3BDPA

Dna polymerase i/dna complex
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVRAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualizing DNA replication in a catalytically active Bacillus DNA polymerase crystal.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA (5'-D(*GP*CP*AP*TP*GP*AP*TP*GP*CP*2DT)-3')
total genus 201
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1997-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3bdpA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3bdpA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bdpA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3bdpA01
3OYKA 1SL1A 5KRSA 1S77D 3SV3A 2D5RA 3WNFA 3H8JA 4ED1A 4DSLA 4KLOA 4DTPA 4I9LA 1QHTA 1BPDA 4RPZA 1B9FA 1Q9YA 4FJJA 5HLFA 2G8KA 4YQWA 4DG1A 4KHUA 3O3HA 1BGXT 4J9SA 8ICHA 3V9UA 4K8XA 4RT3A 5KFVA 3H8WA 1ZBLA 2AGPA 1YT3A 2UVUA 1UOCA 1K1SA 1JLBA 4UB5A 3LP3A 4KLFA 3V9ZA 4FLYA 5J2MA 4KN4A 3DMJA 5KFKA 2J6UA 4ED7A 1RXVA 5DQGA 1Q8IA 5JUMA 3RH5A 3OYDA 4CJ3A 2ASJA 4ECYA 4OJRA 2R7YA 3LPUA 2BCSA 4ED2A 5KFYA 9ICQA 1HMVA 4DF8A 5J2QA 4M3ZA 4DQRA 4KREA 3PW0A 1RT3A 5HMLA 9ICVA 4O44A 4AHRA 3HXMA 1L3UA 1S1TA 3ZSQA 4KLSA 4OKJA 3ZDEA 2PXIA 4B9VA 5EU7A 4CIGA 5KFDA 4YFUA 4RT2A 2VA3A 3C2KA 3ZSVA 8ICZA 2HHVA 3K59A 1S0VA 1ASUA 2X74A 4ECVA 1I3AA 1NK4A 5J2JA 1LV5A 3LK9A 4RQ2A 3C1YA 3LWMA 1TK8A 1WSGA 4BE2A 9ICBA 4DQQA 3HYFA 4KB0A 2ZUDA 5KFWA 3ZT3A 4DTNA 2VG6A 4KHSA 3MGHA 3OVNA 4I2GA 1SL2A 4NM1A 4CK2A 3HM9A 2B21A 4M45A 4M41A 3KTQA 1U04A 2JZBA 3ZDDA 4CERA 2BCVA 3ORYA 2ALZA 4UBBA 1ZQRA 4EBCA 1HRHA 5KT7A 4IRKA 4FK2A 4LY7A 2E4LA 4BGDA 5EWEA 7ICEA 3M9MB 3AA5X 1VSMA 3PW7A 1SUQA 3AO4A 4UBCA 3OYFA 2KW4A 4RW7A 1ZBUA 1NJWA 2JEIA 1HYSA 2FBTA 5D4BA 4DQSA 3QO9A 4Z4CA 4KAZA 3OYLA 3AU6A 1ZQIA 3PX4A 1PZNA 2G8FA 3IHQB 4CFAA 4FK4A 1RXWA 3P83D 4M04A 2Z1IA 1D5AA 4IR1A 1KDHA 2ZJ5A 4QWCA 1C0TA 2HNDA 4CF1A 5BOMA 2RDIA 1XSNA 3JSMA 4M6WB 3N4MB 1RDAA 3RMDA 1RBSA 4F93B 3PW4A 1JN3A 4XIUA 3RH6A 5JS2A 1TKZA 3MEDA 4BACA 4RNOA 4KLMA 2GV9A 3BJYA 2X6NA 3C1ZA 1HUZA 1LAVA 2LYHA 4F8RA 4DLGA 1D8YA 4ED3A 1KFTA 4JV2A 3V81A 2O4GA 3FYHA 3QEWA 3ETLA 2A1RA 2R8KA 3GQCA 1RBVA 1S9EA 1RDCA 1REVA 3IM1A 3NAEA 3M9NB 4DSFA 4EYHB 3JPPA 3TAPA 2IMWP 2FBXA 5CP2A 1U48A 5J0WA 4YMMA 3EPGA 3NF7A 2IDOA 4QZAA 5DDMA 4ECUA 2YKMA 5DB9A 4KV8A 1T8EA 5K14A 1J9AA 3ZDAA 4IBNA 3P5JA 1LW0A 3NH2A 3C5GA 3JPRA 9ICAA 3GIIA 2P1JA 2Z1HA 1JXBA 1N48A 3GDXA 5IIIA 4HYKA 4KLUA 4NXZA 4BE1A 2BQUA 2B6AA 2JGUA 4YXJA 5KFSA 4Z6CA 1RT2A 4DFJA 5HRNA 1LWFA 3OYNA 1L5UA 2XHBA 1ASWA 1KVBA 4B8CA 1NK8A 1C7YA 2FMQA 1U49A 4TUQA 4ECWA 4CJRA 4RG8A 3C2MA 4F5RA 1B92A 3AVKA 4FW1A 3HPHA 3SUNA 1IKVA 5KFLA 3PW5A 4LVSA 2YNHA 2I5JA 3ZSXA 2OPQA 1KTQA 3VQCA 2KFZA 4EZ6A 1WLJA 3OYIA 2WOMA 4O4GA 4F4YA 2YHAA 4I2EA 4F4XA 1VSLA 3V1OA 5KT6A 3KLIA 3HSTB 3SQ1A 2BPCA 4ECXA 2NRWA 3AO3A 4M42A 1VSJA 4LZDA 2HW3A 8ICNA 4CEAA 2VG7A 1X9MA 2ISOA 3TAGA 2O4IA 4BDYA 4UAWA 4RNMA 4EEYA 4FVMA 4NCBA 1ZBHA 5IINA 5J2CA 9ICOA 5IIMA 5J0QA 4JLHA 4MF8A 2DFEA 2D0AA 4KLEA 2GWSA 4F4KA 3HJFA 1WAJA 4M3XA 5L1JA 4J9MA 8ICRA 3OYGA 4RQ1A 2HHWA 3KK1A 4YD2A 4AHVA 8ICOA 5L1LA 4MEXA 5HRPA 2AU0A 4DEZA 4PHAA 1S5JA 4CFBA 3V9WA 2PYJA 3QEVA 5KFMA 1NJXA 1S0MA 1XU4A 4M6WA 5KG4A 3SI8A 1L3SA 4TUSA 5KT4A 2HVIA 4CK1A 4ZTFA 1RTHA 3RB4A 5DQIA 1KVCA 4O0JA 4DQPA 3DLKA 4FS2A 1DLOA 1MQ3A 2ZUCA 3VQPA 4B08A 1XSLA 2C2DA 1ZQSA 3VQ5A 1UA0A 3QIPA 3MABA 3AV9A 1ZQWA 3DOKA 5DG9A 2IS3A 1HQUA 4X5VA 5KFEA 4B8AB 1UT5A 2HHQA 3HP6A 5DK5A 4R66A 3V7LA 3LZJA 3V9XA 3KHHA 4F50A 2E6MA 4HUEA 5KG2A 3V4IA 4GVMA 8ICPA 3L3UA 4B9SA 2OPSA 2W9MA 4Q0BA 4CJWA 2ETJA 2XCAA 4DU4A 9ICNA 3RTVA 4YXMA 2IBKA 5CB1A 2QKBA 7ICHA 1HNVA 3GFKB 3AO1A 4IG3A 2OPPA 3OHAA 4IRDA 4MFAA 3ZSYA 3QLHA 4UAYA 4M3UA 2DFLA 4I28A 1TGOA 2FPMA 1ZQPA 5I3UA 1Z00B 4PGXA 4K4IA 3NF6A 4C8LA 2XC9A 2KTQA 3MBYA 7ICIA 1H38A 8ICJA 4B9MA 3WNEA 1EXNA 9ICGA 3OSPA 1S6QA 3VQ6A 5HP1A 3HT3A 3K5MA 2XY5A 9ICHA 5KRTA 3KD5E 4QZDA 4FJIA 2B4JA 1NKCA 4NCAA 3V9SA 5KFZA 4LSLA 4M3RA 1LWCA 3K5NA 2G8VA 2KZMA 2J6SA 8ICBA 3T5KA 4DSEA 2C2RA 2X78A 1U45A 3V1QA 4UQGA 4CIFA 4E1NA 2XY6A 4FJKA 2IAJA 1I39A 4AILC 4ID5A 1C1CA 1BPZA 3VA3A 4YFKA 1ZQHA 9ICFA 4Z6EA 3OS1A 2IC3A 3C6TA 4CJVA 5J2GA 3Q8MA 3T5JA 3L2QA 3SQ0A 1U47A 7ICMA 9ICKA 4JRQA 5FDLA 3Q8LA 3NHGA 3EWAA 2BGWA 4R8UA 3DI6A 4FK0A 1XC9A 2I1QA 1JMSA 1L3VA 3T19A 5IIJA 3ZCMA 4DTXA 1CUKA 5KG1A 4Z4IA 1J54A 4J9NA 4KMUA 4FJ9A 4R64A 4DL7A 3OYCA 4N56A 3OJSA 4R8UB 1UAXA 1IKXA 8ICXA 4O5KA 2IHMA 5J2AA 3DRRA 4I2QA 4W5TA 4KLLA 4E3SA 1MSWD 3QNOA 4DL3A 3AVCA 3I0SA 1TKTA 3T5LA 4ELVA 4BXOB 2BGGA 4ECRA 1C0UA 3ZSRA 4EP4A 3RJEA 4I2HA 4AHCA 5DBAA 7ICQA 1G15A 5C5JA 3C23A 4EBDA 4PQUA 3MECA 4CJ5A 1T05A 2PFPA 1ZETA 3RJJA 1QTMA 3U3GA 1S1XA 2D0CA 3IAYA 3LAMA 3OHBA 3D45A 5EWGA 3D0PA 4KLGA 2HMIA 1D8LA 1YTAA 3ISNC 3GV7B 4FLXA 3HVRA 2KQ2A 1BHLA 4G1QA 4YVZA 9ICEA 1X1PA 3ISBA 1F21A 4LZGA 3K58A 2F8SA 2FLPA 5T7BA 1VSFA 3L2VA 3VQ9A 2YV0X 3G6VA 3TAMA 1ZQBA 2VWKA 1ZQMA 4OGEA 5D46A 3UQ0A 1S6PA 3UIQA 1XHZA 4DU3A 4M9HA 4CGDA 2RDJA 3SYZA 2NRXA 3MR6A 5J29A 2BQ3A 1ZQZA 3AVAA 2W9BA 4DSJA 3HW8A 4J9RA 2AJQA 