3BDKA

Crystal structure of streptococcus suis mannonate dehydratase complexed with substrate analogue
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
363
structure length
349
Chain Sequence
SHMKMSFRWYGKKDPVTLEEIKAIPGMQGIVTAVYDVPVGQAWPLENILELKKMVEEAGLEITVIESIPVHEDIKQGKPNRDALIENYKTSIRNVGAAGIPVVCYNFMPVFDWTRSDLHHPLPDGSTSLAFLKSDLAGVDPSKEEMKAIIENYRQNISEEDLWANLEYFIKAILPTAEEAGVKMAIHPDDPPYGIFGLPRIITGQEAVERFLNLYDSEHNGITMCVGSYASDPKNDVLAMTEYALKRNRINFMHTRNVTAGAWGFQETAHLSQAGDIDMNAVVKLLVDYDWQGSLRPDHGRRIWGDQTKTPGYGLYDRALGATYFNGLYEANMRAAGKTPDFGIKAKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Streptococcus suis mannonate dehydratase complexed with substrate analogue
rcsb
source organism Streptococcus suis
molecule tags Lyase
molecule keywords D-mannonate dehydratase
total genus 108
structure length 349
sequence length 363
chains with identical sequence B
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2007-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03786 UxuA D-mannonate dehydratase (UxuA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3bdkA00
3M0MA 3VNJA 3DX5A 6XIAA 1XLMA 3KBSA 3M0XA 4ZB0A 9XIMA 5EMMA 1XLBA 5H6HA 1OADA 1MUWA 3KBNA 1DIEA 1XYMA 2QW5A 3FVMA 1XLEA 1XIMA 2G0WA 3M0VA 3UU0A 1DXIA 3CQKA 3UA4A 4ZB2A 1XIIA 3C0QA 3ITLA 4QDWA 4HGXA 3L23A 4YTRA 4GLEA 3ITOA 3KBVA 1I6NA 4X61A 1XIEA 3CWHA 2Q02A 2QUMA 3NGFA 5XINA 8XIAA 4HNOA 4ZB5A 4K1GA 1D8WA 2X7WA 1XIFA 6XIMA 2NQHA 2XIMA 3AYVA 2ZDSA 8XIMA 5EMKA 3U3HA 1YX1A 3ITVA 1XISA 4YTUA 1A0CA 2ZVRA 5EMJA 2X7VA 3OBEA 3M0HA 3U0HA 4XIAA 2NQJA 1XLFA 1I60A 4A8RA 1K77A 3CQHA 5AVNA 5J8LA 3ITTA 1XLJA 4QDPA 1XIHA 4HHMA 4K3ZA 3CQJA 5B7ZA 3KTCA 1CLKA 1DE5A 3KCLA 5B7YA 1XIBA 4X60A 1XLDA 4LNCA 7XIMA 1DIDA 1XP3A 4XKMA 3LMZA 4QE5A 3C0LA 4X63A 3KBMA 2XINA 4J4KA 4A8IA 3N4AA 3WQOA 3UA3A 3AAMA 2HK1A 2HCVA 2GYIA 3ITXA 1XLKA 3VYLA 2I56A 1XICA 4HHLA 2GUBA 4DUOA 1XIGA 5C9ZA 3BANA 2I57A 3P6LA 4GJIA 3BDKA 3IUHA 1XLHA 4GQBA 1XYBA 3GNXA 3M0YA 1XYLA 4E3VA 4QE4A 4XIMA 1O1HA 1XYAA 3TC3A 4G56A 5FA5A 4YTTA 3VNLA 1A0DA 4XSMA 1S5MA 3BWWA 3QZAA 3KBJA 9XIAA 2QUNA 5H1WA 3VNMA 3DBNA 3CNYA 2NQ9A 1XYCA 4Q7IA 3VNIA 4A8NA 4OVXA 4PFHA 1XLGA 4QEHA 5XIAA 1XLCA 2OU4A 3IUDA 4QE1A 5EMLA 4GJJA 3QXBA 4XSLA 3TVAA 3KCOA 4QEEA 4YTQA 2GVEA 1XLAA 3BZGA 3KWSA 3M0LA 1XIDA 2XISA 3C0SA 3QC0A 1GW9A 5AVHA 3AALA 5B80A 1XIJA 1BXCA 3IUIA 4ZBCA 3BZJA 3VNKA 1QT1A 2J6VA 4W4QA 3P14A 1XINA 1XLIA 1BXBA 3XINA 4YTSA 4EAYA 2GLKA 2G4JA 1QUMA 3AYTA 3KCJA 1DE6A 4EACA 3ITYA 5TNVA 5XIMA 4DVOA 1A0EA 5I7GA 2HK0A 3JU2A 3QYSA 4PGLA 3UXIA 4US6A 1QTWA 4KW2A 3KBWA 3XIMA 1XLLA 1S5NA 1MNZA 3UVAA 1TZ9A 2QULA 4XISA 4A8LA 3XISA 3CQIA
chains in the Genus database with same CATH superfamily
4AIUA 4G1NA 3N17A 2NSOA 4Z1AA 3OZOA 1SMAA 4HMEA 1ZGDA 1BG4A 4LVAA 2CPUA 1K03A 3VGEA 3UW6A 2Y5EA 2ZC8A 1IWBA 2NXIA 2YCIX 3L4UA 1OK4A 2CERA 5D2TA 3W26A 3R7MA 1AVAA 1R6WA 5DLCA 2Z6IA 2QIWA 1TR1A 4JTTA 1MFVA 2Y61A 3QV8A 4MKVA 1U1UA 2ZX6A 1PBGA 4GZEA 1XIHA 2ZOXA 5IOBA 1HO1A 4O1CA 1TTJA 1E15A 4GZ7A 4Q22A 1OFPA 2DVUA 1WZLA 4MY9A 3KVMA 5M17A 1UHVA 2YDSA 3AHVA 2XGZA 2NUWA 4WRHA 3NQBA 1T96A 4HD5A 4IMCA 4U33A 3ZLGA 4LBRA 2R1LA 1JAEA 3WQ6A 4P8VA 3QR1A 3A47A 4GI6A 3E6EA 4YN5A 3SADA 5HJYA 2CBJA 3F4WA 4RK8A 4PUJA 1DWHM 4CQCA 4E2OA 4DO4A 1H7XA 3UVIA 1H49A 4RL3A 3OBAA 3LI1A 3STCA 1QNSA 3FXYA 4O16A 1XDLA 1OC6A 1DP0A 3WDJA 1ENUA 1U5JA 3NPVA 4IX2A 4IP7A 2VR4A 1QUMA 3VO0A 2I5IA 2Z2AA 1QI0A 1H41A 4O1FA 1PX4A 1IT8A 2VOTA 3CQIA 4E3TA 1YE6A 3I4KA 1A47A 4G7EA 5T8GA 1HTIA 2QGHA 5FF0A 5HBFA 3GWQA 1S5WA 1CX9A 1Y5VA 3WK0A 3M07A 3GDMA 3PZGA 1I2NA 3W2JA 3DG6A 1LDCA 3UGVA 2FZDA 1J5SA 4JFTA 3CAKA 3GZAA 4J35A 4XZIA 5ECUA 2FLIA 4GRSA 3SGZA 5IBXA 3V5CA 4BEUA 1EFZA 4C7FA 2E6FA 1R2RA 4CEUC 1CXEA 1ONRA 3SQMA 5BRPA 1QO5A 2GGGA 3CJPA 4IWWA 1QI5A 4UC5A 4KGLA 3WQOA 4CNSA 2HK1A 4ZE4A 4H8HA 1Q7MA 5GJMA 1X8FA 3PZQA 4YCOA 2EKGA 1KQYA 4XUYA 5H8MA 5AC4A 2YZRA 1BTMA 3GVQA 3LV5A 2DZPA 2J47A 3W82A 2J7FA 3GXIA 1A4LA 3TXZA 4ERGA 2F6KA 3CGTA 1NU5A 3E0WA 3C86A 5E1QA 3E9AA 1TV8A 3M0ZA 1KFJA 3MUAA 2EHHA 3OIXA 3WX7A 3QGAC 3STPA 1WOBA 4MNLA 1MNZA 5F7UA 3E0IA 1TTIA 3N2OA 4NX0A 4MAZA 4FO4A 3TCEA 1WOAA 3ZO9A 1F9CA 3UZXA 4NI3A 4O57A 2J25A 4MUPA 1UROA 4ICNA 1ZAJA 2EQDA 5K9DA 5M2FX 3LBMA 5A8MA 1NQ6A 2FMOA 2P5NA 3KVKA 4WKAA 3PJWA 1KO0A 3M64A 3NNTA 2DSWA 3KW3A 2NV2A 4GNVA 1G4SA 3USZA 1W1TA 3PWGA 4PZVA 3WYZA 5LA2A 5IDIA 1WNOA 1JD7A 3K4AA 3HM7A 3SJ3A 3MZNA 1NWTA 3C0LA 1LRNA 4S2BA 2PDHA 4ERIA 4UIOA 3RILA 1LT8A 3U5UA 4P7RA 1WXYA 1BSLA 3GTIA 1W91A 2WJZA 1QWGA 2I14A 4F9JA 4QG6A 3OOQA 4GYPC 3JR2A 3W7EA 3UWYA 2XSXA 2JE8A 1IXQA 3AS1A 4HN4A 3HURA 3VDCA 3TFXA 2HRWA 4ACZA 3B8TA 1LUCB 2P3EA 3C56A 3LTSA 3ZSTA 3SY1A 2BBFA 1G4TA 2PPGA 2PLKA 5C7HA 6PTDA 2J7CA 4GO9A 3OLEA 1K8YA 1R3RA 1LLWA 2E4TA 4JIQA 3GIQA 3SCRA 1TELA 2XWEA 5LGXA 1AUSL 3KLLA 3P8JA 3URBA 1MI3A 3WENA 2Y7FA 1K4GA 1GKQA 3PFMA 5C8BB 3OIHA 2PDQA 3HGOA 3M0VA 1UWUA 1P0KA 4M8UA 1IIGA 2BVWA 1JR1A 2R14A 5GPRA 3W7KA 2OKTA 2XIJA 1KXTA 3A4XA 4MKNA 4XBKA 5FL1A 2HXUA 3LNPA 4P7OA 2XGBA 3O06A 3RN6A 1KRBC 1O94A 2X7VA 3DFSA 1PB0A 3U0HA 5F2MA 3HFTA 3A9IA 3IVTA 3G8EA 3S42A 4A29A 