3BDKA

Crystal structure of streptococcus suis mannonate dehydratase complexed with substrate analogue
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
363
structure length
349
Chain Sequence
SHMKMSFRWYGKKDPVTLEEIKAIPGMQGIVTAVYDVPVGQAWPLENILELKKMVEEAGLEITVIESIPVHEDIKQGKPNRDALIENYKTSIRNVGAAGIPVVCYNFMPVFDWTRSDLHHPLPDGSTSLAFLKSDLAGVDPSKEEMKAIIENYRQNISEEDLWANLEYFIKAILPTAEEAGVKMAIHPDDPPYGIFGLPRIITGQEAVERFLNLYDSEHNGITMCVGSYASDPKNDVLAMTEYALKRNRINFMHTRNVTAGAWGFQETAHLSQAGDIDMNAVVKLLVDYDWQGSLRPDHGRRIWGDQTKTPGYGLYDRALGATYFNGLYEANMRAAGKTPDFGIKAKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-mannonate dehydratase
publication title Crystal structure of Streptococcus suis mannonate dehydratase complexed with substrate analogue
rcsb
source organism Streptococcus suis
molecule tags Lyase
total genus 108
structure length 349
sequence length 363
chains with identical sequence B
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2007-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03786 UxuA D-mannonate dehydratase (UxuA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3bdkA00
1YX1A 4QDWA 5I7GA 2OU4A 1TZ9A 4HHMA 1XIBA 3L23A 4QDPA 2ZDSA 2QW5A 4EACA 4YTRA 3UA3A 1XLFA 1O1HA 1CLKA 3M0YA 4GQBA 4US6A 2G0WA 3N4AA 4A8RA 1XISA 1D8WA 1A0CA 2XIMA 4PFHA 3VNJA 4ZBCA 3KCLA 3M0MA 5TNVA 3U3HA 2HCVA 4EAYA 3ITYA 1XIGA 1XYCA 1XYBA 4QEEA 3QZAA 5XIMA 3ITVA 4E3VA 2QUNA 1XLAA 5EMJA 3KCOA 4K1GA 2Q02A 3AYTA 4PGLA 2NQ9A 2QULA 3M0HA 3VNLA 1XYLA 2NQHA 1BXBA 6XIAA 3CNYA 2I56A 4YTUA 3KBWA 1XLMA 1A0EA 1I6NA 1XINA 1OADA 4XSLA 1A0DA 3P14A 3JU2A 3XISA 3GNXA 3KTCA 4XKMA 4XIAA 3U0HA 4HNOA 3UU0A 4A8LA 3BWWA 1MUWA 3UVAA 3KWSA 1XYAA 2ZVRA 3DX5A 1QT1A 4G56A 5J8LA 2XISA 1XLJA 3M0XA 2J6VA 2GUBA 4W4QA 4HGXA 3UA4A 5B7YA 3VYLA 8XIAA 1DXIA 3BZJA 1XLCA 4X63A 3LMZA 1DE5A 1XLKA 1QUMA 3IUIA 4Q7IA 4ZB5A 3XINA 1XLGA 4QE4A 1XLBA 4XSMA 3TC3A 5FA5A 3KBMA 4QE1A 3VNMA 8XIMA 3BANA 4HHLA 1XIMA 7XIMA 3M0VA 2HK0A 4QEHA 2NQJA 2G4JA 3ITLA 1XIDA 3KBVA 1DIEA 4XIMA 2I57A 5B7ZA 3QXBA 5EMLA 1S5NA 9XIMA 4YTSA 4J4KA 3QC0A 1XIIA 3AALA 2QUMA 4LNCA 4XISA 1I60A 3CQKA 1XLEA 1XIEA 1XIFA 4K3ZA 3ITXA 1XICA 4X61A 4ZB2A 3CQIA 1XLDA 3AAMA 4DVOA 5EMKA 5XIAA 3CWHA 4OVXA 9XIAA 4GLEA 5H6HA 1XLHA 2X7VA 1XLIA 2GYIA 5XINA 4A8NA 5AVNA 1K77A 6XIMA 3KBJA 1QTWA 3FVMA 4A8IA 1DE6A 3KBSA 3QYSA 4YTTA 1GW9A 2GLKA 3CQHA 3WQOA 3TVAA 5C9ZA 1XIJA 3OBEA 3P6LA 5EMMA 3UXIA 1XLLA 3KBNA 3CQJA 4QE5A 3XIMA 3BDKA 3KCJA 1DIDA 3ITTA 4YTQA 3NGFA 3C0LA 3IUDA 2XINA 1S5MA 4X60A 4GJJA 3AYVA 3BZGA 5B80A 1MNZA 3ITOA 2HK1A 3DBNA 5H1WA 1XIHA 3C0QA 2X7WA 3M0LA 4KW2A 3VNKA 1BXCA 3C0SA 1XP3A 1XYMA 4DUOA 4GJIA 4ZB0A 5AVHA 3VNIA 3IUHA 2GVEA
chains in the Genus database with same CATH superfamily
4NT0A 3VE9A 2ESCA 2ZKMX 3E2VA 2YA2A 1AA1B 1V0KA 3BUVA 4BQ4A 1R3WA 3MI3A 4KEZA 3D46A 4MM1A 4J9JA 4CEUC 4MJ2A 2ZZ6A 2PLCA 3IIVA 2FH6A 2ZRWA 4JTRA 3SAZA 1JGMA 4DO6A 4Y90A 1AL8A 2IPFA 4ICCX 4AD3A 3W83A 3HV8A 4G56A 2V5DA 3L4WA 2A3EA 1U30A 5IFPA 3SCOA 2HRWA 4TR9A 3MKCA 2CCRA 2ODOA 3LGDA 3CUIA 5DLCA 3UGVA 1N82A 3OB8A 1XDJA 1WDQA 3LNMA 3W1PA 1T8QA 5CPTA 3LGEA 1OG0A 4UQCA 4JFSA 4ZXOA 4FALA 1XICA 1ME7A 4TV6A 3HZ3A 1QI4A 4DPQA 3RLGA 5A5WA 1V3MA 3KEHA 1DWFM 4PBEA 1OF8A 2PLKA 4IUGA 2D2OA 4GXPA 4DY1A 4C6NA 3SQLA 4A2SA 4NAFB 4E5TA 5I24A 4EXBA 3WQOA 1RSCA 1MVYA 1XLLA 3WD0A 2ON3A 3WQPA 4BJHA 3NGJA 4GA8A 4K2SA 1M3UA 2V81A 3AIEA 4POCA 4S38A 1E4MM 3QGVA 1SFJA 4J2MA 3SB0A 5HNTA 3WK1A 4JTDA 1NWRA 2CEQA 2XM1A 1W5NA 1J93A 2V2CA 4EPDC 2FZDA 1VBRA 4RCXA 3MYPA 3MZ2A 4U5IA 1XIGA 4QEEA 1GKQA 4KKXA 3KCOA 2OR2A 1F9CA 4H9TA 3QZEA 2VFHA 3APYA 3LEPA 3WQCA 1LRNA 3AHTA 3O1NA 1E6SM 1CECA 5HINA 4GZEA 3S3GA 1UA7A 4UTUA 2ZOXA 1QPKA 1CPUA 1QW7A 1MMFA 1FWCC 5I2UA 3W88A 1K4GA 3VKJA 2AMXA 4AU0A 4HSHA 3P0XA 4HMEA 4NRSA 2YB1A 3V5OA 4O4WA 4J3VA 5K4ZA 3QR3A 2Y8KA 3DI1A 4BQ3A 1B57A 1H51A 4LY8A 3GH4A 1XUZA 3KZSA 3TYEA 4IGHA 2E6AA 3MYOA 2NW0A 3L9CA 6CGTA 4W8BA 3BG9A 3RMJA 4HK7A 1S5WA 4A8NA 1QK0A 3WNKA 3V7PA 1OCBA 1H7OA 2CBIA 3P82A 1HZYA 3ARZA 3EXSA 2Z1SA 4JHZA 3CQJA 1EL3A 5CSSA 1MZHA 4AB4A 3GBEA 4A4AA 3HQOA 3U4FA 3UNTA 2DZVA 1GKRA 1UOKA 2X7WA 4H9UA 1E0TA 4B2DA 4AVNA 1HF6A 2KX9A 3M6YA 2X2YA 3RR1A 1A3XA 1WNOA 3BSHA 4N9BA 3H2AA 4AD0A 1IIGA 4LUTB 2CWNA 3MT1A 1O4UA 3EX2A 3CBWA 4LAMA 2DZBA 1F05A 4NSBA 5DQPA 1WUFA 3UG5A 3R0UA 3WJSA 4MWAE 2I9UA 1R5YA 3H53A 3KP1A 2YL5A 2QUVA 3G8RA 5FAJA 3CNYA 1XLMA 2VHLA 3G22A 4GNKB 4PUNA 3G1RA 3ONBA 3CYJA 2WO5A 1OC7A 1WKFA 3NZPA 4UNLA 1E6XM 3PJTA 2XISA 2VKZG 1AJ0A 3Q4DA 1TPDA 3MO4A 4I7VA 1JZ6A 4MUZA 3T78A 1MI3A 3PUEA 3WBXA 4EP8C 3TN6A 4CVWA 4G7EB 3ZLFA 3FVDA 2CBUA 2ZZ2A 1XLEA 3CT7A 3U8GA 1TPWA 3TN5A 2QIWA 3CL6A 1XCXA 2E9BA 2AAAA 5F1UA 4WOQA 4QISA 1V0LA 4TMBA 3ZMRA 1ZALA 3KBJA 3B4UA 3PNUA 4ZTXA 1H50A 1EWDA 1HX0A 3U7BA 1Q6DA 3CUFA 3JZUA 1OFPA 1QHPA 3U2EA 4O1AA 3SY5A 4RPPA 4D6HA 4CU6A 4JYEA 1VEMA 2VDIA 4NILA 4GHRA 1B3OA 1HIZA 3PUDA 3UXKA 1TSIA 3UPMA 2POZA 3VNIA 1IR2A 1MO0A 2P88A 3W2LA 4M29A 3RDKA 3KHDA 3N3TA 4HZ8A 4N2YA 1FH9A 5KZDA 1GUVA 1IZCA 3B0YA 3H24A 3S5OA 5A3HA 3VDGA 3N18A 4GNVA 4MPQA 3BCDA 1LT7A 3NEHA 1H5YA 3PSWA 1I1WA 3W1UA 3IK4A 5A8OA 2REQB 