The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
67
|
sequence length |
191
|
structure length |
191
|
Chain Sequence |
GMQTTEIDLRLTEVSQQLTMVLVPGLRDSDDEHWQSHWERRFPHWQRIRQREWYQADLDRWVLAIRRELSVCTQPVILIGHSFGALAACHVVQQGQEGIAGVMLVAPAEPMRFEIDDRIQASPLSVPTLTFASHNDPLMSFTRAQYWAQAWDSELVDVGEAGHINAEAGFGPWEYGLKRLAEFSEILIPNR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of YdeN-like protein of unknown function (DUF1234) (YP_051181.1) from Erwinia carotovora subsp. atroseptica SCRI1043 at 1.66 A resolution
rcsb |
| molecule keywords |
Uncharacterized protein DUF1234
|
| molecule tags |
Hydrolase
|
| source organism |
Pectobacterium atrosepticum scri1043
|
| total genus |
67
|
| structure length |
191
|
| sequence length |
191
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2007-11-15 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF06821 | Ser_hydrolase | Serine hydrolase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold |
