3BDXA

Crystal structure of the unstable and highly fibrillogenic pro7ser mutant of the recombinant variable domain 6ajl2
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
111
structure length
111
Chain Sequence
NFMLTQSHSVSESPGKTVTISCTRSSGSIASNYVQWYQQRPGSSPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSNHVVFGGGTKLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amyloid lambda 6 light chain variable region PIP (fragment)
publication title A single mutation at the sheet switch region results in conformational changes favoring lambda6 light-chain fibrillogenesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 24
structure length 111
sequence length 111
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bdxA00
1FNFA 2YK1H 5F21B 1PX4A 1UJTA 3GO1H 2IFGA 1BIHA 2XWTB 1M1SA 4H1LG 4MB4A 1HZHH 1NANH 3DX7B 3F58H 3V0WH 3MJGX 4W70A 3HS0A 3QQ3B 1EBPA 1OCWL 2COQA 3QXUA 4ZPVB 2V2TB 3MUGB 1MCWW 3D0VA 4GAFB 1PYWB 4XC3L 4WIQA 2MCPL 1EXUB 4QXGH 1XGUB 5FO8B 4C56B 4AQ1B 4URTB 3FOMA 3MNZA 1OTUD 3MV8A 2P5WA 4HWBL 2R2CA 3S6CA 1RD6A 3BKJH 4Z0BL 4N8VA 4JM2F 3WFHB 5HHOA 4GW1B 4GRLC 4LLQB 4M3KB 3PNWA 2A83A 3D69A 3P30H 4WI5A 3TZVD 3CMOH 5C07B 3I75B 1AHWC 4P46A 1AIFB 5EU5A 4BZ1L 4F33B 3MJ7A 1L7IH 2XN9E 1ZTXH 3U0PB 3EDFA 1YMHB 3DUUA 4MCZB 5KG9A 4Z78A 2DIAA 3LDBC 4FG6D 5JZ7D 3V4VL 5HDLA 4OZGB 1RSFA 3HC0A 3T4YA 2R69L 5C71A 4JKPH 1NBZB 3E2HC 4U1JA 3EOBA 3BJ91 2RCSL 4QHLB 1NKOA 2H26A 1ZT4B 3PQYE 2IH1B 4LLMB 2C9AA 2B1HH 2ZPKH 3FO2B 5A3ID 1DFBH 1ZHKB 2F54D 2R4SH 1KIRA 1KENH 1CQKA 4WW1A 4WO4D 5J6GB 1T0MA 2QV2A 3EDEA 1NEZB 4RIRA 4AENB 1QG3A 1PG7H 3FRUB 3OX8B 1GPOH 5IVXA 5EOQL 1WEJL 2DQHL 5EUOE 3TJHC 4NHCL 5DVNA 1FFQA 5IOPB 1ZSDB 4NRXA 1NFDB 2XI9A 1ZLUK 4I48A 1WCBB 1QSEB 3AU1A 5ACMA 3T3PF 4U3HA 4JFHD 1QSVA 1ADQH 3MNVB 2P4AB 2V7NA 3U9PH 3MLUH 5KVEH 4JZJB 4U6HB 4U7SA 1UACL 1UKTA 3CC5A 4LLUA 3VFMA 1CFTA 4KI5C 3O6KL 3MLWH 1FC1A 2DYPB 3DYPA 4X4ZA 1CGYA 1K8DB 4PJ9C 2IPKB 3C6LB 1G9NL 2DLTA 1TVBB 3SKJH 3TVMC 1CDBA 3BN9D 3KPLA 1IC1A 1JYWA 3CFJA 5EBMA 4UINL 4EUPB 1LGVA 1M71A 5MERB 5F6HI 3EJZD 1J9CT 3L5XH 1TCRA 4O02L 1WWBX 3Q0HA 4JR9L 1DQDH 4OUUA 4YBLC 5I1GH 3LEVH 3BGMB 2CGRL 3VXTA 3QBTB 5CGMA 4YGAB 4UIKH 3ARSA 1OAQH 5ISZA 4R96A 5C0RL 1F2QA 4OB5L 4KRPB 1YNKL 1C08A 5I1KL 3C60D 1YEIH 5GSVA 1IQDB 5EFIB 2DQJL 2QJDA 5EBLA 1KGCD 3RY5A 1KN4H 4G9FB 3O6FD 1CWVA 4DOHE 2DM4A 5TQ0H 3FN0H 4M5YL 4Y16B 1FFNA 4XCCH 1QRKA 5D93C 1ZA6B 3QIWD 1IGFH 4PG9B 5I8KH 3O4LB 4JFOA 2BFVL 2P7TB 1FBIL 3L3OB 4GKOA 2EDOA 2P44B 5KZCB 4OZ4B 3MUJA 2C7UA 4LSSH 1BQHA 1BZQK 5D1ZB 3VGEA 4I9WD 4NGHH 2HFGL 1EVTC 1OSZA 4N0UE 4PLJC 4FQLL 5JOFB 1S7RB 4IRSB 4M02A 1OAUH 4X6EA 5IBUG 4F7PA 3QHTC 5E8EA 3D1MC 4XBPA 4M6NL 4FQQB 4P5MB 5JPNB 1EERB 3BKML 2ZSVA 4WU7B 3BPOB 5DXWA 4NN7C 3RWDB 3B8SA 3PV6B 4Q9QL 3WFCL 1A0QL 3BIAX 4M7LH 4OLWL 5KSVB 3N0PB 4GH7B 2B4CH 3NN8B 4F8TA 2QQQA 3D85B 1A7RL 3O2VL 5C0NC 1AE6H 5ACZB 2EH8H 1MI5B 3T0XA 1FNGA 1WQVT 2BY0A 3NGBC 4Z77A 2R4RH 5F1SA 3ARGD 2HT2D 4DW2L 2GCYB 4YNYA 3PHQB 4XBEH 4LASL 3H3PL 1Z5LA 1NFDF 5FXCH 1I8IA 4NYLA 4YAQB 3N1GC 3PL6C 4CW1B 4QCIA 3BZ4B 1A9EA 1DJSA 1GL4B 2QKIA 3IJYA 5EZIL 1JNNL 1UC6A 3BKYH 4M43L 4ESKA 5E24E 4J4PD 2OTWA 5FYJU 1XF3A 5IF0B 3QDME 2APXA 2HJLA 4YXHH 5IK3B 32C2B 1IRAY 5F7UA 4GBXA 3QUMB 4MNGA 4U1MA 5C0EB 4LSRH 4XMLH 4CBPA 4D0BB 3S34H 2ZUXA 4AM0B 3ES6A 4MDIB 4N0FA 3ZL4H 2EE3A 4I0PD 5SX4I 9CGTA 3GMLB 5HHNA 4P57A 1QEWA 5C0AA 2X10A 4FXKB 4XB8A 5CJXA 3QUZC 4MA8H 1NMCC 3H9SE 5SV3A 2VQ1A 2G9HB 2UVFA 2GJJA 3QUXB 4H88L 1ZHLA 2M8XA 1G7HB 3V4PL 3QRFM 3O41B 1PG7X 2FGWH 2XWTA 3WN5B 1MAMH 3GK8L 4KRMB 2XKUA 2IWGA 1II4E 2VOTA 4MJID 1AQKL 3QQ3A 4X7SH 4QXUH 2VLKD 2V2TA 4WHYH 3DGGB 1EXUA 1XGUA 5FO8A 2XNAB 3OAZH 1XF5B 5E2TL 4F9LC 4UQ3B 2D7OA 3EYUH 2BY3A 3MRRA 4S1QH 3SJVD 7FABL 5HVWA 4U1KB 4ELMB 2PYFB 4DGYH 2QQKH 1DEEA 5HI3C 2YZ1A 1BFVL 4LLQA 1MQKH 5HHME 2EZ0C 4NCC1 3MOAH 4H8WL 1LNUB 2JJTC 4HFUL 1GC1L 4M00A 4YE4H 1CDUA 5A43C 2CKBL 1KJ2H 5C07A 4F33A 1AIFA 1P53A 2N56A 3U0PA 1F97A 1RULL 2VZ1A 2Q7YB 2CO7B 1YMHA 4MCZA 2YBRB 3FO0L 3HAEH 4OZIB 5DWUH 1VGEL 1RJYB 3T0EE 4YC2B 4YR6B 3X3FL 2FNBA 1E4KA 4KY1H 4M5ZH 1ZT4A 3UTSE 1IC7H 1TTFA 2IH1A 3AB0C 5EORL 3RUGF 2EDEA 2DQUH 1DBBH 3SN6N 3MA9L 2EIDA 3FO2A 3WDJA 3VXSA 4N90E 3RVTC 2DQEL 5J6GA 5DMKB 1NEZA 4AMKH 4JM2C 3T09A 2HH0L 4PY8I 2X41A 5HDBF 5F3BB 3FRUA 3OX8A 1JNLL 2UUDH 2YMXL 1QBLH 3MV8D 3WHXB 2P5WD 3F12B 5CWSB 3ULUD 2DTSA 1JHTB 5HHOD 5IOPA 2NCMA 4HJ0C 1ZSDA 4P2QE 1HILB 1NFDA 2FDBP 1WCBA 5H8DA 4Q6IA 1SYVA 3MNVA 2WLYA 3BPLB 3QT2A 1C1EH 4IRJC 5DJXA 4P46D 3N1FC 3K4DA 3VXPA 3U7WH 2I5YL 2BSRB 3P11L 1RUQL 4HBCH 4QY8B 4RGND 2HVJB 2LU4A 3WO4C 1E4WL 1K8DA 2Y5EA 3MR9B 5LKNA 3C6LA 3WFZA 3BGFB 3W81A 1QFUH 3BWAB 2NR6C 1TVBA 4P23B 5TE4L 4EUPA 1R3IH 1KCLA 5MERA 2JB6A 2DBLH 4GXVH 2P42B 1CGVA 4UV7L 3Q5OA 3BGMA 1K9TA 3HR5B 3THMH 3ULUH 5FEBA 2AGJH 5CP7A 4PS4H 4EIGB 1EEQA 2HWZH 5GIRB 1UWEH 3AROA 1NFKA 1N5AB 2JLLA 4M7ZB 1TITA 1XT5A 3KPRB 2VZUA 3K2UH 5EFIA 2AJVH 3MRKB 3ZE1F 1UCBH 3LSOB 1JZ8A 5BCAA 4G6MH 2GITB 4PJFB 3RGVA 4Y16A 1CS6A 2KQMA 2DIBA 3U48A 4OIIL 3KS0H 4PG9A 3O4LA 4RMSA 