3BDPA

Dna polymerase i/dna complex
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVRAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*CP*AP*TP*GP*AP*TP*GP*CP*2DT)-3')
publication title Visualizing DNA replication in a catalytically active Bacillus DNA polymerase crystal.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 201
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1997-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3bdpA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3bdpA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bdpA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3bdpA01
1XSPA 4MFBA 3RJJA 3ZSVA 3VQBA 4KHUA 2IOCA 4IQUA 1U45A 4XQ8A 3LDSA 1RCHA 3K5NA 5KG0A 4R8UB 4PHEA 3VQ7A 4DFMA 5KT7A 2ZD1A 4LH4A 5CHGA 4DL6A 9ICLA 4RT3A 2VG5A 1ZBUA 3LAKA 4KLFA 2OPPA 3HW8A 4KHNA 3AVGA 4LH5A 2R8JA 5J0PA 2BPCA 2BCSA 4DTUA 3L2QA 3LP1A 3JYTA 4IR9A 3H8WA 4F5PA 9ICQA 9ICHA 3VQDA 1DTTA 3VQ5A 5DQIA 4KO0A 4Y1DA 2BPGA 3MR3A 3SI8A 3KHHA 5J0WA 1QLNA 3OJUA 4LZGA 3H8SA 3S3NA 3GIKA 1QSLA 1ZETA 3V7KA 4OGCA 1JMSA 3U3YA 3SCXA 4Q45A 4DF4A 3G10A 1S0OA 4EP4A 3K5MA 2W42A 1FXXA 4O5BA 5DBAA 5KT2A 4KLOA 5DQHA 2M9NA 4YFUA 4MQ3A 5L1IA 3O3HA 3NF7A 3OYNA 4E1NA 1D8YA 3ZT4A 1HYSA 1ZYQA 1A5XA 4CEEA 4KHQA 2BGWA 4QWCA 3L2RA 5HRRA 4JLHA 3NF9A 1HJPA 2QKKA 2YKNA 4NLKA 2BQ3A 4NCAA 1IH7A 4XA5A 3RBDA 4W5TA 1RTHA 5J0OA 3KLIA 4CEOA 4DQIA 5D49A 4F5OA 3C21A 4IDKA 3CM5A 4DTSA 4DTNA 2AQ4A 4RUCA 4DU4A 2R8KA 4BE2A 5J2PA 1VSHA 1JLEA 4NY8A 5J0YA 5J1EA 3SQ2A 3RJKA 1QQCA 1NK8A 2C2DA 4FBTA 4RW8A 4CIEA 3QO9A 1U4BA 2HHVA 4FZYA 3GFKB 3BDPA 5J0TA 1RPLA 2UVRA 5DKWA 1SKWA 1DLOA 1JN3A 7ICGA 5HMMA 4M3TA 4OPJA 8ICZA 3QEIA 3QZ8A 4NM2A 7ICSA 3HSTB 1HNVA 4C8MA 3V4IA 3GV8B 1WSHA 1XWLA 3TABA 3ZDBA 4NXZA 1W0HA 3PY8A 3M9MB 1ZQEA 1U04A 3RMBA 4RW4A 4DL4A 3NBPA 4HCCA 3AV9A 1BQNA 2X6NA 4KREA 4M47A 4PHAA 3IRXA 2OYQA 5SWMA 5KT4A 4I7FA 4WE1A 4DTRA 5KFAA 3KLGA 3RJIA 3QIPA 1Z26A 4ED0A 3LPUA 5KGWA 4CEDA 3AU6A 1C0TA 4FJIA 4TSXA 3TAPA 4EZ9A 4YP3A 2HB5A 2RKIA 1ZQYA 4DU1A 4R64A 3K5OA 4PH5A 3ZT2A 1TKDA 5CA7A 2R8GA 1RDCA 4KLQA 3E2EA 3OYGA 3KJVA 1RILA 2IBKA 1ZQKA 3V81A 5KFOA 4TURA 1S1TA 1KCFA 2G8IA 2RN2A 4IFVA 9ICVA 1RZTA 1C0UA 4YQWA 4CGDA 8ICIA 5CZ1A 5BOMA 3WNGA 1IKYA 5KFWA 3B6PA 3MXIA 3RTVA 4CEZA 4YD1A 5J2DA 3HP6A 4YMNA 5CP2A 1JLFA 4HUEA 2V4RA 2HMIA 1XHXA 3ISDA 1SL2A 5DK5A 2VWJA 2W9MA 4FLZA 2PI5A 4FBUA 2XHBA 5IIKA 3LALA 2Y1IA 4ECXA 5CJ7A 3NH0A 4TUPA 3AO5A 1A76A 3UIQA 4CF1A 3NAEA 1S9GA 2YNFA 4TUQA 1N56A 1O1WA 4KHYA 1EETA 3NF8A 3SUQA 4KLTA 2VG6A 5HP4A 1MQ2A 1ZBFA 4NLZA 4G3IA 1IKVA 4GXIA 4B9TA 4F2SA 4F4YA 1S5JA 3DM2A 2F8TA 1NK7A 3JPQA 4QZDA 3NDKA 4FJGA 4ECUA 3PUFA 4RNOA 2Q3SA 5DG7A 4DMNA 2F1HA 4HUFA 1CXUA 1RXVA 2FBXA 1B43A 3AU2A 1C7YA 4HCBA 5DDMA 4DF8A 4J2EA 4JS5A 3C1YA 1BIZA 3CFRA 1NK6A 1BPDA 5DB6A 2F8SA 4KLMA 4CFDA 3CYMA 1RBRA 5DB7A 1RT6A 4I2HA 4I2PA 3CQ8A 1VRTA 8ICUA 2FC0A 4DLGA 1JIHA 5KFJA 1L3TA 4E19A 4Q5VA 4IBNA 4KTWA 1UWBA 1D8LA 3PV8A 1VSEA 4BXOA 2GBZA 8ICLA 1XU4A 1ZQHA 1EXQA 3G6XA 3V1OA 3K4GA 4CHOA 5KFGA 2W9BB 5IIJA 4FLTA 4DO9A 1ZQAA 1TV9A 4BE0A 2PYLA 4OKEA 1N5YA 1RBVA 7ICKA 3P1GA 2O4IA 2NRTA 2G8KA 1JX4A 1TGOA 2AJQA 4FM0A 3HP9A 2XC9A 4XIUA 4I2EA 2E4LA 4CF2A 2XO7A 4IQVA 1HJRA 3PO5A 3KLFA 2YNIA 4FLWA 4ED6A 2DFHA 7ICQA 3V6KA 4R8UA 1X2IA 4RQ3A 4R5PA 2NRZA 3OY9A 3DOLA 3KKSA 1ZQQA 8ICQA 3K57A 3M9NB 4GXKA 4DSIA 4RQ2A 1EX4A 2FMQA 4B08A 4DOAA 1Z3EB 3ZDAA 2A1JB 4Q8FA 4G1QA 2Q0ZX 4ED3A 1HYVA 3ZCMA 3V7JA 3LP3A 4JRQA 3LANA 3V1QA 4O5KA 1VSKA 2Z1GA 5DG9A 1S1VA 3KTQA 4NLNA 3MFHA 2BANA 3TFRA 4JK1A 4GC6A 2FBVA 3MR5A 8ICMA 1TFRA 3H4DA 4M6WA 1BI4B 3T19A 3MR6A 4O3PA 1N48A 3VA3A 3S3MA 2I9GA 1S0VA 4ELUA 1VRUA 5KTQA 1NK0A 4DSKA 5KFVA 7ICJA 4QWEA 4RW9A 3IM1A 3MDAA 4F8RA 3KK3A 1ZBIA 3ORYA 3H4BA 4ECZA 1QHTA 1NKBA 4UB4A 1VSJA 4DSEA 3F9KA 4J9KA 2GV9A 3SQ1A 1K1QA 3ZT3A 4DQQA 3ISNC 2YHBA 3K75D 4M3YA 9ICCA 3SZ2A 2HVIA 4DFKA 2P6UA 1RT1A 3HVRA 4OJRA 3OSPA 2HNDA 4EBDA 4K8XA 4FZXC 3JPSA 5DMRA 3OGUA 2JZBB 4KLEA 2F96A 1HNIA 2PZSA 1NKEA 1ZQPA 2XCPA 2NRXA 7ICRA 3EY1A 3RMDA 2J6TA 2UVVA 3ETLA 4DEZA 4AILC 3GILA 1S10A 1WLJA 2FPKA 3M8SA 4TUSA 4I2JA 1ZQSA 2RDIA 3AO1A 1TVAA 8ICXA 3SV3A 4DTMA 4GC7A 9ICUA 1LWFA 8ICCA 3MXMA 5EWFA 9ICOA 1NJZA 3RAQA 1RDAA 3B0XA 3RRGA 4ECTA 4BGDA 2BE2A 4CIFA 4M9LA 3Q8PB 1L5UA 2O4GA 3TR8A 3LZJA 2MUTB 4B9MA 1XS9D 1KRPA 1BVSA 1UOCA 3M9OB 4YG2A 3B6OA 5F9LA 4YN4A 4AHSA 3DRPA 1CZBA 1PZNA 3HYFA 5KI6A 1QSSA 4DG1A 5CB1A 5J0RA 4PY5A 1BIUA 4N76A 3UXPA 2QK9A 4CHZA 4IRKA 1IM4A 4UB2A 9ICJA 2OPRA 4F5QA 9ICTA 3H08A 4I28A 3HPHA 1BQMA 5KFYA 3DMJA 4FK4A 2H5XA 2LYHA 3PMLA 3AVBA 3DLKA 2MAXA 2BQRA 3ZT0A 4B9LA 1IO2A 2OA8A 2X6SA 4J2DA 2QXFA 4FK2A 4KLHA 1MU2A 4AH9A 3KK1A 3OHAA 2Y1JA 2FLLA 4GW6A 1YVUA 2KTQA 3JSMA 2PXIA 4QZIA 4ID5A 4DS5A 5KG2A 4BDPA 5J2NA 8ICSA 4UB1A 3K58A 4CJ3A 3QESA 3C23A 5L1JA 4K8ZA 1HPZA 4LD0A 5KRTA 4IRCA 2VA2A 1REVA 3N4MB 1BGXT 4NM1A 5BPCA 4IR1A 5J0XA 1U47A 5IILA 4YMOA 4KLDA 4QZBA 3EYZA 2B4JA 1EXNA 4ECSA 3PR4A 2KZZA 2FMSA 3C94A 3HPOA 1H38A 5J2FA 5CR0A 3B0YA 3TAMA 4M42A 1XSLA 4FM1A 4M3RA 3OYEA 1RDDA 