3BDPA

Dna polymerase i/dna complex
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
580
structure length
580
Chain Sequence
b'AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVRAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*CP*AP*TP*GP*AP*TP*GP*CP*2DT)-3')
publication title Visualizing DNA replication in a catalytically active Bacillus DNA polymerase crystal.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
total genus 201
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1997-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3bdpA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3bdpA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bdpA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3bdpA01
2W9CB 2C2RA 4H4OA 3SUOA 3V6HA 2Z1GA 1TK0A 3N4MB 8ICGA 4J9PA 4LSNA 2ZJ5A 1WAFA 3L3UA 3ZDCA 1J53A 2PY5A 4NY8A 2BCQA 2ASLA 7ICJA 4IBNA 2D0CA 3PV8A 1T3NA 1A5XA 3NCIA 1JLAA 4M3UA 3IRXA 4CHQA 2P51A 4DTOA 1U9LA 5J2PA 4YCXA 4F4KA 3LDSA 3HM9A 4CK2A 4YR0A 4GXIA 2KFNA 1BQNA 3M8SA 4M9JA 3NF6A 9ICWA 8ICSA 2EX3A 1S5JA 8ICCA 5HRNA 1HYSA 3WNHA 4JV2A 5KFIA 1FK9A 1WAJA 2BHNA 1C6VA 3H4DA 4FZZA 3B6OA 1JLGA 3Q8LA 2DY4A 2R8KA 3UXPA 9ICKA 2LSNA 4QZ9A 4J9QA 4MQ3A 3SI6A 3KD1E 4RQ0A 1KDHA 3MGHA 3M9OB 4CHYA 4FM1A 5SWMA 3TANA 3T5JA 4GVMA 4RW6A 4ECUA 1F21A 5JUMA 4F50A 1RT1A 3ZSRA 1BVSA 8ICEA 3EZ5A 2PXIA 1RXWA 4ECVA 4B9NA 1NJXA 3QESA 5J2MA 4FJLA 4CEZA 3SQ4A 2PI4A 1VSFA 2B4JA 3AO5A 1ZQSA 4CIEA 3T5HA 5CA7A 4E7IA 4YXMA 3PX6A 1MQ3A 3C21A 4RQ5A 1K1QA 4DL7A 1HMVA 1VK0A 4NYNA 2W8KA 1JL1A 3AA3A 5KFOA 4Q5VA 1ZBIA 3THVA 5HP1A 3SUNA 3IS9A 2H5XA 5J0YA 3RH4A 3V1OA 2BPFA 1HQUA 2DFFA 3DM2A 2FMSA 3MR3A 3QERA 2R7YA 4J9LA 1GOCA 1ZQOA 1Z00B 3B0XA 2NRVA 5SZTA 4RNMA 3H8SA 3LWLA 4ELUA 1BL3A 2BKEA 4Q44A 1BIZA 4ECQA 4I2QA 5I42A 8ICIA 4KO0A 4OPKA 3RTVA 1BISA 2XY8A 4G3IA 3I0SA 4PGXA 1LW0A 1KEJA 2BCRA 4KTWA 5DG7A 4HCCA 1DOQA 3ZDAA 4C8KA 3RBEA 2BQRA 1HQEA 5DG9A 4QZ8A 4LZDA 1RBVA 1DLOA 3HSTB 1ZQYA 1UA1A 3ZD9A 2D0BA 1NOYA 4EYIB 4W5RA 2QK9A 4PHAA 4DTPA 1DTTA 2PI5A 1QS4A 1BI4B 2EHGA 3OSNA 4KHUA 1WSJA 3SUPA 2JLEA 4CEFA 4JRQA 4KI6A 1XHZA 1TV6A 1KVAA 3VA3A 3HK2A 2P5OA 1WN7A 4IRCA 1QE1A 4M42A 1QLNA 2NRWA 3B6PA 3VQ9A 1UT8A 1K6YA 1S1UA 1EX4A 5KFYA 3HP9A 8ICMA 5IINA 5DDYA 5KG0A 4J2AA 4NM1A 1TGOA 4DEZA 4Z4FA 3T5KA 9ICXA 4KLOA 1HUOA 1MSWD 2ASJA 4NLZA 4AILC 5HROA 9ICEA 1S9EA 3KLIA 3C95A 2PFQA 3TAQA 4H4MA 3NH0A 3ZSQA 1TAQA 5HP4A 4RNNA 4OGCA 2XO7A 9ICQA 4RW4A 1JXEA 4I2FA 1TVAA 4KRFA 4YVZA 1JLBA 1LAVA 4CIGA 4IQUA 4G1QA 4FCYA 2JEIA 3KTQA 3QEPA 1ZQAA 4IG3A 4Z6FA 1O1WA 2HHSA 3VQ7A 3TFRA 1T05A 3CQ8A 4FJ8A 2R8HA 4F4XA 4E3SA 4Q43A 1WSGA 2ZUCA 8ICUA 2DFEA 1NJYA 4JRPA 4M9LA 7ICOA 3NH1A 3V6JA 4B9UA 4N5SA 1LB2B 1ITGA 1XHXA 3PMLA 3OY9A 2VG7A 3H8JA 2F1IA 1VSIA 1FKOA 4KN7A 3DOKA 3NGZA 4RNOA 3AUOA 3QINA 3GFKB 1RTHA 4QWCA 7ICRA 3CFOA 1MU2A 5HRSA 4QZCA 3GDXA 1ZQWA 3PW2A 1QSSA 3SQ0A 4C8MA 3T5LA 2I9GA 1RYRA 5KFNA 4CERA 5KFPA 2G8WA 9ICUA 4B8AB 3HYFA 1KTQA 1SKWA 4GW6A 2JEFA 4DU3A 1WSHA 5CYMA 4I29A 3DLKA 3KKRA 5D49A 3MABA 1B22A 2FBTA 5KFMA 4GC6A 4UB5A 3MAQA 2A1JA 3VQCA 3G0ZA 2ZTEA 3RRHA 4DQIA 3MR6A 5KFCA 3MEDA 3LK9A 3H4BA 5BOMA 4NXZA 1ZQVA 1RT7A 4F3TA 4FLTA 5CYQA 1SV5A 1T03A 3MXJA 4EP4A 3DRRA 2B6AA 4J2BA 4I28A 3AVCA 3O4QA 1ZQRA 3KK3A 3K5NA 1GOBA 1JLFA 1BPYA 4HVJA 3V9UA 1EKEA 4QZAA 5IIKA 3OHBA 3OJUA 1RT3A 4FZXC 1KRPA 1S1TA 2Z1JA 3CYMA 4IRDA 3TI0A 2BANA 1LWFA 1I3AA 5K14A 1W9HA 1RBUA 4ECXA 3ZSYA 4DG1A 9ICGA 3LDAA 2IDOA 5KTQA 1IKVA 4FM2A 1UWBA 1X9WA 4RQ2A 1MQ2A 3F9KA 1ZQEA 8ICYA 4DQPA 4CK3A 3M9MB 4FYDA 1X9MA 4B9TA 3I8DA 4RG8A 4CEDA 3NDKA 4BWJA 2RDIA 3AVAA 3OS0A 1Q9YA 2RF2A 4KI4A 5KFAA 3BJYA 1CXQA 2ISPA 3C5FA 5BPCA 3BDPA 5L1KA 1QTMA 4RPZA 7ICGA 1JXBA 2OPPA 3MEEA 4AHSA 2G8KA 3C94A 3DYAA 3BQ2A 1ZQJA 4CJUA 1XO1A 3M8PA 4I2PA 5IILA 3ZT3A 3TAGA 2VANA 2IS3A 2DTUA 2X74A 1CLQA 2HMIA 7ICTA 3B0YA 4F5RA 2FMQA 9ICFA 4ZH4A 5C5JA 3ZCMA 4HYKA 4ECZA 4DQSA 3O3FA 1KSPA 3QEAZ 1LV5A 8ICXA 4EBDA 4NYFA 4QOZB 4E7HA 3TR8A 4F2RA 3RJKA 3M9NB 1IM4A 3UXOA 4PHEA 4IRKA 3SQ2A 5KFKA 4ECSA 1YT3A 3OYKA 3TAEA 1ZQXA 4IQVA 3JPOA 2IHNA 3V1RA 3K4GA 3RJHA 1JIHA 1U48A 3EY1A 4RQ1A 2KN7A 4OVLA 4JLHA 3DI6A 9ICBA 3KLGA 4CECA 5EU7A 1C0TA 4M3ZA 4TQSA 2MUTA 4Y1DA 2ZTDA 3SZ2A 3LP2A 4M9HA 2X78A 5KFSA 2ZD1A 3GV8B 1BPZA 4M3YA 1T4GA 1RDCA 1SKRA 5DBBA 5KFDA 4CEEA 1S10A 1N6QA 3L2RA 2AQ0A 3V81A 1TVRA 1XSNA 4DTNA 3DLEA 4FJ5A 3SI8A 5FROA 5KFZA 2RDJA 4RQ8A 2E4LA 2ITGA 2KZMA 4CJLA 1RBRA 4PA1A 4FLYA 3RWUA 1C0MA 3S3MA 8ICOA 2XY5A 2Z1IA 2A1JB 1J9AA 3IAYA 4LH4A 3JSMA 1FKPA 4CGHA 1D8LA 4ED0A 2VWKA 4E7KA 4XIUA 2WOMA 3OYAA 5DBAA 1B9DA 3RAQA 1VRTA 4DTMA 2G8HA 2B21A 4DFMA 4N47A 5D3GA 3RAXA 2IA6A 4PPXA 3V9ZA 9ICHA 4KPYA 8ICBA 3AVGA 4L8RB 5C42A 3H7IA 4FJNA 4KAZA 2GBZA 3RMBA 3MXMA 1VSMA 5J2GA 3QEBZ 5FRNA 3ZSZA 4DFPA 4E0DA 4FS2A 5KT7A 3Q8QB 3U3YA 2AGPA 8ICHA 1KFDA 7ICEA 3ALYA 2FBXA 5DLGA 2HHUA 1BHLA 2YHBA 5KG7A 3P1GA 1BCOA 4EP5A 2YNIA 5J2QA 4RQ6A 4W5TA 1XSLA 4FLVA 4O3NA 4DU1A 5KG3A 4RPYA 3MR5A 2P1JA 3SQ1A 2OZSA 5L1JA 2NRTA 4I7FA 4HTUA 3LP3A 3RJEA 4F4YA 2PYLA 2BPCA 4P4PA 4DSEA 5KFWA 4O3PA 