3BDPA

Dna polymerase i/dna complex
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
580
structure length
580
Chain Sequence
AAMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVRAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Visualizing DNA replication in a catalytically active Bacillus DNA polymerase crystal.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA (5'-D(*GP*CP*AP*TP*GP*AP*TP*GP*CP*2DT)-3')
total genus 201
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 1997-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3bdpA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3bdpA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3bdpA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3bdpA01
1KVBA 4PHPA 3K57A 3V9XA 2V4QA 3CFOA 3V7KA 4FLYA 3U3YA 4FJJA 1VK0A 3HSTB 3RAXA 4KI4A 2QK9A 4MFFA 5J2DA 3M9NB 3TAMA 3LZIA 4ED1A 2WTFA 1VRUA 4KLOA 3JPRA 2A1JB 3SYZA 3MEEA 4DOCA 5J0PA 4DMNA 4PUOA 4F5NA 4PGYA 4NYFA 4BWMA 5EU7A 3S3OA 2R8JA 4GXIA 4J2DA 2KW4A 4Z4GA 4F4XA 2G8UA 3GIMA 4FO6A 4KLJA 5C5JA 3AV9A 2IMWP 4KLFA 3TAEA 1MQ2A 1BHLA 3QEPA 4I27A 5CZ1A 4CJUA 1TVRA 4DG1A 5KT4A 3HO1A 3AU2A 3OYJA 1GOAA 1QSYA 9ICAA 1Z26A 2BCSA 4RNMA 1BPZA 1JIHA 2YHBA 1WCLA 4RQ8A 4QWBA 2F1IA 5DBAA 4QZFA 3ZSOA 1O1WA 4O3OA 5KFEA 2XY6A 4ID5A 1BI4B 1J54A 4DFPA 4M9NA 3AU6A 3MDAA 3ISNC 2XC9A 2UVRA 4UBCA 3PVXA 3DOLA 4QZBA 3V6HA 1ZYQA 1NK9A 1RTDA 5DMRA 5C25A 4FK0A 5KTQA 2FMSA 5J2MA 8ICUA 1YTAA 2YKMA 3AA5X 3LPTA 5DLFA 4DL5A 1DTQA 5KG4A 2W9MA 4KLLA 2RKIA 4KLHA 4KMUA 1Y97A 3VQDA 4KRFA 1LW2A 2PI4A 4J9NA 3V1RA 1C1BA 3TABA 3BQ2A 1I39A 3VQCA 3NF7A 3SI6A 4GMJB 5KRSA 4DL7A 4X5VA 1C1CA 1EX4A 3OGUA 2ZJAA 1HYSA 4KLIA 5DGBA 2C2RA 1QQCA 2B6AA 4J9RA 2X6NA 8ICFA 2Q3SA 5KG2A 5FRNA 3AVLA 1D9FA 3MEGA 4F92B 3T3FA 3EPGA 1W9HA 1RPLA 2HMIA 4M9JA 3K58A 4KREA 7ICRA 3TAGA 1PZNA 4EBCA 4BE2A 2OZSA 1QLNA 4M9LA 3OJSA 4NXZA 4PWDA 2NRTA 9ICXA 3RJFA 2HB5A 4CGJA 4YMMA 2BGGA 5DG7A 4Z6FA 3HPOA 3IM1A 5SZTA 8ICJA 4FLWA 4E7JA 5HNKA 3UQ0A 5L9XA 4GC7A 4F2RA 3RWUA 3H8JA 4O4GA 3SPZA 4NCBA 1ZQVA 4HHTA 3VQ4A 4CFCA 5CYQA 4CHPA 1TV9A 2FPLA 1L5UA 5KFTA 3L2WA 2YNHA 4CJKA 5CHGA 9ICCA 3ORYA 5K14A 4TQSA 4Z6EA 3C1YA 5J29A 3TAFA 2KN7A 4W5TA 3QIOA 3HX0A 4DTJA 3RB4A 3BGRA 1J9AA 3JPPA 1A5XA 2FPKA 3NGDA 3H4DA 1T05A 4DOAA 3RJKA 1RBUA 4ECXA 3BDPA 1BIZA 2XY5A 3ISBA 1ZQKA 4DSJA 2KZMA 3RB6A 2FBXA 3L2UA 2F1HA 3DLEA 4RQ7A 2W9BB 4FK4A 3OS1A 3QERA 3H7IA 1CEZA 5HRPA 4XUSA 4FZXC 3UXOA 3V6JA 5IIIA 4YXMA 5KFCA 2DFFA 3MEDA 8ICMA 4CJRA 1SKWA 3HT3A 3OYCA 4NCAA 3TWHA 4RT3A 4KLQA 2V9WA 1N6QA 1IG9A 3MR5A 4CEOA 3BQ0A 4FXDA 4Z6CA 4IRCA 3ITHA 5BOLA 3MXMA 3H40A 5KGWA 3SUOA 3P5JA 1XO1A 3AUOA 4FCYA 4RW6A 2F8SA 7ICPA 3OYGA 4CFAA 4MF2A 2XGQA 4DTSA 4F2SA 3F9KA 1KFTA 1SKSA 4QWEA 4DFMA 5KG6A 3QEXA 5HMLA 2J6SA 1IO2A 3GIIA 3VQQA 5SWMA 2KZZA 1JLGA 2XY7A 1EP4A 8ICBA 1XSPA 1D8YA 2RPIA 4TUQA 2BPFA 4CJSA 5KT2A 3TAQA 2X6SA 1X9WA 1N48A 3CYMA 4KHNA 3V7JA 3Q8PB 4PA1A 3OSNA 1NOYA 3NH0A 3KHGA 4KHUA 3TR8A 3MECA 4JRPA 4GXKA 4Y1CA 4M45A 3VQ5A 5KFDA 1HJRA 3L2RA 4YD2A 1N56A 3I0SA 3V9UA 4KPYA 4RUCA 4P4MA 1RXWA 3HXMA 3BJYA 3EW9A 2W8LA 1DLOA 5KFIA 8ICEA 4QW9A 3V7LA 1VSDA 3ULDA 4MEYA 5L1KA 1NJXA 1UT5A 5KFFA 1JX4A 2YNGA 2NRVA 1QE1A 1FKOA 3G6VA 4R5PA 4KN4A 2E6MA 2AQ0A 9ICLA 1K6YA 4F93B 4W5NA 3RBEA 2FBTA 4DQPA 4DOBA 1YTUA 3VQ6A 4GC6A 3DMJA 2VA8A 3QNOA 4RPZA 5D4BA 3PMNA 4O3RA 4Z0UA 3SJJA 3LPUA 3OYEA 8ICVA 3KHRA 1NOZA 3TI0A 2HHQA 3QE9Y 4EYHB 7ICKA 1XHZA 5J2AA 4R8UA 3K5OA 2PFPA 3PX6A 4KHWA 4O5EA 2Z1HA 3RH4A 4O0JA 2FLLA 4ECZA 1S1XA 3ZT4A 4C8KA 1EETA 4CK1A 1HJPA 4QZ9A 1XHXA 7ICSA 4N41A 4R66A 8ICIA 4I2IA 1JMSA 4FW2A 1BCOA 4MEXA 3EWAA 4DQRA 3B6OA 4QAGA 1A5WA 2JGUA 1FKPA 4J9OA 4AHVA 3KD5E 1ZJMA 4ZTJA 5DB9A 1QHTA 1S0NA 4I2AA 1ZBIA 4QZHA 3TFRA 2ZUBA 1ZQYA 4JWMA 4FJMA 5JS1A 3P83D 2P6UA 4ECVA 2YHAA 3GV8B 3B0XA 4NCGA 4K8ZA 4FZYA 4F50A 4BDPA 4YXJA 2KFNA 7ICEA 4E7IA 4HCBA 3ZSYA 1S9GA 1LWCA 1DOQA 3C6TA 1QTMA 3RH5A 1WSHA 3TARA 2AJQA 3C1ZA 4G1QA 3PW0A 4KLTA 3QESA 4I2FA 1CUKA 3AVMA 4E7HA 5J0YA 2DFHA 2ZTEA 1RTHA 4DU3A 1WCNA 2JLEA 4FJ9A 5KT5A 4DQIA 4CHOA 4J2EA 4M04A 1EKEA 1SV5A 2P51A 1T8EA 1IXRA 2BCVA 4N47A 4P4PA 1COOA 4PHAA 4JK1A 8ICPA 4CFBA 2UVWA 4Q43A 5KFHA 4FJNA 2FC0A 3OYFA 4CJLA 3HVTA 2VA2A 1KVCA 1U04A 4DTPA 3OYIA 2FMQA 5HP1A 5HRSA 4LSLA 4HVJA 4CJ3A 3CQ8A 1JL2A 3SUNA 3JPNA 4DU1A 3C95A 1UWBA 4F4KA 4JWNA 4LD0A 3DOKA 4CIEA 4CJWA 5HLFA 1ZQBA 1ZQHA 4ICLA 1ZQFA 5HROA 3GIJA 3UXNA 1GOBA 5JUMA 4QOZB 4J9QA 4KO0A 4FJKA 1WSGA 4RW4A 4CE9A 4I2JA 4I2EA 3GILA 4KB0A 4QWAA 4O3PA 4CGGA 4MFBA 4EZ6A 3O3HA 3MDCA 3MXJA 4CGDA 3UIQA 2AGPA 1QSSA 3OYLA 3HJFA 4L8RB 5KFWA 3PV8A 2ZD1A 1KCFA 3V6DA 1FXXA 1ZQOA 8ICNA 1L3TA 3AVIA 2G8KA 1JLFA 4I7FA 3PW5A 3H8WA 3SPYA 4CERA 2B4JA 4OKJA 3AVCA 5KFMA 3D0PA 3DLRA 3CFPA 3L8BA 4FLZA 4KAZA 3V6KA 4OLBA 1ZQLA 1LW0A 5KRTA 4BACA 3DYAA 4I9QA 4NLGA 3DRPA 7ICOA 4F8RA 4J9MA 4RZRA 4RQ6A 1RTIA 4N56A 2JZBB 2VANA 1BL3A 3RJIA 3I8DA 1SZPA 3GFKB 2O4IA 3OYNA 4DL2A 2X78A 3M9MB 4KHSA 2Y1IA 3MGHA 4HUEA 2JEIA 3PNCA 2HNYA 3WNFA 4K4HA 5EWEA 3LWMA 4RT2A 3DLGA 1BVSA 3IAYA 3ZSQA 4CEBA 5J0OA 3B6PA 4LY7A 