4XZIA 1W1YA 1QBAA 4DO7A 2WMIA 4M7TA 1AW2A 1JD9A 1US0A 1LWIA 2Y2WA 3CHVA 1GOQA 3LMYA 2P76A 3B97A 4WGXA 3S2CA 1QUMA 3TROA 1SM9A 3G77A 4D8LA 2CZDA 4CCCA 3FKRA 1AQ0A 2R82A 3DOPA 3TYDA 4WDWA 1TPFA 3KL0A 2J74A 5GQBA 2TPSA 4LNCA 4MSSA 5KZ6A 3FHAA 1EEPA 1G7VA 1TV2A 4KCWA 4Z1BA 3VM7A 3WQWA 4BR1A 4JIPA 3OZYA 4WD0A 1TPH1 1GJUA 3AYVA 1V6VA 3PZ9A 4LEQA 5CZTA 4UTFA 3HA1A 3QGKC 3GTXA 4AMCA 1XRVA 3DBNA 5KZMA 2WBGA 4S2BA 1IXQA 3C0SA 4HP5A 4NYYA 5F1VA 3P84A 3VOIA 5JIWA 4PMYA 4CCEA 1SO6A 3FJLA 5C9XA 1DJXA 4FNTA 4ZE4A 1XLFA 3WNPA 1TPUA 2XVKA 2F9RA 3DZ1A 2L5HA 4NNCA 3VE7A 1LTDA 1TMLA 1KRAC 3POCA 3O6AA 1W37A 4J3TA 3T0DA 3NCOA 3QSTA 4DPPA 1PTDA 3M5VA 5HMDA 4O8AA 2W67A 3PBYA 4RLIA 3KL5A 1X6NA 1KLZA 3AIWA 3R58A 4IPLA 2PP1A 2A2IA 2J7BA 3FDGA 1GZJA 1R86A 3WNNA 3SY8A 3PSVA 4IFKB 4GYJA 1EQCA 4N9DA 9XIMA 2OZ8A 1TE1A 2EPOA 2OO6A 4L6HA 4YHGA 2WZIA 3U6WA 1BGGA 4D6GA 5DF0A 1TTQA 3F5KA 2PS2A 4LVDA 2HXUA 1HJQA 1BXNA 1FWIC 2QF8A 3GC5A 3GAYA 1TWIA 3ZT5A 1BTCA 2CZEA 2QKFA 5LHEA 3R7MA 3B8IA 3VMOA 2OQYA 3QRHA 3RFAA 2QF7A 2WCGA 3W7HA 1OK4A 2FH8A 3MUCA 3CHFA 3UR5A 2J75A 4EF8A 1T6MA 3T40A 3GZAA 2DVUA 3RYSA 4W89A 4ATLA 2BSLA 3FHQA 1LQ2A 1B0IA 1CLKA 4CEXC 5A6TC 2E67A 5TNVA 1ODUA 4FNUA 3VVGA 4QTGA 3KOZA 1VCGA 2P0OA 3SFWA 3LOTA 2J7CA 5D2XA 4NNBA 3ZT7A 3J7HA 1TE6A 3AMLA 1V02E 2ZDRA 4JIEA 1V3HA 3G1XA 4HPHA 2OCZA 3K8LA 4C6MA 3VFCA 3CAWA 3SUTA 2X16A 3UZJA 5U7SA 4AZBA 2YJQA 5I77A 2CLPA 3MWCA 3VDAA 2WZMA 3C52A 4QE1A 2VX5A 2WK2A 1KRBC 1K70A 3S9YA 4ROQA 1GHRA 4AWUA 4B5VA 1HKKA 1U5VA 3KLKA 3TZNA 4AX6A 1UIOA 5CC6A 4O1CA 4AWEA 3K2GA 1SFLA 2VTFA 1KXTA 2XPKA 4NQ1A 1J79A 1PCWA 3RILA 4WSJA 1NU5A 1P5BA 4IL0A 3STGA 4IIHA 2GJLA 4JDYA 3RM8A 1N7KA 2C19A 3H23A 4MJ4A 1KBKA 4L56A 3NDZA 2J77A 3M4HA 1E0VA 2V3EA 1WO2A 3CV7A 3HU7A 4RNJA 4A3HA 4GVHA 8TIMA 4JAWA 3UG3A 1OGSA 4JD4A 4L1XA 4KRZA 2FHCA 2O9PA 3WZ0E 1XM3A 4O57A 2PWDA 1KCKA 2ZRUA 3MDWA 2IKGA 2CXEA 3UZZA 2ZC1A 3RJXA 1UKQA 1XYZA 5EMUA 1TWSA 1KKRA 2I56A 4NZ4A 2AAMA 3FAWA 1LQ0A 4E8CA 3SIZA 4XKMA 1US2A 2INFA 2NLIA 2OWCA 1HJSA 1MDRA 3OGSA 3T8LA 4QJ4B 2G50A 3WLNA 4KFOA 1S39A 4JICA 4RDWA 4GGHA 4FLRA 3IVSA 3THAA 3W9ZA 1HO4A 7XIMA 5LZLA 2H9AA 1WX0A 3OVQA 1W91A 2Q71A 4PZVA 3CWHA 3IJ8A 2G3MA 4S3FA 3WQDA 2ZRZA 2GDVA 4I5RA 2X1SA 4QG9A 3TOYA 3PBUA 1UHVA 3IIOA 4QSHA 3DXIA 3L68A 3QHNA 3KRBA 3P6LA 2QS8A 5AN7A 5HANA 1TELA 3RX2A 1CW2A 3GNOA 5C71A 3B0PA 3CEUA 1XBZA 3BZGA 3IGXA 3E2RA 2WJEA 4E2VA 1P4CA 4AZ7A 1L8PA 3C8NA 2OOGA 2PDHA 2YDRA 5HPOA 4RPQA 1FWNA 2E0PA 3LPFA 3HOJA 2Z28A 3UA3A 3WCZA 3C6CA 5H8MA 2GVLA 3E0VA 2VR2A 4ZO9A 4AD5A 4GUIA 1FUYA 7TAAA 4AC7C 3EAUA 4ZTYA 6PTDA 5HWMA 1NVMA 3H4GA 1EJSC 2C1HA 4GQGA 5DO8A 1O94A 1ME8A 2PU1A 4PUDA 4H00A 4JTIA 3O16A 4F0RA 1F4AA 4MNMA 4R5EA 4XZHA 4C6JA 3TDFA 5CSRA 1MNSA 3NA8A 1J8VA 2Z2BA 5G2IA 3AIBA 4DBWA 1PTGA 4F0MA 3NQ8A 2W4XA 3IV3A 3LHZA 3C2VA 4C6PA 3TW9A 4LUYA 3LHTA 3R94A 2ZUUA 2W27A 2VFDA 3QM3A 3R5EA 3WLLA 1J6PA 2VGIA 1GJPA 2WPGA 4JKMA 1B5TA 1TR1A 1QAPA 1KFJA 4LCRA 1PYFA 3SCTA 4LNYA 3MMTA 1E4NA 2OJPA 2PE4A 3JR2A 4IPNB 2DW7A 2V2DA 3KVLA 2Y7GA 4HNCA 1RPKA 3FJNA 2EJ1A 5LNRA 3N2CA 1VYPX 1FWHC 2NVCA 4NZ5A 2R24A 2QMJA 4F4RA 5AOUA 3KDOA 4NX5A 4HN4A 3MKVA 2FPYA 2WMKA 3C0JA 1HL8A 1VP5A 3AXHA 3EPNA 3NL2A 3SSZA 3GIYA 1H11A 2OXNA 2YX0A 1UZDA 1NAL1 4AWTA 3L5MA 3N6JA 1DV7A 4ONVA 1E1CB 3NPVA 1VR6A 3KHJA 1LLWA 2PGRA 1RJQA 1XYBA 4RW3A 1D9EA 2Y4SA 1GEQA 4LX4A 2OYLA 4L80A 1XL9A 3WFLA 4JIRA 1N8FA 3H12A 1TV5A 3GDMA 1PKLA 4HU3A 1UP2A 1UPMB 2JKPA 4X3ZA 4NKCA 1VC4A 1VLIA 1Z44A 3LXCA 4GBUA 3VKCA 2JK2A 5C55A 1AODA 4QDMA 3EWBX 3LPPA 3NDYA 1OIMA 3JS3A 1JPIA 2D69A 1F07A 5JQ9A 1QPOA 2XH7A 3A5VA 2DJXA 1SR0A 3CQIA 1RP9A 4JFVA 4JYFA 3VOJA 1FH7A 3KL3A 1XD0A 1JPHA 2PF8A 4GRSA 4CLMA 5GNYA 3KZPA 1AFSA 1POJA 3FN9A 3RHGA 3C0LA 3NDOA 1RZMA 5MF5A 5MKGB 3ES8A 5F2IA 1GTHA 4AD2A 2WVUA 3M0KA 4MHBA 3UWYA 3S8HA 5TQLA 5BXTA 1OZMA 1YBQB 2VDGA 3VGBA 1IGSA 3W2UA 3IUHA 2FLIA 2MANA 4REQB 3BJTA 1ALDA 4FR1A 3THDA 1PCKA 4W88A 4Q4OA 2ISDA 2IQTA 4HCLA 4DZHA 4OOUA 1P0EA 1WDDA 1BLIA 3LLFA 2B4GA 3EOLA 1C8VA 2F6XA 3LLDA 5BOEA 2OKOA 4IZGA 4U31A 3P5ZA 2Y6ZA 1TX2A 1KCZA 3NM3A 1Q6CA 4GGBA 1LCOA 3CGTA 3CZLA 2J7HA 3PJXA 1JYNA 3XINA 2ZA3A 3EMQA 3OBKA 4ZCWA 1TJPA 3KBMA 1H7XA 4NU7A 3VDCA 1CDGA 4B91A 3LV5A 1CXKA 5CAKA 2WBKA 1OY0A 3OBAA 4GZ7A 3K5XA 2PAJA 3FXGA 1C7TA 4O13A 1VYSX 1PUDA 1ONWA 3LB0A 4R7JA 4S3BA 4YCOA 2QJNA 4DELA 3ABSA 1B2YA 3CV1A 4H1ZA 4M56A 4JTFA 2GK1B 1MNZA 5FJJA 4R53A 1I8JA 4XBJA 3WSUA 5AB3A 4Q4RA 4FLQA 2G96A 1J96A 3RGTA 1V6YA 2E5BA 1O12A 3NXLA 4L6DA 3BLOA 3KLLA 1EJXC 3CPGA 4GI6A 5HATA 3CH0A 1JAEA 2ZXAA 2XIBA 2I5IA 1US3A 3POHA 5F4SA 4P7RA 3C3UA 2ZX6A 3NSXA 3DFPA 4Q4QA 4JDBA 3T08A 4UFJA 2OSWA 3QEZA 2PDBA 2VDHA 4QITA 1YDOA 4JY9A 4CNPA 1V79A 3KBWA 1I6NA 3OGVA 1XC6A 3U2CA 3S0CA 1F7BA 3K30A 4JKLA 4LYQA 3PN8A 2EKGA 4XTDA 1D7FA 3VZZA 2QIIA 3LI0A 3A3HA 4FXFA 3BOXA 2BVDA 2UY3A 4QE4A 5AHIA 2A6NA 3FSTA 3TXVA 1UD3A 1CXEA 1XBVA 2GWNA 4QEHA 3RXZA 4OOZA 1OCQA 1BF2A 1XIDA 2OVLA 4RJEA 1UD4A 3AISA 3HFTA 2PC8A 4F8XA 2J13A 2IKJA 4IX0A 1VQTA 1F4HA 3TSBA 2EO7A 1DEDA 4M6PA 1ONRA 1QK2A 3AO0A 1Z9AA 4UFLA 5KEZA 3GHSA 2E5DA 3RO6A 4C1NB 1OC6A 1TUXA 4WJXA 3VIKA 5M17A 2TMDA 2Y7FA 