5C25A 4RZRA 2IBKA 4BDYA 1V9PA 4F4ZA 9ICMA 3ZT2A 3C2KA 4K4HA 1QHTA 1S6QA 4C8LA 4KFBA 2FPMA 2G8VA 3O3HA 3OYHA 3AO2A 2D0AA 2ZE2A 3U3GA 1W0HA 2UVUA 3K5OA 3OHAA 4ELVA 2X6SA 4CF8A 3VA0A 4M9GA 4PH5A 3ZDBA 3AA2A 3EPIA 2LYHA 5JS2A 4YXJA 3ISDA 3K2PA 1RILA 4I9LA 3OVNA 3ISCA 2BGWA 1XI1A 4Z6CA 2ALZA 1HUZA 7ICQA 2PYJA 4QWBA 3M8RA 3HPOA 4IFVA 4RW9A 5CZ1A 4CHNA 4EEYA 4CHPA 3WNFA 4E1NA 3JYTA 3QIOA 4CJTA 2FLPA 5HMLA 4H8KA 4NCGA 2MUTB 1CUKA 5EOZA 4BXOA 3DRSA 4DOAA 3LAMA 2FPKA 2MAXA 3ISBA 5J2HA 2HNZA 2BR0A 3LANA 2NRZA 1T7PA 4KHYA 2D5RA 3TFSA 1ZQPA 2VA8A 4BDPA 5EWGA 2WONA 1ZBHA 4Q0BA 2HNYA 3UPQA 4Q8FA 1ZQDA 2KZZA 4DTUA 3ULDA 3LP0A 1YTAA 4CJFA 4AHVA 1K1SA 5EWFA 4N41A 4E1MA 2Q3SA 3EPGA 4J9RA 7ICHA 4DSFA 1CEZA 4NLNA 3HXMA 2C22A 4KHNA 2OA8A 1WCNA 3UIQA 1KFSA 3JPNA 3S3OA 3L2UA 3VQ6A 3ZT1A 3K5LA 1S1XA 4BDZA 4FXDA 5J2JA 3OS1A 2XCAA 3JPSA 3V9SA 4AHTA 3JPRA 3V1QA 4JWMA 3E2EA 2G8IA 4I2AA 3Q8PB 8ICQA 3TAFA 4FS1A 4MFFA 4CE9A 5E41A 3HPGA 4DSLA 4RU9A 4KLMA 3ZSOA 2P6UA 1JLCA 8ICTA 1TAUA 1RT6A 4O5EA 4IFYA 4GLXA 4X5VA 5J2DA 2IHMA 4BWMA 1S0OA 4PGQA 5KFGA 4KTZA 8ICZA 3V9XA 3U6FA 4BE1A 1X9SA 2BDPA 3RH5A 4DMNA 1NOMA 1J54A 4OJRA 3MR2A 3V4IA 1TL3A 3MFHA 1ZBUA 3VQAA 4ED2A 4MFCA 3V6KA 3VQQA 3EWAA 3AV9A 5D46A 3PW5A 4LVSA 1MC8A 3NF7A 1TV9A 1D9DA 4CJWA 4QZFA 1WSFA 2HB5A 2YHAA 5J2NA 3PUFA 4FO6A 1HNVA 3OYLA 1A5WA 5L9XA 7ICSA 1NOZA 1SZPA 2FLLA 3O3GA 4UQGA 1IKYA 4RQ3A 1PZNA 4EBEA 4IDKA 4C8OA 4AHCA 2IAJA 4W5QA 2FBVA 4KLIA 1ZQBA 1IKXA 7ICNA 3LALA 3L2QA 1S97A 4R64A 1SL0A 3NGIA 4FJGA 4BE2A 2BCUA 4PY5A 4CEOA 1S0VA 4J9OA 3AVFA 4FLXA 5CHGA 3NE6A 4KKOA 4TURA 4DU4A 1ZQLA 3DLRA 4BE0A 4O4GA 4F2SA 7ICIA 4O44A 1J5OA 3MEGA 3ZD8A 4HUFA 4ID1A 3SPYA 4DTJA 4O5KA 3F73A 4FBUA 4RQ4A 1UAXA 3D45A 3L3VA 1S1WA 2P66A 4KLFA 1NKCA 4RUCA 4BXOB 1XS9D 3QEWA 2BCSA 3MECA 4P4OA 1X2IA 2O4GA 4E89A 4KLHA 1YTUA 4CESA 4DOBA 1NKBA 8ICLA 4PHDA 4KV8A 3VQ4A 5KFBA 5EWEA 2JZBA 4O3OA 5TZVA 1ZQHA 5C24A 4FK2A 4NCAA 1JL2A 5CY4A 3AO3A 5HMMA 1HRHA 1S0NA 5KGWA 3ZSWA 4ZTJA 2F1JA 7ICFA 4CFCA 3GQCA 4Z4IA 4OLAA 3VQEA 2JEJA 4I2BA 2Y1IA 3WNEA 2AU0A 4DL6A 1ZQCA 1WSEA 3K58A 3OYJA 1C7YA 1TKTA 3NBPA 3ASMA 3SNNA 4IQWA 3NAEA 4KHQA 3MBYA 3VQ5A 4ED1A 3RR8A 4HUGA 4FZYA 1HYZA 3SYZA 5KFRA 1JMSA 4NM2A 1IO2A 3KHLA 1BPEA 8ICPA 4XA5A 3PO5A 3KIOA 4Q8EA 4Z4HA 3PR5B 4J9SA 9ICJA 1EXNA 4HUEA 1UOCA 3SPZA 3HO1A 3TAPA 4F92B 3QZ8A 4M47A 4P2HA 3GIJA 4KTQA 4O5CA 1VSJA 5J2CA 1SL1A 4B9LA 2V9WA 3VN5A 4QW8A 1S76D 5DMRA 3AU2A 3RRGA 3PR4A 3OYBA 4UB3A 3Q8RB 5HHHA 3NFAA 3KLHA 5D4BA 5KT5A 4UBBA 4QWAA 4TUQA 4IG0A 4CJEA 1KLMA 1VSDA 4Z0UA 2XRIA 5KFUA 3ISNC 4YN4A 5CWRA 4CGIA 5T7BA 3DLHA 1VSEA 3TWHA 3RB0A 3H08A 3CM6A 3KLFA 8ICWA 4NCBA 1DGSA 1TK5A 1HNIA 1RNHA 5DB6A 5KFLA 4E7LA 4FJXA 5J0QA 3AVHA 1NK4A 4LSLA 3T19A 9ICSA 3E01A 8ICFA 1A77A 2VG5A 3CM5A 3NGDA 1LWCA 5J1EA 1B9FA 3KHHA 1SL2A 4CF1A 3G6VA 3LZJA 1VSKA 4O0JA 4DF4A 3I0RA 3NHGA 4JV0A 2E6LA 4CJ5A 3PW0A 3QEVA 3GIKA 1U49A 3VQPA 4O55A 8ICVA 1BCMA 4QZDA 4DQRA 2ZJ8A 5CP2A 5KG2A 2BPGA 4RUAA 4ELTA 5IIIA 1ZQGA 4I2JA 2OPSA 9ICOA 3JPPA 4CGFA 1S6PA 3V7JA 2KW4A 3DRPA 3JPTA 1ZQFA 2HHWA 1CZBA 4B8CA 4EZ9A 1L3TA 3DLGA 4PWDA 2NRXA 2B5JA 1N48A 4J9NA 4JUZA 5DKWA 4CK1A 4CF9A 4YFKA 2W42A 4ZHRA 4MEYA 4K4IA 5J2AA 4Z4EA 4LH5A 4QWDA 5CJ7A 4FW1A 1C1AA 4I2EA 3HJFA 3RBDA 3PO4A 3SCXA 4CHOA 5HNKA 1Y97A 4IR1A 4FLUA 1HJPA 2XY6A 1JXLA 3AVBA 2HHQA 2JZBB 3AO1A 1RT4A 3KHRA 4FLWA 2V4QA 3QNNA 3NTUA 4OKKA 3KJVA 1RBSA 2P6RA 4F3OA 1UA0A 4PHPA 4OGEA 3C6TA 5FRMA 3SJJA 1ZBFA 4YG2A 3CG7A 3KK2A 1C1CA 9ICVA 2YKNA 4MFBA 4DTRA 8ICAA 2IMWP 1I39A 4MF2A 3PY8A 1KLNA 3O4NA 1ASUA 2QKKA 3DLBA 3UQ0A 4AHRA 4J2DA 3EYZA 4DLEA 1S9GA 4KMUA 1NK6A 4OLBA 1TKZA 1NJZA 4J9KA 4CJPA 3VQDA 3PNCA 2G8UA 2FMPA 4FJHA 2I5JA 1D9FA 3VQ8A 1R0AA 3QO9A 4DQQA 1TL1A 3AVLA 2YNGA 3V7LA 4DLGA 4DWIA 2F96A 4E7JA 4Y1CA 4B9SA 4CF0A 4CJQA 4O3RA 1NK0A 4CJKA 1NJWA 5CB1A 3PMNA 3K57A 2A1SA 3ZT0A 1WCLA 3V72A 4YFUA 3L2WA 2OZMA 3NH2A 1BPDA 2IC3A 2W9MA 4EBCA 1AROP 1T8EA 3IHQB 2WTFA 3V7KA 4NLGA 2C2EA 3AVMA 4M3RA 4CJ3A 2ZTCA 3JPQA 4KLGA 4CJSA 5KT2A 1QSLA 2ETJA 3UXNA 2VWJA 4CEAA 4C8NA 2ATQA 3BGRA 3ITHA 4FJIA 1IG9A 3OYNA 3UQ2A 1WLJA 9ICPA 4F5PA 3RH6A 4M45A 4F8RA 1VRUA 3MDCA 1HPZA 4OPJA 4QZBA 2ASDA 1ZQIA 5J0OA 4RQ7A 2OPRA 2O4IA 4CJVA 4DOCA 2VA2A 5CZ2A 4AH9A 1B92A 2M9NA 2Q0ZX 4DSKA 4YMMA 9ICRA 2HW3A 5KGXA 4M0AA 5KT6A 4I2IA 2F1HA 3CFPA 1QSYA 1RYSA 2C28A 2VG6A 2OYQA 4O9MA 5DB9A 4EZ6A 1RZTA 2AQ4A 1DTQA 3Q8SB 2BCVA 3MXIA 3GV7B 5I3UA 4FJMA 3ZSXA 2W9BA 4M3WA 4N56A 1JX4A 3IM1A 4W5OA 4R5PA 4FK0A 4UB2A 4CFDA 1KVBA 4KLTA 4RT2A 4B9VA 4DFKA 5KT3A 1LAWA 3AVNA 1U4BA 3OYMA 5J2KA 2KZ3A 9ICLA 4CFAA 5KFHA 5IIOA 4ED3A 4YMNA 5DDMA 2P5GA 4MF8A 4DL3A 1NKEA 1D5AA 4DSIA 3K59A 3FFIA 4GXJA 1RT2A 1Z25A 8ICRA 4DL5A 4ED7A 4QZIA 4OKEA 1TFRA 5KFTA 4TUSA 1ZYQA 4KLEA 3C1ZA 1Z3EB 4UAWA 2R8GA 5KRSA 2HVIA 2F8SA 3MDAA 4UBCA 1COOA 3OS2A 3OYIA 3ZSVA 4I2GA 4FJJA 5DB8A 2JEGA 4O3QA 1RTIA 7ICMA 4FW2A 5DG8A 3PX4A 4R65A 2HHVA 4XUSA 4KLUA 3LAKA 1ZJMA 3LWMA 4K4GA 1N5YA 2C2DA 2XHBA 4DL4A 5KG1A 4KLSA 2W9AA 5J0WA 4ECTA 4CFBA 3ZDDA 3LP1A 3M8QA 4I9QA 4E19A 1G15A 4GC7A 4DS5A 3HVTA 5J0UA 1BIUA 3ETLA 