 3EG5A 1P61B 1GL9B 2OLKA 1P73A 5JZVA 5GADl 2O0HA 2PZEA 4WVFA 3DKVA 3SYLA 3TQFA 4N0DA 2C03A 1QHIA 1UKYA 1X1RA 1VDZA 1NMXA 4MKIA 4V0LA 2FJUA 2W6ID 4L15A 3R8CA 4PC1A 3NEYA 1VCNA 3PUYA 3IQXA 1DARA 1FOEB 2GCOA 5FUXA 2JIZA 3BFKA 3VU9A 1R10A 5D3QA 1T5IA 1A82A 1VYTA 2JLVA 1KSGA 2WOJA 4JVMA 4DCUA 2O8EA 3TH5A 3TK1A 1CJUC 3T5GA 5TARA 1UDXA 4R7ZA 4DWJA 1E9SA 1KJWA 5H8WA 4A4DA 1O87A 5JECA 1XTSA 5J40A 1DO0A 3MWJA 4QG7A 1FPMA 2HT6A 4LBWA 4RCYA 3K9NA 1MRNA 1YHNA 3SFVA 2LKDA 2CLCX 3KJGA 3QEOA 4JBYA 4DEXA 2ZRDA 2I1VB 4B6FA 4JLMA 1E2PA 1T0HB 3ZVNA 1JNYA 4LJYA 2DY1A 3U3JA 4PSAA 2PH1A 5ANRB 3K9HA 2RAPA 4PHGA 4ZCMA 3QOFA 4Q1DA 3LX5A 2V9PA 4EIWA 6Q21A 4IFBA 3TRFA 2QE7D 4Q4HA 2ZRBA 3NH6A 1SULA 2GJ8A 4TMVA 1NBMD 3FWYA 3K0EA 2ZQ5A 1JB1A 4FIDA 3B5JA 4Q18A 1DADA 1ZCAA 3I61A 3ZQJA 1DOAA 2Q21A 4BQSA 1AS2A 2QZ4A 1SVSA 3B1ZA 3PIRA 4FMCF 2IS4A 4HZUA 1XF9A 4C0KA 1W4AA 3I4LA 4HATA 3D7MA 4ASUA 1W0KD 1W44A 1PUIA 2GXQA 2JLRA 2QMEA 1ZD8A 2ZSAA 4TN1A 4CT4B 1PV4A 4ZI3A 2GBLC 2HUPA 3QF4B 2HXSA 3I1FA 4ASUD 4M9QA 1NIJA 4QRHA 2FSGA 1CULC 1WMSA 2XNSA 4RZUA 1Y63A 1XD2B 4DDVA 3GEIA 1COWD 4PHHA 3FDIA 4B2LA 4OQFA 1KI3A 3FHCB 4H1VA 4G3XA 3U60B 4CEJB 3FKSA 4M1TA 2IBMA 4HAZA 2KI5A 5JJLA 4D0NA 5KNDA 4RFSA 1G6HA 4U7DA 3MMPA 2XOKD 4E22A 1XJCA 2FEOA 3R20A 2ZEJA 5JRJA 3L0SA 4LUCA 3TJZA 1Q0UA 4BFXA 2VSOA 3OE7D 4RD0A 2YC2C 1A1VA 4CRWB 3Q9LA 4UKDA 5LD2C 2O5VA 1NG9A 5KSZA 4C0JA 3T5DA 1DAHA 2J3EA 4HUTA 4DCVA 2GXSA 3V4FA 2GK7A 3QKTA 1WBBA 4YMWA 3FMFA 4AI6A 2AXPA 2FNAA 4F38A 2DR3A 3CH4B 3V00A 1EWQA 2ZJ8A 3AP3A 4JYCA 2PZGA 2F3TA 3IBGA 1S1CA 1GNRA 2XAUA 1Q1EA 4H1UA 4M1MA 4B71A 4D6PA 1OXVA 3FGNA 4PPFA 1R8QA 2VHQA 1TQ6A 1JR3D 4JL5A 1KNXA 3L0OA 4Q9HA 5FOTA 4PAMA 4M1OA 1K5DA 4A92A 4NBSA 1J8YF 2NO1A 4BPBA 2H1LA 2OG2A 5LDDC 2QPTA 4Y0VA 4PO9A 3K8YA 2AD1A 5DE3A 4Q7KA 1JECA 1QF9A 4PZZA 1J99A 2BCGY 2ZVQX 4IDNA 3RRNA 2QMOA 1G6OA 2O8BA 3CRQA 1PJRA 1UM8A 3BOSA 5FOWA 4PSVA 2BMFA 3PEUA 3VNVA 1XPUA 1E9CA 4BLTA 4TWZA 3DKPA 4WW0A 3CIOA 3U7EB 3B2EA 2V55B 1KO8A 1QHGA 2WWGA 3GLGA 1NVWQ 4XD7A 2L0XA 3B78A 1C9KA 2A5JA 1OSNA 3BGWA 1ELOA 3E5HA 1IN4A 4XVRA 1LB1B 4JJZA 3KJIA 4GOKA 3Q8XB 1JPNA 4QNMA 5E7MA 1SXJD 4MRRA 2VPPA 3QF7A 3CZQA 1E79A 3PJRA 2C2HA 2QPAA 4O3MA 4AY2A 1J7KA 1Z63A 1H8ED 2FE4A 3I8SA 2IYWA 1TQ4A 2C9OA 1HH4A 2XEXA 3LDAA 3QXHA 4II7A 3VX4A 5GVSA 2J0SA 1OXUA 3AVWA 3CRMA 1P72A 2FH5B 3C14C 4MRPA 4FMDF 5BWMA 2QT0A 1IXZA 1ZU5A 1Z28A 1D8TA 3ZVRA 1OB2A 2B8TA 3T1VA 5DISB 4PXAA 1U94A 3K0CA 5FPHA 1OH5A 5HE8A 3MSXA 3C15C 1QHYA 4OHYA 1SXJE 4GP6A 4JJKA 4LCBA 4TLAA 3QG5A 4ACAA 1FX0A 2PT5A 4XWAA 3EAQA 3GFOA 1P2UA 4GOXA 2AKAB 2CHGA 1YR8A 2O8EB 3L43A 3GQBA 3VR6A 5J4HA 1H8EA 1NRJB 3BB1A 3BERA 5P21A 2R44A 1Z0FA 2BJWA 1KOFA 3K0FB 3ZDQA 3ZVLA 3MCAA 3FB4A 4GRAA 2WWWA 1Z6GA 1JEEA 1BOFA 2Y8EA 3RRZA 4EFLA 3I3SR 5JCPA 3RC3A 2JLWA 4EPTA 4IRUB 4KI0A 1CBUA 1XTQA 4KYUA 2X8AA 2CK3A 2ZYUX 4Q03A 3RWMB 2ZM5A 5JBQA 3MAAC 4AYTA 1DAFA 2BHRA 2QMHA 2IYLD 2O8CA 4B2IA 2DCUA 2FN4A 1E2JA 2OLJA 2VHTA 2ZRPA 4DLZA 4UXIA 3CNNA 5CDFA 1Z2CA 2MSCB 3TW4A 1GAJA 2ZS7A 4A0GA 5KHOC 1P2VA 3DZDA 1U9IA 2DWPA 4QBIA 2JAQA 3IQWA 3NC1C 3QE0A 4B3FX 3CRVA 4URWR 1A2BA 1K6MA 3SU8A 3VAAA 1QVRA 2LCFA 2WIBA 2YWFA 3KKMA 4G0NA 3C41J 1ZYUA 4PZLA 3F8TA 1UADA 5LPNA 2NQ2C 5H70A 3H84A 2ZPTX 4TTRA 1MABA 2ZJ2A 821PA 4Q4LA 2N46A 1UKZA 3T1QA 2GCOB 1GL7A 1UBEA 1NJFA 2RGGA 5LD2B 4GI7A 1FMLA 4C7OB 1TAGA 3OIYA 2P65A 2ZETA 1FP6A 2Z43A 5JWRA 3AUXA 1FQKA 3CM0A 4RFVA 1IM2A 1GZSA 1E2GA 4YMSA 3GFTA 3WNCA 3R8FA 2W00A 3P1JA 4LWZA 2MMGA 5E95A 4G5RA 1L4YA 2Z0MA 3H86A 1RE0A 4AURA 2JJ1A 1E2IA 1VIAA 1KI6A 4GZLA 2YJTD 3CRW1 3LBIA 4LV5B 2WMOB 1NN3A 2C96A 3CO5A 2YZ2A 2EWVA 3KQUA 2V1XA 3AVUA 3FFBA 3LO5A 2QTFA 3UIEA 2FSFA 2WJIA 5DGXA 3TUJC 4DHEA 1TEVA 4OHZA 3TAHA 2XSZA 1OH7A 1U81A 3THOA 1RRFA 3Q72A 3CUEF 4M9XA 1TQDA 3K9LA 4XWKA 3LD9A 1MO4A 1QZXA 1U99A 4B76A 2YYZA 1NBME 3SEAA 2PEYA 4A36A 1CR4A 1KI2A 2IUSA 1U0LA 5FI0B 2AKYA 2FF7A 2PCLA 3LLMA 