3BDKA

Crystal structure of streptococcus suis mannonate dehydratase complexed with substrate analogue
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
363
structure length
349
Chain Sequence
b'SHMKMSFRWYGKKDPVTLEEIKAIPGMQGIVTAVYDVPVGQAWPLENILELKKMVEEAGLEITVIESIPVHEDIKQGKPNRDALIENYKTSIRNVGAAGIPVVCYNFMPVFDWTRSDLHHPLPDGSTSLAFLKSDLAGVDPSKEEMKAIIENYRQNISEEDLWANLEYFIKAILPTAEEAGVKMAIHPDDPPYGIFGLPRIITGQEAVERFLNLYDSEHNGITMCVGSYASDPKNDVLAMTEYALKRNRINFMHTRNVTAGAWGFQETAHLSQAGDIDMNAVVKLLVDYDWQGSLRPDHGRRIWGDQTKTPGYGLYDRALGATYFNGLYEANMRAAGKTPDFGIKAKTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-mannonate dehydratase
molecule tags Lyase
source organism Streptococcus suis
publication title Crystal structure of Streptococcus suis mannonate dehydratase complexed with substrate analogue
rcsb
total genus 108
structure length 349
sequence length 363
chains with identical sequence B
ec nomenclature ec 4.2.1.8: Mannonate dehydratase.
pdb deposition date 2007-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03786 UxuA D-mannonate dehydratase (UxuA)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.150 Alpha Beta Alpha-Beta Barrel TIM Barrel Divalent-metal-dependent TIM barrel enzymes 3bdkA00
3M0LA 1DE5A 4A8LA 3IUDA 4ZB0A 3ITVA 8XIMA 3N4AA 5J8LA 5XINA 5EMKA 5AVNA 3TVAA 1XINA 1XLJA 1TZ9A 1YX1A 1A0DA 2I57A 1XIHA 3QYSA 2QUNA 3QXBA 1QTWA 4LNCA 4QE1A 3VNKA 1BXCA 1XYCA 1XIJA 4YTUA 4HGXA 5XIAA 3KCLA 4QDPA 4YTTA 1OADA 3U0HA 4KW2A 1XLFA 3JU2A 2G4JA 3C0SA 3QZAA 5EMLA 3UA4A 1S5NA 5H1WA 3XIMA 5XIMA 2NQHA 3QC0A 2QULA 3L23A 3KCOA 4A8NA 1XIDA 1GW9A 1DXIA 3BZJA 4DVOA 4A8IA 3ITLA 1QUMA 3M0HA 2J6VA 3C0LA 3CNYA 1XIGA 3CQHA 4G56A 1XLKA 3KBJA 6XIMA 1XICA 3P14A 1XLBA 1XLDA 4Q7IA 4US6A 4YTSA 1S5MA 3XINA 4PGLA 2GLKA 1XYLA 5C9ZA 2NQJA 1MUWA 4GJIA 3CQJA 3FVMA 4HHMA 3UU0A 4QEHA 5B80A 1MNZA 9XIMA 2GVEA 2HK1A 1K77A 3M0XA 2GUBA 1QT1A 3UVAA 3LMZA 1XYBA 3BDKA 1XIBA 6XIAA 4K3ZA 1A0EA 4E3VA 1XIIA 4XISA 4YTQA 3VNMA 5I7GA 4XSLA 4EACA 1XLMA 3UXIA 3DBNA 4OVXA 4QDWA 1BXBA 1XLGA 3ITYA 4X61A 3U3HA 3KBSA 4DUOA 3TC3A 2HK0A 2HCVA 4QE5A 4GJJA 5EMMA 4YTRA 5B7YA 2XISA 2ZDSA 1XLLA 5TNVA 1XLHA 3WQOA 4J4KA 8XIAA 5B7ZA 2NQ9A 4K1GA 2G0WA 3ITXA 3VNLA 1XIEA 3OBEA 4W4QA 1XYAA 2ZVRA 1I6NA 2X7VA 3BZGA 1D8WA 4XIAA 3NGFA 3KBWA 3AYTA 3CQKA 3UA3A 1XLAA 4HHLA 4QEEA 4A8RA 3VNIA 4XIMA 3KBVA 5FA5A 1XYMA 3VNJA 3KTCA 1XP3A 1XLCA 3C0QA 3M0YA 4X60A 4XSMA 5EMJA 4GLEA 1DE6A 1XLEA 2OU4A 4XKMA 3VYLA 1I60A 3ITTA 2QW5A 1O1HA 3AYVA 4PFHA 3IUIA 4ZB5A 1XIMA 1CLKA 3M0VA 3BWWA 2X7WA 2GYIA 4HNOA 4ZBCA 3XISA 2Q02A 3KCJA 3P6LA 1A0CA 3DX5A 4GQBA 1XLIA 4X63A 1DIEA 3AALA 7XIMA 2I56A 3CQIA 2QUMA 3CWHA 3KBMA 3BANA 1DIDA 5H6HA 3KWSA 3GNXA 1XISA 3IUHA 3M0MA 2XINA 5AVHA 4EAYA 3KBNA 2XIMA 4QE4A 3AAMA 1XIFA 3ITOA 4ZB2A 9XIAA
chains in the Genus database with same CATH superfamily
1P6CA 1WKFA 1FHLA 3LV6A 2IS7A 3ITCA 1L9WA 1YX1A 3T9PA 2FZBA 1GZGA 3H53A 1S1RA 2C0HA 4EANA 1R9XA 3VX0A 1QWGA 1IZJA 1PEZA 2Z1BA 2J66A 5HPCA 1AL8A 2QHAA 1GCYA 1VCFA 1G7UA 4MB3A 2ZXAA 3PNZA 3VGFA 2X1UA 1BRLA 1AUSL 3QZEA 3W2MA 2WXDM 3CNYA 3NDZA 2I14A 3VC6A 3W1RA 1EFZA 3OOQA 1OVDA 1DYSA 3WDHA 3B05A 1J0KA 3WBEA 2PPGA 2E6FA 1S46A 7TIMA 2ZX8A 4EAMA 4HHHA 3B0XA 3PUDA 3W1NA 4DJED 2OZ0A 2X1RA 3TMQA 4AZGA 1G94A 1K8YA 2DZVA 3FY1A 1QCWA 4DELA 3EWWA 1LT7A 2J74A 2QIIA 4MGGA 3NGFA 3KBWA 1H11A 2QVHA 2OLAA 3WQ6A 4FNUA 5I0DA 2HV5A 3ABRA 1CGTA 2HZGA 4B5SA 2WC4A 3TV8A 1UKQA 1NP0A 3THDA 5BWFA 3KAOA 1F4AA 3NQAA 1KXTA 1G6CA 3WLJA 1RPXA 3RPDA 4JXCA 3MP5A 3W1MA 1C8YA 4W9TA 2X0SA 3EA3A 3OQEA 3H23A 1XCFA 4IFRA 2V69A 3VNZA 4PUKA 5CZTA 1TPVA 4S3KA 1J79A 1ISYA 1IXPA 4O53A 3PZ9A 4PN2A 1OINA 4YVPA 3KP1A 2PTWA 3RPTA 4URIA 3TA9A 1FCVA 3LCHA 2ASHA 3B4UA 3EPMA 5C2GA 2PDCA 1DWJM 4JTAA 1ZB5A 1F3TA 1VH7A 4FF7A 4GQQA 4LVBA 3CAKA 1DHPA 1XCXA 1AQHA 1GHRA 4NHVA 1VYPX 2RAGA 1J2BA 3CIWA 3CC1A 2ZWZA 3P8IA 1SFJA 1ZRQA 2PDXA 1GVQA 4F2BA 2AKZA 3AXMA 3DI0A 1JYWA 1UR1A 1DJHA 4D6JA 3UF9A 1NU5A 6CGTA 1KQYA 3VM7A 2J7CA 1EF3A 4Y9MA 3CV7A 3R0DA 2X7WA 4S38A 3IVTA 3B9OA 3WKZA 4C1LA 3LK6A 3HV8A 4QHRA 5JXQA 4KCTA 2E5DA 2POZA 5D09A 4LS1A 3W37A 1IT0A 1MDLA 1AMKA 2Q01A 1PB0A 3M6YA 1XQKA 3OBKA 3Q4DA 2CHNA 4LAMA 1JCJA 1JRCA 4LX4A 4HNNA 4PL2A 4ZO7A 2W91A 1A47A 4W7WA 1JPHA 5KZMA 3A64A 4H2HA 2WQPA 1PXGA 2WZMA 4Y9AA 3LGDA 1ZJAA 4C7GA 2ZADA 3ARPA 5AHFA 3MUIA 1H3GA 1UH3A 1A53A 1F6PA 5FOOA 3TYZA 4J3ZA 3TQVA 4JKKA 3V1PA 4PTNA 3GG0A 2B7NA 3SJNA 2VDGA 3BAIA 1F3XA 1WKDA 4RK8A 4IUGA 3NNTA 2C18A 3WH8A 3REQA 4LUSA 2R14A 2A3BA 2PGFA 3LLXA 4XVDA 5KSWA 3WK1A 4WVXA 2YZRA 3KOWA 4AQLA 4A8RA 3H4XA 1RQEA 3GG7A 1XYMA 3GIPA 3GYEA 2J9YA 1V3HA 4EXQA 3G18A 2CCRA 4QBXA 4QROA 3M7SA 1Z9AA 3IS4A 1CDGA 4Q8WA 2ZRYA 2ACRA 4REQA 1FH8A 1CGYA 5HMSA 2W63A 4S3GA 3H55A 3VIHA 3W7QA 2DEPA 4QNWA 2Z1XA 4ZFMA 2C7FA 5JIPA 3PBVA 3ZR4A 3WBWA 1CGUA 2FVMA 4CNPA 3NL3A 3PTKA 3T05A 3KVJA 4F4RA 4Z1DA 3UBPC 5FJTA 3C2EA 1R85A 2PF0A 3FYPA 3SADA 3W83A 4YTSA 1CXIA 1W54A 3NZPA 5I2UA 2CFFA 3LU2A 5D2YA 2A3LA 4A4AA 1GWJA 1TX2A 4ATLA 4UZUA 2VEGA 2V0TA 1WYIA 3BQ6A 1V6XA 1S5TA 1KM0A 2VDHA 3IJLA 2HE8A 2OGJA 3ABQA 1KCZA 1TVNA 2W61A 3GTFA 4GXWA 3A4JA 1EJUC 5A8PA 