1ZQBA 4B9NA 3DLRA 3WNHA 1JLBA 1ZJNA 4NYFA 4BE1A 4N47A 3VQ4A 2IAJA 4CJQA 3AVMA 4AHVA 4JV1A 1C1AA 3ALYA 3PVXA 4Z6EA 3AVNA 5D4BA 4F3OA 5HROA 4BDZA 1VSLA 4KLJA 3KD5E 4IRDA 1KVBA 4EBCA 4LY7A 4RPYA 2DPJA 3MECA 5J2KA 5HBMA 5KFKA 2OZSA 4FJ5A 3VQ8A 4QZAA 1RTIA 4F2RA 2IHMA 3MBYA 4AHCA 1FK9A 4H4MA 2HVHA 2ATQA 2A1RA 8ICKA 4I2GA 3M8QA 1Y88A 1RBSA 5KFRA 2ATLA 1XSNA 5C25A 3QNNA 1U49A 4DL7A 3VQCA 5J2QA 2GWSA 3LAMA 5BOLA 2C2RA 4KV8A 3PW7A 5EOZA 7ICLA 4CF9A 5KG4A 2AQ0A 1NK9A 4AHRA 4FJLA 3RMCA 2Z1HA 2JLEA 1CZ9A 2PI4A 2G8UA 2IC3A 3PX0A 4M3XA 2KW4A 1RT3A 2W9BA 3OHBA 3IS9A 3OYMA 4KN4A 5J2GA 2FPMA 4NLGA 2XY8A 2BHNA 4IQTA 2ZUDA 3AO2A 1LAVA 3QE9Y 4RQ1A 2ASDA 4FJ8A 3JPRA 3OYHA 4O0JA 1ZQGA 3ZSOA 4W5RA 4QZCA 1ITGA 4CGJA 2HHTA 4CJPA 4RQ8A 5KFXA 4RT2A 1L3VA 3TANA 1EKEA 3EPIA 1X9MA 4ZTFA 1QSYA 1KTQA 5EWGA 3C5GA 3WNEA 4RQ7A 4KTQA 1X9SA 8ICWA 3HXMA 4DS4A 1ZJMA 5J2EA 3PX4A 5EWEA 4K4IA 3QERA 1Z00B 3C6UA 4YXJA 4PUOA 4KPYA 3VA0A 7ICEA 4UBCA 1KLNA 4CERA 4K4HA 5J2JA 1S0MA 3OS0A 1RT5A 3KLEA 4O3OA 1Q9YA 2JEFA 4E1MA 1RTDA 3CG7A 4OPKA 4MF8A 1RBUA 1GOBA 2WONA 1TAUA 4MF2A 4DTPA 5DDYA 1GOAA 4FVMA 3ZSQA 1NOZA 8ICNA 3RR7A 5J0SA 4MEXA 2ZUCA 2G8VA 4HVJA 5KFHA 1LW2A 1WSFA 4CK1A 4BWMA 1QTMA 5E41A 4CFCA 1ZQDA 2HNYA 9ICRA 5HRPA 3CFPA 1YTAA 3QEAZ 4M9GA 2ZJ5A 2IA6A 1JKHA 4H8KA 4QZFA 4QAGA 3K2PA 4M3ZA 1RXWA 3DOKA 5KFDA 1B9DA 1W9HA 2QKBA 3PO4A 4CJ5A 1B92A 2BR0A 1XC9A 9ICKA 1I39A 3AUOA 2X78A 4CEBA 1WSEA 1U9LA 2XY7A 3H7IA 4F5NA 2JEGA 2JZBA 3V9WA 5DB8A 2AU0A 1NJYA 1BPBA 4MFFA 4QZHA 3OJSA 4PA1A 4IG3A 4CJVA 4E7LA 2NRWA 4KLLA 3V6HA 3EZ5A 3NTUA 3S3OA 1BL3A 5DGAA 4Z4CA 4DFJA 5CZ2A 1ZQWA 4N56A 1JXBA 1HUZA 5DB9A 7ICHA 2DY4A 4CJWA 9ICEA 3KHGA 4PWDA 1BPZA 3ZD9A 3RH5A 2NUBA 2W9CB 3OYAA 4M9HA 3AVKA 2D0CA 1YT3A 2NRVA 2MUTA 3V72A 3L8BA 4HUGA 1JLCA 1J5OA 4E7JA 1ZBHA 5IINA 2HNZA 4QW9A 2J6SA 1BPYA 2PYJA 2DFLA 4M04A 3MXJA 3NHGA 8ICBA 2R8IA 3G0ZA 1Y97A 5D3GA 1ZQFA 4ELTA 4O3NA 3HJFA 5TZVA 1B22A 4I2DA 2FBTA 3SJJA 3BQTA 2OZMA 3AO3A 1ZQXA 1UA0A 4P4OA 2IGIA 4HHTA 4DLEA 4CFBA 4JWNA 5DQGA 1KEJA 1NKCA 1RYRA 3WNFA 4PGQA 1T05A 2B21A 1S76D 5D46A 3OYCA 3FDSA 4UB5A 1IG9A 4J9SA 4J9MA 1ZQIA 4JRPA 1S9FA 4CHQA 3Q8LA 2Z1JA 4DFPA 1WN7A 1UT5A 1IXRA 1C1BA 3TAEA 4C8KA 3NFAA 2P1JA 3QEXA 1TL1A 4HTUA 4FJMA 5KFEA 4DQSA 2IMWP 3HT3A 3NF6A 7ICUA 2P5OA 4F4ZA 1DGSA 3AVFA 5DLGA 1LWCA 2KN7A 7ICFA 3AVLA 4PQUA 4KLSA 3RB0A 3UXOA 2FBYA 4UAYA 5J2AA 2XGPA 4KLIA 2ZJAA 4YMMA 5HNKA 3E01A 5J0QA 4J9LA 2HHQA 3AA2A 4CJKA 9ICXA 3HVTA 9ICSA 4FYDA 3DLEA 4AHUA 4DQRA 4RW7A 2KFZA 2HHXA 1RT7A 4KHSA 3G6YA 4QOZB 1IKXA 2P66A 1MC8A 3ISCA 3V9XA 3HX0A 1TVRA 3V9ZA 3HO1A 1BPEA 4R63A 1FKPA 1HQEA 3P5JA 4CEQA 4OGEA 2PFOA 2FLNA 7ICIA 4YFKA 3KKRA 1NOMA 2C28A 2BCRA 3AVAA 3QINA 3U6FA 4DWIA 4RNNA 4E89A 2UVUA 1NOYA 4W5QA 4QCLA 3QEBZ 4C8LA 1MQ3A 1QS4A 3BGRA 3RR8A 4I2BA 4KAZA 4QWAA 2BCQA 4ECYA 3OYBA 1SKSA 4Z4IA 2C2EA 2ITGA 3NGYA 4K4GA 3RBEA 1IKWA 4UAZA 4DTOA 3PW5A 1ZQCA 5HHIA 5KG6A 2IDOA 3LP0A 3JPNA 3UXNA 4MFCA 2E6LA 4EP5A 4OLAA 4RQ5A 1XHZA 3DRRA 2G8FA 1NK4A 3L2VA 4I2FA 4O3RA 7ICOA 1S97A 3DLHA 5JS1A 1ZQLA 3QEPA 4O44A 3AVJA 4LZDA 2ZTCA 2PFNA 3T3FA 3JPPA 4O3SA 4FJ7A 3C1ZA 2FPLA 3V9SA 4JV0A 4IFYA 4FZZA 4I2QA 1N6QA 4FK0A 4LSLA 5J0UA 4OKKA 1HRHA 2YV0X 3I0SA 3AVCA 2YNGA 3TAQA 1A5VA 3SPZA 4NCBA 1TK8A 2ETJA 3ITHA 4BACA 3HK2A 2XY6A 4I2CA 3MGIA 3U3GA 1FKOA 2G8WA 1ZQTA 3HPGA 3V7LA 1LB2B 1T8EA 3MABA 2RPIA 5HMLA 5J2CA 3M8RA 5DG8A 4IKFA 3CM6A 2XY5A 3UQ2A 4JUZA 3TI0A 3GV7B 1XI1A 3RB3A 4DTJA 3RB6A 1T03A 3H8JA 3HWTA 1Z00A 4ED1A 1WSIA 4B9VA 4EBEA 3TQ1A 3ZD8A 2B6AA 1T4GA 3ZDEA 1ZQRA 1KSPA 3LDAA 4ECWA 1S77D 4B9SA 1J9AA 3ZT1A 4P2HA 1KVAA 3GIIA 4FJ9A 4CJTA 3KIOA 2EHGA 4ECQA 4RNMA 4OLBA 4B9UA 1S6PA 1BCOA 3MEGA 3NE6A 2HHUA 3SQ0A 4QW8A 4DSJA 4RUAA 4FJKA 4BWJA 4M41A 2XGQA 3RMAA 3OYLA 4J2AA 4X5VA 4ECRA 1X9WA 4KI6A 3QEVA 5DLFA 1ZBLA 4RPZA 3T5KA 5KFTA 1CEZA 1U48A 2YKMA 4IQWA 1TK0A 3KHLA 2VA8A 1D9FA 4CGHA 1JXLA 4DL5A 3QLHA 3NH2A 4B8AB 1LW0A 5J29A 2A1SA 4FW2A 3MDCA 1SUQA 3SUOA 2VWKA 3JPTA 1Z25A 3OYJA 4L8RB 4M9NA 2R8HA 3Q8QB 1L3UA 4FLUA 4P4MA 3BQ1A 4PHPA 4CE9A 5J2IA 4Z0UA 3AVIA 2I5JA 3LK9A 4KMUA 5J2MA 5KFZA 2BKEA 2BPFA 2D0BA 1S0NA 3LZIA 1HQUA 3AO4A 9ICMA 1UA1A 8ICFA 1ZQMA 3GDXA 3RJHA 8ICRA 1RBTA 4Z6CA 5K14A 1T7PA 3UQ0A 1NK5A 5HP1A 2ZTDA 2LSNA 4J9QA 2W9CA 5I3UA 4R65A 3V1RA 4M6WB 5J2BA 4W5OA 3BQ2A 9ICIA 2WTFA 4NCGA 3PNCA 4AHTA 3OSNA 1UAXA 4KLUA 3RAXA 3C2KA 4TQRA 3I0RA 2XCAA 5L9XA 1K6YA 1WNSA 3S9HA 4QZEA 4PGYA 3ZDDA 4I9LA 4CEFA 1S9EA 8ICHA 1HMVA 1G15A 3VN5A 4Y1CA 3JPOA 3NGIA 4JS4A 1TV6A 5HLFA 3VQ6A 1SZPA 3VQQA 2JEIA 4Z4EA 1TAQA 5KT3A 1TKTA 1JLGA 1JLAA 4EZ6A 3SUPA 4O0IA 3LPTA 4DL3A 5CY4A 4O4GA 2EX3A 2KFNA 2OWOA 4E7KA 3GV5B 4I9QA 2GUIA 4RU9A 5KG3A 4DQPA 2DTUA 3ULDA 1LV5A 2W8LA 3MGHA 5KT5A 3RB4A 2YHAA 3RRHA 4CJSA 4FXDA 1KFSA 3V6JA 5J2HA 1VSIA 2BQUA 3VQ9A 4PGXA 4Z4GA 1RNHA 4ED7A 1ASVA 2J6UA 4M3UA 3MEDA 7ICPA 3ZSXA 9ICAA 5KT6A 3ZSYA 3MR2A 1S6QA 4KTZA 3KLHA 2A1JA 1J53A 1RT4A 4RW6A 1LAWA 4F92B 7ICMA 8ICEA 2WOMA 1QE1A 2F1JA 4CJ4A 1T3NA 4JV2A 2ZTEA 1RDBA 3IG1A 3VQAA 1RTJA 5C5JA 4I2IA 4F93B 4GMJB 3IHQB 3PX6A 3LWLA 3ISBA 