2ODNA 3SC3A 4BRUA 3RS4A 2BMDA 5FTJA 2OCBA 4LV8B 1ODFA 1LY1A 3K70B 2W6IA 4M21A 1ZNYA 3HYRA 4C3ZA 3KZ1E 3FMIA 4US2R 1Z0DA 5JEDA 1YRAA 1FNNA 4MGIR 2AR7A 2AL7A 2GILA 4DC9A 1OF1A 4HB2A 3RS5A 4DLUA 3EPLA 2NPFA 4LHXA 4IVQA 2YVUA 4JLKA 5AJZA 3W8RA 1G41A 2BBWA 2CL7X 2IYVA 2WZQA 1TU3A 4AKEA 2JLUA 5DH9A 2IYXA 3GJXC 3KFXA 4OK3A 2W0SA 4P32A 2BMEA 2DYKA 5CM8B 4F91B 1XPRA 3D31A 3KUDA 1L7VC 1U0HC 4X8LA 2DHRA 5G40A 3U44B 1V5WA 4NCKA 4ZDJA 1CLUA 2RKOA 4NHOA 1NJGA 2ZVPX 4OQNA 4N1AA 2XJ9A 4HLQB 2BKUA 3SHWA 3ZQ6A 2NTYC 1KO5A 3N5CA 4TSFA 4PANA 1G3UA 4UNSA 1YZTA 2JJ8A 4XJXA 5C1BA 2O8BB 4A15A 4DSNA 5CDFE 2WKPA 1HT1E 4MUAA 4TSFD 3BH0A 2KBFA 4B33A 3K9GA 3RANA 1NIPA 2YC4C 3GFPA 2ORVA 2TMKA 4TT3A 2QAJA 3D6TB 4BLPA 3EZ6A 4PO1A 3L0PA 1TUEA 4Q48A 1ZIOA 1KI4A 5JJIA 3AKYA 2W6JA 4Z8YA 2VSXA 5BN5A 1US8A 1SVOA 1BKDR 1HQYE 2W6JD 4EDHA 2GNOA 2G83A 2QORA 5K8TA 1M6NA 1J70A 2GEUA 4BFZA 3EW9A 1RW4A 4NMMA 3I92A 5FUYA 4A6XA 3MUFA 3EPHA 3GMTA 2QNRA 4DJTA 1IJFA 2I4IA 2QUZA 4GBMA 2JEOA 1UDWA 1N6RA 1VG8A 1RFLA 1N6NA 2VEDA 5CIWA 2IXGA 1MT0A 4AG6A 1D2EA 1ZIPA 4D82A 2B7CA 2ATXA 3A1TA 4KVAA 4L9WA 4TL8A 4ACBA 2GEVA 1Z2AA 2XNDA 4ZDWA 1HV8A 5EZ5A 1D6JA 1JQJC 2Z83A 3QBVA 3TMKA 4PC6A 1KDTA 1XEXB 3VR3A 1FTNA 2OAP1 4LJ4A 4LYJA 5IDVA 4AIIA 1G16A 3CWZA 4YMUA 3QVVA 2JLYA 4QGAA 5HKKA 1I4TD 4MRNA 5J47A 3EC2A 1E6CA 4DCTA 2FG5A 1NY5A 2FFHA 1G7CA 2QAGA 1P2SA 2J45A 1KNQA 2ZJYA 1W2GA 5EXSA 1G3IA 1AM4D 3S1AA 4ESHA 5EP2A 3LAWA 1JXOA 4PSKA 4WA7A 4LJ5A 5KDLA 1G291 4JLNA 3KUCA 4Q1EA 3T12A 2C98A 3BK7A 3LNCA 5FH9A 3MGCA 4XSHA 1N6IA 2FZ4A 3U5ZB 4URYR 1SVLA 2REXB 3CX6A 1L2TA 3OF5A 3HJNA 3T34A 2QGNA 3KTAA 4LJ9A 2RMKA 3T1TA 4NYJR 1ZD9A 3X1DA 3BFXA 4C2UA 1AGRA 5CM9C 1BO6A 5UKDA 3PR1A 4HDOB 3H1TA 5KU1A 3EIHA 2A7QA 1HA3A 4Q4HB 3BBPA 3UANA 1KZ7B 1Z3IX 2ANBA 1QHNA 3K0AA 4ZIRB 2HJGA 1D9ZA 2V3CC 2ZIAA 3U7HB 5FOXA 2V54A 1GUAA 2CL6X 3EZ7A 1JPJA 1FX0B 4KODA 2IYZA 4DSOA 3VR1A 5DYIA 1SVIA 1G17A 4NYMR 4HAXA 3W9YA 3IO5A 2WJGA 1IN5A 3A36A 1LF5A 2FSIA 2LWIA 1ZC4A 4IDOA 3LXXA 2ORWA 3CKLA 4QJ4A 5BYJA 3RC8A 2C77A 4WOPA 5G41A 3TSZA 3B13B 1SKYE 1Q22A 2DWQA 2VH5R 1Y3AA 4Q7MB 4GPTA 4YONB 2IS2A 4NCHA 3W6OA 2Q6TA 2HCJB 4A2QA 4M1KA 4RCZA 4B3DA 1XU4A 3B82A 1H8HD 4X8HA 1ZUNB 2FA9A 2ZANA 1LVGA 3KKOA 5JWOA 3THYA 1II8B 3THWA 3BXZA 2WIAA 2DFKB 2XX3A 2QP4A 2ZI7A 3TNFA 4PR0A 5J4VA 2UZ3A 3GJ7A 2JDIA 2X19A 3OAAA 4G1UC 3ZS8A 3DO6A 2WAXA 2FOLA 3MD0A 4TQAA 4D4LA 2WTUA 1II9A 4FI3C 2A5FA 4A8JB 4PPQA 2QP9X 1UKVY 1JJVA 4DBLC 1Z47A 1ONBA 5C46F 1NSTA 4WZAE 3ZS9A 1P4SA 4LC0A 1G3RA 4WAUA 4NYIQ 3GJ4A 1JEDA 2IEZA 4ESVA 3TW8B 5LB2A 3R7WB 3W3ZB 4GL2A 2CCJA 3NVAA 3ZH9B 1TU4A 3LQQA 2FPLA 3KB1A 1IY0A 3VHLB 1E32A 2Q3FA 1M2OB 1NY6A 2AWOA 1T8UA 1X6VA 1QG4A 3GLIA 5K8IA 3OIUA 4HDCA 2RGBA 5D3MA 5HCIA 4KITB 5FTKA 1ANKA 3RSLA 3AVTA 5B30A 2AN9A 1E2FA 4EPRA 2XJ4A 4QJ5A 1KSFX 5JJKA 3M0EA 2GRJA 2I1QA 4CYMA 2ZREA 4XOIA 1XMIA 1YZQA 2XNDD 3DVLA 3UK6A 1M74A 4EPVA 1W4RA 5FOSA 1Q21A 4TL6A 1E0AA 4M22A 4B3XA 2AD5A 2XXAA 3EPKA 3UWKA 3AB3A 1VKJA 4B74A 1QRAA 5KOYA 4AKHA 1XCMA 1JXMA 2WWIA 2HF8A 2CNWA 4U02A 3WBKA 3GJ8A 1XMVA 4Q4AA 8OHMA 3AUYA 4V03A 4QHSA 2D2EA 4RD3A 4UJ3A 4OHWA 3N70A 1OHHD 4HLUA 4RFSB 3KQLA 4KBFA 1GRQA 1J90A 4Q01A 1DAGA 5DNYB 1F3OA 1KI9A 1B0UA 1VHLA 2REBA 3FKSD 3WMGA 2J0UA 1P3JA 3VR5A 3L2OB 1OH6A 1LFDB 3P4YA 4BGDA 2P6UA 3VQTA 2FPMA 1CU1A 4JYBA 2IK8A 2XTMA 2HXYA 3GCGA 3ICQB 3B8HA 4IJMA 1CR1A 1KZGB 4PQYA 4PFSA 2IS6A 2OXRA 4TZ6A 4LJAA 2RCNA 1WXQA 2QT1A 3OEHA 1J8MF 4D80A 3O8CA 3QPVA 3SNHA 2IYTA 2W0MA 2F6RA 3KQHA 3WYAA 3RWOA 1HURA 4HAWA 2PJRA 5HZKA 4C9BA 2IEYA 2WBLC 4ARZB 2VHJA 2QAGC 3QPUA 2OCAA 4TMWA 3G82C 1QHHA 4BWYA 4JSYA 1E79D 2F55A 2FX3A 2NIPA 3WHLA 2GA8A 1SKQA 2IUUA 3AEZA 4BLQA 2VA8A 3K1JA 4GMXA 3PXGA 3CW2A 2JDID 2IHBA 2ZRHA 3IILA 1T3LA 3OIWA 5FBQB 1CJTC 3QY0A 2OM2A 2PLFA 2QI9C 4OQMA 4D4KA 2NOAA 4P3YA 3ETLA 1FZQA 3IKJA 4F93B 2VIIA 2QENA 3LV8A 3P26A 2VF8A 3EPJA 3UKDA 4UNRA 2GKSA 3AKEA 3AP2A 2JJ2A 