4YD1A 1EP4A 9ICAA 3G6XA 2J6UA 1IXRA 4GXKA 3HWTA 3H8WA 4KITB 2VA3A 2J6TA 3ZDEA 3OYFA 4PGYA 2UVVA 4LD0A 4R66A 4FBTA 5J0XA 4JK1A 2ATLA 4DTXA 4PUOA 2FLNA 2FPLA 3GV5B 4F5QA 5J0PA 4UAZA 3GIMA 1GOAA 4I27A 4EYHB 1C0UA 2X6NA 1SKSA 9ICTA 4B08A 3OYEA 3PX0A 1NK8A 4M6WA 4MFAA 4FM0A 1Q9XA 2UVWA 4I2HA 2PFOA 5BOLA 3N97B 1S9FA 3RMAA 4MEXA 1RXVA 1A5VA 2RPIA 1S1VA 2PFNA 4R8UB 4QCLA 4KLDA 3ORYA 5F9LA 3OYCA 4TSXA 3PVXA 4HHTA 5IIMA 1TKDA 5DK5A 1WNSA 4BACA 1LW2A 4KB1A 1ASVA 5DQGA 3HW8A 1ZBLA 3NF9A 4RPXA 1BPXA 1C1BA 4KHSA 2HNDA 3QIPA 3L8BA 2BGGA 3C6UA 4M3XA 2XGQA 3HL8A 1ZQUA 4ED6A 4I2CA 3QEXA 4B3OA 3S3NA 1TK8A 1QQCA 5KFFA 3SUQA 4FK4A 1FXXA 1S77D 3Q8MA 8ICNA 3H40A 3HVRA 4KN4A 1L3UA 5KG6A 3HX0A 1CZ9A 4NLKA 4FJKA 3BQ0A 3QNOA 5J2IA 1BQMA 1U45A 4K8ZA 3C2MA 4YQWA 1JLEA 1XSPA 1KVCA 2V4RA 2R8JA 5KRTA 8ICKA 2Y1JA 1U47A 4KLJA 4O5BA 2W9BB 4F5OA 4QWEA 4DL2A 4XQ8A 4I2DA 1RDDA 1D8YA 2OWOA 2JGUA 2QKBA 2GV9A 3TAMA 2IOCA 4Z4GA 4FJ7A 2G8FA 2DFLA 4YNQA 3RB4A 1RTDA 3DOLA 4UB1A 4M41A 3DMJA 4F91B 2DPJA 4HCBA 4O3SA 2UVRA 3T3FA 1BGXT 1HJRA 4CF2A 5L1LA 3QETA 1NK9A 1EXQA 3RJGA 5HRPA 4DS4A 3AA5X 4JS4A 2AGOA 1N56A 4KLQA 2FBYA 1S0MA 2IGIA 4UAYA 9ICNA 5KFXA 2YKMA 5DB7A 1L5UA 5HLFA 3HP6A 3OJSA 9ICIA 3TABA 3RJJA 2ZUDA 3HPHA 2HVHA 1XWLA 4PQUA 1XU4A 4CGDA 3V9WA 2A1RA 1NK5A 4YP3A 4M04A 2YNHA 7ICUA 4YMOA 3P5JA 3KKSA 4BGDA 3FYHA 4JS5A 1Y88A 3KLEA 4QW9A 2AJQA 4FJ9A 2QXFA 7ICKA 3ZT4A 4YR2A 5KFJA 1VSHA 2YNFA 1EETA 2I1QA 2DPIA 4UB4A 1XC9A 2ZQBA 5DGAA 4CCHA 5JS1A 4QZHA 1ZQNA 3RJIA 5J0SA 1ZQTA 4IQTA 1A76A 4CEQA 2YV0X 5DGBA 4M6WB 3K5MA 3QEIA 1RTJA 2XGPA 3RR7A 4LZGA 2W9CA 2AGQA 5KI6A 2HHTA 3GILA 2BQ3A 2GUIA 4WE1A 4CGGA 4M2YA 4DTSA 1LWEA 5KG5A 2OPQA 4F93B 4Z4CA 3LPUA 3QE9Y 1CXUA 1RPLA 4W5NA 1B43A 4KHWA 1ZQZA 2XCPA 1REVA 5L1IA 3BQTA 3AVJA 4Z6EA 3VQBA 3PW7A 5DQIA 1VSLA 4Z6DA 5DBCA 3RB3A 3RMDA 4CEBA 5KT4A 3PW4A 5J29A 2W8LA 3QLHA 4JWNA 5KFQA 1L3SA 1JN3A 2RN2A 1ZJNA 3V6DA 1NK7A 2XY7A 4ICLA 4TQRA 4J9MA 5DLFA 3NGYA 3SV3A 4KLLA 3LPTA 3D0PA 3HT3A 5J2FA 4O0IA 3OSPA 3OGUA 2J6SA 4CIFA 2FC0A 3TQ1A 1L3VA 5HBMA 1JLQA 4GMJB 3AU6A 4DO9A 2E6MA 1BPBA 4DSJA 4ECRA 3KHGA 4DFJA 4ZTFA 7ICLA 4Q45A 4IKFA 4XRHA 3S9HA 2GWSA 1RDAA 3SV4A 3K75D 1HYVA 2KQ2A 4ECWA 5CR0A 5HRRA 3KK1A 5HHIA 3RJFA 4CGJA 7ICPA 3AVIA 3LZIA 4B9MA 4IR9A 4CJRA 7ICVA 3AO4A 4TUPA 3C1YA 2PZSA 4DF8A 3A2FA 4CHZA 2BE2A 4N76A 4K8XA 1WSIA 3P83D 1ZQMA 9ICCA 1H38A 5J2BA 4YR3A 1RCHA 2KFZA 4P4MA 1ZQKA 2F8TA 3WNGA 4LY7A 1IH7A 1JKHA 4YD2A 4RW8A 1Z00A 5F9NA 3MGIA 3RB6A 8ICJA 1RBTA 5FDLA 3RMCA 1Z26A 1ZQQA 4RW7A 4FVMA 3GIIA 1ZETA 4JV1A 3AA4A 5KG4A 5KFEA 3C23A 2ZJAA 4M9NA 2DFHA 3C5GA 1U04A 4R63A 3MFIA 2R8IA 2ISOA 4KB0A 1UT5A 4M3TA 3TARA 5IIJA 2XC9A 2KTQA 2BQUA 1SUQA 3IG1A 3OYDA 5J2EA 1Q8IA 2RKIA 4J2EA 4AHUA 1RT5A 3T1AA 4QZGA 4RT3A 4FLZA 2NUBA 5J0TA 4ED8A 1BI4A 4CJ4A 3L2VA 3AVKA 4KREA 2HHXA 2ZUBA 5KFVA 1RDBA 4F4WA 3QZ7A 3OYGA 5DQHA 1TKXA 1X1PA 2Z1HA 3G6YA 3EW9A 3CFRA 2PFPA 3BQ1A 4QAGA 3Q8KA 1YVUA 3FDSA 3NF8A 1KCFA 5J0RA 1IKWA 3KD5E 4QZEA 4ECYA 4R8UA 4OKJA 4F5NA 3G10A 3C2LA 1KFTA 1ASWA 4ID5A
chains in the Genus database with same CATH superfamily
2W9CB 2HWIA 2OJ3A 1LWEB 3N4MB 4DUZF 5B0DA 1U6ZA 4J9PA 2M8HA 4DV1J 4K5SA 2ZJ5A 1WAFA 2BH1A 2OPQB 3PM9A 3DGPB 3EKUA 5AXLA 4NY8A 2BCQA 4JI0J 2JH3A 3OL9A 4OJPA 3HCXA 1UPPA 3W5XA 1F5SA 3WK5A 1S57A 2DHXA 4X64J 3NCRA 2DNLA 3IRXA 2P51A 5CCMA 2DGSA 3LA0A 2QA2A 2YKOA 2KFNA 1BQNA 2B9EA 2VKZG 3VTHA 2ZEJA 3M8SA 4M9JA 3CT9A 3NF6A 1VQLS 3V6DB 2EX3A 5K9FA 4G6VB 3J7ZT 1NHUA 1HA1A 2V34A 4A47A 4TU8A 5DDOC 3OR1B 2BHNA 3ZFVA 3ZTOA 1R3NA 1VQNS 2A18A 2WF8A 5AI5A 1JLGA 5ALTA 1OQ6A 2DY4A 1YJUA 9ICKA 2LSNA 2ZVSA 1VQ6N 1WOOA 4RQ0A 3BS5B 1HBMA 1CC8A 1SS6A 4Z94A 3MGHA 3M9OB 4ZOSA 2I2YA 4BRPA 4CHYA 4U7BA 4FM1A 3T5JA 4ECUA 4BR4A 3G82A 2MSTA 2HMPA 1BVSA 8ICEA 4OHVA 2E8OA 2IOHA 3EZ5A 2PXIA 6FD1A 3OUYA 5CYJA 2N82B 1VBKA 5J2MA 4CEZA 3AO5A 4RBUA 3PEJA 2K3KA 4RUBA 3CF5L 3QGHA 4NYNA 2W8KA 1YXQA 4XH5A 4B1UB 1R27B 1PILA 2BE2B 3ISND 1YJNS 4Q5VA 3QATA 4EAHD 5J0YA 4NL5A 4O23A 2NPFA 2VQEK 3UPFA 2G2OA 3MR3A 2HQGA 2OTLS 3H8SA 2C2MB 4ELUA 5F3TA 2BJ7A 1W2IA 5J8YA 2E1YA 4FWLA 4NL9A 3ZX0A 4M5IA 4Y3CA 2ZBPA 1HLWA 2GWJA 4PGXA 1LW0A 2BCRA 3AGKA 1QVGM 4HCCA 3D2QA 3MM5A 3CCES 3TTFA 4C8KA 3NNHA 1N60A 3PYEA 5BYQA 1RBVA 1SV0A 4ISFA 4WFAL 2QWMA 2C3MA 2QARB 4QIVA 4DR1J 3IG1B 5KL8B 4W5RA 4PHAA 1SZ2A 2CJBA 1OVYA 2FUG9 1IR1A 3H2LA 2XMJA 3AN1A 3HHLA 3ILLA 2QSWA 4MKVA 2ZH8A 4AT1B 2EKNA 1VQYA 4JRQA 4CM0A 1RAIB 2KHOA 2VQFK 1TV6A 4JKCA 4DUTA 1SC6A 1KVAA 3VA3A 2P5OA 2YY3A 3P4UB 1UT8A 3GCXP 5KFYA 4C1NI 4ID5B 4DEZA 3T5KA 4ZCMA 3CJKA 1U1OA 1Q8BA 2J9DA 2EDUA 1S9EA 3C95A 2PFQA 1S49A 3DLJA 2QYCA 4CZIA 1TAQA 1R43A 5ADZA 4RNNA 2XO7A 5DM7Q 4NLOA 4RW4A 1OH7A 5AQLA 3IRXB 2E1FA 2K4IA 1JLBA 2BUNA 1R8AA 2ZH6A 4G1QA 4FCYA 3GMGA 4ZP8A 1X5OA 1BQNB 4OHWA 1SJ1A 2W7OA 3C15A 5GAEI 3TFRA 3I32A 2MLZA 4OLOA 2P9IA 3PHEA 4CI6A 4E3SA 3J7AP 4P2FA 1WSGA 3QFPA 4WFXA 4M9LA 7ICOA 1SQEA 3PG9A 4B3RK 4USIA 2W24A 3FM9A 1JLGB 4MJKA 1XERA 3CCMS 1LB2B 1XHXA 1IBLF 3OY9A 2VG7A 2JVRA 4QR2A 3VEXA 2F9JA 1HBMB 3HX9A 4FWRA 5DDPC 1FKOA 3VGSA 4LFCK 2KE7A 3DOKA 