4FCYA 4I27A 4FLXA 4ZTJA 1BI4A 5CYQA 5CYMA 3GIJA 5KG1A 5I42A 4Z4FA 3OYKA 1JL2A 2XRIA 3UPQA 3HL8A 5KFQA 1VK0A 5KGXA 3NCIA 3TAGA 3OVNA 5C42A 2KZ3A 3OS1A 1S1WA 2VANA 3BQ0A 2R7YA 1Q8IA 3SUNA 2PY5A 4KI4A 3L3UA 4PPXA 2OPQA 3AA5X 1NJXA 2JGUA 4CJLA 3KK2A 1ZQNA 8ICGA 4Z6DA 4UBBA 1S1UA 4CJUA 5IIMA 4MFAA 8ICAA 2IHNA 3OYIA 4OKJA 1RYSA 3CFOA 4PHDA 5KFUA 4GXJA 4F4KA 4ZH4A 5L1LA 4DOBA 4CF0A 1ZQZA 1A5WA 3T5JA 4CECA 5FDLA 5KFIA 1C1CA 3PW4A 3K59A 2JEJA 1K1SA 4M0AA 4F4WA 4F3TA 2ASLA 2ZUBA 1HUOA 4H4OA 4Z4HA 3SPYA 1WCNA 3O4NA 2V9WA 4O55A 1BPXA 4ECVA 4CIGA 3ZSRA 4I29A 2OPSA 4M45A 3Q8RB 2W9AA 3K5LA 4M3WA 3QETA 3LWMA 4DU3A 1JL1A 3QIOA 5IIIA 2PFPA 2Z1IA 4QZ9A 3MEEA 4ED2A 5KFLA 4RQ4A 3C2MA 3T5LA 4IG0A 3RJGA 1CXQA 4J9OA 5KFBA 1V9PA 4FJJA 4CGIA 5KFCA 4F50A 2AGPA 5F9NA 2V4QA 4N41A 4F4XA 4KRFA 4FS2A 4O5EA 3LP2A 3ASMA 1COOA 4CJEA 3NH1A 4ED8A 4CK2A 1Q9XA 3AA3A 4YCXA 5KRSA 4CHPA 4CJFA 4QZ8A 3G6VA 4EYHB 3TARA 2KZMA 4P4PA 4GVMA 4CGFA 7ICVA 3NGZA 2VA3A 4RPXA 3DI6A 4Q43A 4RZRA 4J9PA 3RH6A 5KG5A 1TK5A 4GLXA 1CLQA 3L2WA 4FJHA 1VSMA 5KFMA 4FLYA 2C22A 2I1QA 3M8PA 1TL3A 4C8NA 4Q8EA 4YR0A 5FROA 4ELVA 4F5RA 4FO6A 2P5GA 8ICTA 9ICPA 2P51A 2ZE2A 1WSJA 2E6MA 4DSLA 1WAFA 3D0PA 1BISA 2ZJ8A 2D5RA 1KFDA 3C6TA 5CWRA 3MFIA 4UQGA 1L3SA 3RJFA 1BCMA 1ZQUA 1DOQA 2KQ2A 3OS2A 2ISOA 4YR2A 3AA4A 4O9MA 4FJNA 3DLGA 4YXMA 5IIOA 3DYAA 3TFSA 5EU7A 3TAFA 5DBBA 2G8HA 4KB1A 4XUSA 2BDPA 3KHRA 1WSGA 2BCUA 5HRNA 3V9UA 3C5FA 1B9FA 5KFSA 5KFPA 5L1KA 4KLGA 4F91B 5JS2A 3HM9A 3PW0A 1SL1A 3AVHA 3Q8MA 3EPGA 1J54A 5DBCA 4YNQA 1KVCA 8ICYA 4CJRA 1ZQJA 2HHWA 3KD1E 4EEYA 3L3VA 5FRMA 2VG7A 4YR3A 4CF8A 3THVA 1VSFA 3EWAA 4E7HA 4LSNA 1XO1A 9ICBA 5HHHA 3Q8KA 2P6RA 4R66A 4E7IA 1EP4A 3SYZA 3EW9A 8ICOA 3RWUA 2HW3A 5KG7A 1ASUA 3RJEA 2RDJA 1CUKA 4CCHA 4OVLA 5KFNA 1AROP 4CHNA 3OYFA 1NJWA 3C2LA 3L2UA 3QZ7A 1JLQA 4FW1A 5HRSA 4RG8A 4HYKA 1VSDA 3GQCA 3ZDCA 2DFEA 3TWHA 4O5CA 3P83D 2X74A 2ZQBA 1C6VA 9ICFA 4EYIB 1WCLA 4KFBA 1KFTA 2YNHA 1R0AA 4ZHRA 4FLVA 1KDHA 4DL2A 1UT8A 4CEAA 7ICNA 2B5JA 4FM2A 4JWMA 5T7BA 5JUMA 1D5AA 1ZQVA 3SV4A 4E0DA 2ASJA 2RF2A 4RQ0A 1I3AA 1SKRA 1F21A 4B3OA 3H40A 4DOCA 4CHYA 9ICWA 4B8CA 3F73A 2W8KA 1HYZA 1X1PA 4RQ6A 4XRHA 3Q8SB 4UB3A 3ZSZA 1GOCA 1TKXA 2IS3A 1DTQA 4DTXA 5C24A 1JXEA 4C8OA 3I8DA 4E3SA 4J9NA 3BJYA 1TKZA 4KKOA 2FMPA 1S1XA 1MSWD 3N97B 3SNNA 3DLBA 1RT2A 2UVWA 5SZTA 2FLPA 4KN7A 4BDYA 5FRNA 4CK3A 3QNOA 4W5NA 3T1AA 2DFFA 4N5SA 1A77A 1SV5A 4MEYA 4YD2A 1BHLA 3ZSWA 3DRSA 5KFFA 9ICNA 4FJXA 4TQSA 7ICTA 3PMNA 1KLMA 3V6DA 3FYHA 1D9DA 3IAYA 4KB0A 3O4QA 3O3FA 3QEWA 4I2AA 5DGBA 1SL0A 4J9RA 4M2YA 1LWEA 3FFIA 2BCVA 8ICJA 3PW2A 3RH4A 3T5HA 4Q44A 4UAWA 2ALZA 3VQPA 4CGGA 3MAQA 4KHWA 8ICVA 1ZQOA 2PFQA 2HHSA 3OYDA 3SQ4A 4CFAA 4FS1A 4ICLA 3VQEA 4QZGA 4NYNA 9ICGA 4Q0BA 1YTUA 1ASWA 1WAJA 2F1IA 3NGDA 1C0MA 2DPIA 3PR5B 3SI6A 4YVZA 4BXOB 4J2BA 8ICPA 4DSFA 4QWDA 4KITB 3O3GA 2BGGA 3GIMA 3A2FA 2D0AA 4ID1A 4Z6FA 2AGQA 4QWBA 3D45A 4M9JA 3C95A 2AGOA 4CESA 4O3QA 2ISPA 4LVSA
chains in the Genus database with same CATH superfamily
2L9NA 3Q8UA 3HRDD 3ZSVA 1RHJB 2VCPA 4KHUA 1HI0P 4IQUA 1VQ5N 4K4SA 4DV2K 2DGXA 3KLFB 1SV0C 3K5NA 2YNIB 1YTYA 3L9ZA 1NDPA 4OX9F 1X0FA 2XLKA 2MSSA 3VQ7A 1XNQK 4DFMA 3GJTB 4RT3A 4CZCA 2GVDA 4KLFA 4CLPA 3M6VA 1X6IA 1U2FA 3ZZPA 2EG2A 2DCLA 2IJRA 2BPCA 3QUBA 3CW2C 1ZPWX 9ICQA 4K0KJ 2A6AA 4CH1A 1DTTA 1NI3A 2DQNB 2P35A 1Y5NB 5BN9A 5LSRA 4KO0A 2NS1B 4K4TA 3W8GA 1QLNA 3DXKA 5EVZA 4CNYA 1X42A 3CJRA 1VQOS 2UXDF 1T9YA 3H98A 3I6PA 2R4FA 4OMFG 4F04B 3WZ0A 3K5MA 1WDTA 2HHHJ 5DQHA 2HBRB 3PRVA 3KUEA 1YSJA 3J7ZO 4AQYK 4XTTA 4GKJF 4CZLA 3U1LA 3LM9A 4MQ3A 3O3HA 1OIAA 3NF7A 3AH6A 1D8YA 1BNPA 2DRDA 3ZT4A 1A5XA 5K20B 4KHQA 1FF2A 5LOQA 4QWCA 2P9CA 3OTEA 1HNWF 2CNKB 5JU5A 4JLHA 3QMQA 4DV1F 5FPNA 3I4HX 4DU7A 4IXCA 4YEAA 3M32B 4XA5A 1Q3VA 1YI2S 4W5TA 4A2AA 3DRRB 3D66A 5D49A 2ZIVB 4H5VA 3EGNA 3C21A 2VPYB 2RIJA 2IY5B 4DTNA 4KGVB 3DGVA 1VSHA 1JLEA 5F1XA 1B0TA 1ZBTA 1O51A 1QQCA 4WXOA 3IMXA 3FRYA 3MUMP 2JGAA 2V5HG 5GMEA 1TUUA 5H9FJ 4WYLA 4YOWA 2UVRA 4IOCQ 1SKWA 3LVVA 3T9NA 3WK8A 1M1GA 5HMMA 5ALLA 2XYHB 3QZ8A 3F53A 4MYUA 2EWSA 4RNHA 3M7DA 3AOBA 3CCWA 3T1HK 1Y3JA 3ZDBA 4USWA 1SC1B 3CJKB 2YKPA 3QRRA 4NXZA 3DRPB 1VQ5S 4X4PA 3IUCA 3D7SB 4CIOA 1U04A 1GXUA 3RMBA 3VCBA 4DL4A 4LF9F 3OBIA 4N7TA 1T9VA 3IRXA 3TZZA 3CJ9A 5KT4A 2UU9J 2BJDA 1RWMB 2AYMA 3POTA 4A8YA 2DR9A 1VDVA 3RJIA 3MCOA 5KGWA 2W2NP 2CXYA 3G86A 2HOQA 3R5BA 5D4NA 3NY0A 2DKXA 1ZQYA 4R64A 3AXKA 4PH5A 1NHVA 4K2JA 4BR9A 4U7CA 1RDCA 3E2EA 1UFWA 3KJVA 1RILA 3TTFA 2IBKA 1ZQKA 4YY3J 4M8LA 4WFZA 1HIYA 1S1TA 4ALZA 1Q78A 4IFVA 1Q86T 9ICVA 1ZTWA 1C0UA 3OTOJ 4YQWA 2H3VA 4CGDA 1FFWB 5BOMA 4XO0A 1VYAA 3KUHA 5BR8F 2EH9A 3QBWA 4YD1A 1OWXA 1YRUA 3EKUA 1CG2A 3RZAA 1O08A 2ZOFA 5CP2A 1QVGM 2OGUA 2V4RA 2DBBA 3I5BA 2ZZMA 2HMIA 1Y5LB 3H1QA 1XHXA 3ISDA 1XR6A 5DK5A 3GLJA 2KMDA 4PXEA 4FF3A 4FLZA 2PI5A 1N36J 2ZG6A 2OTJN 2ZKTA 3SSRA 3AEVA 1S7IA 2ZIWB 1U26A 2HQGA 5CJ7A 4BVPA 4P2XA 4TUPA 3UR0A 3CJTA 1EETA 1WHVA 2AEFA 3VR1A 2VG6A 2XMVA 1RAOA 3UI3A 2EC2A 4NLZA 1IKVA 2VV5A 3IWXA 9ATCB 2CA9A 3UB5A 3ZLJA 4OI1A 4GXIA 4JK7A 1YQHA 2Q36A 