3UJSA 2J13A 3DGBA 3MUAA 1E0UA 2Z6JA 1E6ZA 3ECQA 3PULA 1JDFA 3U48A 2C3ZA 2E5CA 3MP4A 1HIZA 2E6YA 4GCXA 5AHMA 3GQYA 3MB9A 3BCJA 5EA9A 4UR9A 2DT2A 1OX4B 4OOUA 4L4OA 1G5AA 4RUBA 2WCSA 4HNVA 4BQ5A 4DZIA 2OPJA 5CSYA 2P5NA 1VIZA 1JDCA 1QNQA 2XINA 1PIFA 3KBNA 5D2TA 3CO8A 2A6LA 4PUNA 4RW5A 1ZENA 1MQQA 7CGTA 1WE5A 2GQAA 1HJVA 1G0CA 1HQTA 3TJLA 1MRQA 4HA1A 1REQB 3EDJA 2FZNA 5CBJA 1HFBA 4GUGA 4G6CA 4TQTA 2GVYA 4AZCB 3GU9A 2E1WA 3VIJA 4J2PA 4AWTA 1HO1A 1XGEA 1KTCA 3WQGA 3SRFA 1KBBA 3MA8A 2ZTJA 2QPUA 4ZOAA 4J2MA 3ITYA 2TAAA 4AY1A 4AWSA 4GJJA 2BV9A 4EWJA 4LNYA 5T8GA 3WMLA 1EHNA 2PTYA 4A2SA 4QXIA 4BQ3A 3GUGA 1XFBA 3AHXA 2HDJA 1P6BA 4OT7A 3A3WA 4X0VA 3BMVA 4J27A 4IT1A 2Y7DA 2NX3A 2BOGX 4ICNA 1MZHA 3EOSA 1G1YA 3M64A 4BF5A 1GYMA 3BSMA 3IUHA 4A35A 4EX4A 3B9DA 4UFIA 5DMMA 1QNVA 3ITOA 4IPLA 3GD6A 1W5PA 5D32A 4AB4A 3F5JA 4BY3A 3R89A 1W5OA 1XR2A 2WBKA 1DIKA 4G7FA 3NQ6A 2WMFA 1H49A 1OADA 2WSRA 4MZ8A 1BVNP 3QMSA 1LRNA 3B8DA 3OZOA 2G5WA 2AMXA 3GZAA 3AMKA 4GZ7A 3TH6A 4WKHA 1JUKA 3ITLA 4Q8NA 1XLKA 5BZAA 3LTPA 4O1CA 3B40A 1L2QA 2PTDA 2E8ZA 1ODZA 4BJHA 2WK2A 3OGSA 3TFXA 1MW1A 2OT1A 2G96A 3SCWA 4PR4A 1NFBA 4N0RA 2YL6A 2DSUA 2XZ9A 3MCOA 1ICPA 2DZXA 3DKJA 2XISA 5HMEA 5JU6A 1OGSA 3AXIA 3QMTA 2VOTA 4C65A 5I07A 4GYFA 1TPUA 1EJVC 4NNAA 1ADDA 1W56A 1PKYA 3UXDA 2GOUA 1MI3A 4JIPA 3UWZA 2Y5EA 4EPDC 3ZZ1A 3N19B 3R25A 1W3TA 3LNMA 4KS0A 1VLIA 1MQPA 1RY0A 2XSXA 3WNPA 2IPWA 3GAYA 5JIWA 1D3GA 4IGHA 3GFZA 4RCXA 1XDJA 1ZP3A 3E49A 1POKA 1J6PA 1R47A 4AF0A 1W37A 1FKXA 5LNWA 3SUVA 1AA1B 3SRDA 1IWPA 1M41A 1QBAA 1T7LA 2GGIA 4TR9A 4CVUA 1RVKA 3TW9A 5CJNA 2X1SA 5IRPA 1IXOA 1R3QA 4ZTYA 3UGVA 4R7WA 2Z7KA 5CH9A 1W9XA 1M7OA 4PMOA 2EJ1A 1V4YA 1FWAC 5HJXA 1W2PA 4H7ZA 3UZWA 4MMWA 2OZTA 3N2XA 5BMWA 4LU0A 5BOFA 3W23A 4U4MA 3VPLA 1P0EA 1XIIA 3RF9A 4X2RA 3RLUA 4KESA 3WK2A 3AIBA 1E73M 4H9TA 1TUFA 1EEPA 2BXZA 1KXQA 1FFQA 1FCUA 1MSSA 3NQMA 1EBHA 3PJUA 3PZQA 3WK0A 5AHIA 3KZSA 5REQB 3QHNA 1JDAA 1TG7A 4F3HA 4PMJA 3L2IA 1JFHA 1E6NA 1J8VA 4L1WA 4W93A 1PO9A 4XZ9A 1LUCB 3SUWA 4M82A 4ZFCA 3JW7A 3VUSA 5H6HA 3NXLA 5A2AA 3T40A 3HG3A 4CEXC 1ZJIA 3S9YA 3IUDA 3S2JA 2INZA 4KCVA 4HK5A 1UIOA 1LOSA 2D2HA 3GXDA 1EOMA 1JFXA 4RNHA 4AVFA 5ABFB 5XIAA 4GI4A 4JTEA 4AD3A 4DJFC 4HP5A 3C0JA 2UY2A 4QFUA 4BZYA 4LY4A 1QW9A 2C1HA 2W9MA 1QW7A 3TNBA 1J2WA 1I0BA 4GX9A 5FSEC 3DFNA 4AAJA 4C6MA 3BW4A 4JKMA 5KZEA 1RBLA 4PGLA 2AQWA 1XYLA 1BTCA 1J12A 4RNFA 1CLXA 3U5UA 3DI1A 1K77A 2WJEA 3FK4A 3LHYA 3M1ZA 4MKNA 6XIAA 3VD5A 3VGHA 7TAAA 3WBAA 2BHYA 3H2FA 1S5WA 1TB3A 4EPKA 1XLGA 1QJWA 1ADOA 4C1NA 2WMJA 3WD3A 4IF2A 3EKLA 3N29A 1OYCA 1R7AA 4LGXA 4PB4A 1J0HA 4LVFA 1J9YA 4HMEA 1UMLA 2PWDA 4QSFA 4XZHA 1XLEA 1TKKA 2NQLA 3CTLA 4DWSD 3WLKX 1KXHA 1YDNA 3BSGA 1F6KA 3AALA 3SFWA 1OGBA 3QRHA 3CUHA 4HBKA 2A7PA 4XKYA 3WLIA 1Q6RA 1KFLA 4IGMA 3F4NA 2PZNA 4LRSA 1WXJA 3H7RA 1TWIA 1O4UA 4XD6A 3LTYA 4B5TA 1UPMB 3QHOA 1UP0A 4LS2A 1VRDA 2ALDA 3NAVA 1Q2SA 2DSWA 1XKYA 3GHSA 1ALDA 1HGYA 2ATMA 3GW3A 3KOXA 1SFTA 5LNVA 1FP9A 2G3IA 3L9CA 4B4HA 2P10A 4HCDA 1R3RA 3E0LA 1UIPA 2Z00A 2QCDA 2Z7GA 2YL9A 5HANA 3U6WA 2VGFA 3RITA 4LUTB 3RAOA 4G2DA 4LW7A 3VCCA 4A3RA 4X9SA 3ZSSA 1M03A 1EUAA 1F7BA 3LM3A 4LF1A 2QZRA 6TIMA 2NSXA 3E0IA 1RH9A 3N4EA 2V38A 4NYYA 5HK4A 2BASA 2PDNA 3N34A 3QVQA 4PCFA 4PB3A 1KKOA 2OYLA 4UIOA 6ALDA 3ANVA 3TEVA 3VA8A 3NPUA 2NQ5A 1WZLA 1A4LA 3HO8A 3GKFA 3UJ2A 1LORA 5LNUA 4TIMA 3CUFA 2EPOA 2ODOA 3FYOA 5LA0A 1PWMA 3JZEA 3ZO9A 5C7VA 3AZRA 5KETA 4EXAA 2YPIA 2QV5A 3ZM8A 3NPXA 2EF9A 2JFEX 3T8QA 3TTYA 2Y7GA 2Y8KA 3UJEA 2FMOA 4JFVA 5DN1A 1XIGA 2DH2A 3HPSA 4GYJA 3S3GA 6A3HA 4WKFA 3UU0A 2F7FA 4D8LA 1CGWA 1RV8A 4TMCA 3UVAA 1HKMA 3EX4A 1ZAIA 4UTHA 3OGVA 5D8WA 4OE7A 1EHAA 4ZO6A 3WDPP 1KBKA 1EJSC 1S3TC 1E9YB 2OYKA 2OB3A 4NU7A 4D6GA 1H1NA 3IJ9A 1QU4A 1F2JA 1DWFM 4KCWA 1CX9A 4NJKA 3MHFA 4QCEA 3UETA 3SCTA 1KTNA 4FXJA 2GSHA 4AH7A 4BQ4A 1DP0A 3H7UA 3CAVA 3WJXA 3FAWA 1KV8A 4WCJA 4JIEA 1K6WA 3NURA 2F8QA 1YBQA 3VIMA 4BWLC 3VKBA 3CT2A 1EJRC 2GQ3A 1J0YA 1YW1A 3FS2A 2WHKA 1BXCA 3VAVA 4HYRA 2PD5A 1JPKA 1QASA 4W84A 5F4XA 3GXIA 1W0MA 2C15A 2NUXA 4AZCA 1AJ0A 3L4XA 1B5TA 3DENA 4BEQA 1UD5A 5LGZA 2X09A 4YCOA 4O57A 5BYWA 3ZXWA 2DV0A 4PMXA 1XPYA 2Y6ZA 3TWAA 1J0JA 1LQAA 3TN4A 3E12A 2HE5A 1Q7QA 2P53A 5CAKA 4PMQA 1CPUA 4UTWC 4LYKA 3AS0A 5G1MA 1XW8A 3BLPX 1GPFA 1QI3A 5AY7A 3VMNA 5KITA 3EWCA 4B2DD 2VMFA 3CAWA 3RNDA 4IJCA 3WSUA 1W2VA 1GONA 3URNA 3NO1A 1E4IA 4NL1A 5E0KA 4B2DA 3MHUA 3WK3A 3NL2A 4P7RA 1BEUA 3I3BA 3QYQA 5E6YA 3VDBA 2PZ0A 1S2TA 5T9BG 4QSHA 3UCDA 2W5FA 2PDKA 2YDRA 3D3FA 3LRMA 3PM6A 1X6LA 4POCA 3LBCA 5DBTA 3BGJA 4Y9OA 2C0AA 2BOFX 3S2LA 2OQLA 3EMCA 4X63A 4GY0A 4WX2A 4DJDC 3SSZA 1EGZA 2BOEX 2NSOA 4CQ8A 5I09A 4U28A 1L6GA 1E6XM 3NZGA 1BVZA 4AD5A 4XZLX 2PP1A 3T07A 2D22A 3KUMA 4PCSA 2VCCA 2XFYA 2VWSA 4AIOA 4FEZA 3SB0A 4QS5A 2PF8A 2JF7A 1JZ7A 3O1NA 4GVGA 2X1IA 4WDXA 4M6UA 3U2EA 1C91A 3MO4A 2R1LA 3TYBA 4AHQA 2DZBA 4I5UA 5D2XA 2PSNA 1JZ5A 3L12A 2PCQA 1BGAA 3FJ4A 1EWEA 4Q4RA 1MUMA 2C13A 4O15A 2Y5JA 3PWAA 3NPWA 2I5QA 2GK1A 3W4RA 2WVUA 1RK5A 2V5DA 1IEIA 2VDIA 4JTLA 3GIQA 2FMNA 8XIAA 2D73A 3VNLA 5ECVA 4MAZA 1IHIA 1XYAA 2H9AA 2A7RA 1W9DM 4S2BA 1R9ZA 2DT0A 4FK9A 4L61A 1FFRA 4MB5A 2BWGA 4KCUA 