3BDVA

Crystal structure of a putative yden-like hydrolase (eca3091) from pectobacterium atrosepticum scri1043 at 1.66 a resolution
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
191
structure length
191
Chain Sequence
GMQTTEIDLRLTEVSQQLTMVLVPGLRDSDDEHWQSHWERRFPHWQRIRQREWYQADLDRWVLAIRRELSVCTQPVILIGHSFGALAACHVVQQGQEGIAGVMLVAPAEPMRFEIDDRIQASPLSVPTLTFASHNDPLMSFTRAQYWAQAWDSELVDVGEAGHINAEAGFGPWEYGLKRLAEFSEILIPNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein DUF1234
publication title Crystal structure of YdeN-like protein of unknown function (DUF1234) (YP_051181.1) from Erwinia carotovora subsp. atroseptica SCRI1043 at 1.66 A resolution
rcsb
source organism Pectobacterium atrosepticum scri1043
molecule tags Hydrolase
total genus 67
structure length 191
sequence length 191
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06821 Ser_hydrolase Serine hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3bdvA00
4B84A 1H22A 1XQWA 4G8BA 4FKBA 3RKSA 3O9MA 4U2BA 5IVKA 1OXMA 1XZIA 1K8QA 1AKNA 3FWHA 5LP1A 1MX5A 5ALLA 3M3DA 3BL8A 2WILA 1ZICA 4KRXA 2WJ3A 1FFBA 3T4UA 4J0DA 4GEGA 3S2ZA 1F6WA 5BWCA 1G4HA 1VKHA 2VATA 4Y9SA 4OB6A 1J2EA 1CUGA 5CMLA 3FVRA 1MAAA 3FYTA 1HDEA 1R4ZA 4WY8A 2XE4A 2JGMA 3E3AA 1ZD2P 5EIHA 2RONA 1ISPA 3HABA 1VE7A 1B6GA 1D07A 2VT7A 3X3HA 1VE6A 4N8DA 2JIDA 1EI9A 4QDUA 2W6CX 3DL7A 4H77A 3A6ZA 4A5SA 4X90A 5DLPA 1CR6A 1LPOA 2CUTA 1XRMA 3HC7A 4AN1A 5JAHA 5DYYA 4NS4A 2PPLA 2HIHA 4OB7A 2NW6A 4C4ZA 2I03A 7YASA 4J0GA 4Y2YA 2XUIA 3FVTA 2X76A 1CUZA 1E8MA 3M82A 4QE3A 5AI9A 2G63A 5ALSA 1U8EA 4BTVA 1JJBA 1UXOA 1MU0A 4MWSA 5K3AA 4BVJA 3GZJA 1TAHA 4X92A 2IX9A 1EINA 4BTLA 3E0XA 4PV7A 3DKKA 3VJLA 4MQLA 3OC0A 2QUBA 5JAPA 5LZ2A 3D2BA 1LZKA 3CN7A 1B41A 3U1TA 3V1KA 1JMKC 2Z8XA 3SC2A 3R3YA 3WK9A 4DMFA 3E1GA 1QIIA 3VVMA 2RIPA 1VZ3A 2WJ6A 4GBGA 2H7YA 5LYYA 4OU4A 2GYWA 5IH7A 3HJUA 4X00A 4AXBA 1DX4A 2Y2UA 2OLEA 3HI4A 3WZMA 3LIPA 2WUFA 3ZLUA 4C4XA 1YS2X 2WG0A 4M0EA 3B5EA 3QITA 5AO9A 4DMKA 3STXA 3HSSA 1UKAA 3LCRA 5AM5A 2JBWA 1IUNA 1EVQA 2WHQA 2WLSA 5FPPA 3WK7A 1JT2A 1QFSA 1LPAB 3N0TA 2HADA 1UWCA 5IVHA 3VXKA 5IVDA 4C89A 1W75A 2XUDA 2E3JA 1EDDA 4BRSA 3WWDA 5A62A 2WIFA 4C87A 2QJRA 4BVLA 4DSZA 3WZLA 3OURA 1UK7A 3WA7A 3N2ZB 3RARA 2WUGA 5I7UA 1E8DA 5AOCA 4B0PA 3W04A 4BAZA 2Y6VA 3QVMA 3AZPA 4N5IX 1LPSA 5ALRA 2ZVDA 2WM2A 1IUOA 5AM3A 2QXUA 4KYVA 3WYNA 3KWFA 3MUNA 3VDXA 3H2JA 1WOMA 3ANTA 3UUFA 1LPPA 4FTWA 4HRXA 2YASA 5LZ5A 2IITA 1XLWA 3GFFA 4UUQA 2QZPA 1A8UA 2VJDA 2ZJ7A 4A16A 4B81A 1U65A 4XIIA 1ZGBA 5I8PA 5E4YA 5CT8A 4BAUA 3ZLTA 1W76A 4Y2VA 5AM4A 2XUHA 5JANA 3IA2A 3IBTA 1XQXA 3DL4A 2BFNA 4OUKX 1O6FA 1DT5A 5HK9A 1QFMA 4FOLA 1TKRA 3SWWA 2C5GA 1XZCA 2BUAA 3IULA 1OCEA 3LIIA 4OPMA 4HXFB 3NOXA 3WL8A 1XZAA 2WJ4A 3FSGA 5AICA 2Q0XA 2JGIA 3D2CA 1CVLA 3W05A 4UBOA 4H0CA 3HACA 3PUIA 4DIUA 1XZFA 2YYSA 1AGYA 4UHHA 4N5HX 3FCXA 1DT3A 4DGQA 1K5PA 3H04A 3HRHA 4J0CA 4U2EA 1TK3A 3DEAA 1CUCA 3D59A 1VZ2A 2WQZA 1TIBA 2VJAA 4LYEA 4KE8A 5DNVA 4ZRDA 4UFPA 3BIXA 2BUCA 4DTCA 4H7IA 2WIDA 3OM8A 4LXGA 4E15A 1IMJA 5T4EA 2QKYA 1XKLA 1LGYA 1BU8A 4L0CA 2XUPA 1N5MA 4AO7A 3TEJA 2PM8A 4H7KA 2JEYA 4Q1VA 1WCYA 2RAUA 4X97A 5AKLA 4FWBA 2ROQA 1QE3A 1AZWA 4PO3X 4HZGA 1A88A 1QIMA 1XZLA 1DX6A 3GA7A 4AZ0A 2HHAA 5E4JA 3FCYA 4B9AA 1RP1A 4ITVA 5DTIA 3WJ1A 3U0VA 3V1NA 2XMGA 3WWEA 3AZOA 3IDAA 4KE7A 1CUYA 1QLWA 2AJBA 3DJYA 4JYMA 2GZRA 2XUFA 4OCZA 5SYMA 4NZZA 3V1LA 5EGNA 2QTBA 1ACLA 3AILA 3DDUA 3H2IA 3BDIA 4C4YA 1OILA 5EHZA 4RNCA 5EIEA 2H7XA 5AI8A 4P92A 1Y37A 3IUQA 5IVIA 3WLAA 4KAFA 4HXEB 3STWA 4F0JA 2VAVA 1BRTA 4UHDA 2HA6A 4IHAA 4ZXFA 3WL5A 4KE9A 3O95A 2HA4A 1ETHA 4BDTA 2QVBA 3R40A 4G4GA 1L7RA 1CLEA 3PFBA 4AQDA 2RGUA 1YR2A 2OAEA 1MX1A 4X93A 2UZ0A 1VXRA 1NX9A 1EB9A 1A8SA 5FDFA 3TGLA 4CFSA 1XZEA 2GYUA 4KAAA 4Y2QA 5HKAA 4Q3KA 2WSLA 1XZHA 3P2MA 4G5XA 3IURA 1J07A 4EY5A 5LZ7A 1U4NA 3FLEA 4MEAA 3I6ZA 5JADA 1H23A 1G66A 5DWDA 3FSGD 5HK8A 2PUHA 1SCKA 3JW8A 2QT9A 1XQYA 4WCVA 3I6YA 2WTNA 5AKZA 1DTEA 3DCNA 1CFJA 1QO7A 5ISMA 2YH2A 4FNMA 5CT6A 5C7YA 1CUEA 1AQLA 1UOPA 4BC1A 1C4XA 3Q8WA 5AKYA 4FLEA 1R50A 1YA8A 4BYMA 3C8DA 2R11A 4Y7DA 1CPYA 4EY8A 1VLQA 3WK6A 5JZBA 2J4FA 1FFCA 2BAGA 4GECA 4I4CA 3D3NA 4HRYA 3I6MA 5ALXA 3D0KA 3ZWQA 1RWQA 4K5QA 4DNOA 4H7HA 3G9XA 5ALQA 4AMZA 4C6HA 2Z3ZA 1AC5A 1TCCA 3G7NA 1EX9A 5LZ8A 3ZPXA 1EB8A 4LHEA 3QBJA 4I19A 1K4YA 4RE5A 2H9YA 4E11A 1VA4A 4DNPA 2DSNA 5HQ3B 5AP9A 1M33A 2W22A 2XMCA 2CMFA 3H18A 3WK4A 1XFDA 4ETWA 5EIAA 2FJ0A 2PBLA 3FAKA 2QRUA 3FBWA 1XZBA 4GI1A 1Q83A 1PV1A 2O2HA 3SK0A 4BP8A 3OG9A 1KU0A 4ZI5A 2PSJA 3I2IA 3ESCA 2XI4A 1UFOA 5JATA 2WFLB 5CW2A 5T4HA 4HXGA 1IZ7A 4DMHA 4DNQA 1CQWA 4W1SA 3I2KA 3M83A 1WHTA 1QIDA 3WKCA 2DR0A 3FYUC 3FNBA 5AK4A 4PSDA 1EHYA 5A2GA 5LZ9A 4JEIA 3DOIA 5AKJA 3G9UA 4CCYB 5HQ3A 4G1FA 1X2BA 4U2FA 3G0GA 3QPDA 2XT0A 2WHRA 4EY7A 4YPVA 1ZI8A 3I2JA 3GBSA 3PDCA 5CT5A 2DHCA 3O4HA 2G5TA 3O4GA 1CUUA 5BV7A 5J3JA 1CUXA 3C8HA 5AIBA 3K2IA 1CIJA 5CH3A 5C81A 1K6EA 4ZV7A 3R0VA 3LP5A 4XX1A 1J1IA 4F60A 2HA0A 3EBLA 2QJWA 2WFLA 2C58A 4A23A 4EY4A 2RI6A 1XRPA 1XZJA 2FUKA 4H7DA 5ALPA 3QYJA 3DQZA 4PSUA 2CKMA 1JI3A 4TVKA 3STYA 2VTVA 2JGEA 