3BDVA

Crystal structure of a putative yden-like hydrolase (eca3091) from pectobacterium atrosepticum scri1043 at 1.66 a resolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
191
structure length
191
Chain Sequence
GMQTTEIDLRLTEVSQQLTMVLVPGLRDSDDEHWQSHWERRFPHWQRIRQREWYQADLDRWVLAIRRELSVCTQPVILIGHSFGALAACHVVQQGQEGIAGVMLVAPAEPMRFEIDDRIQASPLSVPTLTFASHNDPLMSFTRAQYWAQAWDSELVDVGEAGHINAEAGFGPWEYGLKRLAEFSEILIPNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of YdeN-like protein of unknown function (DUF1234) (YP_051181.1) from Erwinia carotovora subsp. atroseptica SCRI1043 at 1.66 A resolution
rcsb
source organism Pectobacterium atrosepticum scri1043
molecule tags Hydrolase
molecule keywords Uncharacterized protein DUF1234
total genus 67
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06821 Ser_hydrolase Serine hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3bdvA00
1YA8A 4PSCA 4E15A 4I4CA 3M83A 1LPMA 2JGLA 5A2GA 1ACLA 1EHYA 5HKAA 5AKXA 3T52A 2WHPA 3WK4A 5JZSA 3K6KA 4LXIA 2RIPA 4X97A 1YB6A 3RM3A 3T4UA 2VJBA 3H2JA 2WTMA 1RP1A 3FLAA 3I6MA 4F60A 4UBMA 4KE7A 3SX4A 4H35A 2ZYHA 1GQSA 1CUWA 3VJKA 4AMYA 3DKKA 4BBZA 3V48A 4BTVA 3IVMA 3D2BA 1B6GA 3I6ZA 5JYCA 1MX1A 2XMRA 4JH0A 5EIAA 1UOPA 4K6GA 2P8SA 5D3KA 5ALRA 4DMFA 4B0OA 5ALQA 4DSAA 1WOMA 3A6ZA 2RGUA 3HZOA 3Q0TA 3WL5A 2WLSA 1QIHA 4FLFA 3OM8A 4MYDA 4WY8A 3QVMA 3AIOA 5LYYA 3GFFA 3IIIA 3I2GA 4KJXA 3ZWQA 4G5XA 2QZPA 2OAGA 2QXTA 1H2YA 4GXNA 2PSEA 2XQKA 4J0HA 2EDCA 1ZD5A 2WUEA 3D3NA 4WJLA 5DJ5A 1VA4A 5LLSA 1WB6A 1EX9A 4UHCA 1HKHA 5HK8A 3I2IA 1TKRA 3CCBA 3E0XA 2OXEA 6YASA 4X7BA 3DL4A 1GPKA 1R1DA 1IUOA 2VA9A 3WKCA 3WWOA 2I78A 2XQGA 5DWDA 3O9MA 4M0EA 2G4LA 1DT3A 1QIGA 1MNQA 1H22A 3IUQA 4Y2QA 1XZDA 4ZV9A 2RONA 1VJ5A 2R11A 2XMDA 3M3DA 5JD6A 1CUFA 4Y2SA 4EY7A 4I3FA 3V1LA 1PV1A 3KD2A 4V2IA 2PM8A 5ALNA 2QXUA 2CBGA 1QIFA 3VVLA 3BJMA 3O4HA 5K3EA 5JADA 5AI0A 1YSCA 1PFQA 4HXEB 1EK1A 5AKIA 4BVJA 1UK9A 1IUNA 1LLFA 2UZ0A 3FBWA 2ZJFA 3PI6A 4J0CA 4EY5A 2D0DA 2EDAA 3C43A 4LYEA 3IURA 2DR0A 1W75A 4H7HA 1CUJA 2J3DA 1XZGA 1XZEA 2H7XA 2RHWA 5LKAA 2WFZA 4BRZA 4QDZA 1JI3A 3G9ZA 1R3DA 4UBKA 3ANTA 2XQFA 5E4TA 1QTRA 1LGYA 4J0JA 1J2EA 4W1SA 2HM7A 2XUIA 4XIIA 5AH0A 3G7NA 5AKJA 1CUHA 5AM4A 4B6GA 4UBJA 1CLEA 3I28A 4KR0A 1N8SA 3A70A 2RHTA 4JYMA 3VJMA 1F0PA 2OGTA 3WWEA 4HRXA 1YASA 2CJPA 4KRXA 1CPYA 7YASA 4X6XA 1DX4A 4OUKX 4M0FA 3CXUA 3G9XA 4G8BA 4BCBA 1DX6A 4E14A 4KYVA 4FLMA 3X3HA 2XMSA 1AC5A 3R3UA 2VTVA 4BP8A 5CTAA 1Z68A 5EHXA 2QJRA 2G5TA 4HZGA 2QRUA 2JGFA 5CT9A 4LIPD 4UBOA 4QDXA 3CCCA 1MX9A 2WFLA 4AXBA 3IUNA 1XRNA 5FP0A 1BN6A 4W1QA 5AK5A 5CT6A 2OCKA 4AN1A 3DYIA 4Q3KA 1WCYA 4X3CA 4C6HA 3F96A 5E4YA 3VKFA 2JIDA 3HI4A 3D2CA 2DHDA 4O08A 3STTA 5DYYA 2HA5A 3PF9A 4NVRA 3STYA 3ZPXA 1ZI9A 2DHEA 3IBTA 1XZKA 2PSHA 3GUUA 1QTIA 1TCCA 4KRYA 3O95A 3EIOA 1Y37A 4HXFB 1CFJA 3DDUA 1QLWA 1BRTA 3UMJA 3EQ7A 2W22A 1JJBA 5AJHA 3P2MA 1WM1A 2O7VA 3WK9A 2HRQA 3WKBA 5JZBA 3WJ1A 1XQYA 3O4JA 1CUUA 3HEAA 4MJ3A 4P93A 2DQZA 2JGMA 4OYLA 4CG2A 1ZGCA 2WG1A 1ORVA 2WJ6A 4WFJA 3PFBA 3AZQA 3C6YA 3WYNA 5T4BA 4Y2YA 3FSGA 2D5LA 4Y2XA 3FNBA 1XLVA 4UUQA 1BCRA 1MX5A 4Y9SA 3I2JA 1AX9A 1XZIA 3OURA 4Q05A 3WK7A 3HABA 4Q1VA 3JYHA 3ZLVA 4B84A 2YASA 4EUSA 3WI7A 3TRDA 4GECA 4ZWNA 2ZYRA 4BB0A 5FLKA 4K6HA 1TK3A 2OGSA 3C5WP 4BAGA 5AOCA 1QZ3A 2PVSA 4J7AA 5AKGA 5LZ7A 4JEIA 5AM3A 1TAHA 3CN7A 3R40A 5AM2A 2BFNA 4UFNA 2WJ3A 5HF5A 1CQZA 5AOBA 5AKYA 4LXHA 1L7RA 1LPSA 3ESBA 3HJUA 1G66A 1N5RA 3NGMA 4OCZA 4Q3LA 4XVCA 3E3AA 3WIOA 4BDTA 4OPMA 4FFWA 3B3QA 2X5XA 1H2XA 1K5PA 4B7ZA 1MPXA 4HTAA 1E8MA 4BP9A 3ZV7A 3KSRA 4DMKA 2HFKA 1ACJA 3V1KA 1UKBA 1VXOA 5EI5A 2WHRA 4LXGA 2WUGA 4QEKA 3DOHA 5AIBA 4FOLA 2B4KA 3WIBA 4H77A 3NOXA 2XMZA 4KEAA 2HA4A 4S0XA 4B82A 3LLCA 4B9EA 1XZAA 3AZPA 5EIEA 1JMYA 1YS2X 5LZ4A 1FFBA 1YAJA 5CT4A 4Q3OA 4AO6A 2W6CX 1E8DA 2WHPB 5ALMA 4UHBA 2BUAA 5CW2A 1QFMA 4UPDA 1FJ2A 1K6EA 1X70A 3H2HA 5E4JA 4AZ0A 5LP1A 1XRPA 2DQYA 1BE0A 2CZQA 2PPLA 4EB0A 4ZREA 5DLPA 3MGAA 1DU4A 2ROQA 5HF8A 3ZI7A 1J07A 2WIDA 5ALJA 3FYUA 5CXXA 4DYHA 2AJ8A 2HHAA 4UBNA 2Z5GA 1GKKA 5ALKA 5CH5A 2JEZA 1XRRA 3W2TA 4AZ3A 1QO7A 4PNZA 3OOSA 1H2WA 3SWWA 5AM0A 2OQIA 1A88A 1LBSA 5I8PA 3GBSA 5IVKA 4GEGA 3BIXA 1JMKC 3ZLTA 3BWXA 1Q0ZA 3DL7A 1GXSA 3DKRA 2PSJA 1CUXA 1CRLA 1SCKA 1FFAA 4QWMA 3QH4A 1FFCA 3VVMA 3WZLA 2XUFA 1CUIA 1WB4A 3A2LA 4DNPA 5AKZA 3QM1A 4ETWA 1VLQA 1ZGBA 4DNFA 1LPOA 4Y7DA 5AM5A 1W6RA 4MWTA 2ZVDA 5JD5A 4P92A 4CIAA 4X85A 4MYSA 5ALUA 2R8BA 2CEKA 3B12A 5AKLA 3BDVA 2VATA 3V1NA 4ZV7A 1UK6A 3HACA 2WIGA 2HRRA 5ALGA 3EQ8A 2BJHA 2HA6A 2Z3ZA 3R3WA 3C70A 5CBKA 1SCIA 1W52X 3WK8A 1GGVA 3QPAA 5ALSA 3O9VA 3B5EA 1ZD2P 2NW6A 4N5HX 3VJLA 2ZSIA 1JFRA 4X93A 2PSDA 1ISPA 5HFAA 4U2CA 5ALPA 4HXGA 3VISA 3G8YA 5CT5A 4BVLA 3F67A 3O0DA 5YASA 5AK6A 5CH3A 5ALWA 2VT7A 1SC9A 3FYUB 1F0NA 4GWLA 1QIDA 3H18A 5AI4A 2ACKA 3G0CA 2O2GA 4KE8A 1H2ZA 2WILA 1LNSA 2VAVA 4H18A 2XUHA 5K3BA 1UFOA 5FPQA 2DCMA 1ZD4A 5ESRA 4J0DA 4KAJA 4L0CA 1Y7HA 4GDMA 3LIIA 5DTIA 1QIKA 1MO2A 2ORYA 4QZVA 2WQZA 3C5VA 4B85A 2V97A 4RNCA 1IZ7A 4G1FA 5ALFA 5DNVA 4IQ4A 5BWBA 4YX9A 2PKYX 4HVTA 4H7IA 3F98A 4PQEA 2XMBA 