4NAFB 4PYSA 3T0TA 3AIWA 3R12A 4PMDA 2WQDA 3ALFA 8A3HA 4U10A 3TC6A 1N8FA 5I23A 3MO7A 4PSRA 1G67A 1DWHM 2PC8A 1FVPA 4D1JA 2Q8XA 3O0KA 5EFDA 2X0YA 2B31A 4MLRA 3V3WA 1LRTA 1JYXA 1QTWA 1HO4A 5AYIA 4YTUA 4IZGA 4JQ4A 4B3KA 3GTHA 4HTBA 4NNCA 2EPLX 3WQWA 4P7QA 1QPKA 2Y8VA 3QOMA 3TMLA 3SQLA 2GGGA 2JEPA 3E6EA 3KOFA 2DSZA 3EPOA 1C92A 1RP9A 2BHZA 3IGSA 4OBRA 1UC5A 3MP3A 4I9AA 4J3VA 1BSIA 4P8VA 1UUQA 5JBFA 3UYIA 4E0CA 2WSKA 4FAMA 1EJXC 3NJ3A 4YPJA 4LTSA 3EKZA 4A3UA 1TVPA 2QT3A 1GQKA 5CPOA 2EKCA 2GVGA 5C2XA 1XRFA 1OFPA 3WQFA 1IWAA 2R1KA 3DYMA 2GWGA 3B9NA 2ISWA 3NM1A 1V02A 4OKDA 1FRBA 4F9DA 1LBLA 4P8XA 2G3JA 5M03A 2EEXA 1KKRA 1E51A 2C91A 1S1PA 1OSEA 4UTWA 3FW6A 2CWNA 2FGZA 2BP1A 1H7PA 5KMYA 1V7YA 4N7QA 4ZE4A 4NSBA 2VL4A 3DHPA 4XAGA 1GOQA 3GDRA 4EF8A 2V3GA 2XJ7A 1GEQA 3HTWA 3N6QA 3CUIA 3LQGA 1LTDA 4FNQA 5BXPA 3WD2A 3VZYA 5I77A 2ZTKA 4WJEA 3GU1A 4Y2WA 8RUCA 3NSNA 4NQ1A 3W7DA 1RUSA 2V2DA 4B5WA 6ENLA 1ZQ5A 1SZNA 4M1BA 4Z0SA 4P7LA 2QF7A 3G1HA 3STGA 1F6YA 5AFDA 3RLVA 3NYZA 4G56A 1JGIA 1YTDA 3BG5A 3SSJA 3R8GA 4NZ1A 1C9DA 2VZTA 4AD1A 2YYTA 2Y8UA 2FKPA 2ANUA 3APGA 3HGRA 4K68A 3PR2A 1ZCCA 2JK2A 2W79A 3RK8A 2QV4A 4ROQA 1JI2A 1XHGA 3WNNA 2CLOA 4JY8A 2ZVRA 4LVGA 3AI0A 1GORA 3H2CA 1WOAA 1M7XA 3D6NA 1M7PA 5I3FA 3REQB 3VGGA 2E4TA 4KRZA 3W84A 3UR2A 3VOIA 1OCNA 3TCSA 1O7AA 5BRQA 4Q32A 4Q6JA 1QK2A 3B0YA 4A2RA 4M29A 1V8EA 2E40A 2P3ZA 3SCPA 2WKGA 3T0DA 1T99A 1U30A 1UH4A 4M6PA 5CC6A 3TSDA 3MSDA 3CH0A 5TAOA 5CEWA 2ZKMX 4OOZA 3NQEA 3G1AA 2C79A 2X2YA 1DQUA 4GACA 1QPRA 2VEKA 3VD7A 1JCNA 2PMQA 3WLOA 2XVGA 4DUVA 3B0PA 1E71M 2XPKA 4O1FA 4Y9NA 2PLKA 3N25A 3VKAA 1N82A 1E15A 2I5GA 2E6DA 3A12A 3I7SA 1RVGA 3BOLA 3G1SA 3A23A 2J62A 1IXNA 4UQDA 1ISXA 5C5YA 1XF0A 1XRVA 5ABGA 4DM1A 1OX5A 4LBUA 3O8AA 5CPMA 3IEBA 4LANA 3UT0A 1DBTA 3DEQA 3USZA 3O63A 5AOUA 2POTA 3HZ3A 1LRQA 4H7CA 3EOOA 4DXVA 2CLKA 3OVRA 1T96A 4P7NA 3S0CA 4RV8A 3UG3A 1S2AA 3LDVA 4HT3A 2DSKA 3ARWA 2PS2A 4DBDA 2V5LA 5K9CA 1DJNA 2ONEA 3KBSA 2QCLA 1PL9A 4K7VA 3BV7A 4I6VA 1I0DA 2E6AA 5B7ZA 1GJPA 1X7IA 2QLYA 2YCLB 4JX5A 1J11A 3EX2A 1TPWA 2Y61A 3DERA 3O16A 2CBVA 1CYGA 1FHUA 5C2CA 4Q3MA 1ZJBA 3RFAA 2Y7FA 5DFAA 3U4FA 3B8TA 3CB3A 4UC5A 3UG5A 4H9UA 1UR2A 4OV9A 5A6AA 2FHFA 1PHWA 4QJ1A 4ZL1A 1V7AA 2IKGA 3ZLGA 1J01A 2C6QA 1ITXA 3KBMA 4AZHA 3R11A 4F2TA 3PY2A 3WD0A 5EL1A 4J3UA 5D03A 4AWUA 1XIFA 1KLZA 2RJGA 4DIAA 2E25A 3CZLA 2CBIA 4G8TA 4GZIA 4JAWA 1HG3A 3UZXA 1JPDX 3FKKA 1JZ6A 5DELA 3R0KA 3U0HA 5LIYX 3PWIA 3I65A 4QJ4B 3GXMA 2J9XA 3STPA 4GABA 1JNDA 2PWFA 3MPGA 4ZQCA 1Q6FA 3B4YA 1Z32X 3EWXA 4M51A 3T8LA 1S2CA 3RIKA 4DVOA 3EX3A 1EYWA 2PDPA 5CPTA 2PDHA 3FEMA 3B9AA 5ABFA 2OO6A 3WJYA 4K6AA 4U5IA 4GX8A 3AUOA 4HPJA 1OIMA 1U83A 1ZNNA 4ACZA 3M46A 1B3ZA 2YZ5A 3H24A 1KBIA 1W3IA 1GUVA 2PRHA 3UZYA 3SZ8A 1PUDA 2D0HA 3WD4A 4RZ5A 1SSDA 4TVCA 4NI3A 4XIAA 2VO5A 3KOZA 3S6OA 2QKFA 5G4HC 2D3LA 3NL5A 1H7RA 3ZWTA 4UTFA 2WYSA 1O1HA 4ZSTA 4DWDA 4IIEA 3GVGA 1B3XA 4CLMA 4D6FA 3Q37A 1YDVA 2ACUA 4PUMA 1X1OA 4MNLA 3DFHA 1E40A 4PMYA 3QV7A 1GT8A 1TPH1 5G1YA 5LXXA 4J3WA 1UKTA 1RCQA 3B8WA 5AHNA 3K46A 1XC6A 4Z0JA 4B9ZA 1F61A 4B9YA 4KIEA 2PBOA 3GR8A 4XZWA 3QLDA 3TUUA 2FJUB 2DZTA 2FPVA 4X3ZA 1L8PA 3UY7A 5GNYA 5LA1A 2YCLA 4H9XA 1GW9A 3THAA 5I3HA 4XV0A 5BXTA 2FHBA 1V6WA 4Q6XA 4LF2A 4QDMA 3D5HA 4UTMA 3CHDA 5MKGB 4H00A 1SJBA 3VD4A 3HPZA 2ISSA 3T0CA 4LUYA 2ZCGA 2FJKA 3M0XA 2F6KA 3BLDA 4O52A 1ITQA 4Z2HA 4IFKA 2J78A 4I9MA 5AZ0A 4H6EA 3CPUA 2V2CA 2BS9A 2OTDA 4ROPA 1B2YA 4NY2A 3SJ3A 4LYPA 4L80A 3WBYA 3STEA 1U1HA 1OFQA 4W87A 3GVWA 1NDZA 5JBEA 2VX4A 4O50A 4R85A 5DY3A 3LGGA 5CZ0A 5IBXC 1VB9A 3C3NA 1JEZA 1E6PA 3QF0A 3KCJA 3AICA 1PHQA 3ZLHA 5E0CA 4GKLA 1UW9A 3MTWA 3KWSA 3UG8A 4RV3A 3W1XA 1XSJA 3KL0A 1OF6A 3V0UA 3TVAA 1ONXA 1MNSA 2YCEA 3EPNA 4LNCA 5DMNA 2BB0A 4YTTA 2FVLA 4N02A 1TX0A 3HG4A 1H51A 3V0TA 2DIEA 1F3EA 1S38A 1W1ZA 2VFHA 2ZIDA 3WQ5A 1E4MM 4QQUA 2FTYA 4H6KA 3HGSA 1O5QA 2FFCA 2UZ9A 3TTEA 3DFPA 2Q09A 4H01A 4X9YA 2VZSA 2ZRZA 4DXKA 5HWJA 3AXXA 4GI8A 3ZIZA 4R33A 2FFIA 1P6WA 4C6JA 5GVJA 2IKHA 2HMCA 1NTHA 3L4YA 5K3VA 4MWAA 2O92A 3KVMA 5HQMA 1XLLA 2Y0FA 3BLFA 2QDEA 4E2BA 4A21A 4DUWA 3TYEA 2X7VA 4GGBA 4W85A 1IGSA 4QEEA 4DWSA 3M9YA 5I78A 4V27A 3WEZA 3WQEA 2WM1A 3GTIA 3AYVA 1ECEA 4M19A 3WUFA 3EDKA 3F2CA 3ARYA 3M7WA 1V3LA 2FQIA 4IMCA 2VQUA 1LJYA 1Z44A 1NDWA 3QFEA 3ERPA 4PMVA 1PKMA 1UR4A 1ISZA 1I2RA 4YWSA 1B4KA 2ZX5A 3TROA 5A2BA 3N4AA 2VC6A 3OLIA 1P0BA 1E3ZA 2YL8A 1TTJA 1V3IA 3L65A 3UEQA 3CEUA 2CZEA 1NEYA 1I2OA 3DESA 1MEIA 3UA4A 3S9IA 1UASA 1KFWA 1P7TB 3GHRA 3LG3A 2IKIA 3FHAA 1XBXA 1W5MA 5FJIA 2VFFA 4AZIA 1QBBA 1TMLA 2JGYA 4KFOA 1HNYA 4LH8A 3TJ4A 4DO4A 4WSJA 3FVMA 3M6DA 1M6JA 3ZMRA 3BDKA 1A3WA 4C60A 5DT7A 3CGTA 3W7PA 2J7BA 3H2EA 4C6QA 3SY1A 3IV8A 3ORWA 4YU1A 5FAGA 4ADUA 2CXEA 4JHOA 1T5AA 3T42A 1GZ1A 5TNVA 3Q67A 3NGJA 2DW6A 2A3CA 4P8UA 1YDYA 1N55A 3ITXA 4GC3A 4S39A 5HUOA 5HPOA 1SPQA 4C6DA 5C6MA 1NVMA 4DZAA 3GNPA 3CL8A 3W86A 3UXAA 3WO8A 4WOZA 3IAQA 1MW2A 5RUBA 1GHSA 1O1ZA 4MSSA 1HJUA 3C2VA 4ERAA 4GO9A 3G0XA 2VJXA 3P8JA 4DF0A 3GDTA 1LWJA 1XISA 4I7VA 3QOKA 4HN8A 3WDJA 3L4TA 1QDSA 2NT0A 3BAJA 4GFIA 3WQVA 4CEUC 1SO4A 3EXTA 2MANA 4A6GA 3FSTA 4IQEA 2J25A 1FKWA 1PX8A 4KW2A 1DJIA 4X0NA 