4JZKA 3DDCA 4P31A 3CR7A 4MYCA 2J7PA 2PL3A 3U44A 1LS1A 4CEIB 3QF4A 3N2EA 4U00A 2ZU6A 1NLFA 2V7QD 5JI3E 5H68A 2DB3A 4HLCA 2E9SA 4TLEA 3PUWA 4PPNA 1G8PA 2CLSA 2UKDA 5AJXA 2V7QA 1SHKA 2CHQA 2F43A 1GL6A 1HYQA 3VNUA 2WVJA 3C8UA 1VMAA 2OE2A 3T35A 4DT1A 5EE9A 4RKFA 2GWHA 3HP1A 3WYGA 4QKQA 2ZRKA 2EVWX 3ZYCA 5AUQA 4BFWA 3AVXA 1H65A 5DHFA 1XMSA 2ZUBA 5JRZA 3GLFB 3KTAB 1S1MA 1SXJB 1X1SA 3B85A 5DI9A 3X1WA 5L3RA 1G21E 2ZROA 4C4PA 2JA1A 4LJ7A 3QJYA 2IWHA 2J41A 2ZR7A 4LY6A 421PA 1ZD1A 1TPZA 1R0ZA 1UEJA 1OFTA 5G3ZA 3A58B 1IN6A 2R6DA 2CVHA 4BLRA 4IXMA 2KSQA 2NPIA 2H16A 3OESA 1M7BA 4M1YA 3ND9A 5IF9A 4AKGA 4FMDB 2FDCA 1OFHA 3FYHA 2BMJA 1XD2A 4LBYA 3U6BA 1NVUQ 2BOVA 4RSGA 2C9CA 1N6PA 4OQLA 2GVDC 1BMFD 1YR7A 1RC8A 5FTLA 2GJAA 1DAKA 1VIYA 2R8RA 4A82A 1VG1A 1CRQA 1RJ9B 2Z6VA 4DLWA 3PEVA 4F4JA 4PAQA 2QRZA 4B3CA 3L8ZA 1NVXQ 3ZD6A 5JSZA 4LC1A 2IYRA 3M1IA 1BYIA 1W4CA 1WRBA 5HTKA 1T3SA 3THWB 1IHUA 3CX7A 5HE9A 1AJEA 5M04A 5IHPA 1FUKA 3QKRB 2NMVA 3CNLA 5FUVA 2ZS8A 5FI1B 2ECKA 3U7GA 3GJ5A 2WM9B 3F3YA 3W6PA 3QXXA 1PLLA 4NDZA 1BYUA 3WMFA 1UEIA 2CLDX 4B47A 4M0LA 4PO8A 4EFMA 4LHVA 4Z54A 1R8SA 3M6AA 2WWYA 3PFIA 2OBNA 3AV0B 3IGFA 1NN1A 3UXMA 1XEXA 1QHHB 5AK0A 1EFRD 2QSYA 721PA 1I2MA 1CXZA 1SGWA 2ODBA 3B6EA 4M1WA 5K8LA 1OB5A 2VP9A 3DOFA 3K0AB 3U3KA 1DS6A 2YWHA 3RRMA 1XCGB 5KSPA 2PX0A 1KO1A 5EE1A 2CE7A 3AF3A 1ZJ6A 4LHZA 1H8HA 1AS0A 4JL6A 4KO8A 2JLSA 2QM8A 4D4MA 1HY3A 1CRPA 2NZ8A 2RHDA 4NYMQ 2X1VA 2RGAA 3D3QA 1F48A 3K70C 4PAOA 4MUBA 3A4LA 1ZMXA 5L3QA 2DFLA 4BECA 3AVVA 2EFGA 4EJSC 3SI7A 2BM1A 5KTYA 1PVOA 3K0CC 2A78A 2QE7A 4HZUB 3UG6A 1NI3A 1XCPA 3A1VA 1KK2A 3CPHA 3RYTC 2IUTA 1EFRA 2J7PD 3NBFA 2QG6A 4ITRC 4Q7JB 4DUGA 1Z6XA 1A2KC 5FTMA 3VTKA 5AJWA 4XVQA 4M1SA 3ZLJA 2GAOA 5JFGA 1G9XA 4NCIA 3IHWA 2IHYA 4R2HA 2WSSA 1LF0A 1KK1A 4TT3D 1Z83A 4ZKEA 5C18A 4OJQA 2OT3B 4UXJA 4CDGA 1W49A 3WXMA 5F3WB 1IY2A 3AVPA 3SOPA 4Q9KA 4OI0A 1E1QD 4OQXA 2V4ZA 2QY9A 2V6IA 4W5JA 4Q47A 2WJHA 4A0HA 3WY9A 3EA0A 4PQRA 3EZFA 4MYTA 4QM7A 4CEIA 2BCJQ 2QQ0A 4LPKA 3VMFA 5JHHB 4JLPA 1KJZA 2F9MA 5IK2A 2BM0A 4HB4A 2ZJZA 4BFVA 1OIWA 1TMKA 2ONJA 2WWHA 2PLRA 1N5JA 2R62A 5GVRA 5AUPB 3I62A 3UATA 3W90A 2VP2A 4KLZA 4N0EA 1F6BA 1LTQA 5CITA 1NL3A 1N0UA 2QL6A 3SN6A 1W36C 2FPKA 1DO2A 1EFUA 2OFOA 1XXHB 2J9RA 3WP0A 3CPJB 5EZ6B 3PVSA 1AZSC 1KKLA 1E94E 4G5QA 4KYIB 4WBSA 1U8AA 3EIEA 5SZHB 3RVBA 3OZXA 1DAIA 1C1YA 4C0SA 3KXLA 1YVDA 1G19A 2Z5FA 3SZRA 2FFQA 5GJVC 2CHVA 2ZITA 4AYWA 3PCRB 2GETA 2ZE8A 5EQTA 2WJJA 1XPOA 1XZPA 1SXJC 2MMCA 3MWLA 1L4UA 3OIVA 3O8BA 4K8OA 4HEJA 5B2ZA 4B44A 4A6PA 2DPXA 4DLYA 1N6KA 1KDRA 3EARA 4KLNA 1RZ3A 1II0A 3I72A 2IWRA 4E09A 1NP6A 2D74A 2VP0A 4KFUA 2J46A 1SZPA 1YQTA 5KSYA 3NH9A 4IVRA 4CW7A 4R71A 2O0JA 4B48A 4XIGS 3GLHE 1E2HA 1K5GA 3B1YA 1Z07A 4LPSA 5FBVB 1S9DA 2OO7A 1KTVA 2BEKA 1XBTA 4G01B 4HDQB 5A5GA 5JHGB 5L3SA 3SBDA 2BVNA 1Z29A 3BC1A 2YOFA 1E4VA 1P9RA 3DMNA 2KB0A 2QU8A 3TR5A 3A1WA 5KPDA 2JLQA 3K53A 5F9HA 1BS1A 2NZJA 2QPOA 4LYAA 1GILA 2O8FA 5FOUA 4KSCA 1IY1A 4AYXA 2JJ1D 4DKXA 2R2AA 1TQ2A 1E96A 1HE8B 1GTVA 1UF9A 2IS1A 1OFUX 1XRJA 2ZRJA 4DZZA 4P4UA 3EX7C 4FXPA 5HPYB 2GTPA 2JLZA 4RKEA 3QI2A 3W3AA 4LYHA 2Z4RA 4QC2A 3VX3A 2F43B 4B32A 1CS4C 5TDHA 1U8YA 2IX3A 2ONKA 1C4OA 3WMEA 4TTQA 4BFUA 3SYKA 4IEIA 4D4JA 2QP3A 1MO3A 1R5OA 4LK2A 2WPDA 2GK6A 4KFTA 4IXNA 4QNRA 2G1KA 4RZ2A 2B7BA 4I99A 2LKCA 3VFDA 4BEBA 3IDQA 3BFVA 3NHAA 1Z06A 1T8TA 3AH8A 1G8HA 2YHSA 1UFQA 3BH7A 1IAQA 4OI4A 2EYUA 1MO6A 2W2VA 3C5CA 1ZM2A 4RVCA 3AVOA 4LI0A 1TF5A 1R0XA 4RZ3A 2GXUA 2O8CB 1JR6A 3W34A 4DLRA 3DM5A 1PLJA 3AF4A 1NVVQ 4LOAA 1W5SA 2RGXA 4JBXA 5FBRB 2CCGA 4C0BA 3RSOA 1JQLB 1F2UB 3K09C 3A8TA 3JZMA 3C16C 5J4LA 2A5YB 4Q1AA 5FPKA 1QHXA 1Z08A 1CEEA 3K0SA 1FFHA 1HT2E 3H4MA 1MRSA 1VCOA 3Q3JB 3GLFE 1E0JA 4Z51A 4DLXA 3AVQA 121PA 1R0WA 4WXPA 3EIQA 3EWAA 3EZ2A 4EJSB 4FCWA 5B58C 1G8GA 2H17A 1JR3E 2J7KA 2ZUDA 4F4CA 4Q1CA 1XB2A 3VKWA 1E2DA 3O47A 1ZC3A 5FTNA 1N0WA 1T0JB 2PZFA 2WSMA 1E2KA 2ZTSA 1K8RA 1T6NA 3FHOA 5A4JA 2FGJA 4CT5A 2V8OA 2YINC 2F1IA 1YZUA 1ZM9A 4DVGA 2OEPA 3BB3A 1VG0B 4D26A 4EPWA 2ZSBA 1AZTA 2OILA 2GJSA 2UZIR 3IUYA 1YJ5A 1HQCA 2BBTA 1LV7A 2QEQA 4EJSA 2QSZA 1U9IC 4CIDA 1NLZA 2KBEA 4TQUS 3F5FA 4MKGA 1E69A 3DL0A 4K81B 2JASA 2AXNA 2FWRA 1GDDA 2AFIE 221PA 2EFHB 2OAQ1 2D7DA 1G3QA 3MWKA 4QBGB 3RDPA 2YOGA 2ZJBA 1E9RA 3LWNA 2Q9CA 2HJVA 3ADKA 2BBSA 1XEFA 2B8WA 4XTCS 4P0TA 4M2LA 5JCZA 4DB4A 2GZDA 4F7WA 2O8DA 3DMDA 5CYOA 3FVQA 4AD8A 3THYB 2ZAMA 1CP2A 5IK2D 3KJHA 5JEEA 4QM6A 1MKYA 1RYFA 3ZGXA 1Q3HA 2IW3A 4OBEA 5AJVB 4QGHA 4PC3A 4QGFA 4XTRA 4Q5IA 1FMJA 1Z0JA 3UMFA 3B7GA 5AUNB 2CNWD 4YDSA 5DIFA 3QXSA 1A7JA 4B75A 3W5JA 2P5TB 4JLOA 3R9IA 1EFTA 4YC7A 5DSZA 2VSFA 1V43A 2EFCB 3WRYC 2ZRFA 4IFEA 3PUZA 4MA4A 3SYNA 1U98A 5EJEA 2YWGA 1ZUIA 4QHTA 3L8YA 1Z0IA 2GJKA 3B1VA 1XDBA 1KI1A 1FQJA 2YNMA 3IIJA 4JKYA 2RHMA 3LBHA 4GDFA 4HAYA 4B3GA 2NGRA 4KXFB 5GJBA 2GJ9A 4BLOA 3LH5A 4XSGA 4NONA 3K09A 2H5EA 2P6NA 4C0HA 1FNMA 3ICEA 1Q20A 1AN0A 1GIAA 1R5NA 1PUJA 4JLBA 2ZE5A 2BJVA 3KKQA 3QVUA 4A0FA 2AHOA 2ODWA 5BN3A 2ERXA 2ZYWX 3GLGE 2W2TA 3E70C 3BWDD 3GJ6A 4AK9A 1OV4A 2WAYA 4I81A 4V0ME 5E3HA 2EU8A 4V0MA 3PG5A 1ZAKA 5CYPA 4FMCB 1Z6YA 1TADA 4W5HA 5IT5A 2ZI3A 4E5UA 3WBJA 1FP7A 1R7RA 4EPXA 1D5CA 2BIFA 1Z6TA 4R9UC 4H9GA 3DPUA 3DM9B 4BZQA 4Q21A 5AWFC 4JLJA 3E1SA 3TSWA 3HU3A 4Q7LA 4KVGA 3QIAA 2VP4A 2ZI5A 2GHIA 1KAOA 1N25A 4RD1A 4NL4H 4A2WA 4KU4A 3LVRE 3EXAA 1WE2A 3TVTA 2ATVA 2RGNC 4TYYA 1EX6A 1XP8A 3DHWC 1G5TA 1GKIA 1RRPA 3FOZA 1SXJA 1KSHA 2DFTA 2XGJA 1TEXA 1WCV1 4DSTA 3TGPA 3GEHA 4WIAA 4ZV4A 3AQ4A 3PQCA 2HT1A 1NSFA 4GP7A 4Q1BA 1GOTA 3LBNA 4LZZA 5C4GB 4UXHA 3SE0A 2OSBA 3KXKA 4Q02A 1AS3A 3BRWD 1ZVQA 2O8FB 4LBVA 3SJAA 1E9AA 3H0KA 5J5CA 1RJ9A 3AF1A 1JALA 1XD9A 1P5ZB 1QDEA 3P4XA 5EP3A 3JZAA 4MKHA 4BRWA 2NO9A 2IYYA 3NHBA
chains in the Genus database with same CATH superfamily
4ALMA 4DDTA 4DNFA 4PYNA 4JLAA 3G1WA 4WUVA 4EO7A 2QTCA 3OZBA 1AN9A 5EZSA 5JLAA 3TR6A 4BZPA 2VA9A 1V39A 1ZINA 3WGZA 4DN6A 1LPAB 3CZCA 4X6YA 3F97A 1YKSA 4JUAA 5H16A 3FPGA 3P0EA 3UFXA 1SKYB 2GLXA 1VHJA 1C1XB 3PNBA 3U7IA 1JHZA 3QYJA 3WGJA 4W7IA 2FN9A 3JVUA 3O8RA 1J5XA 3FW1A 3G2NA 4JHXA 3DCNA 4YRQA 3WYFA 5IC4A 3AIKA 1I2DA 4KNWA 3HJRA 2HA5A 5KVAA 1T0IA 1KETA 3F6PA 3D6UA 1NTOA 4EQ6B 2PE5A 1QV6A 3OOJA 4ZU1X 1S4QA 2AXQA 1JU9A 3SHFA 3PC6A 4KHZA 3JYOA 1PG0A 3ABZA 4PC7A 2QLNA 5JNWA 1AGNA 3AESA 4ALIA 2Q2QA 4G0UA 4RHXA 4OI2A 3TIVA 3KQNA 4PCVA 1FK8A 4PTYA 5GZ3A 5HZGA 3V4RA 5GZ1A 3OEEA 4FR5A 2CNOA 4D9KA 1CR2A 4UM9B 3CZMA 2C5GA 2L69A 3RABA 3GZTB 3KWJA 3VPCA 2CYBA 3MAJA 1H9BA 1A9XA 5T3YA 2P90A 4MRAA 4ZO4A 1L8QA 2EW2A 2XD9A 5JD3A 3DC7A 1N0HA 4ZPXA 4K46A 4MDEA 3LYHA 2J3HA 1GTG1 4NZZA 2WV9A 4ENPA 2ZJOA 1FS6A 2B0CA 4TKVB 2FP4A 3AM3A 2IXDA 3U0VA 2WMNB 3JYPA 1JA1A 4RZSA 3WGKA 1CZOA 1N75A 4MW7A 4CEHB 1YF3A 5ALQA 3R9WA 4G9EA 1QIJA 2I8AA 3FDFA 3PNVA 4K6HA 4DEYA 2H18A 2CK3D 4DDKA 4GVPA 1U2EA 3IKMB 3IPRA 5CMLA 1XJQA 1AURA 2NQ8A 3TQCA 3EASA 4OXQA 4LKRA 3FKQA 1H05A 1QAQA 2W11A 2QTMA 3HY6A 3TNYA 1W25A 2BDEA 4ZVMA 4XLLA 3K4QA 1FL9A 3YASA 3NDBB 4GHWA 3UWDA 1HTWA 4BMPB 4BVEA 4YT5A 4C87A 2QT9A 1P2TA 3E9ZA 3DKKA 1TM4E 3G23A 4OK6A 1GL3A 2WAMA 3DT9A 3V33A 3KZKA 4E6PA 3L1KA 3ZWQA 2QGFA 1LBHA 2I4LA 5AK3A 3KETA 2FLWA 2RKBA 3CVOA 1M7HA 3QLUC 1L5KA 4E07A 2EW1A 1L5YA 2FFAA 3D8TA 3E5MA 3FPFA 2ZKLA 1K8ZB 2ADOA 5KKCA 3JD0A 4IY1A 5KWJA 4E3ZA 3B3AA 2WSIA 5L3QB 2IF0A 2ZRCA 4KJXA 1YR1A 2OHOA 3ORHA 1HC7A 1OXSC 2GRUA 2YIJA 1G4UR 4N47A 5KYNA 4YMTA 5LQSA 3KXIA 2REOA 3D0KA 3KQWA 3C85A 2JD1A 3L79A 4Q9IA 4A0QA 3FUUA 3TZ6A 4AT1A 2AOWA 2EL9A 2FEAA 1SFRA 1J0EA 1W2WB 2OG1A 3DBLA 4HF7A 3OHMA 2XCTB 4RPJA 3ZHCA 2V97A 4LQLA 3O8DA 4WD3A 1UBCA 1DZIA 1WSAA 3HI4A 3PIDA 1GUZA 1QCZA 4IP0A 4J2TA 4BNTA 1G2OA 1K6JA 4CNQA 1F60A 3EA5A 3K8ZA 2PJUA 3PIIA 4ML3A 4ZDIA 3H18A 4FN5A 4D41A 2MSEB 3GMDA 2V6MA 4IFTA 4N9WA 1XG5A 3WRXA 3REQB 5FV4A 3CLTC 1Q44A 4IH1A 1EX1A 4G65A 4M60A 3QE3A 4JITA 1QO0D 5CA0B 5H1YA 4HOYA 3SVTA 4PY2A 3WLPA 3LBAA 4PR3A 4ZZ1A 2F4VB 1N78A 3V2HA 1QGUB 5FADA 3ILXA 1IXSB 3TZHA 5AK6A 4UBMA 5CM2Z 3BHMA 2Q2OA 2W71A 3C6KA 2O1XA 4KAXA 4OB8A 1S8FA 3QBDA 1SVKA 2GZ2A 4ZREA 4ARVA 4B9AA 5LP6F 1B3BA 4EKGA 1OWOA 1QH0A 2JBHA 1D3AA 1JA9A 3ANLA 3OX2A 4W9MC 3UMVA 1V9LA 1KE1A 4Z4IA 2V6BA 2AFHA 3PGKA 2GM9A 4DTIA 2VBGA 1H2WA 5B55A 3WGLA 2FW6A 4IOJA 3UMGA 1ONPA 4ZODA 4RW0A 2H5LA 2OHVA 3EQ9A 1B73A 1SRRA 3CISA 2XZDA 3Q3HA 2D0IA 3WQBA 4D0SA 3KQKA 3FETA 1CTQA 4A7PA 3CTMA 1PFQA 2Q99A 3F6EX 3LKZA 2V1UA 4MGZR 4EYEA 3RGWS 2W2NA 5IBCA 3WQQA 4DLKA 1Z38A 2DLDA 4BTVA 4YRGA 3I9V6 2I03A 3WMXA 3NHJA 3IA7A 1CW2B 4YGXB 1V9SA 2WU0A 4DPMA 4XARA 2B99A 1HE5A 4C30A 2FPIB 1T8WA 5JQGB 4TS4A 4MI3A 5KJEA 2PUGA 3V4SA 4ZO8A 4U4AA 3NT2A 2CE2X 1NE2A 1IZ9A 3MQ4A 3X1XA 1W7AA 3COJA 2EX1A 2BP7A 3LVBA 4NBVA 4KRFA 3C3PA 2HWXA 4QATA 4ZO6A 3S29A 4B7CA 3D6MA 3S8EA 3ZD7A 521PA 3DQQA 3ENZA 4LF4B 1IVYA 1F0YA 5F78A 1T1RA 2FZWA 3D7LA 4KR9A 1TM7E 3I1IA 4LNUB 1YOBA 4A0RA 1Z39A 1ZMTA 5IH3A 4G8CA 1XAJA 1KQGA 1HYHA 3FHJA 1HX7A 2GRAA 1DIBA 1XXHA 3NWBA 3I2GA 2FWAA 2Q7XA 2PUBA 3G5UA 1E77A 4MEBA 2BRUA 4WNIA 3KDSE 4CZ2A 4PFJA 1P4GA 2HF7A 2FF5A 3KX2A 3LXMA 3SXPA 2PSFA 4XGNA 1J8DA 1K4YA 3I9NA 2JD0A 1JGTA 4WACA 4XQ0A 4AMUA 2V58A 1WXDA 2JZNA 2D1SA 5SY4A 2D3WA 1U3GA 2HLDD 1KVTA 1G8KA 1S8AA 1X7ZA 2IYUA 3NASA 1FDWA 1GKUB 2VQDA 2V0CA 3MB5A 4NAVA 4RIGA 1TK9A 2V03A 3OF3A 1KU0A 1SCIA 3IPCA 2NV2B 5LOVA 5C8ZA 4TTPA 4MS1B 2DKNA 5DP2A 4BUCA 5A2GA 1JHAA 2EQBA 2YN0A 1IJKA 3RIMA 1O5OA 2Y1GA 2RC5A 2BGTA 3DBHB 1R37A 4I1SA 2K87A 1W1IA 3MGAA 2PR7A 2GFQA 3LC0A 5E4JA 2QRQA 4HGRA 4E2YA 5JATA 5E6UA 1KMHA 2W37A 5B58T 4C4YA 5LVAA 1QWSA 2XUQA 3LA6A 3QNWA 1OIVA 1CR0A 4K3VA 4PLWA 4YJHB 3SZMA 3ZJYA 3C7AA 3W5AA 3RD5A 2GBIA 3ZZMA 1ZVVA 3BD6A 1MZVA 4MS4B 2Z4SA 1T3HA 2FI1A 4QU5A 4RVHA 1L3CA 1N2OA 2HF9A 3H5OA 2XMDA 2P67A 2J59A 4QEKA 1I3NA 4BO6A 3P0HA 5CFPA 2OB2A 4N3NA 4DMLA 2X0EA 4B43A 3DTTA 5CJPA 1YRYE 5KNCA 1ZCBA 2ZUUA 1L5RA 2QTRA 1E4YA 3S8YA 3UQYS 2A1TS 1WSWA 1UFOA 4Q19A 4L8GA 2FX2A 4Q9JA 4QUEA 5EXEA 2XKAA 2HHCA 3VKGA 1KJIA 3F6YA 1UBGA 1FFSA 4RY8A 3L07A 4TROA 1UP4A 5I4IA 1UBHS 1Z4MA 4CI9A 1P81A 1ADYA 1VL0A 3OPNA 1D1QA 4U3JA 5TT0A 2CT8A 2BKEA 3K94A 4MV3A 3JZFA 2JJ2D 3Q7IA 2H3HA 3FOFC 1OWNA 2DKFA 3PGA1 3PDJA 4HB3A 3HVUA 3K71B 2ATEA 3IMFA 4XPIB 4UNNA 3VZPA 2BFFB 4BE7B 2R96A 4NRDA 1YT5A 1Z2DA 5DHAA 3WLOA 3UBTA 1CHNA 3NDJA 4URXR 2W2KA 2BE7A 3CG4A 1GZHB 2FP4B 9MHTA 4AN1A 5JISA 2YMMA 1QLJA 2LV8A 4GECA 3GRKA 4H16A 1OIXA 1W88A 2HA6A 2PX5A 3SDSA 2ZB3A 5HQTA 3REGA 2I2WA 3E84A 4AS3A 1H42A 2BEVB 1Q1QA 3BZUA 1JIKA 4WESA 1NZJA 1T4CB 1KJ9A 1W2HA 2EC5A 2YRXA 2ZUCA 3N9IA 4HN4B 2A1UA 2JFXA 4GKAA 4PLPA 1XD8A 1Z12A 4L5BA 5FWAA 1WMFA 3IBTA 1Q0TA 2PMBA 4WOCA 1E3WB 1COWA 4K87A 3K2QA 2QYSA 3KL4A 5EWLA 2QUAA 4FD2A 1JAIA 5EPEA 1NWHA 4TLDA 3U3OA 4ANFA 1YBMA 2R0QC 2NO6A 4EZIA 3GLFA 3SIRA 5D84A 1Y4UA 4CXMA 2RGCA 4B1FA 5JSUA 4JN6B 3SLRA 2BDTA 1T5HX 3KRTA 2YH2A 3NEPX 2KMLA 2QSUA 3P9YA 2P5YA 3B1XA 5DI3B 1RPJA 2GN2A 2CY0A 3HEMA 5DW3A 1EE9A 1STOA 5AT1A 3ZD9A 3G9QA 4JVLA 5GV7A 3STXA 3TTYA 4M1QA 1NI5A 1QQTA 1XEAA 3A2NA 4II3A 4RKEA 1YCGA 5GGXA 4U2FA 3DZKA 4CR6A 4YUVA 4WJZA 2EBWA 3W04A 4ZVOA 1B8UA 4JIGA 1O3YA 4D9HA 1VZ3A 2Q4DA 3UTCA 2JFBA 5IM4A 5BUCA 4F2DA 1AO3A 4B0PA 4D8XA 4R6XA 2R6CA 5F4ZA 5C8YA 2J9FA 3ECAA 1CB0A 1TMGE 4OYHA 2Y67A 5P8WA 2BW0A 4CCYA 9ABPA 1XVIA 4NDNE 4OQEA 5ITSA 4JVOA 4JT4A 3CBGA 3BK1A 4NZYA 1JKIA 1PDVA 2BGKA 4BXOB 2FMHA 2WHXA 4MUEA 3I53A 3M8KA 4QREA 4W1SA 4BMXA 4EG3A 1IPFA 4TL9A 2Y1CA 4MPTA 2AN1A 3ROQA 4CKXA 1BRMA 3K6KA 4HLUC 4LYDA 4MUXA 4S0XA 4U8GA 1TYDE 3HVIA 4IIHA 2OORC 1T2EA 3FCXA 2R6HA 4R3NA 3ZEAA 4NABA 1P0MA 3VJMA 4FLFA 2RG7A 2AX3A 5K8UA 3HXLA 2FKAA 3TLKA 5CFQA 2XD4A 4GMKA 5JNLA 5KQLA 1DQYA 1RXYA 5BY2A 3QU2A 8LDHA 3QQPA 1KSJA 2VRBA 3CUTA 3H2JA 2C2XA 2KX7A 1RQ7A 2WUVA 5G3YA 3RLIA 2FXVA 3IEPA 3QA9A 5HILA 5HM8A 1QVAA 4GLBA 2G9RA 4YROA 3TCKA 4CTNA 