2B7BB 1K9MO 3HFZB 3SAFA 5GTHU 4DMNA 1BLUA 5AKKA 2DK2A 1DY3A 1C7YA 1GXTA 2OLWA 5AQVA 3HHKA 4J2EA 4CH7A 2DEIA 3C1YA 1BIZA 5M1KA 2C2NA 4S0MA 1RTIB 2YMPA 2F8SA 1MNEA 4CFDA 1FK9B 1VC6A 5DB7A 2DRAA 1YKWA 4NLUA 5AM0A 3IWNC 3LVWA 3LQVA 4B3TF 1AFIA 8ICUA 5CRXA 4DLGA 4US9A 1X9XA 4Q5VA 3J81j 1UWBA 3MURP 5D4LA 2CPZA 4IOCL 4P72A 2JWKA 1XU4A 4ZLPA 4BC4A 3MM8B 3G6XA 2PC6A 2CIMA 4JI2J 1UJ6A 2IC3B 1NGCA 1BQXA 4WIIA 2N4CA 4ZPCA 1NBEB 3IS9B 4KH1B 4O4GB 3HBTA 4FLTA 4QIEA 2ZH5A 2EWHA 2VICA 4ANCA 3F41A 3I96A 2Z7JA 4D3HA 2O8DB 2F76X 1JX4A 3O9UA 4GNIA 5AK3A 4FM0A 4AFFA 5E7OB 1Y3KA 2XC9A 4JI6J 4WBFA 2XI3A 3PO5A 1GAOA 4R8UA 2J5AA 3N7SC 2MU2A 2CUYA 1HLUA 4RQ3A 4R5PA 3DOLA 3PYGA 4CNQA 1ZQQA 4CLWA 3L7PA 3AA9A 1EX4A 2FMQA 4Y6IA 1UZHA 1OYEA 4B08A 3CXCM 4JV5J 5AXLA 4Q8FA 2ZBCA 2Q0ZX 4ED3A 3ADAC 2Q6BA 2XI2A 1UVLA 1QE1B 3LP3A 4OO1J 1QUPA 3FZKA 5EY4A 3KTQA 4UAVA 5LMUK 5CR4A 2WBNA 8ICMA 2OTJS 3H4DA 1AXQA 4M6WA 1XMOF 3MR6A 4O3PA 4OX9J 3HD1A 2O67A 1N48A 3VA3A 2G07A 5A8RA 1MLAA 2I9GA 1WTFA 4KE5A 1LW2B 7ICJA 3F9MA 3E51A 4LFAF 2CDQA 4FXVA 4F8RA 1M0SA 4JI0F 5IT9U 1V5IB 5ALPA 3H4BA 4ECZA 4OZLA 2QEXN 1NKBA 1KVIA 3F9KA 3VGLA 3A5MC 2AEMA 1K1QA 2JJ4D 3QRQA 4DQQA 2YHBA 3K75D 2HFUA 4I64A 5FLXU 2BM0A 3SZ2A 3CCQS 2P6UA 3MEKA 3GG1A 3MXHP 2QV6A 2DNKA 1HBNA 1N0VC 4WXWA 1IJEB 3OSPA 4TXSA 4EBDA 2HI0A 4K8XA 1K9MT 1Z05A 2F4VF 4Y2AA 4NLBA 2UXDJ 1HNIA 1NKEA 2FVPA 3G25A 2FHJD 1ZQPA 3DXMB 3EY1A 2J6TA 2YKAA 3HD2A 5AI8A 3WQUA 2POKA 1S10A 5U47A 4GKJJ 3W66A 4I2JA 3GP9A 4KMOB 4A4JA 4DTMA 1TVAA 2D41A 3PYDA 4MAKA 2WW8A 1VJQA 3CT9A 5K8OA 4XH4A 1NJZA 4O5FA 3MPYA 3RRGA 3MEEB 3QUTA 2C3PA 2IRUA 1N5TA 2BE2A 1XMBA 4DV1J 1WUAA 4M9LA 3I82A 3AOCA 3WIVA 2VL1A 3DU6A 4I6YA 4CT9A 1B99A 1KRPA 2HNZB 1BVSA 5M1FA 5F9LA 2EFPA 4ERDA 3MX5A 4HHUA 1QSSA 4DG1A 5CB1A 1NLKL 2LP4A 4FYVB 4LREA 4FPBA 4CHZA 1ZAXA 4LR9A 2FPHX 1NGJA 9ICJA 3ENVA 2OPRA 4F5QA 4IEEA 9ICTA 2DNYA 2DGZA 3CQYA 4BRFA 1OUQA 2E2QA 3HPHA 2ASOA 5KFYA 3WKCA 3DMJA 4DHYA 3AVBA 2W03A 4KH6A 4CYUB 3H59A 3NEKA 2BQRA 3MR7A 1ATSA 4B9LA 4RWTA 2X3GA 2OA8A 1FI4A 3V2UC 2KE7A 5AM2A 5BREA 4WU2A 4DL0C 3KK1A 3TSUA 4GW6A 2KTQA 4C4SA 1TL1B 2PXIA 2W24A 3GR0A 4BDPA 5KG2A 4GY2B 3H5SA 5E3PA 2O8CB 3DDHA 3K58A 3QESA 4BQZA 4LF9J 3ULEB 2QMUB 1VS3A 4ZP9A 4LRBA 3ZZTA 4NM1A 1R3NA 2BJ1A 5BPCA 3DYAB 4IR1A 3E01B 1HFEL 1REGX 6FD1A 3QSIA 5IILA 2QEXS 2Z57B 3P5BP 1MN7A 1N32K 3DDNA 4V19X 5ALEA 3DLEB 2B4JA 1NSPA 3FEZA 2QM1A 2ZM6F 3PR4A 2KHDA 5G5GA 4PXCA 5J2FA 3MM6B 2P9IB 3AAPA 4KRWA 1XSLA 3OYEA 1CI4A 1FKPB 1XK8A 3OQ2A 4DN0A 3MMCB 1PAEX 1MWQA 3QYYA 1UFKA 3W2WA 3AVMA 1VI7A 2MZJA 3OR2A 3OFGA 4OYWA 3ALYA 4FOEA 1SV4A 4Z6EA 1KVKA 2XMAA 1RK8A 2QWRA 4KBOA 5CD4H 5D4BA 1SJ1A 3A8YA 5I3QA 2FJWA 3IM9A 2V52B 1EIYB 1TP7A 3BS9A 2DNOA 1PYTA 3OL8A 2PFUA 1FHTA 1GNKA 5EX0A 2Y0SF 5HBMA 3SEOA 3VQ8A 3LP0B 2DGUA 4QZAA 1X66A 4FP9A 1FFGB 1Q7YO 1RWXB 4ILRA 2EK1A 5M1OA 2A1RA 5BPLA 3AL0B 3M8QA 3X1LB 1F3FA 4ZCIA 1RBSA 4DFDA 2CJKA 5M1PA 1EHWA 1HW9A 1P9YA 3JTPA 3MM7B 5EOZA 4CF9A 3I55N 1KKHA 4FJLA 1YJUA 2BX6A 4FZVA 1CZ9A 2JWLA 3EWGA 1Y11A 4M3XA 4IOAQ 2DH7A 1RT3A 2W9BA 3L09A 3SFGA 5D8HB 4E2FB 3OYMA 4KN4A 2CQ4A 5K8MA 2XY8A 2YNGB 1S1XB 3AO2A 2NRHA 3ATUA 2ASDA 4FJ8A 3EGVA 4ETZA 1HARA 1ZQGA 1UPPA 4W5RA 2L41A 1ITGA 4CJPA 3CD5A 4OYZA 5KFXA 4Q2MA 1L3VA 1RDUA 3O1BA 4U8YA 3R2DJ 2ILZA 2Y9UA 1N33J 2K1RA 5LT5A 1SQFA 4XDDA 3RYLA 4RQ7A 3S6JA 8ICWA 1ZJMA 1SH2A 5HQ8A 1ECWA 5J2EA 1WTBA 4K4IA 2C2ZB 1G2EA 4FPAA 3C6UA 4FE3A 3O9SA 3IG5A 3JTOA 3VA0A 1KLNA 4ZVRB 4C9DA 4IC9A 2P9UB 3H25A 3H2VE 4LSZB 1S0MA 1WNEA 4IOXA 4WJ3B 1HWKA 3OS0A 3KLEA 5D0HA 4O3OA 2B56A 2YWHA 1RTDA 4OPKA 4MF8A 1RBUA 2OSRA 1U1QA 2LMRA 2BABA 4DCCA 4NRUA 3TJ9A 4ZIVA 4EHUA 3M7VA 4MEXA 1XMQF 3MEGB 2G8VA 4HVJA 4OZ5A 4HLBA 2W7OA 3KZXA 4CFCA 1ZQDA 9ICRA 4ZA1A 3AY9A 3CFPA 1FDDA 2GIFA 1QAYA 1RKJA 3CCEN 4CQ1A 1VQMN 2HS4A 1F44A 2VBXA 4QAGA 1HHQA 2RRAA 2KHOA 1RXWA 3DOKA 4KB7A 2I7PA 2QKBA 1WC4A 3QGGA 3JS6A 2BR0A 1X4GA 3CDBA 1RHRB 4E1JA 2QLBB 1X40A 2F65A 4UQTA 4OI6A 2XY7A 1S12A 5LSOA 1VLOA 3VAIA 4FWKA 1TL5A 2JZBA 3V9WA 4UOHA 3WK6A 5DB8A 2AU0A 1XMOJ 3JAMU 4MFFA 5A6PA 4QZHA 3BO3A 2DNQA 2GELA 3VEVA 4E7LA 4LFAJ 2NRWA 4RKUC 1N5XA 4JI0J 3V6HA 2NR0A 4DFJA 1UVKA 1JXBA 3I55S 3WK7A 4TN2A 4C1NI 3KHGA 2W3RA 4A8QA 1BPZA 3ZD9A 2CKWA 3BPSP 3EX7B 5CZXA 1B0PA 1NPRA 2W9CB 5I3UB 4M9HA 1UFLA 1FO1A 1J5OA 4UOCA 4ZOSA 3NVWA 1SJ4P 1BPYA 2F4VJ 2PYJA 8ICBA 4C23A 3IBCB 1Y97A 1ZQFA 1RUSA 3I4PA 2FBTA 3SJJA 5EE1A 4OYOA 4P4OA 3FC9A 5DQGA 3LL3A 2P9KA 2DIVA 2QL5B 2V2KA 1KEJA 3EVOA 5THWA 1LNQA 1TV6B 3V5RA 5D46A 5AQFA 4WTOB 3L5KA 4CTAB 2YX4A 3EMTA 2PEHA 4UB5A 5J1NA 2K8AA 2AT1B 4J9MA 3BGOP 3ENBA 5AZIA 1M5OC 2GX8A 2RE1A 2G2ZA 4PG6A 2ZUGA 1H72C 3D28A 1IXRA 2XMKA 1WDDA 1BOTO 2A19A 3KOOA 5CXTA 1CS4A 3A0IX 1NGDA 3GWCA 1NMEB 1LWCA 7ICFA 4BS2A 5B0BA 3HOSA 1T44A 4ES2A 3UXOA 4UAYA 3VEWA 2XGPA 3WEEB 2RH3A 2IVOA 1VQMS 1EB0A 4HDGA 2QLJB 4WQ5C 1S6QB 4KPCA 3O3LA 5EE0A 9ICSA 3ILJA 1WF1A 4FYDA 3VAKA 1DRZA 3KLHB 3G8QA 2XZDB 4CZMA 3VQSA 1N33K 3ETOA 1GLLO 5GAGI 5GADI 4JKGB 3V9XA 3F2DA 3HX0A 4P73A 3AAWB 3ZEUA 1M1KO 1BQNB 1U1NA 2CPIA 4OGEA 2I5HA 2HQDA 