1GEHA 2FZ8A 3WH6A 4IICA 1FP8A 2QCEA 3SBFA 1TV4A 3EB4A 2NX9A 3UJFA 1I9CB 3WLSA 5K4ZA 4DBEA 3R2GA 1YTEA 1E4NA 2CBJA 3TWBA 4ERIA 1ISVA 3W7NA 1UJPA 1C7SA 2RJHA 3OVQA 1BG9A 5MF5A 1HTIA 3A9IA 4FXSA 1EO5A 1SSGA 2ISVA 5D9NA 2J88A 2BMBA 1ZCOA 3TZFA 1I1WA 1HGWA 4GO8A 4UMAA 2XFFA 1H1ZA 4I8DA 4EACA 2F61A 1L6SA 4G7EB 4YTRA 3BGAA 3GC5A 3ZQ9A 3W6LA 2G8ZA 3FOKA 3AISA 1VFSA 3L67A 1SU5A 3CUXA 1TMQA 2H9AB 4N9DA 1XH1A 2DP3A 4ILSA 3N3TA 1G7VA 3GTXA 1TRDA 2UY5A 2ZC1A 5D02A 3GW0A 1OCJA 2YA1A 1NSJA 3OVGA 3WDRA 5ECUA 2RDWA 2FB2A 3A6OA 3IVSA 1NDVA 5CKSA 4NNBA 1IZCA 3VNYA 3AZTA 4JNZA 1VFTA 6TAAA 5AVHA 2AQOA 5DRIA 3CASA 4YJ5A 4ES4A 1JCXA 3IGUA 4GCAA 2OEMA 3CH9A 5EMKA 3W1PA 2NUWA 4JHZA 1IXQA 1YNYA 4A3YA 4NZ3A 1TMHA 3RU6A 3LCIA 2OOFA 4I6KA 4XQ6A 4EKJA 2NLIA 5LNRA 4OGZA 4F0RA 1D7FA 4GOAA 1EJ7L 1MQRA 1HN1A 2E7FA 3GXNA 1Z7AA 1UROA 1P48A 1XRSA 3SRHA 5L9FA 1YE6A 3RU8X 3KZPA 4C6NA 3F2BA 4QE5A 2IQDA 2RDTA 2OSXA 2BLEA 3L5LA 3PZTA 1V6TA 1UBPC 1JYVA 3MS8A 2WVSA 1EP1A 3VIIA 4CCEA 3NQVA 1O5KA 1KGWA 3W82A 3CT7A 3PAOA 2VURA 2ADAA 4Z2KA 3U2ZA 4MFDA 3LV5A 4BCEA 1R7OA 3IK2A 3M0ZA 3ZT6A 1ZU8A 3SO7A 4V15A 4W7UA 3B0UX 1MXGA 1X38A 3UERA 2HPMA 4AU0A 3QQ0A 4I7WA 2UV8G 4XTIA 5DXYA 4LYRA 5HNTA 3EOLA 4G7EA 2ON3A 3BARA 1J96A 2YFNA 3BLLA 3GNRA 3PVFA 3U7VA 4M5PA 2BY1A 1BSLA 2QJMA 1AMYA 1KA9F 3Q94A 4GMEA 3WQCA 4AX7A 1VAHA 2NUYA 4XAZA 3T4CA 3O07A 4O1AA 4GK8A 1R87A 3CZEA 4PE8A 1HKJA 1N8IA 3KBJA 3IARA 1EC8A 3MKKA 4IMGA 2XVKA 1CECA 2CZFA 4JS3A 3MBFA 3PZOA 1JVNA 5A6MA 4MDPA 5U7SA 5AHLA 3U7BA 3LEPA 5T26A 2BBFA 3TQKA 2FZMA 1UD6A 3B03A 3LY0A 1BKSA 1OFDA 1EA0A 3AHZA 1SGJA 3I10A 2KX9A 2EHHA 2QAFA 4IJRA 5HBFA 3BPWA 1PCWA 1H63A 1E0TA 3BZGA 4JTFA 2P0OA 3NVDA 1CTNA 1Z6KA 3UA3A 4INFA 3W28A 1YPFA 3C0QA 1OFEA 1Y5WA 1M04A 3II1A 4UTKA 1SYTA 5IHSA 2NW0A 1UBSA 4HPGA 3MVIA 4AZBA 4D1IA 2CIPA 3H8AA 2DIJA 3MWAA 3W76A 5J04A 3GHUA 3WH9A 3HPFA 5BRPA 3GH7A 4BI7A 4LV4A 4U2ZA 1Q45A 1A0DA 5F1VA 2FTWA 4IX2A 2ZBTA 3CPGA 4OUIA 3BE7A 4XG1A 2FYMA 1UP2A 3KCLA 2UWFA 5A69A 2QEZA 3URBA 2O7QA 3ES8A 4ZEPA 3XIMA 1OEPA 3A9BA 4AX6A 2ZRWA 1AH3A 2QVNA 3GFXA 2YIHA 4HPXA 4ZQRA 4ZQMA 4HCHA 3IK4A 4IUOA 5JMUA 6XIMA 4L6HA 1YMYA 4CNTA 3EGJA 1C8QA 4QX4A 3FDGA 4GRSA 3S6DA 1XQLA 3UXKA 1ICSA 3SI9A 4LJ3A 1EGVA 3R43A 3NYDA 5E6ZA 4FSAA 4NRSA 3Q2DA 5C70A 1SJAA 4KFNA 1Q6GA 1OC6A 1X96A 3WQOA 3RXZA 2G50A 2NXIA 1B57A 1BWLA 2XN0A 2EPNA 3PJWA 5FACA 3QKZA 4BWLA 1EF2A 2W6RA 2VKZG 1JCMP 3VYLA 1AODA 3LHZA 4H9YA 1HJWA 1C8VA 1UA3A 4GYPC 3VABA 1J10A 1MDRA 1AQFA 4NAEB 3KRUA 1DQWA 5D37A 3G22A 3MJMA 2X2GA 3UVIA 1G4PA 1MEHA 1V3KA 3SAZA 1TRIA 4LSBA 3W7KA 3W7RA 2R1MA 3L0NA 1XINA 3QXBA 1DTNA 3GM8A 3KTXA 1NF7A 4MPQA 3QZAA 4XUYA 3IJ6A 1UOKA 5K9XA 2FZ9A 5G2WA 1QHPA 4CU6A 3KX6A 3J7HA 5JVLA 2J6VA 4CGTA 3SN1A 2Y5SA 3FJNA 1RY8A 3DFOA 1TPEA 3L2MA 1AW1A 2EPHA 1KWGA 2AL2A 2CWXA 5DRCA 4LAZA 4YHEA 3C8FA 1F07A 3AUJA 3BH4A 4JYFA 2FLIA 4GVHA 4L56A 3FA3A 5I7GA 3N14A 2A2IA 4E8CA 1JUEA 3BC9A 4DBWA 1XG4A 1QXLA 3TW7A 1EYEA 1N8WA 3WJSA 1OF8A 2BDQA 4MJ2A 4N6FA 1RHCA 2HNHA 3WZ0E 2Y88A 1LDCA 3KLLA 1EC7A 4GUIA 4KFPA 2YB4A 1RA0A 4KWWA 5LYRA 4HU3A 3W1QA 4F48A 2E77A 4JEQA 3W00A 4M56A 4JY9A 1VP5A 3L7RA 4JD4A 1V79A 2B81A 4JEJA 1KRAC 3W1TA 3VDAA 4H41A 4FNRA 3COTA 1GKQA 3G1RA 4FI4A 2G95A 2GUUA 1UQZA 1A4MA 3W72A 5HR7A 3DFTA 1CBGA 5DO8A 2V5BA 2QUNA 2BVTA 2O0TA 2ABBA 3WBXA 2OLSA 2MNRA 2GSJA 2QJGA 3CMJA 1POJA 4IP5A 1PTAA 1Q6DA 3C56A 1GW1A 1M9HA 4FZIA 5DANA 3QM3A 2GSEA 1XX1A 2YDAA 2QCNA 4DO7A 4R5EA 1HL9A 2XSBA 1JZ3A 4FNPA 4E4PA 1J5SA 5CBBA 1C90A 3QJAA 3N17A 1L0PA 1W3NA 4AZ7A 4GH3A 3BICA 1WP6A 9CGTA 3N12A 1TPFA 3TSMA 4WY0A 2CZ5A 1VENA 3MQTA 4HMCA 2VZOA 4ENLA 3OBEA 4M3PA 4C6OA 5D2WA 3OODA 3M47A 4IIGA 2JIWA 1QOPA 4KF1A 4YVXA 4RE0A 5FA5A 1OFAA 5CC3A 1HJSA 2CYGA 2JKPA 1NP2A 4E8DA 4H6QA 2QW5A 3P93A 2QUUA 1OZMA 3PHAA 1TQXA 4D6CA 4TXEA 3MSRA 1VLWA 3WLLA 4BEUA 1CXLA 1ZP4A 3BVJA 4WKAA 4IXHA 4MB1A 1NF0A 1FH9A 4O28A 3OHIA 4K7YA 5EMYA 2X42A 1K8CA 3ALGA 3S4TA 2BODX 1KTBA 2OMAA 3KDOA 3E0FA 4C1KA 1TVLA 3N9SA 2G3MA 1UR9A 2F6XA 3GDLA 4IQJA 2CPUA 3L68A 2A7NA 4JN6A 4FOUA 3UWVA 1MZRA 1NFGA 1FA2A 2ZWYA 4L4LA 5HQLA 1IEVA 4QAWA 1OYBA 3LCFA 1FWJC 1AD4A 2JALA 4AD2A 3TJXA 5I24A 3W7JA 2IXVA 4H9MA 3WLRA 2OGYA 3WUGA 2QIWA 3ZWSA 1GVOA 4Y90A 4XO6A 5C9ZA 1PBGA 4YNGA 4GNJA 5B80A 3WN6A 4C6IA 4GUHA 3UPMA 3TTOA 3DKLA 4IXXA 2XTKA 2A1YA 1E1CB 2PRLA 4CQ9A 5CG0A 1W5QA 1M3UA 4B5VA 1R46A 3GXPA 4TU1A 3ISIX 4IIBA 4XBJA 4HSNA 5EMMA 1DJZA 4CD6A 5G1TA 4M8UA 4XAPA 1GVFA 4JYDA 2C8NA 3BLIA 1CB2A 1XLAA 3VNJA 2O9RA 3R4IA 2Y1HA 4UWMA 4GZEA 4DBUA 3IUIA 5LHEA 3UW6A 3BJSA 3VIFA 2Z29A 2DUZA 1FWWA 2FDSA 2YL5A 1V6UA 1XPGA 1VYSX 5C9UA 1TZ7A 4ICCX 4D8AA 4K8HA 4O0KA 4DAFA 3AS1A 4IFOA 4FX7A 1GOKA 3ZJ7A 1BLIA 3ZVHB 1FWCC 1E9ZB 1IEQA 4MFEA 1CIUA 2ABAA 3HG2A 3MSYA 4C5ZA 1VPQA 2BGSA 2VT0A 3CIVA 4CU7A 4LVAA 4JN8A 4C6KA 3D0CA 2G3FA 2UY3A 4L1GA 3W70A 5F4SA 4B92A 5JH1A 1ZBCA 3CL7A 5BOOA 3ZYZA 5FF3A 1X39A 8TIMA 1E1EA 3WLTA 2D0FA 1Q4NX 3CMFA 1Q3NA 3PJXA 3UQNA 4AYGA 1LP6A 1E5NA 2FPTA 9XIMA 4R88A 1ZAJA 3F2DA 1M5WA 1A0EA 3NQ2A 4C6LA 2XM2A 4OECA 1AQMA 5G2IA 3U57A 4K1WA 1TIWA 4W8BA 1Q63A 3IACA 4PUWA 3H4GA 2PWVA 2VUNA 1FOBA 3ANYA 3BW3A 5HOSA 2D0GA 4XIMA 2A3HA 5E0FA 