3NGZA 3G82B 3QINA 1GO3F 2BTFA 2CQGA 2KRBA 3OUYB 5HRSA 1ZQWA 2VBYA 1B3TA 5J2MB 4MK9A 2I9GA 3HFVA 4C0OC 5KFNA 4UY8O 4BRGA 3J7AN 5D4LA 3FC4A 2W03A 2G8WA 4DJBA 3A5MC 5M1NA 4GW6A 2V67A 2RHFA 4DU3A 5CYMA 4I29A 1B22A 3QT6A 3HD1A 2Z4PA 4CBUA 3MC1A 1NSKL 2V69A 2V7ZA 3ZZYA 1J27A 3NGKA 1GLFO 1H72C 3CC7S 3PZPA 3MEDA 1UVLA 2J8AA 2R2UA 2HVEA 4NLTA 3H4BA 5BOMA 1O5JA 2FC8A 4GFJA 3R3LA 4JI4F 1SV5A 1Z05A 3AB4B 5HJXA 4NXMJ 4FL9A 3KK3A 1TYQA 1G4CA 3CCTA 1BPYA 2OELA 1LW0B 1RADB 3OJUA 3MM5B 2E7WA 2BANA 2B7CB 2KP7A 1H6KX 5IT9Y 5K14A 1W9HA 4JKEA 4RU2A 2F40A 4RTFD 3ZSYA 4BROA 4I4BA 1VJ5A 4ZCKA 9ICGA 1LVHA 5LY3A 3DJCA 2FSJA 1Z2ZA 3ED5A 4F0MA 2Q97A 2RRBA 3DWLA 3OS0A 1TV6B 1I51B 3T1HK 1XNQJ 3BDPA 2NREA 2XZTB 3HOTA 4M63C 5L1KA 4F71A 1B0TA 1QTMA 5EDWA 2K4HA 2H1YA 3CDUA 2G8KA 1FA0A 3C94A 3DYAA 3M8PA 5D0EA 4JI8J 3HZ6A 4I2PA 5JICA 3CJKB 3TAGA 2AJ0A 3BKTA 4ZVFA 2ZJQQ 2IS3A 1UVMA 2NSCA 3C14A 1S9EB 4H5RA 1VHIA 1GXUA 2FMQA 4WZMA 2KT2A 3OW2M 2V4JA 3VQTA 4JI5F 4KH4A 4YY3F 4R79A 4RW4B 5KOWA 1JLBB 3RUBL 3AQEA 4USMA 4FSVA 4G1QB 4X4OA 1UFLA 1Q3UA 3TR5A 4CZGA 3SQ2A 2X51A 5KFKA 3C15B 1YT3A 2CPYA 1IBMK 3JPOA 2P9IB 3V1RA 4OYXA 5L38A 1MMDA 3UN3A 5CEHA 5CHCB 4UUXA 3CDEA 4OVLA 4HL9A 4IO9L 3GWCA 3EZUA 3OPKA 3OXGA 1CQNA 3HM8A 4CECA 2VG7B 3KG1A 4KHPK 3DRXA 2QG9B 4ZLNA 3ENOA 1N33K 4LF7F 2J0WA 1FKOB 2ZTDA 3DOKB 4NPOA 3KZBA 2CVIA 2ZD1A 2P6SA 2FVSA 1RZMA 3L4BC 2OLWA 2DNPA 2BJDA 3H2UB 1FRHA 1NH8A 1S10A 3H5UA 3HLUA 3W64A 2YWEA 3LOUA 3JAMU 2ZHAA 5C10A 5AM2A 1TQLA 2HLUA 5KFZA 5CYMB 4KX3A 5KPRA 2WCXA 4CZCA 4KBIA 4FLYA 2RU9A 2HOIA 5EOYA 3SMVA 1D8LA 4AL5A 2ACMA 2QI2A 2VWKA 2KVQE 3MEDB 2YHYA 1SXLA 1XBWA 1B9DA 3TUIC 1SV5B 3RAXA 2IA6A 1ZH5A 3V9ZA 4J8FA 4KPYA 3KK3B 4WQ4A 1TYQB 4DV0F 3BF4A 2K89A 4DV6K 4FJNA 1W25A 2GBZA 4LR8A 4O3MA 2CZ9A 2E5HA 4LFBF 2IBOA 2BANB 2CWKA 3ZSZA 4CRJA 4AYBF 1HI1A 1KOOA 3F2CA 5K14B 5ADXA 1CRXA 1N8RT 3U3YA 4X84A 2KYZA 2AGPA 3MN5A 4UOHA 3TW0A 3CI5A 5DLGA 3WT0A 2ZXIA 2HHUA 2ASMA 2WF7A 2YHBA 3R8EA 2W2OP 3P1GA 2NO5A 4USJC 4RQ6A 1QJHA 3LPYA 3LVWA 2P1JA 2KICA 3SQ1A 2OZSA 5D4OA 3HHDA 5AQOA 2ZZTA 2GOLA 5B8HA 2OIHA 2KJ8A 5T41A 2KT5A 2DH8A 4NASA 4CLTA 5E3PA 3P49B 4I2PB 2KKVA 5IC6B 1YAGA 3J80U 1JJCB 3C2KA 3C14B 3FCWA 4K4HA 2MSNA 3UMCA 3M30A 1ED1A 3EXCX 4FYXB 2V4JB 4KFBA 2IY5B 1KN6A 5K4LA 3OYHA 3C2PA 5LT5A 4B3SJ 3OXFA 1QVFR 4C7YA 2KL8A 4F3QA 3EPIA 2LYHA 2DD8S 1EARA 4P52A 4EUVA 1N4LA 3K2PA 1NU0A 2P9EA 4JB8B 5F8IA 5LJWA 4ENOA 5LMUJ 3ISCA 4MO4A 4ZP6A 4Z6CA 1I5OB 2ALZA 2YX7A 7ICQA 1S3XA 3S1TA 5CXTA 4DR2K 2DHSA 4UY85 3CJRA 4IFVA 4RW9A 1T94A 4FWQA 5CZ1A 1MNEA 5IT4A 4BRHA 2DK2A 3BSOA 3L7UA 1BWFO 3RBXA 4AUKA 1IWGA 1URNA 3IAS9 1R8PA 1B64A 1VLOA 4M8LA 4H8KA 4NCGA 4KSEB 2XVTA 4GNIA 5EOZA 3BGOP 4YOEA 3KJQB 2ZD1B 2FXUA 2NRZA 4K4XA 2E2QA 4DCHA 2EANA 1ZQPA 1FIQA 4WYLA 5EWGA 2WONA 4Q0BA 3HD2A 1RTZA 1VK8A 1ZQDA 2R7RA 3BS9A 1YTAA 2QJ3A 5FLXY 1K1SA 5EWFA 4N41A 3BGLA 3PCOB 3GIRA 5HATA 2UXBF 1CEZA 5AQXA 1Z19A 1P6TA 1KC8O 2FLOA 2M0GB 2DO0A 1RDRA 4ZPTR 2HS4A 1KFSA 5EE1A 3KUEA 3EDQB 1Z4UA 1HUXA 3PYGA 4H4KC 3VF4A 2ZITA 3A13A 3E51A 3K5LA 3NRWA 4GKKF 2I38A 1RLDA 1S1XA 2OTJS 3OS1A 2HQCA 3JPSA 3BPDA 4AHTA 4CQ1A 2Q6BA 2F4VJ 2DNOA 3JPRA 4B3TJ 2XMWA 3VAKA 3KWIA 4KJIA 5AKJA 2JLGA 2VFUA 4HTJA 2YKPA 4JI7J 3GR1A 1NMNA 2P6UA 4O5EA 4GV9A 3FEYB 2B56A 3BB5A 3MX2A 3FRZA 2IHMA 4BWMA 5HR6A 1S0OA 3VQSA 2YTCA 1BMQB 2MQMA 2OM6A 2FJDB 4NLYA 1J2MA 2BDPA 3IM8A 3CETA 4DMNA 2LQJA 5RUBA 2J4RA 3GBTA 4WF9L 1FX4A 1T9TA 1HIWA 3GE1A 1YRXA 3V6KA 1UAWA 4DR1F 2LDYA 4DX7A 2E2NA 4JI8K 3ID8A 3KHYA 3NF7A 3QSYB 2XYGB 1BUXA 2HB5A 4YB1P 5J2NA 1RKIA 2IVFB 3OYLA 2FE9A 2IFXA 5L9XA 1SQGA 1QH9A 7ICSA 3M30B 2UU9J 3UNGC 4F7VA 1SZPA 2FLLA 5GAEU 3O3GA 4KFBB 2NPIA 1IKYA 2Q2RA 2ZUGA 2W43A 4QNLA 1NGIA 5CH7B 3IMXA 1C2PA 4LF4J 2FBVA 4P71A 1ZQBA 3RGIA 3TUPA 2RH3A 5F0XA 1S4EA 3O1LA 4R64A 1Y7PA 1RAGB 4PY5A 2HEKA 4AL6A 2RD5C 2WHEA 4K4YA 3PXGa 3AVFA 1UPMB 1TFWA 4KKOA 1KKXA 4DU4A 2GJFA 4BE0A 4IFVB 4RW9B 7ICIA 3MEGA 1FD8A 3ZD8A 1VDHA 1RWUA 4ID1A 4FBUA 1FXDA 3J81U 3D2EA 2G4BA 1WHVA 4JBCA 4NCGB 3Q0AA 2FGCA 4E2FB 4FOEA 2BCSA 1Q3VA 2I9SA 4ICAA 3H0RB 4HWIA 3OFHA 1YTUA 4KV8A 4PHDA 3D0HE 1B99A 3EN9A 5KFBA 5EWEA 4OCZA 3R6MA 4AQYF 2WONB 4NYZA 4OYAA 2YJEA 2IIRA 4QS9A 4NCAA 1JL2A 1WF0A 1VGYA 1EHWA 4FWNA 1U24A 2JHEA 2XHWA 4NA1A 3ZSWA 3LGHA 5E79U 4CZLA 4Z4IA 5F3ZA 3AARA 5M1KA 2AU0A 4DL6A 1XJWB 1WSEA 1RUSA 3K58A 2CZVC 2MZRA 1DBDA 1YKWA 3VGTA 4CM2A 3RAMA 1HW9A 4FZYA 1S1XB 2FSNA 3G9CA 5IQQA 5C0YA 4DUZK 3F5TA 2AEJA 2M5YA 3POTA 1IO2A 4CDIA 8ICPA 3KIOA 4J9SA 1EXNA 2DNHA 3NOCA 4NV0A 2JGAA 4LF8J 2LCWA 1NAQA 4M47A 2LVWA 1VSJA 2BM0A 1SL1A 2EPIA 1X4EA 1GXLA 3Q8UA 1S76D 5DMRA 3AU2A 3PR4A 4TYBA 3IBFB 4CZHA 1WB9A 5HHHA 3MMCA 4F0HA 3KLHA 3W5YA 3H46O 2XLKA 2GO7A 1O8BA 4B17A 1HBOA 1T9XA 4LF6F 4IG0A 5EE9A 1IBCB 1B7FA 4FF4A 2FDRA 4AXIA 4AP9A 3W5ZA 3R5CA 4YN4A 5CWRA 3MCSA 5T7BA 3DLHA 1WSRA 2B6GA 2YB1A 4O4RA 2P2CB 1VSEA 2XS2A 3H08A 2I0XA 3KLFA 3CM6A 8ICWA 4WBFA 2W4PA 8ATCB 3L09A 2MY7A 3PRBA 5KFLA 4E7LA 2RHKA 3AVHA 3IR6B 3T19A 4OPAA 1Y10A 2UZAA 4NLQA 2VG5A 2QT7A 3G6ES 2Y3YA 3Q8YA 3F9MA 4K0KF 5H1SQ 2BKNA 2YWFA 3ZNUA 2LMRA 