1X2BA 3RKSA 1MN6A 5E2IA 3GZJA 1C7JA 2C5GA 4ZRDA 4J0IA 1SOMA 3GELA 3WWCA 1EDEA 1JU3A 2HU7A 1UWCA 3R3VA 5BOVA 4C87A 1CUSA 4C88A 5LKRA 5FPPA 4BCDA 4JNCA 5K5EA 1IUPA 2XUAA 5EIHA 4TPKA 1K4YA 3DCNA 1R4ZA 1X2EA 1C4XA 1YS1X 2OAEA 2B20A 3AIKA 5C8VA 5ALIA 5HKBA 1XZJA 2H1IA 2WIKA 2C4HA 2GBIA 2ECFA 3JW8A 3HSSA 3FOBA 3U0VA 2XT0A 1U4NA 2WJ4A 2WUFA 4BRSA 1DQYA 1LZLA 5A7GA 1P0PA 3H2GA 5IVDA 3K9BA 5SYMA 1VKHA 1F6WA 1A8QA 4UHFA 1LBTA 2RAUA 4X6UA 2JF0A 2VSQA 4FMPA 4H7JA 4B9AA 1QIMA 1TQHA 2HA2A 1JKMA 2AJDA 1XZHA 4Y2PA 1K8QA 4ARAA 2Y6VA 3ANSA 3EQ9A 3RK4A 5ALHA 1R9NA 1AKNA 2BUCA 5D7BA 2XI4A 1EDDA 2VQ6A 3C6XA 5A71A 2WM2A 3PF8A 2GBFA 1MAHA 3IUJA 3M82A 2GZSA 2WIFA 5A7FA 1XQWA 3D5EA 4FTWA 3H2KA 2AJCA 4DNOA 4MQMA 3BJRA 4EBBA 5EHNA 1XRMA 1L7AA 1G5FA 1DT5A 5JANA 1ZJ4A 1MT3A 1CUDA 3WKDA 4QLAA 2X8BA 5K3CA 4BVKA 5AKHA 4KAFA 4OD0A 2ZJ6A 4L9AA 1IMJA 1AZWA 5JD4A 4C89A 1QIIA 4FKBA 1YCDA 2DHCA 5EGNA 2J3QA 5ALEA 4OYYA 1L7QA 3DEAA 2XMCA 4L72A 3R3YA 2O2HA 3IULA 2V9ZA 2GBGA 2XUGA 4INZA 1MU0A 3ESDA 4EA6A 3PUHA 3WKAA 4B83A 4AB1A 3TGLA 3QMMA 1G42A 3L1JA 1XKTA 3IDAA 5D6OA 4BAUA 2EEPA 3S8YA 4FNGA 2QTBA 2O2IA 1EA5A 3E1GA 1VZ3A 2GBCA 2FUKA 4BZWA 1TRHA 2J4CA 3D0KA 1GPLA 1CUYA 3KXPA 4DTCA 1WB5A 1OCEA 5FDFA 2QR5A 5ALLA 4QA9A 4MEBA 3DLTA 1E3QA 4Y2JA 4FNMA 1A8UA 3H1BA 2CKMA 3ED1A 2K2QB 1ZI8A 4M0MA 4DSZA 1CUBA 3G0BA 5ISMA 1XZBA 1LPAB 1P0IA 4RE6A 4PSUA 3WK5A 4UHHA 4HRYA 2QJWA 1R9MA 5AO9A 5JARA 4CI9A 1A8SA 4X90A 2YH2A 4UBIA 4EY4A 1CR6A 1HLGA 2PBLA 3WWPA 1KEZA 3SK0A 4EY6A 4IH4A 3DS8A 5I7UA 1E89A 4LYDA 2PX6A 3ILSA 1LPPA 2XUDA 1BCSA 2OCLA 5AI9A 1AUOA 4MXDA 4RE5A 1M33A 5IKXA 5CRIA 3AUKA 1QIEA 4G8CA 2RI6A 1CUCA 1T2NA 3IUMA 2WU3A 1ZIYA 5C7YA 4WDRA 1LPNA 5KWIA 4CCYB 3WMRA 4ROTA 5ALDA 5IH7A 2AJBA 4DIUA 4BC0A 2HU5A 4WFIA 4X95A 5CXUA 4EY8A 2XUKA 2C0QA 3DNMA 3R41A 4N8DA 4FBMA 1GKLA 2YYSA 2JGKA 2C5FA 2H7YA 4GBGA 1ODSA 5H3HA 1ZI6A 4TVKA 2O7RA 3QZUA 4KE6A 1I6WA 2GZRA 4X92A 3G02A 2C0PA 1EH5A 4AO8A 1XRQA 1YB7A 2XUPA 1UOOA 2LIPA 4N5IX 5AICA 1QO9A 3FCYA 5D3ZA 1QIJA 1VE7A 3D2AA 3V1MA 1HBJA 3BF7A 1NU8A 4G4GA 4PF1A 1Y7IA 1R88A 2G5PA 4H0CA 3LP5A 2CMFA 5AM1A 3HRHA 2HFJA 4AMZA 3I1YA 5HQ3A 5IVHA 3FVTA 1UZAA 5I9IA 2VEOA 4U2FA 5A6VA 4DLNA 1XQVA 1YA4A 5JAOA 5CT8A 1H23A 1MNAA 3FSGD 1P0QA 5ALZA 4BC1A 1HL7A 3BDIA 4CG3A 2HADA 3CN9A 1MTZA 3L1IA 5F4ZA 1W76A 3L1HA 3H1AA 2XMGA 1UKCA 4W9RA 4F21A 3LCRA 2Q0XA 4YASA 5C8ZA 1Q83A 4G9EA 2JBWA 1O6FA 5AI5A 4NS4A 5ALVA 2CUTA 2BCEA 2XB6A 4PO3X 1DQZA 1EB8A 2BAGA 1CUAA 3WWDA 4H7FA 3H2IA 4EHBA 4XJVA 1HDEA 4WY5A 1KU6A 2PUHA 2OPHA 1XFDA 3WL8A 4BE9A 4GHWA 5K3AA 1WPRA 5BV7A 5DTJA 3WA6A 1U8EA 2C58A 3ICWA 4J3JA 4X6YA 3STUA 5SYNA 4RPCA 5AI6A 1QGED 4IO0A 2HL6A 3STWA 1WHSA 4FWBA 2WHQA 2AJLI 3WL7A 5JZ9A 4NZZA 2PU5A 4G4IA 3C8HA 2HDWA 4I19A 3DQZA 5JALA 5BWCA 3AFIA 1DINA 1SFRA 1FFDA 4OU4A 1NX9A 3C8DA 1CEXA 1W4LA 3QPCA 4CCYA 1VOTA 3RLIA 3D4LA 1IZ8A 1QJ4A 1UXOA 2WG0A 2Y1KA 5FXMA 3JWEA 2C7BA 5FRDA 3WKEA 5A62A 4DM7A 1GPNA 2H9YA 4D9JA 2Z8ZA 2XMQA 1XLWA 2QM0A 2VJDA 1WPXA 3BF8A 4FLEA 1SCQA 3FYUC 1TCAA 2VJCA 1CUEA 4WDQA 3R0VA 3V9AA 5JATA 2G63A 4UFPA 2WFMA 3FAKA 4YPVA 1JT2A 1WHTA 2QS9A 3KDAA 5FKJA 4U2BA 3R3ZA 1USWA 5DYWA 3K2IA 5KWJA 1JJFA 3WQHA 4AX4A 5HK9A 2XE4A 4PSDA 3RARA 4W1PA 5HZGA 2XUQA 3W05A 2V98A 3C45A 4Y2UA 1RYYA 1VE6A 4A5SA 2PUJA 3WJ2A 4E11A 1EI9A 4BCCA 3M81A 3I2HA 3BE8A 3BXPA 3WL6A 4AO7A 3HXKA 3QPDA 4Y2RA 5T4HA 1RWQA 1BS9A 3FWHA 2XQIA 5C8XA 3UUFA 3WLAA 5JAPA 2WSLA 2J4FA 4DGQA 1N1MA 4IHAA 4H7DA 5HF9A 1HQDA 3H0CA 3WA7A 1ZOIA 1XKLA 4IH9A 1XRLA 5DNUA 4Q34A 2VF2A 4KE9A 1TIBA 4AQDA 1E8NA 4ITVA 5JASA 4JUIA 1DWQA 1C7IA 1XLUA 5AP9A 5T4EA 2ACEA 3C6ZA 3GROA 1BEEA 1U65A 3OPMA 1ETHA 3N0TA 3FLBA 1PJAA 2PSFA 5HCUA 1O6GA 4W1RA 3ESAA 1E5TA 5EFZA 3PUIA 1ODTC 3G9UA 3KWFA 5AKEA 4E46A 4U2EA 2XQJA 3ZLUA 2JGJA 3G0IA 5AOAA 3IA2A 3W06A 4B0PA 3HC7A 4QDTA 3YASA 3E4DA 1FFEA 5ALTA 1CIJA 2HA0A 4QE3A 1BEZA 3BL8A 5CMLA 5ALYA 4G8DA 5EHQA 4P9NA 4N8EA 4Q82A 4C4YA 1TCBA 3MUOA 3OC0A 1W1IA 2VJAA 1J06A 3H19A 1LPBB 3BIWA 5ALXA 4BE4A 3H17A 3H04A 3TJMA 2QUAA 2IX9A 2BKLA 3HYSA 2Y2UA 3F97A 5LIPA 1ODCA 3EF3A 3STVA 2JGEA 4A16A 2QT9A 1QFSA 2GYVA 2ONCA 2FJPA 1EVEA 1R50A 1HPLA 4RGYA 3A2MA 4JYPA 5ALOA 3TEJA 2E3JA 3C6BA 2HA7A 4QNNA 5LZ8A 3F9CA 2QUBA 1MJ5A 2X76A 4W63A 2AXEA 5JAUA 1OXMA 4F5ZA 2DFPA 1NU6A 4OSEA 4CCWA 4BTLA 2OCIA 4ZXFA 3WK6A 4LHEA 3KWJA 5A7HA 3O4GA 4J03A 5C81A 1XROA 4BAZA 5FUMA 4DMHA 3W9BA 5K3DA 2XLBA 4HS9A 5FOQA 5DNWA 1J1IA 1S8OA 1ZICA 4BYMA 1CV2A 3G0DA 2I03A 3DD5A 2GYUA 3QYJA 1AMNA 4AN0A 2OLEA 5HFNA 5CH8A 2OG1A 4MWSA 4UFOA 5JAHA 2FJ0A 4C01A 2VAXA 5K3FA 3DYVA 3G9TA 1GZ7A 4C4ZA 5AKKA 2ZJ7A 1A7UA 3VDXA 3F8SA 3PDCA 5LZ2A 1G4HA 2XLCA 4NMWA 2B61A 1AQLA 4QLOA 3U1TA 2B9VA 1AGYA 4HAIA 5K3FB 1DTEA 1ORWA 2HA3A 4OB8A 4X94A 3DJYA 2H7CA 4B81A 4F0JA 4A23A 1P0MA 1EDBA 1THGA 5EHZA 4IH1A 1VXRA 3G0GA 4K2AA 1XQXA 4U2DA 4OB7A 4GI1A 3D7RA 3PICA 5HF6A 4BZZA 4J0GA 2OQVA 4Y2VA 1CVLA 3D59A 5KREA 2FX5A 1Q0RA 3I6YA 4UBLA 4B80A 4YK7A 1B41A 2BUBA 3O4IA 1QONA 2JGIA 4FBLA 2Y2VA 2YXPX 4QDUA 3QMVA 1EK2A 4QDOA 1EXWA 1CUGA 3ESCA 3AJAA 4G9GA 2PU7A 2QVBA 2V96A 1THTA 4GW3A 4CG1A 4CIBA 2WG2A 4UHDA 3IB3A 1ZJ5A 3A2NA 