1D6NA 1NUPA 1BEEA 5LM3A 2VS1A 3QOYA 4C3VA 1Z4PX 4GX5A 4K9LA 3B36A 2CLIB 3TLXA 1MFPA 3EEYA 1YB1A 4UNQA 5L7TA 2ECQA 3IUBA 2R6GA 1CUWA 1IE3A 2C8JA 3BULA 4UCFA 2V0GA 1RKXA 3KOZA 4RGYA 3KYCA 3NBMA 1W94A 4FD3A 3EVFA 3O82A 4EAQA 1MC5A 2ATIA 1L5HB 4MR9B 1DTSA 3ISJA 4HFNA 1NPTO 4J0DA 5KDDA 1PD1A 5GJCA 1E4EA 4WY2A 5HUHA 1EHIA 1KY5A 1EX7A 2J9FB 2PUHA 1OH8A 4M4SA 5SZKB 2PCJA 3ZI0A 1R0CA 1C0LA 5LN1A 2OPBA 4G2TA 4TYPA 4O4LA 3U49A 2B4YA 3LW8A 5KAMA 3VC7A 1M6VA 1VJCA 4OCZA 1YS1X 3ECCA 1ID1A 4P81A 3TKYA 3ZE0B 4LGMA 1NN0A 3A6DA 3E15A 2VTDA 3FRJA 3UH1A 5C52B 1AZLA 2HA7A 3X2EA 5FL3A 1GPNA 4HXYA 1YB2A 4Y1EA 4KIJA 3FWZA 2GTIA 2QVZX 4ZI7B 1YQ9A 1JQKA 1W76A 2VYFA 1S9HA 1NLUA 2IEAA 3A0UA 3BIXA 4O8CA 4GYKA 4JBWA 1MOZA 2P9CA 1UMDA 5GQSA 2JI6A 5JWHA 3SJZA 2CL0X 4C0WA 4EATA 2FSUA 1B23P 3DDUA 3JQ9C 3RJ5A 5SY6A 1GRVA 4C0QC 1GV1A 3OH8A 2W43A 1OXMA 2R97A 3LX4A 4ENVA 5TVKA 1VKNA 1POWA 3F8WA 3B6KA 1IATA 4OA8A 2UZ1A 4OKSA 2WWVD 4E12A 4HHEA 3VR0A 1OZGA 1FLDA 1JW9B 3RHZA 3H5IA 4IG4A 4HAUA 1NXOA 2IIBA 1SKUA 1KAQA 2QRNA 2TYSB 2VZEA 3LHDA 4OGKA 5DM0A 1G38A 1ZGJA 2JVJA 3S1LA 5KDOA 2C2GA 2YS7A 3M6IA 3PB3A 3BBLA 5F1YA 4EYSA 4AZVA 1M5TA 3GBVA 2QBYB 3IVRA 4ZVVA 1CF2O 1CUEA 1YIAA 2PBLA 3LPMA 4I6EA 4TT8A 1DMSA 3E3MA 1V7CA 5K3DA 1U0EA 2GH1A 1Z22A 2XUHA 2QTGA 2WSBA 3AI3A 1CPYA 3T5CA 4WMLA 4JVNA 3JQGB 4DQDA 5JQGA 3LLUA 5KYGA 3IEMA 1Y6GA 2A9VA 2E89A 3LOQA 5EP1A 5KWEA 4TYNA 3CB2A 2XUFA 2IE8A 3Q0EA 4DG9A 2I8CA 5J4YA 4BC1A 3E7WA 3QKUA 3WRXC 3ZZUA 1XCOA 1R9NA 3JY6A 2Q9BA 2ZK7A 3MLBA 4CLOB 1V7PC 2OBMA 1Z13A 4HUQB 4DR7B 4EX6A 2PBRA 4FFDA 4NZNA 5DBEX 5I45A 3SVLA 4D0LB 5HIKA 4QQRA 1Q11A 1U2RA 2J67A 2LDXA 3WIDA 4NTZA 5FR2A 3HC7A 2AG0A 5SZIA 3KSBC 1UJ6A 4ND4A 3E2IA 4EYQA 3WISA 1T6XA 5I47A 2GM3A 3PLNA 1MB9A 2BH9A 2H2IA 1CNFA 3GUVA 3UHFA 1Q15A 1WV1A 3EMBA 3GK3A 3AHCA 4L85A 1U2TA 2BSAA 3P7MA 4ZAWA 1KI6B 3PSAA 4FFWA 2EWWA 4N8SA 4MRVA 3C7KA 4Y3UA 4GPBA 3CZAA 4KXNA 4OI1A 1MO5A 1SPXA 2WFLA 2B5WA 1CSEE 2H4FA 3EWNA 5E9QA 3LZDA 1LNQA 3DD5A 1KY3A 4PVDA 1XAGA 2XVAA 3ZHZA 4C6RA 3LX8A 3ZJTA 1RWXA 1Y80A 3DV2A 1S3FA 1XFAA 1RACA 3NO4A 3OEED 5L6MB 1E8DA 1TTPB 2G9VA 1E8NA 4O4HB 4OTZA 1NQOA 2QIOA 1AG9A 4KYVA 4BNFA 1IWPB 5KO2A 4INJA 4CVNA 5JUWA 1RBZA 1CYEA 2OD9A 5EINA 3RT9A 3IEVA 3WSWA 2IT1A 3IJPA 4NCJA 1GG2A 3U6KA 3T4EA 3TVDA 4F2WA 1QCYA 4ND5A 2G88A 2EX0A 4ZVSA 3K0FA 1Y7IA 3ZWOA 4EUSA 2P91A 2EQAA 4NPHA 1ZS9A 1LS6A 2ENWA 5JZSA 3W05A 3LLSA 1UMBA 1M5UA 4DY6A 4MWGA 2P6RA 2ASEA 3WSTA 1M8PA 4LJ6A 2PBZA 5IYZF 2ORIA 4HDMB 4C6HA 1SELA 2FWNA 4Y1RB 1AQJA 4NU0A 5AHOA 4CL3A 1A77A 2R1VA 5CDTA 2H59A 4G5OA 2OXCA 3IAM6 3QNUA 3R2JA 4EJFA 5AXCA 2FLKA 2YCBA 3C3BA 2SKCA 4QLOA 4R41A 3E61A 5B1YA 5L3SB 2R8XA 3EIXA 3G2OA 4OF4A 4ZCRA 2N75A 4CEHA 4MUGA 1WUKS 4MLDA 1XKXA 1GSOA 5IH7A 1CF4A 4NEHB 3BDVA 3B6ZA 1HWYA 4UM8B 3PHGA 1WZNA 2J9GA 3HR7A 3W9UA 1XNJA 4QYWA 1AXRA 1BC5A 1J9EA 4MWTA 3ZH2A 2EKDA 3SIPA 1YR9A 2E4AA 2GYVA 4OUDA 3UT5B 1GVNB 1EFCA 2CZQA 3DMRA 3O4IA 3H9EO 2IPMA 2LD4A 3SVZA 5IRCD 3STHA 3ZWWA 2VAVA 5IJ9B 1TKAA 3IQHX 1H93A 1TM2A 2IXBA 1TYCA 4AJHA 3CC8A 3OQVA 4A2PA 3ZNOA 1CJMA 3KWMA 1Z0KA 1I36A 4HS9A 1PU2A 1ZI6A 1ZA1A 4P4SB 4AXBA 1FW6A 4N7JA 4QUIA 5DYGA 2JFYA 1I01A 1I51A 3H11B 3JQFA 3M81A 3OU6A 4XWWA 2ODTX 2ZSDA 3PFWO 4LBZA 2XTNA 3U61B 2PTGA 1GNPA 2ZRIA 2FPOA 3C3MA 3LDGA 3F78A 4XCXA 4EKEA 3UA3A 1I5OA 4TLCA 4P3PA 5JZ9A 2B2NA 1RM0A 2XODA 3LP8A 1HMYA 1A9SA 1VPLA 4X00A 5HCNA 3GFSA 2NUTA 4FT4A 4DV3B 3VDNB 3D02A 4BVHA 5A9SB 3A4NA 4RZIA 4DRZA 2PUEA 3MD9A 5E7IA 3MVEA 3L3BA 2EFEB 1E1YA 4AO7A 4ZI7F 3UHAA 1DWOA 3LM8A 1AU9A 4HRXA 3UMRA 1QIHA 1Y5MA 1YDFA 2QDXA 4ENSA 5BXYA 3V7WA 1WCXA 4U7TB 1EGHA 2N42A 5JNVA 4JFRA 3GGOA 2M6RA 2WWXA 2D5LA 4B8WA 5B57C 2ID7A 2VJOA 2FOIA 3UFXB 1Q57A 2IH4A 2IXEA 2WQZA 3CRRA 3I2KA 3N39C 4WZAA 4D9MA 4QTYA 2VDPB 4JQZA 2XQGA 4QFCA 1EESA 1E98A 4DCJA 3DE6X 4B73A 5BN4B 1KF0A 5J5AA 1K06A 3U3XA 2JAUA 3Q11A 2EFYA 2HBZA 3PEFA 4KQ9A 1DAOA 2ZZMA 5EXXA 2QSJA 