3BDVA

Crystal structure of a putative yden-like hydrolase (eca3091) from pectobacterium atrosepticum scri1043 at 1.66 a resolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
191
structure length
191
Chain Sequence
b'GMQTTEIDLRLTEVSQQLTMVLVPGLRDSDDEHWQSHWERRFPHWQRIRQREWYQADLDRWVLAIRRELSVCTQPVILIGHSFGALAACHVVQQGQEGIAGVMLVAPAEPMRFEIDDRIQASPLSVPTLTFASHNDPLMSFTRAQYWAQAWDSELVDVGEAGHINAEAGFGPWEYGLKRLAEFSEILIPNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of YdeN-like protein of unknown function (DUF1234) (YP_051181.1) from Erwinia carotovora subsp. atroseptica SCRI1043 at 1.66 A resolution
rcsb
molecule keywords Uncharacterized protein DUF1234
source organism Pectobacterium atrosepticum scri1043
molecule tags Hydrolase
total genus 67
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06821 Ser_hydrolase Serine hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3bdvA00
3C5VA 4B81A 4C4ZA 1CUDA 3BL8A 1L7AA 1K4YA 4W1QA 4FFWA 4DYHA 1XLVA 5JIBA 2XMRA 4B9EA 1HLGA 5E4JA 3EQ8A 1N8SA 3NWOA 2WJ6A 2RIPA 4Q34A 5EHZA 3PI6A 3ANSA 1QTRA 5AKXA 3IULA 3MGAA 2B20A 3IUJA 5HQ3B 1JFRA 2ZYRA 2Z8ZA 4W63A 4QE3A 2HFKA 4FTWA 3BIXA 3PFCA 1O6FA 4BDSA 3Q0TA 4J0GA 4BYMA 4H7HA 4KRYA 2IX9A 3PF8A 4UHHA 1CLEA 4UHBA 1CRLA 3RKSA 4FFVA 2QUBA 3DCNA 4Y2QA 3G9UA 3G02A 3AZQA 1VJ5A 4FNGA 4E14A 1LPNA 2PVSA 4DMKA 1ZD2P 2HA3A 2VEOA 2XUGA 2O2HA 4BVKA 5I9IA 1HDEA 1LPPA 4QLOA 5HZGA 1EDBA 3R3VA 4WY5A 4CIBA 3RK4A 1QLWA 2HIHA 4BCCA 1ZI8A 4MYDA 1TCCA 1AURA 4YK7A 1K5PA 3GBSA 3FYUC 5AH0A 2BGNA 2WHPB 5K3CA 1UOPA 1XQYA 5CH5A 2BGRA 4AX4A 2DHEA 4GDMA 4LHEA 4C01A 3ESAA 4H7KA 1AQLA 4BC0A 1XQXA 1EA5A 4YASA 5K3AA 1DQYA 1LPOA 5AK5A 5LZ7A 2FUKA 2VJAA 4WDQA 2C58A 4OD0A 1ISPA 4FLEA 2XDWA 4M0MA 1RWQA 2XMSA 4P92A 5A71A 2VTVA 3FNBA 3YASA 4FDMA 5AI5A 4MWTA 4CIAA 2PX6A 1YB6A 5DWDA 3BF7A 1UXOA 3I1IA 3JYHA 3E3AA 4A23A 2WIFA 5AKGA 4X00A 5ALZA 1X2BA 1THTA 2XUPA 5JZ9A 1MNAA 4U2FA 5JYCA 3WK9A 1DTEA 5JARA 1P0QA 2Y6UA 4PV7A 5CMLA 1WB4A 2PBLA 3W9BA 5CH3A 4CG2A 1ACLA 1QFMA 1ORWA 4K6HA 5CXXA 4C6HA 2DFPA 1ACJA 4OCZA 4N8DA 3ICVA 3HC7A 2WG2A 4PSCA 4BRSA 4XX1A 2WG0A 3OURA 4L0CA 1SCKA 4J0HA 2C4HA 2H7YA 1OXMA 2BFNA 2HM7A 1JT2A 1AZWA 4OU5A 1THGA 4C87A 3IVMA 4U2DA 1IUNA 4DSZA 4CFSA 5ALOA 2BCEA 1YA8A 3PFBA 1OILA 4UBJA 2O2IA 3ANTA 3HI4A 4DM7A 4OYLA 4U2BA 3FYTA 5JAHA 2QR5A 1QO7A 5JZSA 5HF8A 1BE0A 3STVA 2WILA 3WI7A 2XMZA 3QVMA 5HCUA 1LPAB 1YAJA 2CKMA 4UFOA 3VJKA 2CJPA 5K3FB 3B12A 5JZBA 1IUPA 4XVCA 4BZZA 1WHTA 4UBNA 2QUAA 4L9AA 2PUJA 4ZV7A 3WJ1A 5JANA 4G4JA 3C43A 3ZLTA 2WIDA 2HU5A 2BUBA 1USWA 3BE8A 2V97A 3WIOA 1XZFA 1W75A 1QIJA 2O7VA 4LYEA 4HRXA 5A6VA 2CB9A 4INZA 2HA7A 3WK7A 2UZ0A 3SK0A 1CUFA 2AJLI 2X8BA 2VJCA 1CR6A 1XKTA 1T4MA 3QPAA 4HZGA 4NVRA 5ALGA 1F8UA 3LLCA 1ZI6A 1MN6A 4Q3LA 3H17A 2PUHA 2B4KA 4Y2YA 1WPRA 4K6KA 1F6WA 4LXIA 2QJWA 1A8UA 5AM1A 1B6GA 5K3DA 4RPCA 4UPDA 2XQIA 4JYMA 3R0VA 3I2FA 3DS8A 4ZGBA 2JBWA 1XZKA 4QDXA 3AIOA 3VVLA 2WFZA 5JAPA 5DNVA 4E11A 4HVTA 5ALUA 1CUCA 3F97A 2OGTA 5JD5A 1KEZA 2LIPA 1E66A 1UK9A 5LZ9A 3GA7A 5A7FA 3G9ZA 2AJ8A 5CT6A 7YASA 3FAKA 5CBKA 2C7BA 5SYNA 3D3NA 2WLSA 4BVLA 2Z8XA 1R9NA 5FPPA 3KXPA 2XMBA 4EY4A 3C87A 1EVQA 1WCYA 1XRMA 4B0OA 4ETWA 5ESRA 3WMRA 3E4DA 4BP8A 1VE7A 1TCBA 2QS9A 3P2MA 4N5IX 4QDOA 2OCIA 3QZUA 5AK3A 4AZ0A 2VSQA 5CW2A 3GROA 2P8SA 1AMNA 4MEBA 4AZ3A 5ALXA 4AO6A 3ZWQA 2D5LA 3DOHA 4E46A 2OGZA 5EFZA 2QXTA 2HADA 2V98A 2XUKA 3A6ZA 1BN6A 1RP1A 4EY7A 1H2ZA 2HA0A 5LP1A 1Y7HA 4NS4A 2AJDA 2R8BA 1H22A 2XQGA 1S8OA 2I3ZA 4UBMA 4ZWNA 4Y2JA 3UUFA 5AIBA 1GPLA 2X76A 5FV4A 3ESCA 3R3XA 3T4UA 2ACKA 1VKHA 5H3HA 1IUOA 1CUGA 4H7DA 3GUUA 3IIIA 5AI8A 1UKAA 4B7ZA 3MUOA 1UWCA 5ALTA 4UBLA 5DTJA 1TCAA 1CUHA 1IMJA 3C5WP 4UHFA 5KBYA 2Z3ZA 3IB3A 1CEXA 5C8XA 4J0CA 2WQZA 3GFFA 1G66A 5HK9A 2QVBA 3R3ZA 1TAHA 1G5FA 4GEGA 4XIIA 4X90A 4C89A 1BEEA 2QJRA 5AP9A 3X3HA 5HF6A 1A7UA 4KYVA 3BIWA 3O4IA 4PO3X 1N5RA 1H2YA 5AJHA 4GW3A 2HU7A 2WTMA 1XQVA 5FKJA 5D6OA 3Q8WA 5CT9A 2PKYX 3STYA 5AM3A 1EHYA 5ALEA 2WSLA 4KE9A 4F60A 1ZI9A 1BCRA 4DMFA 4ZV9A 4JEIA 2DSNA 3M3DA 5E4YA 3EBLA 5CURA 4AQDA 2J4CA 4MYSA 2ZYIA 3IA2A 3N2ZB 3WKAA 4OU4A 3DJYA 1J06A 2XB6A 5JADA 1R4ZA 5E4TA 2IIVA 3ZPXA 1ZOIA 1K8QA 2RONA 1SCQA 1A88A 3KWJA 4MWSA 1QIIA 5C81A 4KACA 2OXEA 3L1JA 1ODSA 4TVKA 2RAUA 3U0VA 2WTNA 1J1IA 1GPNA 3G9TA 3EF3A 1JMYA 2PSDA 2R11A 4HXGA 4Y2VA 1QO9A 3R3UA 3GELA 3QBJA 1ODTC 2WU4A 4KAJA 5AKHA 1DT5A 4J0KA 2H7XA 3HJUA 3DNMA 2PSHA 2Y1KA 1FFEA 3HACA 3JW8A 2VJBA 3WK8A 1CFJA 5HFAA 3WK5A 4U2CA 4J0DA 4Y2PA 1VLQA 2FJ0A 2XI4A 4B6GA 1W52X 3G0CA 1BEZA 3I2HA 1JU3A 6YASA 2VQ6A 4BATA 3KD2A 4AB1A 3QMMA 3WL6A 1PJAA 4FMPA 2B61A 2AJCA 4BB0A 4EBBA 5ALYA 1U4NA 1GZ7A 1X70A 4BRZA 3IURA 5ALJA 1BCSA 5ALHA 3FCYA 4G8DA 2G5TA 2PPLA 5K3BA 4EHBA 4LXHA 3WWEA 5BWCA 1E8MA 1K6EA 3FWHA 1TQHA 1UOOA 2CUTA 1AUOA 3C6BA 1N5MA 1QIFA 1MX5A 3VJMA 3WWCA 1WHSA 4KE7A 4Q1VA 4LXGA 1DWPA 1R9MA 2Y6VA 1LZKA 4LIPD 3JWEA 4G8CA 1DWOA 4MJ3A 1XRRA 3A70A 4YX9A 1SFRA 4OYYA 3H18A 1BU8A 2I03A 3STUA 3C6XA 5IVDA 3UUEA 4WY8A 1ZGBA 5CT5A 3L1HA 4KJXA 3WA6A 2Q0XA 3PE6A 4Q3OA 4C4XA 3KOOA 1KU0A 4CI9A 2I78A 3W05A 3LCRA 1TRHA 3FCXA 4OSEA 4BCBA 5A7HA 