2H65B 1VQKS 2PA3A 1IKYB 4DF4A 3I0RA 4K43A 3FKBA 4DV7F 4P10A 2MKHA 5KAIU 4OL8A 1U49A 4QZVB 1BCMA 2ZJ8A 2BPGA 2K8BB 4ELTA 3M6KA 2OPSA 1UETA 4QU6A 2FZKB 3V7JA 2I8EA 2WHOA 4ZJOA 3H5XA 3DRPA 2VC1A 1SJQA 1OSDA 1CZBA 5ALPA 4KKOB 4ZVSB 1L3TA 2IHR1 3O9RA 2CVEA 1JALA 2RP5A 3A0HU 1V5IB 4BRQA 3CCJN 5CD4A 3CO9A 1D09B 1OYDA 3NAHA 1TUVA 3MEGB 4ZMMA 1V38A 3HBTA 3W7BA 4FXVA 1K73T 1VQ4S 4K25A 4CF9A 4YFKA 4M7XA 3D2EB 4K4IA 5J2AA 4H5VA 4Z4EA 2BJEA 4QWDA 4JI2J 5CJ7A 3ZEUA 4NYOA 3NLCA 1SJ4P 5BR8J 2U2FA 2XY6A 2PMZC 2Z8QA 4KV8B 3CC4N 4A57A 4GKJJ 2DVIA 2DPNA 5A8RA 2CPJA 2QWPA 1RT4A 1JMTA 4BRNA 3NTUA 4OKKA 2ZH4A 3EX7B 5FRMA 1ZBFA 1C1CA 1LEOA 2YKNA 4DTRA 4NOHA 4RLEA 1AT1B 2KG1A 2IDLA 1J6ZA 1FERA 1SZHA 1S9GA 2DNRA 1O08A 3D2NA 3OHRA 2VFVA 4OLBA 5AKEA 1NJZA 4CJPA 1OH5A 1FVSA 3POTB 4FJHA 1FFSB 2ZWHA 1RWXB 2I1RA 1P27B 2AX1A 2BA9A 3IAM9 1R0AA 3VQ8A 5D4NA 2O1PA 2XNQA 2AHOB 1KXPA 4O5FA 2EFGA 1Q81T 4Y1CA 4B9SA 5FP0A 2D69A 4CJKA 1NJWA 4KH0B 1K0VA 4BRMA 7AT1B 2A1SA 3ZT0A 4BRIA 2ESEA 1U8WA 4YFUA 3L2WA 3MAHA 3KLHB 2ZIUA 4DU7A 1T9UA 5IS2A 2W9MA 1HBOB 1AROP 2OKQA 3U1LA 1YSJA 2WTFA 1KQGB 4NLGA 1SV4A 1ZD2P 2HRTA 4PZVA 3JPQA 4MMOA 4JI1F 3GYXB 5KT2A 3FMWA 3NWRA 6AT1B 2CNOB 5BJRA 2ATQA 3KLFB 4JHDA 1LFWA 4OYZA 3ITHA 4QPTA 3OYNA 4DPUA 2EZXA 2DWQA 9ICPA 3RH6A 3HSDA 1FJCA 2VG5B 3MDCA 3O4WA 2DCUB 3MWPA 4TY9A 3OL8A 4QZBA 2ASDA 1FD2A 1ZQIA 5J0OA 2V8HA 3AAQA 2ZIVA 4KMOB 1QY7A 2OPRA 4C7QA 4DOCA 2VA2A 3MCOA 1FEEA 5KOXA 4OZ2A 2DGZA 3I0RB 9ICRA 3HFKA 1QAYA 3TSPA 2V2ZA 1QSYA 5BYRA 1RYSA 4LF4K 2C28A 4K4VA 3UE2A 2VG6A 2MHNA 2HK2A 1Q46A 2V94A 4EZ6A 1RZTA 2F8EX 3GV7B 3VGLA 3DRPB 4KGMA 2D7SA 2W6LA 4KPCA 1X4BA 2OFGX 4N56A 3KKAC 2QA4N 3VEOA 2E7VA 1S72S 3TA2A 4CFDA 4ISGA 4RT2A 1PVQA 3A8JA 2XMUA 1LAWA 3HJEA 3D6FB 2MHEA 3WDOA 2ZOFA 5J2KA 3UMGA 3OYMA 2RHQB 4CFAA 2M7SA 4JI4K 1BNPA 2P5GA 4CLWA 4MF8A 4PXDA 4P74A 2VPZB 2V52B 4JI3F 1LQ9A 1T95A 3ZEUB 5AQGA 4V19S 3OBYA 2MKKA 1Z3EB 2FVCA 1APSA 1HQ2A 2VHGA 5A8RB 1RT4B 3MDAA 1ZZNA 3OFGA 4DV2F 2PFFB 3ET6A 3OYIA 1UCVA 5DB8A 4P2XA 1HNZK 5DG8A 3M32A 4XUSA 2DHHA 1C1CB 2H5JB 2YKNB 3ZZRA 2M2BA 1MWYA 2P9NA 5H9EK 5KPTA 5J0WA 1QAIA 4CFBA 2RRDA 1UCNA 4I9QA 1UVJA 4KHMA 5E84A 1G15A 1OH8A 3HVTA 3CJ3A 5J0UA 1BIUA 1HWIA 4QBUA 4GXKA 1MWZA 4RUHA 4KITB 3CCVS 2VA3A 2DNGA 2VPYB 2UVVA 1R0AB 3C6HA 4FBTA 5J0XA 1HD1A 4DTXA 4A8KA 3BP8A 3O1BA 4YY3K 3FE1A 2DIVA 4FZMA 1GOAA 3A5LC 3IGNA 2X6NA 3LF0A 4X62F 1NK8A 1O03A 3ENQA 2ZIUB 3TVKA 4DX8H 1WTBA 3DN9A 4Y2JA 1WG4A 1RXVA 4B3TF 2PFNA 4PABA 2ZFHA 2R7WA 3ORYA 5F9LA 3SCLE 4DPTA 1DXSA 4JHDB 3I87A 4NLXA 3ITHB 4TXSA 1LW2A 1E3MA 1ASVA 1IR2A 4NLDA 2GCFA 4DUYF 3WQPA 3NF9A 1C1BA 2C3YA 2HNDA 4H54A 4BGBA 2BGGA 2W41A 2Y8YA 4M3XA 5FPNA 4XPEA 2ZIVB 4I2CA 2OPRB 1TK8A 3OTOJ 5KFFA 1UZHA 1FXXA 4R0EA 4OJ6A 4ER8A 1FJ7A 3HVRA 3WEEA 2NXNA 2HSZA 2EBEA 2F5GA 4DR7J 2XI9A 2VG6B 3CJAA 3GFZA 3WK4A 3D9BA 1U45A 3QJLA 1FDBA 3PFEA 1KVCA 2K3IA 3ZX3A 2Y1JA 3BO2A 1U47A 4O5BA 1PC5A 2ZBIA 1NDPA 4QWEA 2FJVA 2O8EA 2UU9F 1RDDA 3ELHA 2Y9HA 4FP9A 2GV9A 1W7WA 5ETQA 2XLIA 2E88A 1YQHA 2G8FA 2DFLA 1QTNB 4PZOA 1F1BB 3DOLA 3DMJA 4F91B 3IA0A 3MM7A 3N5BA 3MN9A 4HCBA 3CJ8A 2UVRA 3T3FA 2R7XA 2MLXA 4ZP7A 4CF2A 1HBUA 4F72A 3D7EO 3BM7A 1S22A 4LFBK 4QS8A 2F8MA 1Z2LA 4X4PA 3R1LA 2MEWA 4CLUA 2HHHJ 4KLQA 2JNJA 2QZ8A 1LK5A 3M32B 5KFXA 2YKMA 3IS9B 5DB7A 5HLFA 4P2SA 9ICIA 3TABA 3RJJA 4B9QA 2QL7B 3VPZA 3KUHA 4WIQA 5HJYA 3GFXA 2P9NB 2CQCA 2HOQA 1DJ0A 3V9WA 3TA0A 4JI6J 1LWXA 4M04A 2YNHA 7ICUA 5EN1A 3HVTB 5ETTA 3KKSA 3FYHA 2BZFA 1Y88A 2Q66A 3RBZA 1WWHA 2QXFA 4LF5F 7ICKA 2HKEA 4BR9A 3IM9A 3MMBA 1VSHA 1HQEB 1EETA 3G8QA 3U26A 1ROFA 3LUYA 4X4VA 3MM9A 1U09A 5DGAA 4DPYA 1TP7A 3AJ1A 3WZ0A 1ZQNA 3JQJA 3RJIA 1HNXJ 2EBGA 4OQJA 4BC7A 4IL6U 1UFWA 1YTYA 1HWUA 1DQ8A 3I1YA 3QEIA 3BZCA 3WK8A 3LDQA 3GSDA 3JS6A 3WXLA 2IJNA 3F2BA 3MCAB 3ICXA 2HHTA 4WE1A 4DTSA 4M2YA 5JVGQ 2C2NA 1S1UB 2HAIA 2XYHB 2ZIWA 5THWA 4Z4CA 1LW2B 1S12A 4C4RA 4TVAB 2CNNB 2KIVA 3DFEA 1REVA 1C1BB 4Z6EA 4A59A 2HNDB 1H73A 2DRDA 1VSLA 2DR6A 5A2QU 3RB3A 1ZQ1C 1RAJA 1I1GA 4CNZA 3QLHA 4MTPA 1C4AA 4PWUA 3VESA 2DL0A 1NK7A 3WEEB 4FF1A 3CPWM 3G71S 3NGYA 3K8VA 5AQTA 3SV3A 4KLLA 3FRYA 1HLUA 3C65A 2X3DA 4KH6A 1N2XA 1URJA 5J2FA 2BJ1A 2J6SA 2GNKA 2R7SA 1X9JA 1FNXH 4ETZA 4RNHA 2O8EB 4U9RA 3CCMN 2UUWA 4V1Ak 4D3HA 3AU6A 3A3NB 4G65A 2E6MA 1Q7YT 1GX6A 1VK3A 3KHGA 4RQMA 7ICLA 4GKKK 2BDUA 3SV4A 1HYVA 3DOLB 5ALYA 2HFNA 1LFPA 5HHIA 3DMJB 3MM7B 3I55S 4B9MA 2Z2ZA 3SK3A 3OD2A 2WTUA 1HBUB 2F9DA 2WBRA 1ZXIA 2D3OR 1F0MA 4CHZA 3FSYA 4I0WA 2I7NA 5J1PA 1GQEA 4Y2XA 1RCHA 2KFZA 4P4MA 3RFAA 3Q8VA 4J37A 3DLKB 3CCRS 1Z00A 5F9NA 1WTFA 2VF3A 8ICJA 1RBTA 4JYAK 2YKMB 3BUZB 4EIAA 1Z26A 3H7HB 4FVMA 3B8AX 5HLFB 1YUWA 3D1HA 3SSRA 3CC7N 2ZG6A 4JI2F 4ZPVR 3GIIA 1ZETA 4ZDNA 3ATUA 3SENA 2F8LA 1RQ0A 5EX0A 3J7YP 4R63A 3MFIA 2R8IA 1OQ3A 2YNHB 4KB0A 4C2MA 2CA9A 2Q31A 4GY2B 3EO3A 1I94F 1TUYA 2BQUA 4M5NA 3OYDA 5J2EA 3L0QA 3J7ZO 1Q8IA 3MMBB 5HQ8A 1S1TB 4J2EA 1EETB 3NMAA 2RNEA 4FLZA 2ZC3A 3HHLD 2W04A 1SH3A 3MM9B 4IOCL 3L2VA 4UW9A 5KFVA 3AH6A 4NMXA 4C0BA 1CPZA 1IKWA 3KD5E 3BSCA 1S8OA 3QRPA 3VAJA 3G10A 3C2LA 3BS7A 2FQQB 1ASWA 2A1AA 