2IAJA 1SUQA 2ZQBA 3RMCA 4DSKA 2BQUA 1TGOA 4O3QA 3RMDA 2HNDA 4GLXA 2DFLA 3E2EA 3HP6A 4RPYA 3K5NA 4DS5A 5EOZA 3PX4A 4O5BA 2G8HA 1NJWA 1UAXA 3NF9A 1NK8A 1JXEA 4DSLA 2VWJA 4J2BA 5KFXA 2FBVA 5F9LA 4M41A 2OYQA 2HHTA 4CEZA 3H08A 3S3NA 3JPTA 4H8KA 3OJUA 4ELVA 3IRXA 2WONA 4F3TA 4OGEA 4UB3A 4O5CA 2ALZA 1ZQRA 3ZT1A 5JS2A 2R8HA 3NH1A 3KLEA 4YD1A 4EBDA 4UBBA 4LZDA 4M42A 4O9MA 4FS2A 3AVJA 3V9ZA 4F4YA 2G8IA 1UT8A 2HW3A 1ZQZA 3SI8A 5E41A 3HVRA 1S1WA 4M6WA 2KTQA 4M3YA 1L3UA 1RT2A 5HHIA 5BOMA 3QEAZ 4CK2A 4N76A 1BQNA 4Q0BA 1ASVA 1DTTA 4ED3A 4B9VA 8ICHA 4IRKA 4NM1A 2IS3A 9ICMA 4NY8A 4H4OA 5D46A 2YKNA 4JRQA 4C8MA 3PMLA 3RAQA 2OWOA 2I1QA 4QWDA 3ZDAA 1QSLA 4RNNA 4E7KA 4M3UA 1TL3A 1Z00B 4CGIA 5KFAA 5CA7A 7ICGA 3QEVA 4YVZA 4DO9A 3C2LA 5KFZA 3G10A 1K1QA 2HHVA 3KK2A 5KFBA 5CZ2A 3A2FA 4F5QA 3AA4A 4GXJA 1VSHA 2H5XA 4RQ0A 3ZSRA 8ICLA 3I0RA 1D8LA 1WN7A 8ICYA 4I28A 1RNHA 4DTMA 3SQ1A 2MAXA 4I2CA 4OLAA 3QZ8A 2YV0X 1TK0A 1S1VA 4O55A 1KLMA 3V1OA 4R8UB 1ZQCA 3TAPA 4AHUA 4C8LA 4ED7A 1ZQMA 3MABA 1T3NA 1X9MA 3UQ2A 3K5MA 3KLFA 1C0MA 3AVBA 4JV1A 1YT3A 2IHNA 4AILC 4OPJA 2W42A 3KLHA 3O3FA 1HUZA 2I9GA 3QNNA 3ETLA 3NAEA 4J9SA 4UB2A 3SQ2A 3V1QA 4O0IA 4CECA 4B9SA 3HL8A 1IKXA 3NGYA 3K59A 1ZQXA 3DLBA 4LVSA 4GVMA 2D5RA 2I5JA 5J2QA 4PQUA 1CXUA 3M8QA 4FW1A 1JLCA 4KFBA 5IINA 3NHGA 3NGZA 1RT5A 3VQ9A 4OKEA 4FM2A 1VSLA 2XY8A 4CJPA 3D45A 1L3VA 1ZJNA 3QLHA 5KGXA 3NFAA 4EZ9A 1YVUA 2V4RA 3L3VA 1BIUA 4CJ4A 3ZSXA 4Z6DA 3LP3A 3ZDBA 4NLNA 1JN3A 3THVA 1LV5A 1NKEA 8ICZA 5I3UA 2IHMA 1LAVA 3BQTA 4CJEA 3SUPA 4DWIA 3CG7A 3PUFA 5J2PA 3C21A 4HUFA 3DM2A 2DFEA 4YG2A 2F8TA 4PPXA 5EWGA 2PFQA 5KFNA 4BE1A 4AHCA 5BPCA 4I2HA 5D49A 4CF2A 1RBSA 1BPYA 2DY4A 1TK8A 2BPGA 2Z1IA 4UAZA 4Q45A 3KK3A 2PZSA 1IKWA 4K4IA 3PW7A 4KTWA 3VN5A 3C2KA 5KG1A 2A1SA 4GW6A 1JLEA 1NOMA 1IM4A 3SV4A 3QIPA 2PYJA 1JKHA 2BCRA 2RDJA 7ICMA 8ICSA 4RU9A 3G6YA 3TFSA 1WAJA 2D0BA 4ZHRA 3U6FA 2AU0A 4DU4A 1S6PA 2ZTDA 1VSMA 5DQHA 2XGPA 2HHUA 1WSIA 3LZJA 1RYSA 3Q8SB 3SQ0A 4WE1A 2JEFA 3LP0A 4P4OA 4J2AA 1RT6A 1RT7A 4DL4A 3RMAA 5TZVA 1C6VA 1Q9YA 4CJQA 4AHTA 1LB2B 1A77A 4KTQA 3LALA 1X1PA 4BDZA 4ID1A 3DRSA 2FPMA 2GBZA 2W9AA 4FS1A 4W5QA 8ICXA 4W5RA 5CR0A 2E4LA 1C0UA 1ASWA 1IKVA 4DEZA 3M8RA 5HHHA 5KFOA 3ISCA 3NF8A 4IG0A 2EX3A 3ZDEA 1HYVA 1RXVA 1TKXA 4M3WA 4RNOA 1T4GA 5KFPA 3KLIA 1ZQEA 4OGCA 3LANA 1REVA 5J2HA 5D3GA 4ED6A 1UA0A 4DSIA 1KVAA 2IOCA 2OPSA 3GV7B 1CLQA 1C0TA 7ICFA 9ICBA 4JS4A 1WSJA 3RMBA 3ZD8A 3H4BA 4QZIA 1B22A 3Q8MA 3RH6A 2Y1JA 1NK4A 2ASDA 1KFSA 5F9NA 5FRMA 3PO5A 9ICPA 2UVVA 3MBYA 3GQCA 2UVUA 9ICEA 4M3ZA 4E7LA 4F5RA 2ZUCA 4ECTA 3RRHA 3IS9A 4CJTA 4F4WA 4YMOA 5DDYA 1RDBA 5FDLA 3ASMA 4LH4A 2R8KA 1S0MA 4MFAA 4JV2A 3O4NA 4FLVA 2ISPA 2Z1JA 1BGXT 2BPCA 3F73A 4DTXA 5KFRA 3RB0A 3HW8A 4YFUA 1U4BA 3KK1A 9ICFA 3MXIA 1ZETA 4QZAA 2HHWA 1S9EA 1BISA 2OZMA 4FJ5A 2R7YA 1VSIA 4FYDA 4RW8A 3PX0A 4CCHA 1B43A 1TAUA 1KLNA 1S0OA 4RQ3A 8ICTA 1BPXA 2PI5A 4MFCA 5C24A 1Z25A 3V9SA 1S76D 3OYMA 5J1EA 5KFKA 1RT4A 1TVAA 4I2GA 3HYFA 1MU2A 2E6LA 4RW9A 1VSJA 2KQ2A 3NDKA 4M6WB 3QEIA 2B5JA 3ZSVA 3N4MB 4G3IA 2MUTA 3LK9A 4CESA 5DBCA 9ICWA 4PY5A 4UAWA 1ZBFA 3AVHA 1RDDA 8ICCA 2XO7A 4QZCA 1SL2A 4H4MA 4LH5A 2JEGA 4QCLA 1LAWA 5J0WA 1EXQA 5IIJA 4CHYA 4CF0A 3G0ZA 1KTQA 4M3RA 3IHQB 1S1UA 3DLHA 1UA1A 2VWKA 5J2FA 3VQEA 2ZJ5A 4ED8A 4FBUA 1X9SA 3EZ5A 1CZBA 4BXOA 4Z4FA 2P6RA 2G8VA 2D0AA 2IGIA 9ICSA 1TV6A 2R8GA 1LWEA 3C5GA 2GWSA 1VRTA 2RF2A 7ICLA 7ICJA 4CF8A 3QZ7A 3VQPA 5J2JA 2OPPA 1N5YA 2KZ3A 2P66A 4CEAA 3LWLA 2PFNA 3ZDCA 1S9FA 3ZT2A 4CIFA 4FK2A 3JPQA 1T03A 2C2EA 3RRGA 4KLDA 4KLGA 4W5OA 1S97A 8ICRA 1KEJA 1HPZA 5J0QA 4CEQA 9ICIA 2G8WA 4IG3A 3KKSA 2X74A 3NTUA 1JLQA 1BCMA 3O3GA 5HRNA 3RB3A 1S6QA 1L3SA 4CK3A 2FMPA 9ICHA 1HRHA 2AQ4A 1TL1A 3AVFA 4CHZA 5IIKA 3LAMA 2P1JA 1TFRA 4YMNA 4TURA 4UAYA 4FLTA 4Z4HA 1BQMA 4M3XA 1ZQTA 4C8NA 2W9CB 5KFUA 4I2PA 4IDKA 4NYNA 4HYKA 2EHGA 1CZ9A 3WNEA 1ZQUA 4CHNA 1XSNA 4EP4A 2HHXA 4FJLA 1NKCA 4Z4EA 4KLSA 2ATLA 3RJEA 4FJHA 1HNVA 1MC8A 3V81A 3M8PA 4DTRA 7ICNA 4UQGA 1HQUA 1WNSA 5J2CA 3OYAA 3GDXA 3T5HA 1FK9A 5KT7A 7ICTA 1ZQNA 1G15A 5J0TA 1ZBHA 3L2QA 4CHQA 2OPQA 1D5AA 4B8AB 4KI6A 4DFKA 2IC3A 5J2EA 4FJ8A 1R0AA 5DB8A 5KG5A 2A1JA 3RJHA 3SUQA 3PR5B 3RJGA 1XWLA 2J6UA 1KFDA 4CEEA 4YR0A 4IR9A 2D0CA 1ZQJA 5DDMA 5FROA 7ICIA 4N5SA 1U47A 4I29A 4YNQA 1NJYA 2ISOA 3OYHA 2BDPA 2ZE2A 4UB1A 1SL1A 4CFDA 1HQEA 5J0SA 3PY8A 3CM5A 4Q44A 4RPXA 1J53A 1ZBLA 3KHLA 3HPHA 3OYDA 5DG8A 4K4GA 2LSNA 2NRZA 1JXBA 3NF6A 9ICGA 3S3MA 2NUBA 5IILA 1J5OA 4DSEA 4IRDA 2Z1GA 9ICQA 1TK5A 1RDCA 4BWJA 5KFGA 4M0AA 2M9NA 4YR3A 2RDIA 4XRHA 2HHSA 1Z00A 1A5VA 1NJZA 4DS4A 3VA3A 3SCXA 3H8SA 1B9DA 1XS9D 4CGHA 4AH9A 4NLKA 3RR8A 2JZBA 2FLPA 2YNFA 4HTUA 1U9LA 4FJGA 2ASJA 1XC9A 2YNIA 2HVIA 2BR0A 4YP3A 3K2PA 5IIMA 4ECSA 3NH2A 3GIKA 4ED2A 4CIGA 2P5GA 3EPIA 4B9NA 4B9MA 4ECUA 3AA2A 5KG0A 4R65A 1W0HA 4RQ4A 4FM0A 3AVAA 3ZT3A 1SKRA 1C7YA 4JLHA 1ZQQA 3C94A 3MGIA 1RCHA 4J9PA 1LWFA 2B21A 8ICWA 4ELTA 4DF4A 3VQ8A 1KSPA 4O5KA 1WAFA 4I2QA 4M9HA 3T1AA 3QETA 3QEBZ 9ICRA 4FJ7A 1VSEA 4DTUA 5J0XA 1B9FA 1JLAA 3WNGA 5KT3A 3Q8QB 7ICHA 3PW4A 3LP2A 2ASLA 3RTVA 1WSFA 4RQ1A 5L1JA 2RN2A 4DF8A 1RBVA 1Q8IA 2NRXA 1BPBA 2VG7A 4FBTA 3UPQA 4HUGA 1Q9XA 3S9HA 4DFJA 1MSWD 3HP9A 3VQ7A 3O4QA 4LSNA 4DLEA 8ICQA 3ZSWA 4KTZA 3EY1A 4IQVA 5HRRA 1EXNA 1WLJA 4KN7A 3T5KA 5T7BA 4UB5A 4KHQA 2LYHA 3MAQA 3NGIA 5J2KA 4B8CA 9ICKA 7ICUA 3L2VA 3KKRA 4CEFA 5L1LA 1Z3EB 4MF8A 4DQQA 4FVMA 3T19A 4KITB 3Q8KA 3DI6A 4DTOA 3C2MA 3JPSA 3N97B 5CJ7A 3T5JA 4IKFA 2W9BA 5DLGA 3AO5A 3E01A 5HBMA 4M2YA 3ISDA 1K1SA 2MUTB 3MFHA 4FLXA 5HP4A 3ZCMA 3NBPA 2AGOA 3KJVA 4TUSA 1X2IA 1BPEA 3WNHA 4RQ5A 3TANA 1T7PA 2OA8A 1BI4A 2WOMA 2PFOA 3KLGA 4KLEA 1ZQPA 3VQBA 1QS4A 5DK5A 4CJFA 3PR4A 3SV3A 4ECWA 3VQAA 2ATQA 4KB1A 3KHHA 1HUOA 2ETJA 1UOCA 1CXQA 1IKYA 3U3GA 1ZQDA 1B92A 3NCIA 8ICGA 2W8KA 2GV9A 3JYTA 4PH5A 5J2IA 4MQ3A 4O44A 5C42A 4RW7A 2VG5A 5KG3A 1ZQIA 4QZDA 3ZD9A 3SNNA 4M47A 4Z4IA 4I2DA 1VSKA 2BHNA 4XIUA 4E1MA 3AVNA 4OPKA 9ICTA 5KI6A 2ZJ8A 4Y1DA 3ZDDA 4E1NA 4IQUA 4R63A 4IQTA 8ICAA 4YR2A 3OHBA 3AO2A 9ICNA 2AGQA 2G8FA 7ICVA 3MR2A 1NK5A 9ICVA 1KDHA 1HMVA 5L1IA 3HWTA 4JS5A 1I3AA 5J0UA 2BQ3A 4ZTFA 4YQWA 4F4ZA 1NK7A 4AHSA 3RJJA 3PO4A 1RBTA 4ECQA 4RG8A 2DPJA 3ZSZA 3MR6A 5DQIA 3IG1A 2P5OA 3DLKA 4PGXA 3NE6A 3SQ4A 4UB4A 4EBEA 4M3TA 2JEJA 2VG6A 4DL3A 2PXIA 4DL6A 4PHEA 2C28A 4F5OA 1VSFA 1NKBA 3C5FA 4RUAA 4IFVA 3DRRA 2IDOA 2O4GA 3LDSA 4DSFA 4LZGA 1U49A 5EWFA 2PYLA 4NM2A 3KTQA 2BGWA 3AVKA 3L3UA 2IBKA 2C2DA 2KFZA 5J2GA 7ICQA 2BKEA 4YN4A 3Q8LA 4PHDA 3AVGA 3TQ1A 1RZTA 4QZEA 5KFVA 3K75D 4K8XA 2DTUA 1A76A 2R8IA 5HMMA 3QEWA 4IQWA 3QINA 4QZ8A 3HK2A 1RILA 3CM6A 4J9KA 4FLUA 1SL0A 4ED0A 4C8OA 4Q5VA 1ZQSA 1S77D 1S1TA 1U48A 4B9UA 1AROP 1GOCA 4QZGA 4Q8FA 3OS2A 4KHYA 9ICOA 2QKBA 1S10A 2FBYA 5KT6A 4KLMA 2XCAA 2ITGA 5KFSA 4IBNA 2ZUDA 1MQ3A 3T5LA 1H38A 4TUPA 4TQRA 5KG7A 4R64A 3MFIA 2BQRA 1RTJA 3HPGA 4Z4CA 1TKDA 4E3SA 1IH7A 3OYKA 4ELUA 4DTNA 4I2BA 3RR7A 3ALYA 3C6UA 1U45A 4QW8A 1S0VA 2XCPA 5J2NA 3FDSA 1RT3A 4DQSA 4BXOB 2BCUA 4O3SA 3LP1A 4CEDA 1S5JA 4XA5A 2VA3A 3C23A 4DLGA 2BE2A 3P1GA 4CJVA 5CYMA 3OSPA 4OVLA 3K4GA 2OPRA 4OJRA 1BPDA 4ECRA 1ZBUA 5KFYA 3AA3A 3MR3A 4ZH4A 5DG9A 3JPOA 1NK0A 1RT1A 4XQ8A 2ZTCA 3PW2A 4E89A 2DPIA 4E19A 1HYZA 4IFYA 2PY5A 1HNIA 4B9TA 1D9DA 1WSEA 1C1AA 2HVHA 4F5PA 4ECYA 1TKZA 3OY9A 3OS0A 2C22A 1XU4A 2QKKA 3K5LA 3VA0A 3Q8RB 3FFIA 1NK6A 3FYHA 1Y88A 4KKOA 4CJ5A 4Q8EA 3EYZA 3SZ2A 1KRPA 2F96A 3V4IA 9ICJA 4B9LA 1JLBA 4B08A 5DB7A 4FJIA 5DB6A 1JXLA 5CWRA 3V72A 1ASUA 4OKKA 4BE0A 2FLNA 3AO1A 3OHAA 5KFQA 3G6XA 1ZQGA 2HNZA 3LAKA 3M9OB 4RQ2A 5J2BA 9ICUA 5I42A 1TAQA 1ZQAA 4F3OA 2IA6A 1F21A 4J9LA 5KFJA 3HM9A 1RYRA 3V9WA 3BQ1A 1TKTA 3OVNA 2W9CA 3UXPA 4HCCA 3LDAA 3M8SA 3GV5B 4YFKA 5DGAA 3AO4A 4P2HA 2XRIA 4NLZA 3B0YA 4KLUA 4FM1A 1JL1A 2QXFA 4PGQA 2BCQA 4BDYA 4I9LA 3ZT0A 4CF1A 3KIOA 2A1RA 4BGDA 8ICOA 2Q0ZX 2J6TA 3JSMA 3QO9A 1ITGA 4EEYA 5CB1A 4KV8A 4B3OA 3KD1E 4TSXA 1ZQWA 3RBDA 4YCXA 4E0DA 3OYBA 1V9PA 4EP5A 3CFRA 1DGSA 3AO3A 4M9GA 2NRWA 5J0RA 1RDAA 5CP2A 4O3NA 4F91B 4AHRA 4FJXA 1RBRA 4IR1A 5DKWA 2GUIA 2XHBA 4EYIB 2BANA 5IIOA 5DBBA 4JUZA 5DQGA 4CGFA 4FZZA 1XI1A 5KFLA 4JV0A 5CY4A 4CF9A 1XSLA 8ICKA 2F1JA 4QWCA
chains in the Genus database with same CATH superfamily
1KQGB 1KVBA 4GNIA 3K57A 2V4QA 4X62J 3NNAA 4YDUC 3JXOA 2R2RA 3CFOA 4K0KK 3U3YA 3DHXA 2HKEA 3H2UB 4MFFA 3P3DA 4ED1A 4JKHA 5JMVA 2RHSB 3CCUN 2FI1A 1VDVA 4DMNA 1ZRNA 2PA8D 4B1ZA 3EDRB 1PYOB 3OTCA 4NYFA 2IVFB 1N60A 1J5OB 3ENBA 3WX4A 4J2DA 2CNNB 2KM8B 3MM9A 3GIMA 4FO6A 4KLJA 5C5JA 2VU5A 3AV9A 4KHPF 4UB6U 1CJUB 3IWXA 3QEPA 1ZZNA 4I27A 1SZ2A 2DO0A 4DR7K 3H8YA 2K1RB 1VLBA 3D6TB 4JI8K 4KHPK 5KT4A 3AU2A 3OYJA 3SAGA 4DMZA 3B8HA 2OUGA 9ICAA 2ILZA 1GH8A 4P0QA 1BLUA 2NYIA 5KPTA 4NZ6A 2CZ9A 3LDLA 4DV4J 3T1YF 1U1KA 1O6XA 2YJFA 2F1IA 4ZVSB 1AUSL 2BBEA 5DBAA 2LP4A 3MD3A 2OP5A 1KHVA 4B9QA 4BC3A 2VC1A 1YHQS 1O1WA 2NO5A 2XY6A 5E0OA 1AFJA 2F77X 1BI4B 1J54A 3QDKA 1QVFR 1ZOTA 3QUTA 2XC9A 5KPRA 5HATA 3PVXA 3CE8A 4QZBA 4LQ9A 3V6HA 3HSJA 1V4SA 4GRSA 3UB5A 3WK6A 2I6WA 2FMSA 5J2MA 3UW1A 5DLFA 3SD7A 3IBWA 3CCUS 4IFVB 4CZHA 1WBBA 4KLLA 3O9UA 1VBKA 3GL1A 3T69A 4KRFA 5HQLA 1SB6A 1YG0A 1XMQK 1FJCA 3EVOA 5E3CA 3V1RA 2HZAA 1C1BA 3TABA 3VQCA 2O1PA 3NF7A 4GMJB 4DL7A 4X5VA 3HRGA 3OGUA 1XR6A 4BX9C 1HYSA 3I82A 3OR1B 4X4OA 4QYZK 4M5KA 5BN9A 4JI6K 2V7YA 2VONA 1S1WB 2Q6CA 5A6WA 3WDOA 4LF4J 2I7NA 3SAHA 3TKAA 5FRNA 3MEGA 4F92B 3T3FA 3EPGA 2HGLA 5T14A 1RPLA 2HMIA 1EWRA 3TOQA 4OHVA 2WVEA 2WAQC 5E3QA 4ZJLA 4AM7A 2FGOA 1OQ6A 1UJ6A 3BF1A 1QLNA 4LIRA 1NNLA 3OJSA 1Q81O 3P4IA 2GVDB 3CC4S 4PWDA 1UWBB 4ETXA 2NRTA 3NRZA 1V5IB 2ILYA 2KJVA 4Y2UA 4Z6FA 1WB9A 3O6WA 2CN1A 4E7JA 4DX7A 3UQ0A 5L9XA 4DV6J 5F3ZA 3VQ4A 4O5FA 5KFTA 3L2WA 3ZO7A 2DGZA 2YNHA 3J80U 3ONQA 3TTDA 3FZMA 3N6LA 5AE1A 2KN7A 3QIOA 1S1VB 4MIWA 2QWQA 3WXJA 2IM0A 4CLPA 2KB2A 1BA1A 1J9AA 1U6ZA 1W2BR 3NGDA 1WNEA 4JB8B 1RBUA 4ECXA 1VC0A 2DNZA 4ZVRB 2J0SD 2XY5A 5BPNA 2OI2A 4PQUB 5AM0A 4DSJA 2LYBA 1IBMJ 3L2UA 2F1HA 2WSFC 1PILA 4N8OA 1CEZA 3R1LA 1BOTO 1UL3A 3VERA 4K25A 4FZXC 3R7BB 2YPZA 5IIIA 4FVCA 4KJIA 4K5SA 5CXTA 2I5JB 1SKWA 2EFNA 3G6ES 5IS2A 2B6GA 2BMBA 4NCAA 1MWQA 4RT3A 4PAAA 3KZIU 1IG9A 1VOMA 5AR0A 2DYAA 3ITHA 4NCGB 4K4TA 1XO1A 4DV5F 3DM2B 3FMWA 5AQGA 