4H18A 1ZD3A 2ONCA 2C5GA 1UKCA 3AILA 4KR0A 5IKXA 1EK2A 1G4HA 2GZRA 4U2GA 1WOMA 2XUIA 4EA6A 2I3DA 4FKBA 2HA5A 2PSFA 4NZZA 3WL5A 4G5XA 3H19A 1B41A 3WL8A 3WKCA 2OQIA 4GWLA 1QOZA 3QM1A 3DKRA 3VDXA 2HL6A 1AKNA 3WWDA 1CUZA 4GBGA 4JUIA 1UKBA 4UBKA 1ZICA 2GBIA 5T4BA 1YR2A 3KWFA 2QM0A 5EI5A 1ETHA 1WB5A 1AGYA 2XUDA 2JGKA 4K6GA 2FX5A 1QONA 3SX4A 4QWWA 4M0EA 1MJ5A 4Y7DA 5HF9A 3KSRA 2B9VA 5AKZA 3O4JA 1PV1A 5HFNA 1QGED 5KREA 1C4XA 4FOLA 5T4FA 2VJDA 2BAGA 1MPXA 1XLUA 1Y7IA 3OC0A 5EHNA 3FLEA 4MEAA 4EY8A 2RGUA 3I2KA 5AM2A 4KE8A 1CUXA 3PDCA 5DYTA 1H2WA 1ODCA 5ALDA 4H7JA 2GBGA 4AN1A 3OG9A 2J3DA 1JMKC 2ZYSA 4DNPA 3CXUA 3R3WA 3DL7A 2YYSA 3F98A 2OAGA 3FYUA 5CH8A 1UK7A 3D5EA 2QMQA 4J03A 1H2XA 1A8QA 4J0IA 5ALPA 3V1MA 5LZ4A 3V1NA 3WWOA 3FLAA 1EK1A 2EEPA 1JU4A 3WK4A 4L3WA 3IUMA 4W1RA 4K2AA 4WDRA 3G0GA 1XQWA 2GBFA 2XMDA 4IHAA 4W1PA 3G9XA 4OB6A 2DCMA 4QWMA 3WYDA 5FXMA 1DU4A 5AKYA 3KDAA 3BDIA 4BAZA 1WB6A 5JAOA 2G63A 5IVKA 4A5SA 3VXKA 3AFIA 2GBCA 3H04A 4AXBA 3H0CA 4B85A 1Q83A 1QE3A 4M0FA 1CUYA 1ZD4A 3ESBA 3HABA 1UFOA 3NUZA 5JAUA 4QDTA 5LKRA 5YASA 4FNMA 4Y2SA 3E0XA 5CT4A 4IQ4A 1MNQA 4IO0A 3WKEA 2D0DA 3PUIA 1R3DA 2PM8A 2YXPX 3C8DA 4F21A 5ALQA 2JGLA 4X3CA 4DNFA 2WJ4A 5AK4A 2Z3WA 1F0PA 2OCGA 1GQRA 3SC2A 3G0IA 3I1YA 4PSUA 5LKAA 1LBSA 1IVYA 5ALWA 4N5HX 5ALSA 2QRUA 3HYSA 2YASA 4FLFA 2GYVA 2HHAA 4AMYA 4OPMA 4CCWA 3H1AA 1E8DA 2H9YA 3CCBA 5A7GA 3D2CA 3WA7A 4GLBA 3W9UA 4FLMA 4WCVA 3C8HA 3AIMA 4RE5A 2RHWA 3H2KA 1UK8A 1TKRA 2YH2A 5D3ZA 4X91A 1DINA 1U65A 5EIHA 1D07A 2NW6A 4JH0A 5ALKA 4TPKA 1QIEA 2V9ZA 4QDUA 3WZMA 4H7IA 3ZV7A 1MAHA 2W22A 3OTQA 1X2EA 5AKKA 4Q82A 1CVLA 5LLSA 1I6WA 2HDWA 5BWBA 1XRPA 4NMWA 5IVIA 3DD5A 4EZIA 2C5FA 4MQMA 3O4HA 5AM4A 5AOAA 3A2LA 2JEYA 3HSSA 4Q05A 5IH7A 2QXUA 1O6GA 1XKLA 3O0DA 4BC1A 2WU3A 1W4LA 1VXRA 1XLWA 3ILSA 3R3YA 1ZJ4A 1GPKA 3D7RA 1VE6A 1SC9A 1QIHA 1ZGCA 4MXDA 1P0PA 2HFJA 3MUNA 4CCYA 3I2IA 5ALVA 1WPXA 2XQJA 1GXSA 1XZDA 1EB8A 3M82A 3H1BA 1N1MA 3D2BA 1XZCA 1Z68A 1BROA 1LZLA 1FFBA 2HRQA 2OCLA 2PL5A 3AZOA 4X85A 4EY5A 3ESDA 1XRQA 4QNNA 5FP0A 3DOIA 2QOEA 2H7CA 2EDCA 5BOVA 2ZJ7A 4CG1A 4RGYA 1W6RA 1MO2A 3LIPA 1E89A 4JYPA 2DQYA 4DNQA 1CUAA 2JIDA 4H0CA 3PICA 1L7RA 5AM0A 5AKJA 4IH9A 3BF8A 4OB8A 1EVEA 3V1LA 3O9MA 1ZIXA 1DQZA 1CPYA 1DWQA 4H77A 1LPMA 3FVRA 1P0IA 4ZXFA 2OQVA 3A2NA 2Z5GA 4PNZA 3D59A 2XMGA 4C4YA 3PF9A 4YPVA 2DHDA 4G9GA 4P9NA 3QMWA 4S0XA 3A2MA 4Y2XA 3LS2A 4QA9A 1HQDA 1R88A 1YS2X 1YB7A 4XJVA 2OG1A 2XQKA 4CG3A 1R50A 1FFCA 1VZ2A 2V96A 4G4IA 3DLTA 3DL4A 1QTIA 4QEKA 1MU0A 1F0NA 4U2EA 1YSCA 1XZBA 4DGQA 3DYIA 4X6YA 3QMVA 5CRIA 3C70A 2QZPA 3DYVA 4K5QA 1JKMA 5LZ5A 4E15A 5D3KA 2WUGA 3HRHA 3O4GA 5ISMA 5FOQA 3IUQA 5JALA 2JEZA 1CQWA 1MT3A 3C6YA 4JNCA 2ROQA 2ZJ6A 1UZAA 3CN9A 5EGNA 3I28A 1QFSA 1QIMA 3M81A 3FYUB 1CUJA 4QDZA 5I7UA 1XZAA 2WFMA 5CXUA 2OAEA 4IH4A 3HEAA 4FWBA 3BJRA 2QT9A 1FSSA 1M33A 3FBWA 4X6XA 3WJ2A 1EB9A 4B84A 3VKFA 1VZ3A 1AX9A 1IZ8A 3R41A 5E2IA 1XZGA 4Y9SA 4GECA 2VT6A 5HF5A 3EIOA 4I19A 2VF2A 3AZPA 1GGVA 5AICA 4BVJA 5FPQA 2G5PA 5AIAA 5DYYA 2VATA 1CUWA 4BAGA 3SWWA 2WUEA 1QJ4A 5A2GA 3ICWA 2CEKA 4ARAA 3G7NA 3EQ9A 1XZHA 4O08A 1MX1A 1OCEA 1H23A 1EX9A 4EY6A 2PU5A 4G1FA 4PW0A 3D2AA 4DIUA 3B5EA 1XFDA 5CT8A 1ORVA 5AI9A 1HKHA 1LBTA 3S8YA 3ED1A 4PSDA 1VA5A 3C6ZA 1GKLA 3WYNA 3CN7A 3OPMA 3G8YA 1TIBA 1EDDA 3NOXA 1Q0RA 1DX6A 3WL7A 1J07A 1Y37A 5D7BA 1BS9A 1XRLA 5BV7A 4D9JA 2OCKA 4DTCA 1IZ7A 2ACEA 4A16A 4UBIA 1GQSA 3QYJA 3VISA 3BXPA 3O95A 2PU7A 1U8EA 4TGLA 3VJLA 2DQZA 1NU6A 3C45A 2WFLA 5ALLA 2C0PA 1XZIA 4P93A 2Y2VA 3G0DA 5AOCA 5FLKA 4DNOA 4ZREA 1HBJA 3WKBA 4UFPA 2XUOA 4J7AA 4FBMA 2PSJA 2ZSHA 2ECFA 3F8SA 1C7IA 1CUIA 2WJ3A 1EDEA 4LYDA 5DJ5A 3D4LA 3ZLUA 2WHQA 2G4LA 4I3FA 5ALNA 2K2QB 3MVEA 1BRTA 2WIGA 1C7JA 1UK6A 1R1DA 3VVMA 4FHZA 3BDVA 1XZEA 2QTBA 3RM3A 1QIKA 2WIJA 5HK8A 1SOMA 5DTIA 1K63A 3DEAA 3FLBA 4X7BA 5JATA 4IH1A 1UOQA 4B9AA 4BZWA 2O2GA 4GHWA 4B82A 2XUQA 1U2EA 3I2GA 1MX9A 4Z49A 4PQEA 2RI6A 3K6KA 4CCYB 1FJ2A 2XE4A 4AO8A 2HA4A 1A8SA 1EI9A 3TEJA 3I6ZA 3WLAA 4GXNA 5EHQA 4AMZA 3B3QA 5EHXA 5HKBA 1XZLA 4F0JA 3PUHA 1CV2A 5AO9A 2XT0A 3BWXA 2O7RA 4X93A 5FUMA 3QPDA 4C88A 4X71A 5SYMA 1YCDA 2ZJFA 4X94A 4X97A 4KRXA 3FVTA 1XRNA 4ROTA 2BJHA 4DMCA 3K2IA 4P08A 3N0TA 5IVHA 4BP9A 1JJIA 4BTVA 1YASA 3D0KA 3ZLVA 5AKEA 4N8EA 5A62A 4H7FA 1CUEA 5ALRA 3STXA 4ITVA 1HL7A 1ZJ5A 2RHTA 4F5ZA 1ZIYA 5FRDA 3TGLA 4HRYA 1JI3A 5HQ3A 2OGSA 1L7QA 2FJPA 3QITA 3H2JA 3TJMA 5ALMA 3HZOA 3S2ZA 2ZSIA 1XROA 5EIEA 3FSGA 1YAHA 3TRDA 1E5TA 4X92A 5HKAA 3F9CA 5AI4A 3EQ7A 4DMHA 2GYUA 2JGIA 2H1IA 4UFNA 1LPBB 1CQZA 4W9RA 1UT6A 2DR0A 5F4ZA 5AM5A 5LZ8A 3RARA 3E1GA 2JGFA 3WK6A 2WUFA 1DT3A 4KAFA 5FDFA 1LPSA 3W04A 4WFKA 1FFDA 1AC5A 1E3QA 4KE6A 2W6CX 3F96A 4UHEA 4OB7A 3AINA 1CUBA 2ES4A 2VA9A 5JD4A 3HXKA 2XMQA 4UBOA 4BE9A 2WHPA 4WJLA 4J0JA 3GZJA 1BN7A 3IBTA 4X6UA 4G4GA 3STWA 3CCCA 4I4CA 4Q3KA 1DX4A 2HA2A 2WIKA 1Q84A 1JJBA 1PFQA 4XWGA 3LIIA 5ALIA 5C8VA 5AKLA 5AHXA 3AUKA 1E8NA 2VAXA 1QZ3A 5LYYA 5DNUA 4Y2UA 3H2HA 2CMFA 3W06A 4Y2RA 2ORYA 5J3JA 1ZD5A 4BDTA 5JASA 3BJMA 1FFAA 3V1KA 2JGJA 1GKKA 1GT6A 3IUNA 2OPHA 4B80A 2VAVA 3R40A 2Y2UA 2XUFA 5AOBA 1XZJA 4GI1A 3U1TA 1W1IA 