4BDSA 4H7KA 3DOIA 4DNQA 1U2EA 2GYWA 1CUZA 3R3XA 2VT6A 5AK3A 3MVEA 4FDMA 3NWOA 4DMCA 1E66A 3PE6A 4J0KA 2WFLB 2XUJA 1UOQA 2OCGA 3EBLA 3KOOA 2ES4A 1T4MA 5LZ5A 3I2KA 1VA5A 2PL5A 5J3JA 3WYDA 1Q84A 2WU4A 4LKOA 1UT6A 5JIBA 2QKYA 1EVQA 1F8UA 3W04A 4X00A 4P08A 5DYTA 3QITA 3HLKA 4L3WA 4EZIA 3FYTA 2Z3WA 4MEAA 5AIAA 2BGRA 3VXKA 5HQ3B 4OB6A 2OGZA 3SC2A 1UK7A 1EB9A 4G4JA 1JJIA 2XDWA 2HIHA 2QOEA 2ZYIA 5T4FA 3S2ZA 1UK8A 4XWGA 2JEYA 3I2FA 1FSSA 1ZIXA 1XZCA 4FHZA 5AHXA 4KAAA 1CQWA 2WUDA 3AZOA 3STXA 1QOZA 3OG9A 2IITA 4PV7A 4C4XA 2QMQA 3OTQA 3N2ZB 4H7EA 3WZMA 2ZSHA 3GA7A 1LZKA 2CB9A 3UUEA 3FLEA 1GQRA 4X91A 3QMWA 5AK4A 1K63A 3C87A 3QBJA 4ZI5A 2WTNA 4WCVA 5CURA 4BATA 5IVIA 2HU8A 1OILA 2IIVA 1XZMA 1MAAA 3Q8WA 3LIPA 1JU4A 3W9UA 3AILA 4U2GA 1XZLA 3MUNA 4Y2TA 1BU8A 1GT6A 4KACA 5KBYA 3FCXA 2WIJA 1UKAA 1CUVA 4FFVA 2DSNA 4GLBA 4K5QA 1KU0A 2I3DA 4ARBA 1N5MA 4TGLA 3NUZA 2Y6UA 1VZ2A 4QWWA 1BN7A 2ZYSA 1D07A 1YAHA 1EINA 3AINA 4WFKA 2XUOA 4XX1A 1DWOA 3PFCA 4MQLA 3FVRA 4X71A 2BGNA 4K6KA 4N8SA 4ZGBA 1BROA 5AI8A 2WKWA 1DWPA 3ICVA 3I1IA 2Z8XA 3AIMA 2I3ZA 3LS2A 4Z49A 1ZD3A 1AURA 1XZFA 1YR2A 4UHEA 4PW0A 5FV4A 4CFSA 5LZ9A 4OU5A 1QE3A 1IVYA
chains in the Genus database with same CATH superfamily
2ZT6A 1NXSA 4PC1A 4E15A 4DB4A 3ZTTA 2C8LA 3H9CA 3M83A 3U9TA 4OVKA 3TIGA 4S1PA 3VNRA 1XOIA 4TWZA 4F9EA 2ZUFA 2Q0HA 3LV8A 2JGLA 5AKXA 3O82A 3SNKA 2WHPA 3ISVA 1A9SA 3QPUA 4I50F 2FZ5A 3M89A 3AESA 3IBYA 3ORSA 1LQTA 3ABSB 3PHGA 3OLYA 4GR9A 1PK9A 4GPBA 4UCXA 1JEYB 3EVTA 1GGNA 2B2CA 1VKOA 2G3YA 3D43A 5ELLA 5FUVA 3A14A 5A03A 4Z9YA 5A4FS 2Q21A 4TL9A 5DXFA 3VA7A 2JATA 4JBLA 4M55A 1UAYA 1YB6A 1CZRA 2XHEA 1D0SA 3ECAA 2WOJA 2JDID 5K0EA 3KYCA 1C1XB 3M9LA 1X6VA 2EWMA 4OF4A 1QB7A 2JEOA 4WKNA 1BGVA 2WTMA 1TC1A 1UM8A 3A1DA 4IGKA 4MRVA 4Q66C 5HXAA 1XXLA 3Q3CA 2GZ3A 3BM5A 1OR8A 2PGNA 2W2TA 4LQ4A 4CIVA 1T5OA 4CR8A 1S9HA 3AUJB 1TZMA 2RSLA 1JQAA 1UQRA 2ZYHA 4H35A 3W8EA 1CY6A 3IOYA 4E94A 4FJ0A 1G18A 1QR2A 3QFHA 1JDBC 3KTOA 1ULAA 3CJQA 1IY2A 4BBZA 3G2OA 1BJRE 4LCJA 4UCFA 5ARCA 4LCEA 2BSAA 3LRPA 2JLYA 3V48A 1FMTA 1FTQA 3IVMA 3VGJA 4A9AA 1PZGA 3D2BA 4I5FA 2AR9A 3ANNA 4LOJA 4B34A 3SC2B 1GWNA 4ZCMA 1SGWA 2QSYA 1PK8A 3I6ZA 4OQEA 4LV6A 1DC6A 3VV2A 5L3QA 4JWKA 1U3FA 2I2DA 2J9RA 1GYPA 1MT0A 1MX1A 5M3BA 3E2PA 3FGOA 3PC3A 3KAKA 4EUKA 4PZDA 5T41A 3I8SA 1P3JA 4FS3A 3N2LA 3IQWA 2CY0A 4F5EA 2HK6A 2XNKA 3C16C 2XBMA 1ATZA 2J7PD 3PG5A 1KO5A 1ZBDA 2BFCA 2PDAA 3K5PA 1KO1A 4JI0B 2FPWA 5D3KA 5LMCA 4YMVA 2IS2A 3AESB 1RCUA 1JALA 2G8LA 4DMFA 3CA8A 1JDVA 1M8JA 2GN8A 2Q41A 1SMKA 5LA6B 4B0OA 2R00C 2P6RA 3CH5A 3E9DA 2OCPA 5ALQA 4DSAA 3QX7A 3A3YA 3JQ8B 3LYAA 3QY0A 5DISB 1USUA 2CMKA 2ZIZA 1YQGA 2QGFA 1HKUA 4XDHA 2DCUA 2YXEA 4AROA 1VCMA 2RGAA 1BU5A 1L1RA 1QIHA 2DEUA 1VIVA 1T35A 1IU9A 4C6RA 2N46A 1YOVB 4JZYA 4RM3A 1MDBA 3WR5A 2IYVA 2V7TA 2ZCUA 3RFVA 1JFVA 4HI0E 1RKXA 1Z13A 4HZIA 3GFFA 3IIIA 3UCXA 4MQFB 3TLAA 2WMOB 1G8JA 2IYOA 5BR8B 3EXHC 1MC5A 3ZBUA 4ZVOA 4OY3A 4DQVA 4ZIRA 4KMSA 5B30A 1XX6A 1KOLA 1RDFA 2OD7A 2IZ0A 3WO0A 5FA5A 2HWWA 2BELA 1YVEI 1MGOA 1V25A 4K1LA 1QXSA 2ZR9A 2PSEA 1QKKA 1Z7YA 1PYOA 3OPVA 4QGGA 2EDCA 2O8FA 2ORWA 3VJRA 4CNQA 2WUEA 4GWKA 3VU3A 3KOMA 4W5WA 4Q4JB 4IR7A 1AGNA 4WJLA 4HDKB 5K8VA 1S4MA 5DJ5A 6CHYA 2GDZA 1IZYA 3C97A 1WB6A 3IOCA 2D1YA 4F12A 3ETGA 4G1VA 1Q91A 1Z7BA 2ZYGA 4NESA 3UPTA 4CKEB 1E64A 2FP4A 1J2JA 3ESZA 1OMOA 1TKRA 3CISA 3N2EA 1JBKA 4BKQA 2OXEA 1DX9A 2N42A 3ORFA 2A7XA 2OHXA 3MTBA 4KQIA 2OYSA 3WKCA 3DL4A 4M89A 5C5CA 2O0HA 4YAOA 4UTZA 4OGFA 2Z6VA 3INTA 5D84A 5EZYA 3DMNA 5IULC 3C1UA 2Z1MA 3M8KA 4LJSA 3JPYA 4OHBA 2G4LA 1FFYA 2XNJA 4EK9A 1X1TA 3UF0A 1DT3A 4HTFA 4LXYA 1KOGA 1FSGA 3L06A 1EWQA 3IUQA 1GHTA 2C9CA 4JROA 1PJ8A 1UDBA 2O1XA 2ZRGA 4UVDA 1OLXB 1XBTA 3PV0A 4JODA 1VJ5A 5TGDA 3V1TC 4PFJA 2XMDA 3M3DA 3AVTA 5IZ4A 3CX4A 4I1RA 2UXDB 4RZUA 1XZPA 3LE8A 1JKIA 2G07A 1D09A 3AEUB 3KQSA 1KK0A 2AOXA 4YIHA 4RA9B 5CYGA 3GFGA 1RQLA 3NVDA 4RTJA 1MC1A 4FNOA 1M2GA 3PDIA 1U9IC 2CBGA 3M6MD 1WCIB 4J1TC 4DV2B 3BJMA 2PZMA 4JLJA 3M0EA 2E87A 4ZTZB 3RC7A 1EJ0A 2JGNA 1EU1A 1SBHA 4CJXA 4IJUA 2WV9A 1O4VA 2QWXA 4INOA 2BJVA 5AI0A 4A2PA 1YSCA 2J3MA 3FIUA 2C29D 3CIFA 1UWVA 3Q3IA 4HXEB 4NYJQ 5AKIA 2OXIA 2P2SA 4AJNA 3UH1A 1MC8A 4BKMA 4BVJA 1S96A 1JEEA 2OHIA 2CUZA 1DO0A 1UK9A 4CE6A 4C76A 4CQMB 1LLFA 1PSDA 3IA7A 1PL6A 3ZJVA 3M4YA 3VAAA 1FXWA 5BMVA 1M9NA 1C1DB 2WY2D 4FFRA 3NT5A 3QF4B 5BORA 2CWWA 2G1PA 1QBGA 3P7MA 5JNLA 5IHPA 1NR1A 1SHTX 2DPLA 3M70A 3A1VA 5JQGA 1LSJA 1GPMA 1HLDA 1LH0A 2D0DA 3C43A 4LYEA 4PPNA 5KNDD 1GLNA 2JD2A 3W5SA 1E9CA 3WLFA 2DR0A 5B3AA 1W75A 3EZ9A 3NBAA 1CUJA 1RFLA 4WCFC 1XZGA 4ZYUA 5LXTF 3OE7A 2RHWA 5CA1B 5IXSA 4Q7JB 1EWYA 4IS3A 2ZPAA 5D00A 1XEXA 1C0EA 3L9XA 4EW3A 1E3WA 1FRQA 2RH9B 3JQ9C 1CJMA 2R65A 5GGYA 4DMLA 3R8FA 4F3TA 4XVHA 3UYKA 1W4AA 2IOFA 1R3DA 3L0IB 1RI5A 1UBRS 3DNPA 2TMGA 3PDHA 3KYCB 4Z2YA 4ZZ3A 3E0QA 1W7AA 2X4DA 4HY3A 4W1SA 2HM7A 2XUIA 2E4UA 2JI6A 1WTCA 3G7NA 2HNKA 4P36A 4QGFA 5AKJA 2V0GA 4MDHA 1QX3A 3ZDZB 4M83A 3I28A 3RVBA 2E4XA 3N6VA 2JAWA 1TK9A 2MSEB 4DCGA 2PMEA 3S40A 3RGGA 1K66A 2FVXA 4IMRA 3VJMA 5A1JA 1HR0B 3FFAA 3HPRA 2OGTA 2WD7B 3D6JA 4I55B 4J4TA 3WWEA 