1NOMA 1SKUB 5E3RA 3QXGA 2BCRA 3MMJA 5CYQB 3QINA 3K2YA 4ILGB 1WC6A 2XWYA 3QIPB 1Q16B 3HKZF 4CO4A 5K4LA 3HT0A 3OVBA 5BXIA 1ZM9A 3MMAA 1LK5A 3RR8A 4KAZA 4QWAA 3OTQA 3EGWB 3TX8A 3VTIA 1U1OA 4MDAA 3W2VA 4CBUA 3QGHA 1H0HB 1PVRA 4ZJLA 2ZM6J 3PLAA 1K0VA 1GXLA 3NGYA 1IKWA 2NZ4A 4DTOA 1IV0A 4PL1A 2V69A 1HIWA 2D69A 2UUTA 2IA0A 3R9LA 4MFCA 2E6LA 1HPMA 2JDJA 3NS6A 3VETA 2UUAF 5GAGP 1NU0A 2EW9A 5IQ6A 1ZQLA 3SXLA 4O44A 2GAHC 2Q79A 2MQPA 1ZBSA 2R7UA 3JPPA 1ZM2A 4FJ7A 2HF4A 2EAOA 2LYVA 1TL7A 3GSDA 3BO4A 2VYPA 4LSLA 2HOEA 2BM1A 1KDNA 4D3GA 4EI2A 1JJ4A 2DKZA 1ZH5A 5D0RA 1FXDA 1FWKA 3I0SA 3KYLA 1RWUA 3M2VB 3PJXA 4ZLNA 5M1NA 3GONA 3MCNA 2GOLA 3V7LA 2CQDA 3MABA 4WZMA 3LP2B 1PJ7A 2IIRA 2ZIXB 5HMLA 2GMJA 3UCZP 5J2CA 3M8RA 2DD8S 4ID8A 2PFDA 2ZH4A 2AEJA 1DK3A 5DG8A 4IKFA 3CM6A 5D6GA 3DI6B 2VJVA 3FZLA 3TI0A 4OX8A 1N34K 2FJVA 3RB3A 5ALFA 1T03A 1D4XA 1UPMB 2N3OA 3HWTA 1SH3A 2GNKA 3W9HA 4L3NA 3N01A 2GO9A 2E88A 2B6AA 1NGAA 1T4GA 2UZAA 2Q0UA 3TPQA 1NDCA 3LDAA 3RW7A 4YOVA 3JSYA 2FF3B 2YX7A 3NGUA 1X6JA 4PKHA 3GIIA 3O9RA 4CJTA 1SB6A 3KIOA 2MB0B 4E8UA 3MGJA 1BCOA 2GZOA 4NWBA 3SQ0A 2IM2A 2HIQA 2KRRA 4FJKA 4BWJA 4DQ8A 2XGQA 2P9NA 3UKUA 1X9WA 3QGPA 1Y64A 1GMWD 5DLFA 1ZBLA 4H03B 5KFTA 2DHSA 4U8VA 1XQSC 1WG5A 2J8AA 2L5YA 2NXEA 4OI2A 2F63A 2HFNA 4EWTA 2B0CA 2OHFA 2IYGA 1MROB 4DL5A 1PIEA 3AQOA 4NXNK 3VGTA 2A1SA 1U6ZA 3HDSA 3PKMA 3SUOA 3JPTA 1YF5L 3OYJA 2ADCA 2NSBA 2QWOA 3Q8QB 2MQMA 1XMQJ 5LM7E 2M4MA 3ZNJ1 4PHPA 5J2IA 5FJ4A 2CQPA 2NZCA 3VAFA 4X4NA 4KMUA 4K4YA 4DV0F 2O8EA 3SMVA 2PDAA 1EP4B 3M30B 2I6WA 2XLIA 5K14A 1O03A 2BANB 5F8NA 1NK5A 1JXVA 1WHWA 4TY8B 5C2GA 1VQ7N 4R65A 1A9NB 3V1RA 4BR2A 3Q2SC 1P27B 4W5OA 3H5UA 2ZH2A 1VQKN 5ALTA 5HJXA 2XNQA 9ICIA 4K25A 4B02A 1VRUB 3RAXA 1Y9OA 4TQRA 1HKBA 1LQ9A 5L9XA 1AT1B 1BD6A 1SVDA 2P9GA 1X4CA 3CPEA 2D9OA 2EG1A 4ZHRB 2VODA 2Z58B 1UZDA 4JNEA 4I9LA 4CEFA 2GJFA 1HMVA 1G15A 2IMOA 4Y1CA 5AQZA 2XG8A 5HLFA 2GCFA 3SDEA 2B9YA 1OW5A 1SZPA 3CETA 4KBIA 1HR0F 1FT8A 3ZZ0A 5IV3A 4IDHA 4C2MA 4A8MP 1JLGA 2HNDB 4CDGA 1DTQB 5BRHA 1HHSA 2RUGA 2EBGA 2EX3A 4IO8A 2DNMA 4C1NK 4I9QA 2DTJA 4RU9A 4DR4K 2JNJA 2OFGX 3ULDA 3H0MB 1LV5A 1WG1A 1RT2B 3WBZA 5H1SV 1F0XA 3RB4A 3VGUA 3AQPA 1HUXA 1X4HA 2KN4A 1F1BB 1KFSA 4WP9A 3MM5A 4K43A 2VU5A 1KP6A 1H2TZ 2DCUB 4PGXA 1CJTA 1RWWB 4Z4GA 1C4AA 2DNGA 1KLMB 2CVEA 1SQGA 2ZVSA 5A8WA 4ATNA 3MEDA 7ICPA 3ZSXA 5KT6A 1C20A 1WHXA 4FWOA 4YOXA 3ZTOA 4CZKA 3S41A 2DGQA 3QNWB 2P9EA 3OA9A 1XTZA 1J53A 4RW6A 1FNXH 2XICA 1PVPA 4YB7A 1LAWA 1EAYC 2YCHA 1UEVA 3NS1A 2WOMA 2AX1A 1NJIO 2F1JA 1BWFO 4DUYK 1RDFA 1T3NA 2XM3A 4GRSA 1U8WA 4U9RA 4IJNA 2CAJA 4TNOA 3GE9A 1M5SA 2RB7A 4CZJA 4WK1A 4I2IA 2F8MA 4GMJB 3LWLA 3ISBA 1YGYA 3MDQA 4I27A 1BI4A 5CYMA 5KG1A 5AQLA 3UN3A 4DX5A 3UPQA 1VK0A 3D6FB 1KQSR 2ZH9A 4KQZA 5C42A 3TVZA 2KZ3A 2Q6CA 2VANA 3N79A 2P9PA 3BQ0A 1YIJS 4KI4A 2PMZC 2WAQD 4K4ZA 3KK2A 3V4MA 1WKJA 4KY3A 4Z94A 4UBBA 1VQ7S 8ICAA 5J2NB 2AJFE 3AAQA 2UXBK 4PHDA 3L4PA 2RDDA 1VQKS 4CLKA 3TU5A 2E5IA 2K4EA 4DOBA 5AQXA 2LQJA 1ZQZA 4NYPA 5MLCV 1KQFB 2AF6A 5E2QA 5IM0A 4NJ8A 2QA2A 3MD3A 3UM9A 3PW4A 2E5GA 1NZBA 4TU9A 3PKYA 2RUSA 2ZUBA 1HUOA 1HI8A 1UW4A 4H4OA 2FE9A 3M6KA 2V9WA 1A6LA 2HFOA 3FGUA 2I7NA 4MLEA 1DTTB 4Y2TA 2W9AA 4O8KA 3G8TA 1ZXIA 5ALZA 2KXFA 1ILYA 4GO5X 1FNMA 3PEHA 2JH7A 3DXKB 4HR2A 3C2MA 3T5LA 2B3TB 3O1LA 3M05A 1NSKL 3CSKA 4CGZA 4F50A 1VIXA 2VOOA 1I1GA 4PKDB 3GYXB 3H1VX 3IMQJ 3FVYA 3N4PA 1VMBA 3OLBA 5ALRA 1COOA 4EGLA 2UUAJ 4CK2A 2KEYA 4CJFA 3FSXA 2HK3A 5E5NA 4EYHB 2MQ8A 1YG0A 2E7XA 2MKKA 3S01A 1RAIB 2FYXA 1UPHA 1N63A 1X5PA 2L9DA 2X1BA 2YWKA 1S79A 1VOMA 1Q1KA 1N8RO 4RZRA 2QX0A 4GLXA 3BH7B 5AQYA 1EWRA 1Q81O 3L2WA 3ZX0A 2WHOA 1VSMA 3N0VA 2HVEA 2AJ0A 1NM1A 4YR0A 3IGVA 1T3VA 4F5RA 2HBZB 1RLCL 3WC0A 3N5FA 4RX6A 2P51A 2ZE2A 5JTIA 1JJCB 1RGIA 3I31A 4KV8B 4LIRA 2B9EA 4E98A 1WSJA 3QAEA 2A3VA 4DSLA 4LRCA 4UT4A 1KC8O 3D0PA 1BISA 3K1RB 4NOHA 2E5SA 1NJIT 3C6TA 4RNFA 3E1YA 3KFUF 3MFIA 1P1TA 2J7KA 3I5CA 2MY8A 2IHR1 3PFOA 3P31A 3N7RC 3QSYB 4WFAL 4EELA 3PIPQ 2WFAA 4OJLA 2MHEA 5AM4A 1SC4B 4TLRA 2G8HA 4OL8A 4KB1A 5HRNA 2WVCA 4AUKA 2VGMA 4ZLJA 4QIWC 3V9UA 3H8YA 4NA2A 1K47A 2EK6A 2YI1A 4FOIA 4KLGA 4F91B 4RO0A 3Q0AA 1SL1A 3CMQA 2Q2RA 3AVHA 4DUZF 4BR5A 3WK9A 1J54A 1WG8A 8ICYA 2A6MA 2JMGA 2M2BA 3IRXB 3NCRA 4FL9A 1WSRA 2H3QA 2VG7A 4CF8A 4LSNA 2ZGZA 4EMDA 9ICBA 5HHHA 2P6RA 4FWLA 1AYEA 4NLPA 1YLXA 4RLEA 3RWUA 3GMGA 2RDJA 3NLCA 3HSZA 1X60A 4HI2A 1NMNA 4OJ1A 3VVTA 5A2QY 3QZ7A 4GV6A 3PXGa 4FW1A 3TUJC 4RG8A 3TWHA 4O5CA 3P83D 3MZIA 4M5GA 2X74A 2BW2A 3KJVB 4B3MF 1DKGD 1NGHA 4DPTA 1FJGK 2YNHA 3GOIA 5F0UA 4IFVB 2G08A 1JKHB 7ICNA 2B5JA 4ZN3A 1C0UB 3BYRA 1IBKF 1P1LA 1F5BA 1GLDG 1OPIA 1MA9B 1EQYA 4DV0J 2RHQB 2JX2A 1Y7PA 1I3AA 3JTNA 4B3OA 1F21A 2KIVA 1OSCA 1VQSA 4OHYA 3VF4A 2H4WB 2V8HA 4X65K 2HMIB 4F7VA 2ZVIA 5HN0A 3HZEA 1HYZA 1X1PA 3Q8SB 4UB3A 1J27A 1UEKA 4DTXA 1Q5VA 5C24A 4J9NA 3HKZC 5T7LB 1T02A 5B8HA 3SNNA 3E9OA 2UVWA 4KN7A 5ALSA 3L6QA 4BDYA 3KG0A 3ICLA 4W5NA 3MM9B 2VG6B 2AYEA 4URGA 4N5SA 2NPFA 1IKVB 2PFFB 3DRSA 5KFFA 9ICNA 3TRGA 2R2SA 5A6WA 2V8PA 3NMRA 3PMNA 4DPYA 5AT1B 3V6DA 2ZHBA 5AQQA 2WSEC 4DUTA 4C8YA 3NRBA 2FDRA 4KB0A 1HR0J 1J5EK 3O3FA 3QNMA 4DR5F 1KC8T 1JLCB 3EJMA 3TO8A 2ALZA 3VQPA 4NLCA 4UAWA 4KHWA 5D3GB 2ASPA 4NLVA 2HHSA 1LOUA 1V6HA 2GIRA 2AKWB 3VQEA 4QZGA 1E4GT 3OVAA 3H0PA 3H0RB 3LM2A 3WT0A 4DCJB 1AZSB 4Q0BA 4LBHA 1YTUA 1CC8A 1UWBB 1K73O 3PIPL 1RA6A 4C97A 4CM2A 1HLWA 2BGGA 3GIMA 2DHAA 2RVJA 2D0AA 4C80A 4DX7A 2AGQA 1VGYA 5AQMA 2AWZA 3Q24A 3C95A 2HOFA 4YDXA 4UTGA 4CESA 5GAHI 1JNRB 3RJJA 3VQBA 1C1BB 4LF7F 1U45A 1N5SA 3EUB2 4Z7YA 4UOGA 4R8UB 2RHFA 4R5PB 1PG5B 9ICLA 1Q95G 3DOLB 2PMZD 2UUBK 2OPPA 4V19J 3HW8A 2NUHA 4FSVA 3AVGA 2HVDA 3IV6A 2J9EA 2WBMA 4DTUA 4CP5A 3L2QA 3BPDA 3JYTA 4JEPA 3ZTSA 1LK7A 9ICHA 1SJ3P 4B3RF 3BZQA 4Y1DA 1LXJA 5CHIA 1LKYB 3J80Y 3KHHA 2GFFA 3H8SA 4P7VA 1DBDA 3S3NA 3F5TA 1SCJB 2NSCA 5CZVA 4OGCA 1JMSA 3U3YA 5G4DA 4DF4A 3VAGA 3OL7A 5GAHP 3J7AP 5A8RB 4HAIA 3WC2A 5DO2A 2P9SA 3IAS9 4DR1J 4KLOA 1SWVA 4AYBF 2FHKA 2M9NA 4H0PA 2FXUA 3CCUN 5L1IA 3MD1A 3BM7A 3UE2A 2XO6A 5E84A 1ZYQA 3R5DA 2ZXHA 5ETNA 3FRZA 5AK5A 2V8VA 4DR7F 2CGKA 5HRRA 3NF9A 4KC5A 3VAJA 5ETVA 3QFHA 4NLKA 1VQ9N 2BQ3A 3PJ9A 4NCAA 4JKFA 1IH7A 1OH6A 2WVBA 4WIQA 1HBNB 3RBDA 3U9DA 3KLIA 4XPEA 3BBBA 4TYAA 4RBTA 4IDKA 4QS7A 1WBBA 2AQ4A 4HI1A 1S4FA 4DCOB 2R8KA 2A3JA 4PG7A 1RAHB 4NY8A 5J0YA 4U96A 3RJKA 1NK8A 2C2DA 4RW8A 4ZPDA 3TTCA 3QO9A 1EO1A 8AT1B 2Z2ZA 3GFKB 3ATVA 4ZN1A 3AT1B 2L08A 5GAHU 3L4BC 5ALVA 2CJBA 1RPLA 5J0TA 1RI7A 4F4AA 1PC5A 2BE2B 3HSJA 5F2RA 1PAUB 4NM2A 3SFUA 2RLTA 4BROA 4C8MA 2LLZA 3GV8B 3C7NA 5CCLA 1E6VA 2DBYA 1XWLA 3SCIE 2K3KA 1FEEA 4WTYA 1RQNA 1ZQEA 3TX0A 3GCWP 4DV4F 4X66F 3OW2R 4BC7A 4DG1B 1O8BA 4W4MA 3BB5A 4ZCMA 2X6NA 1RSCA 4KREA 3FUYA 4UW2A 2M5YA 2W7AA 2OPRB 4PL2A 4WE1A 5HI7A 2QE5A 1OYDA 1B0VA 1R0BG 4QIWD 5KFAA 1WELA 3TZWA 1QH9A 1KVJA 2D6FC 3DMJB 3CHWA 2HIYA 1YDLA 3BGFA 2FZGB 3LPUA 4ZVUB 1C0TA 2RQ5A 3W5ZA 2W4DA 1QZ6A 2YHWA 3CCLN 3SQOP 3HHLC 2ADBA 3CDUA 3DWLA 1Q53A 4JI3F 4QBUA 4DN9A 2MQLA 3K5OA 1D1UA 3SCKE 2XB2D 2DF4B 1UKUA 4LFBJ 2HKEA 3DNCA 2Y1LB 1SIZA 1UVIA 4WF9Q 4KGMA 2MGZA 4DUZJ 1P6TA 3HCXA 1RBAA 1D09B 2VQEK 2LDYA 4KYZA 3QJJA 1RZTA 4FYYB 1SIWB 4RBVA 1SXDA 1RGVA 2V50A 5CZ1A 1MA7A 3WNGA 5KFWA 1FXRA 2YKMB 2ASYA 4CEZA 3E3XA 1I3OB 4NX9A 2A40A 4YMNA 1PJ5A 3VERA 1XNRF 3FZBA 2ATCB 5ALMA 1SL2A 2G06A 1SUQB 1LFWA 4HH0A 1RTZA 1D8ZA 1KAZA 1RHKB 2XHBA 1SZ2A 3LALA 2Y1IA 2R7RA 4RPFA 4FPRA 3AO5A 1DQ9A 3UIQA 3D54A 4CF1A 3NAEA 4B3MJ 4TUQA 3AQFA 4KHYA 2DEJA 4DR2K 1VLBA 2F9JA 3W2WB 4X64F 1PKUA 5EX5A 3OR2B 3ENWA 1MQ2A 4G3IA 1IBKJ 5F8HA 1YVNA 4ZPTR 1KD1T 4F2SA 1S5JA 3DM2A 2XBPA 1Y10A 3NDKA 3D3BJ 5DDPC 4ECUA 3PUFA 5DG7A 3MHYA 1WSVA 4GVBA 1CXUA 4QIGA 1XEZA 1B43A 2RU3A 4NCGB 1Z4UA 5DDMA 3LO3A 4DR1K 2KVIA 4F0HA 1F0MA 5L38A 3M8ZA 1BPDA 1YJRA 5KNIA 4KLMA 3UMBA 2W2QP 1RBRA 3ZZRA 4JKCA 1RT6A 4I2HA 4I2PA 4LBPA 5EUHA 2KVSA 3CULA 1V5VA 2GWJA 2AV5A 2FC0A 4JHDB 3PACA 2N7YA 4K5RA 3ZC4A 4IBNA 2A18A 4W98A 4BXOA 8ICLA 3FMWA 2KI2A 1ZQHA 2H3IA 1ZRNA 2BMBA 2E8PA 3QFUA 2W9BB 2WCXA 4DR5J 5IIJA 2F44A 4CF3A 5AQGA 4B1YB 2KU7A 2K4IA 3HMJG 4OKEA 1N5YA 1RBVA 2ZC3A 2ZBQA 1NU4A 2LXFA 3H6EA 2XHWA 2HMXA 3HP9A 3VGSA 4XIUA 4CF2A 3CCTA 4BRIA 1HJRA 4KGZB 5B0GA 5C2CA 5AFUA 3W3SA 4ED6A 2DFHA 7ICQA 3EXYA 3JQJA 1S57A 4Y2CA 2K1RB 3DV9A 4DPWA 1Y00A 3OY9A 1KQKA 2VIXA 4DSIA 1KHWA 4RQ2A 5IWAJ 1DQAA 4DDFA 2J7WA 4USMA 3ZDAA 2A1JB 2DNRA 2RNEA 4G1QA 5HL7Q 4DV5F 4OHWA 3LANA 3US5A 3V1QA 4O5KA 2W7PA 2G2OA 2Z1GA 5DG9A 2CQ3A 5M2PA 3GFYA 4M5NA 2PT0A 5AR0A 3KLEB 1RTDB 3MFHA 3Q7BA 4YS2A 3VHQA 4WF9L 2E8OA 2HRUA 1UW9A 3VTHA 2N7CA 1QDUB 1SIJA 3CNHA 2MQNA 3S3MA 3KG1A 1X9JA 4ISGA 2ACYA 5KTQA 1NK0A 2LA6A 4Y65A 3IM1A 1ACMB 1VDHA 4WFXA 1WC5A 2X7IA 4DSEA 3DOKB 4JI4F 5B66U 3PEJA 2VFUA 2GV9A 4B3RJ 2LPEA 5AKJA 3ISNC 3FZMA 1TFYA 2U2FA 5E3CA 4PCQA 3O5BA 2Y0BB 4NZ7A 1GTEA 2HZAA 2CPDA 5KPZA 1FRMA 4FZXC 3GDQA 4LF4F 5DMRA 3OGUA 4KAIA 2JZBB 4KLEA 3QBCA 3RW6A 2F96A 5LJWA 1K8KA 7ICRA 2BTFA 3O08A 3TZYA 1HWUA 1NO8A 4DEZA 1FRXA 1URJA 2VPZB 2QWPA 4TUSA 3A1YG 3PRBA 5ALOA 2EDUA 3THWA 1LWFA 2YMQA 2A5XA 3ZETA 3L7UA 4DR7J 3IBFB 5M1QA 4BGDA 2Z30B 1EQMA 2QC3A 4HDHA 3UNGC 4B9MA 3QRPA 2M88A 2YTCA 1J5OB 1I94J 1UOCA 3M9OB 2NXUA 1PK1B 3VESA 3OV7A 3C19A 1H2VZ 3NVMA 9RUBA 3HYFA 2DGOA 2FJXA 3GJQB 2PD1A 4DV2F 4YUDA 4PY5A 5I9EB 3UXPA 3B82A 3WIUA 1IM4A 1SQKA 1VQ8S 2VONA 1XNQF 3FQLA 2P9KB 3C46A 3KJFB 1VQ4N 3R97A 2W1BA 4I28A 1V3SA 1BQMA 3BS7A 5FPEA 4FK4A 2LYHA 3PJWA 3GL1A 3IWLA 2I8EA 1M5VC 2YPYA 2ZC4A 4J5OA 4FF1A 5AZIB 3R1LA 3N7PD 2AZ1A 3UCUP 3IRUA 3JS9A 2X6SA 3BEXA 4QOTA 2QXFA 2VFSA 4FK2A 2AH5A 1G4CA 4DR3J 2I0XA 1MU2A 4AH9A 3MI7X 2Y1JA 5TISU 1UJ5A 3JSMA 5ADZA 3OVSA 4DV4J 8ICSA 4X66J 4UB1A 3W64A 1LWCB 1QVGR 4YN3B 5KRTA 5ALKA 2EC0A 2VA2A 1REVA 1BGXT 2O5DA 5HL7L 4BUGA 3ZYYX 3BYPA 4I68A 4M63A 2BUPA 2M8DB 1U47A 2M9KA 4AQYF 4YMOA 2Z8QA 4KLDA 1U2RA 4BLGA 1IG8A 1FFUA 3W0LA 3LGHA 1J97A 1YJ9S 2KZZA 4JI3J 2MJNA 5H1SQ 5AQSA 3TAMA 3NGRA 4O23A 3DGPA 2Q4TA 4M3RA 5IWAK 5L46A 3DLRA 1JLBA 1XC3A 1ZJNA 4NL9A 3QWPA 2XMJA 2HZVA 3VQ4A 2G1DA 3UDEA 2D3ZA 3NS7B 1U1KA 3MN6A 4IQXA 2VJ4A 1ATNA 1S72N 1V9OA 2ERRA 4HHHA 3NASA 4F3OA 2OM6A 5IXUA 1VSLA 4EBCA 2MLYA 2DPJA 4MK7A 3QT7A 