3SZ8A 2OGYA 3GX9A 1OEPA 3GDRA 3JRKA 2Z6JA 1KGXA 3W1NA 3G8EA 3EMZA 4I9MA 1UWQA 2PWFA 3IACA 2E6YA 4JOMA 1WYIA 2CHRA 2Z1BA 1HKWA 3KX6A 1BKSA 2PC4A 6REQA 1XSIA 2Y24A 1TV4A 3VIGA 3W29A 1RBOB 2XU2A 4I90A 1NDZA 2X09A 3RLVA 3O0KA 3H2CA 4LW7A 3OU8A 1QI0A 5A6BD 2XH2A 1LBLA 2XVGA 3H54A 2E28A 4YNGA 1IZKA 1IZJA 1Q13A 4K8EA 2G37A 1EXPA 5IDIA 3BLLA 3M5XA 1Q6QA 3M0JA 2YBVA 4IGSA 5A2CA 3O06A 4DXVA 2W79A 2NZLA 1PHWA 3FYYA 3QOMA 3LHYA 3HGSA 1PE1A 4UNKA 3KDNA 1ZJBA 4X61A 1XPYA 2D22A 5AZ1A 3EKGA 4D6IA 1ZRQA 2J88A 1LL4A 3EWCA 4NX0A 3HBLA 3WF0A 2Y63A 2QV4A 3DIPA 4NZJA 4L1WA 4H8VA 3CEPA 4L65A 4RK8A 2RKXA 4KEUA 3WUGA 3HG5A 3VFLA 3UPBA 1S5MA 2UV8G 4NJGA 1TJ2A 3T0CA 1K03A 2WNWA 3GRIA 4CCDA 5FIPA 5G2HA 2IKHA 4O10A 3OZMA 4S3EA 1YADA 4PB5A 1S1PA 1H61A 1AH4A 5I0DA 2AOSA 1TJRA 4HU0A 2W62A 3VNJA 2X1UA 2HXTA 1I2RA 3Q65A 1GT8A 3QZAA 3L5AA 3W38A 1B30A 1UUMA 1NH6A 1FP8A 2DT3A 4V33A 5L9FA 2NQHA 1M6JA 1OT2A 5EGRA 3CPRA 4XK2A 2V63A 3BV4A 4KIRA 4JN7A 3CUZA 5ABGA 1DHKA 1ZBWA 3WENA 1SVDA 4JQ3A 3OGRA 3SQMA 2OEKA 4Q4MA 4LS2A 3IK2A 3S2MA 5I6SA 3VAVA 2VFGA 1R7AA 2CLLA 2UY2A 3MCNA 4GNJA 3NSMA 4V1YA 2Y88A 3SCQA 4PCTA 4F2BA 2WSPA 4J2PA 5HMEA 5EPDA 2X0SA 4ZEPA 1AG1O 4HJWA 3AMDA 3BAWA 4PMXA 1RVGA 1B4EA 3QFWA 1EH9A 4GUJA 4GK8A 3NQ7A 3TWBA 1TZZA 3MHGA 1A5CA 2G8ZA 3N2BA 4GY1A 3GVGA 4QLJA 1ECQA 3SIMA 3S4TA 1ZUAX 1ZJAA 1DPMA 1ZSXA 1AQHA 4H6QA 5DCEA 1BXCA 4V2XA 5FJPA 2ZRVA 1TJ1A 2EEXA 4YMZA 2XN0A 1NTHA 1HJWA 1VAHA 1XRTA 3WUFA 3QW3A 1TJ0A 4CQBA 1GVRA 3OZPA 1Q2RA 2RJGA 2GOKA 1XDMA 1H3GA 2JEPA 3AS0A 4GXWA 4DF0A 2PFHA 2W9MA 4ZOAA 4I9JA 4B4FA 3BURA 1E56A 2PU0A 1KXHA 4EXAA 4CD4A 3MCOA 4JX6A 3KM8A 3WBEA 1Z48A 3BZJA 4AY8A 1AK5A 3LCXA 1BVZA 2Y5SA 1K8YA 2IS7A 5JXQA 4YWSA 1JZ5A 2VELA 3ID7A 1EUAA 1YDNA 3KBVA 4WXYA 3KOFA 4IMAA 4WY0B 1JQVA 3N13A 2PZ0A 1XR2A 2EPLX 3PS7A 1DORA 3ICJA 2A21A 4M8UA 3T42A 2VO5A 2C91A 1OINA 2VC9A 2F2HA 3WQ6A 4H19A 4O18A 1XIJA 3NQMA 4O15A 4CCZA 2W6RA 3UYIA 1AZ2A 4PRTA 1KBBA 4ZMGA 4ZFCA 2QXWA 3HGOA 4EPBC 2PP3A 1FCUA 5H1WA 4GI4A 3A4WA 1Q63A 2J8FA 4L1GA 3EX1A 2Q6ZA 1PXGA 2ZUNA 2DIEA 3CLMA 3E9AA 2DQWA 2FDSA 5BRBA 4J3XA 4GYFA 4YYFA 3W81A 1AH3A 4GUFA 1SZRA 1JUEA 3MJYA 3H7VA 2VI0A 4W84A 1GQJA 3MI6A 4IGMA 4YTUA 4LAOA 4KF1A 2BXYA 4U28A 1LQAA 2FJUB 3WH8A 1Z69A 3ZSSA 2FB3A 3HG2A 4CN4A 3A13A 2G97A 4TUFA 4MDPA 4GI9A 1EDGA 3GSMA 1SJBA 3GDTA 5EBUA 3B4YA 4HOXA 3TTSA 4ADTA 1RCOB 3H55A 4I3GA 3RRAA 3CJPA 1YXCA 1ZAHA 2OZ0A 5BU6A 5D37A 2ZUWA 3CH9A 4FX8A 3QY8A 3W01A 3E49A 1DOSA 3T0TA 5DEZA 3THUA 3VIHA 2VFEA 3RITA 2WVTA 1R9XA 3EYPA 4GUHA 2XJ7A 5ECVA 1WAUA 3FX4A 3QC3A 4N9CA 2X0YA 5G1MA 4GJIA 3CMJA 1J0KA 2ABAA 3AHYA 4PN2A 5FJTA 1PZ3A 2R91A 4WR3A 5U4NA 1UCWA 2Z7KA 3LPOA 5A8PA 3CM4A 1K9DA 4M3PA 3GTIA 4Y8FA 1R2SA 1QOQA 5CSYA 3FJ4A 5TD4A 1IWAA 2PDUA 2QULA 1AQMA 2V5LA 3HFYA 4TX6A 5A6SA 4F0SA 4K38A 2Y85A 1M7PA 1FCQA 3W1RA 3U0HA 1YDVA 4OGZA 3EX4A 1Q8JA 1K9FA 1HXJA 2VX4A 1KV8A 4E4PA 3CIXA 5JVLA 3L4ZA 3LGGA 4PTXA 4Q8QA 5A6LA 4KERA 4H6RA 1WXYA 3IWPA 1RD6A 1PIFA 3O6DA 3WMSA 3UJFA 2V38A 3NO5A 2XM2A 1LOQA 4YVVA 1JEZA 4WJEA 4XZWA 1GQIA 3W6LA 4LEFA 4M1BA 1WOAA 4UTHA 1NJJA 3TCSA 2BXVA 3MV01 4IIBA 1HVXA 2E9LA 3VKBA 3WQ8A 5DY2A 1R46A 4Q7BA 3RR4A 3FK4A 3LCLA 4AX7A 3MUAA 1JYWA 3G1YA 3CMFA 4PMRA 4QRNA 3TTOA 3QH2A 2ZC8A 2VZSA 4IT1A 1JZ3A 5FCZA 3VXGA 3L67A 2J24A 3C0QA 3PBMA 2QUUA 3SADA 1GVOA 4ZB0A 4IMDA 1ZJHA 4S3CA 2FZ9A 1ZAIA 3AIUA 1ADSA 2FZNA 2QDGA 3UR8A 4MFDA 2NSOA 3RUBL 6ENLA 4O50A 3ARUA 4WSHA 2VEMA 3RF9A 1EJVC 4E3VA 3MMWA 3GD6A 1QDSA 8CGTA 1EIBA 3SCNA 3ARRA 3OEXA 1KFCA 1Y65A 1DJZA 1SW3A 4DM1A 4Q8PA 1OBAA 3MTWA 5KMYA 1IE7C 2NX1A 4W9TA 2R1NA 4DHGA 3HO8A 3NURA 3I3EA 2NV9A 4L4LA 2EBNA 4FAMA 1HUVA 2ZWYA 1E1EA 4W87A 2PDCA 1JFHA 3CAVA 3GXDA 3TJIA 4Z2IA 3UY8A 3MVTA 4LS1A 3ME3A 5D2VA 3QY7A 2PRHA 3W2KA 3W02A 3FA4A 1PZ1A 2OWWA 3TQKA 1VLWA 4O1FA 4KRUA 1AL7A 4RKAA 2YFOA 3V1PA 3KRSA 1YTKA 1GYMA 3I3DA 3UWEA 4RNHA 3CUXA 3PBWA 3PK7A 3QHOA 2X40A 3BJSA 2P8BA 1H7RA 3QN3A 3TR2A 3TSMA 3WQ5A 3TKFA 4LALA 3ZOAA 4PCNA 4GIRA 3SN1A 2HSAA 4DLMA 1O68A 1MSSA 1FCVA 4K8HA 2PDPA 3ZLGA 5BRQA 4DUOA 4X0VA 1NF0A 2Y7DA 1H63A 1ICPA 3W7GA 1OD0A 2GJRA 2QCGA 2H8ZA 1IXPA 5I02A 1CGUA 5I3GA 3NQAA 3MU7A 4B15A 1V6TA 3VOFA 1JUBA 2X0HA 3H22A 2ZUTA 7A3HA 4N7QA 5CCZA 1FTXA 1VFTA 2P0IA 1YYAA 1A0DA 1OFQA 4JIQA 1SMAA 3TUUA 4PMZA 2XH0A 4OJYA 3NQFA 1F3XA 3URQA 3PHAA 4JBRA 1FFQA 4AD1A 1IEQA 2HQAA 4FB7A 4XD4A 1T0OA 3CQKA 2YXOA 2RH9A 3RCMA 3KRUA 4O1DA 2J6XA 1FHLA 3EB3A 1S2VA 5H6HA 1CIUA 4PUUA 2EPMX 1UD6A 2CLEA 3JUGA 2Z27A 1JF6A 2YIHA 2Q8XA 4FA3A 2YDQA 2BGNE 1HL2A 2VVSA 3HB9A 1Q6RA 1G6CA 2YLAA 3ZLHA 5KETA 4NXKA 3A4AA 2GGHA 3ARTA 4IICA 4AYSA 3RLHA 2YCKX 1U83A 3M0LA 5AC8A 1W54A 2DSUA 1J4EA 2WNNA 3GK0A 3CIWA 5LIUX 4YTRA 1KXVA 1SZGA 2BBFA 2QEZA 2V6AA 1ITQA 3OPSA 3AZTA 4LAUA 4A21A 3SM0A 1E72M 3VA8A 2X30A 3IGSA 3P2VA 5AC6A 2IQDA 4ZFMA 5REQA 4PTNA 4UR8A 3BLEA 4UNIA 1R9YA 4AQLA 5D33A 3GG7A 1YTEA 3NJ3A 3BH4A 2DFAA 2FVMA 3WNMA 3SR7A 4QJ3B 2C6QA 4E2BA 2G4JA 3CUGA 3WG6A 1V93A 3L2MA 4E38A 1R6WA 3DEQA 2XUCA 4PMOA 7ODCA 3CLWA 4GOAA 3NL5A 2G4FA 3AWNA 1EGMA 3CZGA 1OCJA 4GLEA 4B5TA 2HEJA 2J7GA 3TQPA 4Y7EA 1M7XA 3M43A 3W7RA 3S5NA 2GLKA 4N02A 5HULA 3BLDA 1JNDA 