3BDPA

Dna polymerase i/dna complex
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVRAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualizing DNA replication in a catalytically active Bacillus DNA polymerase crystal.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA (5'-D(*GP*CP*AP*TP*GP*AP*TP*GP*CP*2DT)-3')
total genus 201
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1997-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3bdpA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3bdpA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bdpA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3bdpA01
3NBPA 4CIEA 5KI6A 1NKCA 2FLNA 2YKNA 1D8YA 1Y97A 1RYSA 1RBRA 2F1JA 3OYLA 4KHSA 4FS1A 1LAVA 1ASVA 5EWGA 5CYQA 4ED2A 3GIIA 3DLGA 4NY8A 2G8WA 1S0NA 1TKTA 4DQPA 1W9HA 5FDLA 1L3UA 2PFOA 2HNZA 3OYDA 2C22A 1TL3A 9ICQA 4FJLA 1GOAA 3Q8LA 1BPYA 2QK9A 4J2AA 4KLUA 2YV0X 1MU2A 4Z6EA 3VQ8A 4I7FA 3LK9A 3DLBA 5J2QA 3O3HA 3ZSZA 1ITGA 4B9TA 5KFEA 3KJVA 2HHTA 5KFOA 4DFKA 5HBMA 4LSNA 5IILA 1F21A 3E2EA 4IG3A 2HB5A 3DOLA 3S3OA 4Z6FA 3QEVA 1YT3A 3JPRA 5KFCA 2UVWA 2DY4A 4R5PA 4EP4A 1WSHA 3B0YA 1T8EA 3QERA 2DPIA 1T4GA 3AO1A 3Q8KA 4EYHB 3CFOA 2BCQA 4DU1A 2VG7A 3ZT3A 3QIPA 1L3VA 8ICXA 3KIOA 4FLYA 2BGWA 5KG0A 4KHYA 1BIUA 2ZTEA 2IGIA 2H5XA 2GWSA 3V6DA 5J2EA 1T05A 4RNMA 4CJUA 3MDAA 3P5JA 2FPLA 4ED6A 7ICMA 2V4QA 3G6VA 1JLBA 4M9HA 1VSIA 2G8VA 3V6JA 3ZDCA 4FLZA 3IHQB 4MFCA 2WOMA 4RQ8A 2KTQA 3RMDA 4IFYA 5J0YA 4JV2A 2BGGA 3QO9A 3IM1A 3TR8A 3MABA 3AO4A 4Z6CA 5DG9A 3IG1A 4N56A 3N4MB 4DLGA 2XY8A 5KT2A 1JX4A 3NHGA 4DTUA 2NRZA 4GMJB 4BDYA 1ZQCA 5DG7A 2P5GA 9ICKA 5KGWA 1JXEA 1RPLA 1S0VA 2KFNA 4JV1A 3KK1A 8ICHA 4FLVA 1U9LA 4CEQA 3QNNA 3SQ2A 5KT3A 3GIMA 3TAPA 1ZBFA 5CP2A 3PMLA 9ICEA 2F8TA 1RTJA 8ICOA 3SQ1A 4J2BA 3PR5B 3LAKA 3UXOA 4J9PA 1WCLA 3PUFA 4Y1DA 1ZQSA 3DLHA 5KFZA 3RJJA 1JN3A 4CGGA 1KEJA 5J2HA 2IS3A 4QZFA 3RH6A 4K8XA 2R8IA 2FBXA 3HPGA 3L3UA 3AO3A 5D49A 2X6NA 3TI0A 4DSIA 3EYZA 1COOA 3TWHA 1WAJA 3C6UA 1HQEA 1SL2A 1C0MA 4KLDA 3WNEA 4LZGA 5HHIA 4MF8A 2HVIA 9ICJA 1ZQZA 4CEOA 4I2AA 3U3GA 4F4ZA 4RQ4A 3SUNA 1LWEA 2XGQA 1MQ2A 1QLNA 9ICTA 1C0UA 2W42A 1Z00B 3MDCA 2Z1IA 2VA8A 2I1QA 4GW6A 2Q3SA 1CZBA 8ICLA 4CGJA 3SCXA 4ED7A 1ZQIA 4LSLA 5JUMA 2JEGA 4DSJA 2W9MA 4B9LA 1A5VA 3MR6A 5CY4A 2VANA 5L1LA 1VRUA 5J0QA 3VQCA 8ICFA 5KFGA 3SQ0A 3P1GA 4HUFA 4E7HA 5J0XA 5KFDA 1JL1A 5KG5A 4KHQA 5KFPA 4AHUA 5IIOA 4AHVA 1G15A 1VSLA 4QWCA 1TKXA 4KLMA 3OHBA 1JLCA 3UQ0A 4KLHA 1O1WA 5HP1A 3SI6A 5J2AA 4ELVA 2I9GA 5IIIA 5KGXA 3RWUA 4O3NA 2VG6A 3ISBA 1RT4A 4FCYA 4UAWA 2BQRA 1BVSA 3I8DA 3F9KA 5KFYA 2OPQA 9ICNA 1S9FA 4F4WA 3GV7B 1YTAA 4UBCA 3V1OA 1QE1A 4DTSA 1BPZA 4B9VA 4IFVA 3FFIA 3ITHA 5DLFA 5J0TA 4RW9A 3DLRA 4G3IA 7ICVA 3T5HA 4FJNA 3OYGA 3SZ2A 2KZ3A 2D0AA 1ZJMA 4EP5A 4DL7A 4QZEA 8ICKA 5DBAA 1CXUA 4PA1A 3ULDA 5KT4A 2JEJA 1Z26A 2OYQA 4CHYA 2BHNA 4I2BA 1W0HA 3AA5X 5JS1A 4C8MA 1RT3A 4KLLA 3M8QA 3RR7A 1TK5A 3GV5B 1JLFA 3ASMA 3ISNC 4KLEA 4M41A 3KLHA 4B8AB 7ICNA 1VSEA 3VQ9A 2O4IA 1ASWA 4KLOA 5J0SA 4M3TA 4CJEA 1SZPA 5L9XA 2E6LA 4RNOA 2PFQA 4BWMA 4CEAA 3GIJA 1ZQFA 5JS2A 2XGPA 4UAYA 2BQUA 4B9NA 2GV9A 3QEWA 2P6RA 1EKEA 5FROA 4ELUA 2P6UA 5DG8A 4CEDA 3C21A 4N76A 1TL1A 1HUOA 4KI4A 1BCOA 4FLWA 4I2QA 5J2CA 3C95A 2J6SA 4PGXA 1ZQQA 4PGYA 4LZDA 4DU3A 1JXBA 1UOCA 4KB1A 3ISDA 1LW2A 3CFPA 4CJ3A 3CYMA 7ICFA 8ICPA 1MQ3A 1WN7A 5KG1A 5CHGA 2E4LA 3SI8A 5TZVA 4C8OA 1RBTA 1WCNA 1NK4A 4Z4CA 1PZNA 3KLEA 3NCIA 4ID5A 3KD5E 1BHLA 4IR9A 4M9NA 3AVLA 2ATQA 3PX0A 1NKEA 4O55A 1ZQOA 5KFIA 4ED1A 5CA7A 2F96A 2BPCA 3NGZA 2HHQA 4DL4A 1TAUA 3VQ4A 4KHWA 1UT5A 5KG2A 1VSKA 2MUTB 2XO7A 4R8UA 3Q8QB 2AQ4A 4O3SA 3ZSVA 1VRTA 4GXKA 4BACA 4CJFA 1Z3EB 5F9LA 5HROA 2LSNA 4Q44A 4CE9A 4O9MA 8ICIA 1Z25A 4ECSA 4RW8A 3ZSQA 3QLHA 4RQ1A 3C2LA 2FBYA 3LP1A 3DYAA 4FK0A 2MAXA 1QTMA 3V1QA 3MEEA 2AJQA 1WLJA 1VK0A 2NRVA 3L2UA 5KFAA 2UVVA 3IS9A 2KW4A 4RW4A 3RB3A 2MUTA 9ICIA 3T5LA 3OSNA 3ZCMA 3ORYA 4ECTA 3PX4A 1XHXA 5EOZA 1S76D 4JS5A 3QEBZ 3K59A 5J2JA 4Z4HA 3PX6A 1XSNA 3BDPA 4I29A 4DTOA 2ZTDA 3QETA 4ZTFA 4BXOA 4K4IA 4F91B 3H4DA 9ICFA 2IBKA 3KK3A 4EBEA 4F3OA 4XIUA 3S9HA 4KTQA 3AVIA 3K5NA 2IHNA 4F4XA 3L2VA 3RJFA 8ICAA 4CHPA 1D5AA 1X1PA 3G0ZA 4OLAA 3Q8PB 4P2HA 3A2FA 4AHRA 2G8IA 4UBBA 3U6FA 3RAQA 9ICUA 4I2FA 2ZQBA 1S1WA 3WNGA 3H4BA 3LP2A 1CUKA 3NH1A 3M8RA 9ICSA 4CF2A 3HO1A 2YNGA 3RTVA 5HLFA 2OZSA 3O4NA 1SKRA 1KSPA 5HRPA 1RDDA 3NFAA 1VSFA 2PY5A 4CFBA 5D4BA 4Q5VA 4PH5A 2FMPA 3KD1E 4ED8A 4K4HA 3MFIA 3LANA 2IA6A 1A5WA 1N56A 4CGHA 4TURA 1S9EA 4QZIA 1XI1A 4FO6A 5DBBA 3LWMA 4W5RA 2X74A 1HYZA 3SUQA 5DB9A 3EWAA 1HJPA 4FBUA 1NOZA 2ZJAA 1BPXA 1I3AA 4M2YA 3V7KA 4CJ4A 3HK2A 4IBNA 5EWFA 2ZUBA 3AVBA 4CHZA 5HRNA 4FJ8A 5DB6A 4DMNA 4QW8A 2FBVA 4E1MA 4DL5A 3AO5A 4H4OA 2JEFA 4YMNA 4UAZA 4KLTA 3AA3A 4JRQA 1BPEA 3H8SA 5KFTA 2DFEA 1ZQTA 4YR0A 4GXIA 3JSMA 4FZZA 4RT2A 7ICRA 2W9CB 8ICMA 4KFBA 4C8LA 3V9SA 4CJQA 1B9FA 2QKKA 4RUCA 4FJHA 1C6VA 3GILA 4Z0UA 2FPKA 3LDAA 3BQ2A 3HJFA 4E19A 4CF0A 2OA8A 4CJWA 3M8SA 2J6TA 1T03A 1CLQA 1BI4A 4JWMA 1KFDA 4M9JA 4DL3A 3ZDBA 5J2IA 1UAXA 3NF9A 4KKOA 2JGUA 