5AKIA 3AUOA 1KOHA 4KV8B 3CHWA 3NGRA 3C6AA 2XGQA 4BHQA 4F2SA 4C98A 4DHYA 1KFTA 3P5TL 4DFMA 5KG6A 2RDDA 4DV4K 1UW4A 1S59A 1PC4A 4WCEL 2ZJRL 2IJNA 1JLGA 2HNYB 2X3GA 2D7SA 2XY7A 2AEMA 1XSPA 4CTAA 2A18A 2E7XA 4F67A 1QJHA 4CJSA 4F25A 4ZPAA 5KT2A 1X9WA 4OV1A 1YI2S 3JSMB 4K50A 4MK7A 4JI4F 3O5BA 2QKQA 3CCTA 3M1VB 4KHUA 4NYPA 4KH4A 3MGJA 3IGNA 3TR8A 3CIPA 4JRPA 3EEQA 4GXKA 3A5OC 4Y1CA 3UKRA 4ILGB 2OTJN 1RWPB 1F5AA 1T02A 1HJRA 3G87A 4USJC 3B4MA 3V9UA 2Q0UA 4KPYA 4RUCA 2VJ4A 4NXMJ 1UCNA 4P4MA 3HXMA 3BJYA 2NXNA 5KFIA 1X7VA 4U67Q 4QW9A 1SC6A 1R8AA 2I9SA 2MY8A 1WUUA 2W3RA 1NJXA 1RSCA 1UT5A 4MKVA 2R7TA 5KFFA 2PEBA 1X4DA 4KH1B 3CCJS 4X62K 3NVZA 5IT9Y 3WQUA 4CW7B 3SCJE 5M1NA 1QE1A 1JCFA 3HKZF 3QO9B 4GVEA 2VJ5A 3BREA 2E6MA 3HZGA 1Q79A 4RWXA 2EFVA 1YTUA 2CVIA 2MEWA 1DK2A 3J81O 4CLSA 1U2VA 5TKYA 8ICVA 3D3CJ 1RWKB 4FZNA 1NOZA 5AQOA 4LC9B 1JLBB 1LFWA 2KYXA 4K4VA 5F2RA 2Y0SF 3K1ZA 2PMHA 3IAM9 1FKAF 4JHDA 1L8OA 1T05B 3H59A 2PFPA 4K7QA 4DCHA 1Y9OA 4BQZA 3Q8UA 4O0JA 3HULA 2HPUA 5CD4H 1H6KX 4C8KA 4QZ9A 3CO9A 4N41A 3KVGA 5ALUA 2FYXA 1RP5A 3BN7A 4URSA 3C2PA 1XJWB 2Q31A 3EWAA 2HURA 2N82B 4ISFA 1A5WA 2KRBA 2XMJA 3W5XA 1ZJMA 1U25A 4ZTJA 4LF2A 1QHTA 1S0NA 4JI6J 2W2PP 4JWMA 4FJMA 3UMGA 2DNQA 2CA9A 3P83D 2P6UA 3U9DA 3RG6A 2ESEA 4NCGA 4A57A 5DM6L 4ZVPB 2KFNA 7ICEA 2GO7A 2CPJA 3H20A 3ZSYA 2M70A 3L4BC 1LWCA 3WQPA 1TYQA 3C6TA 2GNKA 4M5IA 3C1ZA 3MCMA 3PW0A 2B5JB 5D77A 3D7EO 3E8OA 2MKSA 3Q8YA 2W43A 3ENHA 1X5PA 1LXJA 1RTHA 4DU3A 3FBEA 1RAAB 2O8BB 4FJ9A 4Y2TA 4M63A 1O08A 4NRTA 3ULEB 1OJ4A 4J2EA 2MQOA 1EKEA 3L7UA 5IQ6A 2ZH6A 1YJVA 3M8PB 1A0OB 4PHAA 1YRXA 3UNYA 4H4MB 4LFCF 1BUXA 4BGBA 2XSFA 2ACYA 4CJLA 2VBYA 1KVCA 3D1HA 5D4NA 3WT0A 5JRTA 1RWVB 4CJ3A 2QWLA 4USMA 3WK8A 2YKOA 4H54A 3BQ7A 2DH9A 4CIEA 5HLFA 1ZQHA 4PKDB 1ZQFA 4Z2XA 2CQDA 4IO9L 5GTHU 4FKYA 2VPWB 1MA7A 3WZ0A 1OSCA 5D0GA 2RE1A 4PHTX 3QX7A 1WSGA 5AK6A 4CVNE 3UDEA 4I2JA 1REVB 4I2EA 4QR0A 4DG1B 4FVUA 3F5AA 1JJ2M 2LEPA 5ALDA 3L5KA 2R7VA 3OLAA 3NMRA 4OHYA 3MDCA 3WIVA 1RT6B 4PG7A 2AGPA 4UOFA 4L8RB 1OS5A 2ZD1A 2DT9A 1ZQOA 4M5LA 1JLFA 4DV6F 2B4JA 4OKJA 1HNXF 1IBMF 3CFPA 3L8BA 2EH9A 2OYYA 1N54B 4P74A 1ZQLA 1ZC6A 4DPWA 1L7NA 4IH5A 5CYJA 4FWLA 4I9QA 2VJUA 4NLGA 4J8FA 2A1AA 5B0CA 7ICOA 4F8RA 5F0WA 3ZZZA 4LF9F 1RAHB 1RTIA 1NJIT 4N56A 2JZBB 4FWKA 3I8DA 3RJIA 1HPZB 3GZFA 4L3NA 1DKGD 4DL2A 4OYOA 3M9MB 2X78A 3HHNB 3J7AP 2Y1IA 4HUEA 2HDOA 4PQAA 1K0VA 2MXYA 2JX2A 5EWEA 4MH8A 3LWMA 2V8DA 3TP2A 1BVSA 4PXDA 2F4VF 2OAUA 5J0OA 3B6PA 4C8YA 2IAJA 3AQPA 3QMQA 3OFHA 4DSKA 1YTYA 2BQUA 2DEJA 4NB4A 3RMCA 4B1VA 4O3QA 2RNEA 3W9JA 3PRVA 2HNDA 4GLXA 3E2EA 2ZIVA 3HP6A 3SBMA 3KXDA 2E2NA 3LOUA 4O5BA 1HARA 1UAXA 1P7DA 2OO4A 3PJXA 1JXEA 4C0BA 3CD0A 1DXSA 3W2VA 1VQNN 1ZM9A 2BM0A 3N5FA 2OYQA 3NP5A 2HHTA 3H08A 3E51A 4I6MA 4LSZB 1NSQA 2HS4A 3OJUA 3M2VA 4ZCKA 4ZPVR 2FIUA 1AW0A 4K2JA 3AL0B 3ZT1A 1J5EK 2B9WA 1WTBA 5JS2A 2OTJS 4EBDA 2IM2A 5H1SQ 3V9ZA 3QGPA 4CD3A 1UT8A 2ROEA 3FSXA 3PYDA 2OFGX 3HVRA 2RQCA 4GV3A 2AXTU 3NXZA 4JD2A 5HHIA 5A8RB 2E8MA 2KE7A 4K4UA 2ZHBA 4CK2A 4N76A 4P72A 2LA6A 4B9VA 1ZA2B 1E4GT 2DXFA 2E9TA 4C8MA 1NSKL 2HS0A 2CAJA 4L75A 3ZDAA 3O80A 1ELOA 5GAHI 1SZHA 4CGIA 4OJHA 3VALA 2HZVA 3WUHA 3TACB 2ZVIA 5MLCQ 2MTLA 2V4JA 5KFZA 1K1QA 1XQIA 2D41A 1KL9A 2IPOB 5ETVA 4WKYA 3H2LA 1TFYA 4M1KA 1IR1A 4PZOA 4NXNJ 3DDNA 3QBWA 4UOGA 1U1LA 5HR6A 8ICLA 3I0RA 5HVHA 1U1NA 1XEZA 3SQ1A 1S6QB 1RNHA 4OLAA 1FNOA 3EVMA 4JHDB 1RB0A 1KLMA 5AHXA 1UETA 3MPYA 3TAPA 2DNHA 1QAXA 4WBFA 4C8LA 2DWQA 1JCEA 1C4CA 4FYXB 1MMDA 4DUZJ 1T3NA 1IWGA 1X9MA 4USWA 3OL6A 5D0HA 3KLFA 5JU5A 1C0MA 1YT3A 1FRJA 1TMJA 2IJFA 2YPYA 1EAYC 2IHNA 3PXGa 3KLHA 3EICA 2EZXA 4GKKK 5F8IA 4J9SA 4FWNA 3ZZOA 5IC4B 4O0IA 4LF4F 4G1QB 2H51B 1ZXOA 3HL8A 4Y0WA 1IKXA 2Z2MA 2WBMA 1U26A 2RT3A 3FR0A 2XMAA 4DV6K 3KJFB 5J2QA 4PQUA 1CXUA 4UOCA 4MDBA 2VQFF 3N9UC 4MKYA 3TEGA 2QI2A 1UMJA 5IINA 4QS9A 1RT5A 3NVYA 3NWRA 1KN6A 1SIJA 3V2UC 4FM2A 3QAUA 4OZ5A 3QLHA 2QMXA 2VG7B 2GEMA 4I2QB 3GE1A 2QWPA 3L9ZA 1COKA 2OPQB 4MN4C 4YHHF 4EZ9A 5BN8A 2V4RA 4F4AA 4FPAA 4BBYA 2IC3B 4CJ4A 4Z6DA 1JN3A 2ERRA 4K5RA 4NL9C 4F7VA 1LAVA 4X64F 1C1BB 1RI7A 2CRXA 3THXB 4DWIA 3CG7A 1JJHA 3DOKB 3T1HF 2B9YA 2BOAA 1C1CB 4BRCA 5ALGA 3DM2A 4GVBA 5ALFA 3QGIA 1G1XA 1HNWK 1P8ZA 4PPXA 1CG2A 2BUPA 5K8OA 2VFTA 3MPWA 1DK3A 1NU0A 5KFNA 4BE1A 4AHCA 5AQWA 3VEYA 2E8NA 4D3HA 2RRDA 4CF2A 2CPDA 1BPYA 1TK8A 3S8SA 2BPGA 4N8NA 4UAZA 2OFHX 2XM3A 1IKWA 4K4IA 3JS6A 1QVGR 2SXLA 3VN5A 1TFWA 4F0MA 4PWDB 5KG1A 4OIXA 1JLEA 2YX6A 4PXCA 1VCTA 3AODA 2FJ6A 2ZBPA 3P5BP 5DDRC 2VOOA 1DBDA 1JKHA 7ICMA 8ICSA 3U1MA 3AJDA 1YVFA 4RU9A 1L7MA 3H1VX 1SCJB 4AQYF 2D0PA 2XS2A 2J4RA 1VQLN 4GIBA 2HHUA 1TL7A 2HOFA 2GS8A 5DM7L 4B3RF 1VQ7N 2RILA 3OPXA 2JEFA 2YH1A 3LP0A 3NCPA 1HR0F 1IVZA 1TZ0A 4BRAA 2DR8A 3RMAA 5TZVA 1C6VA 4KC5A 4GKKF 1TAMA 1LB2B 1X1PA 4BDZA 1QH9A 3AY9A 4IOAQ 4RQMA 3DRSA 4X4RA 5AQJA 2FPMA 3DNCA 4M94A 2P9NA 3D1OA 4FS1A 4JI5F 4W5RA 1GT8A 2E4LA 2OH2A 1C0UA 2XYHB 3O3LA 3BPDA 3QICA 4DEZA 4O23A 3M8RA 5KFOA 2WF8A 3H5UA 2LEBA 4RNOA 2FE9A 2MZ1A 3Q83A 3QU9A 4NYZA 2ZGYA 3FSYA 3MHYA 3BO2A 4USIA 1REVA 1YIJS 2NO4A 5J2HA 5D3GA 