3BDXA

Crystal structure of the unstable and highly fibrillogenic pro7ser mutant of the recombinant variable domain 6ajl2
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
111
structure length
111
Chain Sequence
NFMLTQSHSVSESPGKTVTISCTRSSGSIASNYVQWYQQRPGSSPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISGLKTEDEADYYCQSYDSSNHVVFGGGTKLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A single mutation at the sheet switch region results in conformational changes favoring lambda6 light-chain fibrillogenesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Amyloid lambda 6 light chain variable region PIP (fragment)
total genus 24
structure length 111
sequence length 111
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bdxA00
4HUXB 3OGCB 1CFSB 1BZQK 4LSRH 5CSBA 5HYJE 4XNMB 1CFNB 4P4KD 4QRPE 2UUDH 2GJ6D 4HZLA 1FSKC 5DWUL 3IGAB 4HGWA 1NCBH 3H9YA 1GXEA 5LQBL 1XGTA 1WGOA 5KSAA 1QFWL 2IAND 4Y88A 3MV8A 3JVGA 4UNUA 5BVJB 1T1XB 4HD9A 4LLMB 4OD3H 3CFCL 4KKBC 5E56A 1CXIA 3RA7H 1KTDA 2R1XB 4X98A 1NFDA 3P0VH 1LMKA 2G2RB 3GDBA 4KJPC 2BXZA 1NLDL 4KKLC 5E6YA 3I3EA 3LQZA 4OV5B 1JBJA 3T77B 5EU6B 4NQSB 3WLBA 2XN9E 3BGFC 4MNQD 5I30L 2DD8L 1RIHL 5DTFB 3SE9L 5A1AA 1X7QA 1OF2A 4M4PA 5FA4A 1GOHA 3R06A 4YBHA 5T3ZL 2X42A 4OCYH 5FGSA 4XPBH 3TCXA 5CD5D 4K94C 4MD5B 1NAMA 4F7CB 2X4OB 4PJ5A 4NQDB 3T0EC 1MRCH 4JHZA 1JPFB 5EO0A 4E41A 1KB9J 2ESVE 1I4FA 4I3SL 4GS7B 2OJEB 4UT9H 3HMWL 5HVFB 3TVMD 4ELMF 3QHTC 4JO2L 4FTVE 5CP3A 4BM7A 1L0XA 5ELIA 5IVZB 3FN3A 2K7PA 1MFEL 3QH3B 5D1XD 2WZPD 2WUCL 2IJ0C 3HUJB 1FJ1B 4X6DB 2EICA 3SDDA 1LE9A 1RPQA 1XF4B 3FZUC 5DZOA 5C6PB 5C07E 1TTFA 2E7BA 1NGPH 1DQTA 1HQ4A 5LBSH 5HYQA 4UT7H 3GHBH 2XQBH 4F2MA 4ZYKA 4EUPG 2XWJA 5IHLB 3O3BB 4C58B 1S8DB 5IT2H 2GAZA 3QWQB 4AJ0A 2XY2A 3I02B 4YDKH 3GGWA 5CLWA 2BSTB 4JHAL 