4FJMA 4TUQA 3QE9Y 1ZQAA 3T1AA 5J0PA 4EBCA 5DQHA 4NLKA 4OGEA 4CESA 3QZ8A 1ZQRA 2ISPA 2FMQA 2X6SA 8ICJA 4GC6A 1U04A 4DSFA 3TABA 3SYZA 2VA3A 3L2QA 2A1JA 1RDBA 2OPRA 2HHUA 4UB2A 3MGHA 1Q9YA 3SV4A 1X9WA 2DFHA 4CECA 4Z4IA 1RTIA 4O5CA 5E41A 3SPZA 3NGDA 1HPZA 4E7LA 4Z4GA 4YMMA 5KFJA 4PPXA 1K6YA 4QZBA 4E7JA 3RJEA 3QEPA 2F1IA 1KFTA 3B6OA 3DRSA 4MFAA 5J2BA 1TVAA 2BKEA 2IMWP 7ICJA 4QZCA 2R8HA 2PFNA 1NJWA 3MFHA 5L1JA 3HVRA 4DTPA 1LB2B 1HUZA 3PMNA 1WAFA 3KLFA 4TUPA 2FBTA 1C1BA 3VQ5A 5KFXA 4YFKA 2A1JB 3C1YA 4JUZA 2XC9A 3HM9A 3RMCA 2F8SA 5CB1A 3ZT0A 4O3PA 2C28A 1QSSA 3PO5A 1WNSA 4N47A 3OYMA 3K5OA 4IRCA 3C23A 4Z4FA 4JK1A 4P4PA 2DFLA 3BQTA 5C25A 9ICOA 4QWDA 3NH0A 4CJKA 4FYDA 3B6PA 3KK2A 4I27A 1IKXA 3TARA 4KPYA 4AH9A 4YVZA 4UB1A 3SNNA 3THVA 4M3WA 4PGQA 2PYLA 3H40A 3V81A 4JLHA 1HNVA 3WNHA 4CGIA 1HYVA 4F92B 4FLUA 1RTDA 5J2PA 4P4OA 4OKJA 4OJRA 4YXJA 3RH5A 4NM2A 3AVGA 3JPOA 8ICZA 4M6WB 2PXIA 3GDXA 5KFVA 3JPQA 4UB3A 9ICHA 4OKEA 3NDKA 2WONA 1TV6A 1N6QA 4RPYA 1IKVA 1SUQA 1X9SA 3T19A 9ICAA 3RRHA 1KVAA 3OSPA 2KZMA 4I9LA 5HMMA 4TQRA 4EZ6A 3UPQA 4CF8A 1U49A 4YCXA 5DBCA 4RQ0A 4J9MA 1LV5A 1S6QA 4RQ2A 3HL8A 4AHSA 4IQTA 4F5OA 4FJGA 3VA0A 9ICMA 2IDOA 5DK5A 4I2CA 1B9DA 3UXPA 1ZBLA 4I2HA 2ITGA 4NXZA 1Q8IA 4MEXA 2AGPA 4QZGA 3B0XA 3CM6A 4Z4EA 1TKDA 3PV8A 4QWBA 5KFMA 5KFBA 5CJ7A 4IDKA 3MBYA 4ECVA 2BCSA 3ZSOA 1FKPA 5J29A 1QSLA 3LAMA 3L8BA 2BQ3A 9ICCA 3DOKA 4Z6DA 4M0AA 4KHUA 4YD1A 2RPIA 2XY6A 3DM2A 7ICKA 4CEEA 1DTTA 4DO9A 3D45A 4DTJA 1KCFA 3C6TA 4Q45A 1ZQVA 2ATLA 1X9MA 4CJSA 2BCVA 1KVCA 4PWDA 4RT3A 3SPYA 3AVNA 4PUOA 3OYKA 1ZQPA 2XCPA 1TV9A 3KKSA 4L8RB 1B92A 3VN5A 1B22A 4PQUA 1DOQA 3FYHA 5J0RA 1L3TA 1D8LA 4Q0BA 4C8NA 2D0CA 4R8UB 5CWRA 2R8KA 3ZT1A 3PW5A 2NRTA 2RF2A 4CERA 3V6HA 4KLGA 5KTQA 4NCAA 1B43A 4DU4A 5I3UA 4DOAA 3JPTA 3PW0A 1R0AA 2KN7A 3VQPA 3LALA 1QQCA 4KN4A 3MGIA 7ICHA 2R8JA 4F5RA 4W5QA 3C2KA 5C42A 1TAQA 2LYHA 3LP3A 3SJJA 3OYAA 4YXMA 2W9CA 2VWKA 4DQIA 3S3NA 4CHOA 3MR3A 2BDPA 3GFKB 1S77D 3OGUA 4Q8FA 2QKBA 3ZSRA 5HRSA 3AU6A 3JYTA 1WSGA 1U47A 1ZQXA 4UQGA 3NE6A 1WSEA 1C0TA 8ICTA 1HYSA 1BGXT 5J2FA 4KB0A 3VA3A 2HNDA 5KFKA 4NYFA 1BI4B 3MAQA 3OS2A 4R66A 3TANA 3MXMA 9ICRA 1TK0A 2ZE2A 4J9QA 4MFFA 5HP4A 1ZQLA 3OJUA 3MR2A 4CJLA 2O4GA 3ZSXA 3TAGA 2DPJA 9ICWA 2BANA 2Y1IA 4KAZA 1KDHA 3RJKA 4K4GA 4XRHA 7ICOA 3RJHA 2E6MA 3RB6A 4M47A 3HP9A 1AROP 4FK4A 2W8LA 1DGSA 1EETA 3GV8B 5HHHA 1S10A 2B4JA 2Z1HA 4BGDA 3L3VA 3T5KA 1A77A 1ZQGA 5DMRA 4CHNA 5DQGA 1KLMA 4H4MA 4FLXA 2A1RA 3ZD9A 4DTRA 1C1AA 3KLIA 3O4QA 1SKSA 4Y1CA 2G8FA 3C2MA 1JLEA 4GXJA 3OVNA 4O3QA 2EHGA 3T3FA 3DRRA 3HWTA 3G6XA 1K1QA 4MF2A 1EXNA 2YNIA 4B9MA 5C24A 3OYNA 2YKMA 4DQSA 4KTZA 2ASDA 5J2NA 3N97B 1NJYA 4B3OA 5KRTA 1VSMA 3TQ1A 4DFJA 4KHNA 5KT5A 4BDZA 3KHGA 4E7KA 1V9PA 4QCLA 4HCCA 4M3XA 3HXMA 1ZQEA 4KLIA 1EP4A 4ZTJA 1ZQNA 2IC3A 3MXJA 4MEYA 4RW7A 3RB0A 8ICGA 3RB4A 1MSWD 4J9NA 3KHLA 3RJGA 2EX3A 4RQ6A 3V9XA 1NK9A 5EWEA 1GOCA 4I9QA 3C94A 4HVJA 4J2EA 3ZDDA 1BPDA 3HW8A 2XCAA 1RBUA 3OHAA 4O3RA 4RPZA 1XHZA 1CXQA 4F2RA 4TQSA 1CEZA 3O3FA 5J2GA 4YD2A 4DLEA 3PR4A 4GLXA 4AILC 4JWNA 4J9LA 1KFSA 1NK8A 2BCRA 3CQ8A 2PZSA 3ZT2A 5CR0A 2UVUA 5D3GA 1X2IA 4CGFA 4YFUA 1EX4A 4OPJA 3V7JA 4J9SA 3QINA 4KV8A 1BQNA 4QZAA 3RBDA 4I2EA 5IIKA 2HNYA 4HCBA 1FXXA 1RDAA 4LY7A 1HQUA 3GQCA 2HHSA 2DFFA 4RG8A 5KFUA 4CEZA 1T3NA 4OPKA 2IHMA 1S6PA 2KFZA 4FZYA 4IR1A 3EZ5A 1WSIA 4YMOA 8ICEA 4TUSA 4NCBA 2P66A 3D0PA 1RTHA 2HHWA 1J9AA 4F5QA 5SWMA 3OY9A 2YHBA 4DSLA 3M9NB 4RZRA 2BPGA 3MEDA 3VQDA 3QEIA 4DS4A 2DTUA 4CJVA 4DL2A 4RU9A 4B9UA 4IG0A 4CK1A 4DTNA 1ZBHA 2C2EA 5KG4A 1REVA 2HMIA 2ASLA 5KFNA 2Z1JA 4BWJA 4DG1A 3V9ZA 1IKWA 4RW6A 2W9BA 2D0BA 1NJXA 7ICUA 1WSJA 3OYBA 1JLGA 4J2DA 4QZ8A 3L2RA 5BOLA 3SQ4A 1J54A 3V72A 3BJYA 1U48A 2P1JA 4DEZA 1UWBA 4Q43A 4P4MA 9ICBA 4CFDA 2RN2A 2XHBA 4C8KA 5KT7A 3BQ1A 4K8ZA 1CZ9A 3IAYA 3AVMA 3V9WA 7ICSA 4KTWA 5EU7A 1N5YA 2OWOA 2W8KA 1ZBUA 3AO2A 3CFRA 3V4IA 4RQ3A 3Q8MA 4DL6A 4F4YA 5BOMA 5J1EA 3AVKA 4KMUA 3BGRA 3U3YA 1RDCA 3OS1A 4KRFA 1MC8A 1QHTA 9ICPA 4RPXA 4X5VA 9ICVA 3AVCA 4M6WA 3I0SA 3VQ6A 4NLGA 4BXOB 1XC9A 4B08A 1DTQA 4J9RA 4XUSA 4QW9A 7ICEA 3OJSA 2JZBB 5DGBA 4I2JA 1C7YA 2OZMA 2BPFA 1D9DA 3EY1A 4O44A 4HHTA 1ZQKA 1RT7A 4WE1A 2G8UA 4M3RA 1HRHA 1ZQBA 1L3SA 2AU0A 3TAFA 1BL3A 3KLGA 3LZIA 4CJTA 3K2PA 4ED3A 4DQRA 1U45A 4FS2A 4CJ5A 5KFQA 2JZBA 4KI6A 5HMLA 3I0RA 4HTUA 4I2PA 1SL0A 8ICSA 3ZDAA 3PNCA 1XO1A 3QIOA 4Q8EA 3HVTA 2ZJ8A 4M3UA 8ICVA 4DFPA 2JEIA 5DDMA 3KTQA 1RILA 2KQ2A 3RAXA 2ASJA 4OGCA 3KKRA 1A76A 3K4GA 4FJJA 2IAJA 3H8JA 1VSDA 4M04A 3P83D 3PVXA 2JLEA 1RXVA 4KITB 8ICWA 2M9NA 3SV3A 4HUGA 4YR3A 1K1SA 3DMJA 3LPUA 3SUPA 4FXDA 4EBDA 4FZXC 5DQIA 1SKWA 4DTMA 4FW2A 1RBVA 1RT1A 4O0IA 3PW4A 3ZSYA 3M9MB 1FKOA 5KFSA 2YNFA 8ICNA 4ED0A 1YVUA 4FJKA 1NK0A 4FM2A 4CIGA 3LPTA 1ASUA 3C5FA 2GUIA 4KLFA 4CJRA 5J0WA 5J2KA 4IQWA 3NTUA 1IO2A 4QZDA 1S1UA 3OYCA 3S3MA 4E1NA 5F9NA 4IQVA 2ZUDA 5DDYA 1KLNA 4CHQA 3EPIA 1ZQMA 4CK3A 2Y1JA 4HUEA 1XWLA 1XU4A 3AVJA 5L1IA 1RCHA 4BE2A 2ZJ5A 1BCMA 1ZBIA 1ZQYA 2C2RA 1BISA 4KLQA 1VSJA 9ICXA 5T7BA 5HNKA 4DTXA 5FRNA 4O0JA 4ELTA 3OYIA 3H8WA 8ICUA 