1RH9A 3VD9A 1BVNP 4QP0A 4LCRA 2WSYA 2QDDA 2VX6A 2UY3A 4KIEA 1JZ4A 3AUJA 1FX6A 3E0LA 4G7FA 1YMYA 4GNKB 4PUWA 3EWXA 3T55A 4YTTA 5HOSA 3ARYA 3MP3A 3QQ0A 4LVBA 1KCXA 5E0CA 4EWJA 2WVVB 4DO6A 1XLAA 1HUVA 2WJFA 2ZZ3A 5D2VA 3HPZA 1G69A 4WZHA 1XH1A 2WLYA 3U6WA 4NNBA 4AWUA 1EQCA 2WM0A 1NDYA 1VRXA 4GIEA 3ALFA 4MNKA 4GZIA 4PGLA 3KS5A 5A6JA 2CZFA 1QO2A 2Y70A 3E74A 1JI2A 2Y8UA 3MI2A 1E6SM 2ICSA 1GOIA 5FCZA 4F2UA 1KXQA 1UQZA 3FHQA 1P48A 2D69A 2G0WA 2QUVA 5CBIA 4BY3A 4U5IA 1JPIA 5HA7A 1PCWA 3U7BA 4J7RA 1NOFA 1FVPA 1EIBA 4LRTA 2UWFA 3M5ZA 5I78A 1VHCA 2J75A 3KOXA 4MYAA 1HKVA 1GOMA 1TG7A 3ES8A 5CGMA 1E6PA 4B5VA 3MUY1 4TTGA 4IMFA 1MXGA 1ZALA 5HJLA 4A8IA 5HPOA 2OT1A 3QW4B 5G1MA 3SCOA 3M6DA 3D5HA 1C90A 4O0KA 4HHLA 1F6KA 4FS9A 4WK9A 1XRFA 3E49A 1FKXA 3WFLA 1KM5A 1EA9C 4W85A 3ES7A 2ZIDA 3CYJA 3SGUA 3C4UA 1EX1A 3REQA 2D2GA 1PCKA 3OVGA 1RUSA 1FH8A 3TW9A 3N2MA 3F5JA 4FOKA 1ZBVA 5A3HA 4UR7A 5TQLA 1WDQA 4BI5A 5XIMA 2O56A 5REQA 3AROA 3FS2A 1GQIA 3MO7A 1NQKA 1EQPA 4OOUA 3CPUA 4H9UA 3AI0A 5FAGA 1JUKA 2G37A 4S3KA 2WNQA 4MTVA 3WD0A 2BASA 3ARXA 4ICMA 2NT1A 1Q2SA 4B4HA 3MCOA 1GORA 5JBDA 5LIKX 2E9MA 3H6OA 1EHNA 1ZAIA 2CHOA 1R9ZA 3QKEA 3TW7A 1SW0A 3QOKA 1JQXA 5M1TA 4QBXA 2Y7DA 4YTUA 1UIOA 1XDMA 2D0HA 1EJXC 1Q5MA 1E56A 1W9XA 3DH7A 4G7EB 1NIUA 3I6RA 3LGDA 4K36A 3PSWA 3V7PA 1E4LA 1JG9A 5MKGB 2H8XA 3SCWA 4H01A 2XN2A 5C2CA 5D33A 1TV4A 3UZYA 3W27A 1PHWA 2G95A 1A5CA 5HXMA 5I0DA 1RK5A 4O15A 3KL3A 4J5NA 1WZMA 1KFWA 1E0XA 1XLCA 3ZJ6A 1MXDA 2G3JA 2HEJA 5TD4A 4RW3A 2ZZ5A 1XM3A 1UZ1A 2PB1A 4X2PA 3BGGA 3ANYA 3GTHA 4FR6A 4A2RA 3UR2A 4HT3A 1YE4A 3S5YA 3GIPA 3R12A 1TZ7A 2J27A 4O17A 3HMCA 1TRDA 2NW0A 2R1PA 3QFEA 1FHDA 3HPFA 4AVFA 5CCZA 2VR2A 1UH4A 3BVJA 4P7LA 5F2LA 3OGVA 2CWXA 4Q8QA 3N19B 4QDWA 2BODX 1C8QA 3HPXA 4MZYA 1IWAA 1G6CA 5E6YA 1XCFA 4KIRA 4M6QA 3MYOA 4JS3A 4C65A 2P8BA 1VJZA 4CD7A 1FWSA 3LGEA 1VLWA 4PMVA 4BKNA 5CBJA 3QW3A 1W6TA 3L4YA 3VIOA 1V6WA 1I75A 6CGTA 1YBQB 3OGRA 3KBMA 3LRMA 1L8PA 2GK1A 3CZLA 5A2AA 4R7JA 1VBRA 1EH9A 1JPDX 2WCAA 4B16A 3FV9A 4QHRA 3PUOA 4JIEA 1UUQA 1KGWA 2OXNA 3MUZ1 3H53A 4HNLA 3HG3A 1OX5A 1JCTA 1H4PA 3SFKA 3V5OA 4M24A 1M03A 4FLQA 4XSLA 5CJ5A 1OZQA 2YB4A 1WAWA 4JPGA 3KLKA 3BZJA 4YS1A 2ZX9A 1KGUA 2H6RA 1EXPA 1TFVA 3PNZA 4M7TA 4PBGA 2WZMA 1ZCOA 5I79A 3GC5A 4FA3A 3GDKA 2Z26A 3CV2A 2VFGA 3T6CA 3WF4A 3QPZA 3KTXA 3WKZA 4CLMA 4J2PA 4AZCA 5AC5A 3W23A 4C7DA 1PKLA 4H19A 1PIIA 2DW7A 5G1YA 2Z27A 5D8WA 1PS9A 3QY8A 2HJPA 3WH5A 4IX0A 2BZNA 3OA5A 1EKOA 2X7WA 3CB8A 5C7VA 4G5DA 2NX9A 4HNTA 2HE5A 2VD8A 3KHJA 2IPFA 3CHCA 4XVEA 2PDCA 4I9TA 1SPQA 2A6LA 4MVAA 5FEXA 4YWSA 2DVTA 2ZZ1A 3CL8A 1H5VA 3GQYA 1UOKA 4TTUA 5D9MA 2VFDA 4L6HA 1O5KA 3G3MA 3H2EA 4AY8A 4BJHA 3AIBA 3O15A 5HQMA 2H8ZA 3FDGA 2QMKA 4WJXA 3BLFA 1DKWA 3EDJA 2UY5A 3AXIA 3TMQA 3MV11 3RO6A 4RV8A 2YCJA 2CXEA 3AZTA 3WLJA 2HS8A 4HZ8A 3RMEA 2AQWA 2IKIA 2IPJA 3I10A 1NTHA 4AXKA 3BGJA 1J0KA 2FIQA 3H2AA 1RJPA 3ARWA 3GVRA 3QGKC 3C0SA 3AALA 4D2JA 2YL8A 4HBKA 2TPSA 3TOYA 3GXDA 1AD1A 1LWIA 4YTSA 3TR9A 1MWOA 1RLCL 5JMUA 1MNSA 2Z7KA 4KMQA 5RUBA 4TV5A 2QZRA 4W8AA 1NWUA 3KL5A 3ZVHB 1BYBA 3FGCB 4XV0A 4IQDA 5E5CA 3CZ8A 1VP5A 1G1YA 4AEEA 3M44A 4ZB0A 4CUCA 5FJPA 3OLIA 2DZUA 4C6IA 4YWIA 3NG3A 4I6VA 3ARVA 5C5YA 1H0GA 2H3BA 1F6PA 3BGAA 3TYEA 1CXFA 2X41A 4RW5A 2D3NA 4ATDA 4U5KA 5C6MA 4GC4A 3OW1A 3VPLA 3QMSA 3GUGA 3W7NA 1EZ2A 4DJEC 1LYXA 3MI6A 3COTA 1EJRC 4JY9A 4LVFA 1GVFA 2EO7A 2C19A 2GDQA 1RCQA 4LWWA 2GUUA 4KCTA 3NTYA 4I5RA 4DWSA 3NM1A 2A5HA 3P80A 4G56A 3ABXA 1NDVA 1W9PA 2ZCGA 1OCNA 3U2ZA 4FPSA 1UW9A 4DB7A 2F6XA 1W8SA 4HSOA 2DSKA 2OGJA 4AEFA 3HQ1A 4S3BA 3SQLA 1UZDA 3WQPA 2RGMA 4FX6M 4WJEA 2VWTA 4MJ2A 4P8WA 3XINA 1GHRA 4DXXA 3W7HA 2DT3A 4F2TA 4ZGYA 1KFCA 1W5NA 3ITYA 3IAQA 3QJAA 4DBWA 1S3TC 4BA0A 2Y63A 4F8XA 5BWFA 3VZZA 3WJZA 4JD4A 3NL2A 3VX1A 3EWYA 4LVGA 5DBTA 1IGWA 1WQ5A 4UNLA 1HJVA 3WZ0E 1ZTVA 1HF6A 3WLTA 2VNCA 1IEIA 1C91A 2XFWA 4O53A 2VYOA 1AW1A 4W89A 3I68A 1WDPA 2PDWA 3IACA 1D8WA 1W1VA 2PGWA 3UBPC 3H2NA 2FVMA 4DBEA 3KVJA 4O8AA 3D6NA 3QY7A 4GI9A 2PS2A 3W4RA 4U3CA 5D8ZA 1JPMA 2XYLA 3MKKA 3PWIA 4TOQA 1DWGM 4NJGA 3UGRA 4HTYA 5K4XA 3PNUA 1RD5A 2WC3A 2X2YA 4PCPA 4GACA 1JPKA 5BXPA 2ZRUA 2FFIA 2WZTA 3RJYA 1WV2A 2W5FA 2WQPA 3M5XA 2GUYA 2BDQA 1BYDA 4IIHA 4DAIA 5CZTA 3GFYA 1NEYA 1DQXA 2ZYFA 3H8AA 1BF6A 1KM4A 2NQZA 2HNEA 3IJ9A 4UBPC 3SSJA 4H9YA 2XIBA 1P0NA 1P43A 3TOPA 1KRCC 5A2BA 2E28A 3FSTA 3F2BA 1TMLA 2GDUA 5F2IA 3E2SA 2KZHA 4XZMX 3VMOA 3W6LA 3QEZA 1NY1A 2QJHA 1DIKA 5I3KA 1YQ2A 5TNVA 3CS2A 1RVKA 3GDTA 3SQSA 3H26A 1ZQ5A 4UTWA 5DF0A 1E0WA 3L5MA 3SEPA 1RP8A 1WKFA 3PN8A 1UUMA 5C9UA 1L6SA 1EJUC 3KBNA 4AAJA 4UFJA 4INFA 2ZRYA 3THDA 4C6CA 1W3TA 3RX4A 4LW7A 2QGYA 4LAOA 4GIRA 1M68A 1FWIC 3S2NA 2PWFA 4S3AA 2ACSA 1XW8A 1B30A 3RK8A 2OR2A 3EKLA 3ID7A 3LNMA 3S1UA 2I9UA 4OU1A 5AHEA 2P0OA 3NM3A 4MKSA 4Z2GA 3BICA 4AC1X 1Z89A 1OM0A 1W5MA 3S5NA 1CPUA 4U2ZA 1KBBA 1A3XA 1UD6A 1Q45A 2DH2A 4HSNA 4MNJA 3C3UA 3T42A 5FD0A 3W28A 3ZLHA 4QE4A 1V3IA 1D8CA 1TR9A 3QZAA 5DT7A 2V0TA 5I00A 1VFLA 1B9ZA 1T8QA 3WF1A 1GVEA 4ERAA 3G1XA 2QR6A 3KOWA 3O6CA 4RR4A 4YVVA 3EB3A 3TIMA 3GK0A 1N2VA 5HINA 3QZEA 3TTOA 4GVHA 3BLKA 3PZMA 2ZUTA 4MGGA 3ZWTA 4F0KA 3QZ6A 4XZWA 3PB0A 4KEMA 1QBAA 3L5AA 2XWDA 2D20A 1DJXA 3EB2A 4UOZA 4JOMA 5C2GA 3L5LA 3GD6A 1UH3A 3PZUA 5FJIA 2E7FA 4EE9A 2OZTA 4HNUA 1UKTA 1T8XA 4K1GA 4ASTA 5CEWA 3EDEA 7TIMA 1D2KA 4JEJA 1UQYA 2ZVRA 3LRKA 4DM1A 3DFYA 4AY1A 2C8NA 4XIAA 5ECVA 5E09A 2DY3A 4WKHA 4NP7A 1DWAM 2W27A 3BPWA 1PPIA 5IHSA 2IXVA 4ZODA 4CU6A 1GVSA 2GSEA 1PZ1A 1QASA 2DSUA 2GVYA 4UUIA 4UMCA 5EA9A 4IH3A 3H55A 5E0FA 2W6RA 1OC7A 4NJHA 2J7GA 3QHNA 2VQUA 4S38A 2E9BA 3RM9A 3CUIA 1I45A 3WBEA 5EBAA 4EPKA 2QJGA 3M47A 4QJ3B 4LEQA 3KE0A 1UG6A 3UZ5A 2WHKA 3N9SA 1BXBA 3AOFA 4LVDA 3EAUA 2VDHA 3USBA 4HYRA 4BF5A 3R0DA 4JQ2A 1U1HA 2V82A 3WL1A 5GNZA 2ZUSA 3VNJA 1KW1A 2PP3A 2HNHA 3ZS4A 1O1ZA 6TIMA 3DDMA 3SN0A 3CIVA 4PCNA 2BHZA 4DYKA 1U2YA 2WJEA 3APGA 3B8WA 5J5DA 3AYSA 3FX4A 1ISWA 1C8YA 3P82A 1V0LA 3LG3A 4AD2A 3FSUA 4RZBA 1ICSA 1C8XA 3PZVA 1RLDA 1FHVA 3I7QA 3W72A 1CWYA 2JEPA 3OA3A 3SO7A 4Z2HA 3KVLA 1Q8JA 4Q4OA 4CQBA 3AIEA 3TA6A 3F4VA 4YL2A 5D09A 3PK7A 1XIGA 3I6TA 5D03A 1KM6A 1KXHA 1NWSA 2RUSA 1WUFA 3KX6A 3WCZA 2VC9A 5I03A 5G2HA 2VGFA 4CQ9A 3ECQA 4GWEA 1E0UA 2B7QA 3EA3A 3LCFA 3UG3A 4PUEA 1A49A 4FIRA 2YW3A 1ME9A 4OWGA 5AVHA 5LHFA 3TJ4A 2QPXA 3IVSA 3WNMA 2DZTA 3HG5A 3I3DA 2BHYA 3GXNA 4LY8A 4OOZA 3AYTA 4HNCA 4E6MA 1LCOA 1A5MC 1UD3A 4FP1A 3LCLA 4IJRA 3VILA 3TNBA 3GHTA 5AFDA 3S4TA 4A3UA 1OIMA 4GX9A 4W7UA 2BVDA 1EF3A 1YW1A 1KCLA 3CC1A 1B54A 1OCQA 1O5QA 5AZ1A 4NZCA 3S2JA 1IXNA 1OX4A 3N1AA 1Z3NA 4XVDA 4P8UA 3WJWA 1GKPA 3GR4A 4QAWA 1ECEA 1E43A 3W70A 2HTMA 2DH3A 1W31A 3TLLA 4GX8A 1J2BA 1SVDA 3GTNA 1I4NA 1KM0A 1R7AA 1V7AA 3QQ1A 3CYVA 1XLDA 4UOJA 4KH2A 4JQ3A 2O9OA 1DQUA 5AHMA 3TN5A 3CU2A 2CXGA 3RHGA 3F4DA 1GVOA 4I5XA 3VKDA 2C15A 4JTJA 3TCSA 4F66A 1XL9A 3DN5A 1H7RA 1SR0A 2VMFA 3OLDA 3BSGA 1FP8A 3TYAA 3E1F1 3GXFA 1BYCA 1XIJA 1UWIA 1F3WA 5AHNA 2XIIA 5E70A 3LCHA 1AL7A 1EPXA 1TE6A 2YZ5A 2PCEA 3W1XA 5DBUA 4BR1A 2QPUA 3EDDA 3CMGA 1IXPA 2J88A 2GGJA 3GU9A 3E02A 3CUJA 2XH2A 1KFKA 1W3IA 4DBUA 1QWKA 3BJSA 3RU6A 3VKAA 4LV9A 1TKKA 2YYTA 2MNRA 3MO4A 3S6TA 4ZENA 3EXRA 3WQWA 4ZO9A 4XZBA 1X96A 2GQ3A 5KZMA 3BUVA 5KEZA 4XTIA 3VVGA 2UY2A 3DERA 4UMAA 3VGGA 3BJTA 3WD1A 1A0CA 4JTEA 4MFDA 5KITA 4JL2A 5AC6A 3FLUA 6ALDA 2WQDA 1UD2A 1Q6GA 5CLTA 3OZYA 3Q45A 2FDSA 2ATMA 1DE5A 4FNPA 1GK8A 4V28A 3W1PA 4J3TA 4N6FA 4F48A 3HQOA 3PPFA 2E5CA 1BPLB 1SO4A 4UTTC 1IXOA 4NJIA 3KWXA 4ADUA 3ZMRA 1D3CA 4GQQA 1D9EA 2DDXA 4S2CA 3A23A 1FWHC 2FH6A 3VZXA 1N8IA 1Q8AA 1GONA 4EPEC 2YSWA 4RUBA 4NXKA 2W63A 3PSVA 2GJRA 3W1MA 1M01A 1G7UA 1QTWA 3PF3A 5D37A 1S5NA 3NCOA 3SIZA 1UKQA 2WWCA 1VKFA 2WNWA 4IJBA 5EMMA 3ZZ1A 2J77A 3PZOA 1PKYA 1OABA 2Z25A 3PJUA 1Q6LA 5CPLA 2TODA 2WM1A 2VL4A 1B3YA 3SR7A 4DF1A 3D3FA 5CSYA 1WE5A 1N55A 4WOZA 4UNKA 5CPMA 4TVUA 4PRTA 3GZ3A 4WIWA 4XO7A 3NA8A 4G2DA 4CCDA 4O4WA 1UPPA 4GH1A 3IGSA 4JIHA 4L61A 5HNTA 3ITTA 4KCUA 1C8VA 1CLXA 2ZRZA 2NX1A 4PMJA 5ABFA 2X1TA 3N4AA 4HTBA 1N7KA 3C2RA 2QYGA 1W1PA 3VYLA 5I2UA 4AZ6A 4Y9MA 3LTYA 4GUJA 3W7CA 3NQ2A 3CIWA 3E2RA 5CSUA 2VRKA 4NZJA 4GBDA 1Y0EA 2NQ9A 2WC7A 3KDOA 1UR4A 4DJDC 4PUMA 1CTNA 3ONBA 3RITA 4KERA 5G5IA 3P8IA 4YPJA 3VNKA 4UFLA 1O4UA 5HMDA 3UJ2A 4ORIA 3ZFHA 4EACA 5BXRA 5D2WA 1W17A 4PMZA 3ZR5A 2VVSA 3QPYA 3MU7A 3U2OA 3BG5A 2FB2A 4HU0A 3W9ZA 1UC5A 3WH8A 5ABHA 1J10A 4FXJA 4EIVA 5BROA 3CH0A 1DJQA 4FLRA 5CBBA 4UTUA 3VOHA 2PDXA 2CNCA 3W2MA 4BI6A 2EKCA 1VFSA 1OVDA 1I2RA 1C9WA 3IRSA 5IFPA 4C1KA 3CWHA 4Z08A 4MPKA 1HKKA 4JKMA 4PMDA 4REQB 2FJKA 1R38A 4ILSA 3URAA 3DEQA 4PMOA 2J8GA 2ZWZA 2Q8XA 2CBUA 4GIAA 5EMJA 2PLJA 4N4PA 4MF4A 3M0HA 2WPGA 2PDFA 4HZ6A 3QV6A 1KM2A 1ZJAA 3NIYA 2XVGA 1V0NA 2Z28A 1JIBA 4C7GA 1RQBA 3CBWA 1KFBA 1JDFA 3P62A 3SGGA 3B0PA 1K8CA 2YFOA 2QAFA 3HZ3A 1L6YA 5HMSA 1YRRA 3UWVA 2BY2A 1PL9A 2I56A 2BSLA 3MKVA 4WDUA 2VEIA 3MHGA 1SR9A 3L12A 5TAOA 2RDTA 1M53A 3G1SA 4C6NA 3VKCA 2PA6A 2PAJA 3NSXA 3DGRA 3PC0A 4C6MA 4D6DA 1R46A 1ZBWA 4B3LA 4GOAA 3IUDA 2QT3A 2OGYA 3AO0A 4C5YA 1CB7B 5JU6A 4MHBA 5DMNA 3VGHA 1US2A 1F6YA 4AIBA 1V6XA 2DIJA 3WH7A 3AZSA 3MBDA 1GQNA 4GY0A 2W9MA 1FCQA 2PEVA 1VAHA 1QNOA 1LL4A 2Z6JA 1QNQA 1V03A 2VGBA 4Y8EA 3M0XA 3WUBA 1VD6A 1VF8A 2XH4A 1HKMA 1DIEA 1QW9A 2V9DA 4GVFA 1KV8A 4NZ1A 4OTKA 2QLYA 2ZZ6A 2A3BA 1TPH1 1XXXA 3NZ1A 4XUGA 2A2IA 3K8LA 3EWUA 3GVVA 3GYEA 3NXLA 3PPGA 4Y96A 4H6RA 3OZPA 4Z1CA 1R3YA 3UNDA 2XVNA 3R89A 4B5WA 4D71A 3W00A 1TVPA 1RPKA 4PYSA 4D6CA 3AQUA 5JBEA 4EKJA 1V93A 2Q3OA 3WEMA 3KUMA 1ME8A 3A21A 4JTRA 2YA0A 2HDJA 3WUEA 4H6QA 2VGGA 1IR2A 1QI3A 4D72A 2R9RA 1VCGA 2ZVIA 3RJXA 3BLLA 1SW3A 5HDRA 1GOQA 4W7WA 3W7LA 2OZ3A 4V33A 1KC7A 4PL2A 1W1IE 4IUGA 2YXXA 1MO0A 1VJIA 3BAYA 2VFEA 1E55A 5FJTA 2CLHA 4DF0A 3LM7A 4D6GA 3PPHA 1W56A 3B04A 4QSHA 4IL2A 4DXKA 3HF3A 4LB4A 2ZICA 2DORA 2I5GA 1LT7A 3APYA 1MRAA 2J8FA 3W22A 3P7YA 3EMQA 1SFJA 1QMLA 4GMEA 1UP2A 3UU0A 2WMIA 3JRKA 1VC4A 4KEVA 4NU7A 5D04C 1HW6A 1T0OA 2VO5A 1W3JA 4R7OA 1RZMA 4GFSA 1FXQA 5CAKA 1H1YA 1RJQA 2VD9A 4XTDA 4AB4A 1H50A 1MMFA 1O60A 1BSIA 3MSGA 3LXBA 4N9CA 3CV7A 3TSDA 4DNHA 3VD3A 1K8ZA 2E0PA 3NOYA 2DZXA 4Y6GA 3W83A 9CGTA 5DFAA 4EAMA 2VOMA 3L2LA 1BFNA 1F73A 5HK4A 4LXFA 3VKBA 1A3WA 4IIFA 3EWZA 3U7VA 1JF6A 4AVNA 1EUAA 1ISVA 3THAA 3NO1A 4MLJA 1EDGA 2PZNA 2J9YA 3K1GA 3TE9A 2YLAA 3VD7A 3MUCA 1M6JA 