4DSKA 3PMNA 5FRNA 3G0ZA 2RKIA 5JS1A 1ZQNA 3T5HA 5KGWA 4C8NA 3NF9A 3KIOA 4IQVA 3LDAA 1S97A 3ZDBA 1QLNA 1HYZA 5CY4A 3UXPA 3SZ2A 1RCHA 3QERA 4F5QA 3L3VA 3V6JA 2IOCA 2RPIA 3BDPA 2PYLA 4CHZA 1TL1A 4F3TA 4DTSA 4F5OA 4IQWA 3E2EA 3RAXA 3E01A 4PUOA 3WNHA 4ZTJA 1VSKA 4QZCA 1X9WA 3ZT0A 1IO2A 5EOZA 4ICLA 8ICGA 1GOAA 1RT4A 2OZSA 2F96A 3K75D 4GXJA 5CZ1A 1RNHA 5DBCA 1BQNA 3DLHA 1IXRA 1T7PA 4F4ZA 2P5GA 4BE0A 5HRSA 2ZTEA 1DTQA 4I9QA 1ZQTA 2HB5A 5KG0A 3NGDA 1RILA 1FXXA 3UPQA 1N56A 2ZQBA 2UVRA 4J2EA 4UB2A 5J0PA 4MFFA 3RAQA 4CJTA 2KFNA 4W5RA 3NGZA 1WCLA 1TKXA 1EX4A 4KTWA 3ISCA 5DG8A 4W5NA 4ECSA 1TAQA 4CJ4A 3RH4A 1SKWA 4NYFA 3AUOA 2DY4A 3ASMA 4MQ3A 1VSEA 3LDSA 4ZH4A 5J2BA 4PWDA 1EETA 4B9LA 3RJFA 4XUSA 4N47A 1C0MA 3AA4A 4KLIA 5DB7A 3HP9A 3SV4A 8ICIA 2V9WA 4B9TA 4PA1A 4Z4EA 1ZJNA 1KSPA 1NKBA 5FRMA 2DPJA 3RJHA 2V4QA 3GIJA 2R8IA 1QSLA 1CZBA 3TI0A 3DLEA 1IH7A 4CECA 2P66A 2OA8A 2R8HA 2OWOA 2VA8A 4EZ9A 4M47A 1BPYA 3AVJA 4LH4A 3TQ1A 5KG7A 3RMCA 2G8HA 3LP0A 4PH5A 4I2FA 4KN7A 2KZ3A 5KFTA 1J53A 1HQEA 1X2IA 1RT5A 4QZIA 4FM1A 1JLCA 3C21A 4I27A 5J1EA 1RPLA 1BI4A 1JIHA 4KHYA 3Q8PB 3CQ8A 3AVLA 4FJ5A 3QE9Y 1NOZA 3GIMA 2P51A 4CFCA 1RTDA 4KITB 4AHUA 4E7LA 2GBZA 3SPYA 4DFMA 3G6YA 4CJQA 5F9NA 4QWEA 1BPBA 3RJKA 4GXKA 4YN4A 4Q5VA 5E41A 4RQ8A 2XY7A 1N6QA 1JLAA 4QWBA 4Z6DA 4Q44A 1EP4A 1YVUA 2GUIA 3F73A 2G8WA 5EWFA 1ZQCA 5KT3A 3UQ2A 4ED0A 4KI6A 3M8SA 9ICCA 4O3RA 3H4BA 3WNGA 3JPNA 2NRVA 1L3TA 5HBMA 3NGIA 2FMSA 4F91B 4Z4HA 4QZHA 4O3SA 4BDPA 1FK9A 2BPGA 4AHTA 1A76A 4J9LA 4UB3A 2AGOA 1XS9D 5D3GA 2BHNA 3KKSA 5J2FA 3LP1A 3OYHA 5KFAA 2D0BA 2BCRA 3V6KA 4E7HA 1X9SA 4B3OA 1BIZA 3K57A 4JWMA 4QZEA 4KTQA 3ZSZA 4FLUA 3CFOA 1WNSA 4R65A 3QEXA 3MXJA 4DF4A 3MR5A 4O55A 3M8PA 4M9LA 3ALYA 4KLDA 4CIEA 4OLBA 8ICLA 1S10A 2AQ4A 2C28A 5KG5A 1NJYA 7ICGA 1T4GA 4O0IA 2QKKA 4E7KA 2P6UA 1KLMA 5KFFA 1TVRA 3ZD9A 7ICFA 5HP4A 3PNCA 1NK7A 7ICVA 4FCYA 3IRXA 1ZQGA 4O3PA 1S9FA 4CEOA 4QOZB 5KFHA 2XCPA 4JRPA 8ICFA 4OPKA 5J0OA 4RQ6A 3VQEA 3OYMA 4O5CA 3H4DA 4NM2A 1WSEA 4DL2A 3O4NA 3OY9A 4E7IA 5KFPA 5KFRA 3QIOA 2BPFA 3AA2A 4LH5A 1VRTA 7ICTA 4DS5A 2WONA 4P4PA 4PY5A 4KLJA 4MEYA 1JL2A 1HJPA 3KD1E 3UXOA 3LPTA 3HK2A 4QWAA 3S3MA 3GV8B 3K5LA 5L9XA 5HNKA 5L1IA 4F3OA 3AU2A 4J2DA 4LSNA 2XGPA 3BQ0A 4ED8A 4ZHRA 2JZBB 4B9NA 8ICMA 3VQ4A 3EPIA 3VQQA 3KJVA 3KLFA 5DBBA 4QWDA 4DTRA 3H7IA 3ZT1A 5C25A 4RUCA 9ICJA 4Z4GA 3AO2A 1BCOA 1TKDA 3NGYA 4CEFA 1ZQYA 3H08A 2FC0A 3PO5A 1C6VA 4RQ5A 3ZT2A 4J2BA 1VSIA 5DG7A 4FLWA 9ICPA 7ICSA 4M9GA 8ICTA 1UT8A 2QXFA 7ICKA 8ICCA 1KEJA 1JXLA 3ZT4A 1S1WA 2AQ0A 3C94A 5HHHA 1ZQFA 3AVMA 2F1HA 3V72A 2G8IA 4RU9A 3QEIA 2JEJA 7ICOA 4O3NA 1Q9XA 2HVHA 3RJIA 3LP2A 3AVNA 5KFCA 1W9HA 2W9CB 4CGGA 1NK0A 4FLVA 5SZTA 3OYBA 4CEQA 5KFUA 4CF8A 8ICKA 2XGQA 4P4OA 2G8UA 2FLLA 1DOQA 1WSIA 1IG9A 1V9PA 4IR9A 4CJKA 3RR7A 3QNNA 3S3NA 4I2JA 1MC8A 4RQ0A 2W42A 2IA6A 1RT7A 4DSIA 1KFDA 3NCIA 4RPYA 1KVAA 1TVAA 1A5XA 4OKEA 4CHQA 4W5QA 4IFVA 3FFIA 1MQ2A 3PO4A 3F9KA 4QZGA 3SNNA 4FJHA 4E19A 2X6SA 4KB1A 1B43A 4IFYA 5KGXA 4YG2A 3B0XA 1HYVA 3KK2A 5HRRA 2ZTCA 4DU1A 3HX0A 1IKYA 3Q8KA 4DL6A 3DM2A 1N5YA 3RBEA 1D9DA 2JLEA 5BOLA 3TWHA 4FZYA 3QEAZ 1DTTA 1NKEA 5J2PA 5J0TA 1NK9A 3CFPA 1IKWA 1HUOA 3AVHA 5J0UA 2H5XA 2PI5A 3Q8QB 3IS9A 1ZQXA 4JK1A 4DQIA 1AROP 5CJ7A 5KFQA 1RT1A 5KG6A 3SJJA 1ITGA 2NRTA 4OPJA 4R5PA 4TUPA 2VA2A 1WSFA 5DMRA 1S1VA 4NY8A 1WN7A 3ITHA 4UB4A 3V6HA 3B6PA 4DL4A 4I7FA 4E1MA 2BDPA 1UWBA 1ZQDA 8ICWA 4F2RA 3OS2A 3QZ8A 2YNGA 3TR8A 4CEZA 4RNNA 2MUTB 2XO7A 3RMBA 1CEZA 4FW2A 4KO0A 2DFHA 1B9DA 3PX0A 4FJMA 1U4BA 2BE2A 2W9AA 4FBUA 3AVGA 4CGHA 1Y88A 1XWLA 3QEPA 3MXMA 3B0YA 5J2KA 4QZ9A 4JUZA 2BR0A 2F1JA 3DLBA 4GC7A 9ICLA 3RBDA 4QZFA 1Y97A 5L1KA 5C42A 1ZQUA 2HHUA 3HL8A 3VN5A 2HHXA 3LANA 4K8ZA 4CHYA 4YNQA 3TANA 4M9NA 4K4HA 4FM2A 3MFIA 4DLEA 4YMOA 1ZJMA 3SI6A 3HO1A 2F8TA 2HNYA 3QINA 1J5OA 3NFAA 4BXOA 3B6OA 1WSJA 1SKRA 4NYNA 2DTUA 4O5EA 3RR8A 4DFPA 4O3OA 3KKRA 1D9FA 3N97B 4CJUA 3KHRA 1RZTA 8ICEA 4HCCA 3HPOA 4Y1DA 5J0YA 4DS4A 4RW9A 1RBTA 1ZQQA 4WE1A 2IGIA 4CGIA 2ITGA 1QS4A 2OPRA 2YKNA 3MFHA 2VG5A 4FLTA 2F1IA 5C24A 4DOBA 4JS5A 2FBVA 3NBPA 1COOA 5DB8A 4DTJA 3UXNA 4CESA 2W8KA 1RT6A 4FXDA 4N76A 4ECZA 9ICWA 5IIKA 4J2AA 3QEBZ 2UVVA 3CM5A 3A2FA 1WCNA 5J2EA 4CGFA 4CJSA 1ASVA 2UVWA 1LWEA 4FJLA 4QCLA 4KHNA 3ZSWA 1NK5A 2NUBA 5SWMA 1BIUA 1RTJA 4QAGA 3QETA 4F5PA 5KTQA 3MR2A 4TURA 5KFGA 1B22A 4G3IA 4DFKA 4R63A 3KLHA 1LAWA 1BQMA 1RYRA 2Y1IA 4O3QA 7ICUA 4M3TA 3Q8RB 4J9QA 3L8BA 3EW9A 1ZBFA 5J2DA 5IIOA 4CJLA 4L8RB 2XY8A 4J9KA 3O4QA 3IG1A 4EYIB 3CG7A 4CJPA 3DYAA 4GMJB 2YNFA 2ZE2A 4N5SA 1U9LA 4NLGA 5J0XA 3THVA 2PFOA 3KHLA 2BANA 2JEFA 1DGSA 3JPQA 5FROA 2ZJ8A 2XRIA 3MEGA 1BISA 3ULDA 5DKWA 1SV5A 5KG3A 4F4WA 1RYSA 5CYQA 3OGUA 2QK9A 3K2PA 4TSXA 1Z3EB 4FO6A 4Q45A 3SUPA 4ECTA 1S0OA 4JV1A 3OJUA 4N41A 2PZSA 3JYTA 4KHWA 3ZSOA 4KHQA 3C6UA 1HPZA 3BGRA 3KLGA 3PR4A 4QZ8A 1JLQA 4YMNA 3M9OB 4CCHA 4NLNA 4KKOA 2BCQA 1RBUA 4JWNA 4I2BA 4PGYA 1TK5A 3LALA 4KPYA 4I2CA 3DRPA 3HWTA 8ICSA 2V4RA 3T1AA 1S0NA 2LSNA 4FYDA 4I2PA 4CEDA 3RJGA 4RW8A 3U6FA 1TV6A 5KT2A 2ASLA 9ICRA 4FJXA 5J2IA 1Z00A 4YP3A 1SL0A 