5DGRA 3RKDC 2FB4H 1UWXK 5FYJE 2P7TA 1X5JA 3L3OA 1P7HL 4OZ4A 5I1EL 1T2XA 5D1ZA 5SWZA 4TOYL 5CJQH 1J11A 3QJHB 1EUTA 2MFNA 3VD5A 5IFAH 3SGJA 5C9JA 1JF6A 5FO7A 1S7RA 4IRSA 4YWGL 3IFNL 5JOFA 2ESVB 2PTUA 1UZ6E 5JPNA 4FQQA 4P5MA 1CZ8H 4HS6B 3T2PA 3C5JA 3LN4A 1ZVYA 5HI3D 1VEMA 3PV6A 1JI2A 1MCPL 3GJEB 3ZKMC 5KSVA 3AM8C 1FL6A 2DB8A 3NN8A 3WS6A 3D85A 4GOSA 4K94C 1RK1B 3T2OA 4OIAA 3BYYA 3S37L 1A2YB 1MI5A 5ISZD 1CLZL 5GRYA 3RWFB 5D9SB 1FN4A 4DOHB 4HCRL 3SY0B 4ZMAT 2GCYA 5GS1B 4Y2DC 5LXGH 3LKOB 1QPXA 2OJZH 1A1NA 4YAQA 4NIKB 3G08B 4CW1A 5FA3B 3BZ4A 4BQ6A 5J6HB 4WFEE 3X14A 2BOCA 2Y06H 3MFGB 3FFDB 2CIIA 2K1MA 1NGXA 3GB7B 5IF0A 1J7VR 3NVQA 5IK3A 32C2A 2CUMA 4FQ1L 3JV4B 1W0VB 3QHZL 4G5ZL 3QUMA 1FFOB 4I3GA 5FOBA 4D0DB 5CZVL 4HGWB 3S9DB 1MJJB 12E8L 3KWWA 3TM6A 1U3YA 4ZXBA 3V6OE 3OG4B 4AM0A 2DL2A 3MBXH 1DLFH 2VXQL 3LQZB 3GMLA 4FXKA 3IVKB 2RGSA 3ZTNH 5C86A 3D39E 4BELD 2X9XA 3ELAT 3LQAH 1YN6B 2G9HA 4HXBH 3FAXA 2ED9A 5A40E 1G7HA 5EUOF 2WLZA 1NAML 1ND0B 5EA0L 3HI5L 1HKFA 3WN5A 4L4TE 3BAEH 3C8KA 3TO4B 1QBMH 3T2QA 1P4LB 2NXYC 3QHFL 2BDNL 3FFCB 1D6VL 1F6LL 3KPPB 4JFDB 3DGGA 2YUXA 1FSKB 1R3JB 2XNAA 5DD1L 1CQYA 1BJMA 4UQ3A 1RURL 1UCTA 2DI7A 3BDXA 4ELMA 2Q8AH 4LKCB 3D6GA 1T1XB 1HYSD 1G6VK 5I2IB 1UXSA 4HS8L 3TO2B 1Q38A 2NY4D 4GBXD 1FORL 3TPUA 4WFGE 3S36H 1DBKL 1INEH 1FO0B 1SM3L 4I3RH 3BIKA 5JR1L 2VZTA 1AD0B 4WUKH 2Q7YA 5C0AD 3DYMA 2YBRA 3UYRH 4K7PH 1K6QH 3IDIB 4OZIA 5CLTA 5EBWB 1C7TA 3X13B 1VPOL 2WINB 4IOFC 4N8PA 1DUYA 4BM7A 5K9JH 3CXHJ 4R9HA 1A6AB 1RJYA 4WEUD 4YR6A 3ETBF 1EHXA 1JP5A 2MQ3A 4LFHG 1ZT7B 1ROWA 4FFWD 5CP3A 4K8RC 1JNHA 2C1PA 4GRLB 1MY7A 4LQFL 1EVUA 4ZSOE 1BZ9A 5KVFL 3RDTC 1TQCB 2XXCB 3DTXA 4F9PC 4E42B 1CXKA 5AUMB 2WZPD 3ZKMD 5DMKA 2IALB 3N50A 4QXGL 4OLUL 1J1PL 4JY5H 3MRQB 4ZS6C 1HKLH 4Y8AA 2GUOB 3F12A 5CWSA 3UO1H 1TQBB 1DP0A 2J8OA 3KJ6H 3WLWD 5I9QC 5FGBA 1JPGB 3CLEH 3E2HB 5I75B 2XN9A 4EN3A 1HILA 3TYFB 3FHAA 1K3ZA 3M45A 3JV6A 5DLML 5C0JA 3L5JA 2O5ZH 5C07D 4WW2B 5HGBB 5DZNA 3CMOL 3PWPE 5ITBH 4AEIL 2BSRA 1QHOA 3T0EB 4QOKE 1R6VA 1A7NL 1PX3A 1Z9LA 3AFLA 3KHQA 4U1HB 4XAKE 3BP6B 3O11B 2CXKA 4QRSB 3MR9A 4YQXH 3CFBA 3PQYA 2HFEB 5DQJB 4AL8H 4JHAL 4P23A 4FQJH 4F80A 5KBNC 5GZOD 1WZLA 4KK8C 4TYUA 2LAGB 5E6IC 3HR5A 2B1HL 4XWOD 3VXSD 1KPVB 1DFBL 5KN5A 5GS0D 1GVIA 5K9OA 3RA7H 3VWJB 5EUOA 5GIRA 2C5DC 2FD6L 1IKNC 1PG7L 1PBYA 1XGTB 2NY0C 5J56B 3N1MC 1F90H 3CDCA 4JGMA 3LSOA 4N0RA 1AKJB 5GZND 4XVUD 3TFKC 2YPVL 3TVMB 3QEGL 2GITA 5LGHL 4L8DA 4F37F 1C12B 2YD7A 1MFCH 4MQXC 3MRLA 4YBLB 1FAIL 3G5ZB 4QHUB 2YD1A 2BHUA 3GZKA 3PHOB 4W4NA 1R5IB 4D9RE 3QJHA 3SQOH 3UBXG 3QCTH 1N4XH 3F7QA 4MS8C 2ESVA 1CIUA 5E8PB 1KB5B 3P9WB 1MCEA 2X4RB 1Q9LA 4NNPH 5GS0H 3OZ9H 3NCBB 4F37K 4NWTL 4HS6A 5FUZL 5GRJL 2I9LB 3GJEA 3L5XL 4PJEE 1DQDL 5I1GL 4JKMA 1RK1A 2BY2A 5E8DH 4LIQH 3GBNL 3VGBA 2QSCL 4DEPC 4O9HH 2CQVA 1PSKH 1A2YA 3ZKNC 1Q8MA 3FB5B 2BNQE 3RWFA 5EU3B 1UGNA 5D9SA 1OAQL 3CDGA 1J0JA 3VRLE 2UYLB 3SY0A 4PJDE 1YEIL 5GS1A 5DHYA 1QBBA 1KXVC 3U1SH 3LKOA 1QO3A 3S36X 3RGVD 2A38A 2G2RB 5IWLC 3QO0B 2NXZB 5TQ0L 4AH2A 3O4LD 2NZ9C 5F7NC 2VR9A 2YD3A 5J6HA 1J8HE 2KKQA 4PRHE 4EUPH 3HE6C 4PGEB 1MFBL 4LSSL 4WEMB 5SWZD 1MRCH 4K7PX 1BVKB 3FFDA 3GB7A 3TH4T 1NCDH 4NGHL 2R0LL 4L3AA 4IRSD 4KDVA 1HYRC 4D0DA 1W0VA 4PLNC 1FFOA 3HRZB 2R56H 2CR3A 1IAKB 2F53B 1GGIH 3K8KA 3OF6D 4PB9H 2ICCA 1JGLH 1XF2B 4K55A 1GAFH 3F7RA 5GPRA 4E0RA 3D85D 2YC1B 3JXAA 3PL6B 3NCYP 4KQ3L 1YN6A 4LHJB 4P3CL 3VG9C 5E08L 1T6WA 4FQCH 1MCLA 1G9ML 2KBGA 1MCJA 4HUVB 2VNCA 3U46B 3RGHA 5IB4B 4EN3C 1SJHA 4KMTH 5DRWB 3TO4A 3MRMB 3HNSH 5BV7B 1P4LA 5DS8A 4YDJB 2HYMA 5MHSD 1EO7A 4JPKL 2J1KA 1YEHL 3FFCA 2EKJA 3KPPA 1ZLWK 4HJGB 1PG7W 2OXGA 3TEUA 1R3JA 4I18B 3QUZB 5DJCB 2CRMA 2B8OT 4OZFG 3BKYL 1Z2KA 2HKHH 1HINH 4OF5A 4LKCA 3G5XB 3WUZA 3BH9A 5I2IA 4HIXH 2EIZB 3TO2A 3GKZA 3KPQA 1LILA 1FO0A 3GSRB 1LK2A 4XMLL 4ZXBD 5IEHA 2FLRT 1AD0A 2C3VB 1T83C 3ZL4L 5DYOA 5FYKD 1FZKB 1X5HA 1JF5A 2JIXB 3JWDC 3A6BL 3L5HA 4MQXD 3ZKQD 5EBWA 3X13A 2FX9H 2DQFB 1A6AA 1I7TB 1A6TB 4YK4C 5INCB 3NOIA 5IB1A 5ADPH 4PJ8B 5F8RC 2FGWL 4JDVB 4MS8D 1DQMH 3WXVH 2GYSA 2IJ0C 1U42A 4OGAD 5DUMH 3P3YA 4KJQD 4XC1L 4DN4H 1EO8H 1J0HA 5AG8A 4E42A 4LSQH 3QUMH 4NWUL 1AR1C 5ESAB 4RGOL 3MRGB 1E4XH 1AO7B 5L2JB 1CDHA 5F7FA 2WIIB 1UZ6F 2NY5C 1HIML 5FYKH 2W92A 3CAFA 4WGWB 3MACL 5GJSH 1RUKH 2QQKL 1JPGA 1TETH 5F9WC 1V8HA 3TYFA 3PXJA 4NJ9L 2W0PA 3LEYL 2DWEB 3MOAL 4TUJB 3MOQA 1IGJB 1KTKE 4EOWL 4WW2A 5HGBA 3Q6FB 4HG4J 4PRAB 5CEXB 5E5RB 3T0EA 3VGGA 1CXFA 15C8L 4U1HA 3NIFE 4ZFZA 4NKDB 1U6AH 5BJTB 2HFEA 4ZSOB 3MLYL 1MCIA 2LVCA 3VXRE 2Z91B 4X9HA 1MJUH 2Z8WC 3LB6C 3UJTL 4BUGA 3RHWF 1ZLSL 4OQTA 1FZMB 2NZIA 3DETD 3VD7A 1OB1A 2AJYL 5CIPB 1MHPL 5DD6B 1KPVA 1HOCB 3SDDA 3PP3K 4FMFA 2VYRE 1Q1JL 5FO9B 5J06A 3VWJA 4TPRH 1N59A 1N5YH 4YHYC 4P2QA 1MFEH 5BXFB 1T20B 1XGTA 3RHWK 3HA0A 3FQWA 3T1FB 2VN7A 1OAKH 2XN9D 4EN3D 1MIEL 1NC4A 1FAKT 1C12A 1WLHA 4JFPB 1DZBA 2IBGA 2PW2B 3G5ZA 4QHUA 3GSNB 5KANG 3PHOA 1KF9B 1KSRA 1R5IA 5CP3H 2PNDA 2APWA 3U7WL 5IIEB 4OAWB 5DTFB 1TVHB 2VDPL 3PWNB 5E8PA 1KB5A 2X4RA 5I1HH 4NQCE 3DUHA 4PJ5B 4X6FA 1DL7H 3PQYD 1DVFB 3IKCB 3VXUB 4G3YL 