1P7TB 1YTDA 3ARQA 1UP3A 3MP5A 4AEOA 4LXFA 1W6TA 1W2VA 3LY0A 1E70M 4M80A 3TJXA 3B05A 2QDHA 4KW2A 4N9EA 4ASTA 1R3TA 3W76A 1VGAA 3CV2A 1QMLA 2OZTA 5LNWA 4GKLA 2FGZA 3A47A 1OFEA 2VWTA 4UFMA 1D8WA 3QPEA 1OFBA 1QI5A 3MUXA 1AZ1A 5BWAA 3EWWA 4XQ6A 4H7CA 1ISWA 2QT3A 4WSKA 3HTWA 3ZWSA 1UB3A 1D3GA 4JTKA 3PR2A 3NQ6A 3WQGA 1NOUA 3PNZA 3ZWTA 3P80A 4P5UA 2F61A 1IT8A 4ADUA 3N25A 1DL3A 5J8LA 1H1NA 1SZNA 1XLJA 3HPAA 3R8GA 3S1XA 5DBUA 3W24A 2DJLA 1D8CA 2OELA 1S2AA 4HSOA 1HTIA 1O5RA 3LG3A 2OX4A 1V8EA 2XWDA 4UQDA 1YNYA 1YXYA 4V27A 4K39A 5B7ZA 2YW3A 1A50A 1UPPA 1JUKA 2A3LA 3VIOA 1CGXA 4GYPA 2VEGA 3AOFA 4LBRA 4QJ1A 3H26A 3UWWA 5I3FA 2EPNA 1PTAA 1IT0A 3W1LA 4UTTA 5JUVA 3DYPA 4J40A 1W9VA 2RAGA 3CQHA 1ZFJA 3V0TA 1OX4B 3UXIA 5ABHA 4ACZA 3GU9A 3BSMA 3TJLA 4QE5A 4W7UA 5A95A 5HMSA 2DZPA 1JCJA 4Z2KA 4HYVA 3MO7A 3QF0A 2ASHA 5LGZA 1B3XA 1YKWA 4IWWA 1C8XA 1FCBA 3N04A 3E1F1 5MHBA 3NVTA 4K3ZA 3WF2A 1KXQA 5I7GA 1ZQ5A 1YW1A 1BD0A 4QDPA 4IPPA 1YEYA 2E68A 3VUPA 5M2FX 2PDJA 4W8AA 4ALDA 4UTTC 1JZ2A 2PTZA 4IG2A 4ZENA 4JTAA 3OW1A 5CQ1A 4Z2LA 1OADA 1FY6A 4ACYA 3H70A 4N42A 3BARA 4BF9A 2D2JA 4U2ZA 2VX7A 3WKZA 1QFEA 3U9IA 1RCXB 1IEIA 3BMWA 4NL1A 1HJUA 5IXEA 5J5RA 2WC4A 3U4AA 5RUBA 1O60A 3BANA 2NQJA 3UWUA 3WNLA 3WL1A 4FX6M 3KRZA 3PJWA 2QCHA 2SFPA 2Z4GA 4XISA 3AUOA 1I60A 4S39A 4RX0A 3QV9A 4ZQPA 4BWLC 1HGYA 3DC0A 2TAAA 3L4TA 3L4UA 4K37A 4QJ5B 4F3HA 2YCLA 4A2RA 3JVAA 5CZSA 3EDEA 3TX9A 1ZPTA 6ALDA 3GFXA 3W7IA 2OSXA 2WPBA 2DZXA 3CHDA 5F2MA 4QAIA 2P50A 3G18A 2P8CA 4DI9A 1EQPA 4AG0A 5HNRA 4DAIA 3AFBA 5AC4A 4M6QA 2ACUA 1TTJA 2Y61A 2R6OA 1J2WA 4GMEA 1W1PA 3HQ1A 2P3EA 2W61A 1TZ9A 3UVIA 2RHGA 3RPMA 1H2JA 4OBRA 5D38A 1EB3A 5HJYA 3REQB 2PWVA 2ZUMA 3ZZ1A 3HQPA 1CI1A 2J7DA 2GSJA 2ADAA 4NAEB 3VC5A 4JNZA 5F4XA 3K13A 4XZMX 2POTA 1FWGC 4AZCA 4H9ZA 4HZ6A 2QAPA 3BLPX 1F6YA 3T4WA 1EGZA 3QR1A 1G67A 3GHUA 3UJSA 1TQXA 3O9NA 3QV6A 4ICMA 4FNSA 2J6VA 3W71A 2YSWA 4R7WA 3A24A 3T2QA 1JD7A 3G6MA 4TQTA 4XSMA 2NUXA 7REQA 1T5AA 3VGGA 3VIFA 4PL1A 1E5NA 4Z1AA 1QNSA 2G3NA 3WK2A 4CN1A 5CBIA 1VFUA 1VFLA 2DV0A 4JFWA 5H91A 2VZTA 1UC4A 5BZAA 4FLSA 2NUYA 3VPLA 1MEIA 4PA8A 4HMCA 1PV8A 4ZR8A 2E8YA 1XKJA 5CG0A 1M68A 5G4HC 4LFYA 4LSBA 1OVDA 3OYXA 2JGYA 2PTWA 3M0ZA 3MA8A 3WEMA 3NG3A 1QW9A 1PDYA 1I2NA 2E1WA 3HPFA 4CNTA 3H2MA 5DT7A 4RL3A 2JBMA 1X8CA 2ZX7A 1JCTA 3OG2A 2ZE3A 3IEBA 2EPKX 3L4VA 1H41A 1VF8A 1A5LC 4S23A 3S2LA 4AY1A 1XGZA 3AYTA 5T91A 2WMHA 4DUXA 2I5GA 3MSYA 2PDFA 3AU6A 4N4PA 2GQ9A 3PZIA 2VUYA 5J5DA 4W93A 3R1ZA 3VD9A 3P8JA 2YZRA 4X0NA 3W2JA 3MSRA 4JX4A 4C7GA 4HMNA 1UKSA 2RFGA 3B9AA 4S1FA 3CMGA 1BQGA 4HPJA 1CBGA 3VILA 1KRMA 1ISXA 3P3BA 4MWAB 2PCEA 1C9DA 4K7VA 3DHFA 3AYSA 1NY1A 5CPOA 3PB2A 1GW1A 3KVKA 4XIMA 1DQXA 1SQ7A 5G1TA 5EMLA 4R34A 1PS9A 2OMAA 3WLRA 4A3QA 4TX9A 3K4AA 2IUZA 3GIPA 4NZ1A 3N9KA 5CZJA 3LNPA 4YTTA 4XVEA 4JTQA 3AICA 5GJPA 2XN1A 1UH2A 2YCJA 1GK8A 1KQZA 3MUIA 3H21A 3OO2A 4DX3A 2V9DA 5CC7A 3ABXA 1F8MA 3ZJKA 2EQDA 4EVZA 4XO7A 3UCDA 3UR2A 5FJUA 4R7OA 3H7UA 3G5EA 1E4LA 1WKEA 4BY3A 4YS1A 4LCQA 4Z1YA 4Y9PA 4IIGA 3O6YX 2B7QA 4ILSA 4WY0F 3K1DA 4K1GA 3UEQA 1QATA 1FQ0A 2A3BA 2O9OA 1XS2A 2HBXA 4PMVA 3PP7A 4HJFA 3XISA 3NWRA 3ORWA 4M82A 3DC8A 4BA0A 5IBXC 2VZOA 3V0SA 1R7OA 3VI2A 1C8YA 3F2DA 3IRSA 2PBGA 3QTPA 3GNRA 2XYLA 1ELSA 1VFOA 3BAIA 4OECA 4Q8UA 2PPGA 3ABRA 3B8SA 4FNQA 5JH1A 4H8HA 1XGDA 3UERA 2B31A 4O52A 4AMAA 4J3UA 4CD6A 4B3KA 2EJAA 1Q7QA 4KEVA 4MNJA 4OQVA 3GC4A 2HVOA 5GJMA 4Q8OA 4KWOA 4U3CA 3QQ0A 4WRHA 5E93A 4DYEA 3WLQA 4AWSA 4MB1A 4S3KA 4O8RA 2PGFA 4P7OA 4Z2JA 2ZRXA 1PKYA 1P6CA 2XGZA 3SCRA 1Q4WA 1TQJA 1VFHA 4H8UA 3ARWA 3EXTA 3GXIA 3QR0A 3ZR5A 3FYPA 5FL1A 2A4AA 3WL0A 4M81A 1JDAA 4Q8WA 3SY1A 2WNQA 4MAVA 4B2DD 3WH9A 1FRBA 4HK5A 1XC4A 1KM4A 3PWGA 1H09A 3WD1A 5T8GA 4LBSA 4WDTA 1V51A 4WVXA 5FD0A 4TTUA 5A2AA 3BJFA 4TVUA 5LA2A 1B90A 2ACQA 2XH4A 1MXDA 1WUEA 1CXLA 5I3DA 1UUQA 1E9LA 1TVLA 1XLGA 4GABA 3S6OA 1L2UA 3OA5A 5HUOA 4GY0A 1D2KA 1XW8A 2CBJA 4MZ1A 4BQ5A 1KA9F 2ICSA 1HW6A 3KOYA 4IP5A 5E5CA 1I9CB 4UWMA 3LRLA 4YIWA 1DJYA 3LPGA 3SQSA 3S9ZA 4Z08A 2WNZA 3ALGA 1DE6A 1B3ZA 4H9XA 3LZ3A 4GX8A 3H2NA 3F1QA 1UIPA 1KLYA 4OU1A 3BDKA 1W1A1 4GVFA 4XD3A 1UH4A 2G5WA 1AMYA 4GUGA 4DEFA 5ENLA 4K1WA 3ES7A 4BI6A 3WDHA 1LLOA 2Y0FA 5D9OA 2FZBA 1JXKA 2RDUA 1X1NA 2BY0A 1GHSA 1OX6A 3QBUA 4CD7A 2DSVA 2BTMA 1HT6A 2HCVA 1G4PA 4LU0A 5E0CA 4IX2A 4KQNA 2D73A 3HGJA 1CYGA 4UBPC 4QG8A 2YLLA 3STCA 5HQMA 2C13A 1OSEA 2AKZA 4QLKA 4IF2A 4HNOA 2O4QA 3GNPA 3M0IA 3NUKA 4IXHA 3EB2A 5LNVA 2GSEA 2CNCA 4JCMA 1SFSA 2CLOA 1M41A 1R38A 3TMLA 5CSUA 2DZAA 4GI8A 1TPEA 3T0BA 3TR9A 1UR9A 3G24A 3P60A 3AS3A 3QLLA 4KRTA 3PULA 2XIOA 4WIWA 3Q58A 1XIIA 3STFA 2QUMA 3ABOA 3E0WA 1CLVA 1VHCA 1M04A 4JX5A 3K8KA 1PHQA 4DWSA 1KGWA 2Z1KA 4H9VA 3MUZ1 5XINA 2A5HA 4N6FA 1IYXA 4X9SA 2HE5A 1GQLA 3GWQA 1JYXA 2F84A 3SUUA 2WZHA 2YOCA 1R85A 3EA1A 4XV0A 1UR0A 3QVQA 3NPUA 2Y89A 1EJRC 1UD8A 2BVWA 1MDLA 4XAZA 5AHEA 3CAQA 2FGLA 2ZDSA 5E6YA 1BTMA 5KINA 4A8RA 4OBSA 3NQDA 3UWQA 1IWPA 4DJED 3NR0A 4FI4A 1J6OA 2Z24A 3CL7A 1RD5A 2INZA 1CXHA 3YPIA 5DN1A 3WLKX 1BQCA 3TYZA 4YXGA 2H3DA 3WEOA 4O0KA 3N2TA 1SO3A 3H2EA 3LTYA 2YDSA 4TV5A 1E6QM 2NV1A 3MHFA 3W26A 4XAPA 1UMLA 5DMYA 2A3HA 1RCQA 