3KK3A 3JPTA 4RZRA 2ISPA 4IQUA 4UAZA 3SUOA 4ECQA 2EHGA 4BWJA 3AA3A 5CA7A 1Z25A 4YR2A 4FJ8A 4UB1A 4Z6FA 1RTIA 4CHOA 4ED6A 4DL5A 2YHBA 4KI4A 1JX4A 3G10A 4O5BA 3TARA 4MF2A 1JXEA 4YR3A 1YTUA 3OYAA 4FJGA 4P4MA 2ATLA 2A1JB 5DLGA 2YNIA 1FKOA 1GOBA 4W5OA 4YR0A 1NOMA 4CGJA 5KFXA 5HHIA 3C95A 5DLFA 3QZ7A 5KFOA 3VQ7A 2W9BB 3OS0A 3SCXA 1ZBIA 4TQRA 4J9PA 3DRSA 5DQHA 4KTZA 4OVLA 4QZBA 2R8GA 4CFDA 3VQAA 3V7JA 3TFSA 4OGCA 3L2WA 4Q43A 3CFRA 2DFFA 2ZTDA 1ZQAA 3DLRA 1S1UA 3BQ2A 1BL3A 1K6YA 1UA1A 1HNIA 4M2YA 4DMNA 1XSPA 5D49A 3PW2A 1QSYA 1VRUA 1QE1A 5DGAA 3NDKA 4DOAA 1CXQA 3EYZA 4H8KA 1VK0A 1A5WA 4E7JA 4XA5A 5BPCA 2JEGA 3MXIA 2BCUA 4M3WA 4CF0A 3OYJA 5CZ2A 3SQ2A 3EZ5A 1A77A 5HMMA 4BDZA 4FLZA 3M8RA 3SUQA 4CEBA 1EKEA 4CF2A 4ID1A 8ICVA 4RPXA 3I8DA 2R8JA 1CXUA 4B9UA 4RW6A 4Z4FA 3I0RA 9ICIA 3AVFA 4CEEA 4GXIA 3PX6A 3ISDA 1BPXA 4OLAA 4NCGA 3MEEA 4Q8FA 1TK0A 3RB0A 4HUGA 3P1GA 9ICMA 4CJEA 4M3YA 1SKSA 3LZIA 4C8OA 1NJZA 3L2UA 3RMAA 3G6XA 2PFQA 1GOCA 4XRHA 8ICAA 4NLKA 1C1AA 1ZQVA 3M8QA 4BWMA 4RQ7A 2HHTA 2ZD1A 3DOLA 4OKKA 3MR3A 3V1RA 1EXQA 4NLZA 2FPKA 4ELUA 4HTUA 4FM0A 2AGQA 4IKFA 1JL1A 3O3FA 3SPZA 3TAFA 4DWIA 1K1QA 4CHPA 3C5FA 2Z1GA 4HVJA 1TAUA 3GILA 4KLQA 4E89A 3RRHA 3RB3A 4DTMA 4IDKA 4FJNA 3TAEA 4J9OA 4CK3A 4JS4A 5KFIA 3PUFA 4QW8A 2PFNA 1RDBA 2WTFA 5CHGA 1BPEA 3VQBA 3TFRA 2ATQA 1S76D 3SQ4A 1BI4B 1HJRA 2BQRA 3S9HA 4CJFA 1ZQEA 1NK6A 9ICXA 7ICPA 3LAKA 4C8KA 2B5JA 2W8LA 1KCFA 4M0AA 9ICSA 1TFRA 4FZXC 4H4OA 4PHDA 5CR0A 1T03A 3L2RA 4K4GA 1RDDA 5DGBA 3VQDA 4ELTA 4I29A 4MFBA 2RN2A 1VSDA 4GW6A 1IM4A 1JLEA 1NOYA 4O9MA 5J0RA 3FDSA 2OYQA 3Q8SB 3NH1A 4RQ3A 1KRPA 4FBTA 1QQCA 2PI4A 2C22A 4YD1A 2KN7A 2P5OA 4F92B 4XQ8A 3RRGA 9ICUA 1ZQLA 5DB6A 4C8MA 2RF2A 1O1WA 4IRCA 4F2SA 1VSHA 3VQ8A 2ASDA 4DTUA 2MAXA 1KLNA 4EBEA 4TQSA 4H4MA 1XO1A 1MU2A 3NE6A 7ICNA 4HCBA 4FJ7A 3AVBA 1SZPA 4IG0A 2KZZA 4AH9A 4HUFA 4I2IA 2E6LA 1XI1A 1W0HA 3AVIA 5J2NA 3BQTA 5KT5A 2I9GA 3MAQA 3KHGA 3QESA 5F9LA 2PY5A 3C2LA 3T3FA 2NRZA 1ZQOA 3K5OA 3CYMA 2Q3SA 4DO9A 1CZ9A 1XHXA 3LWLA 2FLNA 5KI6A 2OZMA 8ICQA 2FMPA 4Y1CA 1JKHA 1ZQKA 3ZD8A 3MGIA 5KFNA 3AO5A 3DLGA 1A5VA 3BQ1A 2HHSA 4RQ4A 3TABA 4RW4A 1FKPA 2VWJA 4RUAA 4PGQA 3PVXA 4GC6A 2C2EA 2ZJAA 8ICYA 3K4GA 9ICTA 1TL3A 4Q8EA 4DOCA 4YCXA 4KFBA 2M9NA 4LD0A 5KFJA 1WSHA 5DDYA 3GV5B 1KFSA 3RWUA 2HNZA 2ZUBA 3V7KA 2DPIA 3OSNA 4I2AA 2P6RA 5KFBA 1TV9A 4E0DA 3VA0A 3HPGA 4Z0UA 4KLHA 3JPOA 2MUTA 1QSSA 4F5NA 4PHPA 4FZZA 4CHNA 3GIKA 1JLGA 4QW9A 3MDAA 5J0SA 3O3GA 4M9JA 3EY1A 5IILA 7ICRA 4MFCA 4KLTA 2A1SA 4AHSA 5I42A 1CLQA 2IHNA 3OYEA 3H8SA 1BVSA 3PY8A 1S9GA 3RB6A 4PPXA 3JPSA 4P2HA 3NH0A 4CF9A 3S3OA 2VANA 4KRFA 1BCMA 4CE9A 2Q0ZX 3PR5B 3KLEA 4DTOA 1LW2A 5HROA 1RBRA 5CYMA 1JLFA 7ICLA 3NTUA 4FS1A 3MDCA 2Y1JA 4IQTA 4PHEA 5TZVA 3U3YA 1R0AA 2EX3A 2FBYA 3TAQA 2W9CA 3H40A 5CWRA 2FPLA 1Z26A 2Z1JA 1T3NA 3HVTA 4EP5A 4JV0A 4I2DA 3CM6A 8ICUA 4HHTA 1WAFA 5J2HA 1LB2B 3PMLA 1C1BA 2A1JA 2BKEA 2J6TA 1ZQJA 3V6DA 7ICJA 3PV8A 3ZDCA 3NF8A 1ZYQA 4GLXA
chains in the Genus database with same CATH superfamily
3R2DJ 3N0VA 3WNFA 3H59A 2R42A 1OY6A 1BPDA 4OZ1A 1SXDA 2IJFA 2PFFB 5ALLA 1RBAA 2G8KA 2YN4A 4H54A 4X84A 5AQZA 4B3SK 2AW0A 2OD4A 5KFVA 2P9NA 2AYGA 3VF6A 2IRXA 5AQXA 3EVWA 2ACMA 3WHIA 2QWPA 1RWOB 4GVBB 2MHEA 1RDRA 2H3IA 1X4CA 4KLFA 2GHWA 4KGXB 2V50A 4NLVA 5AQVA 3D6JA 4ER8A 2DYAA 1KAZA 1VOMA 4CRJA 4JI2J 4PPDA 2G2ZA 2D1CA 3OUYB 3EUB2 3FZHA 4RWXA 4I2QB 2Q6BA 2W6LA 4UQTA 2WF6A 2HVZA 4M3ZA 4O3MA 4JKHA 4DN9A 1K8AO 4DQRA 4M5IA 9ICVA 1L7NA 1S1TA 4KLSA 4IQMA 1A9NB 2PXIA 3AJ2A 5L8RC 1Q5YA 4DPUA 4CIGA 2QYGA 4JI7K 3AQFA 1QY7A 3ZSVA 4DCJB 8ICZA 3THWA 2HHVA 3R5DA 1C20A 5DDPC 4K4TA 2QYCA 2MTLA 4WE1B 4DQQA 2A5XA 3FRYA 1FEHA 4KB0A 4HT5A 5F0UA 2DNOA 3OFGA 3IM9A 7AT1B 4KHSA 1V5IB 1MA7A 1ZAVA 3JAMU 1NMNA 5LMUK 1PSDA 2M52A 4I6MA 4I2GA 2CQPA 1WG5A 3OV7A 2UUAK 4JI0J 3W9IA 3WT0A 2IVPA 4CK2A 4KHRA 3HM9A 1J6ZA 1U04A 2FGOA 4XTTA 2ALZA 1JALA 2EFNA 4EBCA 2DH8A 4FK2A 1PIEA 1VCTA 1UVJA 4LY7A 4LFAF 2ZBRA 4BGDA 5EWEA 7ICEA 2VODA 3P8BB 3SSRA 4ID8A 1ZAXA 5ALFA 3POTA 1PGZA 3F41A 1YK9A 1X4DA 2A3ZA 3TA2A 2N4CA 3IFEA 3QO9A 3U26A 2YVSA 3TVYA 3MM5A 3AU6A 3ISND 2RH3A 3PX4A 1O08A 2YQ3A 3PG9A 3LL3A 2FIUA 1F0MA 2AWZA 2I9SA 4M04A 1YJ7A 3E8OA 1KDHA 3FRZA 2AX0A 2H48B 2YNFB 2YWKA 2Q4TA 2VJVA 4LF5J 2FZCB 3V81B 3DV9A 1XNRJ 1XSNA 4LF5K 2RKIB 3VQTA 3V4MA 3RMDA 4WU2A 3PZPA 1RBSA 1VQ7S 1JN3A 4Y6IA 2EANA 1O8BA 4EUVA 2B4OA 4DV1F 3FBEA 1DGKN 5F3XB 2KHVA 3I56N 4KLMA 2P9SA 3HHDA 1LOTB 3QGGA 1F2HA 5IOLA 1HNXJ 1LFWA 2EVZA 1NGJA 2ASPA 1HUZA 3HTVA 5IT0A 1H2VZ 4DV6K 2F77X 4DLGA 3FSYA 1KFTA 2J0QD 2KT2A 3V81A 2HVDA 3QEWA 2GLEA 3CC7N 5GAHI 2E29A 2OGUA 3SQGA 4IO9L 1IG8A 1ECWA 5K5MA 5D4OA 2DKZA 3GLJA 3OPXA 3UKUB 5TKWA 1SV5B 5CP2A 2LFVA 2QKQA 1RDFA 4K2JA 2GAHC 4V19S 4YMMA 2OUGA 1L3KA 4QZAA 4LRDA 2HVEA 3BSOA 3SR6A 4B1ZA 3L95X 1C4CA 2CG4A 3P5JA 3FZLA 1IQZA 4KBIA 4F0MA 2IOFA 3QSYB 2K8CB 4JI2F 3GDXA 3F0NA 4CZMA 1JJCB 1WHVA 4BC4A 1S1XB 4BE1A 3GBTA 4WTOB 4Z6CA 4EEKA 1RT2A 2COLA 5HRNA 2WCXA 4JI5K 4NL9A 1KVBA 1NK8A 2KHOA 3PYEA 1GEHA 1K73O 3BF3A 1HR0F 2LA6A 3TKAA 3AVKA 3UM9A 2QB0A 1WI8A 4N77A 3WQUA 