4CCYA 4EA6A 4WFKA 2HFKA 2I78A 4OSEA 1ORVA 1WB4A 2WG1A 1AURA 1XQVA 3WYDA 2XMSA 1XZDA 1HBJA 4B6GA 2RHWA 2AJCA 1AUOA 2FJPA 4BCCA 1FSSA 4H7EA 3L1HA 4B0OA 3TJMA 4F21A 2WTMA 4UBMA 3D2AA 4CIBA 1DWQA 1ZD3A 3AIMA 3STVA 1ODTC 4BE4A 1CUJA 4DMCA 3A2LA 4UBKA 2DCMA 5HFAA 2H1IA 1CUVA 5JYCA 3GROA 1UK6A 1PFQA 3JWEA 5EHNA 4FNGA 2O2IA 1AX9A 4UBNA 1SFRA 1GPKA 1EA5A 3ZI7A 1J06A 5ALMA 3PF9A 1IUPA 4Y2TA 2PX6A 2PU5A 1YB6A 4RGYA 5ALZA 4BDSA 3W9BA 3WWPA 4LKOA 2VJCA 4CI9A 2XMBA 4K2AA 5AM0A 3W2TA 4UBLA 3KXPA 3BJMA 4YK7A 4GXNA 5CURA 4UHCA 3PICA 3WIBA 3QMWA 2PKYX 5K5EA 1ZI6A 3PE6A 2HA3A 2OQVA 4W1PA 3IIIA 5DYTA 3F96A 5BOVA 4CIAA 2QM0A 2XUAA 5AM1A 1QIJA 4AN0A 2BGRA 1WM1A 2B61A 4IH9A 5DNWA 1GQRA 4FLMA 4IO0A 3AINA 1HLGA 3D4LA 1T4MA 4P9NA 3IB3A 3DYIA 2OGSA 1LPMA 3H2HA 2ZYRA 2OQIA 4X6YA 4BRZA 1GKLA 4AO8A 5EHXA 5ALTA 1F0PA 4X7BA 1YAHA 3C43A 3QM1A 3AJAA 4Z49A 5I9IA 4P08A 1WB5A 3IVMA 5AOBA 5KWIA 3L1JA 3VKFA 2XQIA 5D6OA 4C01A 4U2GA 1XKTA 2XUQA 4B7ZA 2VQ6A 2ZSIA 2BCEA 5FKJA 5LIPA 1HL7A 2D0DA 5ALOA 4DSAA 2PU7A 4BVKA 4QLAA 5E2IA 4LXIA 3HEAA 3WKEA 4HTAA 4L72A 3I1YA 4E46A 1QTRA 3DOHA 5CRIA 2ONCA 2JGKA 3R3UA 5JARA 2WIJA 1F8UA 4QDZA 3EQ9A 3ANSA 3HYSA 4WFJA 2XMZA 1X70A 3C87A 1ZJ4A 5ALHA 4QEKA 4F5ZA 3NGMA 3RM3A 3VJKA 5KWJA 4BZWA 4B83A 2XDWA 3OTQA 3BXPA 3WKDA 4NVRA 5AKHA 2VAXA 3ZLVA 1XLUA 3HZOA 2XQFA 1HKHA 2Z8ZA 4BB0A 5HCUA 1FJ2A 4J0IA 3OOSA 2X8BA 2V97A 3EQ7A 4B80A 2VA9A 3PF8A 4LXHA 1MAHA 4JNCA 1ZD5A 1BROA 2PUJA 3EF3A 4O08A 4D9JA 3C6YA 3WKAA 4E14A 3PI6A 5A7FA 4Y2JA 1UOOA 4J03A 1R9MA 1GKKA 1C7IA 4XVCA 3FLAA 2ECFA 1R1DA 3BJRA 4EHBA 2AJDA 2CJPA 3YASA 2C0PA 4Q3LA 2XUGA 4KACA 3V48A 5KREA 2GYVA 4V2IA 2DHEA 4TPKA 5HF5A 5T4BA 1XRNA 3WA6A 2WU4A 5AKGA 1XRLA 5DNUA 4JH0A 2J4CA 2BKLA 3WI7A 4X85A 4AX4A 2GBGA 4AMYA 1KU6A 3G0CA 1WHSA 2CZQA 5FP0A 2VF2A 3D7RA 4ZREA 3KOOA 3QMMA 1GZ7A 3WK8A 2C4HA 1P0IA 2B4KA 5ALJA 2HU5A 4UBJA 5AKKA 2ACKA 2WUEA 2XMRA 4QWWA 1Q0ZA 4WDRA 5FLKA 5KBYA 1LBTA 3RK4A 2ZJ6A 2OCGA 2WIKA 5SYNA 2Z5GA 3F8SA 4RPCA 1YA4A 1UK8A 5C8XA 5FUMA 4AZ3A 3DKRA 3JYHA 1YB7A 1CUFA 1ZI9A 2HA2A 4MJ3A 4DLNA 4DYHA 3SX4A 4BP9A 3I1IA 5HF6A 4UBIA 1DQZA 4M0FA 2ZSHA 5LKRA 2O7RA 4WJLA 4FMPA 1WPXA 4X71A 3CCBA 3DS8A 3G0IA 2WHPA 4MQMA 2VEOA 4L9AA 1P0PA 4EZIA 4QA9A 2JGFA 4U2CA 1JU4A 2XUJA 2I3ZA 3WK5A 2ES4A 3ZV7A 4BCDA 2BJHA 5FPQA 3O4IA 3BDVA 3R3VA 4W1QA 4J7AA 1EH5A 3A2NA 5DYWA 1ORWA 2I3DA 2OG1A 3AUKA 5HF9A 1UOQA 3NUZA 5FV4A 4OD0A 2G5PA 1YCDA 4MEBA 4EUSA 5AM2A 2HU8A 5CT9A 3F97A 3WL6A 4N8SA 3BF8A 3H0CA 3FOBA 2JEZA 4XWGA 3FYUB 2OGZA 4UHFA 3K9BA 2ACEA 2VSQA 4G9GA 1R9NA 3QH4A 1BN7A 4BBZA 5IKXA 4G8CA 1ZOIA 5EFZA 4PSCA 3FLBA 3I2HA 5DTJA 1CQZA 2P8SA 4P93A 2XLBA 3AIOA 3MGAA 2XMDA 5K3BA 3ICWA 2HA5A 3R3WA 4Q82A 2Y6UA 1CUWA 1JJIA 1GGVA 1EDEA 2GZSA 4QDXA 1CUIA 3T52A 3HLKA 3A2MA 1ZGCA 1JKMA 2C5FA 5T4FA 5K3DA 5ALUA 2BUBA 4MXDA 1QZ3A 5FRDA 4BZZA 5A7HA 4FFWA 1VXOA 3FYUA 1DWOA 4G4JA 4UFOA 4WFIA 2OGTA 3AFIA 5A7GA 2AJ8A 1CUAA 5EI5A 3F98A 2PSDA 4YASA 1GQSA 4C88A 1R88A 1UZAA 3M81A 5JD4A 2AJLI 4BC0A 4KEAA 3WIOA 4BAGA 2G4LA 5ALYA 1W1IA 2YXPX 2DFPA 2LIPA 4BE9A 2PL5A 1G42A 3ESDA 1KEZA 1T2NA 1JJFA 5ALIA 1XZGA 3MVEA 4UPDA 5ALEA 1MNAA 4J0HA 1DINA 3WWOA 1MO2A 2BGNA 2DQZA 3STUA 3HXKA 1Y7HA 2CEKA 4B82A 5JAUA 1YAJA 2WKWA 3DLTA 4QWMA 2OPHA 1FFEA 1THGA 1LNSA 3VVLA 4MYDA 1YASA 5D3ZA 3BE8A 3TRDA 1MX9A 3DD5A 4QDOA 2R8BA 1O6GA 1LPNA 4Y2UA 2HDWA 2RHTA 1TRHA 2J3QA 1MNQA 1MTZA 3NWOA 5ALDA 2AXEA 5AK5A 1UKBA 4ZGBA 5CH8A 3KD2A 4OYLA 3G0BA 3STTA 3W06A 2VJBA 3ESAA 2J3DA 2GBFA 1QO9A 5HF8A 4TGLA 4CG1A 5D3KA 5AOAA 4X94A 4AO6A 3UMJA 5ALKA 2HRRA 4NMWA 1C7JA 3G9ZA 2C7BA 2PSFA 1CUDA 1W52X 4S0XA 1XZMA 1YS1X 4JYPA 3OPMA 4INZA 4Q3OA 3W9UA 2EEPA 1F0NA 1NU6A 4GLBA 1W6RA 1BN6A 4DNFA 1FFAA 4OB8A 4MWTA 5CTAA 2HL6A 4UFNA 3D5EA 1BEZA 5AI6A 3BWXA 2ZJFA 5CBKA 4YX9A 1XRQA 3C6XA 3C45A 4X91A 4AB1A 2WFZA 4KAJA 3V1MA 2OCLA 4FBMA 3H2GA 4IQ4A 3DNMA 1E5TA 3H2KA 1P0MA 1ZD4A 3G8YA 3AIKA 3C6BA 4Q05A 2FX5A 3QMVA 1H2XA 3GUUA 5CXXA 1MT3A 3F9CA 5AKEA 1E8NA 1GPLA 4UHBA 3H1BA 4M0MA 4WDQA 1Y7IA 1VJ5A 1THTA 2XB6A 5JD5A 1CUSA 4ARBA 3F67A 3S8YA 1A8QA 1S8OA 1DQYA 2XUOA 4KE6A 2B9VA 1Z68A 4ARAA 4QNNA 1EDBA 1H2WA 4FBLA 2ORYA 3B3QA 3PUHA 4IH4A 1CEXA 2HFJA 4EB0A 4FDMA 2WFMA 1ACJA 2GBCA 4W63A 2DQYA 3BF7A 2WU3A 4B9EA 1JU3A 4J3JA 5A71A 2XQKA 1LBSA 2QR5A 4QDTA 3C5WP 3O4JA 5BWBA 2HU7A 4PW0A 1BS9A 5F4ZA 2OCKA 3QZUA 5JALA 3K6KA 2Y1KA 3I2FA 3G9TA 5HKBA 4ROTA 3CXUA 1HQDA 1QIHA 3PFCA 1QOZA 4B85A 1MJ5A 4H7JA 2XQJA 1FFDA 4EY6A 1Q0RA 3GELA 1CUBA 1H2YA 2PSEA 2OCIA 3V9AA 4FHZA 4K6HA 4RE6A 4N8EA 5ALWA 3A70A 1Q84A 2PVSA 5AI0A 5ALFA 1XLVA 1NU8A 3IUNA 3R3XA 1K63A 4PF1A 1QIFA 1UKCA 5ALGA 3G0DA 1MPXA 3I28A 4DM7A 4QZVA 1ODCA 2QOEA 3H17A 1R3DA 4FLFA 1SCIA 1W4LA 2WIGA 5A6VA 3Q0TA 3BIWA 5AIAA 3WMRA 5E4TA 3KSRA 1XRRA 4CCWA 2V9ZA 3CCCA 2XLCA 2OAGA 5K3FB 5CXUA 2V98A 1ODSA 3DYVA 3VJMA 2X5XA 2JF0A 1JMYA 5K3CA 3R3ZA 3R41A 4GWLA 3WL7A 3WJ2A 1BE0A 2K2QB 2CBGA 2DHDA 1EVEA 1LLFA 1XZKA 2JGLA 4K6KA 1GPNA 1ZJ5A 1SCQA 5DJ5A 5AHXA 5ESRA 5LZ4A 2PSHA 2D5LA 3C5VA 4PNZA 1H2ZA 1TCBA 5CT4A 4XJVA 5FOQA 2QXTA 1SOMA 1IVYA 5JIBA 2CB9A 2QUAA 4G9EA 6YASA 1GXSA 5AJHA 1BCRA 1QIEA 4OYYA 1WB6A 3E4DA 