3BHJA 1EUZA 4E7OA 3S7ZA 1PT5A 4HRXA 3A1CA 4ZZ0A 2A9FA 1IE3A 3KKKA 4MULA 1CDEA 5AMXA 2BZ0A 4GE0A 2IP2A 2X6QA 4COOA 4TV9B 1AZLA 4YT8A 3PGVA 5KVSA 2OHHA 3PDUA 3T9DA 3OZUA 1XQ9A 2WAAA 3CXUA 3G9XA 4G8BA 4BCBA 4CF5A 4E14A 1YCHA 4KYVA 5K4HA 3RBZA 3IBCA 4N41A 3AP1A 2XMSA 3PXDA 4MV3A 4R8LA 1Q7RA 2K6GA 3U5TA 2NNWB 1ZR4A 1V5EA 4OV6B 3OU7A 4MA0A 4BP8A 2WOOA 1FC0A 1P18A 1YZQA 1Z68A 5BVGB 2FW8A 4XA8A 2FEOA 2C96A 2EFHB 3MS4A 4I9GA 3IT0A 2XRZA 2QRUA 4KRFA 3DP9A 4Y1GA 2JGFA 4LNUB 4LIPD 4RVGA 1U0LA 2NXJA 3KZMA 1HT0A 3MWJA 3N07A 4ZQBA 2WFLA 4CNBA 3Q40A 2OMKA 1JG3A 2X8JA 4AXBA 4P0QB 4FD2A 4XPIA 2BGIA 1I3OA 1QFJA 3KTFA 5FP0A 1JTVA 4UMEA 2D7DA 2OCKA 3D3WA 1TQ2A 3DYIA 1T8WA 3GEDA 3LNCA 4LRTB 4X3CA 2QYTA 4XUGB 2PJZA 3V2GA 4RPJA 4EYOA 1GPH1 3VTKA 4PHGA 4N54A 3MRVA 2D3WA 2GK4A 3G5TA 3N70A 3WGVA 4RACA 4C07A 1XTQA 5AW2A 2FXVA 1NMZA 3JQFC 2NUBA 2DHDA 4MZDA 4O08A 3WMGA 4G65A 4B3GA 3QW2A 3STTA 3WGJA 4MCJA 2R1VA 5IVPA 3TX6A 4D9CA 2NPFA 5FPHA 5DYYA 1LNZA 1LF5A 2HA5A 2WDZA 3FLMA 4RXUA 4MS3A 3SD7A 4EMSA 4HMOA 2X4IA 2FQ1A 3ZE8A 3ZXIA 4MW0A 4TKLA 1I8TA 3G1TA 1HQKA 3EG9B 3NBXX 3TI9A 3ZPXA 1JSCA 3WDKA 1PVOA 1ZI9A 1Q1QA 1K3FA 4O5AA 1RM5A 5B4UA 1IZZA 1JLRA 2I2CA 5D2CA 2DHEA 3DCIA 3Q8LA 2M1XA 4PXAA 2GKGA 2PSHA 1PR6A 4BQPA 4CI0B 3P2IA 4M7RA 3AVPA 4H0FA 5JLAA 1WNTA 2FMHA 2P2CA 4KLRA 4U9IS 5KAPA 1AO0A 3RYCA 2C5HA 1IN7A 4DRXB 3L82B 4PZ0A 4BB9A 3WLPA 4GMFA 2JLUA 3JWIA 3MJVA 2P75A 3EYAA 5ITZA 3EFHA 2XKJE 1PT6A 2VHJA 1IBCA 1LXCA 4KRYA 4YLEA 3EIOA 1CNMA 2BTQB 2ORED 2ZAMA 3SHWA 2HQBA 1JUDA 3T7JA 1Z29A 1NGSA 1Y37A 3DR3A 3RYFB 1NJ1A 1IK6A 2EF0A 2R9VA 3SDSA 3AGPA 1XEWX 3DDUA 3V6LA 1IY8A 3DFUA 2RCYA 4D9NA 2O59A 1QLWA 2RKOA 3L7BA 1WSBA 3H5VA 3N58A 2GJSA 5LPNA 1QH8A 2LE0A 5B1SA 2FMUA 5EE0A 2PNJA 4YO7A 3S1AA 3S2GA 3LPAA 3UMJA 4LECA 4NBKA 2GK6A 4ZQHA 4EQ6B 2HBYA 2FR8C 3AK4A 3T3GA 2HV9A 1JJBA 4RCVA 3I4CA 3UPDA 4C5CA 3DTVA 2EYUA 1WV1A 5EE3A 2HRQA 1G1AA 5HPYB 1PTKA 1HH4A 4EKEA 1V2GA 5KC9A 5CFLA 2BE7A 4FGJA 3D6TB 4LYYA 3KSZO 5CEJA 3RCBA 1CUUA 5B3JA 1VL2A 3QKRB 1BJTA 3I6BA 1NYRA 2Q9AA 5FO0A 2E37A 3GRKA 1KYZA 2QLTA 1C3OB 3HXLA 3JSXA 2DQZA 4O6VA 2UVPA 4X3PA 1DLJA 3H87A 1KSGA 3ZZ0A 3GDGA 4CUJA 4KO4S 3WNZA 2NUAA 5JO0A 1EFPA 2P4QA 4F06A 2I62A 1MH9A 1UFRA 4YJHA 4ABYA 5IK2A 3SEZA 1YCGA 1BH2A 1GZDA 1NBOA 3FNBA 3EPPA 3RRFA 5DYNA 1OLSB 3T1NA 4A5OA 1ZWLA 3ABIA 4N0PA 2QX7A 5LOVA 3EZLA 3HGMA 4M6WA 4Q3AA 1AX9A 3DAHA 6GPBA 1Q21A 3ENKA 4WLEA 4ZYZA 1XAGA 2Q4BA 3FHLA 3JAKB 2REQB 4CF3A 2Z83A 4DV6B 4JGBA 4C7KA 3WIDA 1E2FA 1N6HA 2R7AA 2Q5CA 2W8BB 2YASA 4B84A 1J39A 1KVSA 1JG2A 2AFVA 3WI7A 4MB6A 2Z1NA 2VKQA 4C7BA 4CMKA 5LDDC 4JV5B 2IY8A 4H6PA 5E8RA 2OEPA 4JLMA 3NBUA 4D9EA 1D7AA 2PAAA 3OJCA 1RC0A 3OX3A 3P9YA 3QG5A 3MJEA 2REOA 3NHPA 4GZMA 4XDZA 3VTAA 4UTNA 1QFZA 2PFKA 5IKEA 4TYYA 2PR2A 3LC1O 2OILA 2XUZA 2GCOB 3K6RA 3KKZA 2OOKA 4A23A 2O3UA 3AY0A 3Q9UA 3ZOZA 2VJLA 4O1HA 4EPWA 2ZTHA 3GJQA 2VZ8A 4GX1A 3U4AA 4P84A 2ABWA 3ZEAA 4YCJA 2GASA 4PO1A 1V1MB 1QO0A 2OGSA 1QK3A 2UDPA 2C3OA 3M5DA 2KE5A 2EL7A 5AVWA 1NLMA 4KO3S 3BK2A 2KI5A 3TQRA 1HZJA 5LSAA 1MG5A 1R00A 4D4GA 1RPJA 4QXOA 1EK5A 2VJMB 3WTCA 4Z7JA 4GYJA 1QK5A 2KM1A 3DUFB 1UXJA 4MO9A 3BD9A 4WKPA 4KLCA 2ZRIA 2AZTA 2I22A 2JG3A 2XRFA 3RC3A 2ZDGA 3CSUA 1SOWA 4II2A 4OJQA 3BMNA 3ZKWB 4UFNA 1E7RA 2WJ3A 4P7KA 1BXRB 5D85A 4LTDA 2QAGC 4N40A 1LI7A 5F73A 3MT9A 3AUYA 4NFYA 1N6LA 1Z4IA 3SDBA 1Q12A 2Z9DA 2H2IA 1B93A 4IVPA 1FFXA 3LPLA 3T4PA 3VNSA 2WKQA 1L8AA 3H8SA 4FI3C 4UQPA 3VSEA 4HLUC 1CT9A 1DJPA 4YGXB 4EHNA 1VMKA 1UKEA 5CYPA 4YT5A 2CB0A 3NGMA 3FYCA 1SU7A 2H18A 2I7VA 1E98A 1KS9A 4IZIA 4Q3LA 3BPSA 4IX9A 4KN9S 3G5LA 4XVCA 2OUKA 1I01A 4Z9BA 4E2FA 2Y99A 3WGIA 1XEFA 3E9NA 5BXQC 1JVBA 2QQEA 2WJZB 3HN7A 3RVMA 4DR3B 1MEJA 4JJ6A 1XJWA 3VHLB 1V4NA 5DHUA 4QJ5A 3PLAE 5DU2A 4ALMA 1FQKA 4CDGA 1H2XA 4TSFA 3V8BA 1K5PA 1G3UA 4B7ZA 2ZJ5A 4JP1A 5IN4A 4O0LA 1MRSA 1W35A 4MS3B 1WE2A 1JT9A 2GEJA 2YHIB 3NJ4A 3ZV7A 4B7AA 1Q0LA 1KFKB 1UEJA 4NFHA 1WXXA 1ULHA 5C7LO 2A35A 1RFGE 2H63A 2J30A 2X7HA 2AA3A 3DG9A 1QX4A 4I8DA 4L5JA 4P1ZA 4GNRA 4CQMD 4OHOA 2QX9A 5DIFA 3ZWNA 4TMXA 5LYJF 2WHRA 1LC3A 2XXJA 2VYNA 5FWXB 4TLMB 3VKHA 4QEKA 2BFBA 4ZARA 2ATIA 4MVJF 5E38A 4JGGA 3L8DA 5J2UA 2UYYA 1P1HA 2EBFX 2GKOA 1N5LA 4H77A 3OE7D 2G1AA 4F4IA 3L8MA 2XEDA 3EGIA 4OI1A 3A9WA 5JVDF 4KEAA 2HA4A 4WK2B 1I3MA 5JCOA 4KN6A 3VH2A 3G17A 3AJEA 2YVKA 5IC6A 3ZHOA 3RTDA 1TF2A 3NHUA 5BSMA 2M98A 1X7WB 4Q9AA 4ALJA 2WPDD 4NX2A 1J99A 2PX5A 6PFKA 1BWSA 2Q2NA 3NPAA 4ML3A 2DFTA 1PQ4A 2FU5C 2EYQA 4BHTA 1XZAA 3AZPA 1NPYA 2JLCA 2L69A 3REGA 4J2OA 5LZ4A 2HR1A 4OUDA 5KCZA 3L8CA 3MELA 3FETA 2I6FA 2UZ1B 1N77A 3U3OA 1DV1A 2PIAA 1EG7A 4KXVA 1WVIA 4PLZA 3SXUB 5JFGA 1QFMA 3R6DA 5KVCA 1QORA 3L7OA 4UHJA 1V0JA 3W6NA 3CNQS 1U6KA 1FJ2A 3ITDA 1ODJA 1TMGE 2PQMA 2QIPA 4NLLA 4UPDA 3IC5A 4ATNA 2XDQB 3R6TA 5KQGA 3HCOA 2I8CA 2ZS9A 3L41A 1AV6A 1X70A 3U4HA 4DWOA 4G89A 1M2VB 2V6BA 1JXAA 3H2HA 1EZ4A 1PFWA 4OK3A 4C0KA 2MMCA 4Q3BA 1K7EB 2P2ZA 4WZ6A 2BF4A 5L3SB 1NE2A 1X92A 5FJIA 5K8IA 3HVRA 2VHUA 5LP6C 4NENB 1N1GA 4R8SA 5LQSA 3KS9A 2XCQA 3N7AA 2VK2A 1KI7A 2CDAA 1JDNA 2P9QA 2GX6A 2C31A 2ROQA 3IJEB 3JD2A 5HF8A 1K06A 4FNAA 2LKDA 