4LBUA 2AMGA 2G3MA 4D6IA 2R82A 4Z17A 4BWLC 4EAYA 2F2HA 1SSGA 4GXMA 1DE6A 4Z2JA 1FQ0A 3FN9A 4PUUA 4OKDA 1G67A 3NFUA 3MYPA 1K3UA 1FWNA 4ZTYA 2WYSA 3HGJA 1R30A 1ZAHA 3B8VA 4C6DA 2OYMA 3RMJA 1MUWA 3FYYA 3CUFA 3W24A 4JYFA 2NZLA 4HQVA 1RCOB 3OG2A 5DY3A 1X7IA 1J0JA 4DXVA 3KBVA 3PG9A 2G97A 2XFRA 2FYMA 4AD5A 3WF3A 2O92A 2GQAA 3QF0A 2OG9A 5EMKA 5FF3A 3GH5A 4V27A 4H00A 1UA7A 3VD5A 4XAYA 4I9AA 3L4ZA 3FGCA 2J8TA 3S1WA 1CXLA 4H7ZA 4CU8A 2E5BA 4L4LA 2V6AA 3WY1A 3GSMA 2Z24A 1F07A 7REQB 4C6QA 4H9VA 4FSAA 3CAVA 3TH6A 3V36A 4EXAA 3H4XA 2Q09A 4AQLA 1Q6FA 1G0CA 1M7OA 2FGLA 4QCFA 5FJRA 2I57A 1SFSA 5T26A 2O7QA 1QHPA 2IMRA 2J62A 3T81A 3MZ2A 2DP3A 3PR2A 1ZJIA 2CLKA 1YADA 5LHEA 4AW7A 1VFFA 7TAAA 4GI8A 1SZRA 3BC9A 1YPIA 1GTHA 3CHVA 4ZFCA 2PC8A 3GX9A 2PBOA 1Y8BA 2XJ7A 1CBGA 4H2CA 2C13A 2QULA 1FWJC 3AMGA 3XISA 3MT1A 2XZ9A 4EANA 1AQMA 2OYKA 4D6FA 1QXLA 2PRLA 3M5YA 1SO5A 1PKMA 4ZOCA 4S3DA 2PP1A 1EF2A 2VJXA 2HPIA 1DJZA 1RY8A 2WZEA 3CEPA 3L2MA 4PRWA 3VIPA 3HQNA 1CGUA 3F2DA 4IFKB 1M7PA 4YXGA 2FHFA 1P1MA 1DTUA 1XQKA 2AGKA 3F4NA 4XKYA 2DZWA 4HHHA 4B9YA 4MWAA 1XLFA 4QS5A 2Y24A 1VIWA 1JZ6A 1QOQA 1DBTA 4KFPA 1DIDA 2C1GA 4ML4A 1LWJA 3VDGA 3EWWA 4TVCA 5MHBA 3BL3A 2ATSA 3PY2A 3QR3A 2A4AA 4PSRA 3T08A 1B3WA 3CT2A 1JZ7A 4JQ4A 3N13A 1LBLA 2GOUA 3N73A 1EJVC 4H4IA 1X6LA 1U22A 3CL6A 2JEQA 3PPCA 2GQ9A 2GVEA 3AXMA 1BLIA 4W5UA 1WPCA 2JK2A 4JTGA 4S1FA 2X42A 1H51A 2I9EA 5CC3A 3NQ6A 3STGA 4OIFA 1A0EA 3MP5A 4XZ9A 3KOZA 2O4QA 1UR2A 3QR0A 4GE8A 2JFEX 1CGWA 3RG6A 3V35A 4U3AA 4EX4A 3RYSA 2BXVA 1UMYA 4H8VA 9RUBA 1VFTA 3DC8A 3IIVA 3QVQA 1OADA 3GKFA 1JD9A 3GS6A 1CLVA 4IQEA 5FEPA 2JKEA 5HATA 1FDZA 3FEMA 4M6UA 1VCVA 2ZXBA 1TYGA 1GOXA 4R85A 2JIWA 3W76A 3V75A 1AH4A 4CVUA 1PZ0A 2VC7A 1WZAA 1UWAA 3NSNA 3BCFA 3OTRA 2JGQA 2BB0A 1JRCA 3N4FA 4IPJA 3EX4A 5PTDA 2B7PA 3UZWA 4ORMA 3BO9A 3KAOA 4Q8UA 4MUZA 4P2VA 4HPGA 2OEJA 3MP4A 3WL0A 1E71M 1TPWA 5BXSA 1ECQA 3NZPA 2J24A 2FKPA 1HVXA 4QISA 3IRDA 4RNHA 1BHGA 3MTWA 2ZQ0A 4HPHA 5G4EA 3QRHA 3BLIA 3HPSA 4A6GA 2I17A 3CMJA 3DFHA 4QE1A 5AHFA 3HA1A 1DJHA 2AOSA 4ZO7A 3A13A 4O1DA 5M5DA 2VURA 1EUNA 3F4CA 3VIHA 5DCDA 1XBVA 1NOUA 3T0DA 3H7VA 3TN3A 2YB1A 3QSTA 3C5QA 1BKHA 2VQTA 3SN1A 1QNVA 4US6A 1EP3A 3W01A 3CM4A 4IGHA 5A8GA 4GUIA 1YDYA 2QV5A 1CI1A 4I90A 5CSRA 1Y7VA 2OEKA 3CXOA 3VMNA 4ZB2A 1W9DM 4MG4A 4IMAA 3TZNA 4LSBA 4OBTA 1UPMB 4Q6JA 3IJIA 3TP4A 3UJSA 2Z1WA 2YX0A 2YCEA 3WFZA 2PUZA 2X0SA 3QSRA 3S1GA 3TYUA 3G0UA 1LLOA 3B3DA 5D9PA 1HP4A 3MJYA 3R25A 3UZJA 1A53A 1LL6A 4X60A 5I5RA 2J13A 4ZTXA 3CH9A 4AF0B 3TLQA 4HA3A 4BHYA 1KLZA 3GHUA 4LANA 4TX6A 1GOOA 4DN1A 4WR3A 4J3VA 1PV8A 1AG1O 2YPIA 3MCMA 3N18A 2IS7A 4YYFA 3DZ1A 3LMYA 5FEZA 3N34A 4TX8A 3ANVA 4LF2A 1OFEA 1M3UA 1E4MM 3QXBA 3ZXWA 1D3HA 3W1LA 4A4AA 1RV8A 2FPYA 3B0UX 3M9YA 2JALA 5ABTA 8A3HA 1EA0A 3E3HA 1PUDA 5C55A 3RR1A 3DENA 4NJJA 3CUZA 2VEFA 5EB8A 3W53A 2CFFA 5JIPA 3UXIA 2ZC1A 3G6MA 3FIGA 4O28A 4Z42C 4OJYA 2QKFA 3QYQA 3RLHA 4H04A 2VZOA 4OBRA 5AZ0A 3URNA 1AODA 2EJAA 3LB0A 2ZXDA 4J3XA 3L66A 4HGXA 1EJTC 3U9IA 1PIFA 1EP2A 5D4YA 1TMQA 5HJXA 5LSMA 3VCNA 2HROA 4L4OA 5A6KA 1CB2A 4GKLA 1UMLA 1WZKA 2ZUUA 4KPLA 1OY0A 3CHEA 2PD5A 3O8AA 5EL1A 4C6FA 3QV7A 2FZNA 1BVWA 2VX5A 4S3EA 3AYRA 1JQVA 1FP9A 4XD6A 3N2TA 3SZ8A 4IFRA 2IQTA 1JVNA 3TONA 1WBHA 2H9AB 4FB7A 4LYQA 1ESWA 5IFTA 2YXOA 3RRAA 4IPNB 2GJXB 3IJ8A 1CGTA 3KHDA 4DJED 2WCGA 3V5FA 3KDNA 2Y4SA 1RBLA 1R3QA 3C3NA 3UWQA 4KKXA 4QQUA 2ZX8A 1U5HA 3TJLA 1MVYA 3GRIA 3SECA 3WK2A 4PB3A 4E2VA 3GNPA 1YXCA 4UTLA 1E1FA 5DELA 2Z1SA 3GNOA 3H4WA 5CC7A 1JZ2A 1TCDA 3KP1A 3QV9A 4UQCA 5K9XA 3LOTA 5MKGA 1V3HA 3VUPA 1UIPA 1P0DA 1QAPA 1TV7A 1Q13A 4F0HA 2PDGA 3RUBL 3W1TA 4H8NA 1OQFA 3W74A 1J5TA 1LBFA 1Q4WA 3C2EA 5EFDA 3C61A 3ABRA 3V3WA 1NELA 5CG7A 1OX6A 2F9RA 1POJA 4LBSA 4WSKA 3MB9A 1CEOA 4JDYA 1PKNA 3Q4DA 4PCFA 4RE3A 4HK5A 2PFHA 4HMDA 2VKZG 4E38A 4YMZA 3TX9A 2J74A 4FNUA 2FQIA 3OQ8A 2Z00A 2CWNA 5DX7A 3AICA 3MC5A 4JX6A 3IV3A 3VNMA 4LH8A 2QVNA 3SCVA 2NXGA 1XF0A 2PDJA 2F84A 2BV9A 1T99A 2B81A 4WY0A 2J9ZA 2F38A 1XIDA 5HMFA 2VX7A 1TRIA 3UR8A 4J2MA 1BD0A 4B9ZA 1KBKA 1TE1A 2NQ5A 1WDSA 3G22A 3TXVA 3SY8A 1TPEA 4KFOA 1VQTA 3ZM8A 2WHLA 3REQB 3XIMA 3AIQA 2HSAA 4MZ1A 2G5WA 1L2QA 4FNSA 3HV8A 1WO2A 4DYJA 2DUZA 1XG4A 4L7ZA 3CASA 3WK1A 4AFYA 4YTRA 4D9PA 3B9NA 1P6CA 3G18A 2WW5A 2ZUWA 4CN6A 5I3GA 3DKLA 2QNEA 3HU7A 3WUFA 5JH2A 4LJ3A 2A85A 1YX1A 3BOXA 3FJLA 1KTNA 1M5WA 1TSIA 4MWAB 1H7WA 3L4WA 1L2UA 1ZS2A 2V2DA 3QKZA 2CZVA 2PRMA 3ZWSA 3J7HA 2BG5A 1DWJM 4RXFA 2DT2A 3E96A 3NYZA 2P50A 3RXZA 4GYJA 1JI1A 4LC8A 2J79A 3TQKA 4DBDA 4QTGA 5SWUA 3SRDA 3WUGA 3O6AA 5H91A 4DWSC 2PGEA 4IPPA 4Q4RA 3TSBA 4QAIA 1AA1B 5LIWX 5HR7A 4NRRA 4Q4PA 1DIOA 4LCSA 3LEPA 1KGXA 1NWRA 1B4EA 1I2OA 1PYMA 3TVAA 3W75A 3G0SA 5BOFA 4DWSD 4C6EA 4NYUA 3SUVA 1QT1A 1AH0A 1HL8A 4M82A 1XV8A 3W73A 3B8SA 1XSKA 2ANUA 3DG3A 3MS8A 3H2CA 4UMBA 2YJQA 4DM2A 2V67A 3FFSA 1Q6EA 2UZ9A 1CGVA 4RDWA 2DPEA 2A1YA 5FOOA 3KBSA 3C6CA 4MB3A 5A6BD 4WY0B 1G5AA 2Q8ZA 1TUFA 3SY5A 3BOLA 4NUWA 1IZKA 1AQ0A 2V5JA 1QR7A 4JAWA 4CD5A 3PP7A 1UA3A 4UR9A 1S5VA 1XX1A 2GOKA 2CHNA 2VVNA 2IKGA 2X1RA 1FRBA 1IIHA 1XR2A 3NQ7A 3IAPA 4QDPA 4L80A 1E9ZB 2PODA 1QI4A 2POTA 4XBSA 3MBFA 4N02A 