1P0QA 5LLSA 4U2DA 4Y2XA 2B20A 1ZIYA 4H7FA 1MN6A 3ESBA 5K3FA 1AMNA 2WUDA 4ZWNA 5HZGA 5AK3A 5JZSA 1RYYA 2HA7A 3C70A 5JASA 4WY5A 4J0JA 1GT6A 3ED1A 1USWA 5CH5A 3B12A 4FFVA 4X6XA 4H18A 3L1IA 4G4IA 2WHPB 1ZIXA 2EDAA 1L7QA 1HPLA 1N8SA 1IZ8A 2C0QA 2Y2VA 2Z3WA 3QPAA 1VA5A 4BCBA 1U2EA 3ICVA 4KRYA 1DU4A 5ALVA 5JD6A 1EXWA 4X3CA 1QONA 4H35A 4X6UA 4PQEA 2QS9A 3IUJA 4EBBA 2ZYHA 3EQ8A 4HAIA 5AH0A 1YSCA 4Q34A 2XUKA 1E89A 2HRQA 3VISA 1N5RA 1QIGA 2O7VA 3MUOA 2ZYIA 3LLCA 5AKXA 3CN9A 4Y2SA 2VT6A 5AKIA 1BEEA 1A7UA 4QLOA 2XMQA 1E66A 5C8VA 4CG2A 1X2EA 1PJAA 4JUIA 5AK6A 5YASA 4GW3A 3WQHA 3H1AA 4W9RA 4G8DA 3IUMA 3QPCA 1LPBB 1CUHA 1UK9A 5EHQA 3H19A 3UUEA 2JGJA 4KR0A 5FXMA 4HS9A 3I2GA 4GDMA 2V96A 5HFNA 3KDAA 5H3HA 2ZYSA 2H7CA 4IH1A 1XROA 3G02A 4J0KA 3EIOA 3WKBA 1EK2A 5JZ9A 4HVTA 5JAOA 1TCAA 4K6GA 1N1MA 1CRLA 2OXEA 4X95A 5AI5A 4ZV9A 5K3EA 1SC9A 2EDCA 1UT6A 2WG2A 5LKAA 3WWCA 4LIPD 4OU5A 3O0DA 2O2GA 2QMQA 5D7BA 4KJXA 4W1RA 3RLIA 1DWPA 1EK1A 4I3FA 1QGED 2GBIA 2HM7A 1WPRA 4MYSA 5AI4A 3C6ZA 3KWJA 3O9VA 4GHWA 3AZQA 3LS2A 1L7AA 1E3QA 2IIVA 4BATA 4CG3A 1G5FA 1VOTA 4Y2RA 1BCSA 4Y2PA 1I6WA 5C8ZA 1QJ4A 1QIKA 3ILSA 1CV2A 4L3WA 4LYDA 1QTIA 4UHEA 5ALNA 1JFRA 2XQGA 1LZLA 1TQHA
chains in the Genus database with same CATH superfamily
1G59A 4B84A 3LUKA 1PAUA 3V97A 4ZDWA 4ZVPA 4DLKA 1BDBA 1ZBDA 3EDOA 2ANBA 2Y1EA 4CT5A 4EG6A 1NYTA 4WMLA 2W98A 4AY3A 2JJ8A 3L6UA 1KEUA 4U3JA 1BXGA 1MA3A 1IOZA 3AY0A 5FL7A 3LPMA 1WXQA 3X1DA 3PXXA 5E0KB 3RKSA 3Q72A 1L5LA 3TH5A 3O9MA 3GC6A 4NZNA 1NKSA 4U2BA 3D8SA 2R1VB 1DAGA 2QLNA 4IINA 3E7XA 2V6MA 3U48A 2G8NA 2VA8A 1AKNA 3KVVA 3SSNA 3IYLW 1RM3A 3WOVA 2VF8A 3LK7A 4PC3A 3UJ7A 1MX5A 4HEA1 4L51A 4FX2A 1SEVA 1U11A 1I2DA 2WK1A 3M33A 1MDBA 1JBEA 1PZNA 3IPXA 4N7BA 4P80A 4PGMA 5G3YA 1Q77A 5IDXA 5KVSA 1JP7A 3GJ3A 1OZHA 4GM4A 1I80A 3HYNA 3W2FA 2JAXA 2QTRA 4BNXA 4J0DA 4V3CA 3USES 4XQGA 5BWCA 1G4HA 1KMMA 1N6LA 1VKHA 3DAPA 4R1OA 4Y9SA 1E9BA 5FUBA 3PFWO 3OP4A 1CUGA 5JVDF 2PX8A 1E79D 4K9SA 3CXRA 4E6PA 2OBXA 1MAAA 3EIFA 2GCNA 2VCEA 3W5VA 1CS0B 4RPHA 1GTVA 1CD5A 1X14A 1Z29A 3LC7O 5JNVA 5MN6A 5K0EA 3OQNA 1ZU4A 4DLLA 1JLHA 1YKFA 2MYPA 3JCZA 4Q39A 4WKPA 1YFJA 2WNSA 2AN3A 1T6ZA 1P2DA 2JFGA 2LGJA 2RONA 3GJTA 1SQ5A 4HEJA 3QA3E 4JP5A 4JT2A 3SBEA 1RD4A 3CW2A 4R9RA 2GH1A 2VAPA 2VT7A 3DV9A 4N3AA 1XCPA 3K6RA 1VE3A 2NU7B 3MJFA 1BMQA 4GPAA 4X9XA 1VE6A 2PKCA 4P3KA 3RAGA 1CRWG 1ZM7A 1Q15A 1EI9A 3OWOA 1CB7A 4O5OA 1T1JA 4GU5A 4CL8A 3GVPA 1SPXA 1D5WA 3NIFB 4DA6A 2F43B 3BEDA 4H77A 4J76A 4A5SA 1XTPA 3LSTA 4X90A 1DAHA 5EJIA 3ZIAA 3ZHYA 1HLPA 1Z34A 2X4GA 3N5CA 2NGRA 5CYFA 4A2QA 2W7TA 3PI7A 3ZS9A 1QP7A 2CUTA 3T9BA 3TB4A 4MW7A 3USZA 1SK9A 1XRMA 2W43A 3JARB 1T9GR 4LYAA 4N5MA 1VJTA 1FDOA 5ESWA 3WTBA 4DUYB 1L6RA 3HC7A 3E1SA 1BG6A 2IY7A 4DDMA 1GEEA 2OO5A 1ZK3A 2NW6A 3S27A 3U2QA 3EVBA 2QY9A 1NAHA 4Y2YA 2K2WA 2PRIA 1K8RA 2X76A 5BVHB 1M1UA 1CUZA 4XDGA 4GPD1 5KZMB 2PKEA 4A6DA 3DBOB 1CS0A 3ACDA 3IDOA 4J2TA 1N7GA 4MUBA 2OEPA 1M83A 3PEEA 1MU0A 3GZJA 3M0EA 3MFYA 4X92A 4J3FA 3WQRA 1W87A 3QNUA 3HB0A 2UYCA 4FYPA 1NURA 4LJKA 2BRUA 2B7BA 3K9CA 3KXDA 3X1JA 4PV7A 2ASVA 3IP1A 1MOPA 2PMBA 2QY6A 3JD0A 4AIRA 2WYOA 4TMTA 2ANCA 3HR7A 2FWRA 4QFMA 4TVBA 4OJYA 2UVQA 3SP1A 4DEYA 2NU7A 5JW6A 4DKXA 1XPOA 3BILA 4C4RA 3EK2A 1LX6A 5JMTA 3DNPA 1Z12A 4GBED 5DBHX 2FEOA 1EFLA 2DU8A 4MCAA 4X1KB 2F90A 2JFFA 4XD7A 5JAPA 2F43A 3LU1A 1IHOA 4JQSA 1XLTC 1LV7A 4TMYA 3H2ZA 2AUTA 1BJKA 1QLJA 2W6OA 1EP2B 4DDTA 3MBIA 3ECSA 4YPOA 5LLTA 4TMVA 1W5BA 1IIBA 1U1IA 2VNKA 3Q5DA 1T9HA 3IFSA 3HFSA 3V1KA 3R0QA 3JARA 4AZTA 4AG6A 2K6GA 5B3LA 2DPXA 1OWOA 2MSCB 5CM8B 4XSGA 4PLPA 4Z51A 1LTQA 4R1PA 4PN7A 1FQOA 1M76A 4D56A 5KNBH 1E69A 2EBFX 4DMFA 2J5BA 3E1GA 2Q9CA 4Q5IA 1QIIA 2RIPA 5K0NA 1VZ3A 2WJ6A 3L4EA 3A3NA 2H7YA 3FOAA 2EKLA 4G65A 1QCZA 4IX1A 1KO7A 1KI8A 1N1GA 4LC1A 2EFHB 4OU4A 1WP4A 1DE0A 1Y3FE 3BUSA 2YV3A 4MRVA 3HP4A 1JJAA 4RZIA 5BVHA 1JILA 2JJMA 2IUYA 3IKLA 2GAFA 4I1PA 3U7JA 1UF9A 2JASA 2FN3A 2J7PD 4IFIA 1L3BA 1W1WA 4M1SA 2PXCA 2X13A 1O0CA 1K6XA 1HNZB 3I6BA 3C98A 1WD7A 3EZ9A 5EXTA 2AA3A 4DQVA 4POAA 1FNNA 2NWQA 4BB5A 4D6YA 2PJRA 4OMDA 3DCJA 4OQEA 3GLQA 3H8SA 2JW5A 4QNMA 1TYDE 3B2EA 4QYWA 2WUFA 2ZI9A 4XB1A 1R9GA 3L8CA 2PGIA 1X7XB 3M1YA 1GR1A 1U8YA 4IRUB 1YF3A 4M0EA 2C1EA 5J2UB 3RS3A 3UG7A 4DMKA 3L4JA 2PEYA 3ND6A 2RARA 3HSSA 3GJ4A 3OEHD 4DY6A 1I2BA 4FYVA 4DC0A 3OWXA 4YCNA 4X1KA 4GZ3A 2JBWA 3IAS1 3I8SA 3QKRB 4Q9LA 3TZBA 4D6PA 3UKDA 1R4NA 3CLTD 5I7RA 2CXPA 2CMDA 1U98A 4FDVA 1OC4A 1SCAA 2WLSA 2C29D 4PS1A 4BO1A 4HD8A 1JT2A 5HBRA 4ARSA 3DM5A 4HDOB 2O5CA 1QG4A 4R5HA 1LPAB 1Q0SA 3N0TA 3Q0EA 3NT5A 5B1HA 3TB6A 1KO1A 1M34E 3LQKA 4KP7A 1R64A 1XTRA 2OBNA 3EMVA 4NE7A 5AVJA 4O4IF 4YLGA 2HSJA 1XTKA 3OA0A 4BIMA 2FW7A 5IVDA 4C89A 4KIJA 2GD6A 1CR1A 2GILA 1PK8A 2GO1A 2OCPA 2J31A 2R5NA 2SKEA 2V0GA 1YJ8A 4XYGA 1EDDA 1IBSA 4LV5B 5LJLA 3UK7A 2BHRA 4KYTA 2FN9A 1YC5A 3FVQA 3BDAA 2JD0A 4BEVA 1TMOA 4ZIRA 5CM2Z 1GCAA 2WIFA 4ZKDA 1LK7A 2O3SA 4TLCA 1C3OA 3IJ5A 3O82A 4TXHA 3DAOA 3KFXA 4DSZA 1NBIA 1Q0LA 1EEXB 3WA7A 4Z3DA 3IE1A 3JYQA 2V03A 4TTAA 3SKYA 2OFOA 3E84A 1BFDA 2QD2A 2ZUUA 3MYYA 1MABB 5I7UA 4KB5A 4L6CA 1CTQA 2O5EA 4HNAB 5A03A 5FOSA 3D0RA 4OJNA 3U0BA 2GFQA 4TMZA 4AJ9A 3UKJA 1GNQA 3JYNA 5B30A 5E1OA 2O2CA 3KSUA 4UTOA 3LD9A 4S2UA 4YP5A 1X7XA 4N9QA 5J2UA 2HK7A 2I8CA 1E9AA 2XH8A 2Q28A 5ED0A 1NVEA 2XZTA 4R98A 1E9DA 1RVDA 1PWYE 5CIWA 3VPAA 4Y9DA 5G0SA 5FJJA 2HWKA 3OKAA 4F3TA 1EA7A 2C7VA 4K1LA 4UM9D 2B9EA 2VK1A 2R5FA 3RSZA 1A7AA 1C7FA 1F12A 1SAYA 4YMIA 4FKMA 3TZHA 4G0WA 2CW5A 2HCTA 2VP2A 1S2LA 3BXFA 3OPYB 3QKUA 1G55A 2XA2A 5KB3A 1IBCA 4II7A 4R9UC 2YASA 4FEAA 4HDRB 1XLWA 2WICA 4NWIA 2M1XA 3DDSA 4BMCA 1MR3F 3W9SA 1TGVA 2YY7A 4GE0A 2AV6A 3LNTA 3UGQA 4PY2A 5F1PA 3WB0A 4DWOA 6NULA 2VP4A 4V1CA 1JVSA 1EVLA 1U9IA 2VJDA 4YO7A 2IOHA 3KL4A 1C2YA 3G3EA 2FGKA 2VP3A 4DSUA 3CLRC 1KVRA 1QQTA 2ONZA 2VSYA 3G2NA 4RHTA 4TKUB 3THWA 1WDTA 3ETLA 4YVFA 5E4YA 4P0QB 2RFLA 5CT8A 3VR2D 4BAUA 1DJMA 4JYBA 2QDXA 1RAIA 2HBZA 2Q2QA 3KTAB 2NO4A 1NQXA 2Z30A 1MABA 4TSFA 3KALA 4DM4A 1L5KA 1QF6A 5LQUA 2JLBA 4HNAA 5JNTA 4QTUB 3R44A 3QEAZ 4FGUA 3K0KA 2J9RA 1ZCBA 2V6GA 3L6RA 1MDFA 4HYQA 5CFMA 1ID8A 2PGDA 1I7SB 1FW6A 4TS9A 1XJ5A 3U4DA 4L6AA 4E0BA 2XSZA 3PDJA 1NZFA 3IA7A 3C5HA 4YAJA 2FFAA 3WAJA 1TYEB 2GT1A 5MDHA 3WLFA 2BFNA 2FH5B 1O6FA 1MB2A 2GQ0A 2IOQA 3A04A 3OZRA 3Q15C 4NBTA 5SZKB 1NT2A 3ZWKA 3ICQB 3IOMA 3IE2A 5KSZA 4QXQA 4JVLA 3K0CA 4FOLA 5C18A 4MCJA 1Z4LA 2BUAA 4YR7A 4KQ2A 3Q1KA 4KQWA 5E3JA 4K9MA 3MCVA 3OPYA 3HPRA 5AJVB 3WL8A 1XZAA 1CDEA 3FSGA 2Q0XA 4RVGA 2OMEA 2GD1O 3D2CA 4HDRA 1HNWB 1T5HX 2GF9A 2VWGA 4QKQA 4HMQA 3UJ6A 3WBBA 3WLKX 3PGVA 4DLSA 1BQ3A 3BMNB 3D3EA 3WISA 4UUOA 4AMGA 3NKLA 1Z13A 4MYUA 4R54A 1AN9A 4DIUA 4XI9A 3SZLA 3PC2A 5FUXA 5EE9A 4EHIA 4Z4IA 4WLNA 3I04A 1PQYA 3V9PA 5JS7A 1XDZA 2BBWA 2GTHA 4TKUA 3OQJA 3ZV6A 4XRGA 1TK3A 4LE1A 5JOQA 2PS9A 3DEAA 4RSHA 4Y30A 1JPJA 5LNK6 3WOHA 1JBQA 3PPIA 4L4SA 3QE9Y 4F4IA 3WADA 3TLYA 3KTAA 2GZHA 1W2GA 4KFTA 4C2BA 1ZRHA 3FPSA 4N3CA 4K6MA 4B31A 5LL6P 1N5OX 1N2CB 1Y5MA 4J9UE 5DP1A 5ELMA 4UFPA 4R8MA 2REBA 2Q4EA 3BIXA 3KHSA 1H9BA 4GOKA 2V5UA 1P9NA 2OQRA 2PNJA 1E2JA 1PJBA 3U26A 3X0DA 4H7IA 3U6KA 2WSBA 2PZKA 1VLJA 3I9NA 4XD2A 5F12A 3VX4A 1E2IA 2QRPA 4BLOA 3EMDA 4O2AA 4LXGA 1O57A 3K3PA 1TJPB 4LZLA 4E15A 4EUFA 1IMJA 4FE3A 4MUEA 4MWZA 3BFKA 3CVYA 1LGYA 5J4YA 1BU8A 1M6EX 3PNSA 3U5TA 4ZYUA 1FMLA 2X0KA 2EFJA 1D4ZA 2O0JA 2WAXA 1CT9A 1OSNA 2YFHA 4HQRA 2JEYA 3DB1A 2FX3A 3ZHUA 2AUNA 5M3BA 2YJ6A 5AKLA 1Y1TA 4ND6A 4PYLA 1VLHA 1ZR4A 1IIRA 3Q6MA 3BMNA 1OXBB 3B3FA 5F5LA 3KNZA 1A50B 3CPSA 3NYRA 1AA9A 4OP3A 3C3PA 2NYRA 3P5BA 5I7AA 5CFPA 5DF1A 4E1AA 2RGCA 1SUIA 2HJRA 4Q7MB 1XZLA 1DX6A 3FDXA 3FYHA 4C2AA 2O8DB 1VPVA 3GA7A 4KQGA 3THXA 1STOA 2XYQA 3JD2A 2HHAA 1T29A 2D4AA 1N9GB 5E4JA 3ZJ5A 2ZJBA 5C4MA 4RMNA 3FCYA 3IIEA 4NP6A 4B9AA 5KJFA 1J8DA 3FNRA 2V7WA 1Q11A 1L4GA 3AEUB 4CMIB 3U0VA 2DEUA 1TM7E 4E22A 1I4TD 1KZHA 4KSBA 1F4PA 2BE7A 2XMGA 2Q5EA 4RAQA 4YRLA 3VI3B 4BMPB 1A5SB 2XT9A 4KE7A 1FTQA 2FR0A 5MN4A 4FU0A 3UV6A 3PGJA 3TD2A 2GZRA 2XUFA 3ABOB 3BZWA 4DC1A 1EXVA 3OMXA 1AUQA 4FEEA 4OCZA 3ER6A 3VKGA 4OGLA 4QTTB 5H8WA 3RC8A 3UCEA 3ZV3A 3BFXA 2ZROA 2QU7A 3PNBA 1RJDA 4EIWA 4RTNA 4GP7A 1NYLA 1G7CA 4OQLA 2RHGB 4OJMX 4DEXA 1MQ9A 5L3QA 3BD9A 2C96A 1BMFA 4G0VA 4XGRA 4RVOA 1YB1A 3H5AA 3MSXA 3RT1A 3BGIA 3AY3A 1PQWA 1FEZA 1YI0A 2H00A 2EBUA 2PHZA 4HAYA 4IJQA 4YGXB 5EZ6B 5ARDA 1SG9A 3SHWA 2ZBUA 4WN3A 4CLEA 3GYGA 1JLKA 2FWNA 2EX4A 5JXWA 2C7QA 5CK4A 4IIXA 3ZQUA 3VV3A 2H7XA 1IK6A 6Q21A 1ZRMA 1EK6A 1FLNA 3JVIA 5EP4A 1OU4A 4RBNA 1M7BA 5IVIA 2OZVA 1T9BA 2QP4A 5T67A 2IXEA 4U6QA 4KNYA 3L0SA 1M7HA 1U5CA 2R7NA 4GPTA 5L3ZA 2QMUA 2DWOA 3T3EA 16PKA 3QGMA 4BFUA 2O8DA 3HGTA 4P32A 5EQFA 1UOEA 1AXEA 4JLJA 3GLGA 4B79A 1M1ZA 4JJFA 2VYVD 3P20A 2AN4A 1TUEA 1IN6A 2BW0A 2NO0A 4UVIA 4FONA 3AEUA 1WKVA 2FUEA 4CMIA 1FUUA 1T10A 4ZXFA 1NTRA 5CIYA 1ECBA 4K9LA 3CUSA 3DO8A 2GNOA 5UKDA 1XMVA 2QVBA 3IO3A 3V42A 3VPFA 1L7RA 3INRA 1K7XB 4KRGA 1KDZA 3UOGA 2ZR0A 2VDLB 3Q12A 3TMYA 4AQDA 1W8DA 4QRIA 3QLUC 4CR7A 3PXUA 5FQNA 2G1PA 2Q6OA 4LSMA 4X93A 1GPUA 2UZ0A 2G67A 4KVFA 1E7YA 2QRKA 1KNXA 3PPWA 3PNPA 4G1VA 3ZBQA 4EFDA 1Z5OA 5FDFA 2WHYA 3OCJA 3GAAA 3I01M 1J99A 4FHEA 5FUVA 1L5GB 4CFSA 3C3EA 4QBIA 3ONEA 3P97A 3ENVA 1IZ0A 2C84A 2X7JA 1EE9A 4Y2QA 2C2XA 2ORVA 2WP0A 2GJ4A 3P0IA 4WZ6A 5BQ3A 1D6SA 4B7CA 3QPWA 5KINB 4RJ2A 1Z38A 3NJ4A 3IEUA 4MJ7A 1JHAA 4B2PA 5HKAA 2QZSA 5KNDD 2QBYA 1SIWA 1PJZA 3EF0A 2V7QD 2HCBA 3HKCB 4ME6A 4HG2A 1RLIA 3AG5A 3GRZA 1N0VC 1RZRD 1L4EA 3P2MA 3BCRA 3HJCA 4D9KA 2NM0A 4DR1B 3VR5H 2F17A 3H8VA 1J07A 5HRUA 4QEDA 1IY2A 2WZBA 1U4NA 3C1TA 3LYUA 5E9WA 3HCBA 1ZJYA 3INTA 5EJ9A 3E3LA 4ZAWA 1THZA 3SHVA 4G41A 3HJFA 1FYWA 2Z98A 1AJEA 1UBKS 1A4RA 1H23A 1Q7EA 2Y71A 3N6XA 4N4AA 5I9TA 4BLVA 3QI7A 5DWDA 1Z45A 3B70A 3GJYA 1NVTA 1PS9A 4JA2A 4L9SA 2YY6A 4ENSA 4J2HA 1ZZEA 5A1TA 4AWAA 2PUHA 1SCKA 3EIQA 4KPYA 3ESRA 2PZJA 3DMHA 1G6OA 3FDFA 3OCWA 4UU1A 2WTNA 5AKZA 3WHPA 4E6EA 3DV0B 1DTEA 3ZVNA 3HO6A 4LW8A 2REQB 2W11A 5TRTA 3V8EA 1QO7A 3CH7A 1NVVQ 4I8DA 4YAWA 2B7CA 1N0UA 4O2AF 4RK4A 1VG9B 2YH2A 5CT6A 5NULA 2CWDA 3BD7A 3T7JA 5KTNA 1AQLA 2BLNA 3KFLA 5EOVA 4YXWD 5IN4A 1UQUA 3HPQA 4FLEA 4OHBA 3K0BA 1YA8A 3NEJA 3QA9A 3C8DA 2R11A 3H99A 1JSZA 4HO1X 1A9XB 2QPTA 4CM9D 1CJKC 2GPNA 3LT4A 3U09A 4EH1A 4G81A 2YXDA 3OP1A 1VLQA 1T2UA 4RTOA 1TF5A 2J4FA 1SXJC 4KQHA 1JMVA 2ZZNA 1UM8A 4KITB 3VGJA 1G3IA 2ONKA 3OKPA 4I4CA 3ADOA 4JNKA 1BFUA 2VIIA 4GMFA 4EA7A 5ADHA 1U0HC 3T3NA 4IDAA 3L8DA 2GSWA 1E96A 1W49A 2ODNA 4YH1A 4KO8A 1LCIA 1IQUA 2NYAA 5K03A 2JVKA 4KN8A 1K3FA 2NSLA 2YBDA 1DKUA 2YBEA 4QHYA 4RDIA 4RQAA 5IYZB 5LIRA 5T7BA 4RHEA 2BMVA 2YMPA 3LSYA 5J2TA 1L5RA 4DNOA 5ALQA 2FLKA 3RJTA 2EGUA 3ZQ6A 3GBVA 3U3RA 3RUIA 2Z3ZA 3G7NA 4EVRA 2PT9A 2NP7A 1XTIA 5CITA 2J33A 1GJRA 5IEJA 3OC6A 1IVSA 4UOQA 3VC7A 4W9NA 4ZYLA 2XVAA 4ZGWA 2XNHA 4I19A 1Y4SA 1D4OA 1NC3A 4GGPA 1U3VA 1L7XA 3N2LA 5CA1B 4DE5A 1YIOA 1SC3A 2WWXA 4UEWA 4JU9A 1V71A 1PZFA 4AJJA 4DV7B 3LP6A 4QULA 4I4TB 1WMSA 2DQ4A 4RE5A 1YUBA 3ZE6A 2H9YA 4JELA 2OESA 4FILA 3LGAA 4LV8B 2F55A 1JVBA 3NHLA 4LNAA 1VA4A 3IP8A 1OH5A 1AF7A 4Z4CA 4C78A 2AEFA 2ZT5A 1PJTA 3HKBB 1T15A 1O2DA 2BKEA 1M33A 1KGSA 2J67A 3AERB 2GR9A 2CL6X 1DQPA 5EGSA 3Q3EA 4B3FX 3HXTA 2PMEA 2GI4A 4EJSC 2C78A 1ZHOA 1A97A 2GBLC 3TM4A 3L43A 3WK4A 5ESXA 3UJ9A 5JNSA 2ZRJA 4MUMA 4QT4A 3K35A 1VPTA 1EBUA 3DEKA 2ZS8A 5MGBA 4DV2B 1E2PA 3HI6A 4M3NA 4CHTA 1WS6A 1PQUA 4MKRA 3SF0A 3HDGA 3Q98A 4BO3A 5LDHA 4Q12A 2Q62A 1K3UB 4FE7A 4BIIA 2F3RA 2WD7A 5GOZA 3Q3VA 4QU5A 3EASA 2IYPA 1Y1PA 3OCZA 4TRRA 1ZW6A 3DO6A 3L77A 2M2IA 1O95C 3DXFA 3WLPA 2VJQA 4TN5A 1SZPA 3NDPA 4ZYYA 5IYZA 4WCDA 3ZIUA 1PV1A 3IXQA 4HJRA 1W73A 2PJUA 2NZ2A 3RABA 2O3RA 3ESCA 3I2IA 2HX1A 1E1NA 1FUIA 3A1EA 4B4VA 1IUKA 5JATA 3N9IA 4X1OA 521PA 4GBMA 5T4HA 4TROA 3R20A 2R84A 1QGUB 4RH0A 3DOFA 4XR9A 4HAZA 5EE3A 3TTWA 5JH7B 5EJ6A 3PDUA 3AESB 2Q7DA 4DNQA 1FYDA 2PFKA 4KWTA 5CA1A 1GLVA 2DZDA 2HXSA 3KU4A 5AWFC 2WU0A 3GFRA 1Z4JA 2DR0A 3EULA 3FYUC 4LVNA 3E8XA 3OE5A 1JHDA 3OE7D 3D02A 4PSDA 3VKUA 2GZAA 5A2GA 2CUNA 1BIFA 2PL3A 2Q9BA 3H75A 3WRYA 1J7JA 5IANA 1SELA 3G9UA 3PB3A 1Q16A 3L7IA 2CBZA 3LPAA 2IKSA 5DHUA 4X24A 4DGSA 4ENUA 3HKBA 3K1YA 3AUTA 4Q7LA 3AERA 3HN6A 3LW7A 3EPHA 5IHXA 2ZTVA 4I1SA 1W5EA 2ET6A 3REFA 3ZY6A 1O58A 3IUBA 4D9HA 4F8JA 3ILYA 4BUJA 3O26A 5DBEX 3QPDA 5SZHB 1DQNA 5HE9A 3E48A 3FUWA 2GGSA 5DDIP 2H57A 2A0WA 3IJPA 3PU6A 3D6AA 4CTNA 1KS9A 2GTPA 3AETB 1FSGA 2P67A 3VZCA 4N6GA 3GBSA 1FYXA 5IJ0B 2BDTA 1I6MA 2CJYA 2ZITA 4FYKA 5CT5A 4JYCA 5HSGA 1PNRA 3O4HA 2A1TR 3K0SA 3VC3A 3CEMA 1NWCA 1CUUA 4NARA 1MORA 4R71A 1BYIA 3KELA 2G71A 3QVKA 1UR5A 4JVMA 3R0XA 4HGNA 5AIBA 1SOVA 2JIZA 1GITA 1DXQA 5L7YA 1K6EA 4ZV7A 3R0VA 4DKJA 1FS5A 1TZBA 1LW6E 2OO3A 3LP5A 1YVPA 4XX1A 5EJ2A 1J1IA 4F60A 2YZ2A 1XI2A 3EHEA 5C3UA 1IH8A 3FCUB 1CFZA 5LSAA 3WB1A 3DDCA 2Q4BA 3FLMA 1QGUA 5JH7A 2O2DA 3NHAA 1TLLA 4XCVA 3KQWA 4S35A 3AESA 4A23A 5JDIA 2VXBA 3OTOB 1H65A 5IAKA 3U31A 5JV5A 4JX8A 4IICA 4PSUA 5C8DA 3ZU6A 5ADWA 1W581 4IHJA 3LBIA 4LC0A 5LLDA 1H2HA 2V45A 5I5EA 2Z8YM 4WEQA 3TZEA 2BI4A 2JGEA 4P4TA 1R0BA 4TTRA 4BN4A 3UHJA 4F86A 2XTMA 1G0NA 2D8AA 1I5EA 2O8FA 3RVQA 2G5GX 1AGNA 1H6DA 4E33A 2AH5A 2YVAA 1SXHA 1KEPA 1YBMA 2IOFA 1NULA 2N0SA 3OE1A 4I1UA 2A5GA 3SX2A 2X5OA 3U4AA 2BEVA 1E98A 2B7LA 2JLRA 4BN5A 5LR6A 1HNNA 1XTTA 1I0IA 1A7JA 2H7VA 3GAMA 4Q1CA 5FTJA 1H93A 5EKTA 5E9QA 1ORRA 1PBNA 1WB4A 3I58A 3SZGA 3AETA 3OIGA 2WG1A 1JZSA 1NNUA 1QM5A 1JPNA 1T1IA 2HXYA 1AURA 3JQBC 4GE3A 4HUQA 3S2GA 4EI8A 3MUFA 1VLMA 3WYCA 4LJ9A 1GFZA 2AF4C 2P9QA 2RJNA 4JBGA 2AJCA 1QQAA 1HMYA 2WR8A 3DV2A 1SZJG 1H5QA 1G4AE 1IEXA 1YULA 4EA8A 3ZXUB 3QVTA 3IEVA 1XMSA 1JAHA 4W8OA 4D0RA 4YAFA 4XVUA 1NI5A 4R4JA 4IIGA 4IIDA 3CZ5A 5IT4A 5J2TF 1UP6A 1V35A 2ATVA 2J5RA 4C20A 4M38A 4A3SA 1KDYA 5DWQA 4ZEWA 1BDHA 3DL0A 1L8XA 1PKEA 4ZRMA 3TJMA 3FROA 5I7OA 1UEIA 4M0LA 2WTMA 1EFCA 1QF9A 4G09A 2JLWA 3CWCA 1MEOA 3VBEA 3AIMA 4D9FA 1YHNA 1KO4A 1SBTA 1WABA 3O03A 1EX7A 1ODTC 2HWXA 4YMGA 4HDQB 2OO7A 2C5BA 4JY7A 1JG6A 3EIEA 3U6BA 1H4QA 2BGLA 2QTTA 4II2A 4UBKA 2DCMA 4MMXB 4BVBA 3OZCA 5ARCA 1POXA 1CUVA 5JYCA 2HQOA 4CGYA 1GGMA 1XCBA 4P4SB 4DPKA 3IH5A 1SO8A 3QWIA 1FQKA 3QYAA 2JJ2D 2A78A 4WH0A 5AW5A 3ZDRA 5CG1A 3P0RA 2PIDA 4I3HA 1IG0A 1ZSVA 2V58A 3FZYA 3G6KA 3NIWA 4CI0B 4DR6B 1RAHA 1EA5A 2G28A 4J4TA 1N33B 1EVIA 1Q1ZA 3ESYA 2P6RA 2P0YA 3BJIC 5JR3A 4MQEB 3KXIA 4V0RA 4HWSA 3DWEX 1SKYB 3MJ4A 4PCUA 1H1TA 3R23A 5BSKA 3O8RA 4TQAA 1ZN9A 3CQ9A 3NYQA 4WERA 3PGKA 1HF3A 1M0WA 1E9EA 2C82A 2PU5A 1C4WA 1M6NA 2CNWD 2WHXA 4RGYA 3HEMA 1CJUC 1RKUA 3V3KA 3ENZA 3W9BA 2DR2A 4KWCA 4LKOA 1C0LA 4C0KA 4M36A 2W2VA 4LDAA 3HU1A 2XMBA 4Q66C 5IYZF 6PFKA 2JS7A 3ZZUA 3W2TA 3D6FA 3KK0A 1V9LA 4UBLA 4XR4A 4US2R 4O3FA 4G8JA 4YK7A 3B85A 3V8QA 4JLKA 1SKBA 3JR3A 3NALA 4RNDB 4UNSA 3RTDA 3BICA 1ZQ1A 1KDTA 2PRJA 4WE3A 3LK6A 5G4LA 1ONOA 2PKYX 5K5EA 3U44B 2FGJA 1YU9A 4DR2B 4HNTA 3JR7A 4OJTA 5CA1F 1KKUA 3GDHA 1UFQA 3PFIA 4W1PA 4OHPA 3SI7A 4AFNA 5LD2B 5GONB 3DXYA 3F96A 1XCLA 3L8GA 1CDZA 4B6FA 4CIAA 2Y67A 2XCTB 3EAQA 2Q1WA 3FOWA 4OM7A 4P4SA 2XUAA 1IPEA 5AW7A 3GRAA 4BFTA 1PDWA 1DEXA 2JPDA 2EFCB 1HQYE 4OXKA 4NKRA 4RTLA 1GZSA 2IT1A 3T7SA 4FLMA 3M34A 1JPUA 2PX3A 4HWPA 2I65A 1GTMA 1M8JA 4MQEA 2GVZC 2GFHA 1KK3A 2C7GA 4U5QA 1N2EA 3F3SA 1MOZA 3ZW9A 3DVLA 2F3QA 4DMLA 1IM2A 1WBBA 1H6BA 4G6ZA 1HQCA 1AK1A 3SY8A 1YDFA 2OV6A 1G8AA 1TKBA 4BRZA 1NQTA 3PIIA 4KQ1A 4U9IS 2IS4A 2DUJA 5HJ5A 5D1NA 1GKLA 1ZA2A 4G5OA 4ES6A 5FD8A 1QVZA 2J5QA 2PH3A 2RK4A 2X2EA 1JN0A 3JY6A 4JQCA 4Q00A 4X7BA 5B1IA 3M5WA 3ZOZA 4CYMA 4EFKA 1RXWA 1J23A 1V47A 3C43A 2XA9A 3HUFA 2H29A 3TI9A 4DLTA 3QM1A 2G0TA 4LJ4A 3O3OB 4Y8VA 1FFYA 1X87A 3FTQA 4LGYA 4YRFA 4Z49A 2EZUA 3KG2A 5I9IA 3PVCA 1R6UA 5BXQC 3H4MA 3DR5A 1FTNA 5JAIA 2FW9A 3IBFA 2E4VA 5H5JA 2Q5FA 4F2PA 3GX1A 2WWIA 3R0IA 1B2LA 1TL7C 1U28A 2I2XB 2WINI 2ZKLA 3AKEA 3JQAD 1USGA 2CXHA 5IDYA 4Z1MA 3ZX5A 1Q0HA 4QJ5A 4RXMA 5DLDA 4JC5A 3U44A 4ACAA 1ENYA 1NNLA 1JIXA 3G5UA 4RKYA 5A4IS 3VRHA 2C97A 2VDVE 5KWIA 1UFVA 3VKFA 1PR5A 5D6OA 2GCGA 5GONA 2B2CA 3A9VA 4UVDA 2RSLA 1N2BA 1AKTA 4IHJF 2XUQA 1PW7A 3GLKA 3QLTA 4R1LA 5HIMA 5I4BA 3PFFA 4M89A 1LDEA 1UZNA 1V95A 1JG1A 1OIWA 3KPVA 4P4GA 1CBUA 4FIZA 2EZTA 4B6SA 2BCEA 3EAGA 3K53A 3K6SB 1MJNA 4H16A 5FKJA 1ADFA 4DSAA 2HJVA 1Z5ZA 3DF9A 2JKZA 3G68A 3KJQA 4QLAA 1NXOA 3OJWA 2R8YA 2X5KO 5ECGC 3CR7A 1G3RA 4LXIA 1BWSA 4G9BA 3TBKA 1NW9B 2PD4A 2R6AA 5K8CA 4TTTS 2C00A 1V8BA 3FNQA 1VHJA 1YKSA 4AJPA 5CDSA 3KQOA 1TTTA 4E46A 4YRGA 3DOHA 2FETA 2JGDB 2PA3A 3PNMA 4U1RA 1JLLA 5CRIA 4B32A 2O2EA 2JCXA 4HCJA 1MOQA 3R3UA 4G5GA 5JARA 3AONB 4AY4A 3DBIA 1Z4KA 2DECA 2GPSA 3RPEA 5FLEX 1H5NA 2R79A 2FSSA 3PC7A 1ZD8A 4ZZ2A 4HFJA 1KR2A 3AJ8A 3PQ3A 4NPAA 1WB9A 2HDHA 4PLHA 1QMPA 2P9CA 4LWQA 3DEZA 1OJ7A 1GHTA 2C8KA 3C87A 3R6LA 3SR0A 4X63A 3JWHA 2AEEA 1YZKA 4C0WA 2O50A 4WVLA 5EYPB 5A3RA 3TQRA 1XXLA 5I7SA 1YONA 1JPVA 2DBVO 4L5IA 1W6UA 4BKPA 4F5ZA 4CETA 1CYDA 3VJKA 1NUQA 5KWJA 3MIIA 5KNDA 5ECWA 3HWX1 3WNBA 4HNHA 3L46A 3ZVRA 3HB9A 2X15A 4BNWA 5EP1A 4IKPA 4B83A 1SXQA 1OZAA 6REQB 5JXJA 2WLTA 3KAJA 1WU8A 4YHBA 4MWOA 5TY0A 1E1LA 2O1EA 1CEEA 3TW4A 3CZRA 4J1SA 1WXDA 2VAXA 3LDGA 4V0NA 1XLUA 1XTJA 4RD6A 5JO9A 3S81A 3PNOA 3HZOA 5KDOA 4QM7A 2X5NA 4QGHA 1RHQA 1TD9A 5A0VA 1IPHA 3ESQA 1NJGA 4O02B 3OX1A 1HYQA 1UJMA 2ZTUA 3CF0A 4FDUA 4R6XA 3K6SA 1Z63A 2VHYA 2O7QA 3R24A 2HWWA 5HCUA 1MMFB 1RAAA 1W0JA 2EL7A 1U9JA 3FMOB 1YDGA 5DLEA 3GO4A 1V1RB 1HM5A 4P7JA 2V97A 4B80A 1C0EA 4TKVB 4NV1A 1Y82A 3PF8A 1TVMA 2PCLA 1EBBA 3DW1X 2KSQA 2QX7A 1BHSA 2WYIA 3DUFB 4X7PA 5DTMA 4IIJB 2YWFA 1RYHA 2JGDA 4IFTA 3VR5D 2RGRA 4LFAB 3VZRA 1BROA 2B4TO 3QQPA 4DVJA 4PBSA 1UBSB 4XWOA 1G18A 3L79A 2PGAA 5BYJA 4IDOA 4B4DA 4AQ7A 2VLBA 1RC8A 2YZNA 1X7ZB 1DMRA 2CXTA 3OE4A 4Z6KA 4O08A 1ZM9A 4N40A 3PKZA 2VDWA 3WKAA 4AZVA 1CY2A 1GTJ1 3QJYA 4YJGB 3VO9A 1QP4A 2O6HA 3ABQB 3PI6A 4ZDKA 5ICSA 4ETMA 2BP7B 1S6YA 2XDQA 3RVJA 3ZDEA 2YUIA 2CEAA 2WUWE 3OY2A 5EYPA 3EX7C 4EYKA 2JIQA 4X61A 4EHFA 3U7EB 4F85A 1QG6A 3GLSA 3FHLA 5EKSA 5LB2A 1GKKA 3UWMA 1VCMA 2FB9A 3FLAA 3NHZA 4QX6A 3RSFA 4EFLA 4DV0B 4C2UA 3BJRA 6REQA 4HKTA 3T5BA 3HB7A 4R2JA 3YASA 1KH2A 4OP2A 2XA1A 3OOYA 1H4TA 2DHEA 2HMWA 1SBQA 3ISJA 4TPKA 5EKUA 1VTKA 5HF5A 3W2EA 4ZJUA 1LRJA 2O19A 3BX1A 4ZPJA 4C2TA 1XRLA 4HAUA 1W48A 2JJ1D 1DUIA 3WRXA 2BKLA 1YQTA 3LBFA 2EV9A 4A1FA 3H9CA 5BRJA 3ZHBA 1CZUA 2XV1A 3TMAA 4AVYA 2BMFA 4A8JC 4HQ0A 4P34A 1V1RA 4KLAA 4TKVA 5FP0A 1A77A 3W4JA 2PCJA 5HJ7A 4W5TA 3EG9B 4WHMA 1WW2A 3GT4A 4QOSA 5CX1B 2XGJA 1YBFA 3O5AA 2ICAA 1ZC4A 4M46A 4NE2A 3UUWA 1VJCA 1S2GA 3TLGB 1SZDA 1YMQA 3A6JA 3SHQA 3WLLA 1I7DA 4MGZR 4G0OA 5KYYB 1MZVA 3PUXA 2DQSA 2Y1WA 1GQOA 1XN1A 2IEGA 3HQ4O 1X7ZA 4JEHA 1ECJA 1P0IA 1QOPB 1U0RA 1VL0A 2FPPB 4PR3A 1A1VA 4URVR 1B8OA 2W70A 4KZKA 4O6VA 4YJGA 1RXIA 3B52X 1MB4A 5ERXA 1VIAA 2C9MA 1Y1LA 4JR2A 4Y9UA 2H5JA 1V4VA 5KX5B 2Q3FA 4YQZA 2BP7A 2AMJA 5DWVA 1OZGA 1EKXA 2QJOA 3RAEC 1MVLA 4RV5A 1GRVA 4G5QA 1UMCB 3SHFA 1QQBA 1VE5A 1Q92A 2AOXA 2AR7A 1F2UB 3ND7A 5HW0A 2IVZA 5CNJA 4H31A 2FZ5A 5FLKA 2CLOB 1LBTA 4ND8B 3SSMA 5F78A 5F77A 1OUMA 1DG9A 2OCGA 1Z0AA 4J8PA 4ZQCB 2Z5GA 3TBHA 2CSUA 1KI4A 3BK2A 2QNBA 1U2GA 4CCSA 5DU2A 1UJCA 5ABPA 3K1TA 5C8XA 4AZ3A 3OI7A 1TUBA 3O1IC 4PXYA 5I7WA 2H8GA 2IPLA 4LMRA 5GONF 3MLAA 3U40A 3CZAA 1CRQA 5E6RB 1QYIA 2FUNB 4S1OA 1VCOA 5FI3A 3C3JA 1T35A 1YB7A 4HDSB 1RWVA 1NBOA 2YJZA 4WLOA 1DAMA 3TCXB 4RK0A 3CLSC 4DLNA 2DGDA 4GOLD 4C7BA 1C5KA 4EAAA 1V5FA 1QU3A 3GFBA 2CK3A 1QYRA 4C04A 1X8KA 3DZHA 1RKVA 1Z7GA 3RSLA 2JLVA 2AYXA 4IILA 4BP9A 1FRFS 1QGOA 3I1IA 2AC4A 3EG9A 2Q27A 5B6JA 2EHDA 2FSVA 4PPNA 4B3SB 1DQZA 1XCJA 1WPGA 3TLGA 4AJOA 4CXMA 3QHQA 2BEKA 5L53A 3T7RA 1TM4E 2H5EA 5HBGA 2Q99A 2VSNA 3DS8A 3T9FA 5KYYA 3F49S 3VU8A 1RPZA 3FMPB 1H8HA 3FW1A 4JI1B 5BNZA 1HFKA 3N2EA 3VHRA 3QFFA 4AURA 3I5YA 2Z5VA 3CT6A 2VK2A 3FJ1A 5KYTA 3FHCB 1S9HA 3LQYA 3JQQA 2OG2A 5FPHA 4KLNA 2VOEA 3R9XA 5LNK1 2JGFA 2X14A 4RX1A 3S2SA 1UMCA 4DF3A 1BA2A 1IB0A 1RJ9B 2C2OA 1F2UA 3MJDA 4YJHA 3OMWA 1N2GA 3E9YA 3NC0C 1V8ZA 2I3ZA 2WD9A 3M70A 3S2UA 1RSZA 1A9PA 2BJHA 2QPLA 3CA8A 4RETA 3ZV7A 1DTSA 4KG7A 2C2HA 4OBEA 3DPIA 4RY2A 3X1XA 3ZCQA 2N3ZA 2IXFA 1ZCFA 4J7AA 3A2NA 4CLDA 1M5RA 5DYWA 4MVYA 1DKPA 2XXJA 3D1LA 5DYIA 2ZBDA 1ORWA 2J0SA 5J9FA 5G41A 1SHJA 2DUNA 3P9ZA 1NUAA 2NUTB 2VJMB 4G0PA 3RVLA 4E11A 4HN9A 5HF9A 1J56A 5E6RA 3V4VB 4WW0A 2VDNB 3A1CA 5IK2A 2G72A 3T4XA 3DE6X 1HO3A 4URYR 2ID7A 4BMVA 5KWSA 1L5VA 2Y76A 3TD6A 1V5WA 2HREA 2G5PA 3PC3A 4NLLA 5A4DA 4GQAA 2I1WA 3OQHA 4KN6A 1AN0A 3HKEB 5AM2A 2BMEA 4NFYA 5HOQA 2B1JA 2QVCA 3LL7A 3T9DA 1R5BA 5F9MA 3O31A 4HJXA 1J70A 1Q91A 3WL6A 3BF8A 3W5AA 2GASA 3SE0A 3M9XA 1R66A 4CE6A 