1XNRJ 3A8EA 3QX7A 3MECA 2KKZA 1IKWB 3CIPA 4QYZK 3H3NO 4MDBA 4FJ5A 4I0WA 4L3QA 1NPPA 4QR0A 3QAUA 4BC9A 4P7TA 2ATQA 4IZ9A 5ETOA 1Y88A 2C3UA 3EZOA 3QICA 1N60A 5ETTA 4X64J 4MKAA 1TELA 3MC1A 4CLFA 1U49A 5J2QA 4MT1A 5JJBA 2C2RA 2VBYA 4O44B 3KWMA 3PW7A 7ICLA 3KD3A 4AHRA 2DNHA 1N5WA 2JLEA 1VQ4S 2G8UA 3D2EA 1KOOA 1RKIA 1TL7B 5IC6B 3EN9A 4K42A 1F2GA 1TKZB 3I0SB 4OZ2A 4JAXA 3GIRA 3OR1A 4AYBC 4DPXA 5MLCQ 2JXJA 3HSDA 3OYHA 2IVPA 1R8HA 5A2QO 5KOXA 4GKKJ 4CGJA 2WVEA 4QR1A 3RJMB 5IV4A 3TANA 1EKEA 3PSIA 1BU6O 2KT5A 3IDHA 3CXCR 3JB9k 2JH1A 4ZTFA 4A8XA 2YH0A 2B9WA 3CF5Q 5LMNK 3IM8A 3C5GA 4NLTA 4KTQA 2LU2A 3QGIA 3C3LA 2V8DA 3OL6A 1IR0A 4HACA 1I94K 4OYBA 2QLWA 1T03B 3ELHA 5JRTA 4PUOA 4KPYA 4UF4A 1WF0A 3D0IE 3F5EA 2GUPA 2B6AB 5GIOA 5J2JA 3E66A 1FO4A 1V3ZA 1Q9YA 3UE5A 2JEFA 4JOUA 3H45C 4JKAA 3CG7A 2D7SA 1NSQA 3HX9A 1GOBA 1YJVA 1KS2A 1FKAF 5HANA 1BY9A 2YTUA 1GOAA 1NOZA 8ICNA 5KFHA 1WSFA 1PBAA 1JJ2R 1QTMA 2XEXA 3KKAA 3CCSN 4H54A 3UKUB 1S72S 3K2PA 3TNVA 4DR3K 5HQMA 1V4SA 2IDEA 2DJWA 5TKYA 3WU2U 3U1NA 4DV5J 1FVQA 2FZCB 2I9SA 3CJAA 3P6YC 2QL7B 4ZVOB 4B1WB 2X78A 5LY3A 1DT9A 2MKIA 2ZITA 4QU6A 1TZ0A 1RAFB 4W92B 1BE4A 4CO0A 1Q82O 2JEGA 4A8OA 1JQGA 1NJYA 3ET6A 4RUHA 4H5WA 3F56A 2N4DA 3OJSA 1NG9A 2ZOMA 4PA1A 4H5NA 4A2BA 1Z4NA 3L3CA 4KLLA 2CQ0A 1HBMA 3NTUA 5DGAA 3P5TL 3I33A 2O8EB 4FFDA 2HBLA 2HSZA 2W11A 3UFCX 3GG4A 4JI4J 1HUZA 5DB9A 4X62K 2OH2A 4KGXB 3KWIA 5K14B 4PWDA 1OMSA 3EVMA 1TUVA 4XK8C 3WDOA 3AVKA 1YT3A 2NRVA 1FD2A 4LRDA 2D0PA 4I69A 3PRDA 3R5JB 4E7JA 3P39A 1F5CA 4QW9A 4LF4J 5HOOA 4M04A 3NNHA 3NHGA 4C4RA 2CQ2A 2VB6A 4NZ0A 4AP9A 1VQNS 2G0AA 1G1XA 2XQCA 2F8EX 5TZVA 2D9PA 2OSQA 4PWUA 3EICA 4EHTA 4ZITA 2NYVA 3KXDA 4HHTA 8RUCA 4QPTA 1H1VA 1HMVB 1T3OA 3WNFA 4PGQA 5HLFB 1V38A 4L3KA 3I1YA 3FDSA 2VF3A 1RG6A 3C16A 1NNEA 1JLGB 4MO4A 4J9SA 1KW4A 4JB3A 3ZO7A 2FIUA 4LVNP 4JI7K 4H4KC 2Z1JA 3J80O 1B3TA 2MZSA 1WN7A 5AIAA 4IJAA 3GPAA 2E5LK 3R5GA 3M1VA 3CF5L 2W43A 5J1EB 4FJMA 2LYBA 4UW9A 2X1AA 5LMUF 3HT3A 1ZD3A 2O8BB 3UCGA 4DV2J 3MM5B 1DGSA 2KB2A 5KOWA 3AVFA 2KN7A 3M6XA 1KBUA 4NLQA 3TEGA 3UVJA 2FTRA 4PQUA 4KLSA 1RWVB 3RB0A 1CJTB 4CZFA 1XNQJ 5BRDA 2ZJAA 4YMMA 3CCSS 5A8WB 3MEDB 3CCRS 5J0QA 4J9LA 4GKKK 2IRYA 3M5RA 3I28A 3AA2A 4CJKA 3IFRA 2EZXA 1Z19A 4NEYA 3A0BU 3MN5A 1U0SA 4DQRA 3BF3A 4RW7A 2JL9A 3JXUA 3CC2N 3N4WA 2HBKA 3BKTA 1Z2LA 5JVGQ 2B51A 5BPNA 4YY3F 1MC8A 2BZ2A 4RW4B 1YBAA 4R63A 4F9OA 4LJMA 2PN6A 4NMXA 1WBDA 2FLNA 2QIFA 1WKKA 2MZ1A 2E44A 4CLLA 2BBEA 2Z0GA 5CYMB 2G09A 4E89A 2UVUA 2E7WA 3G82A 5KQDA 2BE9B 5ADXA 1MQ3A 3LUYA 5C42B 1M5KC 3BGRA 4DB3A 4AQYJ 2HWIA 4I2BA 2Q1NA 2M0NA 2BCQA 2FD2A 4KT0C 4ECYA 4FZLA 1ZD2P 4DKWA 3KK2B 2HQFA 4K4GA 1U1MA 5GVQA 3KZBA 5D0GA 4DV3K 2YVSA 2KHCA 2NPIA 3D2WA 3V81B 2JC1A 2IDOA 4UY8O 3O0FA 5E26A 1J2MA 5AKZA 4MH8A 5IM0B 3DRRA 3L2VA 1JROA 4I2FA 4USIA 4RJVA 4WU3A 7ICOA 3CMES 5DZ6A 3DLHA 4G65A 5E33A 5IZHA 2G5IB 3WK5A 4RTFD 2MKJA 3QEPA 5HJYA 3KJQB 4LZDA 2PFNA 2BRKA 2E1YA 1B70B 2V68A 2EFQA 3FNNA 4IOBA 4LQ9A 4O3SA 3UKRA 2YX1A 2C2KB 2MKCA 3ZFVA 4JV0A 4IFYA 3SMZA 3D67A 3R1HA 3BP8A 3SBMA 3UO0A 4B3SJ 5J0UA 1U0HA 4ER8A 3UN2A 2YV0X 1VQON 1A5VA 1FEHA 1TK8A 2HBQB 5A8KA 4L6V3 4BACA 4I2CA 4YOEA 3MGIA 3HHLB 3U3GA 1FKOA 2GQQA 3H90A 1ZQTA 2VPWB 4OCZA 5ITHA 3HPGA 5C12A 4USVA 3S7RA 3FEYB 3FKBA 1E3MA 1K8AT 3T1HJ 2MSTA 2AP6A 3CJKA 4WKRA 2KVQE 1CJUA 2D0OA 2IVFB 2E8MA 3S6EA 2ESEA 2CQIA 2P5VA 4JI2F 1R8BA 3LGNA 5JICA 3D1QA 5D78A 7FDRA 3F2KA 2UV8A 1XI1A 2RRNA 4UASA 2R7TA 3HHDA 2ZZTA 3H8JA 1Z00A 4B9VA 4ZLLA 3WX8A 1MMNA 3HULA 1R89A 2H5IB 3UR3C 5HVHA 2DNNA 5F8GA 3GTYX 3H2LA 3K1ZA 3H5XA 1N32F 1QUVA 1MWZA 1HWIA 3CC2S 3EM1A 1J9AA 2YHYA 5LL6d 3ZT1A 3BZCA 4H5TA 4FJ9A 1S5LU 2NXNA 3R9KA 1QY7A 2K3IA 4OLBA 1UEUA 3D4JA 2GX9A 1NSAA 1T0TV 2FGCA 4U95A 5HVGA 4DSJA 3C6TB 3ILLA 4RUAA 3RGIA 2DUYA 1CULB 4OFZA 4X5VA 4A8FA 1N2XA 4RPZA 4US8A 1U48A 4A61A 2WB1F 5JVGL 1S7HA 2KICA 4FWNA 3MK6A 1MWYA 3FEXB 1D9FA 4X2BA 4QR2A 4B8AB 1LW0A 4B1UB 2QRRA 4ENOA 4WP8A 5J29A 1QQ7A 3BKUA 3FAHA 3MDCA 2FJEB 3CIZA 4M9NA 2R8HA 2VQFK 1OKJA 1L3UA 4FLUA 2QO3A 2KG5A 4CE9A 3GFZA 1YWXA 2I5JA 4TKTA 2VG7B 1UTAA 4UY8T 2XI9A 4LSNB 2D0BA 4PYAA 2NZTA 4K4XA 4OI0A 9ICMA 1S1VB 1UA1A 3BGUA 8ICRA 2CRXA 2FB0A 4BX9C 2LSNA 4NO7A 3K7RA 1BNOA 5J2BA 1TUWA 4ZVGA 2OAUA 4BBYA 4HKQA 2Q3PA 3MTKA 3BQ2A 5ALWA 4AHTA 3PSFA 3ZX3A 3OFEA 1UAXA 2K4PA 4KLUA 4TLQA 1YUWA 3C2KA 1LFPA 4RW9B 2XCAA 1LEOA 3PNIA 4YDUA 1Q18A 2HQ3A 3FBCA 4Y0WA 3S9HA 4QZEA 3BV8A 2E7VA 3HILA 4RQNA 2B5JB 5K5MA 3M6WA 3PHEA 1LKZA 3CCMN 2D74B 2DO4A 3HJVA 2BYCA 1UQVA 2CQ1A 3HHNB 3JPOA 3NGIA 4B3OB 4J91A 5CABA 3FCWA 1TAQA 2DIUA 4WYBA 1TKTA 3SUPA 2CXEA 2KM8B 4P52A 4O4GA 3EEQA 2GLEA 2KFNA 4K41A 3W1YC 4L75A 3GV5B 4JMUA 4B17A 4O4RA 1QQNA 2PEBA 2YHXA 3V6JA 3CVKA 4B3SK 2RQKA 1VSIA 2BQUA 4CZHA 5KPRA 1RNHA 1JALA 4ED7A 3V6DB 1ASVA 2J6UA 1L7PA 1U25A 4LBIA 2B4PA 3DDKA 2APOA 3ULHA 2ZUAA 4F92B 1QE1A 2RP5A 3L4QA 3WXIA 4CJ4A 2CWXA 2GQCA 3M2RA 4M5DB 2DO0A 4N8OA 3IG1A 4A5BA 3VQAA 1IWGA 4F93B 5LMUJ 2BOPA 3IHQB 3PX6A 2WB4A 2H4YB 4YB5A 2KYXA 4OJPA 2YQ0A 4Q0BB 1ZQ1C 2BJ8A 4RWXA 1NEEA 5GMKa 1TYQA 2M3DA 4Z4FA 5D4PA 