2VT7A 4BBZA 3DDUA 4RNCA 4UUQA 3WIBA 3DKKA 3UMJA 2E3JA 4G9EA 1G42A 3FOBA 5KWIA 1NU8A 4EB0A 1EH5A 3AIKA 2XLBA 3STTA 4ZI5A 5CTAA 1CUVA 1J2EA 5LIPA 1Q0ZA 4ZRDA 5DNWA 2XUJA 3L1IA 1EXWA 3LP5A 1KU6A 2AXEA 3DQZA 3FSGD 4KEAA 3I6YA 5K5EA 1SCIA 2IITA 1CUUA 4DSAA 4FBLA 2PSEA 4KAAA 1YA4A 4BTLA 5EIAA 3O9VA 4UHCA 4QZVA 5JD6A 1W76A 4H35A 3HLKA 1P0MA 2JGEA 3F67A 4HS9A 1RYYA 2ZVDA 4BE4A 2BKLA 1CUSA 4HAIA 3G0BA 4LKOA 4HTAA 3ZI7A 4L72A 2ZYHA 1WM1A 2QKYA 3AJAA 2WFLB 5AI0A 3OM8A 2XUAA 5KWJA 4HXFB 4RE6A 1LGYA 1VA4A 4EUSA 3M83A 3RLIA 5K3FA 1XZMA 1QIDA 3IDAA 3WWPA 5C8ZA 5C7YA 5AI6A 3I2JA 1QIGA 1VXOA 1LLFA 2JF0A 4W1SA 3OOSA 3WKDA 2BUCA 4UHDA 2CBGA 2OLEA 2HA6A 4PF1A 3K9BA 2CZQA 3QH4A 1LNSA 2C0QA 5AKIA 1MTZA 4V2IA 2XMCA 1NX9A 2BUAA 4B83A 1EINA 2WG1A 1VOTA 5DLPA 1T2NA 4QLAA 2X5XA 3H2GA 3I6MA 1MAAA 3WZLA 2XUHA 3H2IA 4ARBA 4N8SA 4Y2TA 1YS1X 2XQFA 5AK6A 2GYWA 2AJBA 2DHCA 4G8BA 5T4EA 3NGMA 2WHRA 2JGMA 4AO7A 4WFJA 4OUKX 2EDAA 4H7EA 2GZSA 3W2TA 1HPLA 4BAUA 5K3EA 5I8PA 5T4HA 4J3JA 5DYWA 4HXEB 2WUDA 3V48A 2WKWA 3V9AA 4X95A 3QPCA 2HRRA 2J3QA 5ALFA 2J4FA 1JJFA 1CIJA 5LZ2A 3WQHA 4WFIA 4BCDA 2WM2A 2HU8A 2XLCA 4MQLA 4DLNA 3T52A 4B0PA 1TK3A 4AN0A
chains in the Genus database with same CATH superfamily
4UU1A 2IUSA 3KBOA 1JDTA 1KI2A 1YQ9A 3KOWA 1NI4B 2R3SA 2HT6A 3A6FA 5KPJA 1NLMA 5TS3A 2X3FA 1KMHB 2FUNB 2REOA 4JA0A 1W36B 2B7CA 1J7KA 1PW7A 2GRUA 2VK8A 3OBBA 1YZHA 5F33A 2XBUA 2PLWA 1W46A 1GGFA 2NZ2A 2UVDA 5EIBD 3RH0A 3KCQA 1SU4A 2AQKA 3OX2A 4H9GA 4UAVA 1SRRA 5ELLA 2QLJA 5AWFC 1JGTA 2VHTA 3OD1A 4V03A 1NUTA 4CV0A 4UM9D 3IHKA 5AVRA 5IDQA 3PC8A 2JFBA 1ZUNB 2BFCA 4Q01A 4TV8F 1KR2A 1XTRA 1Z2AA 2A3RA 2Q3HA 1J2YA 2FMKA 2QD2A 4JROA 5AKXA 5JROA 1WXWA 1J97A 3ET5A 2KJQA 2WU1A 2DUNA 5AQ1A 1T6NA 2B8EA 3RAFC 5DM4A 2B20A 3GT4A 4M60A 2VQSA 3FUVA 2AE1A 2QUJA 4YGXB 2QYSA 3KYDA 5HQ3B 1B6RA 1P60A 2ZYRA 4JLOA 4UKDA 2ZE5A 1NAIA 4RVNA 3I2YX 4P33A 4WXRA 1F60A 4QE3A 2IHNA 1DFGA 3FJOA 1FYVA 1R74A 4FTWA 4S1TA 3T7RA 1CY7A 1QFJA 1U6JA 2CD9A 3NZEA 2E0IA 5JISA 5ITZA 2VZEA 2G1UA 3BIXA 4RDXA 5JSKA 3RJ9A 2VUUA 1JVBA 3RRFA 1X74A 1Q50A 3ZJ4A 4AKHA 1LS1A 2Q5HA 1CFZA 1OLXA 5SYAA 3EPJA 2P5YA 4A15A 4UHHA 4NJEA 3PEFA 1D2RA 3AERB 1Q19A 3OO0A 2DPLA 4X7MA 3UM9A 3CB2A 1G6Q1 1CB7A 3A6KA 3FTQA 1LJ8A 3EYWA 4GPZA 5SICE 4EJ2A 4OH7A 3EVZA 1OXTA 1ND6A 3G02A 3G9UA 2X0IA 3DW3X 5JFOA 1R9GA 5IHXA 4DL9A 4DV0B 1PFGA 4HQFA 4M22A 5IASA 2OECA 2FEWB 3MD9A 5BSVA 4ENQA 4DV7B 4IUBS 3ZY5A 2OZLA 2FHSA 3TI9A 2XCSB 3E5RA 1NRWA 1YB1A 3QYAA 5DHTA 4GXQA 4XFJA 3TYXA 4BTEA 4BVKA 4EB6A 3KV3O 1LPPA 1I2BA 4YUAA 2NZXA 1Y98A 2WABA 2HI0A 1SVUA 3ENZA 3EZFA 2IY8A 3CH5A 3M6MD 3PGA1 5DMHA 3WMGA 4IIEA 2ZTVA 3URMA 1EDBA 4MCJA 4ZJZA 3C15C 3LUCA 3R3VA 4XPIA 1BDIA 2YYZA 4RM2A 1D1TA 4TWZA 4A92A 2NSJA 1DHRA 3RG2A 4KAXA 4XVQA 3OEHD 1D2AA 1OX4B 3L4SO 1KGDA 4B71A 5DBEX 4DIOA 2WZDA 3LHDA 5G3ZA 2CKDA 3HJTA 1I2AA 4BJ5A 4TTSA 2HDHA 1W0KD 3GBSA 5KOYA 3FYUC 4NEQA 4Q1EA 3O26A 2HRCA 1EFLA 1NLUA 2WHPB 1T9HA 3CA8A 4IQFA 1UOPA 4MMZB 4AX4A 2IFTA 1U0FA 1H0RA 4K2HA 4KQMA 4C01A 4OLBA 4IWNA 3L1KA 1C1DB 4UTZA 3ERCA 4BC0A 1BD4A 1D0SA 4MKZA 4XGKA 4C9BA 4PWZA 1MB9A 2WICA 3AUFA 4YASA 3FFBA 3KUDA 4EECA 3D7NA 4INOA 3EULA 2WU8A 1R5JA 3PFHA 4MPTA 4F86A 3FNGA 1QG4A 4W7IA 1LPOA 1PEDA 4XM1A 5AK5A 4YN3A 4QBFA 1CRWG 1DV1A 4EI2A 1GCOA 4WEQA 5IAEA 1U0NA 4B8ZA 1NP3A 4KXUA 1DBPA 2FW9A 2FUKA 4WDQA 1WW2A 2DC1A 3HZHA 3LT2A 4U6NA 2FF7A 4TSFD 4G0WA 4CMKA 1U7WA 1C8VB 1E3WA 5D85A 4CCAA 4M21A 5COBA 3E9DA 2XMSA 3DYBA 3K32A 4P92A 5A71A 2ZEJA 2NTVA 2QN2A 1SVLA 3DWFA 4FU0A 1QG0A 1HEUA 1Y5RA 3KJHA 4CIAA 1CP3A 3UT0A 1BHQ1 2OE2A 4D97A 3C1AA 1PT5A 4CM9A 2G6TA 3AESA 1IIRA 3R2JA 2ADOA 3IQHX 5DX0A 2F3TA 2X9GA 2NU8A 2XZDA 1E6UA 1F3LA 2NMVA 3IQEA 5KNDH 3DBLA 1PL0A 2KPOA 3IP9A 1ODLA 1YRLA 5ANRB 3N9IA 2WIFA 3NWJA 4B34A 1O96A 4DCOA 4WZ6A 1IWOA 3NEJA 1T9CA 2QROA 4M76B 4M86A 5IAGA 3OT1B 1X2BA 3OLWA 1TYBE 1PT6A 5CVTA 1THTA 5BSEA 3H8WA 5EWMA 1V25A 4OATA 1PF7E 1M2FA 2PD6A 4P4SB 2PS1A 4RVOA 7REQB 1RWMA 2QTRA 2H16A 1FRFS 2JAOA 2Y6UA 1LX7A 4PV7A 3IMCA 1N8NA 1GG8A 1WB4A 4AICA 1N7HA 3KJEA 2H85A 1VJRA 2PBLA 4RWZA 2CE7A 4US2R 1LC0A 4D9BA 3GYGA 5ESXA 1F0KA 2PIDA 4F1KA 5EJ2A 3FPLA 2VYQA 2XTMA 4XSHA 2C3OA 4V1CB 4K6HA 5CXXA 4NENB 1ACJA 2X9VA 3RQSA 3E7PA 1E2EA 3SJ7A 1DNPA 3ICVA 4J1TA 4N8DA 4PZ9A 3M9LA 3OH8A 2APJA 4ND1A 4EYEA 4BYGA 3Q87B 3W5IA 2F1IA 2CDCA 2ZI7A 2WG0A 2PBZA 3H7IA 4L0CA 2V7XA 5KYWA 4F9FA 5FPSA 1N3IA 2PUCA 4OHBA 2H11A 1GZ5A 3H99A 4YV2A 1HKUA 4J0HA 2C4HA 3VZDA 5BV8A 3NYWA 1KH3A 3PUYA 3S2EA 1OXMA 5FL7A 1Z5UA 5BUQA 2JHFA 4YDSA 3WLJA 1JLHA 5TS2A 1E2FA 3RFFA 3TLBA 1XXHE 3UTDA 3ABRB 3LNCA 2FSGA 3A27A 1LRLA 3IVMA 4FE4A 3M70A 1WV1A 4MVJI 4U8HA 1IUNA 5EE1A 5LD2C 4PR0A 2GCPA 1WTAA 5GV8A 3QF7A 5B4UA 4EATA 1TQ4A 3CX7A 1OILA 2NTYC 1LDYA 3FOWA 3HWSA 4XD2A 2DY1A 1NXPA 1EWQA 2Y9PB 4HLUA 2VZLA 2RGGA 4PHTA 3ANTA 1WBBA 5C4IA 1IK6A 2Q5CA 3DAYA 1KI6A 2B3DA 3NIDB 4YR9A 4KVFA 3RRNA 2ZRQA 1OU0A 2PX8A 3QVGA 4KR9A 3I64A 3KQVA 1TFRA 2GYYA 4TTQA 3FYTA 1FTSA 1TAGA 2QR5A 2X22A 1B7GO 2AW5A 1GPDG 5BWNA 4OQXA 4DOMA 2VZ9A 1TQ2A 3JQQA 3PB3A 3LUJA 2OZEA 2WILA 4G0PA 3WI7A 2XMZA 1N78A 3W5HA 1ZOOA 1V9LA 2ACWA 