4M6QA 5M3WA 4U31A 1XWYA 3EA1A 4F9JA 1JF5A 3WH5A 4ML4A 3IIOA 3NG3A 1LBFA 2FZDA 1Z89A 2CLPA 4PA8A 3LHWA 2WVVA 4UQEA 2PBGA 2BZNA 4Q33A 4AC7C 1PS9A 3V5CA 1K03A 2FH8A 4W5ZA 3QYSA 3UP8A 1US3A 2QQ6A 1R3YA 1JXJA 1KD0A 1S5NA 2VCAA 4WDTA 3IRDA 3W7IA 4CU8A 1TV5A 1R5YA 4HOWA 5C8BB 2DSVA 1FWDC 1HL8A 2WC3A 3GBEA 4I5RA 4KPLA 4RDYA 2PTZA 1ENUA 3SW6A 1ZBWA 1QHOA 3KL3A 3P14A 1DOSA 2VFDA 2YCKX 4Z2JA 1D9EA 1W8GA 4DX3A 2ZUSA 4AF0B 2ZA2A 2J6XA 3GR4A 3L0KA 2GK1B 3RILA 2GJPA 4YYCA 3N18A 1UZ4A 4S2CA 3DG3A 3PK7A 2WMKA 3AXHA 2Z4GA 5CSSA 2E9LA 1V0NA 3HPXA 3LCGA 2ZXBA 4JL1A 3SY8A 2HCVA 3DC0A 1OB0A 1UKSA 1KFKA 4NKCA 1UJQA 1TV7A 4YVVA 4B5XA 3FXYA 2YDQA 1ITCA 1Z48A 1JPIA 3GNOA 4B3ZA 1DJGA 4PH6A 4HKPA 4LCRA 3T0AA 1WCGA 4HZ7A 4NIRA 3G24A 3T55A 1XBZA 3C2YA 4WR3A 3N3MA 1T6MA 3GVQA 2Z6IA 1MUCA 4L6OA 3UXLA 1A5CA 3PPGA 1F5ZA 1KM4A 4H2CA 4O0ZA 1UOZA 1C9WA 1XYCA 2PWEA 4ATDA 1PDZA 3PFMA 5PTDA 4HZ6A 3RYSA 1OFBA 1LL4A 3CQ0A 3PNUA 4KWOA 3QC0A 2J7FA 1WDRA 4RR4A 3ZR6A 2VFGA 3MYPA 1XSIA 4Q7IA 1XFCA 1Q6EA 2I9EA 1E3XA 4HNLA 2WM0A 4S3AA 4ZSUA 1Q6CA 3LMZA 1OFRA 2VGIA 5HWNA 3U2CA 4Q4SA 1H7XA 2JIEA 3WF1A 3WQPA 4PTMA 5BOEA 1Q85A 5A6JA 5C9WA 1V0KA 3JR2A 3MC5A 2YW3A 7A3HA 1Q2RA 3WUEA 2AAMA 3NIYA 4XZBA 2O9PA 4IP4A 4Z42C 3TYUA 4EXBA 4WOQA 3FV9A 4GUFA 4DWSB 1P7TA 4O54A 3EKGA 2VR2A 2ZQ0A 3UNTA 2HS8A 3FGCB 4D6EA 4YMZA 1X1NA 4QS6A 4ZODA 2D1ZA 1W9PA 2I5IA 1P0DA 2AQVA 1Y7VA 1KXVA 4HHPA 4AZ6A 4IMDA 2QDDA 1HVXA 5IM51 5ENLA 3WX7A 1JDDA 3TDFA 3PZUA 1OX6A 2OODA 3VDCA 1YEYA 4LC6A 1RPKA 5T91A 1YNPA 3AHYA 2A6NA 2VR4A 2XH0A 3BQ5A 1KM2A 5XIMA 3WYZA 4IG2A 4R34A 3CIXA 5GJNA 1AK5A 3BL3A 2GDVA 4GD0A 2WSPA 3MMWA 4US6A 4PUUA 1T0OA 2VELA 4IIFA 2AGTA 4PRTA 4PEEA 4IIDA 5FCZA 4V2XA 4O16A 2KZHA 2GPTA 4RPQA 1SUXA 3IIVA 5HR6A 1E1CA 1P43A 3CPRA 4PMRA 1H5VA 3OG2A 3A4XA 4GXPA 4AMCA 5CGMA 3O0FA 3DCPA 1JZ4A 4NASA 1R30A 3W3OA 1UQYA 4FIRA 1O60A 1I6NA 1E6RA 2B7QA 4PMUA 4QQ3A 2AKMA 3E0VA 4IPNB 3TW6A 2BSLA 4MZYA 3FGCA 2W67A 3M0VA 3S5YA 2ZA1A 3S1XA 4ORIA 5MHBA 2CXGA 2J7GA 3TLLA 1XLIA 1J18A 2YDSA 3G1FA 3SEPA 3VDHA 4JZ5A 4LRTA 4MHBA 1JCLA 1K6AA 1G4SA 2BXVA 3NO3A 3QGAC 5CZKA 3PUGA 2Z1SA 4RLIA 2B4GA 4F79A 1V02E 3BK0A 5I00A 1VFUA 4GJ1A 1TWWA 1H0GA 1HKWA 1Q4WA 2VZVA 2DU2A 2BNJA 3TOYA 1P0KA 3JU2A 3H6OA 5H1WA 1YKWA 2J9ZA 3N13A 5H8PA 4Z17A 4JX6A 1Y8BA 1EX1A 5LIXX 3KCOA 2W62A 5GJMA 1DWGM 2VRQA 5HMDA 5HJYA 4H1ZA 3AC0A 3LMYA 3P3BA 5M2FX 4A05A 6REQA 1R9YA 5ABTA 1XYBA 3RG6A 4YIWA 3T4WA 2Q8ZA 4E2OA 2D69A 6PTDA 5A8OA 4CD4A 3L5MA 2D2OA 3RGTA 3DBNA 5BNKA 3MDUA 1KRCC 1XDLA 3PN8A 1GGOA 4IX0A 4UTIA 2H3BA 1MXSA 4BR1A 1WAWA 2VEFA 1TUXA 4LY8A 4MVAA 3KDNA 4HZMA 3BV4A 3W53A 3R79A 5AHEA 2H6RA 3VD3A 4Y8EA 3KHJA 4GISA 3MUCA 4NX0A 3DX5A 2E9BA 3UNDA 4Z2LA 2VOMA 9RUBA 1CXHA 2GZXA 2J79A 4M1RA 4B90A 1XRTA 1XD0A 2V63A 1NOUA 2GGHA 2ZXDA 1NWRA 4RE2A 4IGSA 3NDOA 2FPYA 2VCBA 2WMIA 3QQ1A 1E56A 1NARA 1W1PA 5D04C 4HGXA 4CVWA 5CCZA 1E1FA 3GXFA 4CD7A 3L4WA 2XWDA 3N1AA 1MXDA 1K1DA 4J5NA 3BZJA 7PTDA 4KBXA 4RDVA 4YHGA 1OC5A 1P5BA 4UQAA 1FDJA 4GJIA 4NZFA 2CLMA 5HINA 1ZBVA 3B8VA 4OHQA 1YXDA 1R0MA 1SM9A 5JBDA 5CSRA 4HU0A 4HOZA 3WLHA 3MSGA 4WGHA 2GFTA 3ONCA 1YXCA 1GTHA 5EMUA 4JOMA 3P2VA 1ZBKA 1K7XA 1LLOA 5G4WA 3BGGA 1DKWA 1VEPA 2J8GA 3OYZA 2ACSA 4KH2A 4HHLA 4NZJA 3VO0A 3GYCA 1I60A 3P80A 1S5VA 1KB3A 5F2GA 4ERGA 3WJZA 1U33A 5E1QA 4A29A 2D2GA 2PGRA 3QPYA 3OEXA 2HEJA 4REQB 4XD3A 2G97A 4JCLA 2VD8A 1Y5XA 1OFOA 2VRKA 1TA3A 4DJDD 1EIXA 1PX3A 3H21A 4NUWA 5A8QA 1L6YA 5D4YA 1GVRA 3A13A 1TZ9A 1TELA 1UD2A 2IPFA 3W9ZA 3LQLA 1WKYA 4Q4PA 4MWAE 4UFJA 2GVLA 3CZKA 3ARZA 4FXRA 4MWAD 2FDMA 2DUXA 4QISA 3EDEA 2NQHA 2OO0A 2XGIA 2VEIA 1LQ2A 1BXNA 3OIHA 4HOXA 3K13A 4AY8A 4HNCA 1WBHA 2AGKA 4S1FA 2OFJA 4FX8A 5AYYA 1VBGA 4G1KA 1REQA 3KW3A 3R13A 4DF2A 2CKSA 4TUFA 4E5TA 4R9OA 2BVDA 4O14A 3O6DA 4LUJA 1V3JA 4TVUA 3NQ7A 3CEPA 1QMLA 3FKRA 4AXNA 1FUYA 1UWIA 4GWEA 2HK0A 3F5LA 1HP4A 4P61A 1LT8A 3D46A 1OABA 3AWNA 2O7SA 4UMCA 3GVRA 3VNIA 2PDJA 1GNXA 4WK9A 3HQPA 2DVTA 1KM3A 1SVDA 4P8WA 4DRSA 1QVBA 1TCMA 3G1DA 4M80A 2OEKA 3DHDA 4KEVA 4PCPA 1FXQA 3IJIA 4XO7A 4QGCA 4ADSA 2I56A 2CLFA 3GIYA 1W1TA 5U4NA 3ZJKA 1PCKA 3WEOA 2XWEA 5T9CE 4D71A 1FWNA 4ZB0A 3UGRA 3E2VA 3AXKA 5AC6A 1HP5A 3KL5A 3QSRA 3G0UA 1OD0A 1KW1A 1DEDA 1UB3A 5FEZA 3E2RA 3MCMA 4QDPA 3KWXA 1OT2A 4D6IA 5CSUA 5FL1A 4WJXA 2R1NA 2IPGA 1MRAA 2VZUA 3LERA 3M0KA 3FX4A 3K8LA 4LQ1A 3O6CA 1LG2A 3BAXA 1LYXA 4J7RA 1V0LA 1B1YA 5C71A 3ARQA 4H9VA 3H70A 3C4UA 4GINA 2E28A 5C55A 3HMJG 1JI1A 4MNKA 2JE8A 3K1GA 1JYNA 5AC8A 4IMAA 3ARSA 5E9XA 1YPIA 3PZIA 4TX8A 1EXPA 3DHUA 3W7EA 1SMAA 4JTDA 2PDMA 4AMAA 4HNUA 1TQJA 1WQ5A 4C90A 1GVYA 1UD4A 3ZT7A 7REQB 3IIPA 8CGTA 1X1ZA 3V4BA 2ALRA 3V35A 4AZ5A 5M5DA 3KXQA 2WMHA 4B15A 1R3WA 2XIBA 4WRHA 1XIMA 3UZ5A 3ICJA 2QUMA 4C6PA 3GTNA 5GNZA 3NQFA 3W7LA 1PTGA 3F7JA 4BA0A 3QY6A 2X16A 2XZ7A 3YPIA 2YLAA 2OVLA 4KMQA 2VFEA 3DZ1A 2GJXB 4UTJA 4MY1A 3MW7A 4C6EA 3L23A 4NZ4A 1K02A 1K8ZA 2QJHA 2W3ZA 3TTSA 2PLCA 1VHNA 2EPKX 3ZS4A 3C2OA 1PVNA 1SFSA 2FH6A 3PJTA 2V67A 1Q66A 3LRKA 2F84A 4KKXA 3LPPA 7ENLA 1KCXA 2CKRA 1XLMA 2BXYA 1T40A 4OVXA 1NWTA 5G4EA 3ZOAA 1H62A 7XIMA 3A47A 1VCGA 3LLFA 1SO3A 3BAWA 5LIKX 2HSAA 1ZUAX 1DHKA 5DMLA 4J4KA 4Z2IA 3RMJA 