5BXFA 4MAYA 2CLZA 1JHLL 5ERWA 3ZKXC 5D7IA 5E6ID 3C5ZB 1AHWB 5C3TA 2EYSA 2GTWA 2AQ3A 2VLJA 4NO0B 1NFDF 1RUPH 2AEQH 4DEPC 4YLQT 3BUYA 4XP1H 5E2UH 1LEIA 2NR6D 3MOBH 4OZGF 3HHRB 3BDYH 4LASL 5EORL 3KPPB 2XZAH 3ISWA 1JGLL 4BQBA 1ZGLB 4M43L 1BVLB 1MVUB 5TJWK 5AUMB 3O41A 4PYHA 3GI9L 3VXSA 4ZFOL 1T7YA 1PFCA 5IIEB 4KDWA 4HWZA 3RBGA 1HH9B 1E4WH 1HINH 4S1SL 5HHXL 3GNML 3CUPB 1XCTA 5FGCE 2AEPL 2VLMD 4ZO7A 1KELL 3WUWA 2D7NA 1ETZB 2HMID 4JREB 4NM4H 2V5YA 2OLDA 3BUYB 4H20L 4P2OD 5I8CB 1BP3B 4ODWA 3IJHA 4PLOB 1N3NA 1A1MB 5GISH 4CGTA 5GGSB 5EU7E 2XN9D 3WJJC 5J4MA 1AHWC 2A6DA 4NJ9L 5JW4M 4GKZA 1IARB 1EHLH 1F90L 4NKOB 2X70B 4RCAA 1I7ZA 2YKLL 5D6DC 3MJ9A 1FZKB 1CFNA 1YEHH 4MXVE 3S35X 4HWZB 1GZPB 3U48A 4CMHC 4NO2A 5D1ZC 5DFVC 5EUKB 4ZO9A 1AC0A 4KXZI 2VJXA 5HYSG 1NCWH 2NXZB 5DFWH 3QG7L 4V1DD 2AXFB 1JRHH 3V7MA 3GSUA 2QQKL 4JRXD 4JQIL 2PTTA 2JB6B 2VLKA 3MRMB 4JFPA 2BNQD 2P5WB 5DD6A 4G5ZL 3CXDH 4KVNL 4LF3B 4QF1A 4YDVB 1WQVT 4XPHL 4EKXA 2OP4H 3PG2A 2Z92B 5H35B 1IAIM 3GSNA 5CEZH 2CDFA 4YDJA 3FN9A 3FQTB 4IS6B 5I8OH 5GRUH 2E6JA 1LK3L 3IDIB 3ULUH 1LD9B 1A4KA 1W8OA 4MGXA 1QQDB 1D6VH 3L5JA 1FZKA 2BVPB 4ELKA 4QHUA 5IV2A 2DLTA 3BKYL 2O26U 5I2IA 1JYWA 1ED3A 4HDIA 1CI5A 2HT3C 4HBQA 3U1SH 3DVGA 2YN3A 3HUJF 2RIKA 1IVLA 4F37F 5DJYB 4AEIL 4H5SB 1YNLH 4G8GE 1ZLSL 1MJ8L 1Z9SA 1JHTB 4ZUWB 1AFVH 5GGVY 4P0DA 5FUZL 2FNBA 4MAYD 4Q6IC 4U3CA 4LSVH 3T4YB 3CZFB 1YN6A 5E6IA 1S9VB 3L7EB 3B8YA 4ZNEE 1C08B 5E4IA 3QBTB 1YC7A 3CFKA 1QBAA 1A14L 2W0FA 5L8KB 2ITDA 5J12B 5AWNH 2WBJA 1MCBA 3S98A 2V7NA 1AGBA 5BZWB 2R9HC 4M48H 3QHFH 2XTJC 1YPZE 2BCKB 1IAMA 1MHPH 1T03L 3DYPA 3S4SA 4C83A 3LV3B 1F4AA 4MCZB 4U1NA 1QLEH 3SDXB 4WI4A 4NJ9H 3FONA 3BQUA 1MJ7L 2IALB 1F3JB 3H3KA 1IC4L 1YEKH 1H3PL 4U1SB 3SGKA 3DIFB 4PGDB 3BN3B 3ZT6A 5FCUH 1OP9A 1GHFH 1NBQA 1FP5A 1GGIH 1ACYH 3SCMC 2BP3A 