2W71A 3W5BA 4AP6A 3FTNA 3LQFA 5KX5F 4S1PA 1JR2A 1OLUB 2OCDA 2V7PA 3PT9A 3UK2A 1W5BA 3DKVA 3AEUB 4O6VA 3FMPB 1PNTA 1XK7A 5B3KA 3IGFA 1XVIA 1E9RA 1NFQA 1N2CB 4DCNA 5G02A 3HNPA 3THWB 3ZI4A 3B12A 4V2UA 4EX6A 1EE1A 4FYKA 2W6IA 4RK0A 3BXGA 5I9BA 1IULA 2AV6A 4ISCA 1WHTA 3FFWA 4O2AA 4UBNA 3E22B 3O8RA 1QVRA 3OSZA 4WV3A 4TL6A 2ZVPX 4WTOA 1CHDA 4ZV7A 4TYYA 1HTTA 2D62A 3IQDB 2GASA 4HGNA 3F71A 3ZWBA 5K8VA 1UINA 2FYTA 3TXAA 2GDJA 2HBQA 2PJZA 5GMOA 2LTAA 5ABPA 1DDOA 2JVJA 4J07A 1S6YA 1FZQA 4QO7A 3IBYA 4A1OA 2Q27A 4D0RA 3Q1LA 3NJRA 4MWGA 4UNQA 2C9DA 4CM9D 5DTMA 2WVHA 5EPUA 1MABB 2VUSA 2V97A 4L22A 5IMBA 3DZBA 3RK1A 4Q6WA 4MI1A 1RACA 4LXTA 1DWUA 5GM2A 1X7GA 4E5YA 3CUEF 2J6HA 1W75A 3G49A 3JSAA 1A2BA 3CNBA 4KFUA 1DKNA 1P72A 1IRXA 1MRZA 1GDTA 3L9XA 2WNIA 4DV1B 4X8MA 1O7JA 2HZ7A 1OWMA 3VYRB 4DUPA 4HFJA 3U62A 721PA 3TCXB 1TZBA 1N1EA 2IV3A 1SVSA 4RCYA 2OFWA 1ISMA 3SMVA 1E0SA 3T12A 3SD7A 3TXYA 3B6ZA 1E4VA 1VIYA 2PZFA 1Z35A 2OSVA 1KBQA 2QEQA 2UZ0A 3HKCA 3CLTC 2ZFUA 3K0FB 3KB8A 3SK0A 2W8ZA 1UBKS 4QJ5A 2XZLA 2H2IA 1FYWA 3L8ZA 3O8QB 1DI0A 3C5HA 2DJIA 1QV6A 1TVCA 3DDSA 2AHOA 3SQLA 3TZQA 4XWYA 1T4MA 3UA3A 3CZ5A 3QPAA 5JAQA 2CMKA 3JD0A 3RCBA 2ADMA 1VCHA 1CJKC 4H17A 5ALGA 2H00A 4C08A 3Q41A 3SKVA 1RI2A 4LNUA 4BJ1A 1Q0HA 2E9SA 2YZGA 3PUZA 4JQCA 3T7TA 3GUYA 4F11A 2PUHA 1MW8X 4H4CA 2HEIA 4A82A 2FPPA 2H5LA 4DRYA 4Y2YA 2X6QA 1DS6A 3P4XA 3VH1A 3R6GA 3PUXA 2VXBA 2IHVA 2BEVB 8LDHA 3WLSA 2J6IA 2WYVA 2QJWA 4LXIA 1A8UA 1IB6A 3CNEA 3KR2A 1DJOA 1Z75A 1WETA 4CM6A 5K3DA 3U17A 3S81A 1SXQA 4G0VA 1FK8A 1KEKA 1BMTA 4KOAA 4BNZA 1OFUA 4M0DA 1PGQA 5FL7D 5JSFA 5I4KA 3NM5A 4FFPA 4OLHA 1TEHA 3DS8A 4ZGBA 2ZZMA 1YR1A 1XZKA 2R1VA 3AIOA 3EG9B 4NOKA 4ZOBA 1A69A 3KXLA 3RRJA 3U9TA 3VVLA 2XWSA 4FDUA 4LGCA 3LM8A 2PBRA 4HAUA 4PHFA 4DCPA 4KYUA 1G98A 1G4AE 2IEZA 3NNNA 4KGXA 2I2FA 3VR0A 5CLQA 2GEDA 4UTVA 1UKEA 4IJMA 5ALUA 4O4LB 1IL0A 1W85B 1YOBA 2CXQA 1WD5A 4DABA 1UK9A 4PG8A 1XXLA 1NN1A 5LZ9A 3MWGA 1T9ZA 3IO5A 3GNSA 4OKNA 2XSZA 1O77A 3FAKA 1QS0A 5CBKA 2HXGA 5AJWA 1UMBB 3IKLA 2PEZA 2Q7DA 3RQIA 1SUPA 1HYBA 5IN5A 4A8JB 2WLSA 3LGSA 5BN5A 2FETA 2OVFA 1WDMA 4B6SA 5MGBA 3EX7C 1L5RA 3OZRA 5HQJA 2RCNA 2FPSA 2Z8XA 1C7EA 2DGDA 5EJ4A 4CM3A 4DWWA 3LWBA 4B44A 1YO6A 2X0FA 2V7TA 3ZWMA 1NWHA 2JLZA 2NNLD 2RD2A 3DOFA 3ICEA 3OQHA 3KXPA 1PHPA 5JG7A 1R2QA 1NZFA 2RHLA 4N3GA 4AG6A 5KWEA 3TRHA 1YZ3A 4EW2A 2DSTA 2EERA 3F6BX 1H1TA 1KZYC 1UKZA 4BX0A 3ZJTA 2BCGY 2ISQA 3MT9A 2BHNA 4IJKA 3EOAI 3LGAA 3QKSA 1V2HE 3C3WA 5HP4A 1XRMA 1DJPA 2NT3A 4L02A 2BY4A 4RXMA 4BO2A 3I42A 4BRUA 3VU1A 1UDXA 1QH1A 4H4EA 1JH9A 1DE0A 3H8VA 1KXZA 5JW6A 1PUXA 2X8JB 2DPMA 1EUYA 4H1HA 5JWHA 3E7DA 1TCBA 2YV5A 5GONA 3JD2A 2O52A 1XLTC 4CKYA 1SVNA 2BTQB 3L07A 1CE8B 1Y5MA 2C20A 4M87A 2J9FB 3VZPA 4DREA 1NJGA 2PEYA 3K0CC 4OAPA 2V6JA 1AXEA 1YRWA 2VSQA 5CW2A 2FZ4A 4YI5A 1QCCA 4MITA 3L4KA 1LX6A 3EEYA 2XCRB 2C57A 2HGSA 2IYYA 2P8SA 3AR7A 4D8UA 4WWHA 4B45A 3G5AA 2XVAA 1TEXA 1AMNA 5LXTA 3E9CA 4E1VA 5JZMA 3DO6A 3FOAA 4MEBA 3ND5A 4AZ3A 1G8PA 9ATCA 2FGJA 4PN3A 4URZR 4QGSA 2BFBA 4AO6A 1IJBA 2D1SA 2D5LA 3DOHA 3KZCA 4X41A 4CLHA 1JWAB 3UUWA 4LFBB 4Q24A 4WQMA 5EFZA 5JSZB 2QXTA 3FN4A 3QA9A 5FBHA 1YI8A 1BN6A 1Z8NA 3HDYA 4FHCA 4EY7A 5ELMA 4ZCRA 1H2ZA 5J2UB 4Z4QA 1U0SY 1TRKA 2GPBA 3G0OA 4V0LA 2CVPA 4MQ5A 2NO4A 4F5EA 1QXSA 1ZUIA 5JYBA 2DUUA 5BWLA 1DG3A 2GUGA 4A36A 5BSTA 4IIJA 1PG5A 5F7XA 1QGUA 2C3YA 2XQGA 1DCMA 5DTQA 2JIPA 1S8OA 2P7IA 1SIBE 4MB2A 2R5WA 4PS0A 4UXJA 3TIFA 4FYHA 4G37A 2F2TA 3QUSA 1FL9A 2Q1YA 1FTNA 3INGA 4MWDA 4NNOA 5BVHA 5C53B 3CWQA 1HXHA 1J5EB 5FV4A 2OB2A 3ESCA 1ZUHA 4KGZA 4JFRA 3WHIA 3OECA 3CRQA 4N9WA 2ACKA 3JARA 3THOA 4BQNA 3DUFA 1FB5A 1FVOA 1NIJA 1AQNA 4KLNA 2DBZA 4WZBB 2GVDC 3HA5A 4L95C 4X66B 2NPFA 3WHLA 621PA 3M5CA 3IIIA 5AI8A 1UKAA 4EPRA 3WLPA 1Z5WA 2PVCA 4B7ZA 1U5BB 2WDPA 4R2MA 2I2BA 4MX8A 2JPDA 3SZUA 4DLSA 1RXUA 4MO9A 4PYRA 1Z06A 2J8ZA 5F2EA 3HEBA 1TCAA 1TVMA 4YJ3B 3RRBA 4R8SA 4L8GA 5D87A 3HBMA 4OHPA 5G1OA 1CDEA 5KBYA 3JAWA 5DSXA 1KIMA 2QUHA 2WMNB 1UMCB 4KXLA 5EVJA 2FQXA 1B1CA 2O0KA 1U1EA 4OHCA 3M6AA 1XZQA 4N5DA 5EMJA 5HK9A 2YMLA 3R3ZA 4AAYA 2PRYA 3KHUA 4IXMA 3MZ0A 4EKGA 3AVQA 4XIIA 2XSZD 2JAPA 3E23A 4X90A 4OG2A 5L95A 3ZE1B 3UK1A 4F92B 3DT8A 4IQ0A 4HNTA 5KQSA 1ZH8A 4A27A 4W5RA 2QJRA 2YCBA 4IUDS 3X3HA 1SIWA 1A7UA 4KYVA 1SNYA 1S2NA 3BIWA 3LWDA 4A73A 4KODA 4YMHA 2F67A 1N5RA 1H2YA 5FCDA 1JPJA 3ZHQA 3PQDA 1YRAA 4DQ0A 4V0RA 1XSEA 1ENYA 4ZAGA 1RRKA 2HWWA 3Q8WA 5D6OA 3EGVA 1DL5A 2RG1A 4DMGA 3D8SA 1VPEA 2P2GA 2ENWA 2YHSA 3UIEA 3FLMA 1HDXA 1GQOA 1N6OA 2AI3A 2HSEA 1HC7A 4CV2A 3LLUA 3WL4A 4F9TA 4KPYA 1I0ZA 3EQ6A 3FPKA 1BCRA 4DMFA 5C35A 5JSHA 2H52A 3AEQB 5K01A 3RASA 4HT3B 5EMNA 2YMPA 1HQCA 3BWYA 3LY9A 2WJAA 5E4YA 1JAIA 5HJ7A 4DLXA 2WJJA 1T2AA 4HAZA 2HMTA 3N2LA 4KQFA 4M8IA 2EWVA 4C03A 1RAHA 1CIPA 2ZRPA 4NEHB 3AVOA 3EASA 2F8TA 3OZVA 1Q1NA 4GR4A 1RPZA 2Q46A 5DBGA 2BFEB 2I6XA 2HLNA 2NSLA 5C3UA 1AA6A 3QUTA 3WKAA 3DJYA 4RV5A 4ZMRA 4E5DA 2RKOA 4K6CA 3CINA 3ZZMA 4KP7A 3SU8A 2O0HA 1G20B 1HT3A 1NVTA 4YP5A 4US0R 1HZJA 5IBQA 1K8QA 2YWHA 1N7JA 2IYFA 1K68A 4PBSA 1NUQA 2MJLA 4PLPA 4TXJA 4D41A 3R9WA 2B2XA 2GXSA 2R8RA 1NKSA 1XFAA 4MWSA 5HGJA 5JTUA 3IAFA 4JAVC 5EAIA 4JD5A 3RS0A 2RK6A 2OXEA 1M8PA 4CQMD 4M6WA 4TN1A 4Y6GB 1DIRA 2RAUA 4YP9A 3U0VA 5KTOA 1MGOA 1JQ5A 2WMYA 1BX3A 1GPNA 2OAQ1 2VWHA 2C31A 2YV2A 3E70C 3EXFB 4FGUA 4UUBA 2HQRA 1JMYA 1XC7A 1XG5A 4COOA 4NXNB 4F5DA 3I9OA 1Y48E 1J0EA 4I5GA 3A1TA 1TGYA 2O48X 3K92A 3G2PA 1JLMA 2O0MA 2EYQA 1L5SA 1NGSA 2OHJA 3N2GB 3PFKA 3QX8A 4BBJA 3AR5A 3CX8A 4C4PA 4Z1OA 1GSOA 2ZROA 3R3UA 2WF5A 1AZLA 1TUBB 1UT5A 3P2OA 3D4BA 3GP8A 3M4YA 1G5TA 2XKBA 2XYHA 4KAJA 4K6MA 3LT4A 4EHNA 4BE9A 4J0KA 2FXIA 1PWXA 1XPOA 3ZDDA 2IHTA 1UXGA 1FMLA 4OA5A 4HADA 1NNI1 1XPRA 3DNMA 4O4IB 5KYYB 3K8YA 2ZI4A 1FFEA 4XLLA 4RVGA 4MA5A 4MVJE 3EFBA 2XGJA 1CFJA 2REBA 3KS9A 4MW9A 3A6JA 3NT4A 3E03A 1FXUA 4U2CA 2Q8PA 5AJZA 4J0DA 4MUAA 4Y2PA 1BXKA 3EUAA 2FJ0A 3G0CA 4GD3Q 4BFLA 2F1OA 2FZGA 3RSGA 4D5GA 2BRUA 2XT6A 3CF4G 3KD2A 3NTQA 3L6RA 3HKEB 4OHWA 1J20A 3WL6A 3ZX5A 3DPIA 2PUFA 3VKGA 1I4OA 5HVNA 4FMPA 2VO1A 1NVXQ 2BHTA 4GKAA 1RC0A 3ETLA 1U2RA 5EMMA 3CH4B 2ZUWA 1C30A 5ALYA 3CB4A 1EGQA 1CY8A 1YNSA 4F91B 2WVGA 1ESZA 1LV7A 3BAFA 4WLEA 4ETNA 1GZ7A 1X70A 1E69A 2RHJA 4A1FA 3IURA 2V4MA 1T8PA 3NBZC 4N6OA 1E2LA 5EUQB 3FCYA 5B1YA 1Q12A 3HCRA 4O8CA 3AJDA 3R7WB 1VKZA 3GLKA 1KEEB 4EHBA 3PNMA 1W9HA 1VE3A 1G8SA 2QG6A 3B6JA 5CB8A 5JXHA 4B6OA 5BWCA 3O8DA 1JRLA 2IDJA 4QBHA 3H4MA 4ALIA 3GJXC 3T0GA 2RAPA 3FROA 4XEHA 1AVTA 3WV4A 3EEQA 2CUTA 5THQA 1PZMA 1TTTA 2EBHX 3C3YA 3VPXA 3EPHA 1JX6A 2JFQA 3DWEX 4I4TB 3JQPA 1N5MA 2GD0A 5MFPA 1QIFA 1YHYA 4WK6A 4E5SA 2QSZA 2OXRA 1P62B 3GQVA 1Z63A 4RD1A 3MRTA 1DWPA 2QQGA 2QTMA 4LXGA 1RBQA 4ZQIA 3ZLBA 2M32A 5E3JA 4K28A 4QQRA 1SUDA 4H1UA 3RFUA 1FSZA 4RBNA 4D8VA 4OHYA 1AJEA 1GN8A 4YX9A 1XRRA 4NV0A 1RWWA 1SFRA 3DHYA 5LP6A 2HNBA 3B1XA 3ME5A 2JCSA 3LFUA 5TT0A 5KTYA 3AGQA 2QGZA 2BBTA 1RE1A 1A9QA 1BU8A 3H18A 2XD4A 3JWIA 4WZAA 1UBLS 2L82A 2QX9A 3RUEA 3C6XA 2NVWA 3A4MA 2J5BA 3A6HA 4M7RA 5IVDA 4CBVA 5J4VA 3ADKA 4WY8A 4I6GA 1WEHA 5ICFA 1F3OA 4RC9A 3WA6A 5T3YA 2CGEA 3PE6A 4MRRA 5CA0B 5M2QA 1SU7A 4QDJA 2JCYA 3LFTA 2AZTA 5AW4A 4HTFB 3NTUA 1KU0A 4URHA 4ZCTA 1Y3DE 1Y8QB 4CI9A 4YCSA 1PZNA 4HDAA 4P4TA 1JAHA 4MS1A 5DBOA 3W05A 4AP9A 1M7GA 1PQYA 4R31A 5F2NA 1T3TA 2EBFX 3MINB 1T6BY 3D43A 2WQ7A 1W35A 1T5LA 4F3NA 4ZYVA 2IBMA 2J0UA 4BMDA 3ZZTA 2NUPA 3OIVA 5ICGA 3Q7TA 4M9RA 3V1TC 1AV6A 3M6FA 2C5GA 1BXGA 2VHEA 3AILA 3FGNA 3T61A 4ZU1X 3RYHA 4C4SA 2B34A 1WMSA 3ITKA 3WOVA 5LNK1 4DHEA 3NNSA 1ZSNA 3SNHA 3O4VA 3IR6A 4BLTA 2ZSBA 1EQAA 4A2WA 1JHQA 3C4VA 4BOYA 1WKVA 4K8OA 4F5WA 1RZVA 3L7CA 3FIJA 2I3DA 4BWVA 4WMLA 4CV1A 2CHGA 1TYZA 2J3HA 2FPUA 4EB6B 1QYIA 2NVBA 3ZXSA 4TUYF 5LBTA 1CTQA 1PR4A 3AYXB 4Q37A 2I65A 3EPLA 3EIFA 3A1FA 2HRZA 4ENVA 5KVSA 3I9LA 2DQSA 3PUKA 5BPFA 1CQJB 2YNMC 2EGUA 1NXXA 3GIWA 4ZT2A 1TM5E 4HSEA 3SJUA 1Z5PA 4I1PA 3RVKA 3EMDA 3AR6A 1Q7EA 3FXAA 3DE0X 1UP4A 3TZ6A 3PNLA 4Q4DA 2WM3A 3QE0A 1RPTA 3WL8A 3WKCA 1PR9A 4J7UA 4DJTA 4IDHA 4P7GA 2DX7A 2JARA 4JLPA 3T4XA 3T6KA 4I5FA 3T7KA 3H9CA 5TNXA 4PX5A 3K0AB 3ZHCA 3GX1A 5E6RB 2W7TA 4OJQA 5FO0A 1GTJ1 1O6ZA 4PQFA 5EWJA 1FPQA 1AKNA 2EF1A 4CKXA 5CB6A 4EKIA 2X41A 4TYMA 1PQUA 2GN0A 4JELA 1UKBA 1EUCB 3KETA 4AF8A 3WGKA 5K09A 2D5CA 3X1JA 2GBIA 1DBVO 2CNKA 1NMXA 3GW8A 1YR2A 3UMRA 4KFTA 4MOWA 3MJEA 3VYVA 5I7OA 3GLIB 3A36A 2I71A 3OWXA 5EI5A 5T41A 3FE2A 2E5FA 1WB5A 4INJA 2BMAA 4IKEA 2O07A 3USES 4ZQCB 1DTWB 2VNAA 5DEOA 1ULTA 3RADC 1GEEA 1QP8A 2PMCA 2QM8A 4DXDA 4M37A 1AS2A 5DNDA 3I45A 3OJ0A 1BMQA 1Z6AA 1E5QA 3D5TA 4QWWA 4TMWA 2ISCA 2OXIA 1Y8AA 4QGFA 4RANA 3HV2A 4Q7EA 3BFPA 3IBFA 1WY5A 2B9VA 3KSRA 4X9XA 2DQKA 5AKZA 3RS2A 3SYNA 3X2EA 3G1TA 2QAGB 3KR1A 4WKOA 1N0IA 1UKYA 3FHLA 3SQWA 3U9SA 4GWKA 3RABA 2A4KA 4KYTA 4XYGA 4LF5B 2R00C 3M2TA 1XD8A 5KREA 2UZ4A 5FOWA 1ZONA 1R6TA 4BO9A 4FOLA 2FMUA 3MUEA 3X1XA 5T4FA 2HJ9A 1OWOA 1FYEA 4ZT5A 3VU9A 3MJVA 1WZIA 2AOTA 2OM6A 3GUZA 4P98A 4XVHA 2QU8A 2WMOB 2BDEA 4CI0B 2W0MA 1J2TA 5EHNA 3FLEA 3E8XA 2QMUA 4IGFA 4BKMA 1OXBB 3PJDA 1NFRA 2ZVJA 3MM4A 3PDCA 4ED9A 1H2WA 2QTVB 2PDAA 5ALDA 5L3QB 3BMXA 4MQUA 1RRGA 4W6ZA 4HBZA 3IELA 3ZDXB 3ZGOA 1WMBA 2GBGA 4I6JA 3Q7SA 2YJ3A 1FLVA 1U6KA 2DH5A 2QVZX 2VPYA 3D8TA 2OWDA 4U1RA 5KTMA 4PBRA 3SZMA 4FE3A 2NZJA 1TTPB 1IN6A 2J32A 3SJBA 4UCFA 1M1ZA 3CXUA 4DV6B 2YOGA 1M1XB 1NBME 2E85A 5GJCA 2VQEB 3FDXA 2BR4A 3R3WA 4RWEA 2X86A 4JLJA 1WRBA 3VR2D 4DG8A 1KZ9A 2QTLA 1QZXA 4NDNE 1KH1A 1V6CA 1Z38A 4FB5A 5F76A 4GP9A 2W2PA 3F98A 3MT8A 2V7QA 3GGSA 3NXSA 5FI5A 3D5EA 2PQ2A 2VRBA 3UJPA 2PCJA 5GADl 1CJMA 1Y89A 4CU5A 1A8QA 5LMZA 4TM7A 1U0OC 3COSA 4RKWA 1NM5A 2ORIA 1Z08A 3PKIA 3BOSA 4YV0A 5G1NA 3FLAA 1OFGA 4IDAA 2BSXA 1NTOA 4Q9IA 4F5YA 5KOIA 1NPYA 1Y6ZA 4OXIA 1I32A 1QANA 2EEPA 2IXGA 4I50F 1S2OA 3LX6A 4KSBA 5F7ZA 3UFBA 1ISHA 3IEPA 3LVQE 1U9IA 3RYFB 3CUKA 2AQIA 3ULKA 3IUMA 3DFIA 3NCTA 3EDYA 2A1UB 4EUNA 1JKFA 4IDEA 3TJRA 3EAQA 2GM9A 3ZKWA 3FFXA 1R66A 4YIKA 4FW8A 4DKXA 2NPIA 4BQIA 2JLQA 5B53A 1VSVA 2XMDA 4J0EA 3V2HA 4TYWA 4B3JA 3EWAA 4CKCA 1FFXA 1VLLA 4JJKA 2ZIGA 4JXZA 3K15A 2OFOA 3IUYA 4HGPA 4JLWA 1G38A 1FP7A 1QOQB 3EXEB 3L43A 2PIAA 4R1QA 3BH7A 1QLJA 4ITRC 4JBYA 5AKYA 2EP8A 2I80A 4GXTA 5AHOA 4CT0A 4FYMA 1GG5A 4BAZA 2V7VA 1H2FA 1T0JB 3UK6A 2IXTA 3M4ZA 1P2FA 4JB8A 4PM4A 3G7UA 4F6RA 1T2FA 1XP5A 2O4UX 2WF6A 2X5KO 2GBCA 3VXKA 2F8SA 5ER9A 1O3YA 1DFHA 3K3PA 1Q83A 3W2FA 4ZVUA 3SIPA 2WTBA 1CUYA 3TQCA 1EX6A 2VP0A 3FYDA 2E2WA 2VTDA 2YKGA 2VPPA 1ZRMA 4I55B 2QTFA 2QTWB 2J41A 4IIGA 4Z86A 1YJBA 1BWRA 4LCJA 4QUBA 4EUEA 3RNLA 2NVUA 3PU6A 1C3LA 1T36B 5I7EA 2A5GA 3T15A 4C78A 1O2DA 1YCFA 2ORWA 5EESA 4G6ZA 2FQQA 2HWKA 4FNMA 2QY6A 4S1NA 1TPYA 3HI6A 4AIIA 4OHUA 1ZZGA 3WNQA 3IDSA 2VDQB 1JVNA 1XTSA 2Z2JA 5CT4A 3MAGA 4GRAA 5JH7A 3JWJA 3EEIA 2X4DA 4IQ4A 1U8UA 2GPSA 4EHAA 4ARVA 4XYMA 5ITSA 5ICCA 3RVMA 4MVJF 2JBAA 2HOQA 1K9SA 2HQOA 3RI3A 2FPKA 2YJTD 4DV3B 3T4EA 2QL6A 4C7KA 1MP0A 1JN0A 4ABYA 4ARZB 5KOHB 2YXPX 2CNOA 4KIJA 5HTOA 1U5CA 4DVJA 4RK6A 4Q1FA 1M66A 5ALQA 2JGLA 2XXBA 1LB1B 4G56A 5TB5A 2AFRA 4DNFA 2WJ4A 3VC1A 1F38A 3TOXA 2V6IA 3FHCB 2GA9A 3NDIA 4BB9A 3TK1A 2Z3WA 1QPZA 1GUZA 1G55A 3KVRA 4CE6A 1KAQA 1WOYA 3SC2A 4ZYWA 3SJZA 3MUFA 2I9KA 1T5HX 2FPXA 3IQGX 3D5QA 1KOFA 3WLEA 3E7XA 3S29A 2AFIE 1LBSA 2EZTA 3TPZA 1MA3A 2QN8A 4DSTA 5LQNA 1G5QA 1RM5A 1US8B 3ZGVA 4EX7A 4FE7A 1NYLA 5G4LA 4IF6A 2P75A 2ZAYA 3MQFA 4GPD1 4JY7A 4V0MA 5DI9A 5ALWA 3ZVNA 1IZ9A 3KAQA 1P2BA 4N5HX 1YJ5A 1S8NA 3T06B 2VJOA 2QTHA 1M8GA 1GZHB 3RS7A 4D46A 3QOWA 2IDKA 1J8VA 4LGYA 1J1UA 2YASA 2V7GA 1KY3A 3CZMA 4YJ2A 1HDIA 3ZTYA 4NONA 3WGUA 3K9WA 3H9EO 3NO4A 5ARCA 4YDHB 1LI4A 2ZS7A 4EG6A 5H9WA 3KEFA 3H1AA 4O2RA 2FUG6 5K8JB 2CUZA 2H9YA 1DJMA 5A7GA 1P61B 1IIBA 1Z7EA 2R7NA 3IIJA 5JJ5A 1VE5A 4M89A 2QLBA 2Q28A 2W9XA 4GLBA 2A57A 2XB8A 3O94A 1JKXA 4RY0A 4ZYZA 5LSAA 1QRTA 3AJRA 3C8HA 2H1VA 2PA3A 5CPBA 1H42A 3B3AA 3ROZA 1HYQA 3DE7X 3VZBA 3V34A 3Q2IA 1VPTA 4PC1A 2PGDA 1F51E 3DB2A 3UT5B 4UVHA 3RU2A 1YU9A 3WGHA 1DKQA 4HAXA 4RFSA 1RAIA 3JQCA 4AUEA 4RY2A 4U7JA 4Y2HA 3UJ6A 1TKRA 2OOSA 2XMPA 1QH8A 5IH3A 5FLYA 2WINI 4G5QA 3RC9A 1PJBA 2W48A 4TMVA 3U37A 5B7PA 2JGDA 1S1MA 4JH0A 4MUHA 3FX2A 3ONVA 5K0LA 2BFAA 1OE0A 2HMVA 2UYYA 4P0QB 1SULA 2FQYA 3L49A 5BYBA 5T3UA 3FGOA 3URKA 2VJLA 5EIBC 5A0VA 1QIEA 2V9ZA 2Q4OA 2F8LA 3ZS9A 4OP1A 3HXPA 5BORA 2ZIXB 3O8OA 1SEPA 4WESA 4XE5A 1MAHA 1Z0ZA 3JR7A 2W22A 4JS0A 3MSXA 3W8RA 2BFFA 3O93A 4YAEA 2F3RA 3PJRA 1SG9A 2PE5A 1U11A 2AMLA 1SKYB 2DBVO 5DTEA 5H5JA 3RRYA 3C3MA 1A2OA 2OZKA 3QLUC 2VK4A 1LBHA 3LAWA 5TPWA 4B2LA 3DE4X 1XCOA 4RORA 4YHBA 2WM9B 4CMBA 3GLGA 4BX9A 1Q91A 2CCJA 2WKSA 3P27A 5AOVA 4EB8A 3JQDA 5KQLA 1UAGA 3EPPA 4Q9JA 4YS6A 2C5FA 3A7EA 3FFTA 4NFHA 4HWGA 1QQAA 3H5WA 4LZAA 5AM4A 4JL6A 3A2LA 5AOAA 1JEEA 1VIAA 3ONDA 4MLZA 4PNEA 4QJ3A 3DTVB 4PYIA 4ZCSA 3GRZA 5IH7A 3KKPA 1KQ3A 2B9EA 2J0VA 3T34A 3QSYA 2QI9F 4BC1A 3X44A 3VNBA 2JC3A 1WJGA 3TIXB 5AVZA 1Z9BA 3FTDA 1JVSA 1W4LA 1AT1A 4TS4A 1WHSB 2JDIA 3LF2A 4R16A 2B4AA 3QPWA 4MR9B 3G23A 3U31A 2ETXA 1MA0A 1OBHA 2ICAA 4XARA 2HB6A 4JJEA 5DX8A 2R6GA 2JI9A 3QXHA 1TB4A 3IXMA 3HUEA 1XKXA 4TWRA 1TT7A 1YV9A 1RHJA 2IYLD 4L15A 3MJTA 1PJ3A 3I2IA 1GHTA 4NY1A 1DRVA 1TQ8A 4NBRA 1WPXA 2P69A 1IXZA 2VF7A 5L7YA 4NU8X 3I01M 1HOTA 4BFXA 5DRYA 1KVTA 1GXSA 3G2LA 4O8ZA 2RGCA 4DLYA 3HO8A 3CX3A 1L5HB 1XZDA 3B7WA 4LYJA 5J43A 2CVQA 3KWLA 3LC7O 1NIPA 3RUAA 1SXGA 3D2BA 4YACA 4DMLA 4NMLA 1XZCA 1YDGA 1Z68A 3L77A 4GOXA 1BROA 2HRQA 4E30A 1A5TA 2HTEA 2OCLA 5REQB 3GAZA 2E4XA 4X85A 1R4MB 3TNYA 4C0WA 4D4LA 1SUEA 4LHZA 5T8KC 3IERA 1JQLB 1XRQA 2ZVQX 4WKCA 3HBJA 3JD1A 4C43A 2KX7A 2BKEA 2OQRA 2V7BA 5ERYA 5DULA 2IUUA 3ZU5A 2QOEA 3GPDG 4HKTA 1N2ZA 4L85A 5A1TA 4XW2A 4BO3A 2OHGA 2INGX 2PR2A 2ZJ7A 4F46A 1NXOA 4IX1A 2JI7A 4L50A 4RGYA 4DJFC 1A8PA 3E3LA 4YONB 4JKIA 3QKIA 5HCIA 3KSZO 2RGNC 2DQYA 3IR7A 4Y30A 4KK4A 5K0NA 4CXMA 5LQRA 4C4RA 3TI7A 2ZCJA 1A9OA 4TTTS 4YMUA 2VH5R 5E9AA 1U0EA 4D3ZA 2HLHA 2ETVA 2Q2VA 2QRGA 3EDRA 2BW0A 1SO8A 1CHNA 1MVLA 2JIDA 4J7XA 2X2PA 1Y1QA 3MBOA 4A0GA 3D64A 1WXXA 3H5VA 1GADO 4HVCA 5AKJA 3RYIA 2H06A 1KDTA 2V3WA 5EJAA 3MOGA 1L3BA 2G6BA 3L8HA 3P9NA 3RKRA 1EVEA 3V1LA 3O9MA 2XXJA 4MTCA 1DQZA 1KVUA 1LF5A 3TMKA 5IKEA 4K3VA 2F43B 3FPHA 3QIVA 2ZUFA 2W93A 2XEXA 2VC2B 3OPXA 4CJXA 3O8CA 3LBHA 3PCRB 1M1YA 5NULA 4AYTA 5JC8A 5AUQA 1YRYE 3CCFA 1OC4A 1X1EA 3TQOA 3GY0A 4DARA 1UFQA 4GYYA 2Z5GA 3ZBUA 2LV8A 4IDFA 3QUQA 4BRWA 5ITWA 4KIUA 1KIFA 3QPUA 4DRXA 1W2GA 3HKDA 4BX2A 1VB3A 2C5HA 3BM5A 3FDZB 4HZUB 2G4VA 4TS1A 5KVVA 1OH7A 4C7XA 2PY6A 1C29B 4Q7JB 3HUFA 1E2JA 4GL4A 1SHKA 4IDBA 3QMWA 1OI4A 1OT5A 4N0DA 3WVNA 1ZCFA 3OHMA 3D3KA 4IQ8A 2A9VA 4WSOA 3W5JA 3SHQA 1EFKA 1UEJA 4QA9A 5G2OA 3VHXA 5KYXA 1WZCA 1UBFA 2VI5A 2PKWA 3UNXA 3ZCUA 5FOUA 1R88A 1W5FA 2JANA 2IYVA 1C3JA 3L0ZA 2Q2WA 1RXWA 2HBRA 3D4IA 4ZA2A 2OG1A 2C8VA 2XQKA 4LYYA 4UREA 2DETA 3PC8C 1U1DA 4D81A 1EWKA 4CG3A 1ZM9A 1WXGA 4IVQA 4ZOLB 2DMRA 2C7OA 1KDZA 4D9MA 1R50A 2V96A 2W2KA 3RUCA 2AT1A 3J7TA 4LK3A 1UKVY 1PK7A 3QVXA 1AN0A 1DG9A 2V4UA 1IBSA 1YJQA 4WNYA 3ZZNA 2D06A 3H9QA 4JCCA 1QTIA 4QEKA 4ALLA 3V4RA 1Z4PX 4HUQA 2A3NA 2QLLA 5IEJA 1PNVA 2R44A 3N6XA 2A9PA 2NVOA 2ZREA 5TMBA 5JFGA 2PNFA 1OXXK 3QMVA 1Z3IX 2E82A 5IAKA 2QZPA 1MFPA 2GI4A 4AYXA 1Z0KA 3GMTA 5KSWB 3BWEA 2IT1A 4D9KA 2H2WA 3A2KA 1DUIA 3KB6A 5F5LA 4DLKA 1NVFA 3BBPA 2CC2A 1ZVVA 1UBRS 2FRDA 4AZVA 5C7OO 1M2KA 5KKCA 1IQPA 1HI9A 1PR5A 2CZCA 3ENWA 1GPH1 5T6BA 4ZHSA 3K2BA 3EGOA 1ECGA 1W47A 1JLSA 