3O9UA 1J27A 4GVEA 3SUNA 1IKVA 4A57A 3FGUA 2XMWA 4FWOA 1UFKA 2V8PA 3GU3A 1DXSA 3TVZA 5AM4A 4F4YA 1RAJA 2YHAA 2LXFA 2IVFB 2VBYA 1VSLA 1IR1A 5KT6A 4B3RJ 3HSTB 1HQEB 1HIYA 3UE2A 4CEAA 4ZOHC 4YOUA 1X9MA 3UKUA 2O4IA 4BDYA 4KPCA 4EEYA 4FVMA 2EDUA 4OYPA 4XDCA 5J2CA 5J0QA 3D54A 3ID6A 4NXNK 2D0AA 4KLEA 3MGVA 3MMBA 2B9XA 3W64A 1WAJA 2G5IB 3M6ZA 3FMBA 2V5HG 1TKXB 2CZVC 2M5YA 1HBMB 2GIRA 2FJEB 4CZGA 5L1JA 3KNGA 3B78A 8ICRA 2HHWA 4KHMA 2E2OA 2DEJA 4OI6A 4AHVA 3EKSA 4MEXA 3OTOK 1N88A 3FZBA 2JWKA 4HDGA 2LXIA 2F8EX 4WFNQ 4BRNA 1UTAA 5AKGA 3DOMA 2PYJA 1VI7A 1KVIA 1FX2A 2RDDA 1ZRMA 2DNMA 1S0MA 1XU4A 3GE1A 4M6WA 1RJJA 1Q53A 4IH5A 1RWXB 2HLTA 4M1KA 3ZTPA 4ZTFA 3ZXWA 4JKGA 2UV8A 3A8KA 4NWIA 3VAKA 1T03B 3RZAA 5LM7E 5KOWA 4FS2A 3O80A 1DLOA 1NGCA 3GZ7A 2OH2A 4B08A 3TTDA 2JVRA 1VQ4N 3OBIA 1Y7PA 3MOJB 5LMNK 1TELA 1DQAA 2DITA 3MABA 3DOKA 2DNZA 5KFEA 1FT8A 5AZIA 3HP6A 5DK5A 3HKZD 2FVSA 3KWGA 3V9XA 3KHHA 2E6MA 3BKUA 4HUEA 4KMOB 2ZDOA 3L3UA 2HQIA 1C0GA 2OPSA 4CJWA 5ALRA 9ICNA 3RTVA 2DHXA 1RDUA 2RE1A 3GSDA 2XM3A 2VQEJ 1CI4A 4B3OB 2FSNA 2FJVA 1JLBB 2PT0A 3KOOA 2J5AA 3OHAA 1DEJA 3QLHA 4UAYA 2EW9A 3I9ZA 4M3UA 1MWZA 2FPMA 3D6TB 3L4IA 1Z00B 4PGXA 2N3OA 1OSDA 1I5OB 4K4IA 3AOAA 3NXZA 1LWCB 2E5GA 2R7UA 3AEVA 1VDVA 2CQ4A 2J76E 3VQ6A 5HP1A 3HT3A 4P0PA 3K0SA 2E9ZA 2CQBA 4OYXA 4OZNA 4GVLA 3HSZA 3D2EA 1URNA 1NKCA 1WSRA 4URQU 4NCAA 2ZE2B 3ENBA 4AUKA 1DHMA 2JJ4D 5HI7A 1LWCA 2KZMA 2HHHF 3DC2A 2Z2LA 4NEYA 3T5KA 5GVQA 5I3UB 2YNHB 4B3TK 4Q0BB 2X78A 1U45A 3V1QA 1QVGR 4I6WA 3BGUA 2XY6A 4FJKA 3WKCA 4AILC 3R5JB 2IBOA 4ID5A 4LQ3A 2RAQA 2DGXA 4LSLB 1HKCA 4CD1A 1CQNA 2XVTA 2UXBJ 3ZETB 3A8IA 1KBRA 2IC3A 4CJVA 3DWLA 4WFAL 5J2GA 3Q8MA 4IJAA 2PFDA 3T5JA 3L2QA 4H5WA 1VIXA 3TUPA 4ZIVA 1V85A 4OYAA 1UVNA 1SIJA 2M9KA 3H45C 2MQOA 8RUCA 2ZM6J 3TA1A 3NHGA 2BGWA 1KOOA 4WK1A 1CZAN 3DI6A 2I1QA 3BR8A 3I5BA 4LVNP 3C14B 3OXFA 3T19A 1HKBA 2CRLA 4LRBA 3W3SA 2BRLA 4J9NA 4FJ9A 2HBRB 3GG1A 3WXIA 3HSDA 2HKEA 2QSFA 4ZCKA 3GJRB 2ALYB 2P6TA 2QZ8A 4N56A 3OJSA 5GADP 4BHQA 2G9OA 5K8MA 3MX5A 1YZ7A 3DRRA 2DHSA 3TRGA 1MSWD 1BA1A 4Y2KA 4BXOB 1C0UA 1UZDA 1NAQA 1N34F 2RU9A 2N7YA 5AICA 2QL9B 3DGPB 4X4UA 4Y34A 3MPVA 5DBAA 1UCVA 3DJCA 2ZWPA 3TSPA 3G4SN 4WJ3B 2LYAA 3C23A 1WI6A 4PQUA 2V6AA 4CJ5A 3KK2B 1ZETA 3RJJA 1QTMA 4KV8B 2VPWB 1VQMN 5EWGA 4CM2A 1QDUB 1VRUB 1VQ6S 1YTAA 5CRXA 5ITHA 3GV7B 4FLXA 4X65K 5MAOA 4YVZA 5F8LA 1X1PA 4KH6A 4USAA 3J7YU 4DV4F 4QNLA 5AQUA 3ZNUA 1F21A 4PXBA 3BBBA 2P2CB 1VSFA 4IC9A 4Y28C 4ZCLA 1ZQBA 2LECA 4PG6A 3E1YA 3BS5B 1XHZA 2RDJA 4QYZJ 2NXNA 5J29A 3C16A 4R25A 2J0SD 1TUWA 1K73T 4OPAA 3HVTB 3G0ZA 3T5HA 2I7NA 3IMXA 1SV4A 3IS9B 4YHHF 1COKA 3KIOA 3OUYA 4IQVA 3CCRS 1NEEA 1U6BA 2B0GA 3ZDBA 4MK8A 1HYZA 3DAWA 3UXPA 1RT1B 4DV4K 2DXEA 5D0EA 1X66A 3DLLQ 3F44A 4CHZA 2NCKL 1IJFB 1OW5A 3GJTB 1KW4A 3AQOA 1X4HA 3RAXA 1TU0B 2J7WA 1Y64A 4QZCA 2MSSA 5CD4A 3P5TL 2GEMA 3RRKA 4ICLA 4J8FA 3F2CA 2F96A 3I28A 5BRHA 1RNHA 1Q8BA 1IBLF 2GIQA 4DV1K 4H5TA 2ZTEA 2HB5A 4JI3F 3O9TA 3Q8YA 1M1KO 4UB2A 2GQCA 4W5RA 3NGZA 3P96A 1WWHA 2CXYA 3QFHA 3ISCA 4W5NA 1Q7YO 1C1BB 1KNZA 1S1UB 4NYFA 1IBMK 2G2YA 4XUSA 2MGZA 2W4DA 2VC1A 3KLIB 3D0HE 1ZJNA 1KSPA 4YOVA 3TADA 3QUTA 4MYUA 1UFWA 4RWWA 1KAXA 5FRMA 4IOAL 1GX5A 1N33F 1T9TA 1CSJA 2XBPA 3UB5A 2F8HA 2KVSA 2R8IA 1RQLA 5LSLA 1QSLA 2UUCK 3UNYA 4CLLA 2IA0A 4DMZA 2CNKB 3DLEA 1JNZB 1IH7A 2B5JB 3L3FX 2VD3A 3KJNB 1OUQA 2OA8A 2R8HA 4DDFA 2VA8A 3BBFA 3GIRA 3WX4A 2ZC4A 3AVJA 5KG7A 2G8HA 1MN9A 1XEZA 2W2PP 4DCPB 4RJVA 4GV6A 4I2FA 3L09A 3F53A 3BB5A 2BW7A 2G09A 2KZ3A 5KFTA 1J53A 3RJMB 1HQEA 3BV8A 1RT5A 5AM3A 2ZFHA 5H2FU 4YOTA 2CDRB 2PMZF 5J1EA 1RPLA 2XULA 2OYYA 3MCMA 3MM6B 1RTDA 2KO1A 1KTVA 2P51A 3TVKA 1K0TA 4AHUA 2AMCB 1RAAB 4JKFA 3G6YA 4CJQA 3OT9A 2IYGA 2XI3A 2KVQE 2UYTA 1QQMA 1C0UB 4IEEA 5J1NA 5LMNJ 4JAXA 1LFPA 5BR9A 2K4HA 3NBPB 4Z6DA 3HVAA 3LM2A 2HSZA 1O13A 1YVUA 4I2PB 5IQQA 4URSA 2C2ZB 4ED0A 5FP0A 3MEGB 4FZLA 4O3RA 2MMYA 5ALQA 4JI5F 3L0QA 4C0HA 4TKTA 1Q3VA 4GRSA 3QXGA 1MMDA 4Z4HA 3R6LB 3CD7A 1XS9D 4CLPA 3CPWM 1X60A 2G0JA 4ZVTB 2GNKA 1R7IA 2BCRA 3JQJA 3MCOA 1X9SA 4QZEA 4H4KA 4EELA 2P5VA 1XMQJ 3W9HA 1RSCA 4I1TA 4OFZA 1A6LA 4A59A 4OLBA 4U8VA 1RG6A 2OHFA 1RK8A 5KPTA 3CQYA 2AQ4A 5FPDA 4DV5K 5KG5A 4NV0A 4WIQA 1SS6A 3CE8A 1T4GA 4O0IA 2P9LB 1JI7A 2P6UA 2JFKA 4JI3K 4B1YB 3MI7X 2B9YA 2BM0A 2E1EA 7ICVA 3H0LB 4K0KJ 4CEOA 2AYMA 2XCPA 2K06A 2E5LK 3VQEA 2OMOA 3CCLN 2E9TA 5I9EB 3H4DA 2CQGA 1WSEA 3FFKB 4LFBF 3D4JA 2KOBA 1VRTA 2WONA 3UXOA 5ETQA 2KD1A 2LM4A 4KGKA 1X4GA 5DZ7A 1XQIA 3UKRB 4P72A 2W7PA 1HIWA 1F9FA 4J7CA 3CJ7A 4LSNA 3BQ0A 4ED8A 3CCVS 1CJTA 4CF5A 4B9NA 8ICMA 4GKJF 3EPIA 1Q95G 4ACOA 3UWTA 1RGIA 4CO1A 3UVJA 3KWMA 2ZM6F 3QT7A 3ZT1A 4I68A 1YJWS 9ICJA 2MB0B 1ATSA 1TKDA 3NGYA 1S59A 4DV1J 4LF7J 3QT5A 3PO5A 1C6VA 1VSIA 5ETVA 7ICSA 2EZZA 1S7HA 3EDQB 2RVJA 3CCJN 5DM7L 3QU9A 2QXFA 3OD2A 1VAZA 2AF6A 2HFSA 3MN5A 4JI8K 2D41A 3I33A 2ZHBA 1BXNA 2JEJA 3J80U 2CNLB 3EE3A 2E2NA 2HVHA 3LP2A 1OH6A 1D9AA 1WHYA 2PA8D 3E3XA 1BDGA 3BS7A 3P3DA 4WWSA 2OMLA 4CGGA 3VZHA 4A5AA 4ILHA 3OTBA 3GWCA 2ZM6K 1KOHA 3FVYA 1ULRA 4A4JA 3CCMS 2J8AA 5GAGI 8ICKA 4M7XA 4DXLA 2G8UA 1DOQA 1LWFB 1SC6A 3IMQJ 1FERA 2NRRA 1N5SA 2IA6A 3CTRA 4K41A 5CZVA 4RPYA 4HTLA 4DCOB 4M5JA 3I96A 5ETLA 4FJHA 4FZNA 2AZ3A 3R27A 3PJXA 4OX8A 2X6SA 4RKUC 1B43A 1X4BA 3QO9B 4E2FB 1WACA 3B0XA 2O67A 1T05B 2X7IA 4A47A 1HYVA 1N5XA 2FHKA 3MR7A 2DO4A 5EVZA 2CDQA 4EHTA 2DY9A 4ZVFA 1D9DA 1B0VA 1WYGA 3NS1A 3SEIA 4CLSA 5J2PA 3HOTA 4G9BA 2BOAA 4LFAJ 4K4SA 1TTHB 5F8MA 3G82A 5H1SQ 5GAEU 5M2UA 4BLGA 3Q8QB 2FJXA 1ZQXA 2XMTA 1QQ6A 3QJPA 5DO2A 1FVSA 3BR9A 1TKTB 2CAJA 4TUPA 3K2YA 4M94A 4A5BA 2H3EB 1QZ6A 1J5EJ 1X5OA 4WCEQ 2BDPA 4CGZA 3GDQA 2RNEA 4WF9Q 2E20A 3MZIA 8ICWA 2M3DA 4CO3A 4K43A 2CQ2A 3W5XA 2CJKA 1MW7A 3QZ8A 2YJFA 3OR2A 5CYQB 4CEZA 3B8HA 1CEZA 3KNAA 1VLBA 2BE2A 4CGHA 1XWLA 1OS5A 2G13A 3QEPA 3MXMA 2BM1A 2CRXA 2XS5A 3B0YA 5J2KA 3CJ2A 3JXUA 4JUZA 4KH0B 4NLRA 4X2BA 3T1YF 1X5TA 2R18A 5KQ8A 3T1YK 2XYHB 4PKDB 1ZQUA 3VHQA 2BV3A 3RUBL 2D74B 3HL8A 5ALIA 3MN9A 3LANA 5C7PA 1T6CA 4YNQA 1RA6A 4M9NA 3UN2A 3MFIA 4YDDB 4DLEA 5CA5A 3SI6A 3HO1A 2KNJA 3BP8A 1WSJA 3MHYA 2DTUA 2B4VA 3PEHA 3CJKA 4O5EA 4OL8A 4DFPA 1CJVB 2GW8A 3WQPA 1FFSB 4YDUA 4BBYA 2CG8A 4CJUA 4HDHA 5J0YA 1ZQQA 4CGIA 2YMMA 2VG5A 1IUJA 1YJRA 3H20A 2CQCA 4ZLJA 2KHDA 3UXNA 4CESA 5ALEA 4ZDNA 4RW7B 2UXBF 4N76A 5D4LA 9ICWA 4J2AA 2DRDA 3VEYA 1IKVB 1NU4A 1UEKA 2JNJA 1MA9B 4CGFA 4BR9A 3PIOL 4ES1A 4OI4A 4X66F 1S3XA 3LVVA 3PKYA 1LWEA 2CIMA 3CIZA 4QCLA 4KHNA 3ZSWA 1VS3A 2DY1A 2XLIA 5B0AA 4FSVA 3H5UA 2W11A 2Q43A 3OW2R 1HNXF 5KTQA 3EZWA 3MCNA 4TURA 1FNOA 4G3IA 4DFKA 3PNIA 3KD3A 3Q0AA 5BN9A 2P6SA 4PWUA 1YTYA 2VDHA 3A0BU 2OIHA 4ICLB 5JLFA 1CJUB 4US9A 3O4QA 4CJPA 3DYAA 4GMJB 3RBZA 2BEFA 2ZE2A 4NXNJ 3H2VE 2B56A 4QYRA 2F4VK 5HL7Q 3JPQA 5IFMA 2ZJ8A 3M6KA 2F65A 2IC3B 2XRIA 3MEGA 1BISA 4OD0A 3MN6A 1AYEA 5C2GA 1RYSA 2XB2D 2HGLA 3IRXB 4JI3J 4YN3B 3FBFA 3VEVA 1VJQA 2HSEB 2VBXA 4BRQA 4WQ4C 3C6HA 1QVFR 2NUUG 1JLCB 4N41A 2PZSA 2K3IA 2ZD1B 4NXMJ 1ZM2A 2MZ1A 4AF1A 1KDNA 4YMNA 4NLNA 2HQGA 4MIAA 3TJAA 1TK5A 3BS5A 1DBDA 2HHHK 3LALA 3CMES 2V4RA 3RW6A 3R3LA 1S0NA 3HHLD 2W24A 5AQIA 3RJGA 4RW8A 1Y5IB 5KT2A 1Y9OA 4QIEA 4CVNE 5J2IA 1Z00A 2R4FA 5CQGA 4OJ5A 3JPTA 4RZRA 3Q22A 4KO0B 3NOGA 4F3MA 3SUOA 1JK9B 2OELA 3AA3A 1GLCG 4ED6A 2YHBA 2DH7A 3WC2A 5HK4A 3FC4A 3M1VA 1JXEA 1BLUA 3NKYA 2E8NA 3AA8A 3OR1B 4QYZK 1VQ5S 1VBYA 3LDPA 3LDQA 5K8PA 2KJ8A 4IQXA 2A1JB 2WONB 1AA1B 1FKOA 5AQPA 4NRUA 5IV3A 4NXMK 2JC1A 3S1TA 1QQNA 1WC1A 5HHIA 2UXDF 1QHAA 5KFOA 3VQ7A 2W9BB 2KKZA 3IBFB 3SCXA 1ZBIA 3D2WA 2VG6B 3WKDA 3B4DA 2O8BB 4KTZA 4CFDA 3SMSA 3VQAA 2J9CA 2KJWA 4OHXA 3TFSA 4LT6A 2KV2A 4MDBA 3T1YJ 2JH7A 4FZMA 4O8KA 2HK3A 3THWB 3CFRA 2DFFA 2ZTDA 1ZQAA 1K6YA 1HNIA 3HJVA 4IG3B 4P2SA 1UWAA 1UPMB 3QIDA 1K9MO 3C66A 4DMNA 1WORA 5D49A 2GMLA 4CZLA 5BREA 1UAWA 3CP8A 1QSYA 3HKZF 1QE1A 3G8QA 2ZHOA 4AT1B 4IOCQ 7FD1A 1VLOA 4ZHRB 3LDLA 1QAYA 5J2MB 3Q83A 5HJYA 3NGUA 1M5SA 1A5WA 1HWLA 1APSA 2DT9A 3D7EO 4XA5A 5BPCA 5D15A 4B3RF 3TADC 2BCUA 2A41A 3F2DA 5CZ2A 3SQ2A 3CNQP 3CVKA 4FLZA 3M8RA 3ETOA 3T9NA 2GIFA 4CEBA 2E8PA 2BANB 4RPXA 1PBAA 4MLEA 1CXUA 4Z4FA 1V97A 4IH6A 1T9XA 3AVFA 1PK3A 4CEEA 3OL8A 1NH7A 3ISDA 3JSMB 3KJQB 4NCGA 3MEEA 5F8GA 3S8SA 2MA1A 1ZD4A 3IAM9 2HBQB 2EZXA 9ICMA 5B7WA 3KZIU 5FDLB 3LZIA 2QTWA 1LXNA 1NJZA 2ZIWA 4MDAA 4NLKA 3ZTSA 1EQ0A 3BBCA 1S5LU 5BYSA 2OEJA 4B3TJ 4HTUA 4C97A 2O8EB 1X3NA 3SPZA 4CZIA 1REVB 5E33A 2V8GA 2OEKA 2L9WA 2B51A 2BE7D 4Y2RA 3GILA 4C98A 4KLQA 3RRHA 3H5XA 2QA1A 4L74A 5HOOA 1M1HA 5HL7L 2ATQA 1S76D 4IWVA 1U2FA 3DDKA 1SQEA 4DKWA 2GQ2A 2WHOA 3NS5A 3CCUN 1HJRA 2HMXA 1UEUA 3Q23A 1K47A 3AGRA 3LAKA 4C8KA 2B5JA 5SUHA 5FPNA 2PO4A 3JSYA 2W8LA 4HKQA 4M0AA 9ICSA 1YZ6A 1U24A 4RNFA 2KSOB 1RDDA 3OPKA 2OP5A 3D2NA 4EK2A 4ELTA 4Y2MA 4USWA 4F7VA 1FA0A 4MFBA 1JLEA 3VEXA 5C2FA 3LUYA 4JYAJ 2CUYA 2KIVA 3Q8SB 5LXYA 2LDYA 3SQGB 1QQCA 2WUSA 1Q86O 2AJ2A 2PI4A 3M4XA 5HJXA 1J2VA 1VC6A 2EAPA 4F92B 2IIHA 3RRGA 3KKAC 3FMWA 5AQRA 4DHYA 1ZQLA 4QZVB 5BRFA 3M30A 2XSFA 3NCPA 3WK9A 4IRCA 4LFBJ 4LF6J 4OI3A 2MAXA 2QM1A 3KZBA 1TUUA 4LFBK 3KYLA 4EBEA 3GJSB 1NSPA 2J7KA 1HEKA 1XO1A 1MU2A 3WKEA 4JBCA 2CQIA 2VV5A 1HI0P 1VBXA 3VR1A 5ALNA 3O6QA 4HUFA 3NNAA 2E6LA 2ESEA 3W2WA 2VQFK 5CEHA 4RLEA 4LF4F 3BPSP 2I9GA 1VRQC 3MAQA 3QESA 5F9LA 1NGBA 4EAHD 2EK1A 3C2LA 2D69A 4ZPCA 3GYGA 2DGQA 5ALTA 4ZPTR 4WXWA 3K89A 4KGZB 2OEHA 1XHXA 1LWXA 3CC2S 1FESA 1F60B 8ICQA 3BF1A 2C3MA 1CJVA 4Y1CA 3EZOA 3BKFA 4C7ZA 5KFNA 2XNQA 1YITN 2RT3A 2HHSA 4PG7A 2VQEK 4PWDB 1FKPA 1GTEA 2C2EA 4GC6A 1FJEB 4JHDB 2E5JA 3R9LA 8ICYA 4ZVRB 4ZVGA 2O1PA 2MHNA 3K4GA 2OSQA 4ITSA 2M9NA 4WU3A 1SQKA 4IOXA 3QICA 4JI8F 2YKAA 5FPMA 2DPIA 5GINA 2A19A 4NA3A 3H98A 1JNRB 2ZH1A 2WVDA 1KL9A 3UMGA 3NG8A 1JKHB 1J5EF 3NASA 1YF5L 2P9EA 3GIKA 1HBNA 4RPFA 5J0SA 3HI9A 1C2PA 4FYVB 3TYTA 4NZ6A 3CI5A 4CLTA 2C1EB 2FE9A 5ADZA 3T79A 2A1SA 5B0DA 4H0YB 3H8SA 1BVSA 2RHFA 3PY8A 1S9GA 3QYPA 2YQEA 4P2HA 3NH0A 4CF9A 2XQCA 4P75A 2ZOGA 4DPWA 3BGLA 4A46A 2NXUA 4BGBA 1SKUB 4AYBD 1GAOA 1R8HA 7ICLA 1N5QA 3CCEN 3IDWA 2QI2A 4FS1A 2VFRA 3W5YA 2MLZA 3K1ZA 2E2QA 4LJXA 1R0AA 2EX3A 4QU6A 1BY9A 3G82B 3CF5L 2BRKA 1VGYA 4DPOA 4WFXA 2LEAA 4HH1A 3HSJA 4CO4A 1VC0A 5D3GB 5E0OA 1R89A 