4P23D 1NPUA 4NP4L 4ELKB 4QGTA 5JPMB 4OFKA 5GGTL 3MRHB 3RU8H 1S78D 2QQLH 3NA9H 2Z93A 4R26L 4G6JL 1KEGH 3THML 4GS7C 5HHVL 3JUZA 4MDJA 3INUL 2EO1A 5E2WL 4OLEA 3UAJD 1T03L 2R2BA 2HWZL 3X12B 2AQ1A 2LV4A 5EU3A 1UWEL 5E4EC 3PXHA 1GGYA 2UYLA 3PP4L 4KDWA 2A1WH 4U1SB 1WT5A 5D72H 1A3RL 4R4ND 4MA7L 1URLA 3OWEA 4KKAC 4M3JA 2DQIL 2IANE 4OLVH 4HPYH 3ZTJH 4LSUH 4PGEA 2P45B 1I85A 1QKZL 4F57L 4CL7A 3WKMH 4TSCL 5AAWA 3KYMB 5T1DL 1AR1D 3ZHLA 4FQ2L 1IAIH 2ESVD 3VFTB 3TYGL 3E8UL 4TSAL 5DQ9A 1IAKA 2F53A 2AJUL 3EJYD 4Y2DB 2O5XH 1XF2A 1DBAL 4XHJD 4LLAA 1YEFL 4MCYA 3M17B 3QO1B 4LLYB 1CT8B 3JTTB 4CN6A 1GRWA 4PJDB 3D87B 2V5RA 3DO3A 4PLOB 4XPAL 2FX8H 3U46A 3A67L 5IB4A 4U6YA 5CUSH 3QDJE 2P1YA 5DRWA 1P7QB 3MRMA 3WNKA 1S5IH 3O2WH 1CF8H 2W0KA 2UWEE 3TN0B 4NQUA 4YDJA 3VCLB 4RBPK 4OI9A 4PRHB 5LXGL 2VLME 3L95B 3NACH 4HJGA 3QEHB 4G80B 4OZHE 4NO0B 1EPFA 2HT3D 2OJZL 3IDNB 4I18A 3O4OC 4NZRH 4Y89A 5DJCA 4YIQB 4CU6A 4NKIH 4XRCA 1RZFL 4UTBH 4NZUH 2EYTA 4GMSL 4Z0XB 2EIZA 1WBZB 4PV8A 1C5BH 1UG9A 1F6FB 4KWUA 1ZLVK 3GSRA 3WEXB 5HYSG 2FIKA 3D39A 5E2JA 1ZVHA 4EXPX 2C3VA 2NXYB 1DLFL 4JGJA 5GJTL 3I84A 1WZ1H 2HVKB 5DUPL 5KOVC 3LPWA 3EFDH 25C8L 1GSMA 4U4BA 6CGTA 2FZ3B 4L4TA 3BD4A 3O45B 3O3DB 5FOJA 1ORQB 1A7OH 1IAII 4LDEB 2DQFA 4FZEL 2MMXA 1I7TA 3TP4A 1F4HA 3IDJB 5INCA 1IAOB 3KPTA 3P9LA 4GAGH 4PJ8A 4I2XE 4JDVA 4DKDC 2MSPA 3IETA 3BAEL 3TO4D 4X6BB 4NKQB 4NM4H 2VQTA 3HNVL 1YEDB 2DKSA 3B9DA 5I1AB 2EIBA 2OP4L 3FFCD 5EO0A 5HHPA 1B2WH 2ITDB 3QDMD 4K7PY 2VDKH 4GJTB 2CK2A 4KTDL 3IU4H 4PGJA 3IAGC 4Y5VC 1AO7A 5L2JA 4V1DE 4LLWB 4BUHA 4Y0GA 4JEGB 1YN7B 2E7CA 4GKZA 1RUAH 1YQVL 1I3UA 4QTIH 1FPTH 3QEQE 1IAIM 4PJEF 4NQVB 5H94A 2ZCKL 3BDBA 4F8QA 3S36L 2DWEA 4TUJA 4U1NA 3GFUA 2W91A 4ENEC 1TTGA 3Q6FA 4OFIA 2AJSL 4OD2A 5MI0B 5DJAB 1D5BB 3RDTB 1NGWB 4I3SH 2H2PC 3VRLF 2IFFL 2PKDA 1HHJA 4BSVB 1U3HB 4PJDF 1DEDA 1FC2D 4NKDA 5BJTA 3GBML 3T8XA 4ZSOA 1LO0H 2ZUTA 2BVEA 3NPSC 2Z91A 4Y8DC 4I4WB 1UM5H 5SWQB 1EJOH 1I9RL 3N85L 2EDNA 1FZMA 1QQDB 2DKUA 5CIPA 5DD6A 5DMGC 1HOCA 5DO2C 1M7DB 4R8WH 4P2YA 1FO0H 4PTUB 2V2WB 5E2UH 5HHMD 3T08A 3MZTA 2IPTH 3VRIB 1T20A 5I74C 2VC2H 5DFVD 5E8OB 4P0DA 2VXUH 2CLVB 4YPGA 3PWPA 2NW3B 1N0XH 4YDLC 4Y4HC 4QOKA 3HTLX 4JFZL 4JFPA 4G7YH 3VW3L 5L0QC 5MP6L 4S1DC 5B39B 2PW2A 1U8KB 1OLZA 4DCQB 5ADOH 5ITBL 5FUOL 3T0ED 5IIEA 5JW3H 1TLKA 4OAWA 5DTFA 3RVXC 3PWNA 3TWCH 2IGFH 3MLRL 5CEYB 5DJ2B 5C0BB 1BVLB 4JHBA 4RRPA 4PJ5A 1DVFA 3IKCA 3VXUA 2IBZX 4LK4A 5ICYA 2NY0B 2HKFL 3UROR 4OD1L 5JPMA 1W72B 4FQJL 4N90D 3LKQB 3MRHA 2OYPA 4EZMA 4K94L 1T1ZA 3ROLB 5KJRL 3AREB 1U8IA 1RIVL 2X09A 1K5NB 2FJFA 1KELL 3SDDD 5CBAB 3UJJH 3ARFC 2R1YA 4MD4B 2VRAA 3V6OC 3VWJD 3GI9L 3X12A 4WHTB 4A6YB 4P2QD 4KK5C 1P9MA 4P9MH 5KW9L 2AXJA 3V7MA 4U1SA 5HI5C 2ICEA 4JB9H 4XPFL 2JELH 3Q2CA 4KZEH 1JGVH 2G5RA 1UJ3C 3QXWA 4LCWE 4NJAL 1G0YR 1JFQH 1T0NB 3G04B 1AXTL 1NL0L 1NC4D 1D9KC 2GSIA 5F6HJ 2JKXA 3NMEA 1XF1A 3SGDI 1E27B 3ESVF 5ENWA 1YNTB 2R0WL 1N6QH 3T77A 5BW7A 3FT2B 2Z31C 3O8XB 4OQTH 4HHAB 4GXUN 3MRPA 2GHWB 4U0QB 1H5BB 3TV3L 2YR3A 4K7FB 2XOTA 1S7TB 4TTDC 1A64A 4S0TD 4DUVA 2F5BL 4OCRH 4AG4L 1NCWH 1SEBB 4BKLA 1C5CH 5CCKL 3M17A 1BQUA 3QO1A 4LLYA 1CT8A 3CFDA 1OM3H 5I18H 1UH2A 5D7JC 2ORBL 3JTTA 4ZFOL 4OLZL 2G60L 1EEZA 4PJDA 2GY7B 4Z5RB 4RISH 5ID0A 5I1IH 2NY3D 1WSST 3OR7B 1U36A 1A14H 1P7QA 4JFQB 5DD0L 2FGZA 5GGVH 3MGTB 5FYJD 3TN0A 1DBJL 1BF2A 1J8HA 2KQNA 4PRHA 3W2DL 1MWAB 3L95A 3U1SL 4X7CC 2EDJA 4PRNA 3QEHA 1KB5H 4G80A 4LEXL 1MPAH 1XCQA 2NXZD 2QSQA 5FKPB 4BH8B 1CFVH 1WFTA 1X6LA 4C59B 5JMRA 2ZCHH 1EZVY 1PAMA 5I15L 2YN3A 2YUZA 4PG2A 4M7JH 4P2OA 1FLTX 5DO2D 3HNTH 1GIGL 5D2LB 2ICWA 1MRCL 1RU9H 5IW6B 2NY1C 3BRFA 4Z0XA 3RWEB 1WBZA 1M6OB 1LQSR 5C0IB 1GH7A 5CKGA 2I60L 5I6XC 3SKOA 4IBLT 1HNFA 3CX5J 4CVWA 5D71L 1MY5A 3S4SA 5J11C 4PJCE 2AXFB 4XXDA 5DRZB 3BEVB 6FABH 4YHKH 3V52L 5T3ZE 2WBJB 2YKLH 1JE6A 2FZ3A 5FYJH 3MQIA 4HQQL 4CU7A 3V7AG 3MREB 3VWKB 4F7MB 1ORQA 3T3ME 2UWEB 5IJKA 3IDJA 1XF4B 1IAOA 3U9UA 1JWSB 5C0FB 4K8RL 3WFBL 1UEMA 3QIUB 3REWB 1IL1B 1WZKA 1P7KA 5IFJB 4XVJL 4JPWL 3STZB 3S7GA 4K3JH 1YEDA 2LABA 5I1AA 1I8LC 3CXHK 4WFED 1GZQA 3WIIH 5LQBH 1NH6A 3UPAA 2F58H 1KCSH 2SEBB 4WVRA 2ITDA 3PWVB 3WHE0 1OAYH 3P40A 5FK9B 4XVTL 4DGVH 3KPMB 4HULB 2VXSL 4KQ4L 3D0LB 4ODVL 1OGAE 1LMKA 5D7IE 3K2MC 3O6ML 3CJJA 3D39D 3FN3A 4F15C 1ZS8B 2HAZA 2D7MA 2HJFB 3EDKA 5DJAA 4Y5XC 1D5BA 5DK2A 2IQ9H 5CILH 1CICC 4R4FL 2EE2A 5BV7H 2BNUA 2DLEA 4YXLL 1T2JA 4ZTOH 1G7MB 1NCNA 4L4TD 1U3HA 4BSVA 3H9ZA 4R7DA 1BFOB 5A2LH 4HKJA 4PJBE 5M7QA 4I4WA 5J3HD 2R0ZH 2CLZA 4L3EE 4ZOBA 1QQDA 2YEZB 4XNZC 4XXCC 3EHBC 4JG0L 2FH8A 4AJ0A 1HH9B 4JQVA 4JO4H 1ZA3A 4V1DB 3GI8L 3MJ9A 4P9HL 4M8VA 2X7LB 1FQ9C 2YWYA 1MRDH 4UDTB 3VA2C 4PTUA 4JO1H 3ZZ1A 2V2WA 1BFSA 3QEQB 1B0RB 1WZMA 4PRIE 4WFGD 4OF3A 3DSNA 4XWGL 3VRIA 4HK3J 3OR6B 5D7LE 1NGQH 4OSUL 5E8OA 1U95A 2R29H 2CLVA 4HC1L 5DRXB 5IQ7H 1VB9A 4POYA 1JV5B 5H37H 5DUBB 4Z8FH 5B39A 1U8KA 1YEEH 4DCQA 3UBXI 5FCUH 2AEIT 2FJHB 4FQXB 1S9WB 3ARBC 1F4YL 4RFOL 5MEQB 1LE5B 4NO5A 5CEYA 5FHAL 3EFFA 2UWEF 1U6AL 4LCIL 1MCQA 4PY8J 5DC9B 3MODL 3V0VB 1PKQB 2NY1D 1W72A 4OZHF 3LKQA 3UZVB 3PGFL 5L9DH 5JHDE 