1KVAA 1P9YA 7ICFA 9ICBA 3QNWB 1H2VZ 4RPFA 3EKUA 4QOTA 4DJBA 4X4UA 1MA9B 2AX1A 1BNOA 1M90T 5EVZA 2Y1JA 2ASDA 4K0KJ 2YX4A 3ET6A 3C19A 1JLFB 3WKAA 1YIJN 3PO5A 2UVVA 3MBYA 4B3TJ 9ICEA 4E7LA 2W04A 3RRHA 3O9SA 3ZZTA 4PRFA 5DDYA 3I31A 4E8UA 2DF4B 3K5PA 2MGZA 4LH4A 3I4HX 3DLKB 2ISPA 1QZ5A 1HWLA 3BKTA 1VK3A 1BGXT 2ZXHA 4TNOA 5GMKa 3HW8A 3FKBA 5C2GA 3VAIA 5LXYA 2GMHA 4FJ5A 1VSIA 1NG9A 1Q5VA 4ZS6A 4FYDA 3KG1A 3MCSA 3PX0A 4CCHA 1B43A 4RQ3A 2RRNA 3ZLJA 2P9GA 2D1CA 3CJ3A 5C24A 1WSVA 1T9YA 4XDCA 5H1SV 1S76D 2KHOA 1VIOA 5KFKA 3DHWC 2AJ4A 2EC0A 3GYXB 4FWSA 4CLZA 5CZVA 5AXKA 4H0PA 3HYFA 2E6LA 3WXLA 1Q95G 4PABA 3HSZA 3NDKA 3H3NO 4M6WB 1TQLA 2B5JA 2YY3A 4LJXA 2GTDA 4HDGA 3U26A 2B56A 2HOQA 5DDQC 5FLXU 1DZ5A 4V19J 2V2QA 1BG3A 2YVSA 2CVEA 1YBUA 2P35A 2ZFHA 4OLOA 4ZPBA 4NL9A 4UAWA 8ICCA 2EAMA 2GAHC 3RF9A 2XO7A 5F1XA 3CC4N 4B3MF 4LH5A 4C1NI 2FHJD 5IIJA 5E7OB 2K8CB 3CWJA 5KAKA 2OPRB 2VF3A 4M3RA 1NJIO 5IT4A 1UA1A 1FRKA 3NS1A 4LT6A 1JROA 2KM8C 2GH1A 1XC3A 3IV6A 2PGCA 3ENQA 5FPMA 4ZOHC 4M7XA 1HD0A 1YGYA 4FBUA 3MM5B 1N61A 3WK4A 4QJFB 1X9SA 2JOQA 3KHYA 4HLBA 4C11B 1M5PC 4Q0BB 5K8MA 4HI1A 2IGIA 1CI4A 9ICSA 2QYCA 5AQXA 1SIWB 1AQ6A 1LWEA 3NS6A 5I4MA 5LXRA 4ZCMA 5ALOA 3GR1A 3E9PA 7ICLA 3HT0A 3LO3A 3MCNA 3BPSP 5J2JA 3HD2A 2QMUB 3NCQA 1N5YA 2KZ3A 2P66A 1CJUA 3MN7A 4BY9C 3ED5A 3ZDCA 2O8DB 1ZH5A 3FCWA 2XZDB 2O8CB 4CIFA 2E5SA 4FK2A 3TYTA 3JPQA 3GYNA 1ZD2P 2JMGA 2ASMA 1X4CA 2PMZC 1OSDA 2QM1A 4FSVA 4W5OA 8ICRA 3BUZB 1HPZA 4CEQA 2CPRA 3I76A 3ZTQA 1GNKA 2X74A 4JI0F 4OI3A 2EFQA 1RT3B 2LHTA 3AY0A 4BRQA 4Y2QA 3QRRA 2WF7A 2AQ4A 3AQEA 5IIKA 2CPFA 3NGUA 4CH1A 4GKJF 4YMNA 4TURA 4UAYA 2DRAA 1CJKB 1ZQTA 2KXFA 1SBRA 3NEKA 1Z1ZA 4IDKA 4KGVB 5ETKA 4UW9A 4A59A 3THYB 2KHDA 4JI2F 1NSPA 4YHHK 1CZ9A 4TY8B 5JVGQ 1GLDG 1XSNA 3CJBA 4EP4A 2HHXA 2HFZA 4FJLA 4P2MA 3R6GB 3LW5C 4HACA 2BZFA 5AZJB 1MC8A 2CGLA 3CJQA 1WNSA 3A13A 4OD0A 1VYAA 3DXSX 2DITA 3CTRA 2JL9A 4DUTA 1RHJB 4CHQA 5DRKA 1DRZA 4KI6A 3I9ZA 3KYLA 1VC5A 4WCEQ 2VBXA 4H4KA 1R0AA 2VB6A 2PMZD 3QU4A 2M88A 3I28A 4MK8A 1FERA 2PT0A 3CPEA 2OGUA 3VF6A 2M4MA 2FY8A 5B66U 4ZVGA 4CEEA 1ZQJA 2XI9A 5EE9A 1Z1BA 4IZ9A 7ICIA 1YK9A 1XQSC 3EUB2 5M2UA 4U8YA 2ZE2A 4UB1A 4P0PB 2X1AA 5HSPA 3PY8A 2OCEA 4DV1K 4RPXA 1ZBLA 5H2FU 3KKAC 3KHLA 5LT5A 3FZHA 1EARA 3ETOA 3OYDA 5DG8A 1YJRA 3S3MA 9ICGA 3Q86A 4OO1J 3C7NA 3EO3A 5IILA 5AK5A 1S4EA 4K4YA 1VQNS 4DSEA 9ICQA 2AYMA 2RHKA 2V67A 4M0AA 3VAGA 1RQNA 4NLPA 5AQFA 3GOIA 3J81Y 5LMNJ 4OCZA 4FZLA 3PIOL 4F04B 1IR0A 3VHQA 4WFYA 6FDRA 1DQAA 5LM7E 2ZUGA 4HTUA 4FJGA 4OYPA 2ASJA 1DJ0A 4WE1B 1XC9A 4LF7K 4H03B 3I56N 1WC3A 2BR0A 2W2QP 5J2NB 4MDAA 3KK1B 4LBPA 3PM9A 4CIGA 2R2UA 5CA5A 1XMBA 2YKMB 4OX9K 4DV7K 2QA4N 2CZVC 2CNKB 4ECUA 4U7CA 5DM6Q 4OZ3A 4QIEA 3A8YA 2GWKA 2L9NA 4A61A 1K9MO 1BD6A 2B8PA 3QJJA 4JLHA 4ZVUB 4DOZA 3DXMB 1FE0A 4DPTA 4OZJA 5B08A 5AK3A 3VGKA 2FVSA 2DXEA 3FC9A 3VAHA 2NRHA 3VQ8A 1KSPA 3BN4A 4EWTA 1WAFA 1RHQB 4M9HA 2QYGA 1AYEA 2HRYA 4JKGB 4FJ7A 4DTUA 5J0XA 3WNGA 4YOVA 1I94J 2J0XA 3PW4A 1OYDA 4RNHA 5L1JA 2AX0A 3UI3A 2G1DA 4DF8A 1RBVA 3CCLS 1BPBA 3BSCA 4FBTA 2CPXA 2HQGA 3S9HA 2DR9A 3I55S 3GZ7A 4U96A 4KPCA 3AQFA 4DLEA 1BWFO 4Z7YA 3ZSWA 3VGVA 3AT1B 2LEAA 4TN2A 4HDHA 1WLJA 3G25A 4KN7A 3JQJA 2XLIA 1HW9A 5T7LB 3NGIA 3CDWA 3OA9A 2R2TA 9ICKA 4K4WA 1SV0A 1S72S 4CH0S 2LXFA 2WTUA 2A42A 1QQOA 2BJDA 4MF8A 3FGUA 4LVNP 3EN9A 2F9WA 1Q46A 3VEWA 3Q8KA 1OVQA 2RB7A 4OJPA 5AI4A 4AFFA 2W9BA 4FXVA 4RUBA 3E01A 4YUDA 2D74B 3ISDA 3CJ5A 3VEXA 4K4ZA 2G2ZA 3MFHA 5HP4A 3PYFA 5ALQA 1D0EA 2DCUB 1SIZA 4OZ1A 2G2OA 5ALPA 2P9NB 1IWAA 1T9WA 4A8XA 2WOMA 1HWIA 4F0KA 5ETOA 1LXNA 5DK5A 4Y2CA 1GMUA 4CJFA 3CJSA 3UKUB 2KEYA 3T6BA 5B5EU 2KI2A 3CD5A 2ATQA 4Y2SA 1NPRA 1OYEA 4TXSA 3F2CA 1IKYA 5EHHA 2IDLA 2P9SA 3U3GA 1ZQDA 1MNEA 3R5AA 4QIFA 3W64A 4R79A 3NCIA 1I5OB 8ICGA 2W8KA 1J2VA 4LREA 3J80Y 1T9VA 3TJ8A 4O44A 3OFFA 1GTHA 3W65A 3SNNA 4QZDA 3ZD9A 4BVPA 4M47A 2W7OA 2DNNA 2D9PA 3O9QA 4E1MA 2PMZF 4OPKA 9ICTA 5H9EJ 2ZJ8A 4R63A 2HBJA 3FM9A 3A8KA 3W60A 5EOYA 2QA4G 3MR2A 1NK5A 2YHXA 9ICVA 2HFOA 4ES3A 4CDGA 5L1IA 3MWBA 3Q22A 4DU8A 2Z2ZA 3C28A 2I8EA 1HFEL 4DCOB 4LF6J 3QRPA 1V4TA 4L6V3 1MWMA 4AE5A 4HHJA 2CIMA 3ZSZA 3THPA 2A19A 3GIRA 3NE6A 4B02A 4UB4A 3R7NB 1MDUB 4EBEA 3T1YJ 1UCVA 2EBGA 3ZEUB 4F5OA 3PSPA 3THXA 1NGCA 4IFVA 3DRRA 1G2EA 2O4GA 4A8SA 3LDSA 4DSFA 2AZ1A 1J5EF 5EWFA 4B3SF 4EFAC 3KWIA 2LVWA 1KBRA 3BH6B 4NM2A 2BGWA 5CEHA 3G6EN 2C2DA 2KFZA 1S7HA 1FXRA 5JVHL 3N4PA 1Q18A 1LEOA 4QU7A 3TQ1A 5LMUF 3J7AN 2X51A 4A48A 1N34F 2DIVA 5IT9O 1MLAA 5BYRA 4OHWA 2K4HA 5KFVA 2HLUA 2GV1A 2R8IA 3QEWA 4IQWA 3KNAA 2M5YA 4WFZA 3BSNA 3CM6A 2AJFE 4X4NA 1S77D 2V9KA 5T7LA 3SBTA 2O8FA 2ZH5A 2X1GA 5AQHA 1XBWA 1VQ9S 5C2CA 2M8DB 1K0TA 2XCAA 3BR8A 1C0GA 4IBNA 3OUYA 2ZUDA 3M7DA 3T5LA 2O01C 3MFIA 2R7SA 3IRUA 3R6MA 1IN0A 1ZPVA 4LF9K 1EETB 3IWLA 4ELUA 4DTNA 3RR7A 1W7AA 1U45A 4DN0A 2YWFA 1S0VA 2ZD1B 4UASA 2NPIA 2IHR1 4DQSA 4CEDA 4O3SA 1PYSB 4XA5A 2VA3A 2XG8A 3C23A 4DLGA 3P1GA 4CJVA 5CYMA 2QO3A 4GY2B 4OVLA 2HCFA 2X1FA 4OJRA 1BPDA 4ECRA 2MQLA 4ZH4A 4WJBA 3JPOA 1NK0A 5ALYA 3O5TB 2HYIB 5AQLA 4IFYA 1HYZA 3MWTA 1U7LA 4DR7J 4NMXA 1URJA 