2MZJA 1TK0A 4Y0FA 8ICGA 5AKGA 4WFBQ 4BBYA 3L3UA 1K5OA 2PY5A 2ZIWB 1BC6A 3OVBA 1PVRA 5LOQA 4I6MA 4WIIA 4IBNA 2IDEA 2D0CA 3PV8A 4IZ9A 1TMJA 1REVB 4CHQA 2YTUA 3ULHA 3WKAA 3CIPA 4DTOA 5J2PA 4YCXA 1OS5A 2WB1C 4F4KA 3JAMY 3HM9A 1VMBA 2HBRB 4YR0A 1NRKA 3TVYA 1EQMA 3K1RB 2VFTA 4UASA 1NEEA 8ICSA 5AM3A 3MDQA 1L7MA 5HSPA 4AQYK 3W3DA 1U1QA 3SIPB 4DL0C 4C3LA 4JV2A 4DR7K 4H4KA 1FK9A 1WAJA 2DYAA 3GB0A 1C6VA 3N6MA 2J9CA 2W55A 3H4DA 2DEJA 2JSXA 1PG5B 3IR7B 3L7PA 1XNRJ 1NG9A 2ROPA 4QZ9A 4J9QA 3PSIA 2W3SA 5HMYA 3MD3A 4NB4A 5LJVA 4F50A 3N7RC 5AK6A 5B08A 1EB0A 4M94A 4B9NA 3MXHP 1NJXA 3QESA 2E2PA 1NGGA 2PI4A 1TR0A 2D0PA 1X60A 2B4JA 4A61A 4CIEA 1RM6C 3SJHA 3D6HB 4YXMA 3PX6A 3CD6S 3C21A 1K1QA 1D1UA 4PYAA 2JX2A 1HMVA 4MKYA 4C7ZA 1RE1B 3GFYA 5HP1A 4DV3F 1A7GE 2HHHK 1JXVA 1VQMS 2VKQA 4U6PA 1H1VA 4A8WA 2CNKB 2DFFA 1BQXA 1BA1A 4J9LA 1ZQOA 4WP8A 1Z00B 4M5HA 2QWQA 2CIMA 2MQNA 4Q44A 1VISA 5DM6L 2LFVA 2OAUA 4R0JA 5AQMA 3RTVA 3I0SA 3CJ2A 1M5KC 4KTWA 1DOQA 1ZA1B 2A42A 1ZD3A 3RBEA 2JWNA 4QZ8A 4LZDA 2GGPA 3H20A 1Q79A 3K0JA 1LCUA 3L9ZA 1UA1A 4N8OA 3ZD9A 5LXRA 2D0BA 3D2WA 1SC3B 3PSPA 4HACA 2BVZA 4DTPA 1WG5A 3SLCA 4M1KA 2XTJP 1QS4A 4OI0A 2F3NA 5GAHI 3DHXA 4JNEA 4DV7K 4FZLA 3U9ZA 3KBBA 1WSJA 2GIFA 2JLEA 1XHZA 2FF6A 1IIPA 3J80O 3R5JB 1UWAA 1IKWB 4NLBA 2V7YA 4M42A 3VQ9A 2KYXA 1EX4A 1F2GA 4J2AA 2E5GA 2KXFA 1TGOA 4LR7A 3X1LB 3BPSP 9ICXA 1HUOA 5AFUA 3OL7A 1WELA 2QB1A 1T0TV 2KXHA 4GO5X 5HROA 3R2DJ 2N1RA 2BBEA 2R7QA 3U27A 4USKA 4I6MB 3TAQA 5HP4A 2FD2A 4OX9F 1CJKA 3K9JA 9ICQA 2UXCJ 1JXEA 3I5CA 1HPMA 5CR4A 2Y9TA 4LRFA 4WTOB 1KD1T 5J2PB 4DR3J 1S6QB 3GOIA 5IT9U 4IQUA 2H3VA 5KL1B 1KVJA 1KBRA 2JEIA 2JC1A 2OHDA 2PO4A 3M1VA 4IG3A 3CF5Q 1O1WA 2QM1A 4YDXA 2CH5A 3QB0A 2DKOB 1YIJS 2R8HA 3HSCA 4F4XA 3EICA 2NUHA 8ICUA 1MN9A 2DFEA 1NJYA 1FK9B 5AJ3F 1ZBTA 2DITA 3V6JA 1RAHB 1L6NA 2DH9A 4WKYA 3PMLA 4RBTA 4ZVEA 1FEZA 1KAZA 5B0AA 2E5LF 1KQSR 2LHTA 2ZJPL 4OJ5A 4P72A 4WTYA 1P8GA 2WF5A 4I6WA 2XM3A 1HR0F 4CZFA 3Q24A 1U02A 3BQ7A 1RTHA 2DO4A 4NXNJ 4OHXA 1S7HA 1ELOA 4OZ5A 7ICRA 3CFOA 4QZCA 2G0CA 1YF5L 3R2CJ 3ILJA 2F7VA 4C8MA 1ITPA 2NUUG 2PEHA 1RYRA 4XEIA 3NL0A 2ZH2A 4WFAQ 3FQKA 1R8BA 5KFPA 4B8AB 3BO4A 1VQ8S 1HMVB 5CZVA 4OYBA 2UUTA 1WSHA 2P9KA 4F26A 4L3QA 3KKRA 1WUUA 4K4SA 4A8XA 2MZTA 1JUDA 5HMWA 5HP1B 5F8GA 4DR6F 1RQNA 4USAA 4GC6A 1U26A 4UB5A 4CT8A 3VQCA 3NKYA 4IO8A 3B54A 5AQHA 2H3FA 4URGA 2ZTEA 3RRHA 3MR6A 1X4DA 4UARA 5KFCA 5M2RA 5K8NA 3J7Z5 3LK9A 3UW1A 4HTIA 1RT7A 1FHTA 2H3GX 4YHHF 1N5SA 4J2BA 4JI1K 2B8QA 2RQCA 3C0BA 2AEMA 3I0SB 4UB8U 4HVJA 3V9UA 4Y2UA 2XBPA 1M90O 3OHBA 4FZXC 1KRPA 1NNLA 3ICLA 2RQ4A 2GGPB 3CYMA 2LYAA 4WQ5C 5CAAA 1Y4ZB 3E9PA 2JWLA 2HQ3A 2DY9A 3WIUA 4CW7B 3LDAA 5KTQA 4ZIVA 4IEEA 2H9ZA 4HACB 2LM1A 2CYYA 2JRZA 4RQ2A 4MKBA 1ZQEA 2KG0A 3F9KA 2AXTU 4DU8A 8ICYA 4DQPA 4CK3A 2H3ZA 2K1RA 4FYDA 1X9MA 1VBXA 4BWJA 2RDIA 4K4TA 2RF2A 4KI4A 5AQZA 2ISPA 3PKMA 5BPCA 4NA3A 3R7SB 4RPZA 2FJ6A 7ICGA 3QYPA 1Y3JA 4AHSA 5K8MA 4B1XB 3KFWX 1RWVB 3BQ2A 2CQIA 3ZXWA 1KW4A 5IILA 3HHKA 4YOXA 1XMQK 4KR0B 2HS3A 3WC2A 4JK8A 2QB0A 1CLQA 2HMIA 1HWJA 9ICFA 1MMNA 4LFAJ 3ZCMA 4ECZA 1F6TA 3O3FA 1KSPA 1CJKB 3DDNA 2HFSA 4EBDA 2EC2A 4HT5A 1NGCA 5KPZA 3UMBA 4JI3K 1J5EJ 3JQKA 3P96A 1IM4A 3H45C 1UPHA 1VR6A 1Q16B 2NO4A 4QIWD 4K4UA 2LLZA 4IG3B 1KKHA 4IDKB 1FXLA 4ECSA 2YVSA 1Q1KA 3HTVA 1ZQXA 3IRWP 3J81O 2J7KA 1VS3A 3RJHA 4DV2K 1VC5A 2YQ3A 4WU2A 2KN7A 4JLHA 4DR4J 3MI7X 5GAGP 3PRVA 1YJ7A 3D67A 3VEVA 1S99A 2DB1A 1N5VA 2A6MA 2YWHA 4M3ZA 4BG8A 1U2VA 1RHJB 2QWNA 3AQOA 3SSQA 3KLVA 2D74B 3PJWA 3N6NA 3UDLA 2MUTA 2IVOA 4Y1DA 1LOTB 2DISA 1RTHB 4ZLLA 1BE4A 4ZN1A 4CLYA 2X78A 4NZ6A 2BM1A 2L3MA 3GV8B 2YMLA 3OT9A 1GLBG 1RDCA 4M3YA 3IRUA 4OJLA 1NZBA 4CEEA 1NUEA 2KH9A 3L2RA 2AQ0A 3V81A 1TVRA 1XSNA 4DTNA 3DLEA 4FJ5A 5FROA 4IOBA 3O6WA 3MCMA 2RDJA 3RYLA 2P9KB 3CMAS 1ZRNA 4Y6IA 2ZBCA 2PC6A 3KDOA 2KSOA 4PA1A 1C0MA 4DHVA 8ICOA 2Z1IA 1J9AA 4ZN3A 1FKPA 4X62K 4PR6A 1IV8A 1PYTA 3UDEA 2ES6A 2E7XA 5DBAA 4C98A 3RAQA 4Y2CA 5GADI 4DTMA 3SAGA 1N34F 1RT7B 2HG4A 2G8HA 3EDRB 1HI0P 2WF9A 4PPXA 3CD7A 9ICHA 8ICBA 4J91A 4I1TA 5EVZA 3AVGA 3P39A 4XDDA 4U8VA 4L8RB 4QR1A 2V2VA 3IFEA 3QT7A 2M9KA 5C42A 4RWWA 3OTBA 4KAZA 1Z4NA 1F3FA 4DUYK 3QIDA 5ALDA 4IO1A 4BJQA 2BX6A 4DR5F 4E0DA 1LNQA 5BYSA 3VV2B 1WORA 3QT8A 1DZ5A 1KFDA 3ALYA 4CI0B 1BHLA 2XQCA 5KG7A 3IBPA 1BCOA 2MYFA 2K1RB 1FDDA 5J2QA 3B78A 4O3NA 1EIYB 3LL3A 2IJFA 4FKXA 5FLXU 2RF2B 4AE5A 1X7VA 1MN7A 5L1JA 4J90A 4HTUA 3G87A 5IT0A 3UVJA 1CSJA 1V6HA 4MO5A 2EG1A 3LP3A 4IO9Q 3RJEA 4F4YA 3KNGA 4P4PA 2RHSB 3V5RA 2K06A 2IBKA 4K41A 2VJ5A 3G2XA 4CDGA 1FKAF 3ZT2A 4DCJB 3QU7A 3VVTA 4ED4A 2QB0B 2HMIB 4XH4A 3H5SA 4JV5F 2GMHA 4LSLB 2GTDA 1WOSA 2HRUA 4NEYA 4Z37A 2FPMA 4OPHA 3TKAA 2GX8A 2XZDB 1NDCA 3H42A 3AO2A 4FYYB 3QGGA 2KM8C 2BOPA 5A0YA 2H5EA 4M9GA 2IM0A 2HLTA 1AYEA 4UT4A 3ZDBA 5HI7A 1H0HB 1IG6A 4USUA 3RW7A 5ETMA 1RGVA 3VGUA 1F5BA 1UMJA 2YKQA 2PYJA 4QWBA 2LEBA 3HPOA 1FT8A 5LMNJ 4EEYA 3M6UA 1MW7A 1BG3A 1NLKL 1VJQA 2IVPA 4C1NK 3QIOA 3C3LA 2PFUA 1U2VB 2FLPA 2KJ5A 2CPRA 5HMLA 2MUTB 3DAWA 4R25A 2EFQA 5I4MA 5F8MA 1CULA 4DOAA 3Q89A 3ISBA 2LYVA 3LANA 3P4IA 4JK9A 