1DSFL 5GGQH 3LHPH 4KUZL 4YHNA 3ROLA 3AREA 5HVHB 3IAQA 3MUZ1 4YDKL 2DQTH 1K5NA 4MD0B 2Q8BH 1I3VA 2RBLA 4P2OC 1CDCA 1EMTL 1Q72H 4MD4A 2ED7A 4CDGC 4TPRL 1UWGL 2EXYD 3BE1H 5AG9A 1HHIB 2GJ6E 3NFNB 3BPNB 3ZHKA 4A6YA 4KZDH 5F1IB 2QSTA 2XRAL 4GW5B 2OTUB 2YRZA 4XAWL 4FQIH 2X89D 5IGXL 5I30L 2C4XA 2Z92A 4ZFFA 3PWPD 4Y4KB 1T0NA 3G04A 1OAKL 3WNOA 4QOKD 3FMGL 3HRPA 4ZS7H 1FLRH 4RMRA 1EIBA 1CLYL 4DAGH 1E27A 2G5BB 2HLFC 4XAKD 2CPCA 1YNTA 4NQCA 2XA3A 4YHZH 4ZOCA 3VGDA 4H20L 4L9LC 3FT2A 1EGJL 1QFWL 3O8XA 4ZUTB 4Q2ZA 1H5BA 3AS2A 4XCYA 5CIPH 2YD4A 4K7FA 1S7TA 4PJ5D 3EZ8A 3WFEL 1DVFD 3VXUD 5JXAL 5JXEC 5IMMB 2UY7A 3ME0A 3BYTA 4O2CA 1SEBA 3ZDXE 2NYYC 1OARH 4MA3B 2F5AH 1FH5H 1D5MB 1NDGB 1TZGL 5F7EH 3HZYB 5DVLA 1WBXB 3RU8L 2OMBA 4Z7VB 5LBSL 2E27L 3VH8A 1Z0MA 2A74A 1JUFB 4Q9RH 5JQ6H 1HK6A 3RBGA 1QYGH 3TBYB 3OR7A 2PTVA 1FL3B 4P2RE 1EDQA 5I1LB 3GSNH 3HG1E 4JFQA 5CD5C 4K3GA 3MGTA 2IANA 3IFLH 3OKNB 1MJ7H 1MWAA 4PYHA 5IKCB 4C4KT 1IARB 5BZWA 4FNLH 1RV6X 5IBTH 5IW1A 4BH8A 1LP9B 5FKPA 4HKZB 4RAHA 4D9RD 4UILH 2E7LA 2ZKHH 3MBEB 4JFYB 3FQRA 4V2CB 4MQ7B 2UVEA 4F58H 1JRHI 5IW6A 2R8SL 3CU7A 3U4EB 3LV3B 3L3GB 2IBZY 5IG7B 3IDXL 4IM8A 1M6OA 4KKNA 5GXBB 4XP9L 3KPSE 1HHGB 4P5KB 5TDNB 3GMMB 1LO3H 5F9DC 2XZQH 1L7TH 2DQCH 3QULB 3CZJA 3VE0B 4S2SB 3ALXA 4UUJA 2AXFA 4APQC 2ZG2A 5T1KB 5DRZA 3BEVA 3JWDL 1GHFH 4DN3L 2WBJA 1N7ML 4IJ3C 4PJAB 3MREA 4F7MA 3QDJA 1MRFL 4UNVA 1EFXB 3NZHH 4TNWF 3LKRB 2UWEA 5L8JB 1XF4A 5JA9A 3RTQC 4WV1B 3QIUA 3MLPA 1UXWB 1IL1A 2HFFB 5IBLC 3I3DA 3REWA 4OZHA 5IFJA 4KHXH 3LD8C 4J6RH 1P7QD 3RVWC 4P4RA 5J4MA 3W11C 3O2WL 3TN0D 3KJ4C 3HFML 4C58B 1J8HD 4OBRA 4X8XA 4PRHD 4POZC 5BMFH 3KS0J 2SEBA 3NACL 5MEPB 1MCRA 3PWVA 3VMNA 5KSAB 2X5PA 2NY5L 4Y4FC 2ZUQB 1TPXB 2VLLA 2YPLB 2BSTB 1WFNA 1BEYH 1E0OB 1BREA 5E99H 4NKIL 1RZKC 4P2OD 3RIFF 2MKWA 1MIML 2FATL 3D0LA 1I1AA 4PJCB 1D5ZB 2OJEB 1JYVA 3R0MA 1IKFH 2X40A 2IAMB 1H3PL 2L4OA 4KI1A 3WLBB 1D6EA 2APFA 3MV9B 1SQ2N 3G6DL 4DJMA 3LN5B 4FZ8L 5C2UB 3ZYOA 3LKNB 1ZS8A 2VLRE 1CGUA 2VDLL 4Z9KB 3UEZA 3RIFK 4ZNEE 1XZ0B 4I2XA 3KDMA 5FGCE 3T0DA 2HLFD 2X1OA 2RB8A 1KJ3H 3HCVB 1BFOA 2I9TB 4Q6YA 4HG4K 4QT5B 5AZ2H 3KPNB 4OFDA 1K2DA 1Z9OA 1MCNA 1CU4H 4FN0A 1LD9A 2E9WA 1F4AA 4LCYB 1JGDA 1H8OA 1G7PB 4KJWC 1KTLA 4NC1C 5JXED 3CXDH 1D5IL 3STLA 3WDHA 3MRNB 3ZDYE 4UIMB 4V1DA 1G7JB 2NY6C 1CE1L 3RAJH 1DDHB 1B2WL 4N0CD 3EYQD 4C57C 4JHWL 1CFNB 4UDTA 4PGDB 3H7LA 1F13A 3QEQA 4HMCA 5J89A 3BZEB 4YHPA 3OR6A 1UA6H 4HPOH 3O81A 3BKCH 5JQHC 3NPSB 4UBDC 4QTIL 1JYXA 2Q6WB 3KNBB 5DRXA 4PJIB 1EEYA 1JV5A 1QNZL 5DUBA 5CD5D 2EDDA 1PZ5B 1DN2A 4OBSA 4KTEL 4HDIB 4QWWC 3U6RB 1PGRB 4IOSD 2FJGB 4S1RH 3A0OA 1DN0B 2FJHA 4PGBA 3VFOA 2Y36L 4FQXA 1S9WA 3MROA 4HIIB 5MEQA 3P4OB 4I3SL 2CUHA 5EN2B 2PTTB 4NN6B 4NO3B 5EOCL 5IB3B 1U3HD 4HUWA 1FNSH 3QDAA 4XCFL 4YDIH 5DMIH 2DI9A 1LO0L 2V2XA 3V0VA 2QLVB 5TE7H 3DI2B 1BX2B 1ORSB 43CAA 1RJLB 3NCCB 1Q94A 3SO3C 5BRZE 4Y4HB 3K7UA 3EO9L 3FAWA 3WIHA 3FRPG 3SKNB 1XR8B 3J8F7 3IGAB 3HE7B 3MV7B 4H0GA 2E9IA 2KZ1B 3UTTE 1VEOA 3HI1B 1HHIA 5L6YH 2PUQT 3U30B 1F00I 3NFNA 5BOPA 4O4YH 4WCYH 3IDGB 2FR4A 4W6YB 3RWGB 1V7MH 4RMQA 2MQ0A 4HXAH 5IHZB 3SE3C 4PJCF 2VE6B 3G5YB 2ICWI 4Y4KA 2EDWA 2WANA 3IRPX 3TBSB 1FL5B 2IPUG 5ALCL 4D9QE 5KTEH 2F8VA 3FQTB 3BN3B 4IDJH 1ZOXA 3H6JA 2LTQB 5FGSA 1YNLL 1S9YB 3T3MF 1ZGLA 1KCVH 2PF6A 4ZUTA 5F1OB 3ARFB 1A5FH 1WC7B 2Q3ZA 5TGBB 4Y4FD 5DVMA 3TWCL 2IGFL 1UKSA 1N2RB 5F9OL 4LSTL 2NY2C 4AEFA 3SE9H 5IMMA 1I9IL 3MJ9H 3QG6B 5CKAA 1UM6H 1OT2A 4NC0B 1RUMH 3KLHD 1IGTB 2Y5TB 2V7HB 4D3CH 3HZYA 3VXOB 1N64L 1WBXA 1A7BA 2CK0L 3GJFK 4Z7VA 5B4MC 1NBVH 3ARED 2YRLA 5I1JL 1BIIB 3QIBA 3BDYH 1AY1L 5D1XC 1JPSL 1IBGH 3KYKL 1TENA 1A7QH 4OGXL 2OX5A 2Z31B 3OB0H 4LCWA 3TBYA 1DQTA 1FL3A 4H0HB 5I1LA 4KMLB 4LQ1A 4QKXB 3D3VB 4RDQF 3EYOA 4P9ML 3S97C 3BHBB 5EIIB 2ZCLL 4TVSa 3ZYIA 5IKCA 1QUNA 3QJFB 1G9NC 3EKCA 5KAQF 1FNEB 1Q0XH 2VH5H 1JPFB 4HKZA 4LAQL 4KVNL 4NPYB 1U91B 5B22A 5ALBH 3MBEA 4NC2B 2J5LB 3DMMA 3GM8A 4PD4K 1KEMH 5I1CH 4XX1G 5D7JB 2DJUA 3TESA 4MXQC 4NQCD 1OSPH 4HWNA 1W72H 3CVHB 3OTTA 4DGIL 4PJBF 5EO9B 3O8XD 2AXGA 3U4EA 3ET9F 4KVCL 5IG7A 4CAGA 3VXNB 3DX8B 1HHGA 4LVOB 4K23L 4QRPB 3GMMA 5GGVY 3DARA 1KIPB 3QULA 2AJ3A 2C3GA 1QFPA 3TT3H 2VZVA 1SMOA 4JO2L 1I75A 4J3TA 5CINL 5TH2B 4JDTH 3TGXA 3LZFH 4A6YH 1YEKL 2E6QA 4DVRH 3OXSA 4GG8B 4PBVC 1OM3L 1TZIB 5CMAA 4PJAA 3EO1B 1A47A 3H7BA 1DQQB 3P0YH 3HG1B 1IT9L 2VLKE 1AGBB 1RMFL 3LS4H 4W6XB 1J5OL 1ZWIB 5JW5B 5I1IL 1QLFB 4WV1A 1UXWA 2HFFA 2HTKD 5EZLB 1YEJH 4H26B 4CNIB 1A14L 5FF6B 2V5SA 2IAND 3ULVE 2BNRE 1XIWB 3OMZA 2HTLD 4F7TB 2NW2B 4OD3L 3WD5L 2HT4C 2FX7H 3KYAA 5DC4B 3GGWB 2WWKO 5KSAA 1MFDL 2EDYA 1I7UA 4YLQT 2YPLA 5DJ6A 1PY9A 2BSTA 2P46B 1U0QA 4M61A 5DJZB 1RU9L 8CGTA 1VFMA 4PJCA 1D5ZA 5CGYC 4LEOB 4YXKL 3V79C 3WLBA 3C09C 4NM8H 1D3CA 3LKNA 5T5NF 4EBQL 1QSFB 3T0WA 2DDQH 5EDXA 3VRJA 3CU1A 1CR9H 1R3KA 2BVUA 5IM7B 4OM0L 4LPUA 3GJFA 6FABL 3GMOB 3G6AB 1RZJH 2WBJD 5D70H 3AC0A 4IMKA 1E6OH 3GHBL 2YKLL 1MWAH 4QXWA 3QDJD 3CVIH 4X80H 3UYOD 1NSNL 1U3JA 1BBJA 4X7DC 2I9TA 5EPMB 3DX6B 1MOEA 3SKMB 1V7NH 2VLMD 3QIUD 4HH8A 4LCYA 3BZDA 2DWDA 4PP1C 5C08B 3FQNA 3WHE1 2I25N 