1MOSA 1TKBA 3IUPA 4ZQEA 4JVNA 3CLTD 5IH3A 5FLXA 2VXCA 3O8QA 4GMGA 4KHZA 2WIDA 3PKZA 5ALJA 1KMQA 4TKMA 4IXDA 2KHZA 2Q5JA 3MRSA 4YP1A 3ZX5A 4BNJA 5BYKA 5A0TA 1D4OA 4RVDA 2K7FA 4IKOA 3C4JA 3BTOA 2I7DA 1KRHA 4Q9HA 1SUCA 4HDRB 3T8YA 3ZY5A 4DHWA 1GPAA 2O8EA 2HHAA 2C3YA 4RVHA 1P4GA 3IUBA 4MUAA 5T3YA 1GKKA 3B8HA 5ALKA 3UATA 3HJAA 5DBGA 3Q0EA 3IBSA 2JEZA 5NULA 3P4XA 3EHEA 3UJHA 1XALA 4QJ3A 3B5JA 4HWKA 3PNLA 3BSFA 4DLRA 5KNCA 4TQGA 1N6NA 1H2WA 9ATCA 4YUXA 3SWWA 5AM0A 2BBSA 3KU1A 3T9AA 2MOKA 3A4IA 4MGYR 5I8PA 2NU7A 5J2TF 2H9IA 4KXWA 4YCDA 3JV7A 4GEGA 1ZR2A 1XR3A 2LVBA 3MWDB 4AMGA 4CV0A 3BIXA 3A27A 5DN6A 3ZLTA 1JWBB 1IHXA 1NI3A 4D1YA 2W8ZA 4H16A 2FPSA 5CB4B 2JFQA 3Q7SA 4DMUB 4KC0A 1T0JB 3DDNA 3EVAA 1SUAA 1MB2A 3GPDG 3GFBA 3ZR4B 4ENVA 2FW0A 2ZB4A 3O9ZA 4QU8A 5BW6B 5L6MB 3ZC3A 2X77A 4FZ3A 1CUXA 4NFSA 5FFMA 5KTMA 3CBGA 3QH4A 1FFCA 1LFAA 1RRFA 1WB4A 2IUEA 1KEUA 3A2LA 5FTMA 1A82A 2E4VA 3ENQA 1FBNA 4LZOA 1M2NA 5AKZA 2DB3A 3BT7A 2JGDA 1ZGBA 3BERA 1TYBE 2I1LA 4JK3A 1IL0A 1LPOA 4IDBA 4Y7DA 1AKTA 2A5FA 4A0RA 1TM4E 3HUDA 1W6RA 4N5NA 4QSHA 1BKDR 4PG8A 3ROZA 4JBHA 3WG9A 1G8FA 4KHPB 3WLMA 2DE0X 3EAFA 4PZCA 2B5VA 1F6BA 2GVZC 3V4SA 5BW5A 3BE6A 1JKJB 2Q5QA 2SBTA 1KPGA 3OZCA 4GLFA 4WXPA 3SIWA 2CEKA 2I80A 3MWEA 3EXIA 4OXRA 4MYTA 2WTXA 2VATA 4NFLA 4YI5A 2JFBA 3UJ3X 3ZCQA 1D4ZA 1G6Q1 1XB2A 3BYZA 3HACA 4Q93A 3LXMA 1CBUA 4TZ6A 1Z82A 2EXXA 4W6ZA 3L7MA 3UQYS 2HA6A 2R8PA 2AF3C 2O6HA 3B9RA 4LI3X 5A0FA 4ASUD 1UC5B 2PD3A 3F7NA 3QE3A 4MUNA 1I30A 5BSKA 4DLTA 4UMDA 3U7JA 4J8PA 1ML3A 4DIBA 3AFNA 3DAGA 1TYZA 1ULUA 3O2JA 1NPDA 3WK8A 3T9CA 1CQXA 2PX4A 1GGVA 2ERXA 4KWTA 3THXA 3QPAA 4AIRA 4XPIB 3B5EA 1ZD2P 4PBSA 5TPWA 2A9RA 1YONA 3UO8B 3VJLA 3QLJA 3O7MA 3BGDA 2IJGX 4JKYA 1G7SA 4U7HA 4B1FA 4ASUA 3TIFA 2AMJA 2OXCA 1OUMA 1XYVA 2FZ4A 4MQ4A 4ZAXA 1I1OA 3I6IA 1BD3A 1X1BA 2VCHA 2F1RA 4WCFA 4EARA 3VISA 1AKVA 3SVLA 5FAXA 1N2OA 1X7ZA 3EG9A 3PDWA 5CBPB 5IF9A 5AK6A 5EQTA 1J0XO 2AUTA 5H1YA 1P7PA 1XPJA 3HCDA 2VT7A 3FYUB 5TVGA 1LK7A 3SLRA 2BFFA 3OH8A 4GWLA 4JEUA 3T12A 3WLRA 1D1SA 4F46A 1X39A 2IUYA 2NV0A 4MINA 1A2BA 4GVPA 2V0CA 4E32A 1YOVA 1OH5A 4BXOB 4NPHA 1L7BA 3KV3O 2W4IA 4JIGA 3EOBI 3IJRA 5CK5A 4U2KA 5K3BA 4HGZA 4Q1EA 4CIYA 4XOUA 3WLIA 4OJKA 1V5WA 3LBIA 4AS3A 2DCMA 2ODTX 4TYPA 2Q4RA 3JQ8A 3L77A 5ESRA 3GJ0A 1Y8RA 2YJGA 1PNVA 1JU9A 3U7QB 1W8DA 4MUHA 5GAJA 3A6EA 1ICIA 3F5FA 5CM8B 4MVJE 5L6LB 2CF6A 1OAOC 3PJRA 4GRAA 3SXJA 1NKTA 3FB1A 3ZCRA 3OQBA 4BRUA 4ESHA 3AX6A 1KNXA 2WQZA 4B85A 4JI2B 3PEYA 2IBSA 2AYYA 3DTYA 3I01M 1E1KA 3FR7A 4IQ4A 3SS8A 5BWBA 5I7RA 3A6PC 3VPFA 1WS6A 3PPVA 1WMSA 3H05A 3R9IA 3DXZA 2PZAA 3UWKA 5JSFA 2VUIB 2GGSA 5J4YA 4AYXA 1BFKA 1G8SA 1ULTA 2PLFA 3HRKA 4PQEA 3OX2A 5CVTA 1HEUA 4UM9B 1CIVA 1GRCA 1QV6A 4P7GA 3TSAA 4OHCA 3ZU4A 4Z4QA 4UEQA 4UASA 1MN6A 1Y7LA 3W8FA 1KRXA 2IOYA 4LKRA 2FWRA 3AY3A 2W6PA 3GZJA 5E6UB 1Y63A 4RY9A 4EFKA 1WLYA 2I3BA 1WXEA 1G8KA 1L3IA 2HJSA 4L0MA 3D7KA 1CZLA 3I3OA 4DY6A 1X86B 4H08A 1WOYA 2FDCA 1TPYA 2ZTVA 3SG0A 2X5NA 4IL5A 4ZYLA 1QUEA 1Y0BA 2WA2A 3IXMA 5E3HA 1CUSA 3WX0A 3EY4A 4C87A 2XXAA 4OXIA 5FPPA 4BCDA 5JI3E 4PN3A 4Q6WA 5K5EA 2XUAA 2NVWA 2CCJA 4QXAA 2ZSAA 3MIIA 2AC4A 4EW6A 3LPCA 4HNRA 1GJRA 1XMIA 2QUHA 4YBZA 2VTBA 2X86A 3GGCA 1T0HB 2OAEA 3GDWA 4ED9A 1OX6A 1SUDA 1W34A 2RGXA 4W99A 3T7TA 1WZNA 2ZDHA 4ANFA 2ZSDA 2M6RA 3K0BA 1R6VA 3LUFA 4IXWA 2HYIC 1Z0KA 4CF4A 3AIKA 4CHGA 1HZZA 2PS9A 1ZIOA 2V3VA 2MDTA 4IJKA 5ALIA 3F6SA 1GA6A 1M3SA 3KEFA 3Q2OA 4AK9A 1AS2A 4MWEA 1GAXA 5FOVA 3WY9A 2G28A 3HVUA 3TXXA 2OXRA 4JEMA 5HQTA 2GBIA 2Q50A 1COZA 3JW8A 2XITA 5TJ9A 2V6MA 3K94A 1Y1SA 3MJSA 3H4IA 4QNMA 1I7DA 1B8PA 3BQMB 4A2QA 2Y1EA 5BN3B 2AI1A 1R16A 2P5TB 4PLPA 3SF0A 1BX1A 2VPQA 4OLFA 4TQUS 4KSYA 2H4HA 4DWJA 1H94A 1DAKA 3WMXA 4A0HA 3BEOA 2YKGA 3NXKA 3Q2KA 4BFSA 4G0OA 1VKHA 5JJIA 1AOXA 2C84A 1A8QA 2D54A 2GLTA 3RG2A 3VZQA 1M2JA 1LBTA 2IBMA 2QTRA 2ZWOA 2AV6A 2QVCA 1NA5A 3HM2A 4CKBB 1VI2A 4FMPA 4GLOA 5HS4A 2SICE 4HAVA 4C0XA 5C5DA 3FPHA 3BWDD 3JR3A 3W78A 4M87A 2W37A 1LSUA 4PYOA 1T8TA 4R6XA 4Y18A 2AJDA 1L8XA 4KR2A 4XH9B 1N2EA 2FP4B 1BXGB 1NQOA 1XZHA 3AUFA 3BAZA 3DMRA 1M76A 1UINA 3F1LA 4ARAA 4BX2A 3EEOA 3ANSA 2QU8A 3D5TA 3H9GA 1L5ZA 1C2TA 1ORIA 5A02A 2TMKA 3AF6A 4DWWA 4RD0A 2YJ6A 3L0DA 1JJ7A 1TTPB 2PO5A 4DR6B 5KVVA 4NICA 5CK4A 2XI4A 3L7YA 1EDDA 2IVFA 3O8CA 1GNPA 2QE7A 2J9ZB 2O23A 3UB2A 4IGAA 5TB5A 1RLTA 2GBFA 3BWYA 3OTIA 2J6HA 4FX5A 3I58A 2FLVA 4OSPA 4V0QA 2AN1A 3P52A 4D0NA 4IOMA 1L4KA 2GZSA 3O3OB 2FR0A 1E7MA 2BFAA 2H0QA 4IMIB 2WIFA 1RXVA 1ZNZA 2H48A 3UJBA 1ZW6A 1YJ8A 1AXGA 1TMOA 3ZU2A 4R2KA 1RI2A 5GJVC 2MINA 4ZHQB 2ZAYA 4YMIA 3MNFA 5D6NA 1U0SY 3PXCX 2F7SA 4Y9RA 1L5NA 3H4VA 2PGDA 3NAQA 1U7ZA 4Y0VA 4GDFA 3S68A 1U5AA 3KLNA 3FDFA 1YQWA 1XRMA 1M0TA 2ADMA 3FPGA 3KBOA 3QNWA 1U8TA 5EHNA 4ZXPA 1YIAA 5FI3A 5IAJA 3OIUA 2A84A 1P5FA 3T3PB 1ZJ4A 3AKYA 5HE9A 3V00A 1U4SA 1XZQA 3K09A 3VPDA 1X9IA 1Q1NA 4QQNA 3WKDA 4RTLA 2X8BA 2PXXA 3HMQA 4KAFA 5AVXA 3VVBA 3KL2A 4EYGA 5FHRA 2QX8A 3DFMA 1WMEA 1ESDA 3HJRA 1W49A 3ORYA 4J1QA 3AOEC 4PSVA 2Q1SA 5JVDA 1XPOA 5K4GA 3CEMA 3BFPA 4REQA 4XOIA 4GLLA 4FHGA 3TDNA 4ZVNA 2AK2A 1GRRA 4C89A 4MI3A 1U3WA 1VIMA 2NYUA 4Q4JA 