4US1R 3A28A 4B3BA 4IHQA 3R9XB 5C31A 3PRYA 3NVMB 2RC6A 1YS7A 1CWUA 3O2SB 5EKDA 2A84A 3OUZA 2X22A 3G0CA 1ZUHA 3I34X 4YQFA 3B1KA 1XZEA 4BO3A 4YYEA 1JV2B 1XNHA 1Y5IA 3C1AA 3UJDA 1XDSA 1E0SA 4I2VA 5CGQB 1D2MA 2GD0A 2FV8A 1O08A 2OUIA 2ZRNA 2HLNA 3A37A 3O95A 4CT0A 3L4JA 1SUIA 4Q12A 1UMCB 1ZJ4A 3OD5A 1IMOA 3BD9A 4S1TA 3A6PC 1MGOA 1T4GA 4C01A 1AMOA 3MPUA 3TZQA 1BN7A 5F2NA 4YJ3A 3HR8A 2C61A 4RELA 1DAEA 4XB1A 3T3NA 2DX7A 2HYIC 1FTQA 4LE1A 1EDDA 4R98A 1XCBA 2FW9A 3FFAA 1F2TA 1W6RA 1VG9B 3INYA 3JAKB 3A14A 4ZK2A 2XYHA 1OAKA 4IIDA 4L5JA 3CF2A 5A5VA 1T5TA 3I42A 4E88A 4F71A 1FLNA 4PWYA 4MV0A 4LA4A 1RRMA 3NIBA 1LGYA 4AO8A 1AKYA 1KY2A 2R2GA 3WGVA 2CHEA 2B5OA 3BHJA 1CZUA 1V1RB 3RKUA 4DLTA 1H4SA 4TMFA 2WTEA 1ILEA 1AQUA 3J81A 3WDKA 4Z3KA 4KP7A 3HUDA 1MNQA 3H7IA 4MDYA 3VYTB 1GA1A 3S1AB 4EUKA 5J23A 1F7VA 4N5DA 4Y8VA 1UIRA 1EHCA 1PJSA 3GT0A 4TV8B 4IDHA 2M1XA 4GT1A 2ZJAA 5E4FA 4AJ2A 3V2UA 2RKWA 1Z5OA 4HP8A 3SJCA 4OQPA 3GX1A 3WJ7A 1JI0A 5K0SA 2N1MA 1XTJA 3KJXA 2XZLA 4OU5A 4RZXA 4OHUA 3P97A 4M0PA 4D81A 2FFBA 5FBLB 2WK1A 1HNWB 4FT2A 3W3AD 2CNLA 4J4HA 2QPLA 3HJHA 2NW6A 3AP1A 4OGFA 1G2IA 1E5VA 5FFMA 1W36B 4WCDA 2RBKA 2V7VA 4G5GA 5KQMA 2CV1A 1KMQA 1T9HA 3EVTA 4I4TB 1K88A 4X3OA 4Z1MD 3BS4A 1V4NA 4Z7NB 5DLYA 2R751 2EZ8A 2PZ8A 1BXGA 1GU0A 1K6XA 5LZ5A 5JZVA 3QYPA 4YRTA 4GWKA 5KKNB 3R7AA 1JHRA 1NJ6A 3WLLA 3L6DA 3KKKA 1QHIA 5A3QA 2C4KA 2YWXA 1EH5A 3IP5A 2MINB 3IEXA 3FZEA 1PO7A 4G85A 5B3AA 2IXAA 2OWEA 3A9RA 3QRWA 4L15A 3AK4A 1GAQA 3D6JA 4WWHA 4OFXA 4B79A 3L06A 1VCNA 3PUYA 4IX1A 5TMBA 2ACEA 1XF1A 3R3JA 2WW8A 2NT3A 4MUFA 3VZDA 2J33A 1PFUA 1R10A 1T5IA 2IY9A 3I2FA 1PQ4A 2CB9A 4UATA 3ZPXA 4BNUA 4X66B 4JUFA 1SXPA 2PKXA 3T9BA 3NFRA 4S24A 1S5PA 1NFFA 2PGOA 1ISSA 1Y3DE 3QU4A 4K6OA 4LVNA 2DQKA 2FOXA 2GLTA 5H8WA 1KJWA 4A4DA 3CURA 3GB9A 4RLFA 5J40A 1DO0A 3V9AA 1B8PA 1DLJA 1X7WA 4LZAA 4QG7A 4ETIA 2J3DA 4LBWA 4X0EA 2VKQA 2BAGA 1GQRA 3K9NA 3M4NA 1NR1A 2YZMA 2D8MA 3WXBA 1Z5PA 3KJGA 5KX5F 2ZRDA 3I04A 4W5RA 1J25A 4XAQA 1JG6A 3LT2A 3WBFA 3GIDA 3NHKA 3F9IA 4CM3A 2DHQA 3HJBA 1FB5A 1GUYA 4PHGA 4ZCMA 1QJCA 2XVMA 5FAKA 4AX4A 4IFBA 4QE3A 4MIEA 2ZRBA 4MWBA 2RH4A 1SULA 3HYNA 4TMVA 2V5AA 3FWYA 4Q1VA 5CB0A 4ZYYA 1QIGA 2H4HA 1GEEA 4ESOA 3GVXA 4Q18A 1ZCAA 1D1PA 3B53X 3I61A 3ZQJA 1DOAA 2A58A 1RAAA 1V5EA 2HD4A 1JHPA 4GR4A 4BQSA 4R2MA 3AX6A 4N6OA 4WJLA 3DEIA 2JFVA 1U0RA 1JUDA 3DAPA 3S6JA 3SX4A 1L5FA 2CMHA 1BCRB 4UHDA 2Y9PB 1QKKA 1W4AA 3I4LA 4HATA 4RA9A 1T9GR 3UW3A 5KNLA 5JT1A 2Z9DA 1BW9A 2GXQA 2QMEA 3G5MA 4Q82A 2BH2A 1WVMA 4ZQHA 1L8XA 3PKJA 3EG9A 2VYVA 2HUPA 4ZI3A 1JPUA 3K16A 4BQOA 4RTSA 3QF4B 2GFIA 1J42A 2HXSA 4ASUD 4CCAA 3FROA 3GNQA 5TLSA 1CULC 3OICA 2AIRA 4LXIA 3WK7A 2XNSA 4UU8A 2PFGA 3E18A 1C4WA 4ND8B 1UBNA 4DDVA 3GEIA 2VT6A 1NHWA 1YHZA 4PHHA 1HNNA 5B4VA 3SEZA 5K3OA 1PWHA 2G71A 1U1GA 3FDIA 4S3MA 1OY1A 3AT1A 4EA8A 2FR1A 4NZMA 5JCOA 2ZUFA 2IBMA 3BSSA 4HAZA 1GKLA 5COAA 5JJLA 4D0NA 1WM1A 2B35A 4IXWA 1D03A 3EFOB 5HX7A 5C80A 4C6SA 1EHYA 2DHDA 2O3QA 3R20A 4OHBA 1Z7BA 2PLWA 4DNOA 2VXYA 3L0SA 4ES6A 2I1LA 1Q0UA 2YIMA 4OHPA 4BFXA 4XQ9A 1UZNA 4J0CA 4EMTA 3O21A 3ETDA 2XTJA 3Q9LA 2O5VA 5EWJB 1HE4A 2BEWB 3SFTA 2GN0A 4C0JA 2QD3A 4KDFA 1NG9A 2J3EA 1VPDA 2AFIB 2GXSA 2XDQA 2GK7A 2Y68A 4HGZA 4LOJA 2XB8A 3GDHA 4DCVA 1K2VN 1USGA 1CR6A 1V8PA 3BXPA 1RLOA 3CH4B 3VO1A 4XA8A 3NNDA 1TAQA 3V00A 4F38A 5FUMA 3CRZA 3VKUA 1GNRA 1C4KA 4M1MA 5FBZA 4B71A 3UAZA 3VHQA 5BSVA 8ABPA 3FGNA 2WKSA 1XQVA 1EWVA 2J9YB 4HYTA 4Q3BA 2Q2WA 3HMKA 4YJ3F 2PYZA 2PD6A 1ZG3A 1NM5A 4M1OA 4MWZA 3WWPA 3L6OO 4EY3A 2QQGA 5KYTA 1KEUA 1F4PA 1PGQA 1RWMA 3L7BA 2PR2A 4PO9A 4RJJA 5D85A 3O8LA 1JHXA 3SQOA 1JECA 4UAUA 1QF9A 1J99A 2BCGY 4TKUA 1N2JA 3KYDB 4RLQA 4IDNA 1XZNA 4G8DA 3H65A 4KQ1A 5PGMA 3BOSA 5FOWA 2PS9A 1TXGA 3HXKA 2XUGA 3WGNA 3M34A 3VNVA 4Z4CA 3DTVA 4C4SA 3C8ZA 4HADA 5IBRA 4C7BA 4F45A 3I6MA 4PHCA 4D7AA 4EB6A 3U4MA 3CIOA 1DINA 1KO8A 2DG2A 1I3MA 3OJOA 3AJ8A 1V0JA 2YMLA 3W2FA 1DTEA 3RIGA 3JW8A 2QN3A 1JKFA 1AHIA 2KQUA 2A5JA 1OSNA 2YBEA 3BGWA 3BX1A 2ZVJA 3LWZA 4HTAA 4KB5A 3RIXA 1EQUA 3HA5A 5F9FA 2HMYB 3E5HA 5AHRA 5DX1A 2HO5A 3G1TA 1KS9A 2Y1XA 3IAFA 4ND3A 1YJBA 4QNMA 1JPNA 4WESB 5DCLA 5TGZA 4RMHA 2V4UA 1D1SA 1G9TA 2NYAA 2OCKA 3BIJA 3DG9A 3MXTA 3BGOS 3OJEA 1T5SA 4IS2A 5HS6A 4YT8A 1H6AA 1E79A 1L7MA 5HYVA 5EIXA 2C2HA 3AZQA 3UGJA 3EB9A 2Q5HA 3ABRB 1S2LA 4EL0A 5KOJA 3PWKA 3K4PA 1LX7A 1NT4A 1WABA 1RJGA 2I6XA 1HH4A 5ILQA 2HZBA 5FD8A 2J0SA 3IX7A 1UEXC 1ORDA 3CRMA 1G0NA 5TQJA 2ZJ1A 4WFQA 4YN3A 2IOHA 4FMDF 2W22A 2QRLA 3CNQS 1ZU5A 1Z28A 3LCMA 1D8TA 5JQGF 4DR1B 2O2SA 2B8TA 3KZXA 1JYEA 2IITA 3AXSA 3SP1A 1MV8A 2KPOA 5J43A 1KAEA 3SG0A 1ZIXA 1QOPB 1QHYA 3BWXA 4R40A 5JG7A 1ECLA 2EG9A 3U4IA 3T9CA 1KAHA 3TJRA 1CRLA 1SXJE 1V5IA 3OO0A 3QG5A 4Y2QA 2H52A 2FTKE 2I2FA 3F73A 1H4VB 4UZSA 5JADA 3O1IC 4KOAA 3HNPA 2P4SA 3DKRA 2QLMA 4QRIA 1DJPA 3OFSA 5I8PA 5DGCA 5TEVA 2O8EB 4HFMA 3TZCA 3A32A 4COKA 4AZWA 4DPKA 1ZK4A 1NRJB 3BB1A 5J9FA 4RVNA 5P21A 3URMA 3Q2IA 1XLTC 1L5SA 2VZLA 3I2IA 3JYNA 4MW9A 3H1PA 1RZRD 3L4SO 3CZRA 2HK8A 1RR6A 4FB5A 4MWOA 2WWWA 1V1MB 1Z6GA 3TQSA 2Y8EA 3FMGA 3C48A 4EFLA 1VLMA 2G4CA 4O6VA 4KH1A 1L4HA 1WB6A 1N2XA 1F38A 1K63A 3EUFA 4IRUB 3H04A 1CBUA 3D8NA 5HS4A 5JJCA 1XTQA 1F6WA 1VL1A 4DXHA 2X8AA 3N2NA 3P9KA 2ZM5A 1L1QA 1Y3CE 3MAAC 3NPMA 1DAFA 5DDIP 4LQ4A 3VKFA 3NCTA 1BWPA 4X1KA 5LKAA 3HGTA 2ZRPA 4DLZA 1P29A 1MAWA 2E4YA 2X1HA 3ICPA 3R6WA 1QH9A 4UXIA 3ZTYA 1GEGA 3R7NA 4KXMA 2OMEA 2GN6A 4GMFA 3SYTA 4F56A 5I9MA 2MYUA 3ELWA 3PXDA 1GAJA 3VOTA 1M2EA 1AXGA 3KYJB 3R0XA 1P2VA 4RFLA 4YP5A 3C4QA 2NX2A 1J5PA 4EJ0A 1VGQA 4QBIA 1M6YA 2JAQA 3NC1C 3M9LA 4NPCA 1IK6A 1K6MA 2C5SA 3VAAA 3W4JA 1WY5A 2LCFA 1VXOA 2D5BA 2WIBA 2YWFA 1ZRMA 4ND1A 5ECDA 2P2NA 5ALDA 1T2AA 2SNIE 2B1RA 3PA6A 3PPWA 2H9AA 4PZLA 1UADA 5CFZA 1PR3A 2NQ2C 2I4OA 3NDIA 4YPVA 1VL6A 2VC2B 3EAGA 5DBGA 3D4LA 3NJRA 3OKAA 1XZFA 2MTBA 4EHIA 2GD1O 1X7YB 4KDRA 5CEFA 5SYMA 2EF0A 3GQVA 2R1ZA 2FEPA 2P65A 5F3RA 2QVGA 3GDWA 4B6PA 3P0RA 5EGNA 4KHPB 4DADA 4D9CA 1OLXB 3TRHA 3PFGA 4G84A 4OAQA 1IM2A 1MTOA 2A0YA 4KQWA 3NEAA 5IJXA 3PUIA 1FLAA 3WNCA 1D0VA 3P1JA 2HA2A 4LWZA 4MA0A 5I7VA 2PV7A 1CUYA 2H1CA 2Z0MA 3G8BA 1JLLB 1RAEA 2A3NA 3G13A 4TUYB 3FWHA 2G08A 1LRJA 3U7QB 4PX2A 4CM5A 4EG8A 4UPEA 3LBIA 5K01A 1EP2B 3CO5A 1T1GA 2YZ2A 2EWVA 1P5RA 3SQLA 3W5CA 3NWPA 2FMUA 3FFBA 2X0DA 4LVOA 3KC2A 3JWHA 3R0IA 5AVYA 3UIEA 3MBIA 3IC5A 2HQRA 4DV5B 3PXEA 1SHJA 2GR9A 5JCOC 3ITDA 1T9AA 1U3DA 1I14A 1X1BA 1AKUA 5DWDA 3L8DA 3Q72A 3T3IA 2NPOA 3CUEF 4RXUA 1C7IA 5DJ5A 1H85A 1AC5A 3IKVA 2YV4A 3HCDA 4FGWA 4QDOA 2X5XA 1ZVKA 3LD9A 3WGQA 1QZXA 5IU6A 3ET4A 2J0EA 4FWBA 4PYKA 3X3HA 5DLEA 4RNCA 4FHGA 1NBME 1YAJA 3MHTA 3PI6A 4BWGA 2AEEA 1KI2A 2VXOA 5FI0B 1J6UA 4UCWA 3E7PA 2AKYA 3ET5A 1U31A 1E4OA 4BNYA 1UPAA 2P9GA 5EGSA 2ODNA 4QUKA 1L3BA 3NX4A 3MUEA 2BMDA 2XUKA 4UUAA 5FTJA 2ZWIA 4OFWA 1CG6A 4OXIA 3RS4A 1P44A 1LY1A 1L7PA 2FDRA 1PFWA 1Y81A 4C3ZA 2I91A 3HS3A 5JC8A 5ILOA 4UBOA 1Z0DA 3VSCA 1YRAA 2V6FA 2EBHX 1FNNA 4GOOD 4CN8A 5JEDA 5KS2A 2AR7A 5B5SA 4QQFA 5HTOA 1AK9A 3LF2A 3T95A 3EPLA 2NPFA 2Q0XA 1I33A 1W35A 3BSFA 1K9VF 4IVQA 4LHXA 1FFBA 3Q7TA 2NNLD 3G2KA 4JLKA 1OI2A 1LI4A 4OXNA 3DAGA 1U0BB 2ILTA 1ES9A 2WZQA 2JLUA 2PMFA 4R8LA 2Y1OA 2BUBA 3GEPA 5IF3A 4W6ZA 1AV6A 2UYGA 2W90A 1I6WA 3KUDA 2WVGA 4HTFA 4X8LA 4ZEWA 5J2UA 2O19A 4BE9A 1V6CA 5G40A 4BNKA 1EIZA 3COZA 4ZDJA 3BL8A 2JLCA 5EFZA 4RDXA 1PGJA 2H7YA 4YCSA 3BGSA 3H4VA 4GOMD 2NTYC 2PANA 3N5CA 1BOOA 1Z16A 4UNSA 2O8BB 1ATZA 5DNDA 3KYDA 1BEUB 2ON6A 1Y1RA 3CLHA 5CDFE 3HG7A 4A15A 2HW8A 3RYCA 1T26A 2NWQA 4I4TF 4NNPA 1AB6A 2EGHA 3EJWA 4TSFD 1C7FA 5G2OA 3RVSA 4BIIA 3K9GA 2IU0A 4F06A 3W7VA 5KNDD 4MR7A 2Z30A 3SM9A 3GFPA 1F1JA 2GUGA 4BN4A 4G5HA 2VYCA 3EF0A 3L0PA 1TUEA 4Q48A 1ZIOA 1KI4A 4JUCA 4TXMA 1TTQB 2W6JA 3AKYA 4D3FA 5JJIA 1G5QA 2XNKA 5BPHA 2LRHA 5CU7A 4GSLA 1BKDR 3FYCA 3JWPA 5FDFA 3K73O 2W6JD 4IUYA 4W1RA 4HWTA 1V8FA 5C37A 3E81A 1M6NA 1J70A 4NK5A