4PHDA 4JS4A 2FLLA 4CEBA 8ICCA 4PHEA 4YR2A 4W5TA 3PW2A 3E01A 4DOBA 1TKZA 1S5JA 4CIFA 2ISOA 1S0MA 3NGYA 2RDJA 3V1RA 3AVFA 2ETJA 4W5OA 1JLQA 3HYFA 5KT6A 4AHCA 4N41A 1SV5A 4OLBA 3OS0A 1U4BA 4EYIB 4MQ3A 3AV9A 3ETLA 3HX0A 2Q0ZX 5CZ1A 1BPBA 3ZD8A 5K14A 4IQUA 2B21A 4O5KA 7ICTA 2P5OA 4R64A 3RMBA 3K75D 4YNQA 1IM4A 5IIMA 2QXFA 3LWLA 4HYKA 1NOYA 1BQMA 3TFRA 1IXRA 1ZQDA 4DQQA 3AA4A 2C2DA 2B5JA 2YHAA 3KHHA 2VA2A 2IOCA 3K5LA 5HRRA 4XQ8A 1S97A 4FM1A 2FPMA 7ICQA 4RUAA 3LZJA 4O5EA 2ALZA 1S1XA 4QOZB 4JV0A 3PY8A 4CGDA 4PHPA 2AGOA 1LW0A 1ZYQA 4E7IA 1IKYA 1NK7A 4YQWA 4O3OA 5BPCA 3K5MA 5KFLA 4F5PA 2BR0A 3DRPA 3L2WA 4BE1A 3H08A 3JPPA 1YTUA 4FLTA 3UQ2A 4FBTA 3H7IA 3C1ZA 1NK6A 3GIKA 2NRWA 4RQ5A 4F3TA 5DGAA 3RBEA 4ECYA 4G1QA 1RBSA 5KG3A 5SZTA 4ID1A 3QZ7A 4NLNA 3AUOA 1BIZA 1S1TA 3VQAA 4GC7A 2G8KA 2WTFA 3ISCA 2P51A 2G8HA 1S0OA 3UXNA 1JXLA 2B6AA 3AU2A 4KN7A 3EPGA 5KG6A 4IRKA 5I42A 3QEAZ 2R7YA 4ZHRA 1S9GA 2V9WA 4YP3A 3V9UA 1NK5A 1HNIA 1NJZA 4NYNA 2HHXA 3RMAA 1C1CA 3FDSA 3UIQA 2HVHA 4BDPA 3BQ0A 5KG7A 1TFRA 4EEYA 4FJ9A 1HJRA 4LD0A 2HHVA 4LH5A 5DB7A 5J0OA 3K57A 4LH4A 2XY5A 1UA1A 1N48A 1RZTA 1KVBA 2VWJA 3VQQA 4DFMA 4QZ9A 4E0DA 3OYFA 1TK8A 8ICRA 1L5UA 5KFWA 1LWFA 2NUBA 1DLOA 1NOMA 5L1KA 1LWCA 4M3ZA 3PO4A 2D5RA 4IKFA 3OYJA 4DSKA 4KLJA 3KHRA 3T5JA 3CM5A 4NLZA 2OPPA 1Y88A 3RJIA 4J9KA 1RT2A 4QWAA 3VQBA 1IG9A 3DI6A 3NAEA 1RXWA 5D46A 5KRSA 4R63A 1UT8A 1SL1A 4FVMA 5KFHA 4FK2A 4FW1A 3RH4A 2YNHA 3M8PA 2A1SA 2HW3A 2F1HA 4LVSA 2UVRA 4F50A 7ICPA 1XSLA 1UA0A 4YG2A 8ICQA 1TGOA 2ZUCA 1RYRA 1HMVA 1EXQA 1T7PA 2W9AA 3QEXA 2RKIA 4QZHA 4DF4A 5J2MA 5DKWA 3DLEA 2AGQA 5CYMA 1J5OA 4KO0A 3V7LA 3NF7A 4I2IA 2W9BB 4DS5A 5J2DA 2X78A 7ICLA 1ZQJA 4CF1A 3G10A 7ICGA 3NF6A 5IIJA 3TAEA 3MR5A 3MECA 4FM0A 3JPNA 3NF8A 5FRMA 1ZETA 3IRXA 4AHTA 3HPHA 1I39A 4O5BA 4M42A 1ZQUA 1XSPA 4UB4A 3TAQA 4DWIA 4FJ7A 2ZTCA 4CF9A 4FJIA 2XRIA 4QWEA 1JIHA 3AA2A 3DLKA 7ICIA 3OYEA 9ICGA 1JL2A 4ECRA 4EZ9A 4W5NA 4BE0A 4F2SA 2PYJA 2NRXA 3Q8SB 4ICLA 1LAWA 4MFBA 1A5XA 4KREA 1FK9A 4H8KA 4M45A 1RNHA 1JMSA 3JPSA 3MEGA 3V6KA 4M9LA 1GOBA 5KFRA 2FLPA 1Q9XA 4I28A 4N5SA 3EW9A 2GBZA 4ZH4A 1RT5A 2OPSA 3RRGA 3VQEA 3HT3A 4CJPA 2RDIA 3TFSA 1QS4A 1RT6A 3MXIA 2BCUA 3AVAA 1WSFA 3WNFA 3PW7A 4F4KA 4F93B 3O3GA 4TSXA 3ZDEA 4M3YA 3SUOA 3RR8A 4M9GA 9ICLA 1XS9D 1TVRA 2J6UA 2PI5A 4O4GA 4PY5A 4FJXA 3NH2A 4CFAA 2R8GA 4CK2A 1KRPA 4NCGA 1Z00A 3F73A 4F5NA 3VQ7A 4E89A 3G6YA 1QSYA 4ECUA 4RNNA 3HP6A 3LP0A 3HSTB 5IINA 5KFFA 3AVHA 1NKBA 4CEFA 3ALYA 4ECWA 3CG7A 2I5JA 4XA5A 2VG5A 4E3SA 1JKHA 1ZJNA 4I2GA 3QNOA 1J53A 4R65A 4ECZA 2PFPA 4B8CA 4PHAA 3ZSWA 4JRPA 4GVMA 5DLGA 2ZD1A 1IH7A 3LDSA 1ZQHA 2PI4A 5C5JA 4OVLA 4IRDA 3TAMA 4YN4A 5J0UA 2XY7A 4OKKA 2FMSA 4ECQA 2FC0A 4B9SA 2Z1GA 4I2DA 3C5GA 2AQ0A 3Q8RB 4DSEA 1S1VA 4ECXA 2V4RA 3K58A 4CCHA 1H38A 1D9FA 5CZ2A 1ZQWA 2KZZA 4UB5A 3NGIA 2BE2A 4QAGA 4F8RA 1VSHA 4NM1A 1JLAA 5DB8A 4FJ5A 4KLSA 1KTQA 3HPOA 4DOCA 3ZT4A 3OYHA 4RQ7A 8ICBA 3M9OB 4J9OA 4DF8A 4CFCA 3QESA 8ICYA
chains in the Genus database with same CATH superfamily
2ODGA 1EHWA 1D8YA 2MEWA 1Y97A 2BKOA 3CMES 3N28A 4P2MA 1S1VB 4CT9A 1DRZA 4B17A 4CBWA 2O3DA 3RBXA 1FNMA 2HLTA 2NREA 4X66K 1LAVA 1ASVA 2F4VK 1RWKB 2M9KA 1S5ZA 4NXNJ 3P5TL 1X4EA 3BO3A 1C1CB 3ENQA 4KBIA 5LMUK 3QUQA 3TX0A 2O66A 3EKUA 1TKZB 2MKYA 3MGJA 4MKBA 3OYDA 1PGZA 1TL3A 4R5PB 3I4PA 3ZZRA 4OHWA 2MY8A 2RVJA 2E66A 4OZ0A 1N60A 2GO7A 1S7IA 4J2AA 3IO1A 2V5HG 2HURA 4W90B 2DWQA 1MU2A 3PKYA 1OPIA 2PMWA 3NG8A 5J2QA 2G08A 4XPEA 1VQNS 4FSVA 3ZSZA 3L9ZA 3R3TA 3RGIA 2JDJA 1TYQA 4H03B 2OI2A 3KJVA 5AKEA 5GAGP 5KFOA 2L41A 5HBMA 1F60B 2VPZB 3A8JA 4LSNA 4DV2K 1F21A 1J2MA 1YT3A 2EBEA 2KICA 2F3JA 2KXHA 4EP4A 4OIXA 2N7YA 3B0YA 2IDEA 4C23A 3RYLA 3QERA 3Q8KA 1U0HA 4QR0A 3CFOA 3WK6A 2B5JB 1WBDA 2J9EA 4UOCA 5ETRA 1FDAA 3QO9B 4MTPA 4FLYA 2FE9A 2ZG6A 3TKAA 1SKUB 2GO8A 2AMCB 5J2EA 3JTNA 1T9YA 4C1NI 4CJUA 3E3XA 2CVEA 2A3JA 4I67A 4ZP7A 4DUTA 3V6JA 2VYPA 4FLZA 4OJ3A 2WOMA 1QVGM 2X7IA 4RQ8A 3CHWA 4KHPK 2MQ8A 4IFYA 4ZKAA 3PIPQ 3WX8A 1K73T 5HQMA 2DYAA 3O9SA 4CLKA 3MABA 2WVEA 4Z6CA 1R31A 1VRTB 4PXBA 2L9NA 2XLIA 4IOAL 2H3FA 2JHDA 3X1LB 2C2OB 3ENVA 4IOXA 2ZJRL 4BDYA 3LGNA 1Q79A 2QA4S 4CZHA 5DG7A 2OO4A 4P0QA 1RXOB 1V97A 2A0FB 2NUHA 1FF2A 3VGMA 1ZAWA 2LDYA 3MM6B 4GVBB 1MN7A 1NZAA 1HQEB 3CF5L 1FK9B 1ZBFA 4K42A 3OTDA 3PMLA 3MEGB 2F8TA 1YDLA 8ICOA 3SQ1A 2QWQA 3IXQA 3IG1B 3KWIA 3PUFA 1XTZA 2KMDA 4IH5A 3DLHA 4JK8A 1TL7A 1JN3A 1LK7A 5J2HA 3EX7B 4K8XA 5F0UA 1NHKL 3HPGA 4M94A 4YDUA 3VMFB 4NI2A 2VZ9A 4GKKF 4JN4A 4OHXA 1SVDA 2E9RX 1WAJA 1LKYA 3IFRA 3GIRA 2O8BB 3V5RA 2ZXHA 2JLFA 4YUDA 3SUNA 3EE9A 1U8WA 3AGRA 2P9LB 3B8HA 2W42A 1SXDA 2V68A 3O9TA 2I1QA 4KY3A 3CETA 4Y2VA 3J80Y 1CZBA 2Q3SA 4GW6A 2PMZD 1RT1B 8ICLA 3SCXA 1S79A 3TYTA 2YKQA 2M4MA 3LOUA 1M5SA 4B9QA 4HH1A 2KB2A 2W9MA 4G1PA 2LYVA 4KO0B 5GAHU 2ZVSA 3MCSA 3HHLB 5L1LA 4H4KA 2WF6A 2YN4A 3MCPA 3DGPB 8ICFA 5AI5A 3P1GA 4GFJA 4A48A 1U6BA 1ED1A 1FO4A 4AHUA 5IIOA 2I7NA 2GGPA 1G15A 1VSLA 1XERA 3IRUA 1UZDA 3CXCM 5HMXA 3QBXA 4YHHJ 3UN3A 1O1WA 2LQ9A 1B0VA 5HP1A 3SI6A 5J2AA 3VCBA 2CGKA 3QMQA 4ZPBA 4FNIA 1YZ7A 2QLWA 2KG0A 4FCYA 