2F3RA 4RZ2A 1N57A 4X8HA 3NI2A 2IWRA 4TYWA 1P4SA 5K6AC 3B6KA 4GX0A 1E1YA 4LVNA 4V0KA 3LZ6A 2JHAA 1I9GA 4OYYA 4YUZA 1L7QA 4PHFA 4M2LA 1HLPA 3CM0A 3TMAA 3LFHA 3JVVA 2A5LA 3KSBC 5BWMA 2ZYWX 2PVCA 2NV2B 5EIBD 5J5CA 2RC6A 3NETA 4IV8A 1FMCA 2PWAA 4W9NA 1QU3A 2D6FA 2AK3A 3ACDA 4TMKA 4M99A 4N7BA 3TMYA 2GBGA 4BX3A 4URVR 3AERA 2ZWMA 2XHZA 4INZA 3CB2A 1FNBA 1PX0A 3NKLA 4EA6A 1JKJA 1ZRSA 2C7OA 1WUYA 3FFTA 4FSDA 4BJ1A 3QKSA 1PU2A 5DLDA 2C7GA 1LB1B 2EIXA 2H1HA 3P32A 3QMMA 4GLJA 3L1JA 4H31A 3JVDA 4D8XA 4R7GA 3DULA 1H4TA 2H1LA 2XODA 3WNBA 4WHMA 2EGUA 1TKAA 2CMDA 2Q5LA 4HGOA 2Q3HA 3OIYA 2IODA 1VMEA 1U5CA 2A92A 3IDQA 2EEPA 3E8XA 4BAUA 2HWXA 4FNGA 4HDSA 4JI1B 1JJAA 1B26A 5B6PA 4XCXA 3E1GA 1MDFA 3DT6A 5M7EA 3QU4A 3UKJA 1XXHE 1JLMA 2GBCA 3I4LA 2AUMA 2HTFA 1Z83A 2MU1A 5K01A 1SCAA 3GU3A 1N7HA 1U7TA 3K9GA 1IH8A 3LPNA 4HQRA 5EE9A 1I32A 5LA6A 4QTUB 3DMDA 5BV1A 5F35A 1AZSC 3V8RA 1CR4A 1GPLA 1NP6A 2V3WA 1HI9A 1Q20A 4K6CA 3KXPA 1HDOA 1RHMA 1J0DA 3NEYA 4G5SA 4ZA2A 4OHUA 2V1UA 5FTWA 3UXEA 1PJCA 2HD4A 4MKGA 2QR5A 4RELA 3RIXA 1RWKA 4MLZA 4QA9A 5DHSA 3B1XA 5AVTA 5SY9A 1EDZA 1U11A 5JDCC 3BL5A 3DLIA 3KEOA 3PEFA 3RW9A 1WETA 1ZOPA 3M49A 5DV9A 1PS8A 4MHSA 4LJ4A 3ED1A 1T9DA 1LI4A 4JN6B 3ZDYB 4P81A 2L82A 1UAGA 4PLGA 4M0MA 4Z1MA 4DSZA 2CBXA 1ZJYA 4E31A 2DZDA 2FEAA 2QP3A 2JIBA 2ZQYA 3PE4A 3HP1A 4K9DA 1R5OA 4CPDA 5AVQA 3Q4GA 4Q7LA 1LPAB 4Q4HB 4CUZA 2ISSD 1PUIA 4NE2A 4H1WA 3JALA 1RPZA 1VDMA 4UHHA 2JW5A 3BXHA 2QJWA 1R9MA 3JYOA 5HM8A 5AO9A 1OW3B 5JXGA 1IBMB 2BSQA 2Q2WA 1B74A 1Z28A 3BAFA 2XVAA 2YWGA 3AUSA 4JHXA 4P31A 5B2EA 1PR3A 5KJCA 1FA9A 1I3NA 1I4LD 1OJ7A 2ZSBA 3GLTA 3PFNA 4PVDA 4RAQA 4G0XA 1PJBA 3WOVA 4Q4LA 1CR6A 1HLGA 3WWPA 2Y4NA 1BDHA 1ECGA 2JCXA 3RSLA 1VBKA 3UMBA 4IZHA 1KEZA 3SK0A 1D1PA 1E9SA 2PX0A 3CPJB 5TGTA 3DPIA 2H2GA 2E85A 3W7BA 1T25A 4CLDA 3R5JA 5IT5A 4J1NA 1E89A 2WTBA 1XTIA 4MVJD 1PAUA 2PX6A 3J7AC 3ILSA 5TF4A 1TJNA 4JXJA 3SSMA 4UNSA 1P9RA 3OWHA 1RJ9A 3WAGA 3KJQA 3ND5A 3OLWA 3S2UA 5K4AA 4R1TA 4JKOA 4X1KA 1PGQA 4RE5A 1TUIA 2Z0MA 1DEKA 4WKGA 4MRMA 4JI4B 1GEEA 1TT7A 1T2FA 2ZB8A 3IPLA 3DNFA 4J0EA 3RTBA 1QIEA 2I54A 3EVBA 4RWEA 2PT9A 4G8CA 3S5UA 1SB8A 3WJ7A 4YDSA 4BNWA 2RI6A 4JJKA 4UVEA 4ZVQA 4DE5A 2NO5A 1BWQA 1Q3HA 1SBNE 2VSXA 2XIJA 4WVLA 3SJAA 5CDFE 4PZLA 1I2MA 5CNJA 2COKA 2PJUA 2WJIA 4QBFA 4YN3A 3EVDA 5TMDA 1QWSA 1E61A 2R5NA 4HYYA 2DMRA 2Z8YM 3KKMA 1XNJA 4I6GA 5I9BA 4D57A 5LQKA 3X1YA 1TA0A 2HK7A 3OJFA 4GM1A 4CCYB 4ENQA 1RAIA 2LP4Y 4ROTA 4Z0HO 5TSDA 4RKRA 5KNDA 4QYSA 3FVQA 5ICFA 2WZCA 2JA1A 2AJBA 3W8NA 5LQNA 1PO7A 4LWQA 1A4RA 3PBKA 1O94C 5KKCA 4XSVA 1UWKA 3HSYA 2C3UA 1A96A 2XTNA 3OIGA 2HCBA 5IP5A 4X95A 2ILTA 2BGUA 5JPCA 1LTHR 4CR6A 4EELA 2O4UX 2JI7A 3HBFA 1U2GA 2W2OA 3HLTA 3MYYA 2VWHA 3NORA 3ZHZA 9ABPA 5K8JB 4ZMSA 2BEUA 2BC9A 1J42A 5EFOA 4AKEA 4N8DA 1FP4B 3IV6A 2WWHA 4FBMA 3PFWO 1T2UA 2VRBA 2KJQA 2A0XA 2YYSA 4UNRA 2H7YA 4GBGA 2JL1A 2VDMB 4BO3A 3GH1A 1ZI6A 4TVKA 1WQ4A 1BOOA 2O7RA 3QZUA 4MCHA 4I4LA 4QAQA 1JSXA 3L8YA 3V8MA 3AEZA 2G77B 1BW9B 3LVFO 3FROA 4KBYA 2GSDA 2NZXA 1BYUA 1D2MA 4ND7A 2QZJA 1D3AA 1XRQA 1YB7A 2XUPA 3UHPA 1KEKA 1UOOA 3AUAA 1V11A 3AWDA 4R40A 5HCIA 3A1WA 2E5WA 3IEIA 4Z8YA 4N5MA 4OJYA 5F9MA 5KUTA 1QIJA 4BV9A 5E2BA 2ID4A 1NIPA 4M0CA 1XDDA 1YS9A 1XWIA 1Z4KA 3PPYA 3V1MA 1FDUA 1CZUA 2FSIA 1H5NA 1JLHA 4LJ6A 4FXPA 2COUA 4X1YB 3HGQA 2B34A 3QVWA 2VDRB 3HGTA 2ZU0C 1FFGA 3KZKA 1M10A 3OKAA 5HDQA 1MV8A 2G5PA 1KDVA 5GMOA 4GGOA 1JI0A 3SC4A 1VI6A 1BVRA 2F9FA 3CR8A 4C4OA 4AT1A 2EZ4A 1YGPA 2DOKA 1E2IA 1CXZA 3JU3A 3HRHA 4HNGA 2VHCA 3RVKA 4B31A 4PE5B 4YCSA 4RCZA 2HFJA 4U4AA 2ZP1A 4NCJA 3N2GB 4TRRA 5IW8A 4DUYB 1GZHB 3O2NA 4F92B 4AMZA 4TMYA 2ET6A 3I1YA 3VZCA 5HQ3A 2V0NA 1WMBA 5IVHA 1LS1A 4MIOA 2MSNA 3DFFA 5G02A 3T35A 3ZW8A 2PMDA 3AUXA 5HKOA 2CWDA 1NOIA 2X1MA 4H3SA 4EL0A 3R5XA 4MW5A 4AYTA 4O2AB 2VEOA 1ZJJA 3EUFA 3QEMB 2SKEA 4MYUA 1TGYA 2ZRHA 4IBOA 4L8LA 3CW8X 3OHSX 4F85A 4QKQA 5EXTA 4DLNA 2Q4OA 4R2JA 1KHTA 4DLWA 3K9FC 2AOTB 2GPNA 4NQRA 2HJHA 2YVAA 5JAOA 4JJEA 1ESMA 1H23A 3PQ8A 5CT8A 3EPJA 1A72A 3ZWVA 4D81A 1RRCA 5E1MA 4YPFA 4BNVA 1EAMA 4BC1A 1NTRA 1HL7A 2FUNB 1QGDA 3SSOA 2IHZA 1RR6A 3TQCA 3BMOB 1F2TB 4MHOA 3BE5A 4CG3A 2OHVA 2ZJOA 3AKDA 5L3RA 1XAHA 4DUGA 5LJIA 1JKFA 3MMZA 3H1AA 1U7WA 1PHPA 3K0CA 3E18A 4YMGA 2EJWA 2GPSA 2YUIA 2QD3A 1I3LA 3EXAA 1D03A 3HKCA 4E12A 1M2HA 2GTIA 1Y98A 2XD9A 2VDUE 4G9EA 4KMMA 1U1DA 1X1EA 1DAOA 4KIUA 2C88A 3MGKA 3MJDA 4ARZB 2XZPA 3K4HA 5LNK1 1IWPB 4NEHB 1T6XA 3I09A 5AI5A 5G4LA 2CUTA 3IQFA 1VMAA 4X7RA 5CHEA 2BCEA 1N2GA 4Q7MB 3TB4A 4BJ6A 3TZCA 1LDYA 1XSEA 5DGHA 5EZSA 4J9UE 4LZAA 2BAGA 3WB2A 2HPAA 4V38A 2W42A 3WWDA 1QOPB 2HDNB 1YMUA 1GZ6A 3FTFA 3HEBA 3RYCB 3VR4A 1MQAA 2ZJZA 2HQOA 2VPIA 3ZGYA 3KO8A 2QM7A 1DDGA 2VAPA 1RBYA 5MHTA 5A0VA 4M0LA 2BR5A 4XJVA 3V7WA 3WQQA 1E3LA 2YDXA 4OMCA 4WY5A 3WGTA 4C0AC 1KU6A 1YJBA 3T7CA 2QJFA 5DHQA 1J8VA 5FTKA 4EIWA 4DDWA 2C00A 2OV6A 4OBBA 3DAOA 1NYLA 4GQBA 3GIWA 4I1YA 1Z4MA 5BV7A 1RYEA 1X87A 4Q5IA 1YMVA 5DTJA 2VYCA 1E20A 1VPEA 4R1UA 3SYMA 1ZRMA 3HFJA 1U8EA 1FDTA 4IDDA 5EXPA 4IQGA 1F0YA 2IOQA 3KFLA 3QXJA 1M66A 2PZFA 3F2VA 2AOUA 3I30X 2DECA 4AZVA 1Z39A 4J3JA 5IBPA 1T8PA 