3TYAA 5DX7A 2ZA3A 3V16A 3NEVA 3OIXA 1VFOA 1QR7A 4RE3A 1B3WA 4XK2A 4DI8A 2XVPA 5AC7A 4C7FA 1JL8A 2JEQA 4HNTA 5H2ZA 1Z3NA 5FD0A 4ZB5A 3W73A 1ADSA 3UR8A 1WX0A 3TAOA 1L8NA 4LB4A 1E43A 4PEKA 3QV9A 3CWNA 1K9EA 3IWPA 8XIMA 3S5NA 1DE5A 3W24A 3EWUA 3QTGA 5AVNA 4YS1A 1QATA 4ML9A 1NELA 2EXOA 2RHGA 4MJMA 2XU2A 1TSIA 3OLGA 2DT1A 4OFCA 5IDIA 1TR1A 1U5VA 4LBRA 3A5FA 4DXXA 3FAXA 3W26A 3AMCA 1PIGA 1H7NA 3MCNA 4N9CA 3FVDA 4AHPA 1ZPTA 3H2NA 1G01A 3CHEA 5TIMA 2AMGA 3WD1A 4ZO8A 3QMRA 1ZL1A 2DUAA 5I02A 1W9UA 5FJRA 2ZX7A 3D3AA 2P0IA 2R24A 1SW0A 3URAA 2OCZA 4O1BA 4WIWA 4NZ5A 1EH9A 4HVXA 3S1WA 3WMCA 1EEXA 2DVUA 4YXGA 1V3MA 4LALA 5BROA 2ZZ6A 1AH4A 3M4HA 2EG8A 4MB4A 3C61A 1KR0A 1A5BA 3R7MA 3O05A 1MYRA 4LCQA 1E0WA 4GLEA 1V6YA 1I2PA 2XH4A 1SO6A 3MUZ1 1CLKA 4KGJA 3IVUA 5EKYA 4QG6A 2VX5A 3KRSA 2WC7A 4WF7A 4WJ8A 3K5XA 4GNKB 3P5ZA 1TWZA 3WFLA 3R5EA 3LI1A 1FXPA 2DDXA 5IXEA 4BK9A 3SRKA 3NL6A 1BG4A 5GNXA 3RLHA 2IKJA 3E38A 2H90A 3QW3A 4YWIA 2ZFAA 3VI2A 3CJPA 5E5CA 5C9RA 4MKVA 4C6FA 3CQHA 3VKKA 3OP2A 1A80A 2VVSA 3NOYA 4KWUA 3QV8A 3K2GA 5FJPA 2E8YA 3DHFA 1FCBA 4AW7A 3POHA 3CMGA 4LC8A 3E1F1 1XIBA 4MF4A 4MTVA 5GJPA 3SIMA 3QSTA 4MDOA 5JH2A 4CNUA 1JZ8A 3LM7A 2QCDB 3BG3A 1A5MC 1NJJA 4H8HA 1P0NA 4L4MA 3N73A 3MWCA 1DORA 2XIIA 4AXKA 5D2VA 2Z1KA 4H6RA 3KVKA 4J40A 1FY6A 1KCLA 4M81A 2O55A 3M0YA 3ABZA 2NLYA 1GZJA 3FIGA 1EX5A 3HQOA 1PZ1A 4E8GA 5K7JA 4IPIA 4GNVA 1OWQA 4F40A 1U5HA 3CZJA 2QJIA 4GPNA 1NAL1 3W7GA 4XB3A 4UOZA 4RXGA 4B5NA 5D33A 1IIHA 1CT5A 5E93A 1UMYA 2WKLA 5J8LA 2Y4SA 2PU1A 2CLEA 1ECQA 3ZJ6A 4DN1A 1LOQA 3VNKA 2QJJA 2XH7A 4N9BA 4H83A 2J47A 2UBPC 5CQ1A 3PTMA 1RBOB 3POCA 2BY3A 1HW6A 1ZALA 1BFNA 1I45A 4V28A 1NOWA 2PP3A 4JTQA 3LHTA 2ZRXA 4Q4OA 3RJYA 1MMFA 1GJUA 3LOTA 2VM8A 3GFYA 1KRMA 4I5XA 2WJFA 4A22A 1KRBC 4YYFA 3BSHA 4CQBA 4KRTA 3EB3A 2HVNA 3VU2A 1H0IA 1Q5MA 3UG4A 2C19A 5CPLA 1JNEA 3C6CA 2F2KA 4QDWA 1AZ1A 4X61A 1EDTA 4CQDA 1D8WA 3OW1A 4OUEA 1SFLA 1PZ0A 1R2SA 4WXZA 1UWRA 4G5DA 4LEQA 1EDGA 3QGKC 4JKLA 2YBTA 1OK4A 4FPSA 3IGXA 1EPVA 4IISA 3LBMA 4Q8QA 1UKPA 1U1JA 2HXUA 4ZCWA 1TZZA 2ZICA 3GC4A 1V6VA 5D30A 2PWUA 4RZ6A 2HROA 3CWOX 3NQBA 3VZZA 3ARXA 3U9IA 2WZIA 4ZZ9A 3W81A 2V68A 1CZ1A 1FDYA 1US2A 1HT6A 3C2RA 5KINA 3LS9A 1BF6A 3FNDA 4AYSA 1TPDA 1DVJA 3WG6A 1JULA 1SJDA 5BXRA 3OZPA 3G3MA 2GQ8A 4O1EA 4N9EA 4K3ZA 4EK7A 3A5VA 4CN1A 3QKEA 3HU7A 4PRWA 3EXSA 1AFSA 1DTUA 1IWBA 3WF4A 4CN4A 5AYBA 3NO5A 2CC0A 2E68A 3AHTA 4FOJA 1Q6OA 3W6MA 3HBLA 3P5YA 2WOQA 2WNQA 1YQ2A 4K1GA 3VOJA 4O0QA 4FHAA 3UESA 4GIYA 3UZZA 2XHYA 3DIPA 1LCOA 3U2OA 1BYDA 1Q7MA 1OIFA 4JYEA 4JHMA 1NOFA 1QK0A 3S2NA 3UWEA 5FF4A 1A0CA 5HJLA 1UWTA 1DIEA 3SGGA 5E70A 4UQCA 2ZUVA 3WMBA 3KHDA 3IANA 3M44A 2E09A 3DG7A 3AAMA 2IPJA 4BFAA 4DJFA 2WLYA 1XXXA 1XIHA 1YPXA 2F6UA 3LZ5A 4CNNA 2Z2BA 3IAPA 4BF9A 2XVNA 1BYBA 3CV1A 4EIVA 1A3HA 3HFTA 2WLZA 1IIGA 1NY1A 3NXFA 4JPGA 1VFMA 2ESCA 4ZOCA 2QAPA 2Q71A 3M0HA 4ZE5A 3MY9A 2E67A 2PFHA 2Z1VA 3K4WA 2ZC8A 2VC7A 1IT8A 2D23A 4YCPA 3V1HA 1WO2A 3P81A 1ZTVA 1BGGA 5REQA 1XUZA 3E9AA 3MI2A 5KZ6A 4DM2A 4PCNA 2O4MA 1OJXA 3N4FA 1RR2A 3H7VA 4Q8VA 1F74A 5D9MA 1JZ2A 2YW4A 2VXNA 1H61A 2QF8A 4L6DA 3THCA 4KT2A 2RUSA 3GNDA 3LPOA 2Y2WA 2GDUA 4PBEA 3RUBL 3HA1A 2Z27A 3G0SA 3QR0A 2V81A 3KBVA 4MG4A 4R53A 3F4DA 3PBWA 4TOQA 4H19A 2EG6A 4US5D 1FBAA 4PFHA 4HN4A 1VJIA 1FWGC 4UMBA 4FNSA 3JRKA 1GKRA 2ZRUA 1A50A 1DIDA 4GGHA 3JVAA 3B9EA 4CUCA 4IQDA 1E55A 2IUZA 4AUBA 3HPAA 4EPEC 1JF6A 1OBAA 3SQMA 3E0WA 3DN5A 2OSWA 3WLNA 4DYEA 2I7GA 3L0GA 3VOHA 2PLMA 1H4PA 4WEVX 1W32A 3RRXA 1PAMA 4AVOA 2PWGA 2RH9A 1VIWA 2WJDA 4Y7EA 2WSQA 3PG8A 4AVNA 1WOBA 4EP8C 3AIQA 2TRSA 1W3JA 2CW6A 4JIRA 3R6IA 2QUTA 4OJYA 1VPXA 4XZMX 1K9DA 1FX6A 3C86A 2ZZ1A 3ME3A 3E96A 1BD0A 2HPIA 2Z26A 3NCOA 4RZBA 1DJWA 1LLZA 4IG2B 2PDGA 5C9XA 3UXIA 3BG9A 1XYZA 4DJDA 2R8WA 2PDYA 4K38A 4ZQOA 3CL6A 1SZEA 3FA5A 3TN5A 3RMEA 3B0VC 2FHCA 1MEWA 3AYTA 3W6YA 4JTGA 3WUBA 2TODA 2V5JA 3OGRA 1RP8A 1F05A 5SWUA 1NFPA 3PF3A 3CO4A 3APYA 2YGYA 3K8KA 2C1GA 3OO2A 4GQBA 3KTSA 2BX7A 2PGEA 4NP7A 1C3FA 3MU7A 3FHQA 3WL0A 4IPPA 3W1LA 3PANA 3PPCA 1UWUA 3F03K 3ABOA 1L6WA 4ZB2A 1RLCL 3VKJA 2R94A 2H3DA 5I03A 1IR2A 4O8RA 4Y9PA 2Q6ZA 2Z28A 4G9PA 3TR2A 3W2KA 5LSMA 3PZNA 1F3WA 2ZZ2A 3GX9A 3PZMA 1WV2A 1W91A 3W38A 4AEFA 1UR3M 1UD8A 3BOXA 1X8FA 1W9VA 1DIOA 1OG6A 4PUJA 2Z25A 1UP3A 2XN2A 1VQTA 3FEQA 2BY0A 4GQGA 1CXKA 1IEXA 2A21A 1JQXA 3MVTA 2ZUTA 3VKCA 3IPWA 3AMGA 4WDUA 1WPCA 4HCLA 3T2PA 1LG1A 1A3XA 3I7QA 4WHBA 3GZ3A 4I3GA 1QI2A 4K8GA 2YJQA 3TU9A 3I6TA 1ISWA 2JQXA 1O5XA 3NZ1A 2Z2AA 3U3HA 3B8SA 1A5SA 4KERA 3L4ZA 2Y7EA 3V5FA 4CCZA 3VGEA 1BYAA 3BLEA 1AQ0A 3KVLA 4EVZA 4RDZA 2HS6A 3SDOA 2IMRA 4JDYA 1IGWA 5FF7A 3Q58A 5BU6A 1DE6A 4HZ8A 2TMDA 1ITUA 3TCEA 4UTTA 3MKVA 3I4EA 3AMLA 4UR8A 3F5KA 3PBMA 1OX4A 3R1ZA 1R86A 2PAJA 1NQ6A 2WJZA 1NIUA 1YNQA 1PTDA 4XD5A 4ZO9A 5AC5A 1WXYA 3CB8A 2DW7A 2CESA 3B97A 2VQTA 5LKYA 4NXKA 4MNMA 4IQLA 4PMZA 4J3SA 3KRZA 2OQHA 3CM4A 3ANUA 2WAGA 1SZFA 2QDGA 2WV8A 1US0A 1MWOA 3H22A 2GLKA 3Q65A 4CCCA 4IIHA 3WFZA 4HPNA 1UH2A 4S3CA 2IW0A 4MM1A 3VNMA 4XZIA 4W7VA 4RDWA 3U4AA 2PUZA 4O1DA 5FESA 1A5NC 4RE4A 4KEMA 2D3NA 2VGGA 3VIPA 3BURA 4WUIA 1NDYA 1DQXA 4DPPA 4TV5A 3RRAA 2J27A 1O66A 2FGBA 3R94A 