2JIBA 4DBVO 5KYNA 1Y9DA 3I23A 2VZ0A 1JQKA 3I12A 4K9DA 4O1IA 4UTOA 4Q9NA 4MIYA 2R7AA 3KXDA 1OVMA 4HMOA 4TTIA 3JAKA 4NCXA 4I5IA 4LZJA 4JLMA 1NMQA 5I7WA 1NVMB 3NC4A 1II9A 4HQNA 3RU3A 1TMGE 3TG2A 1ZH6A 4K05A 3DTTA 3H1GA 3I61A 1ADCA 4B3CA 5DXAA 4BLWA 3MCUA 3SQDA 4Q9AA 1Z2OX 2QGNA 4DR7B 1MT3A 3LYHA 3OEEA 5LFAA 3DBRA 1ZXXA 1N2SA 3C6YA 4JNCA 4EI9A 2CNWA 1HQYE 3Q40A 2EWWA 3WGMA 3P9PA 1NQXA 4WZZA 2WBLC 2R4TA 2OO5C 4P38A 3M81A 3T9BA 1P3DA 2R751 3FYUB 3UB2A 1CUJA 1A4XA 1XZAA 1D9ZA 3HWRA 4RA6B 2OAEA 3DLIA 5LL6P 3RC8A 2Y1EA 1OREA 3I09A 3NTXA 3QTBA 4Q19A 4TKUA 2QT9A 5J1TB 1R6BX 4OI4A 4PYMA 4WAUA 1SUFA 4RZXA 1DJNA 1C0KA 2YWJA 5HR5A 1U0BB 1EFPB 1E62A 3L7DA 3N87A 4L27A 2AN9A 1VDMA 2JFHA 1UQTA 3SKYA 4IOLA 5EINA 1N5JA 3FZNA 4K46A 5LQAA 4P34A 1JXQA 3GI1A 4L7VA 2JK1A 2YS6A 4WEOA 1NKTA 4BECA 2W6JA 1F2TB 2GM4A 5GM1A 3I04A 2VXOA 3G8DA 4DCTA 4QYTA 3K6SA 2YWXA 4WFQA 4B4VA 3S5JA 1U1CA 4TKVA 3RLFA 1NI5A 1IZ8A 2Q1UA 1P0CA 4F2GA 2AC2A 2BMJA 3TZLA 1BS1A 3DMPA 2WWVD 2GETA 4GECA 5HF5A 2JH8A 2DWCA 1CKEA 3EIOA 2CD7A 3HB5X 4I19A 2C9MA 2R65A 2VF2A 2BSAA 4FN4A 4PC2A 4QRDA 3IODA 2V0NA 3OCUA 3ZZUA 1PJRA 3JVDA 1H5UA 1BKDR 2YQ5A 1QR2A 5JNVA 4HAWA 2Q62A 5CEFA 3OHSX 1YDFA 3NBAA 1V6AA 4GOKA 3PNYA 3K0BA 3PEWA 2RHCA 5FUBA 2IP1A 3TMYA 2M6SA 1DCTA 4JEHA 5AIAA 4AK9A 2VATA 1CUWA 4BAGA 2Y0DA 2WUEA 3N0WA 3AFGA 5DMXA 1U2DC 2XV1A 5J5VA 4AIRA 3ICWA 5L3VA 3TAXA 2ZXEA 3GP5A 4BFCA 3TFOA 4R9SA 3ILYA 3QE4A 5JUWA 4ARAA 3I5AA 3U16A 4QGHA 3PQFA 4NBSA 1CS0A 4J29A 3LY8A 1LBIA 2F6RA 4ZI3A 1GA4A 3O31A 4LCEA 1A9XB 3QPVA 4B33A 5CG1A 3H97A 1ND5A 3A4YA 1GILA 1QVWA 3FUXA 3SX0A 5KNCD 2PWZA 4DQDA 4FMDF 1RPAA 2PU5A 1KPHA 2RMKA 4JUBA 4EY6A 3H11A 2VHJA 3HCBA 4IUCS 4YDRA 2EAUA 3DEIA 1NJFA 5LYJA 3OU7A 3P97A 4ZRMA 3HO1A 3NP9A 2PUTA 3P9QA 2HO5A 4DIUA 1I3NA 1MUUA 2XWQA 5CT8A 4DA6A 3W5CA 2G4CA 2CYBA 2WSYB 1GFIA 1DKOA 1FUEA 1GRQA 1Q7TA 1UBGA 3P45A 4XUCA 1YI1A 2HWUA 3RRXA 3EA0A 2GXQA 1A8HA 3PHLA 4ITUA 4A0SA 1RAGA 3QLTA 1RS0A 2O05A 1GKLA 1PX0A 3WYNA 4E2XA 5JZOA 3WAKA 4E13A 3G8YA 3TR0A 2OGUA 3JQ8B 2HLDA 1J8DA 1EG7A 2AUTA 3JYPA 3S8EA 4BO1A 4J1TC 1PNOA 4JLSA 2YRXA 3SZOA 5D7BA 4EITA 1BS9A 2H48A 4QFMA 4PLGA 1XRLA 3AF4A 3GFPA 3UMBA 3ZX4A 1SCDA 2NXJA 2VKQA 2VJPA 3COZA 1GEGA 3Q72A 3BBLA 1NASA 1WDLA 4ZVLA 3HXQA 4RHEA 4OQMA 3KQOA 5KQGA 4ZTBA 1HR0B 1YVEI 1OTXA 3C48A 3VR6A 1XAHA 2G9UA 4QUDA 3B53X 5EEGA 1T5TA 3KRTA 4HEHA 3BXPA 4HYTA 3WG9A 2Y77A 1OFTA 3Q3CA 4WCFC 3IKTA 3U4QB 4PRKA 2BHSA 3L6UA 4L8YA 2OAP1 4XXHA 1K3TA 1W25A 3DULA 4GI5A 3VVCA 3VJLA 1G64A 1ZMBA 1M2OB 2B5VA 2ODTX 4LSGA 3ZDEA 1GVNB 2C2YA 2TMYA 1DRWA 3QE2A 1NU6A 4WN9A 1NQ5A 3C45A 2UZ1A 2CWDA 2SCUB 4F9EA 1ST3A 1IQUA 1QC5A 4OMFG 4JI1B 2O19A 4WBNB 3JD4A 1SVOA 1KETA 4L28A 4RKRA 1NLYA 5I6DA 5KOJB 1IHDA 3A9WA 1GARA 3FCAA 1XZIA 5HJEA 2ZT8A 3OEED 3TFQA 3WLHA 1E5LA 2L17A 4LX8A 5JAMA 4NFLA 4JSYA 4HLUC 4PO1A 2CNWD 4OP3A 1RQRA 2ZXUA 2Z2IA 1V3UA 5AUPB 4MIEA 4CMIA 3WKBA 1I0LA 3GQBB 5CBPB 1XCGB 3DZHA 1PD1A 1AQUA 1OGIA 1P8JA 3NTVA 3O91A 4NWIA 4ZVNA 4HGOA 4UCWA 5C5IA 4RKQA 4ZVOA 3VI3B 4PX9A 4QO8A 5COQA 3DFUA 4LMPA 1CUIA 3V1YA 3MAAC 5L53A 1PJ8A 1U31A 1CXZA 3G82C 3I6IA 3OZBA 3PUVA 4FYIA 5P8WA 3BEOA 2W6JD 1A9SA 2FSUA 4UTPA 4WK4B 1E92A 4RLQA 4LNAA 4O2BA 4TTRA 2B0JA 3MYYA 1W5AA 3ADPA 4RJIA 1CR4A 1D6MA 1PDVA 2YTZA 1OWLA 3E9YA 3LA6A 1A77A 1ZVMA 2AF4C 3H9BA 3JYQA 4UC0A 1KSGA 1T91A 1BWQA 2Q4BA 3I0MA 4V3CA 5EIFA 1BRTA 2VAWA 2NLOA 2WIGA 3MCWA 4G09A 1ZNZA 4JCOA 2P1RA 4JVSB 4ND8A 3CNHA 1PR1A 1R1DA 3DCIA 3Q9NA 1GPJA 4EAAA 2GBLA 5TF4A 4G5RA 4OBEA 1NVVQ 1V9CA 4ZVKA 4ETMA 2WNSA 5ECYA 4NXMB 4G4SP 3GCWA 1SN7A 3RM3A 1QIKA 5HK8A 2AYYA 2EBWA 5ADVA 2FEMA 4R5HA 2BR5A 1AB5A 3K5IA 5K4HA 1JZQA 3P0HA 3R23A 1X0VA 4BBAA 2KSQA 3DEAA 2ZETA 3P9ZA 2IEIA 1J22A 1UOQA 3PFWO 4IH1A 4U00A 4B9AA 4DIDA 1SHLA 5ELXA 5H02A 1LDMA 4CEIB 3IAEA 3GMIA 4GHWA 3QTTA 4KQ9A 5DCLA 4ZOAA 3SVZA 1Y6RA 4GT1A 4IRUB 3O8LA 4QGGA 2P40A 2RG7A 4YRQA 5FI3A 3N2IA 3AJEA 3RGWS 4ARSA 4Z49A 3H2YA 3H9UA 4GGMX 2RGAA 3SLRA 2X0JA 1ML3A 2AYZA 1UJMA 4IIYA 4AF7A 4DT1B 1U0LA 1KXJA 3VU8A 2ZB7A 4M9SA 2VS1A 4MAAA 4RVHA 4FDVA 3K6KA 3OA2A 3OUTA 1IPFA 4R0MA 3B51X 1E59A 1GFZA 4QQ8A 1M5RA 1BE6A 1C9KA 4GC5A 1JR3A 5CLFA 5F9FA 1CG6A 3K4HA 3MC1A 3CPJB 4L78A 3BORA 3GFTA 3AP2A 3RHSA 4RTPA 2DTDA 2PQMA 3LT0A 1K98A 3DBIA 3L7NA 3CVUA 3F2VA 4NHOA 5EKTA 1J8YF 2J4DA 3G5LA 5EYPB 4HN2A 1EI9A 1ZHHA 3TEJA 3IC5A 3TECE 5B58T 4HZIA 1RJDA 1U9CA 2ZR0A 3PD1A 3DKPA 1QRDA 4TV9F 4UEOA 3SBEA 5JLJA 2AUNA 1BJTA 3TRJA 2E21A 3JQAB 4BMSA 2TSYB 4MV9A 2CMHA 3R7NA 1HGXA 3QVUA 4CM4A 4CMHA 3O2NA 5EKDA 1L5NA 3D1JA 2BONA 4FOTA 4AMZA 5EHXA 4D74A 3WS7A 1XZLA 5KYUA 3RIEA 4BKUA 2IYAA 4LHVA 3VR6D 4P0TA 1CV2A 2X8WA 2Z56A 3DFKA 1F6BA 2QP9X 1TJ5A 2BE9A 1VGVA 2QN9A 2B8TA 5K4GA 1R7RA 4BNLA 1YQQA 2B1GA 3EZXA 3VNAA 3HGQA 3G13A 3AM1A 3QPDA 1TW3A 4DKJA 1KVRA 4RYLA 2BM1A 3MNFA 3ILVA 2AEFA 3L7LA 3OZTA 5K0BA 1YB2A 2HX1A 4ENUA 5K0SA 1RE0A 2H1FA 3KEQA 5L4NA 2OEPA 1W5SA 2AK3A 2H31A 1WVGA 1XRNA 3FUWA 1W0JA 2BJHA 3TBHA 4UVEA 1LTKA 1M8JA 3K2IA 3NKFA 4UVDA 2XB2A 4QRIA 3EZ9A 1P45A 2CLKB 2H1WA 2BFDB 4BHTA 1IAVA 1PI3A 2ZM6B 1FJHA 4KQIA 4MQEA 1N2GA 4Q7MB 4ALNA 1E1RD 4BP9A 4BTVA 4DA8A 1PO7A 3AONB 3MTGA 4KWIA 4HRAA 4M0CA 4LPKA 1HE4A 2ZTLA 5AKEA 2Y1XA 3UJCA 3SC4A 3DC7A 1YFJA 3V2IA 4NCBA 3AHIA 2B2CA 2ZIVB 1T9GS 3K9CA 3V4LA 2NQ8A 1RMYA 4H7FA 3S0JA 2BGJA 1P4RA 2BCJQ 5CLGA 5ALRA 3QEKA 2RKBA 3PL5A 1K7EB 2C8LA 1DXYA 4OUDB 4CM1A 3MCVA 2EHDA 4ITVA 1Z62A 2QPAA 4NMHA 4Z9BA 5I7FA 3PWZA 1ZJ5A 3OPQA 4AKGA 1RJGA 4XEUA 5M3BA 1H0KA 2G9RA 2VFAA 3IAUA 1NF8A 1T8UA 3ZUGA 4HGYA 1RYBA 2ZE7A 4XIYA 1UQUA 1WX1A 4HDMA 4WZAE 1FPMA 5DWQA 5FLEX 1Q5PA 3K70D 3T7JA 1L7QA 1SB9A 2PX2A 4MCIA 1Z18A 3QITA 3T9DA 9GPBA 4PYNA 3IXLA 1MRNA 3ECAA 1A71A 2ZIZA 3FYHA 2EJBA 5IF3A 2V58A 3IKVA 1UXIA 1FFHA 4KO8A 2P4EA 2PWPA 4BS9A 5HIAA 5HUJA 2I6QA 3HA7A 5D5QA 4ZYTA 3T1HB 3B1WA 1XROA 3IX7A 3MBKA 3GF4A 4MV6A 2VTBB 2RCYA 3CWZA 3KYIB 3FSGA 1YAHA 4JL8A 2IYUA 1KZGB 4QTZA 5CDUA 3AVUA 3AKZA 3ZDFA 3DSRA 4ECEA 5CYPA 4RPIA 1Q7RA 1EIZA 1N7IA 1P1FA 1YQWA 2D3TA 4L16A 3EQ7A 4MV1A 3GVPA 4BMYA 2Y0BA 1IQ0A 3FBTA 2GM5A 3BFKA 2JGIA 3UXYA 2W6NA 3NIBA 2V6MA 1II0A 1KNXA 1K89A 3PQCA 1PFWA 3CX4A 4OQNA 3CTMA 3D8HA 1K9VF 5C8YF 2GKGA 4KO4S 5A06A 2GO1A 3RW9A 4WD3A 3ETHA 4B1FA 1U8YA 3E1GA 5KNBA 1TL7C 3WK6A 3UOWA 1P1HA 3I32A 1SJ9A 1F4VA 1FQJA 1TM3E 3H6KA 1Y34E 3DLBA 5EUBA 1NY6A 5AT1A 5FDFA 2PRJA 4Q3BA 3MGKA 5CGQB 4ZPXA 3W04A 2F62A 4WXHA 3GVIA 4XZ3A 3WYFA 2D7DA 4B8YA 3VPBA 5JV5A 3GD5A 2NV2B 1TD1A 3EODA 3F96A 4UHEA 4AL4A 4WLUA 1KO8A 4IYJA 3BULA 1KWGA 2Q5JA 3B2NA 3IPXA 5LXTF 5K8LA 3ZTWA 4M7PA 1JR3D 4Q4HA 3I9MA 5K8TA 5EJEA 1EU1A 1TZKA 5JD4A 2FDRA 3A1DA 2JKYA 3DEZA 3QENA 1U4SA 4I6EA 3VC7A 4OK3A 5F51A 1KA9H 3D7SA 4UJ3A 3EXHA 3UJNA 2FVYA 3JWPA 4RZUA 3WBJA 1MO6A 2MSKA 3KQNA 2FKNA 3UC9A 3AXSA 5H4HA 3AF6A 4WJLA 4EF4A 1IVNA 13PKA 2CNLA 3S8YA 3SE7A 2VCYA 1NOKA 4R6XA 1BN7A 2R1TA 3AVPA 5IM4A 3WO0A 4ZEMA 1JHXA 3NETA 4UOZA 2QBYB 1C0PA 4TLMB 1U3TA 4EYOA 3S8MA 2OV6A 3QUAA 4DCGA 3HFSA 4KV7A 3V4SA 4CR8A 4J16A 2ZR9A 1GQFA 3D8UA 2FUCA 2VHUA 1I33A 1NW3A 3GGGA 2C99A 1H5NA 4LA4A 5A02A 5K6AA 4TKLA 1JI0A 3LXRA 4I5EA 5B3LA 4EK9A 4M1QA 1DX4A 2HA2A 2WIKA 5AUNB 3NVDA 1XXHB 3LCJA 1JJBA 4XUGB 4D6PA 4XWGA 4A5OA 4I36A 3WGLA 5L8VA 1VP3A 2ZWMA 4YFVA 1ZDMA 2NQ2C 5AKLA 5AHXA 3B9QA 1VE9A 3U09A 3AM4A 2WJPA 3I9V6 1B73A 1D6JA 1ZD9A 5JEEA 5LYYA 5A05A 1TDJA 3H2HA 4L0QA 3TIGA 1JIVA 1FMJA 1JDPA 2MMCA 4LJ6A 1GAEO 3I5YA 2Q5QA 2OBBA 1EK0A 5FBKA 1I80A 1XHFA 3ASVA 4BP3A 4HC4A 1W0JD 4IGAA 5IFLA 3SEFA 3HB1A 1P80A 4RMHA 3KPUA 2O8BB 4AUNA 2I4TA 3FNFA 2JGJA 3E1SA 1PL6A 2H2DA 5LWQA 5FWYA 1L7EA 2EC5A 1Z4QA 4DUGA 3OPYA 5C1DA 3IKMB 5DHRA 4B80A 4CLRB 4BEVA 2PO5A 3TG8A 2REQB 1Q74A 3BXOA 2X5JO 3FWNA 3ITEA 4IQGA 3RBAA 3G85A 4IS3A 5IT5A 2G77B 4IO1A 4RMJA 4HLQB 4K87A 3U1TA 4PZEA 5KAPA 5AVYA 3DDUA 3PP8A 4UUQA 4RTRA 2XKJE 4OF4A 5HOQA 1QF6A 3M4NA 3PE4A 4JJFA 1T4CB 1NU8A 2C4WA 2B25A 1NMYA 3D6HA 3LO5A 3EIEA 5ILGA 4TSRA 2JCBA 1GCIA 2VNSA 3K16A 2F55A 1CJTC 1SUBA 2YC2C 5EWLA 6REQB 5L7WA 4XDZA 4I1SA 1P8AA 4KQKA 2BYTA 4LHSA 4HNRA 4YWHA 4MRPA 4BGIA 5LIPA 2FHPA 4XX0A 5DNWA 2XUJA 3LXMA 4XSVA 1JNYA 1QH9A 5JCXA 5KJ1A 3EVBA 5BVGB 3G59A 4HJRA 4GOOD 4HY3A 1KU6A 2PZEA 3JATB 4FS8A 4PLCA 1VG0B 5KIAA 1I94B 3FSGD 5K5EA 3I6YA 1Z07A 1SCIA 4EJSA 1RC8A 2Z4SA 2P9BA 1EFVA 4FBLA 3RVJA 2PSEA 5BVHB 1XU7A 1Q16A 1Y3CE 1J0CA 3KQWA 2BIFA 4BO7A 3BTVA 1YJXA 4C7OA 1W76A 3D3WA 4AMGA 2P3QA 2I4LA 4EO4A 3Q0IA 3A6PC 3HLKA 4L4UA 2P2YA 1SOUA 1JEYA 1O58A 3KFXA 2PCLA 2QQFA 1SQGA 4F04A 1ZP6A 1E3SA 3L4BA 5KNBD 1RHKA 3E4CA 4ABTA 1YFLA 2X23A 1R27A 2HBYA 2B7BA 4JENA 4X63A 2BKLA 3CEHA 4HOYA 4IDCA 4BASA 1W2WB 5DLYA 2ZG6A 2AGVA 4JGIA 1JJ7A 3EQ2A 1Z5ZA 4M9XA 4LKOA 5TGDA 4F8JA 3FIUA 4HTAA 3HFGA 2ZYUX 5DM1A 2ZYHA 1WM1A 5F9MA 1VPLA 1ZM2A 3OOHA 2CHUA 4O59O 3OF2A 4QVGA 4X1IA 5J2TA 1S7CA 2ZM5A 2WFLB 2X9NA 3EISA 2XUAA 3H5NA 2A7QA 2FW8A 1V7ZA 4OXQA 3VPAA 4F12A 1L4NA 1HZZA 3IT3A 5K2OA 2AKYA 2D0PB 4LJRA 4HXFB 4KVGA 4EY3A 4Q4JB 1KJ8A 5JVDB 1Y1LA 1XK6A 3LQ4A 3OKFA 4KLCA 4LXUA 5CDFE 2PS0A 1VA4A 3L0DA 4RE6A 4BWFB 1HDYA 4UQLA 3K0SA 1JSLA 1RI3A 3IBCA 3WWPA 3LD9A 5U4XA 1WPGA 1H1DA 4N4AA 4R1SA 1DKPA 5C7YA 2HK7A 3EJWA 5I51A 4OHOA 1V96A 4XI9A 5C4GB 2W42A 3R0QA 2V1UA 3VKWA 2BRUC 2ZWIA 4C3OB 4S1WA 1E61A 1QF7A 3AQIA 1CR1A 5H9VA 3BYZA 4Q4CA 3T3PB 2I3BA 4CDGA 4XDYA 2PQ0A 4DEXA 1Q6YA 1EQ2A 1E1YA 1H85A 2VHZA 2EG5A 3DT6A 3WKDA 3KKZA 1HH4A 1EK6A 3AFHA 2P77A 3GRCA 2ZGVA 3Q98A 2CFCA 2XR1A 3W2HA 1EVYA 4CWAA 3F5SA 1YZQA 3W7BA 2HQSA 3WICA 2F3UA 3AHHA 3I4FA 3K9BA 2E7ZA 2CZQA 1E2UA 1S9DA 1QR6A 3A7DA 1V7PC 2FK8A 4IP0A 2O5VA 1JS1X 1Z4NA 2YICA 5EHGA 2JLXA 4GE3A 2EJTA 3K5WA 5HIKA 1AZSC 3LVBA 3NALA 2XMCA 3SIRA 2ATVA 3LRTA 1C9YA 3KAJA 1U0JA 3VU3A 3IRVA 3QQPA 1EINA 1D09A 1U7XA 2UYQA 4NRDA 5CLIA 3U4AA 2WG1A 4PZ0A 5G41A 3PYLA 4DPKA 2WA1A 4JT4A 4DUGD 5JNUA 1T2NA 2C7PA 4WOPA 2PHZA 3GA5A 5CB4F 1ZK2A 1UM9B 1OLSB 1ORTA 1ENZA 2V6FA 3I6MA 2Z0MA 1NMEA 4I5DA 3R9KA 5ILOA 1UXHA 4G0NA 1EIWA 1ZJJA 2G09A 4ARBA 2YWEA 1ACMA 3A31A 3GFVA 1DDGA 4DMMA 3Q0EA 1KDRA 1V11A 1EVIA 3AL2A 4N8SA 1E64A 1TKAA 2YIDA 1W88B 3IAAA 3PRHA 3A9RA 3CMMA 3ENVA 4GYKA 4HNSA 4CEHB 4Q16A 4RD0A 3G1WA 4HB0A 5LP6C 4G8BA 5T4EA 1RQXA 5C0OE 4B7XA 2R1ZA 3GPLA 4LC0A 4D6YA 1JYFA 2JGMA 5JBIA 3PXAA 4C0SA 2PL9A 4TUYB 4CM5A 3FFAA 4KW7A 2DPGA 5M29A 4E6PA