4PL2A 3KWSA 3MANA 5A6BA 3S9IA 4JQ4A 4FOUA 3EXRA 2ZADA 4X63A 4NAFA 1OJXA 2VZVA 1FKWA 2PA6A 4C6KA 4F0KA 1JCMP 2OT0A 2E6DA 4FS9A 2P53A 4JHMA 1B3YA 3NSNA 5DCDA 1GVIA 1ITUA 4NRRA 2WJZA 2PWGA 3VGHA 2OT1A 4GFIA 3L5LA 4XB3A 1FXQA 2JEQA 2VC6A 5E09A 1LLZA 4MKNA 1JVNA 5EL1A 2PLJA 1XCFA 3HG3A 4J3ZA 3RPTA 4BFAA 2DORA 1QRQA 2E25A 2WZTA 4Z0JA 2AL1A 2XINA 4EAMA 5A6AA 4AF0A 5M1TA 4H3DA 4L61A 5IHRA 2FMNA 3WY1A 1A47A 5CPQA 1M5WA 5AVHA 2XHYA 3RM9A 1XFCA 2GVEA 2D2GA 2CKSA 3CWNA 4Y9MA 3GTNA 2OZ3A 1SO4A 3TNOA 4ZQNA 4UTLA 3W2MA 3GU1A 3OVRA 4OZOA 5DMNA 3G1VA 3BMXA 4Z2HA 1JXJA 1EC9A 3BAKA 1G5AA 4Y9OA 5I03A 3QLDA 1ZCCA 1RUSA 4ADSA 4LYKA 4ZO8A 1XXXA 2F6KA 5GVJA 3WF1A 4C6FA 2XSAA 4FZIA 4JL2A 4EF9A 1CGTA 1MUMA 3DGBA 3PF3A 2F38A 5AHLA 3U2OA 3UWZA 1CWYA 1TV8A 3QXBA 2PGWA 1A5AA 4CQ9A 4B3ZA 1Q3NA 4E6MA 3V5CA 1F73A 3BAXA 3ITXA 2HNHA 2XZ7A 5JBDA 1S2TA 3I68A 1LG1A 4TIMA 2V3FA 1E0UA 1JR1A 4DJDD 5HWNA 2OOFA 4RV8A 1LBFA 4EK7A 4D2JA 3G3MA 4QQUA 4L6OA 1K77A 4LB4A 4ORIA 1NFGA 5DCBA 3S47A 4EE9A 3IAQA 3FYOA 5JIPA 1FWFC 1Q6LA 3USBA 4LWWA 4H6EA 4RXGA 5B80A 2FDMA 4LAZA 4RV3A 1TB3A 7TIMA 3EOOA 3W6YA 5JBEA 1UC5A 3P93A 1XP3A 4ZOBA 1TVNA 3GS6A 3CZEA 4UFHA 5FJRA 4ORMA 4W7VA 1UUOA 4W85A 3MUY1 3OOQA 2V8ZA 2QCCA 3HJEA 1QNPA 4RE2A 4FF7A 3QQ1A 4NYUA 1XGEA 1EX1A 4FEZA 4O12A 1EOMA 1KFKA 3G0SA 3GG0A 3MBDA 2XIQA 3TMQA 5E9XA 3E0IA 3NVDA 4I7WA 2YFNA 3PG9A 3WLHA 4DM2A 3MSGA 5EY5A 3PY2A 3U2ZA 1DJGA 4I9AA 4AVOA 4W5ZA 3USZA 4GC3A 1YXDA 3GHRA 2IPWA 3MKKA 3I4EA 2BMBA 3COTA 5I3KA 1DTUA 3GTFA 2GJXB 3R89A 3LCHA 1AJZA 4Z1DA 1OWQA 5E6ZA 5BXPA 2UY5A 4J35A 4NJIA 1O6IA 3A4JA 1KFEA 1UWUA 3RK8A 1K9EA 3UGRA 4ERAA 1KC7A 3KW3A 3SN0A 2Z1XA 3RN6A 1OX5A 3URNA 1HJVA 3DG3A 1EF2A 2VFFA 4A22A 1YPFA 1VZWA 2FKPA 1RPXA 1CT5A 1JIBA 1W5MA 4F66A 9RUBA 1LBMA 3L65A 3CUJA 2REQA 1Q45A 1I0BA 4Y9AA 1DXFA 1Q6OA 1MWOA 1QCWA 2HBVA 1LZOA 2YXGA 4CQAA 1KM1A 3F4NA 1GOWA 4K8GA 4IJCA 4H2HA 3BLIA 2YCEA 3GUWA 1K7FA 4IMEA 1RLCL 5C70A 4XSLA 5HK4A 3CUHA 3VD5A 1JCLA 1IIHA 2RGMA 3I6EA 1R47A 3TK7A 5ABFB 2WMFA 5LXEA 3M16A 1PZ2A 2A7PA 3LMZA 2DH3A 5HQLA 3DH7A 4RZ4A 4GH1A 3AXIA 1VEPA 1EDTA 1CXIA 1GG0A 2CBVA 3S6DA 1LRTA 1HP5A 4O0ZA 3TYUA 1YNPA 1W1ZA 2QR6A 4DVOA 1Z7AA 2PD9A 1LRQA 3F4DA 1OYAA 3GDKA 1CCWB 4GKTA 2FVLA 4IL2A 1MW3A 3LBOA 4A3UA 3HGRA 1RVKA 4XTIA 3GVRA 4MFEA 4E2DA 4MZYA 2YKKA 3ONCA 5REQB 4UQAA 1NP0A 2VQTA 4CU8A 2QZRA 3ZQ9A 3LXBA 1IXOA 4HU8A 1EGVA 2JIWA 3B8TA 4JNYA 4MJMA 3SGZA 5F2GA 4J3WA 4UIOA 2PZNA 4GACA 1GZGA 1VPQA 5A94A 5FESA 4YCPA 3VMPA 2CFFA 4GISA 1VEOA 3ELFA 3ARXA 5D30A 4GH3A 3BSGA 4EKJA 4IFKA 4DBSA 3L21A 1L6FA 3QKZA 1CTNA 3MMUA 4YJ5A 3F4WA 2F2KA 2VUNA 4QCEA 4DI8A 1LUCB 4D6JA 3BK0A 2C3ZA 2Z2AA 1W1IE 3DHPA 4DIAA 1TTIA 4PFMA 5EYWA 4BHYA 3H7RA 3RM4A 3DECA 4L4MA 4NIRA 2BVYA 2B7OA 4EPEC 1Q2SA 1G7UA 5H8UA 2J47A 3OLEA 2ZTJA 5K9CA 2NXGA 4ZVJA 2X05A 1CGWA 5CGMA 1UWSA 1L6YA 1RQEA 4LTSA 2ZZ5A 3UXAA 5EFDA 3GW3A 4PCSA 3AHXA 4ENLA 1JCNA 5BMWA 4HD5A 2ZVIA 4IISA 1EPXA 2ZX9A 4R27A 3O63A 4XBSA 1OFDA 4FLOA 3N2OA 1JQXA 2GGJA 2WSRA 3B8UA 4GWEA 1Y5VA 4MY1A 3W6MA 2PRMA 1FWSA 2BLEA 4M7SA 1EYEA 3GVVA 1CX9A 2XSXA 1TV3A 4ZSUA 5AC5A 4CNUA 2R8WA 2VEIA 3NYZA 4Z2GA 1VENA 4DWDA 1DWGM 3WJWA 3MVIA 1VJZA 4FNPA 3VK5A 1T7LA 5C7HA 3GTHA 4N6EA 1PSCA 1Q6FA 3LI1A 1WXZA 3KOWA 1X7FA 4DN1A 4E3TA 2QCFA 5HUPA 1PIGA 3IRDA 4JN8A 4U33A 1OCNA 4XO6A 1X6LA 1BSLA 3QTGA 3ABQA 4MY9A 4NI3A 1Z8AA 3IV8A 4CUCA 4A6GA 6A3HA 1OF6A 2E77A 2QJGA 2QJMA 2Z2UA 5I00A 1WAWA 1XH0A 2GWGA 4B5SA 1UASA 1DWAM 2FHBA 3SCUA 5I3IA 1J18A 2VT0A 1EZ2A 3BOFA 1EZWA 4XAFA 3U5YA 3GH5A 3EZ4A 4LC6A 4O1BA 3WLTA 2YDAA 1I2OA 5HPCA 1JZ8A 3F2CA 1TPB1 1UR8A 1UKOA 1R2TA 2J4GA 1V5XA 2J9ZA 1M01A 3PM6A 1M53A 4LCSA 1W0MA 4JS3A 1QOXA 2X1TA 3SCPA 5C2XA 1BHGA 1W9UA 2E09A 2DEPA 1A80A 3DFQA 2G0WA 2ATMA 1W5QA 3U3HA 3EDDA 4WF7A 3ZSTA 1WPCA 3UF9A 1V6WA 2JKAA 4PGLA 5CKSA 2FFCA 2ZRYA 3BGGA 2HPMA 3N17A 3N34A 3BLKA 2WKLA 4Z1CA 1TA3B 1TRIA 1TREA 5AYIA 1FWJC 2CU0A 3DHUA 3VUSA 1EBGA 3O2LA 4IIEA 2YCLB 3BC9A 4E8GA 5ABTA 4PMDA 5D8ZA 1YPIA 1R87A 3B9NA 4HA4A 3VCNA 3GR4A 3MJMA 2NX9A 4C6CA 3FXYA 4PE8A 1J0JA 4PBFA 3TTEA 2WJFA 2RDWA 4PEEA 4BCEA 2WYSA 1PVNA 1IEXA 2HJPA 2DIKA 2YYTA 1E6ZA 4YTSA 2JQXA 5CBBA 4OHQA 1XIEA 5CH9A 3ARYA 1AH0A 3AAMA 1B1YA 1QASA 3CU2A 2DU2A 5D02A 2YL9A 3N6HA 5AFDA 1PAMA 1YIXA 5HR6A 4RNFA 1K9TA 3WLPA 1QW8A 5FEXA 4ZL1A 4ATWA 1GW9A 2DSZA 4HTYA 3L0KA 4WDUA 2ZIDA 2XGBA 5C54A 1W9BM 2O92A 4AZCB 3UCQA 3E12A 1QR7A 4QBXA 4I5UA 3T0AA 4X60A 1P48A 2PDIA 3M41A 2FJKA 2CETA 1W5OA 1XIHA 2UY4A 3A22A 4Q8TA 3P67A 2OEMA 4WK9A 2B7PA 1WKDA 1VD6A 4GQ0A 4KS0A 2XVLA 1SO5A 3S5ZA 7REQB 4KEMA 3BOLA 1WZKA 4Z17A 2ISSA 2VEPA 3VIIA 4S3AA 1CGVA 1HO1A 1UQYA 1ZP3A 4MWAD 1JPKA 3E02A 3I7RA 4RUBA 7ENLA 5C8BB 3KTSA 1RHCA 4BI7A 4D71A 4X22A 1QHOA 3CT2A 4Q22A 3RG6A 1FWDC 4Q8NA 3KTCA 3A3XA 1R30A 2V5BA 3ANUA 4P8XA 3ECQA 4XD6A 4DUVA 3AMCA 3TJ4A 4LH8A 1U5JA 2BOGX 1UWTA 1FWRA 1E4IA 4EX4A 4KCVA 3VNMA 2MUCA 3OVPA 2YYUA 2C8NA 4O54A 1GOMA 1GPWA 3NNTA 4ZA0A 4PODA 1CEOA 4AW7A 2H8XA 4LJ3A 4Q7NA 1NIUA 2BXZA 1E9ZB 1V3IA 4AAJA 2BOFX 1BG4A 1NM9A 1WOBA 4LC8A 2ATSA 4B90A 4M24A 3DU0A 1BYAA 2PWEA 1OZQA 3IJIA 1VKFA 1BVNP 3C56A 2GL5A 1E1CA 3MSDA 2PEVA 2VCBA 5CEWA 