1HL6A 4NWBA 4FWPA 4RCHA 3DLGB 2YNIB 4OJ1A 4HTIA 2BKEA 1ZQJA 2QO3A 2HBJA 3V6DA 3PV8A 1IM6A 2XEXA 3NF8A 3J7Z5 1LOUA 3P31A 2GVDA 1SL1A 5KRSA 4UOFA 5AKYA 3TJ8A 1YHQN 4DSLA 1YRUA 5B0EA 4RPZA 2PEHA 2H3FA 3MOZA 3WXJA 3NWGA 4AL6A 1SWWA 4DG1A 4AM6A 3O3HA 1BGXT 4J9SA 2FPHX 3MWPA 1SIZA 2VFUA 3KK3B 3NL0A 3H8WA 3SCJE 3DM2B 1Q7YT 1HI1A 4MN4C 2AGPA 5A2QU 2UVUA 1K1SA 2LXUA 3DXSX 4FLYA 2CJBA 4IDHA 4BC2A 3M8ZA 1YKWA 4NXNF 2J6UA 5HO4A 4JI4F 1VIOA 3DGPA 4ZN3A 1PJ7A 3RH5A 2U2FA 2R9LA 3CERA 8AT1B 2DXFA 4ECYA 5GAGP 5L38A 1F6TA 3I56S 4X4QA 4PQUB 1OH5A 4XO0A 3DRRB 1HMVA 5IXUA 3QGPA 4KH1B 1FFWB 3NGRA 3W5ZA 1YI2S 3HXMA 4O44A 2Y8YA 5DM7Q 3A13A 4ERDA 1FFGB 5CXTA 4NLWA 3HFZB 3WX8A 2ILYA 4LF9F 3IP4B 5EU7A 5KFDA 3C2KA 4EGLA 5IV4A 3KG1A 4IEIA 3RYLA 4DBQA 1S0VA 4ECVA 4LR7A 1S4EA 1NK4A 2NLXA 4DPYA 3D6FB 1TK8A 3LDNA 2FDRA 4BE2A 1MN8A 9ICBA 4GKKF 1X40A 3S6JA 2KVCA 3NVVA 2VKZG 3VALA 3ZT3A 2L3MA 4HR2A 4BGAA 4X62F 2VG6A 2NNWA 2O8BA 2WSCC 4ID5B 5H1SV 3MUMP 1YVNA 1KKHA 2KKHA 4CZCA 3I6PA 3CD6S 2CWXA 3K1RB 2A2CA 3KJVB 3R1XA 4M45A 1QQ5A 4CZKA 2NYVA 3ZDDA 2VQFJ 2ZIVA 4UBBA 1HRHA 5KT7A 4IRKA 3MN7A 2V4JB 3I4HX 2FZGB 1Q46A 1VSMA 3PRDA 3PW7A 4X4TA 1KXPA 1SUQA 3BGFA 2KW4A 4V1Ak 3FEZA 3SIPB 4RW7A 3DLLL 1HYSA 4OX7A 4WXOA 1Q78A 1ZM4A 4DQSA 4F4AA 3PKMA 2ASMA 3EVMA 3OYLA 2Z56B 4PRFA 1PZNA 4USIA 5F3TA 4CFAA 4FK4A 5GAGU 3R2CJ 4LBHA 4U7CA 1D5AA 4WFBL 1FDAA 4BR2A 1C0TA 2GC8A 2VKQA 1AZSA 2V63A 4A8MP 4FF2A 1M5PC 3S6EA 3JSMA 3NNHA 3ITHB 2O3DA 4C0ZA 2ZOFA 5JS2A 3TWZA 2R7WA 1TKZA 2W3SA 4DUYJ 2A6OA 3B4MA 3IBCB 1IBMJ 1GMWD 5HMWA 4PEOA 3BJYA 3UVJB 4O23A 4C11A 4WFBQ 3GFZA 3ZYYX 2KT5A 2HFUA 1D8YA 4ED3A 1LEOA 4JV2A 3C16B 3FYHA 4CRXA 3ETLA 1CJTB 5F0WA 1VBZA 2GWKA 2J9EA 1KQSM 3B9JA 3PRBA 2YWWA 1RBVA 1RDCA 3HI0A 5AZJA 2BBEA 3CDEA 3HKZC 3M9NB 4DSFA 4IO8A 3JPPA 2CPHA 1U48A 3O3LA 2IY5B 3L7UA 1V3RA 2C2NA 3E51A 1XNSA 1ZM9A 4ZPBA 2L41A 1AB8A 2RHSB 2HLUA 1FRJA 1VHIA 5AKIA 4ECUA 4ISFA 5IWAJ 3ED5A 2V9KA 3TZWA 4YHHK 1TAMA 1LW0A 4F72A 2G08A 3JPRA 2A6MA 3CO9A 1FK9B 2P1JA 3NS7B 5HMZA 4DV7K 1Z1BA 4EO8A 3A3NB 4HYKA 4ATNA 4NXZA 1IBLK 1SAZA 4GMKA 5HBMB 1BHNA 4ZVQB 2V8DA 3N6NA 1L5UA 2RIJA 1EETB 2NO5A 4UARA 1TL7A 4C0BA 4X4RA 3CCMN 3R1LA 2QE5A 4UOCA 4FWNA 3JSRA 4TUQA 4QJFB 1XMOJ 2QARB 4ECWA 2NYIA 4RG8A 3KLHB 3C2MA 2XMMA 4OZLA 1YJNS 2WB4A 3QT6A 4FW1A 1B7FA 3HPHA 2EK6A 5KFLA 3PW5A 2YNHA 2IOFK 4DR1J 3D9BA 2MZTA 3OFFA 4DUTA 2KFZA 1ZTWA 1NG9A 4EZ6A 4N8OA 3KLIA 2PMZC 3BGOP 1VDHA 1WC5A 4M42A 2UU9K 4Y2PA 3FE1A 1TR0A 2VICA 2ISOA 1WC6A 3NMAA 3ICLA 2ATCB 1WUAA 3J7YP 2MQLA 1PAUB 2YHWA 5C42B 3K17A 9ICOA 1BU6O 4UOHA 2JRZA 1R3NA 1IBLJ 2VWBA 2XMAA 1QAJA 4F4KA 1F5BA 4RNHA 1KQKA 4LF8J 1WKJA 1AFIA 1NUEA 2GZOA 1VBKA 3D2SA 4NE9C 4DR7J 3GFYA 1RDWX 1Q8LA 4DN0A 3PHTA 2NXJA 3I55N 5AQFA 5L1LA 5AQSA 1KN5A 2CPFA 3UDLA 2AU0A 4HWIA 1C0FA 3V9WA 3D3BJ 2W03A 3U1LA 2CADA 5ALJA 2JRSA 5GAHP 4DR1K 5KG4A 3IV6A 3FR0A 3TX8A 5HMYA 4IUFA 4DZDA 3DMJB 5KT4A 1LQ9A 2FSKA 4QS8A 3H25A 1Q16B 2O5DA 2PE8A 3SMZA 4JKAA 1WG4A 2HSTA 1YJ9N 4OZJA 5AJ3F 2DO0A 2ZUCA 3VQPA 4MKYA 2ASYA 1F9HA 1XSLA 1WELA 3I1YA 3FEXB 1ZPWX 2HDOA 4ILMA 1M5OC 2H3VA 1ZQSA 3VQ5A 4HAIA 3IG8A 1UA0A 3QIPA 2QMXA 2BYCA 4HLBA 2Q1LA 4ZVEA 4X5VA 1O5JA 1JMTA 1RTDB 4Y2YA 4R66A 3H8YA 3LZJA 4F50A 5KG2A 2ZIXB 4RQNA 1GNKA 1L7PA 5ALMA 3RFAA 3IBWA 4B9SA 2DNNA 4Q0BA 4LF8K 2FHMA 3ZZ0A 4KB7A 3P39A 3CJSA 3CJRA 2LEBA 1OY8A 1HNVA 3GFKB 2FJAB 4IG3A 1PYTA 2IVOA 3FSIA 4MFAA 3QWUA 1UQVA 3CNHA 5AE2A 3ZSYA 3BREA 1NWKA 1MWYA 4I28A 4JI8J 2VOOA 1I51B 5I3UA 5EHHA 2LQBA 2KYXA 3NF6A 2NZ4A 4C8LA 4IO9Q 3QNWB 3MBYA 4ZA1A 1VLYA 3VERA 2X1BA 1EXNA 2W4CA 2EBGA 3OSPA 3THPA 1S6QA 1TFYA 3FNNA 2W4PA 2HZVA 3AMZA 2IDLA 3ZC4A 5KRTA 1XMBA 1S7IA 1NGFA 4Y2CA 3KD5E 4FOEA 3M7VA 4QZDA 2BJ8A 1Z4UA 2GO8A 3BUZB 1NHKL 4RW8B 2XS2A 4LBPA 2IPOB 2V2ZA 3X3UA 4G1QB 3ZTRA 3QU7A 2J6SA 2R7QA 4DSEA 4ZVUB 3TR5A 4UQGA 4CIFA 3KDOA 4E1NA 5J2QB 3CMEN 4NO7A 3H1VX 1I39A 1N36J 3IDHA 4B3SJ 1C1CA 4DR4F 3VA3A 4YFKA 2CJXB 1X4FA 3UKRA 2GOLA 1VYAA 4KYZA 4OHWA 4EFHA 3OS1A 2CPIA 2FZKB 3NCRA 1VISA 3IFRA 4OJ6A 2VQFF 2QSWA 1U47A 5AXMA 1X9JA 5FDLA 4FPRA 3VPZA 4JB3A 3EWAA 4FK0A 1XC9A 2KM8C 3AL0B 5IIJA 2YPYA 1Y5NB 1FKOB 4UZBA 2G06A 2NXEA 4DL7A 5JJBA 3OBYA 3NRWA 2D6FC 8ICXA 4O5KA 2YH1A 3D0IE 4U7UD 2E1AA 5AK3A 4I2QA 4W5TA 2GFFA 4WPAA 1TKTA 4LSNB 3T5LA 4ELVA 2BGGA 1N5TA 5BR8J 2GO9A 2UXCK 3ZSRA 3F2KA 4AHCA 4LF2A 3H2UB 3MK6A 2NPFA 3MECA 1GLEG 2RHKA 1FFVA 1H1VA 2PFPA 2H1YA 2PGCA 2CGJA 4Y2XA 3OBWA 3LAMA 3OHBA 4CLZA 5ALXA 1D8LA 3OTQA 1BHLA 9ICEA 1OYEA 2YQ1A 4LZGA 3K58A 2FLPA 4ICAA 1S9GB 1RABB 5D0RA 3ILLA 3OQ2A 5T7BA 3G6VA 3MEEB 5AK6A 4PG8A 4FP9A 4NI2A 5L39A 1ZQMA 3Q8UA 5CABA 1H6KX 3VGLA 3UIQA 1W26A 3J7AP 5K14B 4DU3A 1TQLA 3IWXA 2HHPA 2V2KA 2QGFB 3SYZA 2BQ3A 1EKRA 3JQKA 2WF5A 1RAIB 2XMJA 4DSJA 1TL1B 4J9RA 4YORA 2AJQA 3M1VB 5J2PB 2QWLA 1LK5A 5ALHA 1SXLA 3BY5A 2OO4A 5JS1A 4B3MF 4DZ6A 2GWJA 2KKPA 3J7ZT 1JLQB 3NF9A 3MEDB 1N63A 3NMUA 1QLNA 1WHWA 1IG6A 2E44A 2B0CA 4RBTA 4TU7A 3LGNA 1RHRB 3V6JA 2RJZA 2RPIA 3ZZRA 1H2UX 2GHVC 1TL1A 2QLFB 4DTSA 3ENVA 2B7BB 3R5CA 3EGZA 2MKIA 2E1CA 4PZNA 1U02A 1WF2A 1R43A 2VFTA 