4K3JL 3ULUE 5LAXA 3MRNA 4UIMA 1G7JA 4Y2OA 4HFWA 4L4VE 3SE4A 3BQUC 1DDHA 1CFNA 4KK9C 1OGAA 2OR7A 4PGDA 4UDUA 3GMRB 4NCC2 5B4MD 4I0CC 1NQBA 2X4QA 4DGVL 1HH6B 5IHUL 4NN5B 4Z95L 3O3BB 3TT1L 2B1AL 2VLRB 2BCKB 1I1AD 1ZVSB 2Q6WA 2R0KH 4X7FC 5C2BL 3I2CL 1NMAH 2AK4E 3Q1SL 5EC2B 4HJJL 1LK3L 3HZKA 1PZ5A 3DO7B 2H3NB 5TQ2L 5I73C 5DHXB 1ITCA 2V6HA 4HDIA 1S7WA 4U49A 2AK1H 1DN0A 5SX5K 4PJBA 4HIIA 5CILL 3P4OA 2IPUK 5IUSA 4JZOA 5EN2A 2PTTA 5IB3A 2GAZB 4PGCB 5DQDL 1AGCB 1JPTH 4PIRF 4UB0H 1EK3A 1A6WH 1FGVL 1OTTC 4WFHE 1J0ZA 4XPGH 1KCUH 3CH8A 4FFVD 1BX2A 1ORSA 1RJLA 2LE9A 4LOUC 1HEZB 5T5FH 1IFHL 4XP4L 3JWOH 3V95A 3DMMC 5GQBA 5IVXE 5CZKA 4L4JA 1XR8A 4V1DD 3SDXB 3IGAA 4M93B 4E5XB 3HE7A 3QCVH 1CFQB 5HPMB 3I9GH 1U8HB 1MRDL 3QEQD 1CDGA 3VJ6B 1Y0LA 4J1UB 3TA3B 3EOTH 4KU1A 4I0KA 1FDLL 3NCJH 5IHZA 2OLDA 5IP4A 5KSBE 2VE6A 3G5YA 3HC3H 3K8MA 3TBSA 1FL5A 3HPLB 3L1OL 2D9QB 4CDHA 4RAVB 5IQ7L 3FQTA 4FABH 4OJFL 1K4DB 3I50L 3DBXB 4K3DL 2VXVL 5DVOA 4OCXL 3REVB 1GOHA 3WSQH 3SDCA 1HQRB 2ATPB 4KK6D 4PRPE 1CBVL 1WAAA 4FQXD 1AH1A 3M07A 3RZCC 4DUWA 5MEOB 1EX0A 5TGBA 2OZ4A 3L3HB 4RNRA 2CR6A 3BT2H 1N2RA 5JHDA 5SWSE 4LCUA 1CE6B 5BRZB 4ZOAA 4OF7A 3LS5L 3CFKB 2W0FB 4XNMA 4FMKA 5F89B 2UY6A 3PE9A 4XPHL 4YFEA 1KFAH 1IGTA 2Y5TA 2V7HA 5CGYD 5HHQB 4JJ5B 1TNMA 3HZVA 5F6IB 2GJ6A 4WHYG 5E5UB 3RX8A 3MCLH 2X1QA 1Q72L 3ROOB 2I07B 5D96C 3RWCB 5AYQA 2VDRL 4XP1H 4JFFB 2HA1A 5I0ZA 2OQJB 3W9DB 4KZDL 3DRTA 1QOKA 1SHMA 3HLAB 3QFJE 3QR2A 4ZPTB 1JRHL 3CDFA 5E70A 3BHBA 4GSDH 5C09E 3GSUB 4R0LA 3KR3L 1RFDH 4Y4KD 1FNEA 5DHVB 3S35H 1JPFA 4NPYA 1U91A 4X99A 1NAKL 4LARH 1LEIB 1X5FA 1EAJA 4WEBL 1QR1B 4UAOC 5FHBL 3W9EB 3CVHA 4YHZL 4WHCA 5GGUB 5BVJA 1X4ZA 4G6AD 1ZANL 3HAEG 2D7TH 3DX8A 1XGYL 3SE8H 3WIHH 1LO2H 1FVCA 2O61A 4ZAKC 2ZNXA 2QADC 2VDMH 3ZDYF 4ONHB 2JJUA 2A73B 5J1AB 1GCFA 4X5WB 4HMDA 5LCVH 4RA3A 4NQDB 5T33H 4GG8A 1GGBL 3H0TB 1TZIA 1RAMA 3O9WB 1T22B 3CX5K 3SDXF 1DQQA 5HYSB 3HG1A 4GUPB 3QIBD 1SEQL 4TUOB 1AGBA 1MFAH 4JG1H 1ZWIA 4TN9A 3X11A 3LIZH 1DQLL 1QLFA 3LOWA 4UTAL 2F8OA 4LCWD 2BVOB 2XTJB 5ESVB 2OL3B 5IEKB 5EZLA 1DE4B 2VZSA 3QAZB 4H26A 4CNIA 5FF6A 2ITCA 2Z0BA 4HIHB 1A6UH 2W0LA 4U0RC 1KXTB 1YYLL 4X5XB 1MJ7L 2NW2A 1KJMB 2OK0L 2B5IB 1INDL 1Q9KB 3GSQB 4APQB 3UDWC 3GGWA 3MBED 1M7IB 5B8CB 2ZKHL 3DMMD 4JRXB 2MNUA 3KPSA 2H41A 2XFXB 2JJSA 3KPOA 4KHTH 3Q6GL 5A2KH 1W2KT 5DJZA 2M1KA 4LRIA 1NMBH 4WI9A 5C0AE 4LCCA 4LLDB 2PXYC 3L3KB 4LEOA 2C4FT 3VFWB 4ORZC 3GKWH 2XZAH 2BP3A 2QEJA 4XPTH 5TDPB 4YEEA 4GG6B 2DQCL 1QSFA 5I76A 3KJ4B 2B2XH 2UZIL 4TQEL 2C3WA 1F8TH 2NX5E 3G6AA 5FA4B 4P4KB 4FFZL 4N8VG 3HB3C 3WMSA 1MVUB 2V17H 3TBWA 4G7VH 1HXYA 3B2UD 3KG5A 3DX6A 2BNRB 3SGEI 4F7CB 5DF0A 5IT2H 2BJMH 43C9B 4U1GB 1CI5A 1IGML 4C56E 1MNUH 5E2VL 4OCYL 2CJUL 2G75B 2WSKA 1EJ6A 1HQ4A 4YHLH 3CPLA 3B6SB 3HKFA 1MCOL 3SDCC 2MJWA 4RFNC 1A6VH 1IM3B 1FJ1A 5KSAD 3GMRA 3C2AL 2NNAB 1FRGL 4J3VA 1HH6A 3VFRB 4ONGH 5DJYA 3L5WB 1OPGL 2AEQL 1AC6A 3SCMA 3KVQA 1U8QA 2VLRA 4G6KL 4WUUB 5JW4Q 2BCKA 1X4XA 1FZJB 1FFPB 1AXSB 4CKVX 3OKLA 3WNPA 4YJZL 3JBG7 4OZGE 5E1AB 5EZOH 2H3NA 4WWKC 3G5VB 3MLZH 4KKCC 4ALAL 5M94B 4NKOB 4Y5YB 1GGTA 3QPQD 5HBBA 5J13C 2CH8A 2FECI 4PLKD 5DEGA 3NABH 3C8DA 2Y07H 3B9KB 4QTHB 2GAZA 3ALPA 4PGCA 1AGCA 1QRNE 1N6VA 1DTUA 4YGVB 3AS0A 1QD0A 1MVFA 1YQ2A 1AC0A 3MXVH 1HEZA 1ZGLM 4JVUA 5TF1H 3IXAB 3MRBB 1BECA 4ONFH 3OKKB 4IRZL 3S35X 2C1OB 3RVUC 2C26A 4HIEB 3SDXA 2AI0L 4LIQE 4X7EC 4L8CB 4E5XA 1M05A 4LSPL 1CFQA 5HPMA 1YC8A 1LDSA 1YY9D 2ZUYA 2HN7B 4DQOH 1QSEE 1OGAD 4M03A 4J1UA 3TA3A 3P77B 4X9IA 2XZCH 4GRWE 1NJ9B 1HSAA 3E3QC 3MTRA 5AWNL 5E6ZA 3OAZK 2MPAH 5J12C 3UTZB 1RVFL 4XP6H 4KKBC 4K9EC 1YJDH 1VESA 4FTVB 3RNKB 1HWGB 3HPLA 1T3FB 2DIJA 2W07A 3BH8A 1K4DA 1IEBB 3SKUD 2ICES 3DBXA 3ILQC 1JIBA 4HUMB 4XCNB 5KSUB 4LVHC 3UP1A 1VSCA 5EIVA 3RWIA 4MD5B 5J1SC 4MSWB 3MA7B 2D9CA 5MEOA 1ED3B 5E7FA 4LPXA 4L3ED 3L3HA 3ULVF 1CE6A 2FEDC 5BRZA 3BP5A 1L4IA 2EEAA 3CFKA 2W0FA 3MO1B 4MNQB 5F89A 5IJVB 2VAAA 1PLGH 4U3XA 1BQHG 1A6PA 1TJHL 2WP3O 3OGCA 4M7KH 4LMQE 5D2NC 2PO6A 4Q74A 3X3GH 3UTTA 2JJSC 3WL9B 2D7QA 1DQJA 4HUUB 1MHHB 4G9FE 4BH7B 5DT1H 4UV4L 4OTXH 5D7LD 2R1XA 4XNUL 3B3IB 3ROOA 1AR2A 4HWEL 5KSBB 4P59L 3WJJC 4PUBL 3HB3D 4CVXB 1NCCH 2OQJA 4WCYL 3V6BR 3HLAA 3MLVL 3CLFL 4GQ9L 4ZPTA 3R8QA 2EE9A 3EYSH 1P4BL 3GSUA 1IGIL 4HXAL 1IC5L 1YYMH 3B5HA 1YEGL 2FO4A 4ODBD 5KVDL 4PRPB 2BSED 3P4NA 4NFBA 1EV2E 3NTCH 3CK0L 1OTUC 2ADJB 3DVNB 3W9EA 5SWSB 3SDCD 5EO1A 5EOCJ 4O5LH 4LGPB 5F96H 1FHGA 2P24A 3FT3B 4R90L 1XFPA 1L6ZA 5CEZD 3MOBH 1A4KB 4UT6H 4Z7WB 5JHDD 5GS3A 4ODTH 1EAPB 4M6AA 4JLRB 4EI5B 4ONHA 4OV5A 2A73A 3TZVC 5HGDB 5J1AA 1MI5E 3JVGA 1RZ7H 4ZYKB 3IAPA 3M8OH 35C8H 4IIQC 4D3CL 4D94A 3L9RA 5T3XD 3HUJB 3FT4B 3V4UH 3O9WA 1T22A 4LHQB 2ENYA 2GJ6D 4IMLB 4FG6C 4GUPA 5JZ7C 1ZEAL 5MHSE 4X6DB 1NCTA 3U2SB 5DJ0B 2EDBA 5E7BA 3GSOB 3QFJB 3TNNB 1P5VA 1FNLA 3QXDB 3SDYH 5C09B 3WUWB 3OPZH 4DKEH 1BWMA 3SBWC 2BVOA 5ESVA 4RWYL 5IEKA 4RQQB 4XMPH 4R2GB 2P8PB 1DE4A 3DSFL 5IHLB 2D4DA 3GNML 1CLOH 4HIHA 4YHOL 5A3IC 4HV8B 3IDYB 1U8LB 1KJMA 5CEZH 1MCCA 2OZ4H 1BM3H 1OTSC 3GSQA 2AQ2A 5FKAB 4NT6B 3DVIA 2VH5L 4WO4C 2YSSB 1M7IA 5B8CA 