2GZXA 2D3NA 3LXAA 3PB0A 3TXZA 4IP4A 1FOBA 5IDZA 3CTTA 5D04C 1PB0A 3VD4A 3Q2DA 3OG3A 2FZ8A 2BODX 1DP0A 2A3CA 3LRKA 4JL1A 1F3WA 4CD8A 3EDKA 3DHDA 4G1KA 5LKYA 3W7CA 4QS6A 4A05A 1V6XA 2WZEA 4ZBCA 1OFRA 3SGUA 2IPGA 4QP0A 3WO8A 4C5YA 4IQDA 1G0CA 4WKHA 1B4KA 1LJYA 3SFKA 5HNUA 4FXSA 1UJQA 2CC0A 2X2GA 1RLDA 4QSFA 4UMAA 4UOQA 1G4SA 2IXVA 5J04A 1S5TA 4ZB5A 4TVCA 1SFTA 1TIMA 2VVNA 3ALFA 1QPNA 4L9ZA 1VFFA 3OIXA 3A21A 4CQCA 3ZVHB 5MKGA 1GQNA 1JFXA 4PUMA 3OHIA 3W73A 3RX4A 1KNWA 5G2WA 4YPJA 4F40A 2P1FA 3VD7A 3LS9A 2A7NA 4REQA 2OWXA 3UP8A 1ONEA 4LRSA 1N8WA 3UJ2A 3TAKA 4LAKA 4WQ6A 4C5ZA 3GVWA 3B9OA 2QDEA 1EA0A 4WLCA 2QCMA 3AS1A 1QU4A 3B04A 3LUTA 1L0PA 2Y5EA 3MZNA 4L9XA 4NUWA 3FEQA 1U22A 4KIEA 3NEVA 1T40A 3QGAC 1EYWA 2CHNA 4IMGA 4AD4A 2ALRA 3P62A 1TKKA 2Q8ZA 1WXJA 2WLYA 4DNMA 1X7IA 1XIBA 1JCXA 5I23A 1GONA 4DNHA 3CO8A 1GOXA 1VHNA 3I4KA 2C0HA 2QUNA 3HURA 1XLAA 5DBTA 1SSDA 4JQ2A 1U1HA 4Z42C 4KH2A 1Q66A 1Q5MA 3C2FA 1RR2A 4DAFA 2AL2B 2A85A 4IJRA 2CLIA 4GCXA 1EUNA 3PBGA 4CGTA 2W3ZA 1H5VA 3EMCA 5AYZA 5A6JA 3ZM8A 3E5PA 4LB3A 1QO2A 3GW0A 1UQZA 4WGHA 5JBFA 1EC8A 1LG2A 3AIQA 1AD1A 3WMCA 2Y5JA 1F61A 2J25A 4E4UA 4BEUA 3QMRA 3TN3A 3SECA 3CPUA 2HVNA 2GK1A 5TIMA 1LT8A 3TC6A 3V3WA 1HP4A 5G1YA 1EXBA 2DSWA 1V0MA 1NSJA 4PCPA 2PWUA 2CIPA 1VB9A 3QYQA 3G1SA 4FK9A 4NP7A 3B8VA 1XBYA 3ATZA 4WKAA 5SWUA 1KCXA 3QFEA 3VU2A 5DELA 2D23A 2EAWA 1P6WA 1IXNA 4CVUA 4RE4A 3P7YA 1KGUA 2NX3A 2OO0A 3VNKA 5K7JA 4JTJA 1D3HA 3EWXA 1A53A 3VZYA 1L6WA 1OGBA 3C3NA 4BQ2A 1MUCA 1I4NA 1GPFA 3MC5A 3V1HA 1ZGDA 4HHMA 4WOZA 4EACA 3RRXA 2VD9A 1AUSL 4F0LA 4XZLX 3TC7A 1WZAA 1VPXA 2HZGA 1NFPA 4GC4A 3UZXA 4K7YA 1K7EA 2BGQA 3CK5A 1EO5A 2Q01A 2J62A 1PX3A 4NVTA 3WF4A 3B9DA 1PIIA 2VL4A 1E1FA 3GYEA 2GGIA 3R13A 3LM3A 3PTMA 4UTWC 3W53A 1O5XA 3SUVA 3CYVA 3DX5A 3DFNA 5B7YA 2Q8LA 1TCMA 1J0YA 1D3CA 4ZQCA 4I8DA 3SRKA 2HVMA 1QI2A 3R4IA 3ZO9A 4HHPA 3K4DA 3AMKA 3R0DA 3WDQA 1MQPA 1YE6A 4C1NA 2CXGA 3W7JA 4C6IA 3QPYA 4JTTA 2QCDB 1HKVA 4PUJA 3WLIA 3GY1A 3UXLA 5D32A 1U1UA 1D7KA 1PBGA 1HJXA 1XQLA 3L4YA 2D3LA 1W1VA 3W23A 5C9ZA 3WNOA 1HKIA 4IPIA 4BS0A 1KWGA 1QXLA 4D72A 1L9WA 1TTPA 4AH7A 4HBKA 4LYRA 4WDXA 1HG3A 4FHAA 4JFTA 4O0QA 3BVJA 4JTHA 3IIZA 1MEHA 3GC2A 1NDWA 5CXPA 1CNVA 1J5SA 4UQ9A 1A5SA 2OU4A 3L2IA 5I3HA 1XISA 4FF5A 3BW4A 2WB5A 1A5UA 1VBJA 1L6SA 1FHVA 2YBUA 4XKYB 3WELA 2VRKA 3B40A 3PZVA 4DWSB 1BG9A 4AZGA 4H7VA 1R3VA 4PUKA 3W4RA 4S3DA 3WD3A 1PKMA 2EHHA 1FA2A 2VMFA 1VJIA 4US5D 4MPKA 1GVFA 1Z32X 4AVFA 1DJQA 1P43A 3NOYA 1S1RA 2X42A 4XUGA 1M7OA 2V3GA 1DVJA 5DT5A 4A29A 3DFOA 2WSYA 5M03A 5FEZA 5A69A 3EPOA 4J4KA 4J3SA 3AZSA 3CV6A 2VGGA 4ZZ9A 4NJJA 4QM1A 2H6RA 4GZJA 1ITXA 4PH6A 1XLIA 4GXMA 2NWSA 1M65A 3CXOA 3FV9A 3KE0A 3TFCA 1V7AA 3LTSA 1G01A 5LNUA 2IW0A 2JIEA 3LCIA 2Y8UA 4QNWA 2HMCA 1W17A 5CJNA 4B5NA 4IIFA 1QHZA 2PGEA 2WHMA 3DKLA 1TMHA 3GG1A 1S2WA 1F6PA 5D03A 5CG7A 2W66A 1NEYA 3MP3A 1Q7ZA 4OV4A 2DZTA 4C6EA 2WC7A 4H41A 4P7LA 1RA0A 1UR4A 1XCWA 2YXXA 1UKTA 2WWDA 4MB4A 1QNQA 4LPCA 3T8QA 1GOOA 3G2GA 1BPLB 3VTRA 4B9ZA 2X1RA 4AF0B 5KITA 2NWRA 1HQTA 3EWZA 4PULA 3TAOA 3QC0A 3TFXA 4AEEA 1X97A 1PEZA 4DLFA 3W70A 3NQEA 3RLUA 5BOOA 1ZL1A 1JNEA 3T81A 4ERGA 3ZIZA 5K2ZA 3LHWA 2YCIX 3EBVA 4AEFA 5CLWA 3AROA 4F2TA 1I45A 2TODA 1E71M 4YYCA 5M5DA 1S38A 2FPVA 3VOGA 1UWRA 2NXHA 4H9MA 5LIWX 1C90A 1XX1A 5K3VA 1EJWC 1M9HA 1V08A 3N4FA 4DYJA 4DF1A 1WDPA 2VNCA 4D8ZA 2CZVA 4EANA 4ES4A 8RUCA 2HPIA 3K8MA 3NYDA 4QR6A 3C5QA 1QWGA 4DRSA 4JCLA 1VPYA 3QQWA 5ABEA 1ZBKA 3WMLA 3M0MA 4ERIA 4DYKA 1FBAA 4JFUA 4C91A 2QPXA 1F2JA 4U10A 5AHFA 1JDFA 1BXBA 1ENUA 3DI0A 1KR0A 4DBDA 4G1NA 4WY0A 7CGTA 4NG3A 3S1VA 1PYMA 4LQ1A 1MZRA 2V67A 2QHAA 3APGA 4IP7A 1B9BA 2J8TA 4C90A 3PZOA 4JEQA 1XKYA 2DPEA 4AIUA 3NO3A 5AECA 4QHRA 1NWSA 3R6IA 4IGNA 1VFMA 3M1ZA 2QPUA 2I16A 4J27A 3CASA 3IVTA 4JPGA 1PO9A 2V5CA 2HS6A 3V18A 2BGSA 1KFBA 4UTKA 1O7AA 2OODA 4HU4A 4FPSA 3WIJA 3MQTA 1Q85A 1PJ9A 4XZBA 2P3ZA 2C1IA 4OBTA 2BZNA 3SCWA 3N2MA 3AUJA 4MKSA 4IXXA 4MNLA 3D0CA 5A2BA 3NZ1A 1EP1A 4MOZA 1RY8A 2XGIA 4GFSA 1CGYA 2EF9A 4DXXA 2FQIA 3Q94A 4M51A 3BXWA 3GKAA 5HJXA 1P1XA 5HA7A 4XZNX 5CAHA 4IHCA 2HE8A 4HK6A 1R0MA 1QOPA 3H8AA 3N1AA 1YRRA 1UJPA 1K8CA 4YWIA 1ZP4A 2G41A 4PMQA 2O9TA 2ZUVA 4GQBA 1QPRA 3IAPA 1ONXA 3AS2A 3D3FA 1J0HA 1SR9A 5FACA 1ISYA 2GQAA 1F8IA 1ZBCA 5FOOA 1WB0A 2IQ0A 2VJXA 2WCSA 3FNDA 1UROA 2WXDM 3P5YA 4HZ7A 4RDVA 2PURA 3UYCA 3A9IA 5BCAA 5K4XA 3TIMA 2KZHA 1KM6A 4DZ5A 1K6WA 3W00A 1H4PA 1O1ZA 4QQ3A 3BW3A 3P61A 3PAJA 3S1UA 1W3NA 4MDOA 1UBSA 1E9YB 3M6DA 1VS1A 2V3DA 3UW6A 4PEKA 5BMXA 2FYMA 3ZXWA 5LXXA 4GIYA 3NPWA 2V2HA 3CZ8A 3W74A 2I14A 1GOKA 3TVAA 2J7FA 3MDUA 2XZ9A 4KFNA 3CB8A 2OFJA 4R33A 3MY9A 3UWVA 3INPA 3DFTA 3PTDA 2HV5A 1XSKA 3LN3A 2Q3OA 3BLFA 5CZKA 1T41A 1OYCA 2RUSA 3BTNA 3F03K 4UQEA 1IR1A 4PMJA 3N4AA 3TYAA 3GE7A 2WANA 4HPNA 3OZOA 4O17A 1H7PA 2NQLA 4B16A 4QFUA 4DJEA 2PSNA 3HPZA 5DANA 3TW7A 4G9PA 3VNLA 3UESA 4U2YA 3EKLA 1RQHA 4X2PA 3B03A 1QJWA 1XINA 2XIIA 1KBLA 1IWBA 5DXXA 3TWAA 2QPSA 3PUGA 2V68A 4MZ8A 3S5SA 4A8LA 1JDEA 4V1XA 4WXZA 3TYBA 3VYLA 5DRIA 1W9PA 4H2CA 4FMVA 4P7NA 3W0KA 2FHFA 3ARSA 3TC3A 4OWGA 4Y8EA 4MUPA 3WJYA 1C7SA 1GG1A 1B31A 3BW2A 3L4XA 3SN4A 4TMCA 4IQLA 5GPRA 