3QV6A 1CI1A 3R58A 5EMJA 1PZ2A 3GB6A 2WHJA 2WVTA 2X30A 2NWRA 3P6LA 1Z42A 1KFBA 2XFWA 4J3TA 3BANA 4MUZA 3EWBX 2QCFA 5F1UA 2ZZ4A 4NZCA 1VC4A 3V18A 4CQCA 3TQ0A 3BOFA 4JBRA 1GK8A 2GQ9A 1S3HA 4ZR8A 3E3HA 3AU6A 3L4VA 2OKTA 4F0MA 5EBAA 4QTGA 3W2JA 3W88A 5LHFA 2ATSA 2G37A 1F8IA 3WLPA 3B8UA 1GG1A 1TV2A 4K36A 3G77A 2FB3A 1R2RA 3SN0A 1X97A 4N4QA 2F38A 2W27A 2ZDRA 1EC9A 3P7YA 3V5OA 2P1FA 2P3EA 3NOEA 4BQ2A 4Z1BA 4QEHA 4LUSB 3SUSA 4JNMA 5HQEA 1BVWA 4IPJA 2X41A 3OYXA 3CYVA 4Z2GA 4WD0A 4S3EA 3E2QA 4U3CA 3VMPA 1X8CA 3CLWA 1A5UA 3W01A 5BWAA 3GSMA 2XIJA 4X22A 2RGLA 5TD4A 3E5PA 5KTLA 1P1XA 3W74A 1IF2A 1BYCA 4UFHA 3USBA 4Z1AA 3G8EA 4NJJA 4S3JA 1QW8A 3BCDA 2PLJA 4YN5A 3VTRA 2J7DA 3HIJA 1SW3A 2NXHA 1ME7A 3VE9A 4NAEA 2W4XA 3CWHA 3K4AA 4LVDA 3V36A 3HM7A 2GOKA 1RCXB 3I68A 9XIAA 1LWIA 3SUTA 4A8LA 4FLQA 3TQPA 4O8AA 5A1AA 1UWAA 2BGQA 1EJWC 5M17A 5J5RA 4LAKA 2CNCA 3WCZA 4PTVA 1KFCA 5AECA 3NWRA 3I6RA 2CEQA 2GWNA 4QG8A 3VM5A 1HKIA 2EJAA 4TO8A 4JTKA 3AYSA 1OGGA 1H5YA 5LA2A 4F0HA 2WHLA 2FVKA 1KGXA 1XDMA 2VEMA 3LN3A 1JJKA 5C0QA 4LUIA 4GKTA 3OB8A 4TMBA 5MKGA 2QNEA 3AIEA 4BHYA 3AIVA 4R9XA 3BCFA 2NWSA 3OA5A 2X1TA 1K4GA 4Q8TA 1UHVA 4NJHA 1JR1A 1NH6A 4UNIA 4QR6A 2O9OA 4RW3A 3AFBA 3CV6A 4S23A 2XIOA 1EP2A 2VEPA 2O56A 4J28A 2Z1WA 4K2SA 3B06A 4D6DA 5FEPA 1FWSA 3MI3A 5JQ9A 1AL7A 2O4QA 1B30A 1KC7A 2QMKA 3KM8A 3C8NA 1R2TA 1HVQA 5TF0A 1EPXA 2Z0IA 1EBGA 1KO0A 2BG5A 1W17A 3DBPA 1SMDA 3CV2A 5HXMA 3MI6A 3V0SA 1OM0A 3VDGA 2ZUMA 2XIMA 1W1YA 3R8HA 3LB0A 2WB5A 2TPSA 3LX9A 3QBUA 2OG9A 1LROA 5HULA 2ZZ7A 4K39A 2GDQA 3FSUA 2GUYA 4ECLA 1ONEA 4JFSA 2DZUA 1WZAA 3QEZA 3BAKA 3ZVHA 1E70M 4FR1A 1LUCA 3SGZA 4AFYA 4H7VA 4GIRA 1IQ8A 5A5WA 2NVAA 3HB9A 1DXIA 1TCDA 1TJPA 1U22A 4HK7A 2IXUA 5F7UA 2P8BA 4I7UA 4HU8A 3N9RA 1TV8A 1JAEA 3DG6A 4JFTA 1HKVA 4IL0A 3VFCA 4BI5A 3F4VA 2YA2A 4YL2A 1JAKA 5JUVA 5AN7A 3CHCA 2BTMA 1XGZA 4UTLA 3PFRA 4LPCA 1IV8A 2R82A 1WB0A 1FHDA 3MMDA 2CBUA 3A3XA 4E2DA 3OPSA 1PKNA 1XLHA 1QWKA 1GOIA 1WDDA 1UZHA 1IZKA 2ZRVA 1QI5A 2L5HA 2YKKA 1CNVA 3I3EA 2XN1A 3GG8A 1DPMA 2NV2A 4HA4A 1LZOA 3M5YA 1OC7A 3MKCA 4XSMA 5HUPA 1TIMA 2A3AA 4ZENA 3NEHA 1XBYA 1ICQA 1QNPA 1GVSA 1VHCA 5CBIA 3SQSA 3XISA 3U5YA 2X8RA 4W88A 4LBSA 4DHGA 4JFWA 1ME9A 2B7OA 4NVTA 4DAIA 3ATZA 2QCMA 3T0BA 2NQJA 4PUDA 4M24A 3VMOA 3S5SA 2WZEA 4UTUA 2J7HA 3G3DA 5GPRA 1UA7A 1OCBA 3TTQA 2OX1A 5I6SA 1A5AA 3S5ZA 1QPQA 2HVMA 3D47A 3O06A 4JDBA 3NVTA 1LQ0A 1YXYA 4MY8A 1VBHA 1XIDA 3RDKA 1S2WA 3ATYA 4BS0A 1BWKA 2C14A 3MHGA 5A8GA 1WDPA 5F2LA 4JGDA 1UKOA 2QPXA 2ICSA 1Y65A 3TSBA 1W1IE 2GUBA 3BUVA 3TA6A 4TX9A 2RDUA 4WQ6A 4KWSA 1W1VA 1Q6QA 2YXXA 4R7JA 1JRBA 4RNJA 5CJMA 3GWQA 4GY7A 2JKEA 1QOXA 4E38A 4ACYA 2WWDA 2EPMX 3DXIA 4N4PA 4I8YA 3P62A 5FF2A 2RFGA 3TR9A 3PBYA 1O68A 1ZJHA 1PV8A 4NG3A 4M7TA 4I9TA 2OU4A 3K1DA 3P84A 3M41A 2GJRA 2CITA 1VYRA 1D7KA 1F73A 1GPWA 4DO6A 1VKFA 1J6OA 1UR0A 2JF6A 1T8QA 1AD1A 3L5AA 1LL6A 3WQ4A 5LIUX 2WMGA 1ODUA 3VOGA 1W1B1 2OJPA 4IMEA 4MYXA 1WKEA 3O15A 4V1XA 2R91A 2G41A 3NSXA 4LCSA 4KWVA 4DF1A 3O9NA 5IFPA 4D9PA 1M68A 3TOPA 2OOGA 2HWGA 3UR5A 3C0SA 1J5TA 4PTXA 4GFSA 3ZJ8A 2WHMA 2QULA 3OHMB 1F9CA 3VK5A 4O4VA 1W9BM 1H41A 4NILA 1JCYA 3C0LA 1Q8AA 2ZUWA 3EMQA 3SM0A 1FWBC 1EGMA 3FJLA 4GIAA 3N2TA 1CGVA 1DWAM 1Q13A 4HJFA 3NQGA 4XSLA 3BMXA 1EP3A 2VI0A 3VCRA 2OLHA 2CU0A 3GHTA 2IQTA 4GYPA 1KV5A 1AVAA 2A3EA 5DCBA 2I17A 5I5RA 1ZFJA 2PDUA 1L2UA 2EBNA 2ZE0A 1GVIA 3IJ8A 4S3FA 3QQWA 2CHRA 1FWFC 4O17A 2VR5A 1XYFA 4P5UA 1X98A 3WL1A 3NPVA 2OZ8A 4JQ1A 2X0HA 2PDIA 1JDEA 1G4TA 3GLCA 2MUCA 3SIZA 1BQGA 2PDWA 1QI0A 1XM3A 2Z24A 1R6WA 3LD5A 4MWAB 1XLJA 1EO7A 3N9KA 3H26A 3OLDA 2DFAA 5A8MA 1E5JA 3DYOA 4W5UA 4H4IA 2Y63A 1ZHAA 1P1MA 4JCMA 4JX4A 4GA8A 5AYZA 1CCWB 1EJTC 2ZX9A 4J1OA 1R3TA 5I06A 1UYQA 2R9RA 1TTPA 3DUGA 4ZTXA 3SY5A 4FLRA 4QP0A 4MWAC 2YR1A 4N42A 1RBAA 4KGLA 2GJXA 3FCPA 4US5A 4EE9A 3QPEA 5IBXA 1GOWA 2GGEA 1XC4A 4C6BA 4JQ3A 1RQHA 3EMZA 2CLIA 3K30A 1TE1A 2R1PA 4ASTA 1OY0A 2YX0A 4C1NB 3RCMA 3ARUA 1IE7C 2W0UA 3O7UA 2E1DA 3VOFA 4DUOA 3QGVA 1WAUA 3NA8A 3UJRA 4B91A 4OIFA 1RK6A 3AS2A 4GXMA 4JFUA 2VVNA 3W7MA 1RALA 1LL7A 1K9FA 4QJ5B 4OBTA 3GBDA 1JPMA 3N2CA 1W3HA 4KIRA 1WXZA 1H2JA 4JTRA 4UOQA 5BRBA 1LF1A 4GI6A 1TJRA 1QO2A 4QRNA 3NQCA 3EX6A 4V33A 4L9XA 5FAJA 1VFHA 3IJ7A 2HNEA 4ATWA 1O95A 1TPB1 1U5JA 3BJTA 3N11A 1QFEA 3WFAA 3EWZA 4H3DA 1WDQA 4JTTA 3PWGA 1T8XA 1KBLA 1IT7A 1ONRA 1Z41A 3TJIA 2RDXA 4IFKB 5C7HA 1UWQA 3LUTA 4UFLA 1FWEC 4HU4A 1MW3A 1VPYA 4JIQA 3GH4A 3ES7A 1OZQA 3QTPA 3P0WA 4V1YA 5HNUA 2IQ0A 2Q3RA 3EEGA 1ZS2A 3C52A 4FXFA 3Q45A 1S5MA 5A95A 3MZNA 1A5OC 4HTYA 1PJ9A 3RM4A 4L5ZA 3MV11 1MNZA 3S9ZA 2VHLA 3UCCA 2NX1A 2YBVA 3EOUA 4QIUA 3AWOA 4PMNA 2OWCA 3WIJA 4QCFA 3T1GA 3VKDA 4JQAA 3CK5A 4LWWA 2PCEA 3FFSA 3WJWA 4JTIA 3NFUA 3S47A 3MANA 1X6NA 1W1A1 3G8RA 3W2LA 3RJXA 5KZDA 2PWHA 4RKAA 3RX3A 2WZHA 3ENLA 2VTFA 3V75A 4HMDA 1NWUA 2DY3A 4ADTA 3N2BA 5BMXA 1BAGA 2P88A 3AIUA 4JNYA 3IGHX 4LFYA 1H09A 3CZ8A 5CPNA 5E09A 2VYOA 3AQUA 4QG9A 1V51A 3EWYA 2V3FA 3GNXA 1Q65A 1VS1A 5HNRA 4H9ZA 4H8UA 2DJLA 2EKGA 3TP4A 3SCNA 1KBJA 2J8FA 3VX1A 1ME8A 4PULA 3PPFA 3L2LA 1WNOA 3OG3A 4L9ZA 5DY2A 2CZVA 4RX0A 1RXOB 3N2MA 2PC4A 1SZGA 5CXPA 3UWUA 1G4EA 3VE7A 3G1VA 2V3DA 3XINA 