5DD5L 4JRXA 2W38A 1KEML 2CRZA 5D4QA 2B39A 1JI1A 3RWJA 1OSPL 5D7KE 5ILTL 3PG2A 1OP5K 4S0SD 5T3XH 2X4UB 3FOLB 4LLDA 2J6EA 1Q0YH 3L3KA 4WTXA 5B21A 3GUTA 3CSGA 1MLBB 2FHFA 2H45A 3VFGH 3HMXA 5C7XH 3VD3A 2KL6A 5IVXF 3MJ8A 5LGJB 4OCSL 3S5LA 2DOCA 4BQCA 4GLRH 3TT3L 1C8PA 4MJ4A 2XKSA 5TJWK 1CG9B 4LKXB 4LAJH 5FA4A 4P4KA 1TVDA 4JQXA 1MVUA 1BBDH 5HHXH 3HG1D 3OJVC 2EYSB 3MLXH 3UC0H 4UQ2B 5F7YC 3ISWA 2X4SA 1BZ7A 2BNRA 2MHAB 5KSBF 43C9A 2R9HD 1X9QA 1AGDB 5EZJA 3FZUD 3NFSH 5HDQH 2YN5A 1YEJL 2G75A 1NCBH 3CVHH 5SX5H 2EIEA 4ELME 4D9LL 2EH7L 1LO4H 4GMTL 2DD8H 4MWFA 3HZMB 1KC5H 4LLVB 2GJZB 5I19L 1RHHB 2BRRL 1QLEH 2EXWD 4UT7H 1SJVA 2A9NL 1XCTB 2NNAA 3KPSD 3QISA 1S3KH 4K3HA 3T0BA 4AEHH 1MF2L 5CHNB 3VFRA 3WFDL 4S1SL 1U8NB 2B4CC 3L5WA 3O6LL 4FQPA 4TVPD 3KXFB 5IW3A 4ERSL 1RK0B 3O6FC 4JPVL 2V5YA 4P48A 4ZDHB 1G9MC 1FZJA 1FFPA 4OZIE 3QIWC 1AXSA 2NX5B 3IU3B 3QNXB 4LVEA 1NEZG 3G5VA 1AD9B 4NM8L 3UZEA 2XTLA 4Y5YA 1HHKB 1SBSH 2APTA 3MFFB 3BQUB 1CVSC 3C5ZB 3B9KA 4Y1AB 4QTHA 4HUXB 1RZJL 2OTPA 1E6OL 4KJYA 4X6DF 4BYHA 3LMJL 4HLZH 1WK0A 5HVGB 4FXLA 2CLRA 2HLAA 1G7IB 2NTFB 2HMID 4MQTB 4HT1L 4L4VA 2RIKA 3A6OA 5IV2B 1F4XH 2V9RA 4GLRI 3SDAB 4RFEB 3NFPB 3U0WH 3MRBA 3BESR 4TVPH 2C1OA 4L8SB 2IG2L 1NC2B 4K3EL 3OAUL 4KRNA 3EDJA 4TULL 3QZWA 1Y18B 1JTPA 3O3UN 3H9HB 2FH6A 4EUPG 1FV1A 3ARGC 4NOBA 3GM0A 2AK4A 4OKVA 2HT2C 4L5FH 2P8LA 3SCMD 3LKPB 2VLRD 2HP4A 4LSVH 1NLBL 2LFGA 3TJEL 1T3FA 1JHLL 4HWBA 4KH2A 1IEBA 2YUVA 1XMWA 1S5HA 1ZHNB 4Y7MA 5KSUA 3I3EA 1U92B 4IS6B 3QEUB 3LH2H 4J4PC 1QRNB 4OT1H 2AK1L 3QUYB 1I9JH 1OTSD 3A6CH 4JN2B 1XGRA 4PB0L 2CKBB 4XZUB 4KROB 1X7QB 5IB2B 1ACYL 3J7HA 1JPTL 3U79A 1AFVH 4WY7H 5GRUH 4M48H 1NANI 1SVCP 3MO1A 1KCUL 4MNQA 1JWUB 5IJVA 2O26U 5J9PA 1E28B 3PF2A 4I0PC 4XMKL 3ZKXB 1E6JH 4KPHL 3KPRE 3PUCA 5KS9B 2N1KA 2X1WL 5IMLA 5JUEL 3QWRA 3R1GL 3WL9A 5IB5A 4NNXB 1MHHA 1OWWA 4R4BA 1YY8B 4GRWB 4PJFE 2R2EB 5JO5B 3B3IA 3MXWH 4QRRE 5KSBA 1CLCA 2DMKA 3SHSA 4CVXA 1TNNA 5DJ8B 3TA3D 4P5TB 3MRDA 1H3VA 4YZFE 5E00B 4HSQA 1H8SA 1BJ8A 1HDMB 4JREB 1J8KA 4JRWA 2JB5L 4QXTB 1A3LL 4PRPA 2ESVE 1FE8L 1BLNB 3GRWL 4JM4L 4HX1B 2WUBL 5IFHL 2QHRL 1IGCH 1V5JA 1OW0A 4DZ8B 1CD8A 4DVBB 4R97B 4I1NB 4DTGL 3DVNA 1RZGB 3JTSB 5SWSA 4YHML 1RIUH 1UQSA 4DKFL 3MRIB 3FT3A 1D5XB 3QSKB 2FO1A 3HPJB 5TPWH 4Z7WA 3QPXL 1EAPA 5BRZD 4JLRA 4EI5A 1PVHA 1ZK9A 4TUKH 1HXMB 2JF1A 1EO5A 2DQGH 5ETUB 2QQNH 2ARJQ 2PO6D 2EDKA 5F71A 3UTTD 3L7FB 1BGXL 4XVSL 4X6DA 4G8FB 4NQEB 3U2SA 5DJ0A 4O2EB 5HGAA 2BHZA 3QFJA 1IQWH 3C5SB 1J1OL 4C83B 1A9BB 1NUDA 3EYVA 3QXDA 5C09A 3WUWA 2E3VA 5K33A 3NPZB 5L7XH 3D18B 2P8PA 4XP1L 2V9TA 1JBJA 4HS3A 1I8MB 4OZGF 3ARDB 4D9QD 3C9NB 1HI6B 1MJ8L 3CFCL 2WUCH 4J23A 4EEEA 3ARUA 3BUYB 4NT6A 4WI7A 2DN7A 2YSSA 2R23B 1B0GB 2BC4A 4LRNH 5E56A 4EQ2A 3VXME 1BWWA 1TJGL 4IDLA 4PP2B 3ULUC 4G8GB 1VFUA 1AGEB 3FOLA 1I1FB 4H5SB 4PGZA 4WJ5B 3ZE0E 3E6HB 4QYOB 5AYUH 3TH2T 1RQ5A 2AERT 3U0TB 4MA1B 2ZOLB 2O5YH 1W8NA 4HAGA 1ONQB 3OKEB 5GS2D 4U0RB 2B20A 4U6VH 4P46C 5GISL 4XPBL 2LVEA 4LKXA 2MOVA 5C6TH 5IMKB 4RGNC 4XT1C 1KCRL 5GGRB 3UPRB 3O9WD 4H25B 1J88A 1YECH 2EYSA 2VDQL 4GRWF 5TFSL 3FFCE 4KXZH 3QQ4B 4JFDE 2F9BT 1SY6H 4BFEA 3QCUL 4L1HA 5D1QB 3ZYJA 1T7XA 2HFTA 1VADB 2Y1VA 2W9DH 2APVA 4UT9H 1KLGB 2GJZA 4LLVA 4TRPL 3UTQB 1RHHA 4KDTA 1Z0NA 5I71B 2BK8A 3GSVB 4TSBH 1XCTA 1U8PB 4JRXD 5FM4A 3ECBB 1PKOA 5CHNA 3BP7A 5GS2H 4OIBA 2YD5A 1NEUA 5TDOB 2K9UA 3GHEH 4X4MA 4KHTL 2FECL 1IC4L 3QRGL 1UM4H 2NY7L 1RK0A 4ZDHA 2OI9B 2W9EH 5HYIA 2NX5A 3IU3A 2XZAL 3DX7A 3B5TA 4L8BB 2XICA 1ZT1B 5I0DA 4LVNB 5F88B 1CTNA 4ZPVA 1HHKA 3MUGA 3MFFA 4Z76B 1PYWA 3C5ZA 1F8TL 2P5EE 4HUXA 3HI6L 4C56A 3CMGA 4X0KB 3P73B 5FUCE 1MH5B 1G7IA 2NTFA 3VGAB 3ULVD 1WTGT 2BNRD 2YUWA 2DLFH 4Z18A 4EQ3A 1Y6KR 1RPQA 1JVKA 1V05A 3WFHA 3S88L 5IV2A 4GW1A 3QG7H 2AEPH 3SDAA 4JO3L 4RFEA 3VG0H 4OLYH 1T5XB 1NAMB 3MLSL 2WQ8A 3O2DH 4YHLL 4L8SA 2J6EH 3I75A 1W0WB 3ARXA 1MREH 1Y18A 4XB7A 3ZTJG 3HMXH 1F58H 2A77H 3H9HA 2OXHA 2D2OA 5F7WC 1MEXH 4N0YL 5EWIL 1IEHA 4OZGA 4ONGL 1YMMB 4MAYB 2CKNA 5FFLA 1NGPH 3QI9B 1NBZA 3LQAC 4QHLA 3ULVH 4LLMA 3CFIC 5EZOL 1ZHNA 2PN5A 3OKOB 4KJPD 5BVPL 1RZKH 5F1NB 3MLZL 2D03L 1DBMH 4IS6A 3QEUA 4M6OH 1ZHKA 1QRNA 3OKMB 3QUYA 3T2NL 4MQSB 3W0WB 1EHLH 3B9KD 2CKBA 2Y07L 4AENA 1S9VB 5IB2A 2WW8A 1GOGA 1CGSL 4N9OB 4GRMB 2ERJC 2DLHA 3ARZA 1JWUA 1KNOB 3QXAB 1VFOA 1E28A 4RZCB 4L4VD 4KI5E 4Z7UE 5J12B 3RL1B 1T2QH 1AJ7H 1QSEA 3VGFA 5TF1L 5F7LB 2H32B 3QWOB 4NNXA 1BF8A 1FNAA 5C70A 4JZJA 4U6HA 1YY8A 2R2EA 5JO5A 2J4WL 2Y6SD 1U8MB 1NCAH 2VLJB 4JQIH 3SQBA 2F19L 3U4BH 1IM9B 2X05A 4XI5D 5T3ZL 5L2KB 4YDVB 3WJLA 2DYPA 2AK4D 4P5TA 1I3GL 1CL7H 2GFBB 5E00A 4Q7DA 1HDMA 2IPKA 4X98B 2D0GA 3E1F1 4ORGB 2A6KB 5ESQB 3AY4A 2H6PB 2PYEB 8FABB 1WITA 4ACPA 1BLNA 4MGXA 4HX1A 2ADIB 1VGKB 3QDGB 4DZ8A 1IEAB 3Q5YA 5D2NB 1QA9B 4JVWA 1AI1L 4ODXB 4WFHD 3MRFB 4KAQH 1WWWX 1UYWL 1HYSC 1D5XA 2NY4C 4GBXC 3HPJA 4ELMF 1IQDA 4W81A 4IOIB 3DUSB 4MNQD 1S7VB 1QACA 3AMKA 1OCWH 1HXMA 4G9FA 1K3IA 3GSXB 4ODSL 4KDTC 2A6JB 5ETUA 2ICWJ 1A7PL 1ZA6A 4XC3H 5F70A 4QRRB 5DVKA 5J1TC 2MCPH 5CJXC 3QWRD 2Q7NA 3U7YL 4AEEA 1OP5H 4NQEA 2PR4H 1K4CB 4O2EA 1MCBA 4UU9B 4C83A 