3VGVA 5EXWA 2AYEA 3BSAA 1RM6C 1KAZA 3HZEA 4JV5F 3DLJA 2JV3A 5GTHU 5EX5A 1BE4A 1K47A 3ZNJ1 5JJBA 2WUSA 4OX8A 1W97L 1S9FA 3LO3A 4ZIVA 3PFEA 3GV7B 4UBCA 4DUZF 1YTAA 2NXJA 1QE1A 1BA1A 4ZVPB 1S4FA 2N1RA 1WEXA 2DGSA 3TEGA 4LR8A 5J0TA 3K0SA 3DLRA 3DU6A 4NZ6A 1T44A 3SZ2A 1Q86T 2KZ3A 5D4PA 4CD3A 3GONA 1UTAA 2DEJA 4NWBA 4PRFA 1Z26A 3HHDA 2OYQA 3THWA 4JKGA 2KT5A 1V3RA 1WNEA 3NVWA 3HSZA 4OPHA 1RT3A 3TACB 2JFDA 1WORA 4DV6F 5E0OA 3DXKA 4CIOA 2EG2A 4LSZB 3GV5B 2Q66A 2FF6A 2O8EB 1VK8A 2F8KA 7ICNA 2AZ1A 1VSEA 3A5LC 2P9KA 2GIQA 1R0CB 1D9AA 3CC2N 2QSWA 2DNOA 2ZWOA 2E6LA 3HD2A 1FFUA 3Q22A 1ZQFA 2XVTA 4MN4C 2VJVA 5FROA 4LF8F 1XC3A 3RU0A 1HUOA 4FLWA 3BDEA 3H0RB 3WC0A 3C95A 2VL1A 2RRBA 2RQ5A 1SJRA 1X6JA 2J6SA 4PGXA 3O4WA 2IBOA 3L7OA 4BRIA 4NLUA 5JVHL 3GL1A 1UOCA 3IN5A 3F2DA 1EKSA 3HKZD 4WYLA 2MSTA 4JI1J 3H59A 1PYSB 7ICFA 1IR1A 1YX2A 3CCRS 1WN7A 3AM9A 1QAIA 4XDDA 1XBWA 4C8OA 4Y2CA 1GT8A 3GJTB 1FTCA 1V5IB 4DUZJ 3KLEA 4ID5A 3NGTA 2P6SA 2AD9A 1TMMA 4EO6A 1U8SA 1NKEA 1MDUB 4IH7A 3FVYA 2HHHK 3QFWA 3WXJA 4ITSA 2HHQA 3ZI4A 3VQ4A 5KG2A 3K5PA 2MUTB 4IH6A 1BOTO 3H20A 2QLXA 3VF6A 2EBGA 4IJAA 1EZZB 3FCWA 4K0KF 1KXPA 4IYQA 3WC2A 2FXUA 1VRTA 2MDAA 2ZM6J 1KD1O 3ED5A 4PQAA 5F0WA 1G3OA 4ECSA 1XMBA 4CO4A 1WWUA 1NG9A 3QLHA 4RQ1A 2HWTA 2ACYA 3LP1A 1S22A 5ALVA 1RHMB 2MAXA 4NLCA 3V1QA 4UY8O 5KAIU 3C6AA 4CLUA 1S12A 5D4LA 1G7CB 3RB3A 4RNFA 5AKLA 2QA4G 3PX4A 3HZGA 4ZLJA 1VQ7S 3N9UC 5LXYA 3AJ2A 4LUBA 3WKCA 5J2JA 4Z4HA 4I29A 3D2NA 3C6HA 1YJ9N 5K5MA 2VPWB 9ICFA 2YBVA 3DRYA 2E1RA 1HMVB 5AR0A 4KTQA 1N32K 3FKBA 1VBKA 5J2MB 4XAKA 3WKDA 4E8UA 1D5AA 2KD1A 3Q8PB 3SCKE 5ALUA 2G8IA 4X84A 3VR1A 3GE9A 9ICUA 3UCZP 5KL1B 4B3SJ 1M0SA 1S1WA 1SI9A 1X5OA 3AEVA 1PUZA 2E5IA 3HO1A 2UYTA 5HLFA 2OZSA 3W66A 4LR9A 1VLOA 2DH9A 4OV1A 1URJA 1N8RT 3IRXB 1KSPA 2P9UA 4O3MA 3W1YC 2C3YA 3TTCA 2FZKB 2Z57B 4IOCL 3V6DB 2A3ZA 2IVOA 5D4BA 4Q5VA 4HWIA 3FBEA 4ED8A 2GS8A 4K4HA 4WP9A 1A5WA 1N56A 2V0NA 5C24B 1KNZA 4HAIA 1XI1A 2MLXA 4FO6A 3LWMA 4WU2A 3QUCA 2DXEA 4JAXA 4W5RA 1WHYA 5CABA 1SJQA 4QBUA 4FBUA 2W2PP 3BBCA 1DQ9A 4P7VA 1I3AA 3A4TA 2H3GX 3VOVA 3VV2B 4CJ4A 1RP5A 1MA7A 3EJMA 2QWOA 1BA0A 4BR4A 5DB6A 4DMNA 1NSKL 2KOBA 4QW8A 4QQBA 3VHQA 2BE9B 2Z0GA 3MM7A 4H4OA 3AA3A 1RT4B 2XSJA 5KFTA 2WB4A 1EO1A 3U8XA 4GXIA 1S9EB 4KFBA 3TADA 4CJQA 4RQNA 2XZTB 1MWYA 5IS2A 4Z0UA 3MMVA 3BQ2A 4EMDA 4E19A 1PJ5A 3G87A 2GVZB 2OA8A 2VFSA 1Z4NA 2WF8A 4JKCA 1QVFR 1BI4A 3HI0A 2QB1A 2PDAA 4DL3A 1UAXA 3M1VB 1BHNA 3CCTA 3RG6A 1U7LA 4TUQA 4EGLA 4C9DA 5J0PA 4JKGB 4GNIA 4PG7A 4DR3J 4ZVHA 2K3KA 2KP7A 3DRSB 4OZLA 3PYEA 2ZHBA 1ZQRA 2ISPA 4RNHA 2X6SA 3PKMA 1JLFB 3H45C 4DSFA 4EX7A 3TABA 2VA3A 4ZCIA 2NZ4A 3U1NA 2DF4B 2OPRA 1RDBA 3R7NB 1HI0P 1HBUB 1Q53A 2LDIA 3VQSA 1PAEX 3FCHA 4X4OA 1Q9YA 1W2BM 2V94A 1U1PA 4P74A 2E7WA 4CI0B 4CECA 3D1OA 4O5CA 1Q8BA 3SPZA 1HPZA 2HEKA 5KFJA 1VQLN 1K6YA 4QZBA 1YG0A 3MX2A 3QEPA 4Y2TA 2F1IA 7ICJA 2PFNA 2AJ0A 3MFHA 5L1JA 2X1GA 2PD1A 4DTPA 1PBAA 3ZTRA 2PEBA 1VQMS 1V38A 1T6DA 4BY9C 1C1BA 1LNQA 4YFKA 2A1JB 1N33J 3C1YA 2XC9A 2L5YA 1IKWB 2HGMA 3ZT0A 4O3PA 1KHVA 3Q8UA 2C28A 1QQ6A 1WNSA 2CDRB 4NLYA 2ZKTA 4P71A 1EQMA 3K5OA 3HHLC 2BDUA 4TY8B 2CYYA 4BG9A 4YY3K 1XN9A 2OFGX 3LH2S 1WC3A 5HP1B 4N8NA 3CF5Q 4Z4FA 1GMWA 3Q2TC 5AQMA 1S1XB 3PJ9A 5C25A 2QLBB 2DGZA 3Q89A 2YHYA 5L8RC 4KH4A 1L7MA 4PXEA 3KK2A 3Q0AA 3TARA 4KPYA 4AH9A 4ZPVR 1WACA 2DUYA 2YTCA 2G0JA 2Z2ZA 3WXIA 2W54A 1E6VB 1P1LA 1KN5A 1FFVA 3H40A 1XMOJ 2ROGA 4OD0A 1RGVA 3HRDD 4OKJA 4OJRA 3A0IX 2HGNA 4CF4A 4J9UE 3JPOA 5GAGU 4ZVGA 4CLSA 4M6WB 1HR0F 4UOHA 2PXIA 4LQ3A 2DGQA 1EKRA 3DXKB 4J8FA 5G0RA 2AF6A 1TV6A 1URNA 3JAMU 4WTYA 2JZ5A 5IWAF 2GV1A 3OSPA 1RT7B 4PEOA 4WE1B 3VZIA 2P9EA 4FWPA 5J2PB 1XUPO 2KDOA 3SLCA 1U49A 4BC9A 1P6TA 4J9MA 5DZ7A 4ZVQB 4F3MA 3HL8A 3KLGB 4AHSA 2UXBK 4PZOA 3ETOA 3VA0A 2GUPA 5A8KB 3T6JA 3K89A 2CNKB 4DDFA 5DK5A 1QAXA 1B9DA 2DNPA 3UXPA 1ZBLA 5BR8J 2CGLA 2DIUA 1R89A 1Q8IA 1N5QA 4FYXB 4OJPA 4QZGA 3TU5A 4FPBA 4F26A 4JV5K 5KFMA 1VBZA 4ECVA 1I51B 2ASMA 4QIGA 2HRUA 2HS3A 3I5BA 3P8BB 1HL6A 1HKBA 3CTRA 2CDQA 2CQ4A 4IQXA 3DOKA 3IWLA 3T1YF 2R7SA 1FRJA 3GFHA 2APOA 1RU2A 2AV5A 3DM2A 2OUGA 2RF2B 4CEEA 3MCAB 1B0XA 4KRWA 3D45A 4OV6A 1KCFA 3L4PA 4TN2A 1ZQVA 1X9MA 3BYRA 4CJSA 2K89A 3UPFA 1KVCA 3TOQA 3SPYA 3AVNA 3AODA 3F0NA 2B8QA 2HWHA 3IP0A 2XCPA 3TTDA 5F3TA 1TV9A 2EDUA 4LIWA 1ZC6A 1Q1KA 2VU5A 3FBBA 4RKUC 3WQTA 3QU9A 1WOSA 2OTLN 2EC0A 2DNYA 1D8LA 4I6WA 4R8UB 2PA8D 2J4RA 3IR5B 2H4WB 5HAOA 4X65K 3C8YA 1JMTA 5KTQA 1RB0A 4NCAA 4DU4A 2EXUA 1LXJA 1N5SA 4Y6IA 3VQPA 1L7PA 1QJHA 4KN4A 3MGIA 2D0PA 7ICHA 2R8JA 3CJ3A 4W5QA 2VHGA 5C42A 3FR0A 1TAQA 4JI8J 4YXMA 2KIWA 1Q0NA 5JU5A 4O8UA 1FE4A 3I33A 2G0CA 2KKPA 3OGUA 1DXSA 3AU6A 3AOCA 2KHOA 2QA1A 1ZQXA 2FJ6A 4ZOSA 5ETTA 3Q7CA 3VA3A 5LOQA 5KFKA 2G1HA 4R66A 3MXMA 5ETMA 2RSQA 3VF0B 2MPUA 1TK0A 2ZE2A 4MFFA 1ZQLA 3OJUA 3KKAA 4P0PB 3MR2A 1X4DA 1YRUA 2JH7A 1RQLA 3TZXA 3A3PB 2O4GA 4CJLA 2A2DA 4P72A 3O1WA 2DPJA 2V2VA 3KG1A 2BANA 2K4HA 3B4MA 3O2IA 3POTB 1DARA 2LM4A 4PYAA 5D6GA 3O44A 3US5A 2KXFA 5BPMA 4XRHA 3MM8A 2YNIB 2KYXA 4H0XB 3RB6A 2V8VA 3HHLA 2IRUA 1WKKA 4M47A 5J1NA 