5DXXA 3VZXA 3UCQA 5I3GA 4MKSA 5AC4A 2VUYA 1FWHC 1K7EA 5BU9A 3SUUA 1LOLA 3RPMA 4E3VA 2PD9A 4GIEA 3GR7A 3BLKA 2INEA 3LHUA 4WZHA 1EZ2A 1CXFA 3LENA 1EB3A 4RPPA 3I4KA 2EGZA 2NVCA 1RJRA 1V0MA 1Q7ZA 3SCQA 4HIBA 1QPNA 4E3TA 1HZYA 1K70A 1KGUA 2XFRA 1R8LA 2DT3A 5FJUA 3VCNA 1J4EA 4GHRA 4X60A 1VF8A 4XTDA 5FL0A 3ARVA 3KFTA 1SZRA 1DXEA 1S39A 1TR9A 2GYIA 2BY2A 3EBVA 1RJQA 1EKOA 4TTGA 1XUUA 1TTQA 2JBMA 2WKJA 2ZXQA 4W8LA 3WENA 4QE4A 1F8MA 3T44A 2YYUA 3AZSA 4O19A 3UFYA 2PEVA 1BRLB 4MAVA 1TWDA 2PDBA 2QGHA 3PBGA 4FO4A 5EPDA 5IDZA 3OA3A 3PS7A 2WCAA 3C3UA 3A21A 2Z2UA 3M0JA 1BPLB 3AYRA 3A24A 3DECA 2ISDA 1GJWA 2VD9A 5EFFA 3DC8A 3H2AA 1XKJA 2GVJA 2DGAA 3AU2A 3V7PA 1HL2A 2XM1A 3S1GA 4IMFA 2FGLA 1VGAA 4HSHA 3ZVIA 1YADA 3RM8A 4ZMGA 1KCKA 5E9AA 1NM9A 4YTQA 2YB1A 3G6MA 1S2VA 2ZZ3A 4BKNA 2CHOA 2A85A 4C91A 3TC3A 1FCQA 2BGNE 3GXTA 3W27A 4UOJA 1XCWA 1I4NA 2O9TA 2CZDA 3KP0A 1TPC1 4QJ3B 1AZ2A 4LAOA 5CLWA 1E0VA 1LWHA 4Q4KA 3CYJA 2DZSA 2PODA 5EBUA 1FTXA 3KRBA 3EZ4A 2QCGA 2KAUC 3R10A 1WUEA 3ITTA 1WDWA 1V77A 2CLHA 1EUNA 2HBVA 4NI8A 4WSKA 1RA5A 1JD9A 3VOCA 4JTUA 1QOQA 4QAIA 3W25A 5FJOA 4IGNA 1PE1A 4GE8A 4KEUA 3S42A 3P74A 4PC8A 1RSCA 2VNCA 4HJWA 3TNOA 4X2PA 4GH1A 3HJEA 2VFIA 3LGEA 3SCVA 2I1OA 3IJDA 3G2GA 4MNJA 3W2UA 2J75A 1TYGA 2E9MA 1E6SM 5CGTA 1VR6A 2RGMA 3LCWA 2FIQA 1XLFA 5CZSA 3LSBA 4DYJA 3GS6A 3FXGA 3PSWA 4E2VA 1XI3A 1UPPA 3H2MA 1FDZA 1UZDA 2QJNA 2V2HA 3PZVA 3FYYA 5BCAA 3HGJA 5BXSA 1CEOA 2NZLA 4L64A 2ISFA 4ZQPA 3M16A 4HHMA 3QH2A 4LXFA 3G1XA 1EL3A 3E5BA 3HJZA 3DYPA 2A4AA 3BO9A 4DQWA 2ACQA 4HD5A 5CAHA 4J9JA 5CJ5A 4AIEA 4ONVA 1O12A 4XBKA 2V82A 3MBDA 3THQA 2ZUUA 4JQ2A 4DYKA 5A6BD 1KWKA 3HQ1A 2YCIX 4LYQA 3DFSA 2EO7A 4WY0F 3WMSA 4UCFA 4QM1A 5HA7A 4KEZA 3FA4A 3TK7A 1PYMA 3BW2A 3W2NA 3THUA 1BTMA 5LXEA 2VGBA 3LNPA 4XKYB 4PB5A 4AIUA 5D8ZA 3S1UA 2ZZ5A 2WCGA 1TREA 4G1NA 1YLVA 2YSWA 4J3XA 2ZYFA 4R3UA 1EQPA 3W87A 5LIWX 2HBXA 4EAYA 4B3LA 2F9RA 5DCDA 4FLSA 3I3DA 2D24A 4DI9A 2V5CA 2BFGA 4I9JA 3HMCA 3P61A 1UCWA 4JTSA 2G4JA 4CKQA 2PTXA 4DWSC 4ZXOA 1DJXA 3W85A 3T2OA 4LB3A 4A8NA 1W8SA 5FKYA 3ZR5A 3I7RA 5TQLA 1XS2A 5FSDC 3NSMA 3EWDA 1SQ7A 2PURA 3S83A 1CENA 5IOBA 3QY8A 1R3SA 4Z1CA 4NJGA 3SFKA 2QXWA 3G5EA 4FP1A 4TTUA 4DPQA 1EQCA 2PA6A 3MT1A 3GNNA 2WBGA 1M65A 3O6YX 2DVXA 2VC9A 1GOXA 1D3CA 3ARTA 2YFOA 3BJFA 1B9BA 3TYDA 4EF9A 3GDBA 1UWSA 1KNWA 1XIEA 5I79A 2J8TA 3HN3A 1LLWA 4U5KA 2VWTA 5M1TA 3TXZA 1J0ZA 5A6LA 4QNEA 5DT5A 1XD1A 3TAKA 5D38A 1QI4A 4FNTA 1VFLA 2AL2B 1SR9A 1DJYA 1TJ1A 4K8EA 1JUBA 3OVPA 3LPGA 3HG5A 1K9TA 3K8MA 1MVYA 2OR2A 1B3VA 4O4WA 4DO5A 1RD5A 3NQ8A 4F66A 3SCOA 2TSYA 4IWWA 3LXAA 1J93A 1HF6A 1PX4A 2J4GA 4HA3A 3T81A 4DY1A 4MY9A 3NZQA 5TBOA 1CXEA 3PZGA 2PDLA 3ZLFA 1VBJA 3SN4A 3APTA 1GG0A 3TKFA 3WEMA 3W7OA 4NF7A 2VRJA 4ZA0A 4CD5A 1KM1A 4JL2A 2YXGA 2HRWA 2REQB 2XUCA 4D8ZA 4PSPA 4Q22A 4WXYA 4AISA 3IIZA 1VRXA 3WNOA 3HF3A 1TTIA 3LSCA 4HK6A 3MV01 2PDFA 1VJSA 5BW6A 3VINA 4Q8UA 1XV8A 4NYUA 2V6AA 4DBSA 1KLYA 2OX4A 3CUGA 4PRRA 3G6LA 4E6MA 1JIBA 4DJEA 5EYWA 3R0UA 4DZ5A 5ABEA 5KEZA 3LLDA 4ORMA 3KTCA 1AJZA 3A3HA 1I2QA 4E4UA 4XZNX 2YBUA 4DZHA 4CCDA 3GH5A 3ARRA 4L4PA 3T6CA 4MJ4A 3FN9A 2Q8LA 3UWQA 4PZVA 2AOSA 2NQZA 3GU2A 2QR6A 3UZJA 4NAFA 1O94A 3TC7A 1RD6A 3BXWA 1KR1A 1T41A 4HA0A 5J5DA 1GQNA 3PUEA 5CC5A 3EOEA 3TFCA 1LBMA 3G1YA 4FA3A 2OYMA 1BQCA 3DFYA 1D8CA 3TIMA 4MIMA 2VC5A 3ZSTA 2F2HA 1XICA 4F2UA 2FTPA 2OKOA 4KQNA 3W71A 1EOKA 4DNMA 2REQA 3QPZA 3QR3A 4AWEA 4OZOA 1QT1A 1LM1A 1VBUA 3AJ7A 3IIXA 4Y8FA 4Q8PA 5EU9A 3ONBA 2QPSA 1PKLA 4MYAA 2D2JA 4W8AA 3EB2A 1D2KA 1ESWA 3NDYA 1RCOB 2ZE3A 2G3NA 2GL5A 1B54A 3NR0A 3EAUA 2WWCA 2WNWA 5I3KA 2G0WA 2NV9A 4U3AA 4NT0A 2V5KA 1OHLA 5HMFA 4ACZB 3N15A 1S2UA 3GO2A 4IHCA 3A4WA 4M7SA 2NVDA 5FEWA 4MUPA 4ZBCA 2Q02A 4HB7A 2VP8A 2XYLA 3B04A 4LAUA 1C29A 4QLKA 4RNIA 4H8NA 2CETA 4JN7A 1AJ2A 4AY7A 1VEOA 1QO5A 5FIPA 3WELA 3LXCA 4JTJA 1HKKA 1OD8A 3HOJA 2A5HA 1ZLPA 4FB7A 3QN3A 3EDFA 2W92A 3GE7A 4D6HA 4XVEA 4JTCA 1UZ1A 3FLUA 2X05A 4JICA 1EA9C 3EA2A 3AIRA 1B3OA 4EPBC 5I3IA 1C7TA 4XAYA 4L7ZA 3KLKA 1QAPA 2OT0A 2V3EA 1YHTA 3UR7A 3L21A 4KETA 1CWYA 1HXJA 2HJPA 5A6SA 1MUWA 2QCHA 3VILA 4M6VA 3HFYA 3GG1A 1UC4A 1D3HA 2QUVA 2HTMA 1RJPA 4UBPC 2WSYA 4CNOA 1MW0A 3SURA 5LZLA 5FF0A 1GKPA 3PBUA 1ZZMA 1A5LC 1UUMA 3BAYA 3ID7A 4W4QA 1JG9A 3WNMA 3OJGA 2BVYA 3VFLA 1ZSXA 1IYXA 5K4XA 4UQ9A 4OU1A 2EG7A 3CS2A 5EY5A 3RM9A 2Q3OA 3P82A 1YDOA 3H54A 3WNLA 3LYEA 2NT1A 4JTHA 2TYSA 1THFD 3QFWA 3GRIA 4GQ0A 1A5KC 3RO8A 3LBOA 1HJQA 1K8XA 2VX6A 2HVOA 3GC2A 3LRLA 4HQVA 4HSOA 1OQFA 4WGXA 3KOYA 3OZMA 5XINA 5IHRA 2P76A 4EWND 1YIXA 4NRRA 4HPHA 2WPBA 3TXVA 3SECA 1XIJA 4TX6A 1BWVA 3HV9A 3BLOA 4MJZA 4FOKA 5K9DA 4PBFA 1O6IA 1UD3A 1QNRA 4GZJA 1SR0A 4DUXA 5G5IA 1PSCA 1EZWA 2X40A 5A6TC 3CAQA 3E2SA 1QUMA 2LLEA 4XBSA 4O11A 5CZJA 3T2QA 5A8NA 1WDSA 5LGXA 3LHVA 3T09A 2ZVIA 4AD4A 1ZAHA 1B31A 3JZUA 3ABXA 4DJFD 3W7HA 1YYAA 4QITA 2NXGA 1CGXA 1IEWA 4A3HA 3QC3A 3WF0A 1A49A 4L65A 3O6AA 3R8RA 4F0SA 2XG9A 2YA0A 3N2OA 4GYKA 4GY1A 1MO0A 4GUJA 3UPWA 2Y70A 4UNKA 2XGBA 2OWWA 3NQDA 4CQAA 1YTKA 1VD6A 3CQKA 4O10A 3WNKA 1AG1O 3S1VA 3UYCA 3SCRA 2E0PA 3VGDA 3LXBA 1O5RA 5FI8A 3T08A 2WANA 2P50A 2OQYA 3ZFHA 3PG9A 1OYAA 1UUOA 1AH0A 3AS3A 4UCGA