1S7UB 5BO1H 4HWBH 4Z0BH 4OZIF 4FFWC 4Z7NE 4OCWL 1I8MA 1NCCL 3ARDA 1OP3K 2GIYA 1FCGA 1HI6A 2YHGA 2VDOL 1SVZA 4WU7A 2JCCB 3SGKA 3TZVB 4ODHL 3ABZA 4DWHA 3RWDA 4BZ1H 4PRPD 5CSZB 2R23A 1T7YA 1B0GA 2ARWA 3RY6A 2F53E 1XEDA 3PWLB 3NCYS 5SWSD 3V4VH 4PP2A 1G6RL 2R69H 2OR8A 3OKDB 5ACZA 4G8GA 3QXTA 1AGEA 1BQLL 1I1FA 4H5SA 4WJ5A 5ANMB 3WLWC 3E6HA 2RCSH 3ARPA 4BSWB 4XNQB 3ZE2E 3U0TA 3MOBL 2E7MA 4PJGB 1T1WB 2ZOLA 4JE4B 5C3LD 5FGRA 2HRLA 4EI5D 2ZJSL 3OKEA 4MZ2A 3ZHDA 3PHQA 3DJ9A 1B4JL 1KOAA 3KHOA 5IMKA 1T04B 3G6JE 5GGRA 3UPRA 2XQBL 4H25A 2CDFB 4RX4A 3V4UL 2ID5A 4I5BB 4EIZC 4OGYH 1I1CA 3QFJD 5CD3B 3QQ4A 1R3LB 5C09D 2A9ML 4OKDA 5EOQH 1NBQA 3SDYL 1WEJH 2DQHH 4PBWD 4NHCH 5D1QA 5L88H 4R2GD 5GZOC 4JDZB 3C87A 1E4KC 4YH6A 4GKNB 4NQSB 1CLOL 5C0EA 4TNVF 4D0BA 3BGAA 4XWOC 3L6FB 2XA8H 5ABDE 4MDIA 1KLGA 3G9AB 5GS0C 5JNYB 3VXMB 2AJXL 3UTQA 5C92A 1UACH 3GSVA 3O6KH 1U8PA 5EU4B 4WTWA 3MV01 5I8EB 3IF1B 1C5DB 1NLDL 3ECBA 5TDOA 2E9JA 3QUXA 2X2YA 4NUGL 3ARTA 2Z8RA 3O41A 1KBGL 5GZNC 4XVUC 4HGKC 4TNVK 4UINH 3MV11 3AMLA 4O02H 1YPZB 4JR9H 4DFHA 4Q6IC 3E6FB 3QQ9D 5IESH 4L8BA 2CGRH 1ZT1A 1U3ZA 5HI4C 5F88A 4PJFF 4YBQD 1H3UA 5GGSB 4Z76A 2AVGA 1LEGB 3ARQA 1WTLA 1P6FA 4GAJL 5E0QA 4JRYE 1XF5A 5C0RH 5ACLA 3WJLC 4OB5H 4X0KA 4YZFF 1YNKH 1BBDL 1MH5A 4M1GL 5IROA 3C60B 3C6LC 3TIEB 4U1KA 2PYFA 1F4WL 4XP5L 1U8OB 4CADB 5ITFB 1AO7E 1MCSA 3I6LE 2DTMH 4M5YH 3NH7L 5DURD 2RR3A 1T5XA 1NAMA 3QIWB 5FM5M 1LNUA 2AP2A 1FBIH 3LEXB 1W0WA 3AS3A 2CIKB 3CFEB 4LHUB 2HFGH 1QLEL 4FQLH 3FONB 2CRIA 4GXUM 5BQ7B 4MAYA 3PABB 4K9EL 4M6NH 1A22B 4LU5L 5I8CB 3QI9A 1GJIA 3BKMH 3SOBH 4WRLA 2YK1L 1J12A 3GO1L 5FAAA 2BVQB 3CSYB 3RGVC 2XPGB 4Y16C 4N5ED 4Q9QH 3WFCH 1AXIB 1A0QH 2NX5D 4OLWH 4HK0B 1HZHL 1EHNA 2P5EB 5B3JE 1I7ZB 3OKOA 3F58L 1J18A 3V0WL 5FIEA 4DZBB 1A7RH 3OKMA 5D1ZC 2DS4A 1RUPH 1AHWB 5K93A 2F74B 3C5ZD 3UJIH 3SGJC 4D0CB 2EYRB 4C56D 4IRSC 1S9VA 5F3BA 4GRMA 4ZUSB 3LDBB 3WHXA 2X1XR 1KNOA 1MUJB 3BPOC 4JFEB 4DW2H 3SGKC 1JHTA 4RZCA 3BKJL 2YXMA 4LASH 2GTWB 3RL1A 2OCFD 3ZDZE 3SDAD 3WS6C 4LPWA 4KMQA 2H32A 3OQ3B 3P30L 4U05A 5EZIH 1L0QA 1JNNH 4M43H 1GZPB 2BRQA 2XQYK 1U8MA 2VLJA 1UT9A 3ZE0F 1L7IL 1ZTXL 1IM9A 3NAAH 4QY8A 2HVJA 2XWJB 5L2KA 4ISVB 4ZOEA 2GFBA 4E9LA 3LY6A 2Y7QB 3BWAA 4ORGA 2A6KA 2OSLB 4L5FL 5ESQA 2H6PA 4JKPL 2PYEA 4PJHB 8FABA 3DVGB 1QTYT 5DDHB 4KKLC 4I0PB 5CJOH 4KGLA 1VGKA 3OHXB 3QDGA 4PJ5E 3VXUE 1IEAA 3TF7C 1QA9A 4J3OC 1A6ZB 1MHEB 1QRND 2ZPKL 4AQOA 3QUYD 4H88H 2K7QA 4XGZB 3V4PH 2R4SL 1I9JL 1KENL 4KROD 1N5AA 4P9HC 4Z7UB 3V8OA 3GK8H 3W5NA 1JL8A 3KPRA 4ODUB 1ZGLP 1RJCA 1F3RB 1GPOL 2ZUWA 3MRKA 4IOIA 4MJIB 4PJ9B 1AQKH 4ZXBC 5DC0A 2VB5A 3GSXA 4PJFA 2A6JA 1NBYB 5BS0B 1U93B 4QRRA 3NCEB 1QSED 3K4AA 3LN9A 3VD9A 5E2TH 3IYLW 2IC2A 1ADQL 1K4CA 4MJ6B 5HI4D 3U9PL 4WDIB 3MLUL 5KVEL 7FABH 3SJVB 3W39B 1KG0B 5HTSA 3WN5C 1OAZH 3P4MB 1BFVH 3MLWL 1JHKH 2DYPD 4P5TD 3M1BB 4OGAC 4H8WH 3C6LD 4KJQC 1MHCB 4HFUH 1GC1H 2JCCA 3PGCB 2CKBH 3SKJL 4RCAA 4JFXB 3Q5TA 1CYGA 5CSZA 1P4IH 1RULH 5D93B 2WM0A 3FO0H 3LEVL 3BP4B 2H8PB 3PWLA 1G1CA 1VGEH 1UH3A 5C0DB 5K9KB 2Z4QB 2BOBB 3RJDA 4CRPA 4UIKL 5DEFB 4J3WA 3TC9A 3X3FH 2DLGA 4BSWA 2ZUVA 4XNQA 4KRPD 5CSBA 1JZ7A 4HF5H 3N1PC 4J8RB 4GRWH 5EORH 2FSEB 2A2QT 3MA9H 5GRVK 1Z9SA 4G9FD 4Q97A 1KN4L 4Y16D 1T04A 5JA8B 2DQEH 3FN0L 4NN7B 4XCCL 1B0WA 1FIGH 1IGFL 2CDFA 3G08A 5FA3A 5I8KL 5DI8B 1JWMB 2HH0H 2RJMA 4I5BA 4WW2F 4AK1A 4NQED 5KZCD 3FOMB 2MCG1 1JNLH 3C6SB 5CD3A 2YMXH 1R3LA 5D1ZD 4YC2C 2EDHA 3MV8B 3PDOB 4N5UA 4N8VB 3NGBB 2XXMB 3GIZH 1J10A 3JV4A 3ARDD 3DETC 1OAUL 4HGWA 1P5UA 1MJJA 3D69B 3L6FA 2E6PA 3VXMA 3FHQA 3LQZA 5KOMC 4C55A 1WCQA 2NQCA 1P69B 4P46B 2I5YH 3MMEB 1CDYA 1X5IA 3P11H 3MJ7B 3QXVA 3TBVB 4M7LL 1RUQH 3IVKA 1VACB 5I8EA 2B4CL 5ID1B 5KG9B 1E4WH 4Z7QF 2YPKB 3H42H 4M9OA 1TIUA 2N7AA 3HC0B 1AE6L 4G8GD 3T4YB 1MI5D 3HN3A 3R8BB 1ND0A 5TE4H 2EH8L 4KI5F 4NBZB 4Z7UF 5FGBC 4U1JB 3EOBB 2YRPA 2R4RL 3G6JB 2HJKB 3E6FA 4UV7H 3BPLC 1KPRB 1MFNA 4U6VL 4XBEL 4JFDA 4KKLD 2Z8SA 3L3DB 3RKPA 1F02I 3ARYA 3Q3GB 1T0MB 4RX4D 4W4OA 1NMCB 3C60A 3TIEA 3BGFC 1OWRM 1WFOA 4P23C 4NOFA 1U8OA 1T1XA 3B9EA 3MNWB 5D1QD 4YXHL 5ITFA 4DK3A 1S78C 4OIIH 1WIOA 4NRXB 4HUKB 1PY4A 3AU1B 4LNRB 4LSRL 2IH3B 2W9DL 3S34L 5I1EH 1X3DA 3QH3B 5D7KD 4TOYH 3CFEA 4LHUA 4WI8A 3UAJC 3DHMA 4A2LA 4LLUB 1CFTB 5LWYH 4M7ZC 4YWGH 3IDIA 2V9QA 4MA8L 2WINA 4OFYA 3QUXD 1CGXA 3PABA 1NKRA 5I8CA 4R4NC 4RMWA 2FCBA 4MAUH 4RMVA 3RNQB 2XPGA 1ZT7A 4IEFB 2YA0A 4CMHC 5EBMB 1MAML 1MCPH 4HK0A 2W9EL 4GRLA 1TCRB 2P5EA 1I7ZA 4JRYB 3BRGC 4LMQI 1U9KA 3VXTB 3OGOE 4NUJB 4OFVA 4QXUL 4X7SL 3DIFB 4KGJA 3S37H 5AUMA 4NNYB 3B5GA 4NRYB 2EYRA 2IALA 1JCKA 4Z7NF 1CLZH 1JZ3A 5ISZB 4R96B 4XH2B 4WFFE 3MRQA 5HD8D 3LAFA 2GUOA 1RIHH 3EYUL 4S1QL 4U7MA 5GSVB 1MUJA 4JFEA 3EJYC 3L3IB 1IILE 4DGYL 5EBLB 2EC9U 4UOW1 2OS7A 4XHJC 4P3WA 2W59A 1MQKL 4LGRB 1F3DJ 4HMEA 4OFPA 3DXAB 1KT2B 4JFOB 3AB0B 1WICA 4YE4L 4RRPG 2J6EL 1KJ2L 2QL1A 1FYHB 2XWJA 5HYJB 3ZE2F 1OSZB 4ISVA 4MMXC 2ZZUT 3BP6A 4FQ1H 4JM2B 3O11A 3QHZH 4G5ZH 5E6YA 4QRSA 5CZVH 5DWUL 3U36B 4NBYB 3ZYZA 1O7VA 2Y7QA 4MAYD 5DQJA 5GS1C 12E8H 2ERJB 4XBPB 3QI9D 3ZT5A 4PJHA 5CJBA 3DVGA 3K0WA 