2NY3D 1A7QH 3U46B 3IGAA 3VXMB 3FKUS 3OKMA 3J7HA 4BKLA 3P9MA 4L4VA 2ZCHH 3WXVL 2KBGA 2HT4C 2LFGA 1P84J 3Q5TA 5EBMA 1KCUH 3SGDH 2DN7A 1JZ2A 5FKAB 1F8TH 4HCRH 3D85D 3MRFA 4OM0L 3O8XB 2WW8A 4Y4KD 1S7RB 1CGWA 3RWEA 2XNAA 4PJHF 3MUY1 4HJ0D 1INDH 1QBLH 2NTSP 1RIUL 1CWVA 2DQTH 2XICA 3TBVB 4BFIA 3PP3H 2XZZA 3C5ZD 2HLAB 5DD3L 1Z5LB 2FEEL 1JUFB 1F45A 4RIRA 3HR6A 4P5TB 4IOFC 4IIQC 1FL5B 4YHNB 5KS9A 1U92B 2YPKB 2BSSB 4LQFH 3BRDA 3GMQA 2EDTA 4PGCB 5CJ8A 3ES6B 4XCFH 4YPGB 1IGIL 1KNOA 2DQCH 3OG4B 2OL3A 4WENB 1A1NB 1YJDC 2YC1B 1FAIL 1IAKB 1UH3A 3ZTNH 2NY1C 5FYLD 4JFHE 5I66B 5KVMC 3RI5F 5C0DB 4M1CD 1CL7I 5BOZG 2X4TB 1BFOB 2AEIT 1Q94A 5EORH 4JFQB 1EEUA 1G6RH 3IFOB 4MXVF 1KPRB 2WBJC 2B0SL 1L4IA 1V7MH 4BFIB 3X12B 5J9PA 4RMQA 3IS1X 1LE9B 4YIQA 1QSVA 3AS3A 3X17A 2P7TA 4YWGH 3SDAD 4HS3B 3L95A 1J11A 3TNNA 1FHGA 5J6GA 1IGMH 4AMKL 3BH9A 4JRWA 3H9SB 2UWEF 4F9PC 4NPYA 4N90E 3WNKA 1IAOA 2D7PA 3P4NA 1LO2L 3GEWB 4J6RH 5FV1L 3NCYP 5T3ZD 4PJEF 2DMCA 1V3MA 3NCMA 5I66A 2XZQL 4R4ND 5HGAB 4NSKB 4PJBB 1P4BL 1UB5A 1XR9A 5MHSD 4NKDB 2DKUA 2RB8A 4WI3A 1HEZB 3G6JE 3VXOA 5FCSH 2PYEA 3L6FB 4MVBC 5TGBA 3PF2A 4J2XA 3TO4A 4MNHB 2P5EB 1KJ2L 1JNNH 1NKRA 3MOAL 3W82A 5B22A 3GB7B 4Z77B 1TETL 5KG9A 5FOJA 4GG6E 1E27B 4HPYH 1KCUL 4XTRD 3MNVA 4ODUB 5JXED 1R3IH 2FR4B 2GSGB 5CCKH 3VH8G 4I18B 1HKLH 2BFVL 4TRPL 1CICC 1AI1H 3RWGB 2DMBA 1UB6B 4K8RL 3L3HA 5JMRA 4JPKL 1XGPA 3ARYA 1EEZA 2I9LA 2XRAL 3QQ4A 4J3SA 3W0WD 3NABH 3P4LA 1CFQB 1FN4A 4NSKA 3ILPB 3EW3B 4PJAE 4TPRH 4NUGH 4Y4HD 3MJ7B 3JSSA 3AB0B 3MV8E 1CIUA 4NBZB 3GHEH 2FSEB 1F6LL 3HG1B 3TPUA 4Z6AT 2VR4A 2X4QB 4YHLH 5GJSL 3ZTJH 4O2EB 4NQSA 4NHCH 3IDJA 1YEGH 4UT6H 4XCYB 4YHIA 2FB4H 5K9OB 4FQCH 2E7MA 1P7KB 3SCMB 5EUKA 5E95B 1VFUA 1XF2B 4R6UA 3BDXA 5KW9L 4Y4HC 3H0TB 5D70L 1U8PA 1X5LA 1NEUA 4PY8J 4OZIF 4KUCD 1CLOL 3CVHL 3QCUH 2X4SB 1CDBA 3AXLB 3EIFA 2V7HA 2D4FA 3H3BC 4GQPH 2IBBA 5F9WC 2EO1A 5EIIA 3D69B 1ZA6A 2CGRH 4OAWA 3B83A 2J5LB 1J5OL 3VXUD 1K8IA 3SOBH 3Q1SL 4GKNA 4HWEL 4W6YB 5FYJL 1ZT4B 3RGVC 1RIVL 3VRJA 5FO7B 2X6MA 3ESVF 4OGAD 3PDOA 1FZMA 3CFBB 1DQJA 2VDLH 4JPIA 2PW1B 1IZJA 2NY7H 1RJYB 4X4XA 4OD1L 1UC6A 4YHIB 3VXRE 2UZIH 5DMKA 3GSXB 5CEYB 5I71B 1H0DB 1YNLL 1RFDL 2DQEL 4JQXA 4LHQB 1NUDA 2HVJB 5TDPA 1T03H 2IMMA 1E0OB 3RVTD 4Z7UB 3QQ9D 3VJ6A 5DR5L 3HS0B 1AKJB 1DEEA 3L5HA 4ZAKA 4G6AD 8CGTA 4LLYB 4GAJH 4OF3A 3T8XA 3TT3H 4XBEH 1F6AA 1ODAA 1C1EL 2IPTH 4N5EC 1NMBH 5IFJA 4LGSB 4C4KT 3GO1L 5HHVH 2ZSWB 4JM2C 3H9ZA 4BJLA 3T4YA 5I1LA 4JZNA 1BIIA 5I1CL 2DQIL 2ZZUT 4U1KA 1FGNL 1MCHA 4RA0C 5FO7A 1IC5H 5EWIH 2V2XB 3TBTA 1QNZL 5DK3A 3WJLA 2ADFH 3PWJA 2AQ2A 4YHYC 3MLPA 5KZCB 5L2KD 1T21B 3WNLA 4FXKA 2B2XL 4PJ5B 4MCZA 1XZ0B 5KVDH 2PNDA 4X6EB 1DBML 3NCJH 5IEKB 3BDBA 1FO0H 1QZ1A 4KKCC 1F6AB 4KTEH 2NY2D 4O4YH 5HGDA 2QL1A 4B5EA 1AH1A 5DYOA 4WUKH 3QR2A 1JF5A 5F71A 2DQCL 5A3IC 3MLVL 3VWJA 4Q0XH 4Y8DC 4MB4A 3ARFC 3FO9B 4NZJA 1J8HD 1FSKB 4GG8B 1U8KB 4RX4A 4I3SH 1SMOA 3CX5K 1OGAE 1E6OH 1WJ3A 3MRDB 4F57L 1A21A 1MQKH 2BZDA 4WTZG 3X13A 4XCEA 3GB7A 1ZAGA 1LK2A 2DMKA 4WV1B 4X6CF 5DK2A 2F8XC 1T66C 5IR1A 1BD2D 1LO4L 2F58L 4FQJH 5EZJA 1U8IA 1JWSA 4JQXC 1I8KA 4LARH 1YQVL 3PGCA 3DSFL 3MBED 3O3BA 3O8XA 2HFGL 3EDKA 1VACB 2NXZC 3KDMB 3S9DB 1S7SB 3NAAL 1A7BA 4P4KC 4A6YA 5E5MA 12E8L 2FD6H 2FL5B 3BW9B 4YBQC 3QUZD 4F9LA 5C0GA 1I9EA 2D9QB 3BP4A 1L7IL 3MFFB 3QDGD 4ZAKD 4OFVA 4GMTH 4R7NA 2IG2L 3FFCA 5FKPA 2FX9H 1U8HA 5D2LF 4LIQL 1FFOA 4YHNA 4PRPD 4YE4L 2X10A 2BSSA 4YDJB 4N0FB 1LE5A 5C71A 3VGBA 3E6FA 2NW2A 3WJLC 2B7DT 4JB9L 3FHAA 3HG1D 3P30L 1RJCA 3KLDA 5DJ2A 3QEQE 4K71C 4R7DB 1M6OB 3VXQB 4BZ2L 1UM4L 1MPAH 5IIEA 3BHBB 4NQCE 2EIEA 1HH9A 4R96A 4EBQH 2FIKB 4R4BA 4X80L 1AXTL 3SDCA 2FL5A 