3CCRN 2WC9A 2EQYA 3CXCR 1RCOB 4XH1A 5AKLA 2WAQD 2QKKA 5HMYA 4F0HA 1YBAA 2DNOA 4PEOA 1SI9A 4KKOA 4Q8EA 1YF5L 2FZKB 3SZ2A 4JI8F 2ATCB 2LKZA 5AQNA 2YKPA 3M1VA 4B08A 1JLBA 2FSNA 4CD1A 5DB7A 4BQLA 1ILYA 5DB6A 3PACA 1G7CB 2ZITA 3CMES 4OKKA 2XI2A 5K5MA 4L73A 3G6XA 5C25B 3FMBA 4RQ2A 5D4OA 5AQSA 1F21A 3AA9A 2OHDA 2QGFB 2GCFA 1SGGA 2UUBK 4PR6A 1Y3JA 2KP7A 3BYRA 1WTFA 4YFKA 5G0RA 1WACA 4A5AA 2GFFA 3ATUA 1FO4A 3KWMA 1JL1A 3ZTSA 5A0YB 2QXFA 4UZBA 2OELA 4LRDA 3ZT0A 4CF1A 3R9KA 4BGDA 4TLQA 2J6TA 2UUBJ 2C2MB 3QT8A 1SQKA 1U1QA 4M5GA 4NZ0A 4B3OA 3D1QA 5ALSA 3SCKE 3WKBA 3GDQA 4ILHA 3RBDA 4YCXA 2R7OA 3TPQA 3OYBA 2LQJA 2NZTA 3HZEA 3CFRA 2WBNA 1BNPA 3AO3A 4M9GA 5E2QA 2KMDA 2GMLA 4MFBB 2AIRB 4AHRA 1XTZA 1SXDA 2GUIA 4RLEA 4EYIB 4TYBA 3OTOF 2FHKA 4JUZA 1F44A 1TR0A 3ZC4A 3DGPB 1XI1A 3ICXA 1YJWS 4DBQA 4ER8A 4PPDA 1XSLA 2F1JA 1S1TB 4NYOA 3VESA 3PFEA 4CO4A 3VAJA 4ZP8A 4JI3J 1M6YA 2AA4A 3HSTB 3RAXA 2YNIB 2QK9A 2IFXA 2GQCA 3AOAA 5BRDA 3M9NB 2ZJPQ 2DHGA 3M6KA 1N34K 1HPMA 2WBRA 2H54B 4KLOA 3JPRA 5K14B 5AKXA 3H0MB 2E9RX 3MEEA 2NPFA 2DY1A 3GJQB 4DOCA 2GO9A 1HBMB 3P45B 3ENWA 3S3OA 3IG5A 3C14B 5AKEA 2C2OB 4LFBF 2KW4A 5BPMA 2GA7A 1V5VA 2G5IB 5IWAK 3AB2B 3O6QA 5JLHA 2CNOB 2RJZA 2D3O1 5CZ1A 4CJUA 3CCSN 3N79A 1QVFM 4DUYF 3IFRA 3TZWA 1P27B 3Q7BA 3EDQB 4EX6A 5F8HA 4U7BA 4RNMA 5GINA 3GBTA 4RQ8A 5C2FA 4IOBA 2KVSA 2BM1A 2VKRA 2L5YA 5HJYA 2EFOA 4JI3F 3D2EA 1SUQB 4ID5A 1L7OA 3IAS9 2YX1A 1YJNN 1WC6A 4QS7A 2LKYA 1P6TA 2AHOB 2Z30B 5GAGU 3IG1B 3HHLB 4UBCA 2Z56B 1X5TA 3DOLA 1F2HA 1WBDA 1NK9A 1RTDA 5C25A 4FFDA 3E0FA 4FK0A 3LVWA 2YKMA 4FPBA 4M5NA 2MKKA 3EE9A 2OSQA 4DUYK 3LDQA 2RKIA 4A8KA 2F3JA 2PC6A 1VQKN 1Y97A 2R18A 4HACB 4S0MA 1LW2A 2E1MC 1X31C 1FD2A 1RTHB 2Q3PA 2ZBIA 4OV6A 4H4OB 2HBLA 3EZUA 1C1CA 1N32J 4OZLA 3TX8A 4ZVHA 3PKYA 3HTVA 1B7YB 5J8YC 4NOHA 4J9RA 8ICFA 2X6NA 4OX7A 2E88A 3MCAB 3AVLA 1D9FA 2LYVA 1K8KA 1X4EA 1W9HA 4M9JA 1RA6A 4OJ3A 3KG4A 1WELA 3J7Z5 3K58A 7ICRA 1R0AB 4BC5A 2F9JA 4BE2A 2OZSA 4P2SA 1BY9A 4M9LA 2VFSA 1FVQA 1FFGB 2YXLA 3IO1A 3RJFA 4CGJA 2BGGA 2Y0BB 3CRXA 1QQ7A 3NOCA 2ITMA 8ICJA 1CC8A 3KUEA 2ZE2B 3RWUA 3D28A 2VKQA 4O4GA 3MXHP 3SPZA 4NCBA 1ZQVA 4HHTA 3IR5B 1NZPA 5AK4A 4Y2KA 5CYQA 4LSNB 3O44A 2XQCA 1IV8A 4X2BA 3QSIA 5HAOA 1U24A 2CG8A 1WKLA 3PNIA 2YJEA 2PMWA 1RACB 3ORYA 2W6LA 5K14A 2HWTA 2G0AA 4Z6EA 1N52B 2DHHA 1TU0B 4W5TA 3OTOK 1D9AA 3C65A 2B7BB 4KH6A 2MY7A 3JPPA 1A5XA 2BUNA 2HBKA 2FPKA 3NS5A 3D6MB 3DDHA 5ALIA 4PPZA 4JKAA 4Q2LA 4UF4A 2ZDPA 4K43A 3DLEA 4RQ7A 1VQ7S 3ZFVA 3ZX3A 1KQSR 1NXIA 4LJMA 4B3MJ 2H5JB 1X9JA 3QERA 1N8RO 2JV3A 3DYAB 5HRPA 2ZEJA 4OFZA 3LM9A 3GYGA 2HQCA 3JYTB 3V6JA 4CI6A 1WWVA 4YXMA 3EMTA 5AKZA 2AYBA 2YWEA 2E5HA 3U1NA 1OUQA 2DKOB 8ICMA 4CJRA 2JSXA 1KD1T 1FWLA 3QWUA 1N6QA 1DFDA 4CEOA 1VQ6S 4FXDA 2HWHA 2HRTA 2KICA 2YMLA 5BOLA 4CP5A 1VDHA 5ADXH 2VDIA 4LFCK 5LSLA 1T0TV 5IFMA 2DL0A 4RW6A 2F8SA 2VFVA 4CFAA 1JB0C 3FE1A 1XNQK 3W5YA 1VFJA 3GIIA 3VQQA 2KZZA 2EVZA 4BREA 1EP4A 1TKZB 1D8YA 4XK8C 4DPXA 3TAQA 4NLSA 1RAIB 2UUBF 2W2NP 2BANB 3Q8PB 3CCMN 4HKQA 1N33K 1W26A 2LQBA 5J2QB 2OKQA 3OSNA 2Z57B 2UP1A 4BR9A 3NH0A 1SJ4P 2UUCK 2A2DA 3MECA 4YDXA 3EGWB 1VQKS 4M45A 4C2MA 2XYGB 3M6ZA 1N5WA 1N56A 3K2YA 1TELA 5C0YA 2GC8A 1VQLS 8ICEA 4QNLA 2B43A 4EAHD 3CCQS 2RRBA 3BDEA 3UD5A 1VSDA 3AD8C 2DNMA 1QHAA 2AJ1A 1EO1A 5AQRA 3J7A1 2Q0RA 2HGNA 2GQQA 3FAHA 2CQBA 1Q7YT 1FKOA 4OJLA 2IVNA 2EG1A 2QLTA 4KN4A 3KNGA 3BKUA 5M1QA 2J9EA 5IC6B 2AQ0A 2MKIA 1K6YA 4K59A 4F93B 2FBTA 4DQPA 2IVYA 2GHWA 4ZP9A 2WSCC 1X0PA 2RHQB 1RBOB 2JC0A 3MCPA 3J81j 2V8PA 3PMNA 2B4OA 4EI2A 5JICA 1HBMA 4Z0UA 3SJJA 4KKOB 3D2WA 3WXMB 1F0MA 4QR1A 1IJFB 4DZ6A 5AI5A 1LKYA 4FKXA 3VENA 4JK7A 1K73O 7ICKA 1BU6O 4C3LA 4R8UA 3K5OA 3JTPA 5A6PA 4O5EA 2Z1HA 1XNRF 3RH4A 1WWHA 2FLLA 5AM4A 3GU3A 3CDBA 4ZJOA 1RWMB 3ZT4A 2FF6A 3NVWA 3FEZA 4CK1A 1IBKK 1XHXA 2ADBA 1QM9A 1JMSA 2FJWA 1WI6A 4FW2A 1BCOA 3QFUA 4XO0A 4F02A 3WKCA 4CNQA 2PKEA 1HKBA 4DQRA 3B6OA 3OBYA 2J7WA 1HI1A 1FKPA 2YH0A 4EK2A 4YOEA 5DB9A 1HI8A 2GMJA 2K4PA 3TFRA 2GQ2A 1ZQYA 4DR4K 3KBBA 5JS1A 3KOOA 3DRXA 2ZC4A 3B0XA 4YXJA 4E7IA 3CJ7A 3KUHA 3TARA 3MAAA 4OHXA 2NSBA 3QESA 3IRWP 4X64J 1CUKA 3AVMA 2CQHA 4E7HA 1N4LA 1N36F 1V6HA 2MLYA 3MZIA 5L8RC 5DM7Q 2G1HA 4EGLA 2VIXA 2JLEA 2DQNB 5KT5A 4DQIA 2AV5A 4CHOA 4RX6A 3UVJA 2KHCA 1SV5A 1WI8A 4HHHA 3BP8A 4M5DA 1X42A 2LM1A 1FRMA 1IXRA 4RTFD 1OH8A 4JK1A 8ICPA 4CFBA 2QEXS 1YITS 2FC0A 4JN4A 5E33A 5FPEA 2R7XA 3DOLB 1WHXA 4CBWA 5HP1A 5HRSA 3F2KA 2QA1A 4LSLA 4HVJA 3I33A 1ACMB 7FDRA 3CQ8A 2KT3A 4DU1A 3CERA 4PKGA 1BDGA 1ZQBA 4LF6F 2MKJA 2KXNB 5HROA 2JH1A 1NBEB 2ROPA 3UXNA 5JUMA 1L6NA 1NGFA 3M2UB 3NG8A 2LQ5A 3U27A 4BCAA 5L46A 3DCAA 2V2VA 4FJKA 4LFAK 5CYQB 4RW4A 4CE9A 2YQ3A 3GILA 1CLFA 2M3DA 3CCES 1EQMA 1GLEG 3D66A 1IKWB 4EZ6A 2C3PA 1MROB 2W54A 3MXJA 3TADC 3UIQA 3HJFA 4TLRA 3V6DA 1FXXA 1KAYA 3AVIA 2G8KA 3GB0A 4I7FA 4GVLA 3SPYA 1PJ7A 2UUWA 4CERA 2KJ5A 1C0UB 4CM2A 3BO4A 4MKAA 5GAHU 1LW0A 5KRTA 2GELA 3DYAA 4X66F 2KJWA 4RZRA 4RQ6A 2WB1D 1BL3A 1SZPA 2HBRB 3GFKB 2P9UB 1SKUB 2O4IA 5AJ3F 5ETSA 3OYNA 1QUVA 3MEEB 5BR8J 4ZA1A 1YZ6A 3T1HJ 3VGMA 1JCGA 2F40A 3IA0A 4AXIA 3QU2A 