4AHQA 3AAMA 1AZ2A 5LXXA 1TVLA 2FZ9A 5AKQA 3UXAA 3R11A 4LUSB 3DYPA 5C9ZA 3OODA 1TPB1 3DFPA 2R24A 3GE7A 2WSRA 4LUTA 3SB0A 4XKYB 3PBVA 4LALA 1P5BA 2SFPA 3N6HA 1XKJA 1FY6A 2DSZA 3TQPA 2HE8A 4JY8A 1HJQA 1UR3M 2CW6A 3NR0A 1EP1A 4HNNA 3O2LA 4FHAA 1VBJA 3NQAA 2B7OA 5BMWA 2HQAA 1ZP3A 1LUCA 3O3RA 3QHOA 5CXPA 4LU0A 1GG1A 3RPTA 2OWWA 1YTKA 2VDIA 1XLBA 4E5TA 4UTHA 2CESA 2E6DA 2C7FA 1AL8A 2H9AA 3LCGA 2Z1VA 2NUYA 1CCWB 3UCCA 2IQDA 3Q67A 1B0IA 2BVYA 2VI0A 1FWRA 1K6WA 2YDRA 5EMUA 1CT5A 4A3RA 3IJ6A 3P2VA 1G4PA 5A8PA 3S6DA 1Y5XA 4RXGA 4PEEA 7REQA 2GWNA 2DQWA 3B4UA 1Q6OA 4OUIA 4ZXLA 4DAFA 3GNXA 4IPLA 1LROA 3GG8A 4IGNA 2BY1A 2NLYA 2HXTA 4E4UA 2DZAA 1R9XA 2A3LA 1OD8A 2YBVA 3M0LA 4O13A 1K7EA 2CITA 5DCBA 1JYWA 1TPUA 3VIGA 4N0RA 2FH8A 1ZSXA 4M7SA 1D3GA 3B0XA 1HO4A 1AW5A 2R1KA 1KB3A 4XG1A 3VC6A 1TTQA 1GG0A 4O1BA 2WVUA 4D6JA 2OPJA 1IT7A 1UH2A 3W3OA 1LTDA 2AL1A 2INZA 3R0UA 3O05A 1JDDA 3TTEA 1EWEA 1XG3A 2EJ1A 2X40A 4IP4A 3B9EA 3POHA 5DRIA 3DHPA 4CU7A 2PP0A 3ZT6A 4HZ7A 3DESA 5I3DA 3GIYA 1GCYA 4ZOAA 3U8GA 3C2FA 3UPMA 1KD0A 1OINA 4FXSA 3P5ZA 3TZFA 4JX4A 3N2CA 3PUDA 1OGSA 3FCPA 3ZIZA 1ITXA 3B05A 3HFYA 4MOZA 3TQ0A 1EJ7L 3FK4A 1MW0A 2FB3A 3OP2A 4K6AA 1UKSA 3MW7A 1LM1A 2Z1XA 3KFTA 3LHUA 2Z4GA 3N14A 3NSMA 2G50A 6REQB 1NDWA 3FKKA 3ANUA 1GPWA 3W88A 3E2VA 3W2KA 3NQ8A 1W1B1 1DXFA 1J9YA 2DUXA 3WLRA 4PN2A 3R8GA 1KRMA 2VZTA 3L4VA 1Z6KA 1SFLA 2QV4A 4WDWA 4IPIA 4CQ8A 2W62A 3WJYA 4DYEA 3WJSA 1YXDA 4C6JA 5H6HA 4LAZA 3R4IA 4MSSA 3FKRA 3OEXA 3LRLA 1TJPA 1YNQA 4HJWA 5E0KA 3OPSA 1DEDA 4XK2A 1FHLA 3WLSA 1GHSA 2EXOA 1W54A 3T09A 3MJMA 2FGBA 3OYXA 3P81A 3Q37A 3E38A 2ZRXA 2AAAA 3G1DA 2PDBA 3QN3A 4A8RA 4AYSA 2C3ZA 4O0QA 3W87A 3CZGA 3EWDA 2E6AA 4QJ1A 2POZA 4WSHA 3ORWA 1LOSA 3UA3A 2NUXA 4LS1A 2HCVA 4O0ZA 3RRXA 2X05A 1K7FA 2WKJA 1KM3A 1SM9A 3VFLA 1E70M 3N9RA 4IMDA 2E8YA 5K3VA 1EZWA 3CHDA 3WMBA 4HYWA 1XYCA 5XIAA 1Q4NX 5CC5A 5U4NA 3S8HA 1JCMP 1QI2A 2C1HA 1E9IA 3PWAA 2G4JA 1K6AA 2R1MA 4GUFA 1ISYA 2YCLB 4CKQA 3PAJA 1ML1A 4DUVA 2EG7A 4JKKA 1V5XA 1J12A 4B5NA 1OFOA 1OSEA 1T7LA 1BGAA 3EX3A 3K30A 4XX6A 2RH9A 3ISIX 4HPXA 4Q8PA 4C1LA 1ZLPA 4JX5A 4RZ6A 4US5D 2QW5A 3CUHA 5CGTA 1W5QA 2BOEX 1C3FA 2FZMA 1FWBC 3LDVA 2PDMA 1GQKA 2ZUMA 1MQPA 3L2IA 3G1YA 8XIAA 1R9YA 1DVJA 4CEXC 1L6WA 3IARA 3GHRA 2NV1A 3W86A 2A21A 1BRLA 1WCGA 2Y7GA 2R8WA 1OD0A 3AISA 3DFTA 1EOMA 2VTFA 5A6AA 2WVSA 1ZENA 3WQDA 1MZRA 3ARPA 5BCAA 2CLMA 4C91A 3MA8A 4EPBC 3VDHA 2F6UA 1REQB 2GJXA 1O5RA 1HKJA 3G1FA 1NF0A 1GEHA 2FFCA 5A8NA 5BRQA 3KWSA 2NVAA 1VPYA 4RNJA 1B57A 4ZBCA 5A94A 4Z2LA 2XHYA 3DHFA 2V5LA 3AMDA 5C9XA 4MAVA 3KXQA 4ZOBA 2HZGA 3R8HA 4X9YA 1IEVA 5ABEA 1V6YA 5IM51 4AY7A 1UKPA 2E67A 1DJIA 4Y7EA 4UQBA 1C7SA 3NAVA 1FWDC 1J96A 5EYWA 1ITQA 3E5PA 4X0VA 3VU2A 2YR1A 4JFUA 2CZEA 1R0MA 2F61A 4DPQA 1GJPA 4GH3A 1AH3A 1ZU8A 1K70A 4BQ5A 3T4CA 5EPDA 3AYVA 2VXNA 4NKCA 2E68A 5GVJA 4JTQA 3LCIA 3A24A 1VFMA 4L5ZA 3IGHX 1K8XA 3SUUA 2GL5A 3H4GA 1IF2A 4PR4A 3U2CA 2VDGA 3W7PA 2GFTA 1UR8A 1VEMA 1N82A 1FHUA 4EK7A 3IGXA 1JF5A 3L4XA 4KCWA 1KV5A 3PTQA 3MHUA 1OYAA 3WQGA 2AGTA 3LSBA 2W79A 4Q8WA 5A8QA 1FUYA 1S2UA 3FA5A 2C18A 5G2WA 1Q7ZA 5FSEC 1BQGA 1GW9A 3LERA 4D8AA 2E1WA 1W2PA 1WXZA 1CECA 1IHIA 3T7VA 1BYAA 3W1RA 4DVOA 1JJKA 5I7GA 2XH0A 4H41A 4HCLA 2RAGA 2Y5SA 4F2BA 2VRQA 4UZUA 4J3ZA 4I7VA 3UPBA 3WQ8A 1KBJA 1K7XA 5L9FA 4AD1A 2V3EA 3H7UA 1NP0A 1OF6A 1OFQA 5C54A 2INEA 4NAEB 3LV6A 2XFFA 4RKAA 5JQ9A 4LAKA 1UWRA 4HCDA 4N9DA 2RJGA 4YVPA 2QAPA 4H1ZA 3P61A 4ZQOA 1MW1A 1R85A 3G24A 2O7SA 1VBUA 3EPOA 1RBOB 3TU9A 1X1ZA 4GQ0A 3L0GA 2ZZ4A 3NDYA 4CVWA 1V3KA 3LPFA 3ITCA 1DPMA 5L6UA 3MWAA 4I7UA 4QIUA 4WF7A 3JS3A 3W6MA 2OZ0A 1XLGA 1BWLA 4EXBA 1ITUA 1SGJA 4Y9NA 5T91A 1LBMA 4N2YA 1Z41A 4B15A 5HQEA 5FACA 1XFBA 5GJNA 2WSKA 4Q8MA 4K8GA 1R7OA 2PZ0A 3D46A 1BEUA 1X1OA 3EEGA 4O10A 4LQ1A 4IGSA 3WLIA 4Q4KA 1GZJA 3CO8A 5DO8A 5HUPA 1JCLA 2BY0A 5M03A 1Z32X 4JNYA 1XIIA 4RDVA 1AQHA 1VB9A 1A5BA 4JDBA 3EBVA 1AJ2A 1TV3A 4ROQA 4GVGA 1F3EA 1I1XA 5CPQA 1PWMA 1OBAA 4LPCA 2ZDSA 4M1BA 1E0TA 1CXIA 4Z2KA 3Q2DA 4NNCA 3BH4A 2DZBA 3BOFA 1PIGA 3MDWA 1US3A 2TYSA 1V0KA 2HBVA 4DEFA 4PMYA 5A69A 2BVTA 3WNKA 3VOFA 5J5RA 1C93A 2PGRA 4LYRA 1QJWA 1H0IA 2VEPA 3WBXA 3AHXA 1GYNA 2YBTA 3NUKA 4LCQA 3YPIA 4S3FA 1TVNA 4DLFA 2OELA 4OV4A 2VFIA 3K46A 1J0HA 3SFWA 1VIZA 1GOWA 5I3JA 1NFGA 2O4MA 4M56A 3UCQA 4PCTA 1OX4B 1MUCA 4O8RA 1H11A 1A3HA 1ZP4A 3KTSA 3LLXA 4WY0F 3N04A 1JZ8A 3W1AA 3PB2A 3IIPA 1X6UA 1CNVA 4M19A 3B03A 4Q3MA 3G1HA 2VZVA 4GUGA 1M65A 4Z2IA 1HXJA 1I2PA 3DYOA 4IT1A 4XAFA 4AZBA 2WSQA 5AN7A 3CHFA 1DL3A 4BF7A 1NP2A 3EMCA 2EF9A 3DFOA 1QW7A 4IOTA 3LM3A 3CLMA 2OQLA 1SO3A 1RA0A 1LLZA 1XISA 3VE9A 1B9BA 4PH6A 3S9ZA 4GUHA 2KAUC 3HG2A 4AD4A 1MZHA 2JBMA 5CPNA 1TPC1 3S46A 1UD5A 2ZADA 3WDHA 5F4SA 4KWVA 4TV6A 3EOOA 2WC4A 1DHKA 2J9XA 1FH7A 3VDAA 1B2YA 4REQA 3O9NA 3WQVA 4OZOA 1PO9A 1XGEA 2QUNA 4NF7A 3EDFA 2F2KA 4G1KA 5LGZA 1UZHA 1W3HA 4GD0A 3VNIA 1PZ3A 4OVXA 4ZFMA 4KFNA 5BU9A 3TTSA 1RVGA 3GBEA 1ZZMA 1B3VA 2HWGA 3OJGA 3S1VA 1DXEA 5A6TC 2CHRA 3N3MA 4UFKA 1E6XM 4WGHA 2NT0A 3URQA 3ZYZA 1PTDA 2W0UA 1E6RA 5CJMA 3LXAA 5IDZA 3VE7A 2ISWA 1LRTA 1SQ7A 3UQNA 4GCAA 4RZ4A 4CCZA 4EF8A 1H7NA 4W8LA 2D24A 2PDPA 1TPFA 4AZ7A 3LPOA 5FESA 4H3DA 4AIEA 1YDVA 4N9BA 5CSSA 2A79A 3AMCA 3DIPA 1J18A 1O68A 4GYPA 3WSUA 3EA1A 1I9CB 4J3UA 4A2SA 2D2JA 4HOXA 2BTMA 4UNIA 4C6BA 4NASA 3MQTA 1KR0A 2ZX5A 1TREA 4UXDA 1MEHA 2DJXA 4GC3A 1ZY9A 1DQWA 4M29A 5BOEA 3FYPA 4HVXA 3VABA 4CN1A 1S2WA 2WKLA 4JTAA 2CYGA 3KTCA 3VA8A 1V79A 4FNRA 3CTLA 3S0CA 1UD4A 4TIMA 1S2CA 2QIIA 3ZR4A 3R43A 1TWIA 2WMJA 3O7UA 2PDKA 2GYIA 2AL2B 3PTDA 5CLWA 3EXTA 4JHZA 2ISFA 4DJDA 3NPWA 3SJNA 1E51A 4ZVJA 1A0DA 4O1AA 3D3AA 3R13A 3GU1A 1GPFA 3S2MA 1WP6A 5EMLA 1QHZA 4GJJA 3VNYA 4LYKA 3K4DA 1HNYA 2PF8A 3U2EA 5I24A 4RPPA 4JTDA 4UQDA 3W7MA 3BXWA 3LPPA 3RX2A 1SO6A 4WKFA 3R5EA 3OHMB 5C71A 1ELSA 3GH4A 3I7SA 4YJ5A 2EEXA 2HVOA 2RDWA 3V0TA 1B3OA 4KBXA 1V3JA 3MPGA 1KFEA 3RDKA 4UTKA 2O0TA 2G8ZA 2Z0IA 3T2PA 4WD0A 2W61A 1IZCA 1JCYA 1FCUA 1XSJA 2Y85A 5CPSA 2NQHA 3VCCA 5LNUA 2EBNA 1E4IA 4QM1A 1JGIA 3W6YA 2C16A 1Z9AA 4AZCB 1XC4A 1Z69A 4S3JA 3L65A 4JHOA 4HU4A 4MY8A 5BOOA 4R88A 1W32A 1DWIM 3INPA 3TYBA 4LGXA 1JGMA 4MWAE 1J4EA 1M7JA 2PWEA 3GDLA 3VIFA 3UR7A 1GJWA 1UKOA 4HHPA 4DJFA 3GW3A 5EFFA 4YVXA 5H1WA 2WJDA 3QPEA 4QRNA 5AB3A 4NIRA 3NQFA 4S3CA 3M46A 4YLWA 1AQFA 3IVUA 3WDQA 4DUWA 1TX2A 3P3BA 1I1WA 4B5TA 3I4EA 3KOFA 1MXSA 2GDVA 1E9YB 3NQCA 4ZR8A 2ABBA 2GK1B 4UB9A 2OTDA 3VOIA 4ES4A 2RFGA 1PJ9A 3QYSA 1KA9F 2VZSA 4L9XA 1RBAA 2XM2A 4PBFA 4V1XA 1IE7C 3MMDA 4GQGA 2VP8A 4AWSA 2G4FA 1K9DA 1HX0A 5I07A 4DO5A 3U4FA 1JXKA 3LS9A 3SCSA 1JYNA 1XIMA 3TW6A 2E77A 1EHAA 4ZQNA 2GJNA 2CLOA 3G1VA 3CZEA 1F3TA 1LORA 1TWDA 2DT1A 2FHCA 3CAQA 3IIXA 3LHZA 1H7OA 3CT7A 4J3WA 2YXGA 4MY1A 1UZ4A 1Q6QA 1O7AA 3V0UA 4ZZ9A 3LA4A 2ACUA 1FCVA 1GVIA 3TJXA 1RCXB 1Q66A 1XIBA 5AC8A 1PVNA 4E8CA 1UR1A 3W1UA 3C2OA 3KRBA 3UETA 2W66A 3WEOA 4JFSA 1KTBA 4Q7BA 1E40A 3MSDA 4XD4A 2PDIA 3DXIA 3CAWA 3ONCA 1CGXA 2I7GA 4MWAD 3EOEA 2V3FA 4K38A 4EF9A 1ODZA 2ISDA 3UG4A 1US0A 1HJWA 3W7RA 3W7IA 2RDXA 2V5BA 3VIMA 4AX6A 4DIAA 2EAWA 3O6DA 2VWSA 5DN1A 3P0WA 1UR9A 4F0LA 6REQA 1OG6A 2PWHA 1PDZA 3G0XA 2ZA3A 4WQ6A 4TVDA 1CYGA 4CNOA 1YPXA 3SUSA 2BLEA 2ZA1A 1UJQA 5MF5A 3DU0A 1EC7A 1XLMA 1OFBA 4LNYA 1CGYA 1Q63A 3EOSA 3DG7A 3BV7A 4UTJA 3A9BA 3HGSA 1JPHA 3T2OA 2XN1A 4A21A 4L65A 4F4RA 1TMHA 3L0KA 1LP6A 1SZFA 3SCNA 3S1XA 1PZ2A 1A5NC 2WKGA 4GKTA 2VC6A 3NJ3A 1F4AA 4NXSA 1S1PA 1DJNA 4GXWA 3NL5A 2AL2A 1OEPA 4F9DA 4IG2A 1EDQA 3ZJKA 2X1UA 3TAKA 1XYLA 2QCLA 3LK6A 4HA0A 4XZNX 1H61A 3S2LA 3F2CA 3W29A 2Y8KA 3T4WA 3ZJ7A 4AMAA 1ZJBA 3EYPA 4PE8A 4DELA 2ADAA 3VZYA 5DMYA 4R9XA 2ZE0A 2B0MA 4EXQA 1J8VA 4NT0A 4AHPA 1CZ1A 5AY7A 3RCMA 3P84A 1EBGA 5LXEA 4AU0A 4ZQMA 3SUTA 1UYQA 2DFAA 1XYMA 2QHAA 4B90A 3M16A 1LG2A 3LYEA 1GQJA 3EA2A 5AYBA 2CCRA 4C6OA 4NZ3A 2OZ8A 4UWMA 1YBQA 5G4WA 1EOKA 3CV6A 1RR2A 5A6MA 3OVPA 1HGYA 4E2BA 4AZ5A 1D7FA 5LYRA 2V81A 4H7VA 1W37A 1OFRA 1XLJA 3GR7A 3M7WA 4MMWA 5DCEA 2J66A 2QUUA 1AMYA 4QE5A 3AMKA 3PZ9A 3VDBA 1U33A 2J7BA 1E3ZA 4GJIA 4NZ5A 3HOJA 1QRQA 1S2AA 3BG3A 4GO8A 2WMGA 2OEMA 1H1ZA 3WLKX 3AS3A 2CLIA 2QPSA 2JF6A 5GNYA 4FOJA 2J6XA 3PFRA 5TF0A 2I1OA 4X22A 3HG4A 4ROPA 4LFYA 3PHAA 2PTXA 3II1A 3WMLA 1JNDA 1TJRA 2CETA 2CLFA 2E5DA 2PU0A 2YW4A 3GXTA 3EOLA 3EMZA 2A0NA 2VM8A 3TYCA 3MCNA 4I9JA 3IJ7A 1S46A 4HN8A 1MFUA 1L0PA 3DFQA 1RJRA 2OKOA 1T40A 2TMDA 3EEZA 4V2XA 2ACQA 3BSMA 1NFBA 3BMXA 1IYXA 4RDZA 3NQGA 1A80A 3W38A 1IWPA 9XIMA 2WWDA 2ACRA 4CCCA 4PUKA 1M9HA 4CNNA 1KRAC 3C0JA 1U83A 2BGQA 4QCEA 3OB8A 4R5EA 1OIFA 3CZJA 4PMXA 2R94A 4QJ5B 4JKLA 3OVRA 4OE7A 4JICA 3VM7A 4ONVA 1DJGA 3TWAA 2PDLA 3IIZA 4DWDA 1WX0A 1E1CB 5HANA 5CG0A 1SMDA 3CWOX 3H2OA 5DANA 1L6FA 1FDYA 4HHMA 4K1WA 2P53A 3WLPA 1E9LA 4OGZA 3GAKA 1JFXA 3A3XA 5D32A 5CAHA 3GTFA 2GVJA 4LC6A 1XWYA 4IIGA 4KEZA 3DUGA 3TYDA 5U7SA 4C1NA 4FXFA 4W87A 4AVOA 8RUCA 3H2MA 4UTIA 1MW3A 1AJZA 2O9PA 3KP0A 4DQWA 4PTMA 3AJ7A 1K9EA 1MUMA 1CXKA 1OG0A 1XRTA 4YTQA 2Y1HA 2PTZA 2OLSA 1EJWC 1BWKA 1BXCA 3MI3A 2WXDM 4OV9A 4ATLA 4CNUA 1PXGA 4ZQPA 2D2HA 2EG8A 4HJFA 4BCEA 4IIBA 1A5KC 4JEQA 3V0SA 1PEZA 4A8LA 3T0TA 3WMCA 4Z1DA 2W91A 2J78A 1JNEA 1ZHAA 2IKJA 2X0HA 3NQEA 4D6EA 1Q6RA 1TCMA 1EIXA 4CD6A 1B31A 1JCNA 1POKA 3WQ4A 1X8CA 3B8DA 4HA1A 3ITGA 3DCPA 3QMRA 4U2YA 3N6QA 4PA8A 1G4EA 2AQVA 5E9AA 1V6UA 2XSAA 3EWCA 4AZHA 3T1GA 1BRLB 4KF1A 3OZMA 2D73A 3ARSA 1UP0A 1KFLA 3RLVA 1LOQA 1CW2A 3FA3A 5K4ZA 4DX3A 1XLKA 3NPXA 1FWWA 3H24A 4NG3A 1QK0A 1GT8A 4Y9OA 4CQDA 3KBJA 3M4HA 3WQFA 1HP5A 1QU4A 1WXJA 2DJLA 1JRBA 4A8NA 3WDIA 1UUOA 1NOWA 4ZO8A 4O1EA 2ALDA 4F79A 5HAOA 3NO5A 4NAEA 3EX6A 2XVLA 4YYCA 4PRRA 3AHZA 4IMGA 4NRSA 2XZ7A 4TX9A 4JQAA 4M1RA 1YPFA 1R2TA 4OECA 3GC4A 5KTLA 2WVVA 2ZX7A 5GNXA 3R1ZA 4RDYA 4I6KA 3NGJA 2Q01A 4IIDA 2XIOA 1SJCA 3IK4A 1EB3A 3DI0A 4N7QA 3VGBA 4CGTA 1YNPA 3LBOA 2GPTA 2ZA2A 4J27A 3G77A 3AWNA 3GH7A 3NDZA 3NGFA 5E93A 4HOWA 4V1YA 2VT0A 3L68A 1E1EA 3AXXA 3AWOA 4X9SA 3PUGA 1TA3A 2PBGA 4NAFA 1SUXA 4PCSA 4GG9A 1EL3A 4ZA0A 4PMNA 2ISSA 3JZUA 5AVNA 3ZQ9A 4ADTA 1F76A 3EOUA 1OYCA 3IPWA 1BAGA 1SSDA 5AYXA 4GISA 3SN4A 4X63A 1AFSA 3S83A 4URIA 4XAZA 1XD0A 2EG6A 5KETA 3MSYA 4HMCA 3LD5A 4J40A 4Q4SA 1OYBA 4AH7A 1P4CA 3P0XA 1C29A 4TQTA 1Z44A 3RNDA 5FJJA 2QCDB 2VEGA 4H6EA 2G96A 2EPOA 4M81A 4LRSA 2PURA 3EZ4A 5CZSA 3NURA 2V8ZA 4DF2A 2YL6A 3ABOA 3QC0A 4NVTA 3S5ZA 4AWTA 3IUIA 1V3MA 3P14A 3W81A 2OJPA 3SRHA 4K7YA 1EDTA 2DV0A 5AYIA 4FLOA 4U28A 3IIOA 3VNZA 4ZQRA 3FEQA 2C0HA 2XU2A 4Q8NA 1M04A 4I8YA 5HNNA 2VENA 1R47A 4J1OA 4MB4A 3A3WA 1FWGC 1NFPA 2QF8A 3LZ3A 5HNUA 3GR8A 5KZDA 1V0MA 4J9JA 4QQ3A 1VH7A 3STEA 1J0YA 3CWNA 4JBRA 1JCJA 4Q8TA 2A7RA 1EX5A 3ENLA 2D23A 4JYDA 5FSDC 2JKPA 1ZBKA 4B3KA 2C1IA 5H8UA 1IEXA 2IXUA 3FXGA 3R79A 4ZEPA 1V51A 5F4XA 2HMCA 1R5YA 1N8WA 5A8OA 4UZSA 2AAMA 4B3ZA 2OFJA 5IXEA 2Q3RA 3E2QA 3TK7A 2WBKA 3MKCA 1XGDA 5HULA 4DO7A 3NZRA 1F3XA 1CLKA 3F5LA 5AOUA 2WHJA 4EOUA 1UOZA 3TC6A 2XG9A 1O12A 5LIUX 4J4KA 4LB3A 2ZTJA 4H2HA 3E5BA 4JXCA 2W67A 1XBZA 3UJFA 2PC4A 3VX0A 1A50A 2DGAA 1LOLA 4POCA 3EGJA 1HL9A 1XYBA 3AMLA 4K8EA 3LZ5A 2ZBTA 3B9DA 4IZGA 1S5MA 3C2YA 3OU8A 1OJXA 2VGIA 4KRTA 1P1XA 5D2XA 1UWTA 5D02A 4E4PA 1UWQA 2GWGA 2P1FA 3S47A 2OOGA 3FJNA 4PODA 3WDPP 3KS6A 2XDFA 1NSJA 3BAKA 3MVIA 4B2DD 4IIEA 2IQ0A 5HWNA 1Z8AA 3NVTA 1QOXA 2OWXA 5ABGA 4F3HA 4DI8A 1N8FA 2R1NA 1PAMA 4IG2B 5LNSA 2V2HA 2PWDA 2FGZA 1MEWA 4O52A 1TV2A 3E0FA 1WKYA 3PTKA 4RNFA 3FJ4A 4KWWA 3AS2A 2J7EA 2XIMA 4QX4A 2PGFA 3GM8A 1XPYA 4Q4QA 1R87A 2PTWA 3GFZA 1DHPA 2PSNA 2VC5A 1W9VA 5JXQA 3GG0A 4MZ8A 1JAKA 1Q3NA 3ARTA 1G01A 3KZSA 4IQLA 5TBOA 3THUA 2QCHA 3S2CA 2PF0A 3U5YA 1WYIA 3PS7A 4JGDA 5F4WA 3CPGA 2R6OA 2YOCA 1PX3A 4XZHA 1X1NA 3TV8A 4UTFA 4GQBA 1THFD 5JVLA 3PM6A 2BFGA 1TO3A 1HKWA 9XIAA 3HMJG 4JTLA 2OX1A 2FZ8A 3LCWA 1R3WA 3IGUA 1SJAA 3OHIA 4OHQA 1OCBA 2J7HA 1FKWA 2ZUNA 2WLZA 3W2LA 4O54A 2PLCA 5B80A 1BF2A 3A5FA 3L7RA 5DQPA 4MADA 4NILA 1SJDA 2FPVA 3CZKA 5D9NA 3VIIA 3UEQA 4UTMA 3AUOA 4GJ1A 4PUNA 3QH2A 3L21A 3VK5A 3IS4A 3GNRA 2VZUA 3Q94A 4JIIX 4W84A 3TSMA 1PHQA 3U48A 4KS0A 3GG1A 5A1AA 2Z7GA 3T2QA 4N42A 1DWFM 2ZRVA 3CMFA 1DXIA 2DSVA 3SDOA 1B4KA 3AIUA 3P74A 4FXRA 3AIWA 4QROA 3WLLA 3H2FA 3EX2A 3W37A 1ZPTA 4MM1A 5AYYA 4HOZA 4LOCA 1QDSA 3UWZA 5A6LA 1ZJHA 3CEUA 3SW6A 4AISA 2Z2UA 4I9MA 3A12A 4NAFB 1E6NA 1W5PA 3T44A 3HQPA 4RE4A 3SIMA 5FF4A 3ZLFA 4QSFA 3UFYA 4MLRA 2Q8LA 3PANA 3N6JA 2OLHA 3SBFA 2PDYA 1F8MA 4UR8A 4PBEA 4HKPA 2CKRA 1FWTA 4Q6XA 1J93A 2XVPA 1XPGA 4WJ8A 3VKJA 1B3XA 4ZE5A 1X6NA 3S9YA 3W7GA 2JQXA 1YIXA 1JEZA 4KCVA 1AJ0A 1YXYA 2G41A 4EVZA 3PBMA 5G4HC 3GXPA 1W2VA 1W3NA 5I3HA 5D2YA 2BXZA 3AHTA 3TA9A 4DWSB 3NZGA 4DNMA 4IQJA 1XLLA 4L6OA 2PCQA 4W8BA 3L0NA 5EBUA 1ISXA 4HPJA 4RPQA 3NO3A 1Q2RA 3DECA 2QCEA 3WFAA 4GQRA 1E3XA 4QLKA 2OB3A 4Q4MA 3LSCA 4WXYA 1PSCA 3WO8A 4WCJA 5C2XA 4DI9A 1YDOA 4HNOA 4ZB5A 3WBAA 3AS0A 1XSIA 2Y8VA 2GQ8A 3TROA 4IJCA 4IF2A 2WVTA 1Q7QA 4LAMA 3QQWA 3VUSA 2GGIA 3NQMA 1QPNA 3NL6A 4AWEA 2P10A 1RA5A 2FHBA 2PWUA 3IJDA 2VFHA 2IUZA 3W7OA 3A4JA 4JYEA 3MVTA 3WNOA 4AEOA 4GVIA 4PB5A 3WLHA 3DKJA 1FFRA 5C9RA 5CPOA 1FWFC 2HPMA 4Q8VA 1G9HA 3RCNA 2DIEA 1QOPA 5LNVA 2NQLA 2B31A 2DQXA 5CJNA 7PTDA 2BNJA 4ZXOA 3W1QA 2ISVA 1VZWA 4ZSUA 1MDRA 3ERPA 4W4QA 1RXOB 4R9OA 2XTKA 1VGAA 2I16A 4AD3A 3WLMA 3RAOA 1GTEA 3IJLA 3BK0A 1HG3A 2BOFX 4TO8A 2X16A 4MFEA 3K8KA 5F1UA 1A5SA 3BV4A 2OSWA 2HBXA 1ADOA 5LA1A 2DU2A 3NPUA 3GDBA 4A35A 3M0MA 5FL0A 4NX5A 4NYYA 1NAL1 1P6BA 1V02E 3HO8A 1OHLA 3M41A 3VGFA 3CQKA 2HS6A 4QG9A 3RR4A 1UBPC 1K9FA 4KGJA 4CNPA 5C70A 1QW8A 2CBVA 1J6OA 3PBYA 5AHIA 2JIEA 1VHNA 6XIMA 3WD4A 3OG3A 5I09A 4NZ4A 4D8LA 2E3ZA 2JF7A 2A7NA 1OB0A 2NQJA 2V38A 2QCDA 2REQA 1OF8A 4K3ZA 3CQJA 4PULA 4FIQA 1W3KA 1FFQA 1T5AA 4HK7A 3SCTA 2CIPA 4JFWA 1V4YA 3B4YA 4JFVA 1DYSA 5DEZA 3ARZA 1OFDA 2AKMA 3N4EA 1S3HA 2OX4A 2G3IA 1UASA 1VLIA 3LXCA 4LV4A 2A3AA 1SFTA 1QNPA 3DBNA 1DV7A 4N6EA 2ZZ7A 2OU4A 1HL2A 2O55A 1Z48A 4QR6A 4F40A 5IRPA 1VBGA 3VAVA 1JUEA 1W1A1 4MJ4A 3W0KA 3WQ5A 4PL1A 5LNWA 1TA3B 1RD6A 1GYMA 3ABQA 5BXTA 2BXYA 4UCFA 2WNZA 1QBBA 4PTDA 4HSHA 4NHVA 3HGRA 3H7RA 3HB9A 1KLYA 3UY8A 1A5UA 5FAJA 4DBSA 4YNGA 3C52A 1YHTA 2YDQA 1Q6DA 3LHWA 4J3SA 3B8IA 2C6QA 3SI9A 3MWCA 2FVKA 3CO4A 3SAZA 1H62A 1TIMA 2DW6A 3CPRA 3N25A 4ACZB 2OOFA 2WZHA 3TJIA 4LEFA 1JZ5A 5BU6A 2ZDRA 1BTCA 1H09A 1U5VA 3CTTA 1LG1A 2F8QA 4YIWA 3RGTA 3DAQA 4M0XA 4AZIA 1MRQA 2AKZA 1Y65A 2QVHA 2PE4A 1OGBA 5J04A 3OBEA 3W07A 1Z42A 5D05A 4Q8OA 1R8LA 4Q7NA 2Z29A 3TMLA 5CZ0A 3H21A 3QBUA 3MY9A 3UG5A 1TUXA 1EBHA 2RGLA 4D8ZA 5I02A 3O0KA 3ITXA 3NL3A 3PBGA 3KRZA 3BLDA 5DRCA 4QLLA 4WOQA 2V5CA 1KQZA 2WMKA 4JCLA 2E8ZA 2CKSA 4GI4A 1GVRA 1TPVA 4LYPA 1P7TB 3UNTA 2EPNA 3KM8A 1ZCCA 3ARQA 1JULA 3EXSA 3R0KA 5C0QA 3VOGA 1VENA 1PTGA 4R27A 4E4FA 3DC0A 4W93A 1EXBA 1S39A 2VR5A 4O14A 4WHBA 1F05A 1P6WA 3MDUA 1BG9A 3KBWA 4UCGA 4UTTA 2O9TA 5I23A 4HA4A 3HTWA 1IT0A 5I77A 3OBKA 2V3DA 2CLPA 2GGEA 2Y88A 1GVYA 4ZL1A 3S5SA 3UA4A 1OZMA 4IHCA 4JR5A 4P7QA 2NX3A 3T9PA 4ZSTA 3HN3A 1DORA 4F0MA 4XQ6A 4HCHA 3BAJA 1HGWA 1EWDA 4AF0A 4BWLA 2J4GA 2DUAA 3QHMA 3E12A 2ON3A 1O95A 2YDAA 4MPQA 4LS0A 2QQ6A 8CGTA 1K77A 2X09A 3OQEA 4FLSA 3V1HA 5FEWA 4RX0A 1ZL1A 3A22A 3LMZA 1IEWA 4Y9PA 4K68A 4W5ZA 1JFHA 1XCXA 3LBCA 5EU9A 2MUCA 1KBLA 3ZR6A 2GSHA 2QDHA 3GHSA 4PUDA 1XYAA 3R2GA 1TZZA 4AX7A 4CCEA 4LY4A 3CIXA 1T41A 1PE1A 1XC6A 3CK5A 2VX4A 3KCOA 3BZGA 1CXHA 1ZB5A 3R10A 1TWSA 3EX1A 2NWSA 2P88A 1GUVA 1W0MA 2VCCA 2J7DA 3VC5A 2E09A 1ADDA 1ONXA 3SURA 1GGOA 3FA4A 4EP8C 3TFCA 1EC8A 4IISA 3O16A 3LN3A 4XISA 3GUWA 2QCMA 4R3UA 3D0CA 3GNNA 1D7KA 1RQEA 4GYKA 4H8UA 