1I2PA 1EF3A 1K7XA 4DJEC 3VDHA 3I10A 4F9DA 1IQ8A 1TWWA 2WMIB 3GXFA 3I3BA 3U48A 4AHPA 1DQWA 2WOQA 4C6OA 1I75A 2QV5A 2QCEA 2V5JA 1G1YA 4PTMA 1EC7A 3W84A 4C65A 1R3QA 4CNNA 3VIMA 1W2PA 5HDRA 5BYWA 2HWGA 4S3JA 5IRPA 1KTBA 1IHIA 2FTYA 4DZAA 3PFRA 3NO1A 2ZZ4A 1EJTC 3FLUA 3GR8A 3LHVA 1DJNA 1XYMA 1E9IA 1X98A 5LIXX 1ME9A 5FKYA 3M47A 2PDNA 3QW4B 4HA0A 3T4CA 4H8NA 3F4CA 1RA5A 4D6DA 1U5HA 2I17A 2PDGA 3TP4A 1FHDA 3GZ3A 4YL2A 3O3RA 2VP8A 1DXEA 1S3TC 4UFKA 1E0WA 3I7QA 1DWHM 3R10A 3SRHA 2PTYA 2JF6A 1KM0A 3BG3A 1G4EA 5L6UA 1E73M 3VX1A 4UR9A 1W5PA 4UTMA 4Q4PA 4MLJA 4Q7IA 3BGAA 3GG8A 4A3RA 1VYRA 2DGAA 2H3BA 3II1A 4I6VA 4PUEA 4UZUA 1R8LA 2E8ZA 4BK9A 1ZB5A 4NXSA 1W8SA 2R1PA 3IJ9A 4TOQA 1C3FA 3GXMA 4S3GA 3DFSA 4B5WA 3QMSA 2WM1A 3WLMA 4DJDA 5A8NA 3W1QA 2O7QA 4PYSA 3ARPA 3ZR6A 2Y62A 3CL8A 3DN5A 4KWUA 1F5ZA 3RAOA 3WH6A 3AWOA 2C18A 2ZE0A 3G3DA 5D2WA 4YTQA 5CGQA 4TTGA 4LVFA 3THCA 1Y8BA 4B4HA 5LA0A 2VR5A 3HMCA 3H2OA 1LL7A 3LYEA 3BL3A 3ZS4A 3LV6A 5I78A 2ABBA 3AZRA 3LCFA 4L9YA 3LX9A 5FF2A 3DG6A 2JGQA 4FP1A 3Q45A 4DJDC 2Z1WA 1XD1A 2GUYA 1OM0A 4PTDA 2XG9A 3W72A 1E51A 2QJHA 1KTCA 1XF0A 4PR4A 4C1LA 2PDMA 2YA0A 4LV9A 1C92A 5HWJA 3FY1A 4JYDA 4XIAA 4JXCA 1V6UA 2DH2A 1BAGA 1QT1A 2DW6A 3BPWA 2D0HA 1PX4A 1XRSA 3LM7A 4P8UA 4HGXA 4JQAA 4EWJA 2TRSA 3VOCA 4MYXA 2ZCGA 4WKFA 1TWZA 4R9OA 1BRLA 3MHUA 2J79A 1YHTA 4AYGA 1L8NA 4D1JA 3IJ6A 3TTQA 5IOBA 4RE0A 2H90A 3PZGA 1DJWA 4AXNA 3ZJ7A 5D9PA 3W7EA 1UBPC 1LWJA 4A8IA 4UTIA 1WBJA 2IMRA 1JI2A 2XDFA 4ZQRA 3TQ0A 1ECEA 2V0TA 2BV9A 1JDDA 1NF7A 5BXSA 2VEKA 4Q6JA 2CWXA 2ALDA 3ZR4A 4M5PA 4QAWA 1TFVA 3RCYA 1DWJM 4IQEA 1GKPA 1UMYA 3WLJA 1V77A 2V30A 2DZSA 4M0XA 1ZU8A 3W27A 4NASA 1REQA 3NZGA 3W37A 4EAYA 1KM3A 1LROA 1Q6GA 4XWUA 4LF2A 3W7OA 1AW1A 2Y7EA 1UD2A 3NQCA 4CQ8A 5C9WA 3JW7A 1GTEA 5DRCA 1BGAA 3W2NA 3WQEA 2WSKA 5E0KA 5E9AA 1ZY9A 4LS0A 1FKXA 3P81A 4Q8MA 5DXYA 2B0MA 3L0GA 4RE3A 1PL9A 1K02A 3OJGA 2QGYA 3BO9A 3EWUA 1MW0A 2YW4A 1A5MC 1P7TA 3OQ8A 1FWTA 1S5NA 1EA9C 3BQ6A 3LU2A 2C0AA 2GQ8A 3NXFA 1B9ZA 4RDYA 3GAKA 3PUOA 3MCMA 3UG4A 5C5YA 1IGWA 3N15A 3AXXA 1J0ZA 3W75A 1DYSA 4L5ZA 3QYSA 5A1AA 1GVYA 2GDUA 2D24A 3OLIA 2PMQA 2OGJA 5FAGA 3TE9A 3WDPP 2YB4A 2H9AB 1X96A 5FF3A 3ITTA 1W8GA 3F5LA 3OLGA 6TIMA 3M07A 1W1B1 2J27A 2W91A 2WVSA 2DDXA 1BKHA 4G8TA 4E0CA 1YX1A 3DESA 2OYKA 3EA2A 3L23A 1A5BA 3N3MA 2C15A 4PRWA 4F48A 5FL0A 3ITVA 3CHEA 1RJRA 2GOUA 2E4TA 1VJSA 3O8AA 2INEA 1KO0A 4IH3A 3GNDA 3IANA 1DQUA 2C14A 1XWYA 2QNEA 3UVAA 3QZ6A 3GO2A 3BV7A 3EX6A 4U3AA 3M44A 5D8WA 2WSQA 4MMWA 3T09A 1BFNA 4M19A 1OX4A 2CLKA 1J2BA 2TYSA 4FIRA 5C9UA 2G3FA 1GYNA 5KZEA 3QMTA 4DQWA 2Y70A 2AQOA 3UXDA 4GVGA 2GVYA 3TN4A 2QCNA 2QYGA 4GIAA 4YVPA 3RNDA 1W9XA 3E96A 4DO5A 3S2NA 4HMDA 3LRMA 3VX0A 4H4IA 3W85A 5AYBA 4ZQOA 3G0UA 1OG6A 1OB0A 3N19B 4MTVA 4UOJA 3T6CA 4IFOA 3WYZA 4AY7A 3M7WA 4FR6A 3W7QA 3VCCA 3BICA 3ITOA 3ZFHA 2C1GA 4PMNA 2NV2A 4UCGA 2FTPA 1H7WA 4YLWA 3IARA 2QUTA 3EOUA 5K9DA 2ZXDA 2O7SA 1G4TA 5CPSA 5HOSA 2HTMA 3IPWA 4LVBA 3BAYA 2ONEA 5FJOA 3EWDA 3EDFA 4L64A 5EMJA 2ZWZA 1XI3A 3VO0A 2E5CA 2GVGA 3OHMB 3HPXA 3WLOA 3KTXA 2DZWA 5G4WA 2VC7A 4AHQA 2FVKA 3GNXA 2VENA 1BEUA 2R9RA 4FNRA 3CS2A 3GKFA 5F7UA 2ZICA 3R25A 2UWFA 8XIAA 3SJNA 5T26A 3O0FA 3C2YA 8XIMA 3ITGA 2ZXBA 2EGZA 2VGFA 3NAVA 2OQLA 2KAUC 3W25A 4B3LA 5C7VA 2PDKA 2QVHA 2XN2A 1DIOA 5CLTA 4R88A 2J9YA 3DYMA 3LSBA 3DYOA 2PB1A 1C8QA 4NJKA 1MRQA 3MBFA 5BU9A 4V28A 3LHUA 3C86A 5FF0A 3F7JA 5C9RA 3T2PA 3GFYA 1U2YA 5K9XA 1FVPA 3REQA 3CZKA 2PD5A 3GR7A 3W1TA 4NAEA 5EFFA 3IJLA 2QLYA 1AD4A 2DVTA 3FAXA 4XX6A 5HMFA 2E1DA 3B8DA 3ZJ8A 2YZ5A 4OE7A 4KBXA 4EXQA 3RX3A 4E4FA 4G2DA 4BWLA 1HFBA 1AVAA 3WBAA 2V82A 4KCTA 2ZBTA 4IPJA 3N4EA 2AKMA 1LOLA 1GZ1A 1VCFA 3BG5A 3B0VC 3S1GA 3DFHA 4MAZA 3A64A 3U7VA 3EKZA 1UA3A 2XVPA 3WN6A 1V3JA 1TMQA 4JQ1A 1M7JA 2WAGA 3H2FA 3UU0A 1EPVA 1XQKA 5HQEA 3HM7A 3STEA 5AYYA 3V0UA 3D47A 2NQ5A 3W7LA 1XLKA 1R2RA 1KR1A 3DENA 2YR1A 1F3EA 1XG4A 4NY2A 4NNAA 4DJFD 1E0XA 3T9PA 4B92A 1VBUA 2WCAA 4AFYA 2Z6IA 2J8GA 3O6CA 2DZUA 2VR4A 1SW7A 3HJZA 2NT0A 3DCPA 3RU6A 2E3ZA 3HG4A 1A3WA 3UD6A 4Z0SA 1XRFA 1HVQA 4AUBA 2RDXA 3WUBA 1JZ7A 2HDJA 4LBUA 4ZXLA 4DWSD 4TX8A 3WQFA 1NOFA 3RPDA 3A23A 2QQ6A 2J7EA 4LT9A 4L4OA 1R3RA 2BB0A 8A3HA 2XFYA 4W8LA 3GIQA 2CW6A 1OT1A 1VFSA 5EB8A 4ZE5A 1GNXA 3FFSA 3A6OA 4DB7A 2AQWA 3W82A 3SRFA 4ZO7A 2ISFA 3C4UA 4UFIA 3VKAA 4MWAA 3AJXA 3LERA 4QS5A 1ISVA 3ANVA 4CNOA 1GJWA 1QO5A 2QMKA 2TSYA 1RALA 2C79A 5LNSA 5DX7A 3EEGA 3LD5A 1GEHA 2GUBA 3T55A 1A4LA 1SSGA 1O66A 1SPQA 1W3KA 1KTNA 2NLYA 3WJXA 3ABZA 4P2VA 1Q6EA 1JDCA 4GVIA 4OV9A 4PCFA 3CQ0A 2JKEA 5A6MA 1XH2A 1IEVA 2ZUSA 4FOKA 1C93A 5C0QA 4MWAC 3WDRA 2OG9A 4PSPA 1N8IA 3CWOX 4QCFA 1WBHA 3OTRA 2ZA2A 1QTWA 1K3UA 2BHYA 1P0BA 1FWEC 3E2QA 3FJ6A 3PTKA 1KFWA 3MW7A 5EU9A 1ZNNA 3OQEA 1MEWA 1UZHA 5D2TA 3LCWA 1H0IA 1FXPA 1TVPA 1F6KA 2WV8A 4U4MA 3TSDA 3NFUA 1JGIA 4QX4A 1A3HA 3QSRA 4PB3A 1RAKA 2X41A 3W7MA 7PTDA 1I2QA 3AIVA 4D1IA 4HKPA 4UMBA 2Z1VA 4LUSA 3ITCA 4JIIX 1F3TA 2I1OA 3DKJA 3LBMA 1HL9A 1FH8A 2CKRA 4I9TA 2ISWA 3MWAA 1PZ0A 3WF3A 3SEPA 6REQB 3M0XA 4W4QA 1XPGA 3WX7A 3EEZA 1LWHA 3KFTA 2GUUA 4Q6XA 5FA5A 3PZMA 1B3VA 3A4XA 2XSBA 2I57A 2LLEA 3MPGA 2W92A 4UXDA 3WMBA 