4CO4A 1OXJA 4BY9C 2D5RA 2W7AA 4BDPA 4JB3A 1ZBHA 1XNRF 3V81B 2ZH1A 1TVRB 3KNAA 3DLEB 3HKZF 3IO1A 4ILRA 2O66A 1OY6A 3MM6B 2DNQA 1K8AT 3ULDA 2YXLA 4HVZA 2E44A 4CJFA 3P3DA 2Q3SA 3EPGA 4YDUA 4J9RA 2BEFA 4DCPB 1YG0A 1OO0B 1JWWA 3AY9A 1AUDA 4CNQA 1FKPB 5B0BA 2KFYA 2UUBJ 1FX2A 2DT9A 1FVQA 3L2UA 2CPDA 3VQ6A 3ZT1A 2UXDF 4BDZA 4FXDA 2DR9A 5J2JA 1NGHA 4X4NA 3K9KA 4Q7AA 3KWGA 1S5ZA 5C42B 3ID6A 4JWMA 2FZGB 3E2EA 2G8IA 4I2AA 2R4FA 1PK1A 1VCTA 3TAFA 2QWOA 4CE9A 4RU9A 4USVA 1JLCA 2VV5A 2Z30B 1TAUA 1ESVA 2VKRA 3JXUA 4DV5J 4X5VA 1NO8A 3TJAA 1IBKF 3J7A1 3ZZTA 1XR5A 4PGQA 2MY8A 2Q36A 4KTZA 3U6FA 1P1TA 3AODA 1M1KT 3THPA 3G8TA 3RH5A 3K1ZA 2D3ZA 1J54A 1TL3A 3MFHA 2DRAA 1TL5A 1ZBUA 2YN4A 1U2RA 3UVJB 2IOFK 1IJJA 1NBWA 4MFCA 1FF2A 1PGZA 1YVNA 3AV9A 2IVMA 5D46A 3PW5A 4LVSA 2U1AA 1JNZB 4BC4A 3LM2A 5KQ8A 2D3O1 2ZOGA 3CERA 2QN6B 4QZFA 1WSFA 2YHAA 3PUFA 4N77A 4UW2A 3N6LA 3DU5A 1L3KA 3SD7A 7FD1A 3O8WA 3R5GA 3C6AA 5BRFA 1NPPA 1PZNA 1WC0A 3PEHA 3R8YA 5A0YB 2P9CA 1WD6A 2H51B 1IKXA 3VGKA 3G4SN 2OGUA 3VEZA 5FJ4A 1KBUA 2HF4A 4Y28C 2BCUA 1L7NA 3NE6A 4CYUA 4NJ8A 3MWBA 4M5LA 5ALGA 1ZQLA 2AX0A 1TL7B 1XTZA 1T6DA 4F2SA 2LQ9A 3KDNA 1J5OA 1YRUA 4QIEA 4WJ3B 2FPHX 2C42A 4DTJA 4O5KA 2D1CA 4RQ4A 3MWTA 2O8CB 1ZAWA 3D45A 4MHVA 1S1WA 4U96A 4HEA9 2P66A 2VIHA 3N79A 3T1YF 4Y2TA 1NKCA 1D3WA 3QEWA 1XS9D 1CULB 2Q1LA 4P4OA 1X2IA 4WFYA 3O9QA 4CTAA 3AGRA 3MM8A 4DOBA 1NKBA 3T69A 4B3MF 1WC3A 3VQ4A 1I6JA 4LR9A 1I94K 2ZNZA 3WX4A 2HAFA 4CF5A 4FK2A 2G0JA 4WXWA 5ETNA 5CY4A 3ZZOA 5HMMA 2MPUA 2NCKL 1HRHA 3N9UC 1KAYA 3IMQJ 1NH7A 2F1JA 7ICFA 3R9LA 1VQOS 3GQCA 2VQEJ 4QR0A 4OLAA 1RHKB 2Y1IA 2LMIA 1ZQCA 4NXNF 3TYTA 1M5PC 2MQPA 5AI9A 3NBPA 3MGJA 3US5A 4FWKA 1FE0A 5LSOA 4I69A 4WF9Q 2MU2A 1VC6A 2XB2D 3ZC4A 4K5RA 4FO0A 2DHAA 1V97A 4RCHA 1JMSA 1YITS 1VOMA 3KHLA 2AJ2A 4LBPA 1BOTO 3PO5A 1EKRA 3EGWB 1Q53A 3MN7A 4K7QA 4IEIA 3MMJA 3TAPA 3AXKA 1PK1B 2B0GA 1VI7A 4P2HA 4KTQA 4QOTA 4XO0A 2WBMA 3CCVN 4B9LA 2V9WA 4IH5A 1JLCB 1QCKA 1WJ9A 3GFHA 1Q5YA 2RUGA 4CH0S 3FBBA 1JCFA 4I56A 2PMWA 4UBBA 2VQFJ 1RABB 4TUQA 4CJEA 3H8MA 2AYEA 4Z0UA 5KFUA 3A0IX 4HH0A 1K73O 4DX5A 2VODA 4PPZA 3RB0A 4OI3A 4Y2AA 2QL9B 1TL3B 2AZ1A 2ZUAA 4HLBA 1DGSA 1EWQA 1RNHA 4PXEA 2VOOA 4F02A 3UKUA 1H74A 1SJ3P 4ZP9A 2GAGC 8ICFA 5J1EA 3CM5A 5AQQA 3NGDA 3W0LA 1M6YA 3QAEA 4U7UD 4OX8A 1A0OB 3FCHA 1QAJA 1URRA 3BV8A 1B4FA 3LZJA 1VSKA 5ALQA 3VF6A 3NHGA 2MQOA 3PSFA 4M5MA 4CJ5A 5MAOA 3BZKA 3QEVA 5U47A 1ZTTA 3VQPA 4OJGA 8ICVA 4DQRA 2PEBA 5KG2A 4RUAA 5IIIA 1ZQGA 3LM9A 3IWXA 2XMKA 1VQ6S 2JFKA 4PG6A 3JPTA 2GIQA 4X4QA 4A46A 2LXFA 1ZQFA 3TUJC 4DV3K 4B8CA 4CYUB 4B3RJ 3DHWC 1WDDA 3B4DA 4LFAF 4J9NA 1J5OB 5MLCV 3CVKA 2KG5A 1UZDA 2LU1A 3UM9A 1TE2A 1UW4A 4IJAA 4CK1A 1S1WB 4LFCJ 1N62A 1Q81O 4PXBA 3I4PA 1C1AA 3A3OB 3HJFA 4NLCA 2JDJA 2E8NA 3RBDA 2DNYA 4ZPCA 5HNKA 2Z7JA 2YQ1A 4CTAB 1Y97A 3MM8B 4FLUA 3D2SA 2J8SA 1JXLA 3WKCA 5AXNA 3BF3A 2L48A 2ROEA 2VPXB 3AVBA 2VOPA 3AO1A 1CC7A 3QU4A 3KHRA 1H7XA 4QIWF 3QNNA 2R42A 5AI4A 2PN6A 2YCHA 1UA0A 4OGEA 4LQ3A 4Y0WA 2EEYA 3W2WA 3SJJA 4YG2A 3KK2A 3CG7A 4YOVA 1YK9A 3DXMA 4GMKA 2VH7A 4ED5A 8ICAA 3ENAA 1I39A 3AOCA 2O8FB 3PY8A 3N0VA 2XMMA 3NBPB 3SMZA 3WQUA 1FRKA 3BEGB 3UQ0A 3ZNJ1 2AYGA 4AHRA 2WVCA 3EYZA 3QU9A 1FFWB 4B1YB 1KHVA 1SIZA 2EWHA 2A19A 2FB0A 2HURA 5HAOA 2FMPA 2AT1B 1Z4OA 1FJGF 2E8PA 4O8KA 5M2UA 1TL1A 2IA0A 4WP9A 2YNGA 4OX9K 4BR5A 3THXB 1V4TA 4O3RA 2DXEA 2VBZA 2P8IA 1WCLA 5ALKA 2CUYA 3W66A 2Y0SC 4K4WA 2NZTA 2B7BB 4TN2A 5AE2A 4F67A 4YEAA 4BQZA 4EBCA 1S6OA 5AKKA 2JMGA 2C2EA 5F0WA 3H0MB 1SXDA 4NYPA 3T1HJ 4CJ3A 1RYUA 2ZTCA 2GMJA 4KLGA 1N52B 3SFGA 5A2QO 1QSLA 5AJ3K 2ETJA 3P5BP 1JB0C 1M1HA 2VWJA 2J0XA 3ETMA 4DMZA 2XZWA 3WUHA 4FJIA 2DNZA 2YJFA 1Q86O 5ADXH 3AT1B 4KGZB 1N5TA 3AHPA 3I82A 1Q4RA 4F5PA 3K2YA 2EW9A 1QZ5A 3CJ4A 3CWJA 5J1EB 1HR0K 2P9LA 4BRFA 2ALYB 3ISZA 4JK7A 3THTA 5E7OB 3AD8C 3ZO7A 3KFUF 5CZ2A 1WBDA 1RAEB 4LF9F 3DXKA 1B92A 3BH7B 2Q0ZX 1WC6A 4V19X 4DSKA 4UZCA 3UR3C 4YMMA 5KAKA 3L95X 2DUYA 5KT6A 2F8HA 2BUPA 3S41A 1KQQA 4HHHA 4W92B 4OX7A 4IS7A 2E66A 1HW8A 3ZX2A 4O9MA 2O67A 5BR9A 1U6FA 1KONA 3H90A 5DB9A 1IBMJ 5M1QA 4BX9C 1DTQA 2IRXA 3QYYA 5I3UA 4ZOHC 4K59A 2AMCB 4A8FA 3KWMA 4DR6K 3SEIA 2BKOA 4DV4F 2QGFB 1KQKA 4UB2A 3LO3A 4KLTA 1RFQA 2CNLB 2ZZMA 4DFKA 4PYDA 4KHPJ 3MN6A 1U4BA 3FZBA 3O9UA 1C4CA 4IOXA 2E1PA 1N33J 4YHHK 1OPIA 4C6AA 1YGYA 3D1QA 2H54B 1D5AA 3W9HA 2LP4A 1X5PA 3L4IA 4X66F 2AP6A 3K59A 1U1KA 4GXJA 1FI4A 5IWAF 1PK3A 2ZDOA 8ICRA 3THWA 4CT9A 4QZIA 3IC1A 1HNWF 1UTAA 4HAIA 2B4VA 3OLBA 2RMLA 1Z1ZA 3I55N 2F8SA 1R8HA 4LF2A 5LMNF 2GWKA 1Z1VA 3QUBA 4EEKA 3OS2A 3ZSVA 2X7IA 1NB2A 2JEGA 4O3QA 5HMZA 1RK8A 1XMOF 7ICMA 1VIOA 4FW2A 3PX4A 3M2VA 2DCLA 3AM9A 2ZBQA 3W2WB 3LAKA 3KK2B 1JJ2M 3NOGA 4CLZA 1F0XA 1C0FA 2UUCF 1RA6A 5AICA 2R3VA 3LGMA 3CCRN 1S48A 3DXMB 5ETVA 1QM9A 2YX1A 1N88A 4ECTA 1KR4A 4LRBA 3WIVA 2XEXA 1FWKA 2EG2A 3M8QA 3UNYA 2WAQD 2VASA 4K2JA 4NO7A 3ETLA 1T44A 3QUTA 9ICAA 3G6XA 4DV6J 5AQKA 1XC3A 2VL1A 3B8HA 4WFZA 3NCQA 4LD0A 1TL1B 5B0CA 3RSEA 5AE1A 4MT1A 2YNGB 4RJVA 1XR6A 3GV5B 5GMEA 4I27A 3BGUA 2P9SB 1SKSA 9ICTA 1VQ7S 4BRLA 4LJXA 4B08A 3OYEA 4M6WA 2EFOA 4MK8A 1TL4A 