2VOJA 1RWKA 4GICA 2ORWA 1OXVA 2OGZA 4JJ4A 1T4GA 5HYVA 1NKTA 3GUZA 1BFKA 1P4HA 1M2GA 5D87A 5SV2A 2IP4A 2OV4A 5A4MS 4MK4A 4BBZA 3HUTA 4G8CA 4N5LA 2WKSA 4DIMA 5EFZA 4EW1A 2XVYA 2WDPA 1RQGA 5BQPA 1ZUD1 4W5WA 1SC1A 3FLBA 3HJGA 3BG5A 4RM3A 3KKKA 3ASVA 4LBVA 4BLWA 3PEFA 1RJ9A 3IQZA 2G0NA 3ABSB 4IM7A 4BPBA 4OFBA 2RC6A 3KJZA 3IDQA 2AG5A 3ISTA 4GOJA 4JZKA 4P7FA 1XWFA 3PQ4A 3B7WA 4RVFA 4XYEA 4N7JA 3DLBA 2W6ZA 4Q1FA 4YUWA 1SKYE 2XLBA 3MGAA 3QV2A 2V1XA 1QHXA 1GADO 1I3LA 4FJ2A 4WOKA 2FQXA 5K3BA 5I7FA 1O0BA 3OT1B 1SUSA 1Z37A 8ADHA 1TT5A 2XRMA 5ADVA 4ZAYA 4D3XA 1EYZA 2IYTA 3FUTA 4YCAA 1FFXB 1GZUA 1H3FA 5IBPA 1QVRA 2AWOA 3D8HA 3F74A 4IJWA 4C6RA 1DKQA 3SU8A 2GZSA 1MOSA 3F3YA 4LOLA 1Z33A 4QDXA 1BO6A 1E2MA 3IT1A 3BFJA 5ETJA 4GOOD 5KKAA 1X74A 3UW1A 1D6JA 4BNUA 3QBEA 4HB4A 2H3HA 1JKMA 4Q4AB 5FULA 2QYSA 4XA8A 4BNKA 2NVUB 4CM4B 1U0OC 4QBKA 4LYHA 5T4FA 4LV6A 1NTOA 3WWYA 3MLEA 5BOSA 5DI9A 3HKEA 1EEHA 1F2TA 4O1IA 4DLRA 5CB0A 3SDSA 4NENA 1H69A 1T3SA 4F4FA 5C32A 3CUYA 4R1MA 4ZQIA 3ED5A 3BZUA 3RHFA 1HEYA 1T8WA 2DUMA 1VSBA 1XTUA 3RVKA 2D0OB 3EXIB 7ADHA 1RXCA 2M6SA 4WFQA 1Y33E 5F35A 3RBXA 1YFKA 1OKKD 4PLGA 2ZWVA 3R8XA 4JCOA 1NMXA 2CFIA 4B8YA 5AVXA 3AOEC 2R9VA 3M3PA 1SPBS 3QU9A 3OPXA 3RUPA 2YZ7A 5A7GA 1QV9A 4TL9A 5JCJD 1UXIA 4I1VA 2RBGA 1Z0SA 1KERA 2ZT8A 4IUYA 1M2NA 4OSPA 4TYPA 2YMMA 4E2ZA 4HATA 4QXAA 3WXMA 2DHRA 1DX9A 1NW5A 3UOAB 4Z2AA 1UXGA 1E3LA 3UHAA 2FMKA 5KVCA 4XEUA 3RWMB 3VTKA 4OAQA 2ZI6A 3W6NA 2HLDA 2PAFA 3TLCA 2AJLI 4B48A 3DLCA 2ZRLA 3EGDA 4BC0A 4DIEA 1JDJA 3T9CA 1K97A 2GDZA 3OT1A 4RHUA 2Q1UA 4Y2HA 4BQQA 4EUKA 1O7JA 1BAPA 3AFHA 2G4LA 4PYIA 3Q2KA 4CF6A 5JC8A 4YYEA 1H1LB 3GLGB 3PUJA 4IIEA 1FFXA 3OAAD 2LIPA 1B73A 2D5CA 2POQX 1IN1A 3LGXA 2VAWA 4K0RA 3WGHA 1G42A 5JJLA 4XJSA 1GPH1 1RRMA 3O92A 4I1OA 4NRDA 4M9ZA 4Q4AA 4YS6A 2G9VA 1VHDA 4K28A 3E5MA 4R0MA 2MOKA 2EJBA 4UPDA 4CM4A 5EJ5A 3LFUA 1YZUA 1RC0A 1FXWA 2IYZA 3JD3A 1P2FA 4BBJA 4EW6A 1ZVMA 2QJTA 2BGNA 5C5EA 1K27A 3HXKA 1NXSA 2J5XA 4HQNA 1G60A 5H59A 5DHQA 3TTSA 4N47A 1ZEMA 1Z0ZA 3LC2O 4WPGA 1YAJA 3KZXA 2YNMD 3LNCA 3EXIA 4KU4A 4LZWA 2POCA 3DLTA 2RHCA 1WY7A 3HO8A 3VNSA 1LNSA 1ISMA 3AJ9A 3BE8A 2IF2A 4LN1A 1MX9A 1EWVA 2G8LA 2VR1A 4TWJA 2HMUA 5J5VA 3TRDA 5BR7A 4U7DA 1XMPA 4QVGA 2R6CA 4KXLA 1AK9A 1FUEA 3V1UA 1E1QD 2Q3DA 4H7PA 3M6AA 4MEJA 1HEUA 2R8BA 3D6TB 3N7UA 3OOHA 5GJVC 1O6GA 4YUAA 1LPNA 4R2LA 4G4SO 2REOA 4D99A 4PTYA 2UUBB 3IX7A 1MVNA 2P6OA 3V4ZA 1WXHA 1YIAA 4B6PA 1MNQA 1MTZA 3DMFA 3NWOA 1Z8DA 2FN8A 5JCZA 2AXEA 4MRNA 4AJ2A 1FSZA 4BGUA 3FB4A 3KL2A 3OU6A 2JLCA 3COYA 4DCGA 1VMKA 4G5SA 4GMXA 2IYRA 1JYFA 4Z9YA 2F3UA 1ZGZA 2H06A 3KD2A 4I1IA 4RVHA 5H68A 4HX9A 4DIDA 3HXMA 3G88A 2Z9BA 1LA2A 1Z62A 2ZVJA 1R74A 3AVXA 3SOZA 2KWIA 3TVYA 3QOWA 1XWWA 2ZREA 4MA5A 3EUAA 3KEFA 3CG4A 1D2NA 2QDKA 4LHSA 3DHEA 3W06A 4EDFA 4JB2A 5TT1A 5E3IA 4IX9A 4BNTA 1JDUA 4R3NA 1MTOA 2AI1A 4UVGA 4E5KA 1GVHA 1A76A 4YJ3B 4H1UA 4I99A 2GBFA 5DN6A 1YI8A 3PWKA 1JHMA 2ONYA 4PRLA 4CG1A 5AOAA 4HFMA 3OM9A 3QFSA 1PFKA 2Z4RA 2FQYA 3WLSA 5BW5A 1CDDA 4FC7A 4WKNA 1ISRA 2C8VA 1KMHB 2HRRA 4NMWA 2AMYA 5IM5A 4BKOA 1Q6ZA 2EL9A 3ACCA 2P9BA 3JD1A 5GM1A 2G70A 1CUDA 2HPHA 2Q29A 1Y48E 2CZCA 4J7CA 1WE2A 2FWJA 4OH1A 1OXTA 2PV7A 3L3BA 5KCZA 4FI3F 1J09A 4IOLA 3LDAA 4AJ4A 5KDDA 3GLFA 4EJMA 2HT1A 1WLSA 4TYYA 4JYPA 4P4UA 4B3DA 3ZOKA 2V7TA 1PGJA 2EEPA 4WJKB 3GRUA 3LWBA 2VEDA 1F0NA 1NN1A 4W5NA 2RK6A 1G7SA 2QD5A 2YYYA 1P4AA 2ZBEA 3EIHA 5E7MA 3X1KA 2JDIA 2FPUA 1KIMA 1MC1A 1W6RA 2AMVA 3ZKWB 4H1HA 4FS8A 4UTPA 3DDOA 1XCOA 1EK5A 4OB8A 1KTVA 2YFKA 4N7RA 2GXUA 1Z6QA 2HL6A 4UFNA 3W7AA 5JFGA 3D5EA 1FTWA 2GJAA 4UREA 2GZDA 1BEZA 1Y1SA 1QNLA 2H4HA 3RS4A 3BWXA 5AHKA 2ZJFA 4HQKA 4KH0A 5TEWA 1JX6A 4EF6A 3W78A 2Y92A 3C45A 1Z8FA 5D7NA 3KQMA 3RYIA 4AB1A 1QHFA 3IV9A 3AM1A 5BR4A 3NX4A 4MKGA 1RAEA 3OO0A 1J42A 1B16A 2JA1A 1HETA 1AXGA 3H2GA 4FDAA 4IPTA 1AS3A 1U8UA 1XOIA 2PGNA 3NCHA 5F33A 1J8QA 3HCNA 3EOZA 1ML3A 1E5TA 3KKQA 2GPTA 3EZ6A 1C7EA 1GYPA 1P0MA 2P2YA 3BS4A 3LRTA 3Q3HA 5A3VA 3U81A 4DLAA 4HNGA 1KWGA 3G8YA 4CNQA 4L8YA 2BKAA 1Q2XA 3ETHA 4IDFA 4Q05A 3K73O 5I7HA 1O5IA 1KMHA 2Q1SA 4IV0A 1U7OA 3LDFA 4JVOA 3PS9A 1VJRA 1V8OA 3DTVA 1E4EB 2YWXA 1E8NA 3MHPA 1SXIA 3H1BA 2VHXA 5ANRB 3TSZA 5I3ZA 1JQBA 1WDKA 3MWLA 4HEQA 2VHZA 3NIGB 3R6WA 5AXAA 1M73E 1YR8A 4HAOA 1P1FA 2M9MA 3K8YA 4PLWA 4RXUA 4F56A 4MV5A 4F6RB 4F2DA 5BSGA 1ISGA 3HR4A 1FDIA 2AN5A 3OTGA 4Q9IA 1QTQA 1ZVKA 2P30A 4MYRA 5JD5A 3GCGA 4L5CA 4RF3A 3K4PA 1YDMA 3O83A 4X1YA 1SURA 3D3JA 1HDGO 1F8YA 1U31A 3F67A 1T5LA 5JQWA 3GV0A 4QRDA 1S8OA 2JK1A 2NNWB 3DGEC 4TVSA 4UTZA 4V38A 5F3WB 3ZKWA 4HBZA 1DQYA 1Q0UA 4IWYA 5CFQA 4KE6A 2KBFA 1Z68A 2CNDA 2Q7OE 3UC9A 4QNNA 4FBLA 3WBFA 3TVDA 4Q4LA 4E1BA 3N75A 3ZJTA 4D98A 1HT0A 1JAZA 4MUIA 4CGZA 3B3QA 5LUBA 1JA1A 3BEOA 1O89A 5T57A 1D0IA 2FDRA 5BYBA 5BMVF 1CEXA 2BFPA 2OOKA 3H1PA 5F1YA 1O94D 4OQYA 3UENA 2IBSA 2BLLA 1FDWA 5CEEA 1N25A 3BXEA 1EFPB 4L22A 4RZUA 1NL3A 2WZQA 1S8NA 1P2TA 3FNIA 3Q9SA 5DIFA 4F92B 4ZQGA 3FDIA 3KHKA 4C4TA 4FDMA 3V33A 3ITKA 1C0PA 1GD1O 2HLPA 2XW6A 4UPEA 2I8AA 4WOJA 3D8TA 1JIVA 1IAVA 1S7GA 5EIBC 1SU4A 1FXWF 2L19A 3Q1LA 2DQYA 3BF7A 2IS1A 3G8DA 2EXXA 1FX1A 2IEAA 