2ZIXB 4KGKA 4N8OA 3MMBA 1HYSB 1U2RA 1EETA 4QZVB 1S10A 3PZPA 2Z1HA 4G9BA 1A77A 1ZQGA 1PJ7A 2I38A 5IQQA 1DFDA 4YB7A 4FLXA 3KZXA 2ZM6F 1VBYA 2E1YA 2LCWA 4NZ7A 3W3SA 5GAEU 3KLIA 3O4QA 3IBCB 3CJ4A 2QC3A 4O3QA 3OXLA 3MOJB 3HSCA 1KR4A 3HWTA 3SD7A 3FZHA 3NGSA 1DGKN 1CJUA 3F41A 3D6JA 1VBXA 3Q83A 1NJYA 1VDHA 4MYUA 3UR3C 4XK8C 5KRTA 3FNNA 1D8BA 1NGAA 4LF7K 3J81O 4KHNA 5KT5A 4H4MB 4QPTA 1YIJN 2F5GA 2B56A 3QWUA 4L3KA 2W6LA 5GVQA 4KGZB 3KUGA 5J8YA 3EM1A 5EE3A 3LGHA 4MEYA 1WF2A 4RW7A 2NRHA 4JYAF 4K2XA 3RB0A 4DCPB 2EX3A 1VJWA 1NK9A 3C94A 3TSPA 4FWMA 3JTOA 1H98A 2XCAA 3M8WA 1NGCA 3FZKA 2KEYA 3KDNA 4ZP6A 1CXQA 3CJ0A 4TQSA 1CEZA 2V2QA 4NJ8A 2B51A 1WB9A 4DLEA 3TA0A 3HHEA 4NXNK 4J9LA 1NK8A 3CQ8A 4RBTA 1NDKA 3QJPA 1EX4A 4Q2LA 4UTGA 2E1ZA 1NEEA 3IAM9 4QZAA 3RBDA 2ZXIA 4HCBA 4LY7A 2COLA 5D15A 1LXNA 3L4BC 5AQJA 2V2KA 2YTUA 2KFZA 4FZYA 1QVGR 1WSIA 2XS2A 2HMIB 2ZBQA 4USWA 5AQNA 5LL6Z 1MN8A 2F63A 5LSRA 2F7VA 2YHBA 4DSLA 1VGYA 4RZRA 5D3GB 5AXNA 3QEIA 4NLWA 1HPZB 3TRGA 1BQXA 4Y2KA 3WK7A 2HFZA 2OH2A 1NGGA 2FJXA 1I3OB 3IBWA 2LA6A 1RHJB 4I1TA 1ZBHA 4M5LA 1WUDA 3DRPB 3OTOK 3DC2A 2ASLA 4IJNA 4FWSA 3MF5A 1IKWA 1HWKA 3QFHA 4G1QB 3EWGA 1DJ0A 1FJGK 3R2DJ 1SS6A 3DOKB 3OYBA 5J1EB 4PL2A 3U02A 4J2DA 2VG7B 4QZ8A 3L2RA 3SQ4A 4ILGB 3MTKA 2AJ2A 1DTTB 1UWBA 5CQGA 2KKZA 1FO1A 2NXNA 4J7CA 2XLJA 3UD4P 2PE8A 3IAYA 2GQCA 3V9WA 3UVJB 2VGMA 3UDVA 3QLHB 3MEKA 2OWOA 2D9OA 2W8KA 2XMJA 5JVHQ 2NZTA 4HLBA 1W7WA 3AO2A 2HHHJ 3VCDA 4M5MA 2RE2A 3SFGA 3AVKA 3ZTSA 1U1RA 3U3YA 3SMVA 4G6VB 3OS1A 2FZCB 2HYIB 3RAMA 4DI6A 1HPMA 3SDEB 1QHTA 9ICPA 3ZO7A 1ZA1B 1WBBA 3WXMB 4M6WA 3I0SA 4NLGA 4CNQA 4B08A 4J9RA 3PJXA 2ZH8A 4ISGA 2AX1A 3OJSA 2UXCK 4H0VB 5DGBA 1AFIA 1VQ8S 3BPSP 2HK3A 5G0RB 1XMQF 3CJ8A 2QL7B 4K59A 2F4VF 2Y8WA 2DNHA 4QR2A 3BP8A 4HHTA 3EGNA 1RT7A 2A1AA 4WE1A 2G8UA 4M5HA 4M3RA 1OYEA 4BVOA 3I82A 4ZIWA 4DV6J 4DKWA 4NL5A 4BC4A 1ZBTA 2FJVA 2JWLA 1BL3A 1WC6A 3KLGA 3PHTA 2XWXA 4NCGB 4ED3A 1U45A 2WW8A 1TUUA 4FS2A 2Z2MA 2P9UB 2JZBA 1MROA 4KI6A 3I0RA 3JQMA 4I4BA 2BANB 8ICSA 4USJC 3POTA 4OI1A 1XO1A 4USIA 1J5OB 4CLFA 4OGCA 2MQQA 2I5JB 4FJJA 3K4GA 4DX7A 3D5MA 2Y8YA 1WELA 4CZCA 3P83D 4KITB 3CCUN 4ZPTR 2NXCA 4R0JA 3EVOA 2ZJQQ 1X9XA 1C0UB 3AA9A 3SUPA 4CP5A 4FXDA 4EBDA 4NE9C 4DTMA 4FW2A 4CZLA 2HVEA 4F0HA 4I56A 3CIZA 3FBFA 3PW4A 4X4QA 5KFSA 2ZH6A 4A8OA 4CYUA 2YNFA 2YQ3A 2VJ5A 3BGOP 1YVUA 3Q23A 1V9OA 1N63A 2K8BB 1HWLA 4ATNA 3LPTA 1JQGA 1JUDA 4LIRA 2QYGA 2GMHA 3QNWB 3R9LA 1FCAA 3FZBA 1JLAB 2CH6A 1SIWB 2YQ0A 3IGNA 3OXFA 5AQOA 2LMIA 1B70B 2E29A 4IQVA 2KN4A 2U1AA 2NQPA 1NNEA 1QQ5A 4Z7YA 3PIOQ 5DDYA 2VF3A 1VCTA 1QY7A 4RW7B 2Y1JA 1FKOB 3CD5A 4EX6A 1XU4A 4KSEB 4H5RA 2ZJ5A 2Z2YB 3FSXA 1ZQYA 5EE1A 4K0KJ 3M2UA 3CB4A 9ATCB 5HMZA 4ELTA 8ICUA 1N34J 2FLLA 4JS4A 4I6AA 5CHCB 3I56S 1S1UB 1BNOA 3CPEA 1S5JA 3IR7B 2W11A 4CIFA 1FX2A 2W2NP 1S0MA 3NGYA 4WZQA 2KRBA 1LKZA 2B9XA 2MZTA 1YJWN 3AVFA 2KJ5A 1N5VA 2ETJA 2MZSA 3B4DA 2LQ8A 4P0PA 3N4QA 3AQPA 3QGGA 4N41A 3C3LA 4IEIA 1SV5A 4H54A 2RHFA 3AV9A 4M95A 5AJ3F 5CZ1A 3SCLE 3ZD8A 4QIVA 2IFXA 5D4NA 2P5OA 3HMJG 1IKYB 3K75D 1H1VA 2R42A 4GKKJ 2OD6A 1IM4A 2HMXA 1KQSM 4NLPA 4ZCKA 2WAQC 5IIMA 2QXFA 3LWLA 4E2FB 1BWEA 1BQMA 5D0EA 2ZC4A 2YH0A 1R8BA 1KLMB 1VHIA 4DR5K 5BPLA 1PC5A 3VAMA 2E9TA 1Q5VA 2B7CB 1NGIA 1ZQDA 2B5JA 2Y0SD 4I69A 2YHAA 2IOCA 3RW7A 2MRLA 3CDUA 1S97A 3IM9A 2OTJS 4UY85 2ALZA 4JV0A 1SWWA 1YHQS 4PKIA 1N5XA 5IZHA 2BM1A 4DV5J 4E7IA 5T14A 4YQWA 3HSDA 3OW2M 3DRPA 4K41A 4C4WA 5AICA 3H08A 1XNQK 7FDRA 3UQ2A 3S6EA 8ATCB 4RQ5A 2QEXS 2KL8A 1E6VA 3RBEA 3N7PD 2K1RA 4XH4A 4ID1A 3QZ7A 4NLNA 1X9JA 4IFYB 1RDFA 2G8KA 3GSIA 3ULHA 3UXNA 1NBEB 3GCXP 2QIFA 1EJ7L 2B6AA 5IC4B 2QWNA 1LW0B 2R7XA 3QEAZ 4M1KA 4F72A 1S9GA 4YP3A 4OYWA 2AEFA 3MPDA 5IM0B 3BS5B 1KKHA 4Y2XA 1NK5A 2QTDA 5CYQB 5D0RA 2J7KA 3BF1A 4CH7A 3FZMA 5LJ3Y 3S41A 4NYNA 2HHXA 2BZ2A 1C1CA 1U2CA 3FDSA 3UI3A 2Q6BA 2F9DA 2NS1B 2OKQA 5H9FK 1GEHA 4EEYA 3ZEUA 5DB7A 1A9NB 2I0XA 4X4PA 3FSIA 3GWCA 2IJNA 2G5HB 1SJFA 1KAYA 2HOQA 1JALA 2DR5A 2VBWA 4QZ9A 4ES1A 2W55A 5KFWA 4IOAQ 4K4XA 1GTHA 2QMUB 5L1KA 1LWCA 1VRQC 4M3ZA 3PO4A 4IKFA 4LRAA 4KLJA 3HX9A 1SJ1A 2GH1A 2OPPA 2DRAA 1LKYB 3BGUA 3QIDA 4WU3A 4FOIA 4K4ZA 3DLEB 1RLCL 4ZDNA 3J80U 4L73A 5D46A 4OHYA 4R63A 3UKUB 4PZNA 5AZJB 1SL1A 4FVMA 2YMPA 5KFHA 2P9IB 3QB0A 3D0IE 4FK2A 4FW1A 5M1FA 3CCVN 2DL0A 5GIOA 1O51A 2F1HA 4FVCA 3CCLS 2GX9A 2UVRA 3CCQS 1UA0A 4YG2A 3F2CA 3BREA 2LYBA 1MROB 1TGOA 3AJDA 3CCQN 3UM9A 1HFEL 3WEEB 4R25A 1NMEB 1HJOA 2RKIA 3E8OA 4QZHA 2GHWA 1ZM2A 2N4DA 2NLXA 4KO0A 3P3DA 3R97A 3V7LA 2JJ4D 4L75A 5B0DA 7AT1B 7ICLA 1EWQA 4CF1A 2LMRA 2V8HA 3TAEA 3PACA 3MR5A 3MECA 4FM0A 3JPNA 1SJ3P 2M7SA 1ZETA 3I1YA 3CMAS 3HPHA 1I39A 4O5BA 4N77A 2FHKA 2E5LJ 3P5BP 4UB4A 5IV3A 2ZH7A 3I76A 4WWSA 1ITPA 3UVJA 2XRIA 3AA2A 4CYUB 4CH1A 1TTHB 5HI7A 3ZZPA 4PG6A 4LRFA 1JL2A 4EZ9A 4W5NA 2RH3A 5MLCQ 3Q8SB 2Y3YA 2IJRA 1VFJA 3L09A 3LM9A 4KREA 1FK9A 1YTYA 1JMSA 3MEGA 3TJ8A 3A8YA 1TVRB 2CQCA 1U26A 4CLYA 3AOAA 1KONA 2OMOA 2GBZA 4DV1J 1RT5A 3D2FB 3PSTA 1I6JA 5L9NA 5GAGI 1R59O 1KEKA 3TFSA 3UR0A 1RT6A 1QS4A 4FKXA 3AVAA 3WNFA 3T1YK 1HLWA 4DUYK 4CRXA 4P2XA 