2UVWA 3J8AA 2PFOA 4M7YA 2HFZA 2KRRA 1RQLA 1S9FA 2JHDA 2WF6A 3RMAA 3AA8A 4TLRA 3MF5A 3NS5A 4KT0C 4MEXA 1AXQA 1S1VA 4ES2A 5ELZA 4FFDA 3OYCA 2JZ5A 5AQFA 2B8PA 4MN4C 3HULA 5J8YC 1LOUA 4HHTA 1FRIA 1WNSA 5AQIA 3QU5A 3GR0A 2CXYA 2RJZA 4DDFA 2B9WA 4C80A 5ETOA 3HW8A 1L8OA 4RPXA 1BPXA 2OEMA 3N28A 3C6UA 2P9LB 3HL8A 1ZQUA 5G5HA 2CPHA 4MIAA 3W3SA 1B4SA 1SV0C 1X9XA 4CO3A 1QQCA 3DXKB 3FMBA 2CQ2A 1S77D 2H3IA 3Q8MA 4K8RA 8ICNA 3H40A 2CGKA 1L3UA 4FYVB 3D7SB 4ZCLA 1X4CA 4OFZA 3HX0A 2FDNA 3I76A 2WFAA 3BF1A 1BQMA 1BWEA 1DTQB 4BR0A 3C2MA 4D3GA 1XSPA 5I3UB 4X4SA 2V4RA 3ILIA 1QQ7A 8ICKA 2D3DA 2F4FA 4DR2J 4KLJA 5DO2A 4DL2A 3IBCB 1D8YA 3OPXA 2KT3A 3A8IA 2OWOA 2JGUA 2QKBA 1PBUA 1WBBA 4WQ5A 4Z4GA 1N34K 4FJ7A 3O2IA 2ZH7A 5ALXA 2ZM6J 4LC9B 2VU5A 5A8KA 3NGUA 4UB1A 4UAVA 3K89A 2YI1A 1VQ5S 2AZ3A 3GZFA 3DEEA 2J76E 2WBNA 3GTYX 5L1LA 1FCAA 4HH1A 1W26A 3CD6N 4KAIA 3CCZA 4JD2A 3RJGA 4C48A 1IG8A 1LXNA 5HRPA 4DS4A 3WXIA 5EE0A 3WXKA 4JS4A 2AGOA 1F60B 1VFJA 2HBLA 4QYZK 1MLAA 2KKHA 1WC5A 3M2VB 1U8SA 1TUGB 3I9V9 3FC9A 4EO8A 5AK3A 5FIIA 4WPAA 3HP6A 3OJSA 5DZ6A 5A6WA 4IOAL 3C16A 3HPHA 2HVHA 3WK7A 4CGDA 4YN3B 2A1RA 3U1MA 3BH6B 2DY1A 1NK5A 4TU9A 4LSZB 3UD3P 3BKFA 1FFVA 2L5YA 2ZNYA 4YMOA 4BGDA 4NE9C 5HQMA 4JS5A 1GNKA 4QW9A 1U1RA 2JH1A 2QEXN 4B1WB 3SAFA 4X65K 2HZVA 4JV5K 1A0PA 3DXSX 4F04B 2LPEA 2DPIA 2VPWB 2OMLA 1NHKL 3DGVA 3RSEB 2CQPA 1GLEG 2ZQBA 4ZKAA 5JS1A 4ZS6A 4QZHA 1KEKA 4LT6A 1D9AA 1ZQTA 4IQTA 3HHLB 3E3XA 1WF1A 2YV0X 4MDAA 5DGBA 4M6WB 3CJSA 3K5MA 5JXSA 2GV1A 3RJMB 4CE6A 1Q7YO 3KMQA 2AGQA 5KI6A 3GILA 2BQ3A 4EX6A 2A3JA 1S1VB 4CGGA 3BBFA 3QRRA 3BR9A 3M1YA 1RISA 5IT9O 1YBTA 5SUHA 3DU6A 3W2VA 4PRFA 3LPUA 3QE9Y 1B43A 3UCGA 1GMVA 3OL6A 1RU2A 1O6XA 5LXYA 3BQTA 1Q7LB 3PW7A 4MAKA 3C6UB 2WVEA 4Z6DA 3M2RA 3RMDA 1ZZFA 5KT4A 2MMYA 3PW4A 3W9JA 5J29A 3FZ2A 3B4MA 5KFQA 1L3SA 2RQKA 4NLRA 2RN2A 4XTTA 3AA9A 2AJFE 2FJWA 2E5IA 4ICLA 5G4DA 4J9MA 2L08A 3MCPA 3G8SA 5DLFA 4WJBA 2JFDA 3GONA 1RWMB 3LPTA 1F9FA 4O0IA 3OSPA 4OV1A 2VYPA 3MX5A 4DFDA 3H25A 1HIYA 4LVOP 2FC0A 3PIPL 3JB9k 4QJFB 1FW6A 1GAOA 1PJ7A 3DCAA 1L3VA 5F1XA 5C2CA 4GMJB 3QU2A 1QVGR 4DO9A 2JL9A 1V4SA 4IWVA 1WG8A 3IG8A 3MDFA 2F9WA 4ECRA 1T9VA 2CRLA 5K5MA 2UXDK 4XRHA 3R1HA 1V9OA 2CQ1A 2FJBB 5A8KB 1Y5IB 5ETSA 3KK1A 5HRRA 4OV6A 1WI8A 1YX2A 1L7OA 3AVIA 5E0OA 3AO4A 2K8GA 3C1YA 2MRLA 2PZSA 4DF8A 1S79A 2XULA 3WXMB 4A2AA 3T41A 4N76A 4K8XA 3HKWA 4JD2B 9ICCA 5CD4H 5ALJA 3WNGA 2X1GA 4G9ZA 4LY7A 2MKIA 5B0EA 3ZZPA 1T3OA 1SBRA 4RW8A 1IBKK 3RMCA 1WUAA 1ZQQA 4H0VB 5D0RA 2CADA 4RWTA 5ALUA 3C16B 4YOUA 3C23A 2E1EA 5H9FK 2A41A 2DFHA 3C5GA 1VHFA 4YB5A 4IC9A 3OA9A 2MKJA 1DHMA 3OV7A 3AB2B 3GYNA 4DUZJ 5BPLA 2N3LA 3AL0B 1N36F 1SUQA 5BPNA 1TMMA 3NNCA 3D6RA 5IV3A 3VCBA 2AIRB 4AHUA 1N32F 3T1AA 4QZGA 4RT3A 4CZKA 2NUBA 1BI4A 5HL7L 5E33A 3AVKA 4KREA 2ZUBA 3CCUN 1KOHA 1RDBA 3EZOA 3E9LA 4A5BA 5A8WA 3TZYA 2C3PA 2Z1HA 1UEKA 4IKAA 2GAHC 5I3QA 4R8UA 4EFAC 1NJIO 4NZ7A 2B9YA 5EGYA 2C2RA 3SUOA 3V6HA 3CCQS 3MAAA 2Z1GA 3FEXB 4HKQA 4LSNA 4BG9A 2AP1A 1JCEA 3ZLJA 3ZDCA 1D0EA 3TJ8A 4CD1A 3ENBA 3W2VB 1R0CB 3DYAB 2ASLA 3M8PB 7ICJA 1B70B 4K4ZA 1P90A 2Q79A 2M3DA 1T3NA 2GVZA 4E98A 1JLAA 3L4QA 4M3UA 5T7LA 1X0PA 2FJEB 1X6IA 3T1YK 3LDSA 3DKDA 4CK2A 4GXIA 4QYRA 3BBBA 1YLXA 1OJ4A 5D77A 3T1HF 2QFIA 2LDIA 9ICWA 4B3MK 2UUAF 4UQTA 1S5JA 8ICCA 1F9EB 4ICLB 1VHXA 5HRNA 1HYSA 2J0QD 1QUVA 2CJKA 2XI2A 2MGZA 4KGXB 4FZZA 1GLLO 4DV1F 1KHWA 2UYTA 4H03B 1X4FA 2CQ3A 1HBNA 1SIWB 1AA1B 2E3TA 3SI6A 3KD1E 4JI0F 1KDHA 1M5SA 4BRKA 4DB3A 5SWMA 1M5VC 3TANA 1F21A 5JUMA 3U1NA 1IJEB 4X64F 1RT1A 1NB7A 2PFDA 1KL9A 3A8YA 5C2FA 1RXWA 2ZXHA 1UW9A 4G1PA 2ADBA 4FJLA 1LK7A 2CGLA 1VSFA 2ZM6K 1E6VA 2VUGA 4TLQA 1NNDA 3KK1B 3T5HA 4FWMA 2CN1A 1KN5A 2GO8A 1VK0A 4UATA 4UF4A 1CZAN 1JL1A 3T9ZA 4A48A 2ZHBA 3GG0A 3AA3A 2A40A 1ZBIA 1JCGA 3THVA 1YJTA 4HT7A 1BNOA 2H5XA 3RH4A 1NGEA 2FVQA 1U2FA 4QIWC 2A6AA 2BPFA 3QNMA 1HQUA 3D6MB 3CMAN 3DM2A 3QERA 2HSEB 1GOCA 2QLFB 4RW8B 3B0XA 3NS7B 3LWLA 5CQGA 4H0TB 4ECQA 4YB6A 2W01A 4I2QA 1WUDA 5AQWA 5I42A 2AKWB 1PAEX 4CRXA 2XY8A 1G3OA 4G3IA 3AJDA 3HVWA 5ALOA 1TAMA 2DRBA 3KOOA 2WW4A 1Q95G 1VQPN 1QQ6A 3ZDAA 3ENVA 1KD1O 2BQRA 5DG9A 5FPDA 2KM8B 1DLOA 2ITMA 1WWUA 3DRYA 5FLXO 1SUQB 4EYIB 2NNWA 2GS8A 1X4HA 1KQFB 2PI5A 4WCEL 1BI4B 2EHGA 3OSNA 3FLCO 5I9EB 3FFKB 4RX6A 2HGNA 4C8ZA 4CEFA 5A8WB 4BS2A 4KI6A 2KB2A 2CPZA 2K2PA 2RIJA 3HK2A 2HQFA 1RG6A 4IRCA 1QE1A 4OI4A 1QLNA 3B6PA 1K6YA 4CO2A 3HP9A 8ICMA 5IINA 3M6ZA 5DDYA 4QS7A 3ILOA 4NM1A 2C1EB 3MAAB 3VMFB 1MSWD 2ASJA 4NLZA 2WAQF 1IBLJ 9ICEA 2EXUA 3KLIA 4ILHA 2RDDA 2VGNA 3NH0A 3ZSQA 1HFEL 2L9NA 1O0PA 2VFRA 2NR0A 2GVZB 4KRFA 1TVAA 3SBMA 4YVZA 3PIOL 2A0FB 4CIGA 3S6JA 3FGVA 4YS2A 3SMPA 3L4PA 4KQZA 3UB5A 1ZQAA 4Z6FA 3D28A 4J5OA 3VQ7A 3CJ0A 3CJBA 2QX0A 4FJ8A 3CCJS 2AH5A 4Q43A 1HYSB 2ZUCA 3NVYA 2GVDA 5D8HB 3ZTQA 3NH1A 2MGZB 4NMLA 5JVGL 3NGRA 1KWMA 2G1DA 1VBZA 3EVOA 1ITGA 2G13A 1UEUA 5AQSA 1JQGA 1HBNB 4JN4A 1UJ5A 5B7WA 3H8JA 1BU6O 5DM6Q 3JSBA 1E4GT 4RWXA 1X40A 3FZLA 3DLLL 1YWXA 2E8AA 1RT1B 3NS1A 4QWCA 4N7TA 4NLSA 3CC4S 4JI4J 1L8LA 3S7RA 1MU2A 3B82A 3E8OA 1E6VB 3T5LA 2YQ0A 3UFCX 4CERA 2EVZA 3CJQA