4LBZA 2XE7A 2C5SA 4BN0A 1FRNA 3LX8A 3ASYA 1PU2A 3GUVA 4R2MA 4J3JA 1SVNA 2XGGA 4YIKA 2GCPA 2XQKA 3SMVA 1LBSA 2QR5A 4DMRA 3NM5A 4R84A 3HO1A 1E4EA 4AS3A 3GEEA 3C5WP 1ZGAA 2E5LB 5HTOA 1XJQA 2X9GA 3L4BA 1AXRA 4EKEA 3DAYA 2R87A 2HU7A 2OCYC 1JIKA 4PW0A 3N0WA 1SKUA 4BX9A 5AVWA 2IEIA 4KOEC 5DBIA 4MDYA 5BN4A 4HNSA 3AR6A 3RSQA 4KXNA 2DG2A 1Z5WA 2XR1A 3DWGA 2ZIXB 4II3A 4CQNA 4YA6A 3FTNA 2OCKA 3GGPA 3BTOA 3QZUA 1K3TA 4AJLA 1USUA 3S4YA 2X1MA 5JALA 4RDHA 1PT7A 3K9QO 3A2KA 3I2FA 2R7AA 2DUUA 3VC1A 3HA3A 1N2IA 4TSRA 4ROTA 2IYAA 3MCTA 2V6IA 4YRTA 1E60A 4MICA 3ZY5A 5F9FA 5J4LA 2FRDC 2HK6A 3A11A 1A27A 4EKGA 3LKDA 1NSTA 1W4RA 1WXIA 4DGQA 2A9JA 3CX6A 1I7QB 4OI2A 3OJ0A 3DFUA 4QXMA 1Y7LA 1MJ5A 2E5WA 3D7LA 4LGVA 2IY9A 2XQJA 4LVUA 4ZCPA 1EFPA 3QF4A 1U0JA 2QW1A 1XFAA 1I32A 4EY6A 2XPCA 4X8LA 4C4PA 2OORC 3QI2A 3DZDA 3CTMA 3VPXA 4TV8F 2HWYA 4KNVA 5DYGA 3T3DA 3QVSA 5U4QA 1DO0A 4BEWA 1OQAA 4W82A 4G2NA 5KJ1A 221PA 1U8FO 4IIVA 4N8EA 5ALWA 3TRHA 1R5NA 2VAMA 2CNBA 1JEEA 3HP1A 3FR8A 2ZI3A 1S7CA 2ZB7A 4F06A 4REOA 3RRYA 3G5MA 3KSMA 2XWQA 1E7SA 4N5DA 3UJNA 2EGHA 3K72B 4B73A 1PR6A 3VZDA 1ZM3A 3NBXX 1ZLXA 3COWA 2H92A 1H1DA 1UKCA 5ALGA 1APBA 3F47A 3G0DA 3VSCA 4X44A 2PLNA 5D5PA 1YIDA 4QZVA 4PAWA 1PDOA 3IT0A 4OHKA 1RLMA 3OO1A 2ZIXA 3C4VA 4M1MA 1F8FA 3GWZA 5F52A 1R3DA 3K9GA 4OHWA 2AYZA 1SCIA 1QAQA 4INPA 3CVVA 1GXSB 4QOIA 2P78A 1BCRB 1X1TA 4CQLB 3II6X 2PR7A 4FYXA 3I37X 4YRJA 1L1RA 1E6EA 4L5BA 4LJSA 3TGPA 5LD2C 4A15A 1TLTA 1U2ZA 1SUFA 4ZOQI 1M2VB 5BSFA 3AUXA 2A14A 4CCWA 2YV4A 3EVCA 1C8KA 3AFOA 3D2LA 3R6GA 4ARVA 2PYDA 2XLCA 3EGXA 4UAGA 3ZCSA 4PYRA 1PL0A 2Z09A 2FR8A 5CXUA 3P71T 3DYVA 3OCVA 4CKEB 2HIAA 4QG7A 1SVSA 3RJ5A 2QM7A 3TYXA 3GR6A 5A1JA 2OWEA 4EJ2A 4Y1FA 2A3NA 4FZVA 3VR0A 2O54A 1JS1X 4GWLA 2J08A 4RQBA 1W35A 2XF8A 2ZB3A 3QLEA 2JZNA 1RCUA 2YZMA 2K2QB 2XY4A 4M9SA 1VYVA 5M7EA 2R8XA 3FN4A 1IHDA 4KTTE 5C53B 3GCDA 1NMSA 3GY0A 1RU3A 4TL8A 2SECE 5TMPA 1GPNA 1Z22A 5IJ9B 1SCQA 3M9LA 1HDIA 1X0XA 3ZNNA 1WTAA 4YB8A 5EUMA 2P2NA 3RREA 3A0UA 5D5QA 2Q46A 1B0UA 4QSMA 5JBQA 1ABEA 1IMOA 2H2FA 1EBFA 3AB3A 4HH3C 3RWBA 3C5VA 4RVCA 4KRFA 2OP0A 3UGJA 1GTSA 4CV3A 3DZJA 2A0YA 4XJVA 1JEOA 4WZBA 2JHFA 4RZXA 2GO7A 2ZJ0A 3WAKA 9LDTA 2HK9A 2QRVB 2PX0A 1L2TA 2JLQA 4D3YA 4MP8A 1Z0IA 5GJCA 5JIBA 2VH5R 3A9TA 3FMFA 2QAGC 5CBPA 5JS2A 1NXXA 6YASA 2I22A 1GXSA 4U2KA 5AJHA 1BCRA 4CQLA 4IDBA 4OYYA 4C30A 5EFOA 2X1LA 4JLAA 3E4DA 2RKOA 1D1QA 4PHCA 4WZZA 1M2VA 3A4YA 2PMWB 4LYYA 2R0QC 1O9HA 2EJCA 2OBMA 1E2EA 2I6XA 3ERCA 3HBNA 1MN6A 2CSXA 2J9FB 3MHTA 3OFNA 2UZ4A 3Q7SA 2XBMA 4NBWA 3L8EA 1GPWB 1KQOA 1II8B 3F6YA 1AE1A 4CKEA 3KR9A 1SD5A 1P4SA 1KIFA 2ZCVA 4H1TA 1YJ5A 2QTGA 4GF5A 5FUQA 1CY1A 5HZGA 5AK3A 4PO8A 1RYYA 4E03A 3ZU3A 3NAZA 1FDRA 4Q9NA 4OXRA 3BCSA 3FH0A 4ZO9A 5J4VA 1KIAA 2X0EA 3FZNA 4NCJA 1KXZA 1W59A 2A5FA 4RJTA 5AVTA 4BO6A 1KWKA 2G1JA 3K2QA 5IJ9A 3S44A 1IN7A 2I9KA 1CZLA 3ZGOA 1HRKA 2XEDA 1H3NA 2QORA 2QMEA 5CH5A 4X6XA 4DRXB 5L7WA 1JF8A 2NXNA 4AS2A 4YALA 2HR1A 4PNEA 5IP5A 4GLJA 1W36B 1MW9X 1YHYA 1HPLA 3WYFA 3HA2A 4HQLA 1GZ6A 1R37A 1IZ8A 4EBBA 4G3XA 3G85A 1NJ1A 2CXSA 4LRXA 1VA5A 2QRVA 3P7MA 4CQMB 2AI3A 4XUGB 4KRYA 4DR3B 1SU7A 4OUDB 1OT5A 1XMOB 3L1KA 1DU4A 5TPZD 3B1ZA 3DWIA 4Z7OB 3NKVA 2V7BA 3DLAA 3ZHXA 5JFOA 2NPIA 3P2OA 3BGOS 4MR9B 1SUDA 5C3MA 3GJZA 4MNTA 1T5DX 1L5HB 4OKNA 5KEIA 3WWZA 3NC1C 2JLXA 2ZUFA 3RVRA 5KNCD 2Z08A 5CLHA 4Q34A 1ODKA 1MJHA 2HZBA 2XUKA 5E1MA 3AR5A 3PHCA 4HP8A 1QIGA 4UM8B 3VISA 2Y99A 3CRQA 5K0FA 3QHAA 1QRUA 3TG2A 3BWDD 1RLUA 2A0FA 5BSVA 4FFSA 4WK6A 2W2NA 3FETA 4F71A 1ODLA 3C5EA 3CKMA 3NM4A 3V2GA 4UNRA 4BBPA 4EQ6A 1ZH4A 3ZEIA 2Z2XA 4ZZ0A 3OIDA 2C2GA 1QWOA 1XT6A 1XMJA 2I7XA 4UD6A 1T8TA 5F3DA 1NPTO 1YHZA 3WP1B 2ZUDA 1QUEA 4TMWA 2EG9A 5CVDA 4ICIA 4QU9A 3L7BA 1WX1A 1TJ3A 3M5PA 5BVGB 4B3XA 2H63A 5FHQA 5KHLB 3ZKAA 4DRXA 2W2XA 4GT1A 3IRVA 4F4CA 4Y2GA 4TTVA 2IH2A 3DXXA 1A04A 1EGHA 1FW8A 2XWSA 1HG0A 2ZRIA 3IUMA 9LDBA 3QPCA 4U63A 4F11A 3K16A 3OLQA 2VHQA 1N5KA 3U62A 4GMDA 5EHQA 5GZ6A 4CQMA 5IFLA 2Y66A 1T0JB 4M9QA 2CNLA 4OUDA 1NVUQ 3Q7RA 4IS3A 3AHHA 4IMJB 5KHAA 3NB0A 3A1DA 1PS0A 2R6JA 1B15A 4MR9A 3OOEA 3VAAA 421PA 4GDMA 3WQSB 5LWQA 4ARIA 1DC4A 1F5NA 2UXDB 1BHQ1 1ZIOA 2ZYSA 4ARZB 3V4SA 2JD1A 2E4AA 3JV7A 3U4CA 1TRKA 4LQCA 1U7HA 1XF9A 4A0RA 4LRSB 4WXYB 3O0TA 4IH1A 5TQVA 4DTIA 3H9QA 4MLCA 4X1IA 2NP6A 1QRDA 2AZTA 2Y0DA 4F5EA 2PTGA 3L18A 4LMPA 3VO1A 1C9YA 4ALLA 4KFCA 2IV7A 1R0CA 2K4MA 4AWBA 4O3MA 3E61A 4MHTA 4NMXB 1G17A 5DI3B 1TK9A 1Z2EA 2VUTA 2F62A 5JAOA 3GRPA 4D44A 3PG5A 1IJKA 2OP1A 3UWPA 4K6GA 3GZTB 2L2QA 2O48X 3VKWA 5BVGA 2G7MC 1OXSC 3M6XA 3MERA 4W5QA 2W0MA 3OCYA 1ZJWA 2CXQA 1VBNA 2CVZA 3V8RA 1RWNA 1WF6A 4P3YA 4QLBA 3KM0A 4XSVA 1Q20A 1P7YA 1B76A 5DKFA 1UT6A 2DLNA 2NQTA 3FFBA 3NAMA 2C61A 5B3AA 2G9NA 3U49A 3WWCA 1NRIA 5KYNA 4MAMA 5JBIA 2YJ3A 3LX4A 2ISQA 4NL4H 3A28A 1R5OA 4BYGA 5H9WA 1W34A 1LU9A 1COWA 1L4BA 1GSHA 1S8FA 1P81A 2O2GA 2QMQA 1QX3A 3LZ6A 2Q1TA 3QFCA 4L0MA 4LPKA 3KTDA 3WQQA 3ADKA 3AVYA 1LEHA 1NMEA 5K0SA 1NY6A 1J9GA 4GZ6A 4DQUA 1DWPA 1EK1A 1HSOA 4EHJA 3CLUD 3K5HA 1QGED 1JZQA 5IU6A 2HM7A 1WPRA 3TI7A 4B6EA 4IOJA 1AB5A 1P91A 2SKCA 3C7TA 3Q9UA 1RZUA 4MYSA 4D3ZA 3SXUB