4NY2A 3H22A 1E0VA 3TUUA 3L67A 3L4TA 1AK5A 1XIEA 2QEZA 3LTPA 4LUIA 1BXNA 1YLVA 1KCZA 4IFKA 3QMTA 3ARUA 4NNAA 3B06A 2E1DA 1XRSA 3W1NA 4IXHA 3T07A 4A05A 3EB4A 3EDKA 4TR9A 3LU2A 2A7PA 3T8QA 4TU1A 1ZFJA 5B7YA 3C8NA 1IR1A 2D0FA 4AXNA 5A2CA 4R7WA 3NXFA 5D38A 2OO6A 1R3TA 1VJSA 4XB3A 3APTA 1A5AA 1J11A 3GW0A 1ISZA 3BANA 3P6LA 1JDCA 3FVDA 2E6YA 4GBUA 5F1VA 3MMWA 1RALA 2YIHA 1BGGA 3PZIA 2BP1A 3MHFA 4DPPA 3WBWA 4G8TA 4XWUA 5E9XA 1I0DA 4ZO6A 3RF9A 4WGXA 4J28A 3RU8X 4DZIA 3HV9A 3B8UA 5CKSA 3KZPA 3WLOA 2VCAA 4FI4A 4MWAC 4C1NB 4O18A 4KRZA 4XAGA 1F61A 1QPKA 3TC7A 3BLEA 2CLEA 2HVMA 4AG0A 4BI7A 1VFHA 2YCKX 4JTIA 3V4BA 4BK9A 3ELFA 4MB5A 3JU2A 4M6VA 4MDOA 2ZTKA 4O19A 4XAPA 3STFA 2Z2BA 4BQ3A 1E1CA 4L56A 1FWAC 2Y6ZA 4JTSA 3GO2A 3UXDA 1VFOA 3TYZA 3JUGA 1OGGA 3AIRA 1JUBA 2YBUA 3V1PA 1FDJA 4QJ4B 1TB3A 4GY1A 1OFAA 3F03K 1UWSA 1M1BA 3TKFA 1TTPA 1K02A 4C6KA 3WN6A 3H54A 3WJXA 1EEXA 1FOBA 4IXXA 2V2CA 1XH0A 2QJJA 1BKSA 1Y5WA 1LRQA 2XH7A 3ARRA 1F7BA 4NL1A 2WSPA 2IKHA 4OBSA 3N29A 5LIXX 5C9WA 4JN7A 4B92A 3BSHA 2DIKA 2JKAA 1X7FA 3FAXA 3RPMA 1V77A 2NVCA 2VELA 3BCJA 4ENLA 2QCNA 5KMYA 1KTCA 1X98A 2V68A 1HT6A 3VNLA 4GA8A 3RLGA 4B5UA 2CEQA 1FCBA 1XJBA 3ZT5A 4L64A 4JNMA 2X0YA 4PFHA 3TN4A 1NVMA 2BS9A 4FF5A 3M0IA 2IPWA 2EPMX 5EKYA 1H5YA 1OT2A 3ALGA 3BURA 3GU2A 3WF0A 2B7NA 5K9CA 2X8RA 3K8MA 1QHOA 3LUTA 3RO8A 3OLGA 8TIMA 2WANA 4KWUA 3M5VA 2YGYA 3QM3A 2H3DA 4DZAA 3RPDA 1RQHA 3DX5A 5DXYA 1HIZA 4I8DA 5DY2A 5TIMA 3ZJ8A 3O0FA 5DT5A 1L6GA 4BS0A 3UCDA 1YTEA 2OMAA 3L23A 4WVXA 4QNEA 1I6NA 3BJFA 1QATA 4LAUA 4PB4A 1U1JA 3I7RA 4QDMA 2VUYA 2PDUA 1QPQA 1H63A 3ITVA 3TTQA 4Z0SA 2WMIB 4IM4A 3DHUA 3U4AA 3NQDA 2D22A 3G6LA 2RKXA 2YL9A 4A3QA 1QPRA 2VEKA 4NZFA 4HU8A 1IQ8A 4JTKA 3UYIA 5HMEA 2BX7A 3G2GA 4L1GA 3R94A 3WIJA 4LUYA 1VRDA 4LX4A 2AMXA 4WDXA 4D6HA 4H7CA 3S9IA 3Q58A 4L1XA 1Q85A 1NDZA 2D3LA 3ICJA 3BWWA 2WK2A 3GDRA 4NJKA 3LLDA 3MANA 1XKYA 4X2RA 1J2WA 1LWHA 4AZGA 4Q7IA 4FMVA 2YKKA 2PMQA 1ZNNA 3LI0A 3H70A 5AHLA 2QXWA 1V3LA 4D1JA 4P7NA 5KINA 1R2SA 4DJDD 1TIWA 3HIJA 3TR2A 3PZNA 5HPCA 3FNDA 2HK0A 3W02A 3UG8A 3UP8A 3P67A 4BFAA 5FF2A 3GVWA 2CZ5A 1C7TA 4O12A 1UBSA 5BMXA 2BHUA 2X1IA 4CNTA 3HJEA 4S23A 1R86A 1RK6A 5HWMA 5A6BA 3VKKA 1JL8A 1C9DA 2P0IA 6TAAA 4GFIA 2BMBA 5EY5A 2E9LA 2GJLA 3IWPA 4GCXA 2ESCA 4PEKA 4UOQA 3TDFA 3Q65A 2DEPA 4I3GA 1SW7A 4Y90A 1S5TA 2ZXAA 3GKAA 1TJ0A 1EGZA 2GZXA 1RSCA 3C2VA 3EWBX 3JW7A 5IBXC 4KRUA 2YA1A 3GBDA 1TPDA 3UESA 4A3HA 3O63A 5EMYA 4NQ1A 2QCCA 3TQVA 3VIKA 3IUHA 2PD9A 3UWEA 4E3VA 1ZRQA 4ML9A 3TEVA 3MMTA 4JNZA 2QJIA 5JIWA 2WB5A 4L4PA 1LL7A 3WELA 4DJFC 3GTXA 2OT0A 3T0BA 2PDNA 3ZT7A 2YFNA 4O50A 2LLEA 4KT2A 4EPDC 1JYVA 1TWWA 4XD3A 4YHEA 2J6VA 3NQVA 4N4QA 4DY1A 5JH1A 1B90A 2D0GA 4MIMA 4U4MA 3IANA 1XD1A 2V63A 4DJFD 1XRVA 1HFBA 1XBYA 4Z0JA 1ITCA 4WX2A 1KWGA 2QJNA 4GZJA 3AZRA 4Q32A 2R91A 2BOGX 4WSJA 3AU6A 1HKIA 4K7VA 1TWZA 2EGZA 2ABAA 5JUVA 3S3GA 2ZRWA 3PAOA 1F2JA 3LQGA 2WCSA 3MUXA 3R58A 3B97A 6ENLA 4X0NA 5CPTA 4YHGA 3B9AA 1H60A 3OGSA 3BTNA 5LA0A 2Y89A 4FAMA 3P60A 1I60A 5BWAA 3AFBA 5B7ZA 4IL0A 1E5NA 4LNCA 1W1ZA 1XFCA 3TNOA 1KBIA 2AQOA 3ATZA 2Q71A 1O6IA 2DT0A 3B0YA 1HQTA 4BEQA 3SRFA 1SJBA 2QDGA 5DMMA 4F0SA 3LHTA 3PVFA 1EGVA 3NVDA 3RLUA 3I3BA 2WO5A 1FA2A 2FJUB 1MQRA 3A64A 2UV8G 5FKYA 5D9OA 5HUOA 1GEQA 4N9EA 4PMQA 2X2GA 4JZ5A 3KCJA 4G6CA 3ZVIA 3FHAA 4QXIA 3LLFA 3OVQA 1AMKA 2GSJA 3CB3A 3E0VA 1A5LC 5H2ZA 4FX8A 4LS2A 2RJHA 4HPNA 1UP3A 4L9YA 5LIYX 2PWVA 4MJZA 4WXZA 4HNVA 1XS2A 4JHMA 3VGDA 1EO5A 2QUTA 4DLMA 4GINA 4R53A 4RLIA 3UZZA 3V16A 3G8RA 1YKWA 2WMFA 1EO7A 4GLEA 1ALDA 1F8IA 1HVQA 3WD2A 1YYAA 3HBLA 1ZUAX 4P61A 3EPMA 2YL5A 3WH6A 3N11A 3W2NA 3V18A 1DJYA 5I6SA 1KCKA 2FTPA 1RP9A 4L4MA 1E73M 1UJPA 4L9ZA 3AC0A 3RM4A 1W8GA 3WNPA 4KEUA 2XN0A 1B1YA 1FXPA 7A3HA 4RCXA 3EKZA 4CQAA 3GFXA 4JN8A 3KCLA 2PTDA 4MNMA 5T9CE 7XIMA 2Y7EA 1V6VA 1XYZA 1XDJA 1FBAA 4HP5A 5EGRA 1J79A 4AHOA 1BVZA 3WQCA 3VM5A 2CZDA 3BLPX 1E72M 1F4HA 3ABSA 5FA5A 3MV01 2XVKA 2QF7A 3CNYA 1R3SA 4GXPA 3PJXA 4U31A 2A3HA 3BCDA 3P93A 1I2QA 2V30A 2QDEA 3U57A 4FNTA 5LZLA 1NM9A 3GB6A 1ME7A 3LX9A 4WDTA 2FPTA 3CL7A 2ZXQA 1KKRA 5CZKA 4DZ5A 2CC0A 2NLIA 4OT7A 4ZMGA 1MSSA 5HNRA 1XBXA 2F7FA 1OC5A 3I6EA 1SZGA 3GC2A 5FF7A 1TQJA 1SYTA 1WDRA 3A6OA 4M6PA 1CIUA 1Z7AA 1HJUA 1PDYA 2IW0A 3UWUA 2XSBA 3M43A 5ENLA 2ZE3A 4RNIA 1GZGA 4M3PA 4K8HA 3TN6A 1F74A 2EPKX 3OO2A 4YCPA 3THCA 2CU0A 5ABFB 3A4AA 2OSXA 4K2SA 3LGGA 3H23A 1JZ3A 1RAKA 4CD4A 1LJYA 1J0ZA 1VYPX 1KXVA 4QS6A 3VCRA 2D2OA 4DUXA 2P3ZA 3GNDA 3OYZA 2INFA 3IK2A 2B4GA 3WLQA 5E6ZA 4DUOA 4LF1A 2W92A 3GY1A 4O4VA 4W7VA 2OQHA 2A3EA 3WBYA 5BW6A 3B9OA 1GW1A 1ADSA 4WUIA 3LENA 1GOKA 4Z1BA 4AIOA 3LY0A 3O07A 3TWBA 3EPNA 2GLKA 3KOYA 2PLMA 1RHCA 2X1SA 1SU5A 2UBPC 2X30A 2YA2A 2KX9A 5CZJA 3GVGA 4AC7C 4JL1A 1DJWA 1PYFA 4ACYA 4JTHA 1VCFA 2C91A 2W3ZA 3VOCA 2XPKA 3BAXA 1XQLA 4B91A 1GKRA 5A5WA 1UD8A 4QITA 3SUWA 1P0BA 4CD8A 5JBFA 1E6ZA 1MDLA 5M3WA 1S1RA 1OT1A 3N12A 4US5A 2C14A 4X61A 1X38A 2PI6A 3DFNA 1V8EA 4JIRA 3O6YX 2BGNE 1VBHA 3M1ZA 1VEPA 3IEBA 3SCPA 7CGTA 2C71A 2TAAA 2DVXA 3QTGA 2ODOA 3BW4A 3SRKA 1HN1A 1UCWA 4Y8FA 4IGMA 1M7XA 5KZ6A 1OK6A 2PU1A 3HJZA 3T05A 3UYCA 3NDOA 3BLOA 5J8LA 3BG9A 1NH6A