1RHMB 1PAEX 2JWNA 2JEIA 3PNCA 1PK3A 4RT2A 4ACOA 5TKWA 3SSQA 4A8WA 1MN8A 2CH6A 1WKJA 2ZH4A 2HFNA 4OI4A 5HJXA 1B7FA 4CEBA 2OHFA 4C4SA 3CCVN 3QBCA 4PZVA 2QV6A 3QLHB 3VTIA 3F0NA 3SCLE 2VKZG 2DFLA 1JQGA 2IM3A 4RPYA 4AT1B 2VDHA 4PXBA 3CJ1A 3CCJN 3PX4A 2VOPA 2VWJA 2MLXA 2FBVA 2DXDA 2R2SA 4Y65A 4CT8A 4DR5F 3O0FA 2YMQA 1SWWA 3JPTA 5A8KA 2BE9B 1AXQA 4ELVA 2WONA 4C4TA 1D8ZA 4N77A 1Q8LA 5ITHA 3WHIA 2WB1C 4X4SA 3NH1A 4YD1A 4UBBA 4LZDA 2V8VA 4O9MA 3AVJA 4OYIA 1BUPA 2W2MP 1V97A 1HQ2A 2CKWA 1ZQZA 3SI8A 1HBOA 2ODGA 2HHHF 4R0EA 3VZHA 4M3YA 3MDQA 5BOMA 4ZN1A 5CQGA 2HMIB 1L7PA 3DGPA 3NGSA 4IRKA 4NM1A 4ZMMA 2IS3A 4J90A 3NVMA 4H4OA 2DHSA 4NXNF 3UD4P 2Q1LA 3MUVP 4KSEB 1W7WA 3AXMA 2CDQA 3CW2C 3G4SN 2I1QA 3BO3A 1UAWA 3M2RA 1VQMN 4CDIA 3R2DJ 1K5OA 1VQ8S 2W55A 5JJBA 4HTLA 1VQON 2F65A 2GHVC 3TJAA 3EXCX 5CZXA 1OPZA 4FOIA 7ICGA 2J8SA 3C2LA 3AEVA 3G10A 1NWKA 2BXJA 5M2RA 4LRAA 5KFBA 4F5QA 3AA4A 3MWPA 1VSHA 4XPEA 4RQ0A 1IBCB 2GJIA 2AJ2A 4B3MK 4DB3A 4PG8A 3K9JA 4I2CA 2YV0X 1TK0A 1H72C 4O55A 3V1OA 1ZQCA 2WW8A 3US5A 3H46O 1ZQMA 3MABA 2BKOA 3BZCA 2I1RA 3TA2A 2UU9J 3K5MA 3QMLA 1LW0B 5L1MA 4M8LA 1NM1A 5ALNA 4AILC 4OPJA 2W42A 4QJVA 2P9SB 2RE2A 4WFAQ 3ETLA 4OI2A 3LF0A 5DETA 2P9UA 1N32K 4Y6IA 2XLJA 1HBNB 3TZXA 3DLLL 3DLBA 1N32F 4JI2K 4DR5J 2AWZA 2D5RA 2I5JA 3WK7A 3BBCA 2MZRA 3IS9B 4LF5J 3NHGA 3HCXA 3G8TA 2B9EA 1H7XA 4OKEA 3VQ9A 1R8CA 8RUCA 2MKHA 1VSLA 1TL1B 4CJPA 3MM8A 3VEZA 1L3VA 1ZJNA 3FEXB 1R0BG 4B1XB 1UFKA 2HNDB 2OD4A 2JC1A 5J2MB 5CHCB 1NH8A 1YVUA 3L3VA 1OH6A 2HZCA 1R8HA 3LPEA 2VIHA 2HQFA 1BC6A 5LMUK 5G4DA 4Y2PA 1SC3B 3A5LC 4NLUA 3BQTA 3PUFA 4RCHA 2MZQA 2FJDB 3C21A 2KFYA 3I32A 2WHEA 1ZD3A 1RT4B 1TUWA 2JFDA 4EIAA 2QZ8A 4IO9Q 3NNHA 3ZETA 2VC0A 5EWGA 1FX2A 5IT0A 2GZOA 2XO6A 1UJ5A 1NPPA 3FBBA 4HHUA 3H1QA 3KDOA 3AMZA 1VLOA 1RBSA 3M6VA 2FPHX 3HSCA 2ROGA 2Z1IA 2L9DA 3HHKA 4Y0FA 5BJRA 3OL8A 3N7PD 5HLFB 2PZSA 1B0TA 3JQKA 2KVCA 4KTWA 4WFNL 1S5LU 4I0WA 2HEKA 2QWOA 3SV4A 1WEZA 3QIPA 2PYJA 2VQEK 2BCRA 3HFZB 2RDJA 5AKYA 3JSBA 2ZBQA 3G6YA 4DR1J 3I8BA 1Y10A 2F1FA 2E2OA 4ZIVA 4WFNQ 4M63C 3N01A 4URGA 3H5XA 1FCAA 4V19S 4P4OA 2AKWB 3SMSA 2H4WB 4DL4A 1FDNA 4CJQA 4AHTA 2DNPA 1T94A 3LALA 4ZPDA 5HMXA 2DVIA 4WFXA 3U7JA 2PBDA 2W9AA 4C7QA 8ICXA 4WTYA 5CR0A 4IDHA 1WUAA 3D67A 2P2CB 2MQPA 3I55N 1IKVA 3UKUA 3ZZUA 3QYPA 5HHHA 2EEYA 3CQYA 2EX3A 3ZDEA 2OPPB 2YKQA 5GAGP 1RFQA 2DY9A 3EVWA 3MCOA 5KFPA 3C46A 1ZQEA 3LANA 4J91A 1KWMA 3CULA 2OPSA 2F8KA 1FJEB 4LUBA 1N34J 4QZIA 1B22A 2VG6B 4ANCA 3RH6A 3LP2B 2E20A 1VBYA 1KFSA 2UU9F 3FZKA 3NBPB 4PG4A 3MN5A 1VC6A 4DUZF 4BVOA 1SV5B 2HAFA 4BRFA 1RWWB 3DRRB 4F5RA 2ZUCA 4ECTA 3TTCA 3IS9A 2A41A 4F4WA 1J2NA 3TQEA 1HKGA 1RDBA 4YOWA 5AKKA 3ZNJ1 4C3KA 2J0QD 2L3MA 1M5KC 1GLBG 1UPHA 5KFRA 4WXOA 1SQGA 2XB2D 3CEDA 4U8VA 4H5VA 3MXIA 2P9IA 4QZAA 2HHWA 1PVRA 3BEGB 3BGFA 3UPFA 2G4BA 2CJKA 4L3QA 4ICLB 5HROB 1TAUA 1S0OA 3HILA 3I56S 3U1LA 1I1GA 5LY3A 3LM2A 3I5AA 5J1EA 2Y0SD 4I2GA 2IAJB 2JGAA 1B70B 5GIOA 1MU2A 4B3OB 2KQ2A 4X4PA 1NI3A 3MK6A 2V7ZA 5B8HA 1PSDA 1X60A 2V4JB 2KRRA 4G3IA 1GLLO 4I56A 4FF4A 4CESA 3BSAA 3CD7A 2E44A 2U2FA 2FZCB 2KJ8A 1ZS6A 2VFRA 3AVHA 4FYWB 3M2RB 1RDDA 1SH2A 2CJQA 3OFGA 4H4MA 3LP1B 1ZD4A 1WG4A 2JEGA 2HK3A 1LAWA 2KHVA 2KH9A 4HR2A 4D3GA 1WF2A 5J0WA 3HKZC 1EXQA 4CHYA 3HHLC 4O0NA 1OH7A 3TA0A 4FZMA 2NNWA 4CF0A 3G0ZA 4KY3A 4YB1P 1FWPA 3IHQB 3G71S 5J2FA 1BO5O 4JD2B 1RT7B 1CULB 4ED8A 3PSTA 4CLKA 2HQ3A 4OPAA 3RU0A 1B4SA 3Q0AA 2P6RA 2GWJA 1TV6A 2H3ZA 2LECA 1SS6A 4OYAA 1OMSA 4MYUA 3PIOQ 1W25A 3C5GA 2RF2A 1F6TA 3H5SA 3QZ7A 4HH1A 3VQPA 1NHVA 1S1XB 1XN9A 2ZJQQ 4I64A 3BS7A 3LWLA 2PFNA 2N7CA 2P9LB 5KNIA 3ZT2A 2D4WA 3GTYX 4P2XA 3CIZA 2C2EA 3RRGA 2D69A 2MQ8A 1RLDA 9ATCB 2A6MA 2G09A 2J7UA 9ICIA 4K2XA 3VOVA 4PWUA 1JLQA 3M4XA 4PYAA 5HRNA 2FJAB 1S6QA 2W40A 4CK3A 9ICHA 3FSIA 3E3XA 1EKRA 2FUG9 1TL1A 1OY8A 1U0HB 2EKYA 3RGIA 4UUWA 2P1JA 4P71A 1B0VA 3I1YA 3TSUA 1WHYA 4BRLA 4KT0C 4FLTA 1BQMA 5C42B 2P9EA 3OTQA 4M3XA 2A5XA 2W9CB 3H42A 5LL6d 4A2AA 3TUIC 2B3TB 3ETRA 5AI9A 1FEHA 2WRMA 4ILLA 4LF6K 2EHGA 1CJVB 2E9ZA 5LSOA 4UATA 2BJ3A 3CGIA 1W2IA 1LK5A 2E5GA 4LF4K 4KLSA 3K89A 2ZJPL 3RJEA 1WDTA 1HNVA 1R6YA 4KH0B 2ZH8A 3V81A 3M8PA 2YX8A 1H7WA 1IQZA 4C80A 3GDXA 3JB9k 3T5HA 4BC4A 2AYEA 1WG8A 1FK9A 1NLVA 4OJOA 2E1AA 1N5SA 4N7TA 3P6YC 1NGEA 2A40A 2MJUA 1M5SA 4O8KA 2MU2A 3F53A 2E1RA 4P75A 2W24A 1TKTB 5L39A 5J2EA 4FJ8A 2A1JA 4MT1A 4CRJA 3RJGA 3SMZA 1XWLA 1R43A 3N0VA 4GMKA 5ETTA 4YR0A 2D0CA 1X5OA 3OFEA 2E5JA 4N5SA 1J27A 1U47A 2IJRA 2WZ1A 2CUYA 4Q7AA 1QQ5A 1VI7A 5AXLA 1ICEB 4CFDA 3QAEA 1RT2B 3CJ4A 4P7VA 3W1YC 1IBLK 1J53A 2RD5C 4HL9A 1U2CA 3NF6A 2NUBA 4ZVOB 2HLTA 2AH5A 2M52A 1J5OA 1IKVB 3OXFA 2IM1A 2HFUA 3VVTA 1VR6A 2IA0A 1RDCA 2DJWA 5KFGA 1A6SA 2M9NA 4J9UE 3HKWA 1Z00A 1A5VA 1RGVA 1NJZA 1TUVA 4ZP6A 4YHHJ 1K47A 3BBFA 3LUYA 5B7WA 1IJJA 1ITPA 2NXJA 4ZHRB 1B9DA 1XS9D 2Q66A 4AH9A 1FXLA 4NE9C 3RR8A 3PCOB 2JZBA 1YQHA 1R8PA 3KLFB 1N2XA 2QL5B 3TJ9A 2K8BB 4UZCA 4A8EA 4E2FB 2YNIA 3N28A 3GG1A 1HBUA 2FJXA 3M30A 4OX9F 1Z05A 4YP3A 2XMKA 1T6DA 5IIMA 1H1VA 2NQPA 3NH2A 3GIKA 1JXVA 2P5GA 4EELA 4B9NA 3CI5A 3CMAS 2GLEA 2EG2A 2XNRA 1F3VA 5KG0A 4RQ4A 3AVAA 3C29A 2LXIA 5BXIA 1ZQQA 3C94A 3MGIA 2FVPA 1VHXA 5GVQA 4KH5A 5AQTA 1RHRB 2BX6A 1UFLA 4L72B 3OVBA 2P6TA 3PYGA 3MM8B 4B17A 5F8JA 4I4BA 3AAQA 4RNFA 3MEGB 3SFUA 1SVDA 2RHFA 3T1AA 2VH7A 9ICRA 5HL7Q 3M2VB 1CJVA 5A0LA 3CC2S 1VSEA 1RG6A 4GKKJ 3CDUA 3DDIA 4EENA 2ACMA 3Q8QB 3LP2A 5A2QU 4OX8A 4ZKAA 3OTBA 3CD6S 2K60A 2VG7A 1NZBA 2L41A 3CJ9A 4WP8A 5FDLB 4P2FA 2N7YA 1EX8A 4UB8U 5HO4A 4DFJA 5D78A 4ZP7A 4JYAJ 3T9NA 5KPZA 1L3KA 1N36J 3NAIA 3Q7CA 3PHTA 2RQKA 2B4PA 4NLBA 5IWAJ 3EY1A 4IQVA 2RUGA 4ED5A 1EXNA 3TO8A 4X66K 1NSAA 3C14A 4UB5A 2KN4A 2YX7A 4JYAK 4CO5A 2V8HA 2COLA 3TX0A 2F8HA 1AZSB 3BYPA 5L1LA 1RWUA 4JI0K 3THWA 4BRHA 4WXWA 2KSOB 2G0CA 3VGTA 5AXMA 3ELHA 4DV7J 3C2MA 1MU2B 1RTJB 5IWAF 3JPSA 4EU0A 1IBMK 1YSJA 2RMLA 3MMCA 5F3TA 5HBMA 4YN3B 2E66A 3KKFA 2WK4A 1T03B 1KDNA 4QIVA 3ZCMA 1WEXA 3JXUA 3KJVA 4TUSA 1X2IA 3MPDA 3B54A 4IC9A 2IDEA 1T7PA 1BI4A 3CB4A 4B1WB 1X4FA 1XNSA 3BZKA 5RUBA 1QS4A 4JI7J 4ECWA 4AL5A 1F2GA 3WKEA 2RLTA 2X1BA 3CC7N 4UAVA 1HUOA 2H3GX 3RUBL 4PCQA 4LRFA 4OJ5A 4AYBC 3TSQA 2DEIA 4PH5A 1RDRA 5C42A 5KG3A 4I2DA 3MN6A 2BHNA 2IOHA 3VGUA 4GV9A 4DV5K 2KDOA 1C0TB 3MX2A 3ZDDA 5B0EA 4IQUA 4TKTA 4IQTA 4YR2A 1XNQJ 1CS4B 2AGQA 2V2ZA 2FZGB 3EWGA 3UD3P 3DOMA 2M2BA 5IM0B 1I3AA 1NGJA 2BQ3A 1XMQF 2NV3A 3IMQJ 1SJFA 4AHSA 3RJJA 2E8AA 3MR6A 1FXDA 1F0XA 4FZVA 2P5OA 3DLKA 1Q3UA 1PJ6A 3A4TA 1VQPS 5HK4A 1EP4B 3SQ4A 3NMUA 3ZI4A 2JEJA 4DL3A 2PA3A 2F44A 4DL6A 4TY8A 2QW9A 4EX7A 1SH3A 4WQ5C 5GAEU 3QNMA 3CNQP 1NKBA 3C5FA 4Y2AA 2IDOA 4NLOA 4IG3B 2Q2RA 3MTJA 2R9LA 1U49A 4WQ4A 2N4CA 1YJ7A 2KD1A 2KU7A 2PYLA 3Q23A 4IOCQ 1VK8A 3KTQA 4OHZA 2ZH3A 1LK7A 2D3DA 4DX5A 2BKEA 4YN4A 4NRUA 4PHDA 3AVGA 2HHHK 3I87A 3PG9A 4DI6A 1GXLA 2PN6A 1RZTA 2FQQB 4WZMA 4PKIA 2K2PA 5AKGA 2NZ4A 3WC2A 3KMSA 2BVZA 3TUPA 4QZ8A 3OXLA 5E3RA 3SIPB 4J9KA 1NGGA 1SL0A 4ED0A 4C8OA 4MK9A 1ZQSA 1U48A 1AROP 1GOCA 1N62A 3W0LA 2CPHA 5A2QY 4QZGA 4Q8FA 4K42A 3OS2A 1UEKA 1QAIA 2QKBA 2FBYA 2ZBRA 2IRYA 4NLYA 1MQ3A 3F44A 4TQRA 1I51B 1ULRA 1NHKL 2NS1B 1RTJA 4MTPA 4Z4CA 1WC5A 4E3SA 1IH7A 2DD8S 4I2BA 3C6UA 1HKAA 5AICA 4QBUA 4RBVA 5GMEA 2ZF5O 4QIWD 4KRWA 4ILRA 2VV5A 1FKPB 2WSEC 2UXBJ 3AAWB 1VQ5N 2OPRA 3CJ2A 4XEIA 3OV7A 4E89A 3OPKA 2R7QA 2VGMA 1PK1B 1ZPWX 2I5HA 3FZLA 2QTWA 3DRPB 2IVPA 5SUHA 1T6CA 1C1AA 3CF5Q 2HVHA 5AQZA 3HJVA 4CWBA 1H2TZ 4HT5A 3F5TA 2P9LA 1YBTA 2OMLA 1TKZA 4RW7B 3OY9A 3OS0A 3CCLN 3TZZA 4CF3A 3FZFA 3VMFB 3FFIA 1E4FT 4F72A 1FFVA 1Y88A 3EYZA 1KRPA 3B4DA 2RF2B 2ZDOA 3ENOA 4DR5K 2QL9B 1LKYB 3LGMA 9ICJA 4B9LA 3V4IA 1B0PA 4FJIA 1N6QB 4EO6A 3SQGA 3OHAA 4ZITA 1J5EJ 5G5HA 5KFQA 2HNZA 3J7YU 5I42A 3GR0A 1TAQA 1RXOB 2FF3B 5A8WA 2AT1B 2IA6A 1NGAA 1RWXB 1M5OC 3KFWX 3V9WA 1I94F 2YB1A 2W9CA 1PCAA 1WHWA 5EUHA 3O08A 1N36K 4LSLB 3CJCA 5DGAA 2H3QA 3RFAA 3CCSS 1Q8BA 3B0YA 1PGZA 4CT9A 1XK8A 5JXSA 1YITN 2BCQA 5K9FA 4PL1A 1A7GE 1U0HA 3DLLQ 4OYXA 1Q82T 1GO3F 3ISND 1ITGA 4KV8A 3MMVA 4LRBA 2GVZA 4U95A 2UXBF 3KD1E 3MMJA 2YHWA 1V9PA 2HVEA 3QJLA 4F3MA 4CI0B 5ALHA 3RSEA 4YOYA 2EZYA 2HF3A 1U2VB 3GMGA 1RBRA 2W4DA 1NGDA 1NDPA 4LF1A 5DBBA 2B9XA 3V5RA 5CCLA 1KC8T 5DQGA 5CABA 2PFUA 4CGFA 4FZZA 4WKRA 2UUCF 3D0GE 1KN5A 8ICKA 4KHMA 2KKZA 2KT5A 4QWCA 5AZIB 1BQXA 2APOA 4JI5J 1B99A 2BKPA 2ADCA 5AM3A 3V7KA 4FLYA 2HVZA 4AYBD 4DV0F 4FJJA 1VK0A 4MJKA 4KI4A 1BA0A 2L48A 4Y2XA 5J2DA 2FDRA 1PYTA 3GLJA 2WTFA 5HP1B 4CLYA 4I69A 2A1JB 5GADU 2QN6B 4EFHA 3SYZA 2F7TA 1VQ5S 5J0PA 1QAYA 1N5VA 4PUOA 4F5NA 4NI2A 4PGYA 2E2PA 2YWKA 4BWMA 4BR7A 3CCEN 2R8JA 4GXIA 3CJ0A 2LBOA 4F4XA 2G8UA 3SMPA 2IMWP 1MWYA 2VQFK 3MPUB 4IQXA 1KR4A 1BHLA 2VCPA 1UVMA 2HHPA 1N0UA 1TVRA 1TL5A 4DG1A 1IM6A 2F4VK 2CQ4A 1GOAA 2H5IB 3LH2S 3CCVS 3D2QA 1ZM3A 2FGCA 1BPZA 1C2PA 1JIHA 2YHBA 4UOHA 1WCLA 4B1YB 4QWBA 4LF7J 3ID6A 1S4FA 3O1BA 1T9UA 4J9VA 3ZSOA 1FNMA 2E1ZA 4O3OA 5KFEA 3VQSA 1PO6A 1KKHA 3ICLA 3QB0A 4DFPA 3D68A 3IR7B 3IMXA 3WK9A 3W2WB 3MDAA 3KJNB 4ZVFA 3NGKA 4NLRA 1ZYQA 5BPLA 5DMRA 1XNQF 1WF1A 3QXGA 2KT2A 4KX3A 8ICUA 1YTAA 3TW0A 4DL5A 3R27A 4JI1F 1DTQA 5KG4A 2ASYA 3GPAA 4Y28C 2QB1A 2QC3A 3LDNA 4KMUA 3UMCA 3BY5A 4DL0C 1R31A 4C0ZA 3WIUA 1PBUA 1I39A 3D2SA 5KRSA 4P6QA 2ZJAA 2W1BA 1C4AA 1QUPA 1RHKB 4KLIA 5DGBA 3NAHA 2QLBB 4QR2A 3R9PA 3C6TB 2Q3SA 2RUSA 5ETMA 2QWMA 2VL1A 3MMCB 5HBMB 3VETA 1Z1VA 2WVCA 4LBHA 5L9NA 1HWUA 1BMQB 3WXKA 5LOQA 4L3KA 4KREA 3EZOA 1PZNA 1HR0J 4IJAA 5EE1A 1EB0A 5AE2A 2FXUA 2J7KA 2LPEA 3ZEUA 4BROA 1R0CB 4NXZA 2GX8A 9ICXA 2EXUA 3GFXA 5DG7A 2H48B 4LFBK 4NASA 3IM1A 3FVYA 4X65F 5SZTA 1GFWB 4FLWA 1AZSA 3IG8A 2RVJA 5HNKA 3H8JA 1CQMA 3TUZC 2KSOA 3RZAA 1UZHA 4CFCA 2K8AA 3MR7A 1TV9A 2VG5B 3G71N 2BRKA 3C15B 1L5UA 2V0NA 4CJKA 5F0UA 3VCBA 3RW7A 5CHGA 4UW2A 2NLXA 1G99A 3C1YA 4IYQA 3HX0A 4DTJA 5AQMA 2CJAA 1AT1B 1XIQA 2WF9A 4AL7A 3BGRA 1NLKL 2QIFA 5IM0A 1W2BM 3QT6A 2HQIA 3I6PA 1T05A 4DOAA 4JI3K 3RJKA 1BIZA 3ISBA 1ZQKA 1WJ9A 5KQDA 1LOUA 1R7IA 3MM6A 3DI6B 3RB6A 4IKAA 1UFWA 4YS2A 1XNRK 4LR8A 1WYGA 2HNZB 3EXYA 2LFVA 1IKYB 3MOZA 2HOEA 4XUSA 1YI2N 2HVDA 2FTRA 4ZPCA 3UXOA 5KFCA 3AOCA 3T1YK 1HWKA 3MI7X 2AMCB 3G8SA 4KAIA 2W3SA 3HT3A 3OYCA 5M1PA 3TWHA 4KLQA 4DQ8A 2V9WA 3RYLA 3WKDA 3MR5A 3NLCA 3PEHA 4IJNA 3MXM