3ODGA 3IBFA 4N5DA 2AEJA 5G0WA 5SYNA 5AI6A 1GTL1 2D7JA 1YHZA 4AZ3B 3MT8A 2XTJA 3DB1A 3G3EA 3MTGA 5SZIA 3I76A 5ILOA 3OUZA 4J49A 4BQOA 4GM4A 1R6DA 3AI7A 2ORIA 5KSZA 2WHQA 4LDJA 2DF8A 2ESRA 4NZZA 1N2XA 2C1EA 5TT1A 3GRCA 4G4IA 4RVSA 2MT9A 3PYLA 2YHAA 3MGCA 2AL7A 2HDWA 3EMKA 4HZUA 3L93A 4RZIA 4YRCA 5THXA 1CETA 5EERA 3SMQA 1FRFS 3GEMA 1KH3A 2OR3A 5HUJA 3AFIA 5B7GA 1FW6A 4KPUA 3D81A 4JKIA 1ISFA 2ZZMA 1OU0A 1S3FA 3HDVA 4URFA 1AG9A 1PFKA 4F1WA 3C8DA 1AE1A 3G9QA 4TXMA 1FPMA 3VKWA 4TL6A 1FTWA 2JBAA 2Q49A 4LMPA 3WQSB 3DOUA 5IJZA 4U5QA 3RLIA 2GJ4A 5JW6A 2YYYA 4DCSA 4FS8A 1XA4A 4YTEA 4BNXA 1Z7GA 4PWZA 4PC2A 1SY7A 2HJWA 3ZE9A 3EEIA 1C8KA 2YZNA 2FWPA 3IYLW 4FC6A 1T26A 4HDMB 4C3ZA 5B5SA 5AW5A 4ENRA 1RNLA 1JPJA 1OLUA 2BDUA 2DH5A 3P26A 1C41A 4NOLA 4F1JA 4ESVA 3AF5A 4CDNA 4LOKA 1OBVA 4ZFNA 2PUCA 1IN6A 3BZUA 4NP6A 2FWIA 3H83A 1UBHS 3BIJA 3TBKA 3DLCA 3QVXA 1DCMA 4WBNF 2H9YA 2WB4A 3CKKA 2PCJA 2IIPA 2W2LD 3F4LA 4UCWA 4H0NA 1NJ5A 2QM0A 3JS5A 4WBSA 3SVTA 1CTQA 2P2LA 1WPXA 3LT1A 5P8WA 3WGLA 2W2KA 4FLEA 2X22A 1G16A 1IC6A 3LOQA 1OVGA 8AT1A 1I6KA 3B13B 1RRMA 1U0NA 4GBED 4CTKA 2QRGA 1T9GS 1PR9A 2CC2A 3MTDA 3VM6A 4WNAB 1TB4A 1XEXB 4HNUA 1CUEA 4WDQA 5BY2A 1C7QA 2C77A 1K75A 4K87A 4ZAFA 3V9AA 4OYHA 1UPAA 4C2BA 2RB4A 5AVSA 2G63A 2BMFA 2I55A 2OG2A 3BSSA 3R6WA 2UVQA 4ZMRA 1G8YA 4XGNA 3IAM1 1NW3A 2MWMA 4FDUA 1MBZA 4CMIA 1W73A 5KYWA 3DLBA 2YCLA 1RM4A 4AKSA 2QMHA 5J2TA 1WHTA 1E4YA 1T5IA 3IQEA 4PCVA 2QS9A 5KOHA 3RF7A 3EWSA 2HZ7A 3GRYA 4U2BA 4UDNA 3QF4A 1N6KA 4TV9A 1L5SA 1GQOA 4CDMA 3H11B 2WF8A 3L0PA 4OI2A 3K2IA 1JJFA 2JAQA 2IYNA 4XWWA 4WQMA 2FQWA 2XE4A 3FI9A 5I7FA 4TUYA 2EWWA 3O8OB 4RF5A 1VMDA 4MVYA 3N0RA 4W1PA 5HZGA 5K0JA 3W05A 2QJOA 5IMBA 1QP8A 5BVHA 4JT9A 4LISA 4UXIA 5DN9A 2PUJA 4A5SA 4ENSA 4YS6A 2V5VA 3LTEA 2RHGB 1ZK1A 5EXEA 4QRIA 5D86A 3TIXB 3R09A 1H69A 2YV1A 2OZKA 4EGCB 1E1RA 4BCCA 4DSUA 2JBHA 2IEDA 2B35A 4QC2A 1KK1A 3A1FA 4MRSA 1SA0B 3EFOA 2RAFA 4EFDA 3BE8A 3WL6A 4YR9A 1XLTA 4AO7A 1SWWA 3PYMA 2D0PB 2W2KB 4L5BA 4EMTA 3QPDA 4X20B 3RASA 2D5CA 2IDZA 2H4YA 2JI9A 2XEXA 2O20A 3GGDA 1C9KA 1Y5IA 1MCZA 2I8LA 5ELMA 2YX1A 1DIHA 3DE4X 1M8KA 2BVNA 4LE2A 3PXAA 1IPEA 4KK4A 1YR8A 4MKHA 4QQFA 4HUTA 3ESXA 5C0OE 4DGQA 4RTSA 2AW5A 1F7UA 5A5EA 3CS3A 4DY4A 4CLOA 4FGZA 3NU1A 5EWJA 2PZ8A 1KMHA 5DCLA 5G4KB 4IOLA 4GE3A 2YFHA 1DKLA 1XKLA 2P7HA 2G7MC 2V1XA 4IH9A 4GL2A 4D3DA 1REQB 1XRLA 2DM6A 5DNUA 3ABOB 3H8WA 4JBNA 4ODIA 1ATIA 1U0HC 3PC6A 5DM2A 3BX1A 3NVMB 4NDZA 1GV0A 2Y0BA 1P1RA 2J41A 1O08A 1VG9B 3HYLA 2ZUEA 1Q19A 4BQNA 2IHTA 2E49A 4FUQA 3DJFA 2VDLB 1MPTA 3Q87B 1S2OA 4RJIA 1E8NA 1R5JA 1VIDA 1XQ1A 3TTSA 4D98A 4RTMA 3AI3A 4E2YA 1DHTA 1I5EA 2WT4A 3DF7A 4JUIA 1EQ2A 2PRIA 4LOAA 4NR0A 4QHSA 1DWQA 1OFUX 2AN4A 3K92A 3RYIA 3ZE6A 2Q1TA 2BBWA 1FK8A 1PKEA 3C6ZA 4XYGA 1IQPA 3O92A 1TAGA 2JKVA 3AJDA 1I6MA 1U65A 2B1RA 2QENA 4HQFA 3HHEA 4IO1A 1EP1B 2UYCA 1GZVA 2YZ7A 1JG6A 2GZMA 3T7AA 2YVQA 1PD0A 3OM1A 3D1JA 2PSFA 4QAJA 3JAWA 2A33A 2H5EA 3IP8A 1Y48E 1KMIY 1ZNWA 3B60A 5C8YA 4Z54A 2GHIA 4UCQA 3SVZA 1Z18A 1N25A 1AKQA 2IQ5A 1G55A 1Z2CA 3E7FA 3NATA 2Q3MA 4N18A 1E2UA 4OH1A 3HO6A 4CM9D 1NBMD 2QI9C 2Z6UA 4U2EA 3KXDA 1MP0A 2XQJA 3C3EA 2WVJA 4C22A 4JIMA 4WW0A 1P0FA 3IDOA 2JGJA 3TLMA 5AOAA 3GGJA 3IALA 2IIBA 3HU3A 5I45A 1ZH8A 1O8CA 4QDTA 5JHGB 1FIUA 2GAFA 2PRYA 3DBIA 4YPOA 16PKA 2BLLA 2JANA 1KRWA 4UARA 1F17A 3RQIA 1JEDA 5FL7A 5IDXA 4G1CA 4QUIA 5ALTA 4I2NA 1X7XB 1W93A 1EX1A 2PH7A 3E7WA 4FEGA 4FCCA 4TTVA 5EHGA 1V48A 4LQLA 4HB3A 2A1TS 3BL8A 5FYQA 4BLRA 1R15A 1J00A 1Q1ZA 4HQKA 2OA0A 4AZ0B 1Y6GA 2BMDA 4YAKA 4OHPA 2OAQ1 4JMLA 4P9NA 4YXWA 3V33A 3VU1A 1V47A 4C4YA 3IKMB 4MAFA 1KC1A 1QCCA 2V4MA 1W1IA 1ULSA 3VR5A 4RABA 5DFAA 4EKGA 4XRRA 4BO5A 1J06A 1A04A 1U2SA 4GSKA 4B71A 3L5OA 1LPBB 1ADFA 1SEPA 3JD3A 4Q18A 1SUWA 3BIWA 4PLFA 3HBJA 4ZT5A 3U1VA 4ZOQI 2FFRA 3H04A 2VJQA 2F8SA 4RF3A 4X9XA 2QUAA 4QOEA 3CUUA 3KE9A 1I0ZA 1DKOA 2PXHA 5E3JA 5HW0A 2BKLA 3R5KA 3RC8A 2CW5A 2KBEA 2PLWA 2Y2UA 2YXNA 3F97A 4UOZA 5IPFA 1EP9A 1RQ7A 1ODCA 2C2GA 3INGA 1QNFA 5LIPA 4KIFA 2QMUA 3E22B 2Q0SA 1DKRA 5DASA 5KS2A 3G1WA 2VP6A 4RUKA 4TKUA 5GQSA 2H11A 4JR0A 3DQQA 2Z5FA 1V71A 1W4CA 3W6ZA 4HAWA 4IVQA 5A1TA 2FJUA 1WJGA 1FRZA 1EVEA 3U56A 2D0OB 4UOEA 2JJ1A 3UMYA 3PKIA 5CVDA 2FDRA 2V65A 3TTVA 3R7NA 1T8YA 1JHXA 7GPBA 1QRUA 3TEJA 1W25A 1MA3A 4KZPA 4ZZIA 1GARA 2VP5A 5FFFA 3UNXA 3O8BA 1BA2A 4ZTBA 1S1MA 3RSOA 4FMCB 2VP3A 2N75A 2WAOA 3E5RA 4IUCS 3IAUA 4R9VA 2QUBA 1JEYA 3JSAA 2I4NA 2RB5A 4CTMA 2GD6A 1EWRA 3FPSA 4UEWA 4WCDA 5EKDA 3VBEA 4D2IA 3ETHA 1YJAA 4R1PA 3CRMA 1T1IA 2Y1WA 4DOMA 3V7UA 2FG6C 1Y9AA 1E3SA 3AONB 3GFRA 1YTLA 4H59A 2A8YA 4EJ2A 5LQAA 4RY2A 2OCIA 1C9MA 1HSZA 1P1IA 2IXDA 4OM8A 2UUBB 4O29A 1HA3A 1F4PA 1NF9A 4QFCA 1VJGA 1SNYA 3T9FA 3VR6H 1QZZA 4BGIA 2ZYVX 1EFHA 3PNOA 5DP1A 5L8VA 4HNAA 2G06A 2ADFA 2JIOA 4GPD1 5B64A 1WPQA 4URYR 5FWNA 2BEKA 1GLGA 2X7JA 4NARA 3ANMA 3IKLA 1KYQA 3QVGB 3CIOA 4JT8A 2F9MA 1JQJC 4R1LA 1O94A 1J2UA 2GEFA 1CP2A 2H17A 4BAZA 4DMHA 3W9BA 3FKJA 2IZ6A 2XLBA 5DNWA 4DADA 1UC9A 3K0FA 3GRAA 3ENNA 3W6PA 1WR8A 3C3DA 1GYQA 1YZYA 2I66A 2K2WA 3GRVA 4EVRA 5LM3A 1UODA 1KETA 4RGBA 4AN0A 3N8NA 4I0WB 1YUNA 4YHHB 5CH8A 3VR3A 5DBFA 1YR6A 5LDGA 4MPRA 3ZQ6A 1G9XA 3ASVA 4UFOA 3DDZX 3JYLA 1O96B 3ICEA 2JFHA 3PUZA 1TEZA 4CHTA 3D6VA 3FPJA 4Z51A 2WAXA 4FZJA 4ZI7F 3FF4A 4Q21A 2CLCX 1FXSA 1RQRA 1QLJA 1GR0A 2EJTA 3DFZA 4LRYA 3I53A 4OHWA 5A9TA 4O2RA 4DZTA 4FR2A 2QY6A 1FNMA 1R64A 1ZONA 1MTOA 2GN2A 1A50B 2PIDA 3R4VA 3CGWA 1VECA 3DONA 2CYAA 2DKOA 4IDFA 4CF6A 4GP9A 4DM3A 3IODA 1Q1AA 2PKCA 4MIEA 4MZXA 2ZIXB 2UAGA 3CZ5A 3U4IA 5DE3A 4CTJA 5JI2E 4J43A 1BC5A 4C4TA 2ZRDA 4HTFB 1I51A 1AUXA 2HN9A 4TZTA 1GPJA 4MPDA 4QLOA 3KPJA 4GP6A 4YJ2F 3L4BA 4TLLB 3JCZA 3UJAA 4DLLA 4EYEA 3RADC 1E6CA 3QGMA 3N8HA 1EFTA 5DF1A 1VIAA 1ORWA 2HA3A 1N2CB 2CVHA 3EAQA 3JQ7B 4E5UA 2VHZA 1E0JA 4WXMA 1J2RA 3OP1A 4OB8A 1IUKA 1MOZA 2C4TA 3A0RB 3LBYA 4Y6SA 3WLJA 3VU8A 2AFIB 5FBWB 4NNPA 4JWTA 2DR2A 3NJ8A 2W83A 4NHEA 5K0LA 1KK3A 4EO4A 2HRCA 1VGRA 2H7CA 3G23A 4QU0A 4HF7A 2F8TA 5KTOA 1JAXA 3NHAA 4HWTA 2ECQA 3LXXA 4C04A 5HVNA 1QF7A 1Y1TA 2HHLA 4ON9A 4IG4A 4ZHQF 4PRKA 5T64A 4IH1A 4MQ5A 3VKGA 4L16A 2JK0A 4K2AA 3P1JA 4NOKA 4NMHA 4DQLA 1U2DC 3D7RA 3BE4A 4HEHA 4HLCA 2JIZA 1ZHOA 5HF6A 3ZXSA 3A6FA 3EPLA 2XNHA 4HKTA 1JTFA 1F8GA 3FWZA 2E89A 4HNQA 2QDKA 5JPDA 2N1MA 3AV0B 1CVLA 2AJTA 5DI3A 2EC5A 4YACA 3T34A 1H5QA 5EKSA 2BN4A 3RVDA 4URXR 1PS9A 5MN6A 4G5QA 3K96A 4JX9A 2RGEA 2WMYA 3BJEA 3H6HA 4IM7A 4UD2A 3T3HA 2HMSA 4G01B 4W7IA 4AZWA 4E5KA 1F1JA 3B6MA 2QXYA 4ZK2A 2AXPA 2WSBA 3MB5A 4TS1A 5KREA 5BSTA 1Y7PA 4JA0A 4U02A 1BDIA 4HH0A 2RIRA 1LJLA 1TVEA 4EBFA 2D5IA 1PQUA 2GZAA 2XYQA 4YK7A 5K03A 1G20E 4X20A 1EWTA 1B41A 2W2XA 1UIRA 2BUBA 3HCBA 3O4IA 4OHXA 1HFKA 5HR5A 1QONA 3E9CA 1Y81A 2FR1A 3DL0A 1A1SA 2XT9A 4FBLA 4O1MA 2JLXA 2A0UA 2YXPX 1RXWA 1VLJA 2ZJAA 5KWSA 4BMYA 1WZ2A 3QMVA 4YQFA 3MOSA 4Z1MD 1ZGGA 1VFPA 4OHYA 3RS3A 4MA4A 5JNSA 2ZJYA 1P5RA 2R44A 2XWSA 3A36A 3ESCA 3IRUA 5LB2A 3AJAA 4RHUA 4H4CA 3RK0A 4D74A 5BNFA 1B8OA 4IF6A 4IDHA 1GR1A 1UBCA 4OP2A 3THOA 3LXUX 2Y77A 2BT4A 1DAEA 3GXOA 3MPOA 3T5GA 3K5HA 3OCUA 4NY1A 3PT5A 3P2JA 3BBPA 3PNQA 2V9CA 5F78A 4TUYB 3JWPA 2PH1A 1Q2UA 1PLJA 2GETA 1GFIA 2PUBA 8ADHA 1PYDA 2A5DA 4LJYA 1G5IA 2EFJA 4CG1A 4JS0A 1RYMA 3MUFA 4IWYA 2V58A 2XSZA 4UAJA 3OMWA 4J1TA 4D26A 2BFWA 4Z3KA 2XA2A 2RHLA 4ZT4A 1ONBA 3BZWA 3ZK8A 1QB8A 1OU4A 2D1RA 2QEQA 2WM8A 3A2NA 4BDSA 2JJ1D 2DVMA 4WK6A 4ND4A 2FSFA 4NHOA 3QHAA 1OLOA 2O5EA 3LNTA 3EQZA 2QBYA 3OHMA 1U2EA 1NXVA 2Y0PA 1MHTA 1CUZA 2OBNA 5AK3A 2UXCB 2D5BA 1O0CA 1K5DA 3MVEA 1SKUA 3R7LA 3A3PA 3S27A 1JG4A 4G41A 2CD7A 4DMCA 1E66A 3SJUA 4IRXA 2Q6KA 1P73A 2GZ2A 4YCBA 2WD8A 4OL9A 1KYWA 4LN1A 4QLBA 3GPLA 1STOA 1UOQA 2B25A 1GDTA 1WEHA 2FZVA 4ZZ2A 2OCGA 3WLEA 3UZUA 1T0BA 2YC2C 3K6SB 4RLSA 2Q7OE 1IRXA 2YIMA 4U7TB 1T4MA 2Q1WA 1PCXA 4WE3A 2FDXA 1HQYE 1Z5ZA 1KBZA 3N53A 5LZ5A 4FFDA 1JX6A 5CX1B 2NV6A 2SHKA 3Q5DA 1QGAA 2YMPA 3HU2A 1KE2A 2AMVA 4TM8A 1Y34E 5J3JA 2PL1A 3DMHA 1PR0A 4PZZA 4BNDA 4XQEA 4MVWA 5DBOA 1Z63A 4DA7A 3REFA 2WU4A 3F6RA 4I8XA 4EM6A 1ZUHA 3CUVA 3MAAC 1MB0A 1FU8A 1ZN2A 2HNAA 3V32A 2B98A 3RS8A 4IFIA 4X00A 1CEQA 4P08A 4L3WA 4D9IA 4G97A 2QVLA 1JLSA 2GCPA 1LW6E 1PK7A 3AXTA 3OIFA 5FBRB 3VC7A 4AAYA 2Z3WA 4LWPA 5AIAA 1Z2PX 3NNDA 3N39C 1H85A 2H3HA 2VPZA 1J8YF 4OB6A 1V3UA 2QN8A 4EECA 3L6BA 5BSRA 2CNOA 2EW2A 3C4QA 4FINA 3RC2A 1WUJS 1UMDA 2O7SA 4G4JA 1FRNA 3F9RA 4GU5A 1Z16A 2CVPA 1Z7WA 2G1KA 4MW1A 4E5YA 1M54A 1RPNA 2HOQA 3LUBA 4A2WA 4BNFA 1PWEA 1X8KA 2YRXA 1OIVA 4WOCA 2QOEA 1RRGA 3ZS8A 4G4SP 1BZYA 1W36B 5JBIA 1ISIA 2CN1A 5DIZA 4AF7A 3AL0C 1CZNA 3ZIAA 1BMTA 2YN2A 2WK1A 2R2AA 2WWGA 4ISBA 1N2SA 1TU3A 1ONNA 1T29A 4RDHA 2IZ5A 2VDWB 1MO3A 4FZVA 3LPDA 4XWAA 5AVZA 1MB4A 5HIIA 1YULA 2GLUA 2O2SA 1DIAA 3BHMA 3SF8B 1ABFA 4DFDA 5IJ0A 2GF9A 3B2NA 3BFJA 1BVHA 3COYA 5AHXA 1WF6A 2Z3VA 3DO8A 2WUDA 4R3WA 1KDOA 3ESYA 2Y3IA 4N9WA 3STXA 3LCVB 1U3GA 4AMBA 3KYDB 4GX5A 4MPJA 2I4RA 5CDYA 4I1VA 1TJ3A 5EOVA 4YR7A 1EFKA 1CHNA 1PDWA 3DKIA 4L28A 4LZJA 5EP1A 1NT2A 3GUHA 4KMOA 4H7EA 3WZMA 5AW0A 4JOCA 1LZKA 4ZCSA 3WGUA 2DBRA 1O6BA 1EE1A 2Q2QA 3PRHA 3ONEA 3QMWA 1JL3A 3TNLA 1K63A 2GUWA 4TV8F 3BIFA 3KQQA 3W5AA 1FP2A 3ZBPA 4BP1A 4ZZ1A 2VCEA 3R3HA 3ASZA 3EZFA 1O9BA 5IT4A 2YV3A 1V95A 4LBVA 1P2BA 3K7EA 1Z2AA 4KQGA 4YJ3B 1YK0A 4WCVA 3ZHCA 5CURA 3L04A 4BATA 4LHYA 4RTOA 4TTPA 1OHHA 3ZHQA 2G5CA 3X1DA 1NN3A 5F7JA 1NW8A 3SLKA 4PHHA 4PHTA 2AG8A 1M8PA 1MO4A 4V0LA 3U61B 4Y8VA 3BL6A 3IP5A 4BNLA 1W9MA 1FX0A 4L9SA 2HF8A 5ER6A 1ZY2A 3AILA 4DLKA 4F3RA 3LO5A 4U2GA 5AJUA 3ZW7A 1XZLA 3ZZUA 1FEZA 3U4GA 1SU6A 4LHZA 4K40A 5ILGA 3NFYA 1A9QA 4RDCA 2X0EA 4DCVA 2JFYA 3D6MA 5CLGA 2FPIB 2A9KA 4FFVA 1D2HA 2JZOA 5IS2A 1KQGA 1ZJ6A 1LQ2A 3D6HA 3W79A 2CVQA 4U7PB 5L3VA 2C2HA 2OP1A 3JATB 4GLBA 5NLLA 3T0GA 2BMEA 3CY6A 3ORQA 1ECCA 4RVNA 4ARBA 3AF3A 3C3AA 5EKUA 3GJ4A 3L07A 3HXQA 3TUIC 1E2JA 5TMBA 3OQJA 4PNPA 2Q8QA 4LK3A 2F8MA 4MITA 1FUYB 3PA6A 1BHSA 5HP4A 1IY9A 2BMWA 3WZ2A 2Y6UA 1VZ2A 3GEHA 2QT1A 3DC2A 1E62A 4FYJA 3BMOA 3KYJB 4ZO9A 5F4BA 3BMXA 3IMFA 3GGGA 5D3MA 1MJGA 1U4OA 4ID3A 4PQYA 4RTRA 2OBLA 4PAOA 1D2CA 1VJ1A 3DD1A 1KEPA 1QHGA 1O5TA 3SIPA 1GG9A 1EINA 4ME6A 4RAOA 1JIUA 2QN2A 3AINA 4WFKA 4XX1A 3SMVA 5H9VA 5CA0A 1DBIA 4BLOA 3GEIA 1DWOA 4QBHA 4IFTA 1U5BB 2DPGA 1NBIA 3H11A 5T3UA 4KWHA 3NBQA