3WNHA 4ZTJA 1Q81O 1VQSA 2VFSA 1Z19A 3ICXA 1IXKA 1X9WA 1AUDA 1IO2A 4BVOA 3DLEB 2BH1A 1XUPO 2JDJA 4UAVA 1M1GA 4H0TB 5CZ1A 3LYSA 4PL1A 1T7PA 5JVGQ 4EU0A 2Y0SF 1X6JA 1DTQA 4LJMA 3IUCA 1FX4A 2FDNA 5KG0A 2POKA 3EVOA 1N56A 3DHXA 3AY0A 3KKFA 4W92B 2D3DA 4CJTA 4JEPA 3W60A 1NGGA 1TKXA 5DG8A 1IVZA 4ECSA 4F3QA 3AUOA 4PL7A 2ODGA 4PKHA 1U1QA 4K2XA 1WEYA 1EETA 2OPRB 3AA4A 2F4VF 2EKYA 3SV4A 8ICIA 1KC8T 4PA1A 1RCXB 2KL8A 1YX2A 3BN7A 2EFVA 3UCZP 3TI0A 3G6ES 4RTFD 4CECA 4US8A 1Q81T 2IM0A 3SXLA 1MLAA 3H7HB 5BN8A 1ZQ1C 1BPYA 3TQ1A 3F2BA 2WBRA 3J81U 3RMCA 3OXGA 4Z2XA 5F8IA 1Z1ZA 3V6DB 4DPXA 2JFDA 1RU1A 1AXQA 3NWRA 3DHWC 2RD5C 4QZIA 3VGSA 2O8DB 3QFUA 1JLCA 4I27A 3MMVA 4I67A 1JIHA 3L4QA 4KHYA 3CQ8A 1NCLA 3J7ZO 2F9TA 2E7VA 3LPYA 1ZA1B 3R6GB 1NM1A 2LKZA 2GBZA 4DFMA 1UCNA 5H9FK 1KQSR 3WK7A 3RJKA 5CHCB 3M6WA 1KKXA 3UR0A 1OH8A 2K8BB 4MT1A 2KHQA 4RQ8A 1DTQB 2BKNA 3WXLA 4M5DA 1IWAA 3TACB 4Q44A 2ZJPQ 1RFQA 1EP4A 3WIUA 1JLEB 2BXJA 4TN2A 2G8WA 1ZQCA 1VK3A 1E3MA 4KI6A 3M8SA 2CPRA 1X5SA 1RLCL 3NP5A 2FMSA 3DNCA 2VUGA 2MQNA 1EARA 1VJWA 4BDPA 2E5IA 4OZ2A 4XH4A 5AI9A 2AGOA 3NGTA 3W9JA 3FZFA 4MH8A 1N34K 3LP1A 4KRWA 3AT1B 5HN0A 2DGTA 2XS7A 4A2BA 3BS9A 2MQ8A 2Y0BB 3V6KA 2W7OA 4B3OA 1U7LA 2PA3A 1BIZA 4ILJA 3K57A 1I94F 3HHLA 1WNSA 1ZC6A 3QEXA 1HW8A 1N33K 5BPNA 4C11B 1F5AA 1O51A 2DD8S 3MAAA 1FO1A 4MAKA 5E2QA 3M8PA 5AHXA 4ETXA 5AR0A 3KLGB 3G71N 8ICLA 4WZQA 3G8TA 2YB4A 2KE7A 4DV5J 2GUPA 5IM0A 1NJYA 2DNQA 4Y2JA 4E7KA 1PC4A 5KFFA 2QMWA 2QWQA 1M1KT 3JXOA 5HP4A 1OPZA 2WB1D 3CC4S 4KHPK 3PNCA 3D6MB 1ZQGA 1DAXA 4O3PA 4PHTX 3IKMA 3GCXP 3T1HF 4ETZA 2D9PA 1GK8A 1BE4A 5J0OA 1F44A 3OVAA 4C1NI 4NM2A 3O4NA 2CPXA 2BPFA 2VDIA 5AXLA 2ZH8A 2R7XA 4LH5A 7ICTA 2LM1A 4KLJA 4MEYA 4O0NA 2VJUA 3AGKA 1QZ5A 3KD1E 2EAMA 3LPTA 3CJ5A 3HK2A 3S3MA 3GV8B 2XHWA 1Q82O 3K5LA 5L9XA 1S1VB 4B3SF 4L6V3 4F3OA 2RUGA 2ZNYA 4BUGA 4J2DA 4B3TF 5LXRA 5FIIA 1PJ5A 4WP9A 4ZHRA 2PSZA 1NSKL 3RBXA 3TUIC 4NA1A 2NRHA 3VQ4A 3PCOB 2UXDK 4C7YA 3H0MB 5GMDA 3M2UB 4OZ5A 1CPZA 3VQQA 1LW2B 2JR5A 4IYQA 4K7QA 4NLYA 5GTHU 3AO2A 1BCOA 3VGTA 4CEFA 1ZQYA 4HL9A 3H08A 3W8GA 2FC0A 5AQMA 4X4SA 1M90O 2HAFA 4FLWA 9ICPA 5ETPA 2JLGA 1NZPA 1KEJA 3UW1A 3ZT4A 1W2BR 2Z2ZA 2AQ0A 3C94A 1N36F 2QA2A 3GCWP 1ZQFA 1N36K 4OYMA 4AL5A 2F1HA 2NV3A 2WTUA 2G8IA 1RTHB 3QEIA 1NO8A 5LSOA 4PL8A 1Q9XA 3RJIA 5MLCQ 3MM5B 3MTJA 5AKZA 3IR5B 3AVNA 3MCAB 1WG8A 2R2RA 5CZXA 1W9HA 3CO0P 2FYXA 1NK0A 1ZA2B 4C1NK 4AE5A 2BA9A 5KFUA 4TU8A 4P4OA 1VQMS 1S22A 5LMUF 1EHWA 3H0PA 2Z30B 1IG9A 1R31A 4WQ4A 1V5VA 4I2JA 3NVMA 4F71A 2W42A 4UZCA 3S7RA 3MC1A 4OHYA 1NMDA 4FFDA 2ABYA 4OKEA 3IG1B 2AD9A 1ITPA 3F9KA 3GP9A 3SNNA 3O0FA 4MFBB 3Q24A 4DG1B 5A2QO 4KB1A 3ZLJA 4PUOB 4KH5A 5BYRA 5KGXA 4YG2A 3AB4B 5JMVA 2ZTCA 4DU1A 3HX0A 3Q8KA 1ATRA 4Y2UA 2HFVA 1X31C 1N32J 5FLXU 5BOLA 2X3GA 1DTTA 4IFVB 1NKEA 1RTJB 4GKJK 1HBNB 3HHLB 1NK9A 3CFPA 1B99A 2WAQD 1HUOA 5J0UA 3N4WA 2GS8A 2HQCA 4JV5F 2OD6A 3SBMA 4DQIA 3I31A 1AROP 3TZXA 3DDIA 1R6YA 3W62A 5IM0B 1RT1A 4CM0A 3S41A 2FHJD 1H72C 5AJ3J 4UY8O 1N62A 1LCUA 1VJ5A 1FIQA 4ZPVR 1U1MA 4Y2TA 2KVIA 2VA2A 2ZNZA 1MNEA 4JI4J 3WEEB 3V6HA 4UT4A 3D1OA 4I7FA 4OPHA 1UWBA 4UUWA 4U9RA 2HOFA 4F2RA 3OS2A 4H4OB 2YNGA 3TR8A 2XO7A 2QXLA 3RMBA 4LRCA 2JH1A 2DFHA 2D0PA 1B9DA 4FBUA 3BO4A 4TYAA 5G5HA 5JMNA 2HK2A 3K0JA 1XNRF 1NJIO 4FWLA 1I94J 2DHHA 1XNRK 4FWRA 2Q6CA 3HF5A 1JUDA 2F1JA 3DLBA 1ZRNA 1IKXB 5M1QA 4YDXA 3RBDA 4RW4B 4JV5J 1Y97A 5C42A 4PAAA 4CBUA 2HHUA 1LWEB 1E6YA 3AD7C 2AYEA 4K8ZA 3VCDA 2AHOB 1DK2A 1OY9A 5AT1B 4DUZJ 4JI7F 2HNYA 3BPDA 4L75A 3QINA 5AI5A 4BXOA 1W97L 3GB0A 2FVQA 3B6OA 4PXCA 3T69A 3VCBA 1SKRA 3H5YA 4NYNA 2M88A 5IT9Y 1TL4A 4HVZA 3A8EA 1D9FA 4DR1F 4CNQA 3ISZA 1RBTA 4WE1A 3QDKA 1S8OA 4E8UA 2P8IA 3HZ6A 2OPRA 4LMZA 2ITMA 1T9UA 1T9VA 4CLWA 3WXMB 3F5EA 2F1IA 4ZKAA 2FBVA 3NBPA 2GX8A 5B0GA 4DQ8A 4OZ3A 4FXDA 2LMIA 4ECZA 1V4TA 2PEBA 4F0KA 1R6VA 2EEYA 3Q2TC 4FOIA 4Y2IA 4QIVA 5J2EA 1P1LA 3EUNA 4CJSA 4B1UB 3KJFB 1CVJA 4O5FA 3UDCA 1NK5A 3VEOA 5AE1A 2YHXA 1NHUA 4ZCIA 4BC7A 1RQNA 3QETA 3ALRA 4F5PA 4IO1A 3MR2A 1YBUA 1P7DA 4P74A 3TUZC 5K8OA 1FI4A 1K9MT 4DUZK 6FD1A 3WU2U 4FF1A 3IR6B 2YTUA 3TO8A 7ICUA 4M3TA 1YUWA 5IIOA 5LOQA 4CJLA 4L8RB 5IC6B 3CG7A 2YNFA 4ZPAA 2KK0A 3R97A 2APOA 3KHLA 2WFAA 2BANA 3K5PA 5JLHA 3CXCM 1DGSA 4M5MA 2RS2A 3CIPA 5KAKA 3VEZA 2RILA 4ZN1A 3ULDA 3AAPA 2ZJPL 1SV5A 3O9RA 3C28A 5CYQA 3ONQA 3NRZA 1FJGF 3HKWA 5CH7B 4FO6A 1Z3EB 4Q45A 2FVPA 2G4BA 3SUPA 4ECTA 3UD5A 4BRGA 4JV1A 1ROFA 2HIQA 4NASA 3ZSOA 3C6UA 1YLXA 3BH7B 1Q0NA 5EDWA 1JLQA 1HW9A 1L8LA 2DNGA 2QLBB 1Q1KA 4I2BA 3IWLA 2C3UA 1HWJA 2GJ2A 3ULEA 4X62K 4Y3CA 5AI0A 1CJUA 2V94A 4KPYA 2EFGA 3FCWA 5CCMA 3O5TB 4QIWF 3T1AA 4CEDA 4YB1P 2CN1A 3U6FA 1U0HA 1ILYA 4ZLNA 1R8AA 1V9OA 1Z2ZA 4FJXA 2CVIA 4BJQA 2W3RA 1B70B 4LR9A 4RO0A 2KT3A 1U1NA 2ISPA 4UAZA 1P8GA 4BWJA 3DOMB 2CPJA 2V8HA 4FJ8A 2KMDA 3PJWA 1RTIA 2RF2B 5AQYA 4CTAB 3G10A 4HT7A 3CETA 1HKAA 3W61A 4O5BA 4M5GA 4CT9A 3E9OA 4MF2A 2HNZB 4YR3A 3HDSA 1N5VA 4KHPJ 4K25A 4P4MA 4C4RA 2ATLA 4G1PA 1T6DA 1GOBA 1YVFA 4IZ9A 2EFQA 4W5OA 1M5HA 5E84A 5CYMB 1NOMA 2OPSB 3T7ZA 4CGJA 3WIVA 2EFPA 1L7MA 4J9PA 3DRSA 2F9JA 4OVLA 2CJAA 2WVCA 1YAGA 3EEQA 2QLXA 4PG5A 3UE5A 2DISA 1T02A 2K8GA 5L46A 2B3TB 3DLRA 1BL3A 2D1KA 3KKAA 1RP5A 3DRSB 3RF9A 5ALWA 2KEYA 4M2YA 1C4AA 1U26A 2CYYA 2C2MB 1VR6A 4OIXA 1UKUA 2XHCA 3AFGA 1CXQA 4H8KA 3QUCA 3D2FB 5DDRC 1VK0A 4B1XB 4Q2MA 4NYZA 1EX8A 1WF1A 4DJBA 4U7UK 2DBBA 2C3OA 3AY9A 3CJ9A 1N32F 4M3WA 1FJ7A 3OYJA 2XI2A 2RMLA 4NEZA 4DV4J 3SUQA 2B9EA 2Y9HA 3B8AX 4ID1A 5B0CA 1TL3B 3PJ9A 2D4WA 2DNPA 1CLFA 3I0RA 2VG7B 1VHXA 4GXIA 2WHEA 3PX6A 3R9KA 4FZVA 4K4XA 3IGVA 4Q8FA 4Z7YA 2GGPA 4DV6J 4M3YA 1LVHA 1NSAA 2PFQA 2QA4G 1GLBG 8ICAA 3LGMA 3GE9A 5EX3A 1ZQVA 1C1AA 2ZBQA 4M63A 3OL7A 2YHYA 4BWMA 4RQ7A 2HHTA 3MR3A 2HGMA 1WF0A 2BX6A 5E7OB 2FY1A 3Q8VA 1GXTA 3FJ2A 1BC6A 3O3FA 3TAFA 3N28A 4BRPA 3ZFVA 3C5FA 2Z1GA 2DGSA 2FJWA 4HVJA 2RRBA 4X4VA 4E89A 2KFYA 4B1VA 2E5SA 2JX2A 3I76A 1KHWA 4CK3A 1G7CB 4JS4A 2F8LA 1GTHA 4B9QA 4QW8A 2PFNA 3PYDA 2WTFA 2GMJA 3SSSA 3FZKA 1GQEA 2LKYA 2GJIA 2MQMA 3TQEA 4CJFA 1S48A 2A18A 5D4NA 1Q4RA 2PFUA 1I6JA 2GA7A 1KCFA 4C4WA 4K4UA 1MROB 4NX9A 1UPPA 4CF4A 1SBRA 3PYFA 1T03A 3CEDA 3L2RA 4K4GA 4CDGA 3MUVP 4X65F 4YB7A 1SVDA 2XO6A 1PILA 1VSDA 1FJCA 2HOQA 2ZH4A 2AH5A 1W2IA 1NOYA 5CAAA 4P0QB 2QV6A 2R7RA 2ZEJA 4Y2QA 4C6AA 4FBTA 1BUPA 1HX1A 4BR7A 3A8JA 1TZ0A 2CJQA 1KQGB 2OSRA 2DQNB 3AJ1A 4U95A 2XWYA 2XSJB 2ZOMA 2Y9TA 4OV6A 2JH3A 1HARA 1O1WA 4GNIA 4H0PA 3VQ8A 2ASDA 1I3OB 4DTUA 2DEIA 5ETOA 1DFDA 4TQSA 4NXMF 2NPIA 1B0XA 2IVYA 3PIPL 1GMVA 3AVBA 2KZZA 1Q86T 5BYQA 4MIBA 4ZP7A 1FDBA 1VQ9N 2XTJP 2QC3A 5H9FJ 1W0HA 3SJHA 4ZIWA 2W1BA 1VQON 4X66K 1TP7A 2Z7JA 2VG5B 3PSIA 2DNHA 1RXOB 3T3FA 3C14A 1ZQOA 3K5OA 2IHR1 3CYMA 4BR5A 4DO9A 4OHZA 1RADB 4JV5K 2CQDA 1CZ9A 2KU7A 1DURA 4WYLA 1IJEB 3SEOA 4FE3A 2ZXIA 2F76X 3QJJA 4DR7F 1JKHA 1HNZF 5J2NB 1FWKA 1A5VA 3VC8A 2HRUA 3TABA 1EZZB 1TVRB 2W2MP 3M30B 2EWSA 1VQOS 1TE2A 2MZQA 3K7RA 2PMWA 3DXBA 9ICTA 1S5ZA 1WBDA 3ENWA 1VQ7N 2KIWA 3MDFA 4KFBA 4BRMA 5AK5A 1R0AB 1N6QB 1Y3KA 5DDYA 4JI1J 3RWUA 3QMQA 3N6MA 4I2AA 3JYTB 5KFBA 1TV9A 2HAIA 1OQ3A 3KLVA 2F3NA 5KNIA 4KLHA 3DN9A 2ZUGA 4CDIA 5K9FA 3JPOA 5LT5A 2UU9F 2L9NA 2MUTA 5AKLA 1QSSA 5FPEA 4F5NA 4A8EA 3SAHA 3JB9k 3HHNB 1JLGA 2XSJA 3R5BA 1QAXA 5D77A 3MDAA 2LQ8A 3BSCA 5MLCV 1UHUA 2E1PA 4M9JA 3O3GA 4MFCA 3WK8A 5I42A 1FNMA 2CFXA 4YUDA 4NRTA 4LFCJ 3JPSA 2YNGB 3E9PA 1PUZA 5BR8K 2KJ9A 2VPYB 4DR6F 2VANA 5KQDA 4LF7F 2NREA 3AOBA 3KLEA 4DTOA 3IG5A 4DR2J 3H8MA 4TXSA 1RBRA 1JLFA 3EN9A 2ZH2A 2JHDA 4JI6K 1SIWB 4IQTA 4PHEA 3CCTA 4JI6J 3U3YA 4WIIA 2FBYA 4PR6A 3CCRN 2DF4B 5CWRA 5KPRA 2K4EA 1Q79A 1Z26A 2Z1JA 2Z8QA 2F1FA 3HVTA 2QA4S 1B7YB 3AQEA 3HFVA 4LF4K 4I2DA 3KZXA 4J91A 4MKVA 1WAFA 1HBMA 1H74A 1EQMA 4KX5A 1ZXOA 1TYQA 1VRTB 7ICJA 2IAJB 3UDVA 3OYKA 3HZGA 4LIRA 4PQAA 3SV3A 1FDDA 3H8JA 4FYYB 4MMOA 1QHTA 4AQYJ 3EXYA 2GX9A 1FRHA 1Q9YA 4FJJA 4PPZA 4YQWA 5DJBA 4KHUA 1RACB 5AQGA 2E1FA 4V19X 1J2MA 4K0KF 4NLUA 8ICHA 3V9UA 2CGKA 4RT3A 9ATCB 1ZZFA 4IFEA 1MG7A 2GO7A 1YT3A 1BO5O 1UOCA 3THXB 2VCPA 3LP3A 2VKRA 2I7PA 4KN4A 1AW0A 1KLMB 1RXVA 5ALPA 5DQGA 3LOUA 3AB2B 1Q8IA 4BS2A 2AYBA 1FKAF 4ZP6A 1MDUB 5JUMA 3L5KA 3FK4A 3Q2SC 3VAJA 3OYDA 4USMA 2QL5B 1RWVB 4CJ3A 1HNXK 3NAHA 1Y3JA 4OJRA 1ZD2P 4BX9C 2R7YA 2BCSA 4GVBA 4C8ZA 4ED2A 5KFYA 9ICQA 5J2QA 2BJEA 1RWPB 1BMQB 2L08A 4FYWB 1QE1B 3PW0A 4CO0A 3LP2B 1RT3A 2NSBA 1L3UA 3CT9A 4OKJA 3ZDEA 4B9VA 2KH9A 2R7TA 5HLFB 5K4LA 4RT2A 2VA3A 1F3FA 4DL0C 1XTZA 2UUBK 1HHSA 1RKIA 2J7UA 1ASUA 3PSFA 2XIDA 2M8DB 1ZM3A 2VF3A 2P35A 3LK9A 1LV5A 4RQ2A 3C1YA 2KN4A 3LWMA 3M8QB 1WSGA 1HNWJ 2PAVA 3HYFA 2IDEA 5A6WA 5KFWA 3C29A 1TV6B 1UVKA 2J0WA 3ILJA 4CP5A 4Q7AA 1SJQA 3ULHA 3OVNA 4CBXA 3CCWA 1SL2A 4NM1A 1JCEA 4A8YA 3EX7B 4RQMA 4M41A 4CERA 2KRBA 1ZQRA 3FKBA 5BJRA 5CE3A 3CMAN 3ZZPA 5A0YB 5GAEP 1VQPS 2GTDA 1JCGA 2E4LA 2FJ6A 2Y3YA 1T3OA 3M9MB 3PACA 3AA5X 4U96A 4I6MB 2VL1A 1H7WA 3OYFA 1NDKA 3MURP 2GVZA 1ZBUA 3O5BA 2JEIA 3HHLC 4DUZF 1J5EK 2Y9UA 3D1HA 3VAHA 2HF3A 1IKWB 3HHEA 2IRYA 4F26A 3DU5A 4JK9A 2V0NA 1NZBA 5M1NA 1ZQIA 2G8FA 2L48A 1RXWA 4CLFA 2BJ3A 2Y0SC 4JI4K 5E5NA 2ZJ5A 1FWPA 2CQHA 4QWCA 1QAIA 1P9QC 2K3KA 2OFGX 1CQMA 2QL7B 1GLJO 2RDIA 5AI6A 3J81j 2Q97A 2YY6A 4M5LA 1RDAA 4DR5J 4NLTA 2NQPA 4XIUA 3RH6A 3SCKE 3SMVA 3DXKB 5AE3A 2DNKA 5A2QY 4BACA 4RNOA 2YX4A 2GV9A 4QBUA 1WC4A 5AQTA 2X6NA 3US5A 1XO0A 3OL9A 2R7SA 1FXRA 4DV5F 2O4GA 2PBDA 4RBUA 2MLXA 2R8KA 3M1FA 3GQCA 4H4KC 1S9EA 2VB6A 2VHGA 3TSUA 2IFXA 1N61A 5B66U 3LP1B 2DIVA 1P8ZA 3TAPA 2Q2RA 4BRKA 2IMWP 2FBXA 2ZF5O 3MMAB 4JOUA 4EHUA 3UR3C 5J0WA 5AI8A 1V6HA 4CYUA 4QIFA 3EPGA 3PYGA 3MCPA 1Q8KA 4W90B 5DDMA 1UMJA 2YKMA 4KV8A 3CXCR 5K14A 2A42A 4ZP9A 1GH8A 4IBNA 4DR4K 3C5GA 9ICAA 3GIIA 2WF7A 5LMUJ 2Z1HA 2W41A 1N48A 1LXJA 4YY3K 5LL6Z 5IIIA 3HBTA 3QBWA 2E8AA 4KLUA 1SJRA 2BQUA 2B6AA 4D3HA 4YXJA 1YDLA 4ED5A 5KFSA 1OPIA 4XPEA 3MAAB 4OLOA 3OYNA 3GL1A 3M5RA 4NLCA 3OLAA 3TOQA 3P49B 4B8CA 3EMTA 4OJGA 2FMQA 2VZ9A 1U49A 5CD4H 2YY3A 1G2EA 4CJRA 2EQYA 4N7TA 4I6YA 4HI1A 2VGMA 2M4MA 2F7TA 3H0RB 2RQCA 1SJ3P 4ZMMA 4LVSA 1U8SA 5H9EK 4QQBA 3EGVA 3VQCA 3NOCA 1VC5A 1ZBSA 2WOMA 4O4GA 2AT1B 2VPZB 3TZZA 5A6PA 4F4XA 5D8HB 4FN5A 3V1OA 1H73A 4ECXA 1VSJA 4LZDA 2HW3A 3LTOA 1X4A