2XRIA 5KGXA 3DLKB 5KFQA 2BEFA 4Y2XA 4C7QA 4WQ4C 2QSWA 5AXMA 3TUPA 4MHVA 2AJ4A 4EFHA 2R7YA 3MMVA 3WKAA 2ZHOA 3SUNA 1S48A 3L3UA 4HWIA 4PPXA 1UVNA 5AI5A 4ZVFA 3AA5X 2JGUA 2E1MC 5K8PA 3RUBL 4CJUA 5EN1A 3TTDA 2IHNA 1DQ8A 3K17A 5KFUA 1HPZB 1P8GA 5H9EK 3GBTA 3AA8A 2E1PA 4K7QA 4CECA 4P2MA 3AMZA 5BYRA 1RBOB 1N4LA 2JEJA 4M0AA 3FBEA 2OPPB 4F4WA 3ZZOA 3CCMS 4MLHA 2R2UA 1BPXA 3JYTB 1M5HA 4CIGA 5EE9A 3J7ZT 2RMLA 3M2UA 4P10A 5J8YC 3K5LA 3J7A1 1XIQA 1JL1A 3QIOA 3SQIA 2PFPA 2Z1IA 4PEOA 4DXLA 1CJVA 3MEEA 5HATA 4BC2A 4RQ4A 3BO2A 5F8JA 2WK4A 2MJUA 1SGGA 4J8FA 4F3MA 4J9OA 4BRLA 5CD4A 2HK2A 5ETPA 4FJJA 3O9TA 1VIOA 4N41A 1MWMA 2P9SB 2G1HA 1D3WA 4HHJA 4K59A 3P49B 4CHPA 4QZ8A 3AD9C 5HROB 4GVMA 1FWPA 4Q2LA 7ICVA 3WKBA 4RPXA 3CCQN 4Q43A 3FFKB 2EFVA 1PK3A 4JB8B 2O8FA 4EO6A 4DJBA 2H5EA 2M70A 5B0FA 3EZWA 4JI1K 3GJRB 2C22A 4O0NA 1YVFA 1XUPO 3M8PA 2AX0A 1TL4A 4LMZA 2G0CA 4Q8EA 3RSEA 4FF4A 1YZ7A 2F77X 2RE2A 3O4WA 3GR1A 1N33F 2P5GA 4IDKB 3PYEA 8ICTA 3KNGA 4OYXA 2W04A 1WAFA 1YJTA 3C8YA 2D5RA 1VHFA 2O8CA 4RW8B 4ZPVR 5CWRA 3QO9B 1BCMA 1Q3UA 4NXMK 1DOQA 2HQIA 2OD6A 4YR2A 3DRXA 3UPFA 1OS5A 2WZ1A 3W7BA 3T69A 3OD2A 4YXMA 3DYAA 1ZS6A 5EU7A 2R7OA 5DBBA 1LCUA 3T1YK 4XUSA 2BDPA 1N32J 2BCUA 1E6VB 3C5FA 3TADA 3IBPA 3MCSA 4A8WA 5KFSA 5KFPA 3G71S 2HSTA 4LFCK 5JS2A 3D6JA 4WKYA 2YWGA 4BG9A 5DBCA 1OSDA 4BJQA 2FC8A 2E20A 1ZQJA 5B0CA 2JH3A 2XZWA 4BRDA 4WE1B 3L3VA 4ZVQB 4C98A 2A6OA 1VSFA 1W2BR 3J7Z5 3P4UB 2XIDA 3OXGA 3L0QA 2ZKUA 2R7WA 8ICOA 5L9NA 1C0TB 2HW3A 5KG7A 1ASUA 3RJEA 1CUKA 4OVLA 3OHRA 2B6GA 1COKA 4Y2QA 2WONB 3FR0A 1AROP 4CHNA 3OYFA 1NZPA 1MN8A 1JLQA 4HYKA 1VSDA 3GQCA 3EE8A 3ZDCA 2DFEA 5SUHA 2OEJA 2AIRB 2OTLN 1XERA 2CJ9A 2ZQBA 1KQSM 9ICFA 1C6VA 1WCLA 2HVZA 2E5HA 1N52B 5AJ3K 1RWNB 1R0AA 1QQOA 3B6BA 3OUYA 4DL2A 1UT8A 5FD1A 4FM2A 1XJWB 2V2QA 4JWMA 3NCQA 3WQTA 2KH9A 1D5AA 1ZQVA 3SV4A 1AQ6A 3H0LB 2ASJA 1UMJA 4PHTX 3A3NB 2GWKA 2RF2A 3JQKA 2G13A 1U8SA 3MOZA 1SKRA 5BJRA 2BJEA 2UUWA 4EX7A 4J90A 1H2UX 3CJSA 2W8KA 1N34F 4RQ6A 4XRHA 2DR8A 3T79A 4M7YA 2G9OA 6FDRA 3MUTP 4E3SA 3BJYA 3K0JA 1S1XA 3EVWA 5KAFU 2CG8A 2AZ3A 1UCVA 1VBXA 1QQ5A 2HYIB 3LDLA 2HDOA 3QNOA 3L4IA 1SV5A 4MEYA 4YD2A 3TA0A 2LDIA 4A47A 1BHLA 2CQHA 3Q22A 4FJXA 3DM2B 3C15A 1X5TA 3FYHA 1CC7A 1T94A 5BN8A 3IAYA 3IR6B 5AQUA 1T9WA 4C11B 4I2AA 4J9RA 1WJ9A 4M2YA 2VUGA 1RE1B 2BCVA 3FSYA 3MX2A 3MAQA 8ICVA 2P9UA 1ZQOA 4JK9A 4ETXA 5E0OA 1RT6B 2D4WA 4I2PB 2DB1A 4J9UE 5EGYA 3N6NA 2G4BA 3BN4A 2RQCA 4G1PA 4USJC 2E9RX 4KHPJ 2CQBA 1OJ4A 2LI6A 3VALA 4NXNF 2PA8D 2H1YA 4R0JA 1WAJA 2F1IA 1YJ7A 2DPIA 2BKPA 1U6FA 2YXLA 2X51A 4BXOB 4J2BA 2R9LA 4DSFA 3M1YA 5LJ5Y 4IL6U 4Z7CA 4ID1A 1NCLA 3W9IA 4LT6A 3D45A 5JMNA 5HVFA 1KBRA 4LF8K 2F1FA 5HAOA 1N5YB 2CZ4A 4ILLA 3TP2A 1FVSA 2C3OA 3UMCA 3AB4B 2PAVA 2OTLS 2JLFA 1RXOB 3B54A 2FVCA 2ZD1A 1FTRA 5CHGA 2HF3A 2CJYB 1X3MA 4CLZA 2E1FA 3LAKA 2AYGA 1W2IA 1WC1A 2IM3A 3KLVA 3IXQA 3TQEA 3G4SN 5J0PA 2GGPB 3H8WA 4G1QB 3VQDA 1RT7B 4CZEA 4GFJA 3FGVA 5DQIA 5HR7A 1VBZA 3SI8A 3J7YI 3DOMA 2QB0A 1HQEB 1IJFB 2ZDPA 3KFWX 5J0WA 1F9EB 2GAGC 2LBOA 3OJUA 4LZGA 2KNJA 3A12A 3V7KA 5AHXA 3BR8A 1FFVA 4Q45A 3G10A 1YITS 3FCVA 1CZAN 2W42A 4O5BA 5KT2A 4DR4F 3C2PA 4FWMA 1FJCA 2K60A 3OYNA 1SV0A 3RF9A 4HTLA 3OXLA 4A46A 2W2MP 2AW0A 4BCAA 5ALHA 4F25A 1IBMK 3W3DA 1H98A 1FFSB 2YPZA 2QKKA 2YQ1A 1J2VA 2NO4A 5EE3A 4LR7A 4JYAK 2YJEA 1FD8A 1KWMA 5J0OA 2BV3A 4CEOA 4OHXA 3MDFA 4F5OA 5D77A 3SR6A 2R7QA 3CM5A 3DKDA 1XO0A 1Q8BA 4RUCA 1QAXA 4DUYF 2VIHA 3J7YP 3KDOA 5J2PA 4JI8K 3M8YA 2EZZA 1NGIA 2D3UA 7AT1B 2KSOB 3CC4S 4OHVA 5AIBA 4DR6K 4OPAA 3HFVA 2QWLA 3NVVA 3THWB 4EEKA 3LPYA 1LWFB 5AXKA 4FZYA 2NCKL 5EHHA 2OUGA 3BDPA 4A8EA 3UW1A 2UV8G 4BR4A 5DKWA 2JRZA 2OD4A 3BF4A 3WEEA 4AM6A 4OPJA 3QEIA 1HJOA 5AFUH 2KK0A 7ICSA 1VFJA 4W90B 2UXCK 3JXOA 5CQGA 1HNZK 4M94A 1ZM4A 4X4UA 2FHJA 2IOFK 3AD7C 5BR9A 3PY8A 3I32A 2UXBF 2OI2A 3P45B 3NBPA 3R7SB 1NGGA 1BQNA 2EEYA 2LQ5A 4M47A 1Q79A 4PHAA 3D68A 1RAEB 3ZXWA 3PHTA 4I7FA 2F9DA 3SCLE 1ZPVA 2V94A 1JJHA 3G4SS 2E2PA 3DLLQ 3J7YU 3QIPA 1Z26A 4CEDA 3AU6A 1N62A 4KHPK 2WF7A 4TSXA 3TAPA 3TJAA 4EZ9A 2DY9A 3IGNA 4Q7AA 1NGBA 2BUNA 3HKWA 1W7WA 2F7VA 2QL9B 4M5LA 4WJBA 3M3ZA 1SPBP 2DXDA 2O1PA 1MU2B 2O6KA 1TKDA 5CA7A 2R8GA 4F72A 3QJPA 3OYGA 5KFOA 4TURA 2G8IA 1KCFA 2FJBB 5DRKA 3FZFA 2UUCK 1C0FA 1HBUA 1KN5A 1REVB 3MN9A 1G99A 5ALIA 1IKYA 3NRWA 4X4SA 3B6PA 3RTVA 4CH0S 4CRXA 2JSXA 2HS0A 1L3KA 4ANDA 3KWGA 3CJ2A 2ZWPA 3QLHB 2X1GA 4N77A 5EOYA 3PZPA 2VWJA 1HNXK 2W9MA 5G0RB 1B7YB 5IQQA 3TAMB 2Q31A 4FBUA 2LM4A 3DGPB 3P3DA 4DV6K 3FSIA 2IIHA 1NAQA 2VFTA 4ECXA 4X84A 4BREA 3CDEA 2VBWA 3M2VA 5EX3A 2HAIA 2YQEA 1U2CA 3QFWA 3SUQA 2IJNA 2Y8YA 3CERA 4BRMA 1Q7YT 5E3QA 1HQUB 3NMUA 2IFXA 2P2CB 4B9TA 2GS8A 2ZIXA 3JPQA 4QZDA 4OIXA 5HP1B 4PQAA 4LF5J 4RNOA 1MWKA 2Q3SA 5K8NA 1RXVA 1FRHA 5AI9A 3GZ7A 1BUXA 1N34J 4HCBA 3MECB 1Q4RA 4JS5A 1TMMA 2GMLA 4NA1A 1GQEA 1RWOB 3CFRA 4V19S 1KKXA 3J7AN 3E8OA 2PGCA 1U24A 3CIMA 3CYMA 1PUZA 2JV3A 2B8QA 2E2NA 3I76A 3VGVA 1S9EB 4ZPAA 5AKLA 1JIHA 2IYIA 3T9ZA 1QAIA 5KFJA 4IOAL 4U6PA 2JOQA 4E19A 5J2QB 3TACB 2GA7A 1VSEA 4ISEA 3FQKA 2GBZA 1IBLK 4URQU 1DURA 3K4GA