4F93B 5L38A 2J9DA 2H5JB 4ICLB 4MFBB 2MQLA 2R7TA 3ENBA 5AQQA 4M9GA 5ITHA 2OM6A 1HBNB 5D78A 2XQCA 1JKHB 3CD7A 4A5AA 1ZTTA 2QL5B 4PR6A 2RLTA 2MQPA 2Z2LA 2O8FA 3HVWA 2YWKA 3NH2A 2RE1A 3F5AA 1CJTB 4UW9A 3UD3P 4NCGA 3G9CA 2BTFA 2CNLB 2HSZA 4B02A 4AT1B 3HFVA 3F73A 4F5NA 2IA0A 3D6FB 3CI5A 3KG4A 1J5EF 3CD6S 3HP6A 2UXBJ 4CNYA 5IINA 3JB9k 5KFFA 2MSSA 2FC8A 1NKBA 3CCSS 5F8MA 4ECWA 1T9TA 2MKIA 2I5JA 4XA5A 2A10A 4E3SA 1ZJNA 3QNOA 3E9LA 4R65A 5HATA 3NNAA 4M7XA 1X3MA 3QSIA 2X1AA 2UUWA 1BNPA 2LKZA 2ZBIA 4TXSA 2BA9A 5DLGA 3ENOA 3ZSWA 1IH7A 3LDSA 4OVLA 3WKBA 4IRDA 3VGTA 4KX5A 3NBPB 4NXMJ 2WSEC 4DV6K 2ZOGA 1RWOB 1RAHB 2QG9B 5GTIU 3C5GA 4O4RA 2AQ0A 2XO6A 1N34K 4ECXA 3RBZA 2E1FA 4OI2A 1QTNB 1N88A 2ZGYA 5CCMA 1ZQWA 3SSRA 3NGIA 4QAGA 5A2QU 3WIVA 2R4FA 3PEJA 5LJVA 4KLSA 2MHNA 4X65J 3CC7N 4P75A 1YITN 2G06A 8ICBA 2F1FA 4DF8A 4CFCA 2WFBA 3I5CA 1BWVA 3FJ2A 4TU7A 2YKNA 4HT5A 1NSQA 3HF5A 3OVSA 4OJOA 1RYSA 1WG1A 1RBRA 3ATUA 3UFCX 2MQOA 2F1JA 1MU2B 3BYPA 4CLPA 3OYLA 4KV8B 1WHXA 1OIAA 2RHKA 2R7OA 2NYVA 5J2QB 2DBBA 5EWGA 5CYQA 3WIUA 4NY8A 3AJ1A 4DXLA 1S0NA 3H8MA 1TKTA 2P35A 4H0TB 1Q86O 4DV4J 4DQPA 5IFMA 3IS9B 1W9HA 3MPVA 3R6LB 1NGDA 1TR0A 3CC4N 1KWMA 2E8PA 4K2JA 3I31A 2DNRA 1WI6A 4LF4K 4F02A 1FRKA 3PFOA 3D6TB 3QAEA 2YV0X 5HQ8A 1N8RO 4PPDA 1K9MT 2ACMA 4WFAQ 1SC6A 4I7FA 1Z1BA 3VQ8A 3O6WA 2IPOB 4TLRA 5LXRA 1DLOB 3UDEA 5IWAK 1ITGA 4B9TA 1CJKA 5KFEA 4ISEA 5B0EA 1CI4A 1RK8A 2CIMA 2DNMA 2QMWA 5IILA 1IKVB 1VHFA 2YJEA 2HB5A 3DOLA 2DITA 2C3MA 2HDOA 2HFUA 1OQ6A 3AO1A 4ID8A 4DR3K 3CRXA 5LMNF 4DU1A 2JH1A 2VG7A 3CJ9A 4LMZA 1UVMA 2LXUA 3KIOA 3UN2A 1AUDA 3OVAA 4CZJA 5KG0A 3GG4A 1N2XA 1O5JA 2W2QP 2H5XA 2BBEA 4NXNF 3V6DA 1C2PA 1T05A 4JI4J 1PCAA 4ICAA 1VDVA 1KQQA 3G6VA 1VSIA 5AT1B 4YS2A 1BU6O 1O0PA 3QGHA 3MM6A 4FN5A 1VQPS 2HBMA 2KTQA 4RU2A 5J0YA 4BG8A 5EOYA 2FJDB 2VV5A 1U2VA 3TR8A 1T0TV 3NNCA 4N56A 4OX7A 4DLGA 4USTA 2XY8A 2B6AB 4C0BA 2P9GA 2VQEJ 4FOEA 1JX4A 5B0AA 3NHGA 4GKJK 4WFXA 1ZQCA 2P5GA 1S9GB 4I0WA 1JXEA 1RPLA 3D4JA 3LA0A 3LVVA 1S0VA 2KFNA 5A8RA 4WFNL 4KFBB 2VC0A 4N7TA 5AM5A 4USHA 4CEQA 2AYGA 3QNNA 2F7TA 5KT3A 1EQYA 5CP2A 3A0HU 1YJ9S 3ZTOA 5IT9U 4OYOA 4ZN1A 3N5BA 4J2BA 1KTVA 4J9PA 1N33K 2OMLA 1GMWD 2GHPA 5KFZA 3RJJA 3D3CJ 2FBXA 3G96A 3AO3A 1U25A 3DDIA 2OEMA 2QO3A 2RAQA 3I0RB 3S7RA 2VIXA 4PABA 3KK1B 5K20B 3FLCO 2ZVIA 3C6UA 2OPPB 4MAKA 1SL2A 1C0MA 1EWRA 1M1KO 4KLDA 2YCHA 1R0BG 4DV4K 2DQNB 4MF8A 2HVIA 9ICJA 1XR5A 3NWGA 1ZQZA 4OZ2A 2HHHF 3DEEA 3PYDA 3MUVP 2HI0A 2IOFA 3D0GE 3CJKB 5AZJA 4NLBA 2XGQA 5HLFB 1MQ2A 2HFNA 4JI4F 4LBIA 1Z00B 2YQEA 2Z1IA 2ASYA 1YI2S 5IT9Y 4DR7F 4C7YA 2OLWA 3CE8A 3P38A 4CGJA 5DDPC 4OHVA 2GWJA 5HMWA 5JUMA 3NGKA 3B6BA 4ZP9A 1A5VA 3H5UA 5F8LA 2VANA 4DX6A 4FZNA 2D4WA 2FHJD 3VQCA 2KG1A 1JJ2M 3R5GA 4KHQA 2FVCA 5KFPA 2Q3PA 4WCEQ 4WQ4C 4TYAA 2GELA 2ZHOA 3FZFA 4DU8A 4KLMA 1CULB 1JLCA 4KLHA 3GU0A 1OH7A 3QRQA 2LEAA 4FKYA 4WFBQ 1KBRA 2M0NA 2I9GA 3RWUA 1JNZB 4K5RA 1RT4A 2W03A 4UAWA 4LF7F 4E98A 3F9KA 5KFYA 5KNIA 2OPQA 3W65A 1Y5LB 2Q0RA 4B3RK 4KC5A 5CRXA 1FKAF 2RU9A 5ALEA 5ALLA 3W9HA 4G3IA 4P2SA 7ICVA 2AW0A 4FJNA 2QT7A 3W62A 2J8SA 2X1BA 4LBPA 2D0AA 1ZJMA 4EP5A 2KE7A 2YHWA 5DBAA 3R7SB 2CKWA 1CXUA 4YORA 4CHYA 3PRDA 5HJYA 1VQ7N 2BHNA 2R7UA 1W0HA 3AA5X 3NGUA 5JS1A 4WF9L 5H1SV 2KKVA 4CO1A 3WK8A 4J37A 2C2NA 2H65B 3D2WA 1TK5A 5GMKa 1JLFA 2Q31A 2DH8A 2ZIUB 1YBUA 3VPZA 4K50A 1APSA 3VQ9A 4RW9B 2O4IA 3KKAC 3M6WA 1HNXJ 2FHJA 4CJEA 2H51B 2M5YA 4BWMA 2E5JA 3SFUA 4CEAA 5JS2A 3DXMB 4UAYA 4B9NA 2GV9A 2WVFA 3PLAA 5DG8A 4DN0A 3QNMA 3M8QB 4KI4A 3KOAA 5CXTA 1BCOA 1S3XA 4I2QA 2OD4A 2DJWA 3OQ2A 4AM6A 1BMQB 4Z7CA 4AM7A 3CEDA 4EK2A 4EIAA 3F56A 3MI7X 4PGYA 4LZDA 4ZVEA 3K7RA 2HBZB 4KB1A 4Y2MA 1VC6A 1ZBSA 4CJ3A 1AW0A 1U0SA 1G4CA 2KG5A 2MZQA 2FIUA 1MQ3A 5H9EJ 5H9FJ 2BE7D 2YX7A 1KC8O 4LRCA 1WCNA 1WOQA 1ZRNA 1DZ5A 2YX6A 1PZNA 5E79U 1XNQF 2YPYA 3KNAA 4RBUA 3SQGA 1JJ2R 4IR9A 4M9NA 4ZPWR 5GAHP 5AQVA 1B3TA 3PX0A 3BS5A 2C42A 3OFGA 4O55A 1ZQOA 5KFIA 2CA9A 4ED1A 5CA7A 2F96A 3A5NC 3FAHA 4DL4A 2JR5A 1SJ4P 4KHWA 1UT5A 2WB1C 2XO7A 4R8UA 2OFHX 1JLGB 3Q8QB 1X4CA 3TPQA 2E8AA 3AB2B 1F9FA 3S8SA 5F0XA 3ZSVA 4CJFA 4IQMA 2BJEA 2GIFA 1YJ7A 5I4MA 2CWXA 3ZSQA 1S99A 2V67A 1GMUA 1J97A 3B9JA 4NL9C 1N5YB 2FBYA 4U8YA 2RIJA 1OYDA 4YB5A 5T7LA 1LOTB 4NEZA 3M7DA 8AT1B 2NRVA 1VK0A 3L2UA 5KFAA 2UVVA 3IS9A 1N36F 1Q78A 1T3OA 4RLEA 3ORYA 1B4SA 2G2ZA 4QIWD 1JJ4A 2LQ5A 1B4FA 1S76D 1ZOLA 2EK1A 4FL9A 4DV4F 5AQGA 2HNDB 3PX6A 4DTOA 5I3PA 2GW8A 2EANA 4BXOA 2IBKA 1RQ0A 3IR6B 2XHWA 3AVIA 3K5NA 4CZGA 3MD1A 3RJFA 5BR8K 3MM8B 3A2FA 4JI2J 4AHRA 2KVCA 3RAQA 5K9FA 1WWHA 4M5GA 3J7ZO 1F9EB 3H4BA 3EZOA 3NH1A 2YKPA 2Y0BB 4FF1A 4BR2A 2JH3A 1P1TA 3RTVA 4M63C 1FJCA 5JLFA 5AKXA 1SKRA 3NFAA 1VSFA 3W5ZA 2CQBA 1SC3B 3RZAA 3W2VA 3HJEA 1H74A 2MXYA 3N7RC 2CG8A 3KD1E 1NGJA 1JLBB 2HQDA 4C4TA 1IWAA 4CQ1A 3GPAA 1S9EA 1F0MA 1WUUA 1NMDA 4DL0C 4OFZA 3EWAA 1UJ5A 4O8KA 1BPXA 3J7ZT 3CCRN 4M2YA 3L3FX 2GVZA 1N54B 3V2UC 5EWFA 4QS8A 3O80A 2PBDA 1CULA 4MLHA 1QQ7A 2RILA 2V34A 2QW9A 2NV3A 3AO5A 4B1VA 1S7HA 2OEHA 3H8SA 3VVTA 3VGKA 2DFEA 1CG2A 4FZZA 2HFVA 4RT2A 7ICRA 4U7UK 1FEEA 4C8LA 