3G6JF 1PJ9A 5C0BE 2HT3C 4KY1L 4M5ZL 1G84A 1O7SA 1IC7L 2YOCA 1L0YA 3BIBX 2DQUL 3MCKB 1A6ZA 1DBBL 2BVPB 4M6OL 4XTRD 4IRJB 1VEPA 1OP3H 5B38G 1NAMH 1EHLL 4M62H 3HI5H 1NCUA 4Z77B 5JOPE 4Z7UA 4AMKL 4ODUA 1CGWA 4O00A 3WO4B 4PJ9A 1QBLL 1AKJA 2BDNH 4LNVA 2J8UE 3TVMA 1D6VH 5BS0A 1U93A 4UOJA 4WTZA 1Z5LB 2P8MB 5JHLH 2XACC 1EHAA 4NYLB 2OMNA 4QCIB 1RURH 4MJ6A 1C1EL 4WDIA 1E4XI 1DR9A 3IJYB 4QNPE 3W39A 2VLJD 3BJLA 1IM9D 1L9NA 1RZ8B 1KG0A 2KUTA 4N8CH 4S11A 3U4BL 4HBCL 1EZVX 4HS8H 1TXKA 3TO4C 4B0MM 1FORH 1DBKH 5GRXG 1LDPH 4MNGB 3K4ZA 1MHCA 1SM3H 1QFUL 5JR1H 4CN1A 2I9LA 1R3IL 4N0FB 3KLAB 1FSKC 4L9DA 3QDGD 2DBLL 4GXVL 1INQB 1PQZB 2Y4SA 1QEWB 1BJ1H 3BP4A 1JZ4A 3ULUL 1OL0A 5A2FA 1VPOH 1H15B 2AGJL 2NTSP 2VQ1B 5C0DA 4PS4L 5K9KA 1ZHLB 2Z4QA 3GEWB 3FB5A 5DEFA 2H32H 3KPRD 4J8RA 4LQFH 5E5MB 4LL9A 3K2UL 2FSEA 2AJVL 5KVFH 1UCBL 3LKSB 2G2RA 4G6ML 3QO0A 4QRRD 1VCAA 1CK0H 2OM5A 5DI8A 1JWMA 4OLUH 1J1PH 2FB4L 5GGTA 4X6CB 3C6SA 2PR4L 3KAAA 3MRRB 1BVKA 5BO1L 5CJQL 2DKMA 3PDOA 3S4SG 1DEEB 5IFAL 3DGCR 3WNLA 4QLRA 5B3JF 3HRZA 1FVDB 5L8KB 3OJ2C 3K3QA 5EOTB 1KYOJ 5D2LE 4HUNB 1CZ8L 5DLMH 2MQCA 5ICZB 5FUCC 1T7VA 1TQCC 4NKMB 1RJZB 4AEIH 3MMEA 3TBVA 1R5VB 5FM8A 4S10A 2EDFA 1VACA 1A7NH 5ID1A 2YC1A 4EI6B 4OCNC 2N7BA 3PL6A 3ARRA 3S37X 1H3GA 2YPKA 1N8ZB 4JY4B 5DFVC 1TQBC 1S7QB 4JHAH 4HUVA 2Y9RT 4RAUB 3ZDZF 5I75C 1QLRB 3G6JA 4N68A 2HJKA 4PD4J 1KPRA 3MGAA 1U41A 3EUUA 4HWUA 4Q0XH 4WW2C 1JYNA 4QRTB 3VXSB 3T0EC 3L3DA 4H1LB 2VTFA 2GI7A 3EIFA 3Q3GA 3QUZA 2FD6H 3R0NA 5DSCB 1I9EA 2XV6B 4OGYL 4KTYA 2Y06L 3H9YA 4ZFOB 3G5XA 3MNWA 4U1LB 2YPVH 3QEGH 5LGHH 3WS3B 5L88L 4Q58C 5J57B 1JGUH 1BMGA 5D6DA 5JW4N 3TIDB 3RPKA 1R5WB 1OF2B 4PTTB 4ZQKB 4LNRA 4PREB 4Q6IB 2IH3A 1SYVB 1FAIH 3QH3A 2XA8L 3SDDC 1JGEB 3VXMD 1J0IA 3MBXL 1FZKA 5DJXB 3VWJC 3RVVD 3VXPB 2X42A 3OB8A 2VZOA 2JIXA 3BVNB 4MX7B 3ZTNL 1CD9B 1VKXB 3NIDE 4F9LA 3H2WA 3LQAL 1ULVA 4HXBL 4NWTH 1A6TA 3MZGB 2WP3T 5FUZH 5GRJH 3V8CA 1G0XA 3RNQA 2XG5A 5IMOB 1QBAA 3HR6A 5CZXD 5J0BA 2JB6B 5ELIA 4QGYA 4JRYA 1I8KB 1QBML 5IESL 1MAJA 1R3HB 5CS7A 2JJTA 4NUJA 3GBNH 4HD9A 2QSCH 3DIFA 4U6XB 5CP7B 4JFDD 2L7UA 4NNYA 4NRYA 5ESAA 3DECA 3MRGA 4X6CF 4XH2A 1DUZB 2WIIA 3ZSTA 3BI9X 3B43A 3L3IA 5B39G 2CO6B 4XNYH 2Q8AL 4MZ3A 5HVFB 3RGVB 3FJTA 3CSPA 2DTML 1LHZA 3FB6B 4NDMB 1QVOB 4N1HB 3DXAA 1INEL 1KT2A 1IGJA 4I3RL 2X1PA 5EBGA 1NUNB 1MFBH 5SX4H 4PRAA 4MLIA 5CEXA 4WUKL 4LHUD 2NY3C 5SWZB 1EH9A 5HYJA 3SO5A 2R0LH 1PEZA 1J87A 5DZLA 3UYRL 3VFUB 4K7PL 1K6QL 5C9JB 3BWUC 4JM2A 5FO7B 2VDNH 5MENB 3U36A 4OFYD 1WT5C 4PPTA 5K9JL 2Y25A 3SOBL 1JTOA 2R39A 3VXQB 4AY0A 3C5JB 3LN4B 2NXZC 3V5DB 5I9QB 2X4PB 1CD0A 4GRLD 3GBLA 2P5ED 3K81A 4I8DA 2PCPB 1FL6B 1J1XH 1I7RB 2HRPH 4J3SA 3MCKA 2BVPA 1PKQE 4KQ3H 3EDDA 4P3CH 1I85C 4IRJA 1H9VA 5E08H 5FO9A 5DMYA 1GXEA 4QHKI 1G9MH 1RUPL 5CSGA 3PIQB 1Y6NR 3UJIL 1FN4B 1I4FB 4JY5L 5BXFA 1HKLL 4PV9B 4CMMB 2QR0B 1V3LA 5HDOA 5K9QI 4JFED 5AD0B 3T1FA 3UO1L 3RUGB 5H2BB 1LE9B 4JPKH 3KJ6L 1YEHH 3MCG1 1F45A 3CLEL 2P8MA 4AIXA 4YUEH 5FYLE 1A1NB 5E6IB 2GSGB 3GSNA 1EEUA 1IJ9A 2O5ZL 3EO0B 3X14B 2BOCB 1PD6A 3QNZB 4B5EA 5CJ8A 1RZ8A 4J3UA 1WWAX 2CIIB 1NGXB 1TVHA 3NAAL 1WUNT 2A0LC 4HW6A 4AYFA 5BV7C 5F8QC 5FOBB 4YQXL 1X6NA 4AL8L 3KWWB 3VH8G 4ELKA 4ZXBB 1U8JB 3TJHD 3OAYH 1ODAA 3KLAA 5CJOL 1WVZA 5FV1L 5IBUB 1INQA 1PQZA 4I18C 2LU7A 4PRDB 3A6BH 1P6AB 1H15A 3RA7L 4Z7VE 2J8UB 4KI5D 4QF1B 4MJ2A 1F42A 5D6DC 5E5MA 3C8KB 4PJ9D 5D6CB 3BSZH 2HG5B 4XC1H 2L0DA 1F90L 1AKJD 1UFUA 4M1CC 3TVMD 3LKSA 5BS0D 4NZDA 3ALWA 4NWUH 4HWZB 3AM8A 4BQ8A 4QEGA 4RGOH 1MFCL 1G9EA 4O2FB 4X6CA 4MXWH 3GIVB 4HIJB 1HIMH 3GMPB 4R7NB 1LP9E 4DEPB 3MACH 3SQOL 3KYMA 1OT1A 4PJ8C 3QCTL 5J3HC 2BXYA 1N4XL 3VFTA 1OAZL 1UXSB 5DK0B 1JHKL 1FVDA 4NJ9H 3TPUB 3LEYH 5EOTA 5GS0L 4NNPL 3OZ9L 5ICZA 2XG4A 3EOAB 4EOWH 4NKMA 1RJZA 3BIKB 4Y2DA 1JNJA 1NFIB 2YD9A 1R5VA 1P4IL 2D0FA 4EI6A 4C4KO 5DR5H 15C8H 1JJUA 1N8ZA 4JY4A 5E8DL 4LIQL 4MHHI 4O9HL 1S7QA 3HE6B 3MLYH 1DUYB 1PSKL 4RAUA 1HE7A 1CFBA 4PJAE 3UJTH 4PLJD 1ZLSH 1QLRA 1JNHB 2C1PB 4HF5L 3F6IA 2IQAB 2WBWB 1QZ1A 2AJYH 3VCLA 1MHPH 4QRTA 4OF0A 1BZ9B 3VI4E 4H1LA 1Q1JH 3DTXB 4NO0A 4X7TB 1S9KC 3IDNA 4RA0C 1TFHA 1FIGL 2Y23A 2ADFH 1JF1B 4YIQA 5DSCA 3WBDA 4U3CA 3VG9B 4HZAA 5C0ND 4ZFOA 4K71C 2FBOJ 4JY6B 3PGDB 1NCDL 4U1LA 2RQ8A 5I66B 3WS3A 3UYPA 4Y19E 3F7VB 2YPLE 3GIZL 3S98A 1MIEH 1SBBA 2XN9B 2ADGB 4EN3B 3TIDA 1R5WA 2R56L 1OF2A 4PTTA 4ZQKA 1T4KB 3WEXA 2F53D 3OB0K 4PREA 3JV6B 1GGIL 1JGEA 5C0JB 5IHBA 4PB9L 1VA9A 5GHWH 2AKRB 1JGLL 3X17A 2HVKA 2EXYC 1GAFL 1KV3A 3MV9E 2VDPH 3BVNA 4MX7A 3O45A 2X9WA 3O3DA 3PL6D 5GRZA 1VKXA 4J2XA 1OOAA 4G3YH 3H42L 3CFBB 3PQYB 3FQUB 4FQCL 2J8UF 4ZO7A 4NP4H 3KLSA 5IMOA 2KDGA 4N9GB 2A0LD 5GGTH 2FL5B 4KMTL 4X6BA 1AGFB 3MC0A 3HNSL 1I8KA 4R26H 4G6JH 5TF0A 1R3HA 3VMOA 4QNPF 5HHVH 4EDXB 4U6XA 4R3SB 3INUH 5C0CE 5KN5B 5E2WH 5K9OB 1T03H 1A1OB 4NQTA 5EUOB 3N9GH 1DUZA 3QUZD 1YDPB 2ATKB 4LLWA 1DVFC 2RAMA 3PP4H 3U7AA 1YN7A 1A3RH 1HINL 2HKHL 5GGRY 4MA7H 2ZUSA 4YK4B 4HIXL 1L0XA 1I1YB 4NQVA 4CMHB 2BMKB 4L8DB 4QRQB 2DQIH 3FB6A 2R1WB 1QVOA 4NDMA 1UKQA 3MRLB 4BZYA 3B8YA 4M1CD 4PJIE 3RDTA 1QKZH 4F57H 1B6DA 4F9PA 1NGWA 4TSCH