4MG4A 3H4XA 5AKQA 1GGOA 1FWBC 2AGKA 1S46A 3WUEA 2BHZA 5IBXA 5F2LA 4HSNA 3PAOA 5DMLA 2GYIA 3WFAA 3T05A 4IFRA 2NVDA 2A79A 4IQJA 4WZHA 4B9YA 4D6FA 2WMJA 2ZZ3A 3KS6A 3PWIA 3BCJA 3VNZA 1BYDA 2ZX5A 3NGFA 3M9YA 2C71A 1MQQA 3V5FA 1JG9A 2WVVA 4OFCA 2PWHA 2HK1A 1ESWA 3W3OA 5LIYX 2JF7A 2NUWA 3W7NA 4JTLA 1ZLPA 2UZ9A 4YVXA 4R85A 4ZO6A 3OIHA 1E55A 3BE7A 4MKVA 3QJAA 1BWKA 3FGCA 3VGFA 3FSUA 1B3WA 1J10A 2OLHA 1I1XA 4UUIA 3ZT6A 3A9BA 4XD5A 4K6AA 3B3DA 3P14A 2GQ3A 3W7PA 2YL8A 4Q3MA 4BZYA 4OIFA 4KPLA 3CB3A 1G69A 1XYAA 2GVJA 1AMKA 4A35A 2O56A 2Z26A 2ZFAA 2VGBA 1THFD 3PJUA 4UQBA 1EBHA 1VRDA 4QLLA 3V36A 1PWMA 1LYXA 1JRBA 1MFUA 4HHLA 2Z0IA 5AHNA 3M0VA 1NDYA 3MV11 3GVQA 5AC7A 1CLXA 1FDYA 4HB7A 1F76A 4X2RA 1KM5A 1NWUA 3AIRA 4ZB2A 2OEJA 4S2CA 4IJBA 3R79A 4ROPA 1Q4NX 1KM2A 2VC5A 5CJ5A 4JIHA 6XIMA 3O7UA 3IIXA 3FVMA 4K68A 4H01A 5AZ0A 4A3YA 1ZJIA 2BS9A 2VURA 1E43A 2AGTA 3GHTA 2GGGA 4DUWA 3TA6A 4OTKA 2VOMA 3IUDA 3NPXA 2WW5A 2OPJA 5LHFA 3N9SA 1P0DA 1E3ZA 1OABA 1EDQA 2RGLA 4AC1X 3PC0A 3KVJA 4GINA 2WQPA 2QW5A 3IJ7A 1J5TA 4O14A 3TLQA 3FCPA 5I06A 4PSRA 1A0CA 4J5NA 1SGJA 1TR9A 1A5NC 2C16A 1H49A 1AQFA 5D9NA 4GO8A 2A3AA 4INFA 1V02A 5IHSA 2IXUA 6TAAA 3D6NA 2ZX8A 3UJRA 2ZQ0A 5BOFA 2QCLA 1Z41A 3N6QA 3S1WA 3R8HA 3EPMA 1W3HA 3WDJA 3PVFA 1QNRA 3GM8A 3R43A 1JZ4A 3NQGA 1H1ZA 1KWKA 3B0UX 1WA3A 3TQVA 2C7FA 1TO3A 3R2GA 1DWIM 3W7KA 1OQFA 4F0HA 1ZAJA 4DXKA 1E6NA 5XIAA 5T9BG 1EO7A 3LK6A 1P6BA 2Z25A 3E38A 2CYGA 4JN6A 1J0IA 3OP2A 4GE8A 4HNLA 5IM51 3OVGA 4LUJA 1TYGA 4JTGA 4PTVA 3FOKA 5LSMA 3VINA 3EB4A 3DUGA 4M6UA 3SDOA 3GDLA 1DBTA 2ZTKA 2WM0A 3VMNA 2FTWA 2O0TA 3NOEA 3WH5A 1BWLA 5CZ0A 1QPQA 5LIKX 3TLLA 3UETA 5FF7A 2PDXA 4ML9A 3URBA 4WEVX 4PFHA 1BF6A 4Y9NA 3C2EA 3KUMA 3HIJA 4R9XA 3T2OA 2Q02A 4PC8A 1XYLA 1A5KC 3TZFA 4Q32A 1UH3A 3EWYA 1TUFA 3G0XA 5I3JA 4M6VA 2VM8A 1JCYA 1M03A 4XG1A 4US5A 3S2JA 1MW1A 4UOZA 3CHCA 3UZ5A 5FF4A 3HQNA 2A6LA 4I6KA 1I0DA 1V0NA 2ZXQA 4NJHA 3F4VA 2DVXA 3UPWA 1UZ4A 1FWWA 4HA1A 1KRCC 4F2UA 1K4HA 4ZGYA 1Z3NA 3AALA 2X1IA 3IVUA 4HNUA 4GG9A 1T8XA 2WLZA 2PP0A 5EMKA 1W3LA 1VIWA 2BHUA 1F74A 4GCAA 1QNVA 1ISZA 3VCRA 1UWIA 1QI3A 2QDDA 4JHOA 1S3HA 4C1KA 3S6TA 5EMMA 1QNOA 2CZ5A 3GNNA 1X38A 2CHOA 4DZIA 1DIDA 1W3JA 1X1OA 4ICNA 4GJJA 2MNRA 4FXJA 1GWJA 4ECLA 4Y2WA 2WHKA 3VM5A 5G5IA 1LF1A 4MLRA 3PPFA 1O95A 2DUXA 1GQKA 3NL6A 2XIMA 3GU2A 5A8GA 4CD5A 3ITYA 4LUIA 4O4VA 3BAJA 1Y7VA 4B5XA 3SUWA 2NQZA 5CPMA 3EOSA 3CO4A 1FDZA 5A8QA 5AHMA 1HKJA 1QVBA 5DMMA 4O11A 4AIBA 3WD4A 3NL3A 2BG5A 4IMCA 1UR3M 4C7FA 4XUYA 4LOCA 1W9DM 1TIWA 1SZEA 4KGLA 3TA9A 3W87A 1XV8A 1YPXA 2DT2A 5TF0A 1A49A 1ZENA 3G1AA 3E5BA 1TZ7A 1TRDA 4NZ3A 1PKNA 3AHVA 5A6KA 3AXKA 4IM4A 2ISVA 2DQXA 1AW5A 4RW5A 4O16A 4H7ZA 1Q65A 3N2XA 1B54A 1K8ZA 3RO8A 4J1OA 4D8AA 3HV9A 4G5DA 5HR7A 5GJNA 1SZFA 5EMYA 1KFLA 3NIYA 1C91A 1SW0A 1V7YA 1N55A 5FSDC 1W32A 2NVAA 4B5UA 9XIAA 1H7NA 2OLSA 1RK5A 5C2CA 3PBVA 3V4BA 2PTXA 1H1YA 4KGJA 4GBDA 3AYRA 3OLDA 3W1MA 1HKMA 3IGHX 1KQYA 2R1LA 4DO4A 1POKA 4W86A 2GJXA 4BI5A 3TTYA 5JU6A 3SBFA 2CERA 4UZSA 2VX6A 1WP6A 3VKKA 1RH9A 3O05A 3R0KA 3MI2A 3W22A 4KWWA 1FP9A 1V4YA 3PWAA 4GJ1A 2OSYA 3RU8X 2EG6A 3CC1A 2PDYA 2VZUA 3T7VA 3QPZA 5IFTA 4RDZA 2HISA 2F6UA 1P0KA 2XFFA 4URIA 1ITCA 4GYKA 2OKTA 4LUTA 3GYCA 1JF5A 1EOKA 2W5FA 1RQBA 4UTJA 4FX7A 4HPXA 2FIQA 2BY3A 4JGDA 2F7FA 3UBPC 5AVNA 3G6LA 2IKIA 2WKGA 2ZZ1A 2E6FA 3L66A 4HYWA 3H4WA 5FSEC 3MB9A 1S2CA 1JL8A 5E70A 3NZRA 5CGTA 4G7EA 3RIKA 3OODA 4F9JA 1OC5A 5ABFA 1BRLB 1EP3A 1OYBA 4US6A 3V35A 2OX1A 4GX9A 5I07A 3EOEA 2WWCA 4P61A 3BCFA 4ZOCA 1N2VA 4TVDA 3LCGA 1XHGA 1A0EA 3TH6A 2HROA 4E8DA 1EIXA 3CAKA 2NXIA 1SUXA 1BSIA 3GLCA 2EKCA 5FEPA 1CZ1A 3F2BA 5LGXA 3ENLA 4JR5A 3SW6A 5M3WA 1Y5XA 2PBOA 1ZBVA 3AU2A 2VRQA 1UG6A 2AMGA 5BWFA 4I8YA 3I6RA 3K1GA 5CBJA 3BQ5A 4AXKA 4MY8A 3SJ3A 4IUOA 3NM1A 1W31A 1REQB 4HT3A 4OVXA 5EA9A 4MJZA 2WHJA 2CLMA 5GNZA 3GXTA 2OTDA 3MP4A 4UMCA 2HS8A 2G95A 3STPA 3W07A 3R8RA 3UQNA 3FDKA 5F4WA 3KAOA 2J78A 1EEXA 1LM1A 2QAFA 4JEJA 3T44A 3LSCA 1EP2A 4PUWA 9CGTA 1WZLA 1XYFA 4EPKA 2ZA1A 4ATDA 4XAGA 2XWEA 1OD8A 1BWVA 2EG7A 4KWVA 4DBEA 2Q3RA 2Y1HA 4PRRA 4QDWA 4GZIA 4NHVA 1L2QA 3UCCA 1LUCA 5TAOA 3ZJ6A 2A7RA 3LBCA 1FX6A 3AQUA 1KKOA 4QGCA 3P0WA 2WKJA 4I7UA 1G94A 4AZHA 6XIAA 1K8XA 3NZQA 1XG3A 1NQ6A 3SURA 1TCDA 2D0GA 3T07A 4ZOEA 3PZUA 2PUZA 3A3WA 5HAOA 4HOZA 4MADA 4GO9A 4EIVA 2DUZA 1L6GA 3B06A 1TPVA 2F8QA 3NTYA 3N14A 3N73A 2O9RA 1XLBA 2BNJA 4BF5A 3E3HA 1NQKA 5BXRA 1E40A 1XIMA 1X6UA 2HK0A 3LQLA 3N11A 2PCQA 2VD8A 1EJ7L 3UR7A 1X1ZA 3PPGA 3K4WA 1TG7A 3WBWA 4L7ZA 1UP0A 3TCEA 3KS5A 3B0XA 4XBKA 1KBIA 1WDWA 4HZMA 3FA5A 1J11A 3UJEA 1WQ5A 3W1AA 4YN5A 4H6KA 1YDYA 1EFZA 2D0FA 2XVNA 5EBAA 4TO8A 3SUSA 1S5VA 5FEWA 1KBJA 5BNKA 3L7RA 3K46A 4C6QA 4C6LA 3N29A 3PZQA 1OIFA 3DDMA 2A1YA 2BP1A 4ML4A 1XBXA 4BKNA 4AHOA 3WK0A 4QNEA 1SMDA 1RK6A 3PG8A 4XZ9A 4CQDA 1KV5A 4P8VA 2GGEA 3VGEA 1DTNA 4PTWA 4AZIA 4X9YA 1BVWA 3L2LA 1ICQA 2BX7A 5I79A 2WC3A 1W1TA 3BMVA 3FEMA 2ACSA 5LYRA 4NZFA 2HNEA 4P7QA 4PB4A 1UW9A 4GYPC 3FIGA 2BVTA 5T9CE 4KMQA 1HNYA 3PZTA 2ZVRA 5D4YA 4Q4KA 2G3JA 4Q8VA 1DE5A 2VWSA 3EA3A 3VABA 2ANUA 1RXOB 4KESA 5HBFA 2CZFA 4AISA 4QIUA 3SRDA 4HPGA 4UCFA 1UZ1A 4HNVA 4QROA 4JTUA