2D0OA 2NNWA 1X6IA 1B9FA 1GNKA 2QKKA 4RUCA 1C6VA 3HZ6A 1L7OA 5KPRA 2AXTU 1PVRA 2F3NA 3HJFA 3G82A 1F2HA 3U26A 3VTIA 3ISZA 5LMNJ 4ILLA 5F3XB 1T03A 4JWMA 2N3LA 1KFDA 4M63A 2F9TA 3ZDBA 5J2IA 2ZE2B 4KKOA 4OI3A 1RGIA 3NF9A 4A2BA 4DCHA 1ZQAA 1NDLA 4NLKA 2HFOA 2WSFC 4OX6A 2P9SA 2QFJA 4B3SF 1C4AA 2GWKA 1Y00A 5ALQA 3FFKB 1U04A 4ZPCA 2CQGA 2BJ8A 4DR6F 5AE3A 3MGHA 2V4JB 1NPPA 4UOGA 3DXMA 2DFHA 3VGUA 5F8HA 5E41A 2AYMA 4Z4GA 4YMMA 2L08A 4B6JA 2FVPA 2JSXA 4E7JA 4IS7A 3DLLL 5J2BA 1ZH5A 2BKEA 2DR9A 4DB3A 3HVRA 2CQ0A 1LB2B 3OHRA 4NYPA 2UXDK 1KC8T 3VETA 4A47A 1WAFA 5BYSA 1SH0A 1Q7YT 4TUPA 3J7AN 3BO2A 4A62A 5KOWA 3I32A 4JUZA 2E2PA 3RMCA 1LW2B 5CB1A 3C19A 4UATA 3MWBA 4CGZA 4JI3F 3QFUA 3OYMA 3LDQA 4XDCA 3EGWB 3J7AP 4CO3A 3HFKA 2AZ3A 4OL8A 3C23A 3ZFVA 4QOTA 4U8VA 4P4PA 2E8NA 1H3DA 2UUBF 2GHVC 1GAOA 2ZJPQ 4NASA 2EAPA 3B54A 4CJKA 4FYDA 2DO4A 3W5YA 3PDNA 1EX8A 4KBOA 3U9ZA 2DTJA 3DRXA 1IKXA 3ID6A 2E5LF 2JGAA 2AP1A 4UB1A 2PFFB 2VPYB 4K8RA 3IDHA 4Y34A 1AA1B 1VQ9N 5GAEI 4A8WA 1HNVA 3WNHA 1HYVA 2FSJA 3CCES 1UVJA 1RTDA 5J2PA 2PFUA 4P4OA 4WK3A 2VONA 4WQ4A 4YXJA 3N6NA 3DAWA 4NM2A 4C11A 4BQLA 4DR4J 3WXKA 3C16B 1U1OA 1QHAA 4RL1A 2D69A 5AKGA 2LEPA 1RAAB 3JPQA 5AK4A 2XM3A 9ICHA 1GLJO 4OKEA 3FQLA 1N6QA 4K25A 3U7JA 1SUQA 1X9SA 2IVYA 3VEWA 2D1KA 9ICAA 3DOLB 1ZRMA 1KVAA 3PNIA 3H42A 2Q1NA 5B5EU 3BY5A 4TQRA 3UPQA 2OXOA 3MTJA 4YCXA 2W6KA 4RQ0A 1LV5A 2BRKA 4Z37A 1S6QA 1ZXOA 2AKWB 1TUYA 3MN5A 3O9UA 1U09A 4F5OA 1SH3A 4YOVA 9ICMA 1WG5A 1UHUA 2OJ3A 2I6XA 2FJWA 3KK3B 4JV5J 4I2HA 3F44A 3SQIA 3KJFB 1XR7A 1W26A 2QGFB 2JRSA 3CM6A 4Z4EA 1OW5A 1TKDA 5AQKA 3PV8A 2UXDF 1RTZA 5KFBA 2L9DA 2HOEA 1ZPWX 4HACA 3ZSOA 2CPIA 1H0HB 1G6BA 3J7YU 5AZIB 1GLLO 3SMPA 5C10A 2IVFB 3LAMA 3L8BA 2UUAJ 3WZ0A 9ICCA 3I4HX 1ZPVA 1FDNA 3JS9A 3DGVA 1WHVA 4RCHA 2K8AA 2IMOA 2XY6A 3THTA 1DTTA 1UWBB 4B3RJ 1FJGF 4Q45A 2ATLA 2LQBA 1PILA 2HPUA 4PWDA 4GV9A 4UT4A 2QA2A 1ZQPA 2D9PA 5A6PA 2QSFA 2XIDA 4L8RB 1B92A 4HTLA 3VN5A 2HQGA 4DR1F 2H3ZA 4GVBA 5J0RA 5ALHA 1L3TA 1PKUA 5D0HA 2E5GA 1NAQA 5CWRA 2HGLA 2YWGA 4NLSA 2LI6A 5HSPA 2XMVA 3PW5A 4FF3A 2NRTA 4BRLA 4CERA 3V6HA 5I3UA 2YQ1A 1HUXA 4FVUA 1UAWA 2P6TA 1QZ5A 2KN7A 5A0YA 1QQCA 2A1BA 1TFWA 1KAXA 3GU3A 3SQOP 3SCJE 1REGX 2J8AA 2O1PA 4MJKA 1JB0C 3EUNA 1HNWJ 2LYHA 3LP3A 3QMLA 3OYAA 5THWA 4DQIA 2H5EA 3IDWA 5AKIA 3H0PA 2H1YA 2KKHA 4YN3B 3GFKB 4BC2A 3QFPA 4QIWC 1WG8A 3NVZA 3R27A 2D3O1 4ZLLA 3JYTA 5EX3A 3F9MA 3VF2A 4JI5K 5G4DA 2OTJN 3M30A 4YY3J 4UQGA 3MX5A 3VENA 2VODA 1UEKA 1S8OA 8ICTA 1HYSA 4MLEA 1BGXT 3QQCD 4IFEA 4KB0A 2HNDA 2GEMA 3MAQA 4Q7AA 3TANA 4JI3K 9ICRA 1JLQB 3NAIA 4HKQA 2ZDOA 1OKJA 3HJVA 3CO9A 2HSEB 3KLIB 1DHMA 2MGZA 4OLOA 1JLEB 4QS7A 4KAZA 1KDHA 5F2RA 3VEYA 2E6MA 3T9NA 2IDLA 1A0PA 1FERA 3DGPA 5HHHA 4NRUA 3L3VA 1VQ6N 3T5KA 4CHNA 1KLMA 2ERRA 4H4MA 3TW0A 3TO8A 4DTRA 2QWMA 3HLUA 3WU2U 4PZVA 5ETOA 4Y1CA 2G8FA 4GKJJ 5JRTA 4GO5X 5L39A 1GH8A 3T3FA 3G6XA 1Z2LA 2UU9K 2BVZA 3L4QA 3A0BU 3FCVA 3M1YA 1FRMA 4X4UA 1EXNA 2YNFB 4B9MA 4RUBA 2ZNZA 2OSRA 4OYXA 3OYNA 4YOXA 2KHCA 5J2NA 1YXQA 1R6VA 5D77A 4OJLA 3TQ1A 4PCQA 2V8DA 2W40A 5EUHA 3I56N 3DJCA 4P10A 2EKYA 4QCLA 2BOAA 4M3XA 3O9QA 1M5VC 4J9NA 3KHLA 1CC7A 5EWEA 5I42B 4JI4K 1NHVA 1RAIB 1WEZA 1RT3B 4J2EA 1Z4UA 3M2UB 2G07A 1CC8A 1R27B 1RBUA 3OHAA 4O3RA 4RPZA 3MPUB 3BGLA 1XHZA 4EENA 1F5CA 2GIRA 5HOOA 3O3FA 2DRBA 2P2CB 5J2GA 3ULEB 4AILC 4ILRA 1BC6A 4JWNA 1PSDA 2PZSA 4KKOB 3ZT2A 3DWLA 2LBOA 3IA0A 4CRJA 5D3GA 4CGFA 2J7UA 2E5SA 2K7KA 1BQNA 2EFPA 1HHQA 4DHYA 4H5TA 5FD1A 4PG8A 2HHSA 1TP7A 2DFFA 1LFWA 3G25A 1T3NA 4OPKA 3KOOA 3A1YG 2XS5A 3QT5A 2ZUAA 4TUSA 1HW8A 5T41A 2P66A 4DR7J 3ZC4A 3BUZB 2V4JA 3CCUS 4F5QA 3OY9A 3UD5A 3I9V9 3M9NB 3MEDA 3VQDA 4OX9K 3Q8VA 3H5YA 4JKFA 4P6QA 2K7JA 3O8WA 3SCIE 4Y2YA 3DDKA 4A8XA 4RU9A 4CK1A 1ATNA 3W9IA 2X1FA 3SQGB 2C2EA 2XYGB 2C3UA 4Y2PA 2M88A 1Y3KA 4NA1A 3UDCA 5KL8B 1PK3A 2IYIA 4DZ6A 1Q18A 2HKEA 2DIVA 2HF3A 2PT0A 2OIHA 7ICUA 4C0ZA 5AQLA 3M6GA 3CPWM 4MH8A 1JLGA 2ZBCA 1HNXF 3V72A 3BJYA 4DEZA 4Q43A 9ICBA 1GX6A 4EUVA 4GVLA 3OLAA 2RN2A 4CF5A 3SDEA 2QWRA 3BQ1A 2CADA 5EN1A 7ICSA 3NY0A 1YJUA 4KT0C 5LT5A 3KK7A 3QWPA 1TE2A 4MT1A 1ZBUA 3V4IA 4ZS6A 3Q8MA 3U1MA 3PIOL 3D2QA 5BRHA 2BJ3A 5EVZA 3WUHA 1WC5A 2EW9A 2LXFA 4PG4A 4AFFA 3ETRA 1VQOS 2VKQA 4KMUA 3OTOF 4A5BA 4OCZA 3M5RA 1E4FT 3HHKA 1GLBG 2OTLS 1OWXA 3H3NO 2F2AB 4NPOA 2ZOMA 9ICVA 3AVCA 4J5OA 3ZZTA 2J0XA 3VQ6A 2HZVA 4FNHA 4BXOB 1XC9A 2J0QD 2KJVA 1YJNN 1Y3JA 3CSKA 1ZS6A 2UZAA 2UU9F 3CERA 1NWKA 4UUXA 2NSBA 1FVSA 4F71A 3AY0A 3H5SA 4BRHA 1D9DA 3EY1A 1UFWA 1ZQKA 4I68A 3RJMB 4DV0F 3C28A 2JHEA 3GOIA 5E26A 3MK6A 1EAYC 3ZNUA 1PVQA 2U2FA 2E44A 2AU0A 4XH1A 1T11A 1NXIA 2QWLA 1DRGA 2XS7A 3KYLA 4CJTA 3THXB 2GQ2A 2R7WA 1DTQB 3I5AA 4CJ5A 4ETXA 4HTUA 3O1BA 4I2PA 1SL0A 4WQ5A 2GAGC 5TKWA 1VK3A 3PNCA 1RCOB 4BX9C 3HVTA 4M3UA 3T1YJ 5TKYA 4DFPA 3KTQA 4ZMMA 3RAXA 2O8CB 5L46A 1VSDA 1O08A 3PVXA 1VQYA 1CQMA 4DV1K 5AM3A 2PN6A 4WFNQ 3MMJA 3D6RA 4JBCA 2PIIA 2M9NA 3SV3A 1LWEB 4YR3A 3DMJA 3LF0A 4DUYF 3TEHB 3EO3A 1VQKN 4CLZA 4FZXC 5DQIA 1SKWA 5LMNK 4M5DB 3TVKA 4DCOB 1ZM4A 4CD1A 3BR9A 1WOOA 2CFXA 4I6MA 2HSTA 3OTQA 2G13A 1CLFA 4DV2F 1VQ6S 1AB8A 1PJ6A 2ZBPA 2SXLA 3TTFA 1KOOA 1ASUA 2GUIA 1W25A 5J0WA 3AD9C 1NB7A 1S1UA 2V2ZA 4LJMA 3OYCA 1NSPA 5GAHI 2ZUDA 4CHQA 5M1KA 3C66A 1EP4B 4C3LA 4RWWA 1RT6B 3M1VA 2VG6B 4DPUA 3R5AA 1XWLA 2VJUA 3AVJA 2O5DA 1IJJA 4LRDA 3D6HB 5F1XA 3EZWA 1OS5A 2X3GA 9ICXA 4V19X 5HNKA 1RLDA 4PHDA 1KQSR 1BDGA 3TSUA 1TKTB 1QDUB 3JYTB 4PHEA 4W5TA 1HNWF 5AFUA 3A8KA 2OELA 2ISOA 1Z6RA 2YWEA 1VQ8N 1KKXA 3KG0A 1JLQA 1Q8LA 4AHCA 2LLZA 3GG0A 4OLBA 2GC8A 1VIXA 1U4BA 4MQ3A 2DO0A 3ONNA 2Q0ZX 3H7HB 5K14A 3NUQA 3CDBA 1BO5O 2AA4A 1CJKB 1Y10A 5ADZA 4PL8A 5C15A 3OL8A 4K43A 2QKQA 2QL9B 3EKSA 3SJHA 4CF3A 4CLLA 4AXIA 2YJFA 5JMNA 5AK6A 3AY9A 3CVKA 4HYKA 3CDAA 2QX0A 1EQ0A 2K1RB 4K5SA 3UCGA 1Z05A 3D66A 1D1UA 1V85A 1X8DA 4ZVFA 2R7QA 7ICQA 1WD6A 3CMAN 1S1XA 1N0VC 2O8DB 3PY8A 3VAIA 5C25B 4ES2A 2AGOA 1ZYQA 1YJVA 3JTPA 1P27B 4BE1A 5KFLA 2BR0A 5IM0A 5IC6B 3GIKA 4L76A 4F3TA 4ECYA 2QYCA 2Q4TA 5SZTA 4L3NA 1BIZA 4PG5A 5BREA 4X2BA 4ZJOA 2YKNB 1S0OA 1JXLA 1MWQA 3UCUP 1T94A 4Y2QA 3AXMA 1WSRA 5KG6A 5FLXU 5I42A 3R3LA 2R7YA 4ZHRA 3QXGA 4LVOP 3C0BA 2AJ4A 3R9KA 2J9CA 1NJZA 4MK9A 4F0KA 1IIPA 2DCLA 4QU7A 2IIHA 2BM0A 1WOPA 2QE5A 3TSQA 4BDPA 5IQ6A 3BQ0A 5KG7A 1SUQB 4LD0A 1UPPA 4A8FA 4LH5A 3D2EA 3T79A 2WMMA 5F8GA 4NYZA 1UA1A 1N48A 4U67Q 1OPZA 5B66U 2DXDA 2R2RA 2FB0A 1B64A 4I7FB 1MMLA 3CW2C 1HNIB 1NRKA 1DLOA 1NOMA 1I94J 3OVBA 2L48A 2FGOA 4DSKA 3HKZC 4NLZA 4LF5K 2ITMA 3M6XA 4O44B 4CT8A 3T69A 1F44A 4QWAA 2NZCA 4F9OA 1RTHB 1HWIA 3I87A 1XMQJ 2LQJA 3SXLA 3KJQB 4BR7A 1UT8A 1ULRA 5H1SQ 4C4RA 4DHVA 3RW6A 5EY4A 3RH4A 2CPRA 3MMCA 3GFYA 2A1SA 1XSLA 1QQOA 2ZUCA 1RYRA 4Z94A 3CO0P 1R8HA 1H7WA 6FDRA 5AXKA 3PRBA 2JWKA 3HVTB 3R1LA 1RT2B 2VUGA 4TU8A 2IAJB 3Q7BA 3NF7A 2W9BB 4NA3A 3R5JB 4LFAF 3QUTA 1CJVB 2ZWPA 3F2KA 5J2DA 1TL4A 2UXDJ 1RJJA 3G10A 1YITS 1Q4RA 3NF6A 2CXEA 2AJ1A 1XNSA 1NMNA 4L6V3 3NF8A 4W98A 1Z1ZA 3RF9A 2E1MC 1TKXB 4RWXA 1JROA 4UAVA 4YOTA 3TX8A 1ZQUA 1NSAA 3W7BA 4MDBA 1SV0A 4DR1K 2Q2RA 4FJ7A 2IRXA 2ZTCA 4HR2A 1PYOB 4CF9A 3CC2S 3CPWR 4QWEA 3R8EA 4ANEA 7ICIA 9ICGA 2BZFA 4F2SA 4ICLA 4MFBA 1YUWA 2RQMA 3Q2SC 2ASOA 2OCEA 2VFRA 3UKRA 3ZTPA 2A18A 3JPSA 1V6HA 3V6KA 4M9LA 1RTJB 2XULA 1JXVA 3AHPA 3QRPA 1RA7A 1TUVA 1M1HA 2ZC3A 1T02A 5AQSA 4H5WA 3KXDA 3M6UA 2W24A 3GYXB 4NLTA 3W61A 5GADU 4RPFA 3L3CA 1IBKF 2GJIA 2D3DA 1JK9B 2DKXA 4IO9L 1VMBA 2CQDA 1Y5IB 2ZJRQ 1CS4A 1L7NA 5E3RA 3C2PA 2NYIA 9ICLA 2KVSA 1XS9D 1IBLK 1UZHA 5RUBA 2J6UA 4PY5A 4KMOB 4GV3A 2B4UA 2R8GA 1N34F 4CK2A 4K0KK 1KRPA 1Z00A 3G6YA 1YK9A 4BC3A 3VAGA 4KJIA 4XO0A 4RNNA 3LP0A 1RAGB 1TL1B 1JRPA 2CZ4A 3MAHA 3AVHA 3ILIA 1SXEA 3UE2A 3QSYB 2UUAF 2V7YA 1CJUB 1BUPA 4I64A 4WF9Q 3CG7A 2VG5A 3ZZZA 4I2GA 3G86A 1J53A 1SWVA 3HI9A 1OQ3A 5J2NB 4JKHA 4DOZA 5ETKA 2DGTA 4YMEA 1NJIT 4PHAA 2CPZA 2CQPA 2KRRA 3R6MA 4GVMA 2ZD1A 1ZQHA 5K4LA 3CCMS 2MYFA 5CZXA 1RABB 4YN4A 2XY7A 4OKKA 2KSOB 2FC0A 4B9SA 2Z1GA 2GTDA 1SZ2A 3Q8RB 4DSEA 5ALIA 3ZX2A 2A40A 4JI0F 1S1VA 2V4RA 3LM2A 4CCHA 4RJVA 4U6PA 2VOOA 3KLFB 2ZKUA 4IKAA 1VSHA 1FE0A 4ALZA 2QMXA 4KH1B 4FJ5A 4JI2K 4LF5F 2QN6B 1YZ6A 4X4RA 2RMLA 4RQ7A 2RS8A 3I55S 3M9OB 1E6YA 3P5JA 4MIWA 1RHUB 1VOMA 4CNZA 3ZYYX 5KAKA 4ACOA 2IM2A 2QEXN 2VDIA 3AAQA 4ED2A 5L1MA 3GIIA 3DLGA 3DYAB 4NRTA 3MURP 1X0FA 3NRZA 4ZP8A 1KVKA 1A7GE 5FDLA 4CTAA 1L3UA 3NEKA 1NU0A 3RSEA 4ZA1A 4FJLA 4ZJLA 1GOAA 3Q8LA 1BPYA 1Y5NB 4HHHA 1DEJA 1UJ4A 4DR2K 1UVNA 4KLUA 3DNCA 4Z6EA 1KN6A 2VKZG 3DLBA 2W01A 3Q86A 4CE6A 1HEKA 3SEOA 2P5VA 2WONB 1IJEB 2HHTA 4ZPAA 1T05B 1HNZJ 3A5OC 1VQ9S 2WVCA 1X40A 2DBYA 2E2NA 4CZKA 3S3OA 4Z6FA 3QEVA 1ZM3A 3JPRA 1VQ5S 4G65A 2DY4A 1TL3B 3DI6B 4R5PA 1WSHA 3DOMA 4GKJF 2AEMA 3KNGA 5M1PA 3N6LA 3KUEA 1T4GA 2Y9TA 4A59A 5A0LA 4EYHB 2BCQA 3LYSA 1LOUA 1IBMF 1XQIA 3IWXA 1N5WA 2DGUA 2YWFA 8ICXA 4YDXA 2BGWA 1ZD2P 4C2MA 2GWSA 3W2VB 4RNMA 1VS3A 4ED6A 1NH8A 7ICMA 4IDKB 4PHTX 2V4QA 2ZIVA 1WYGA 3PXGa 1Q81T 1JLBA 4M9HA 2G8VA 1WG4A 3ZDCA 1K73O 1VJQA 5CYJA 3SR6A 2F4FA 4CJ7A 2Y9HA 4WFBL 5LSLA 1S59A 1XEZA 3TR5A 1H72C 2G09A 1X4GA 2MU2A 4JV2A 2BGGA 3QO9A 1OY6A 1FX4A 3IG1A 5DG9A 3N4MB 5KT2A 2RRAA 4DTUA 1WC1A 4GMJB 3IP4B 4DCCA 5KGWA 5BN8A 1OMSA 4G9ZA 4C98A 4D3HA 3HM8A 3KK1A 3SEIA 3M8ZA 8ICHA 3NOCA 1U9LA 4MKVA 4ZCMA 4Y2IA 4BQZA 1RWNB 3SQ2A 4KR0B 3TAPA 4WXOA 5IT4A 3UKRB 1RTJA 4NXMK 3AA8A 3D7SB 5FLXO 3LPEA 2UP1A 3BM7A 5ELZA 2GA7A 3R6GB 4QZFA 3RH6A 3L3UA 4YHHF 2ZBRA 1AFJA 5DZ6A 3C14A 4K4TA 2ZGZA 3FE1A 5HANA 3TI0A 5E7OB 3LW5C 2Q43A 4DSIA 4ILMA 1QZ6A 3TWHA 4U96A 4K4SA 5AKHA 3KHYA 4LZGA 2O67A 4YB1P 5LMUJ 2YH1A 4OI0A 4BRKA 1ZD4A 5FLXY 3CCJS 3U3GA 4F4ZA 4OI4A 1M1GA 1RWPB 2B4PA 1TL7B 2HS4A 1LWEA 4CI6A 3NL0A 2NO5A 3QJJA 2JRZA 3M05A 1C0UA 3QAUA 4Y28C 3MDCA 3NASA 5E33A 1HKCA 3MCOA 2YX1A 1GX5A 2HBYB 4TVAB 1X4BA 1ZQIA 1COKA 3PSIA 2JEGA 4CO0A 1WTFA 3PG9A 4B9LA 5CY4A 2IM1A 2KM8B 1DKGD 1R8PA 2FZGB 1VIOA 2FTRA 3SQ0A 1UVLA 1VQON 1KVJA 2EFVA 4E7HA 5J0XA 5KFDA 1JL1A 4DV0J 3EGZA 4AHVA 2AH5A 2P9LA 2ZD1B 3NAHA 4ZVOB 1TKXA 1ZOTA 3H2UB 2CPEA 2R2TA 1NGEA 3OHBA 1MMNA 2ZH9A 3UQ0A 1TFYA 3UE5A 4ELVA 1WEYA 2ROEA 2MLZA 2YB4A 5KGXA 4RO0A 5CEHA 3ISBA 1HI8A 3NOGA 2F8HA 5AIAA 4OZJA 2ILZA 1BVSA 3QGIA 3I8DA 3KUHA 2E8M