5GGSY 5K59E 3QDMA 1IL1B 2XQYK 2XZCH 5DC4B 4WFFE 1BOYA 4M48L 3SY0B 2UYLA 2DLFL 2J4WL 4EXPX 2DWDA 5I19L 5KSBF 2VITB 3IFNL 4RWYH 1ZT7A 4OZHB 3SE8L 5KVGH 1R0AL 1ZHKA 1QP1A 4M6NH 1EMTL 3MRBA 3ULVL 4L3EB 2AV1B 4OCMC 3IB4A 2F19H 3E6HA 2BJML 1D5MB 2VQTA 2A38A 3E8UH 5TDOA 4J1UA 2ZSVA 5EU6D 3WS6A 3ZMRA 1HHGA 5L2KE 1FG2B 4FS0A 1QLFB 4HPYL 3EYOB 2BCKA 2KZWA 4YNYB 3S3SA 4ORGA 4PPTA 5HD8C 3FRUA 4FA8A 4L1DA 2IBZX 2OZ4L 4X7SH 4OFDA 5HHPB 3OZ9L 5BRZE 4GAGL 5FUCC 4PB9H 3UJTL 2Z8VC 2H3NB 4M6OH 1LVEA 2R0LL 5B38G 4NQED 1EBPA 1F2XK 3BIKA 2FZ3B 1T3FB 1NH6A 3QPXL 5HD8D 2AJVH 3DPBA 5IROC 2BNUA 1H3UA 3LKRB 4BSWB 3CSPA 4ZPTA 1RULH 5FDWB 3T0BA 2AK4D 1XGRB 2X1PA 3G04B 3ILPA 4CU6A 3FB6B 2LU3A 1MHEA 5E24E 4JO1L 4U7MA 4Y19A 4M02A 5FA4B 1B90A 4YFLI 5BV7B 3MR9A 3OB0K 5E4EB 4BH8B 5FM5M 2SEBA 4HC1L 4X9HA 3MNWB 2B4CL 4OF6A 4OI9A 1DBBH 4Y2DC 3SE3C 3DNKA 2F74B 5FUOH 1MFDL 2HN7B 5LGJB 1FL5A 3R1GL 5D7SL 3D0VB 3MCLL 4QXUH 2CGRL 5DD1L 3MO1B 1LK2B 3LPWA 3GZKA 4PJHB 5C7XH 3PWNA 5BVJA 1FVEA 4MA8H 1F2QA 3MLXH 4PJFF 3QEUB 4NO3B 1NFKA 1YEFH 1RUAH 3AS0A 3ARGA 4NNYB 4OBSA 1TJIL 4HF5H 2DQJL 4G9FA 5D1QA 3UTSD 4ZOBA 4JKKA 5F3HA 3FT3A 3NVQA 1RJYA 4X4XB 3HNTH 2X7LB 5GS3A 1MFCL 1CXEA 3WXWH 3IDXH 3L3IA 5IVNA 3GHEL 3F5WB 4O2CB 4CN6A 2HT2D 3I6GA 4LAQL 4PBVC 2XTJE 1GL4B 1PSKL 3CFDB 3ALWA 3MLVH 3D6GA 1HHHB 2CK0L 4YPJA 5J6HB 4ZUTB 3MRFB 2X5PA 4Y89A 3STLB 2E7LC 5JA9A 2XKUA 3D85A 1S7WB 2AKRB 4NKDA 1E6JH 3MREA 3ARGB 3QXUA 3BAEH 1UZ6E 2L4OA 3HUJA 5DK0B 3OR7A 3V4VH 2VKXA 4UDTA 5ETUB 5I71C 5H2BB 1XGQA 1MJJB 3OAUH 3DI3B 4LSVL 3MUGA 4OFPA 3WDJA 5EO1B 2OP4L 2B0SH 4PJ7E 5CUSH 4N1EA 5I1JH 4PRDA 5ITFA 4MDIB 1DUYA 1NCCL 3KPMB 4W4NA 5DRZA 4O51B 1XEDA 4M1DH 2ZJSL 1UGNA 5J0BA 2I5YH 4D9QD 1FV1B 5ESQB 5ERWB 2C1PA 1AHWA 1MY7A 4PJ9A 3BKYH 3CH1A 4LSTH 3QIWA 4ZO6A 2H26B 4JJ5A 1LEGA 3ZE1F 4AENB 4HJJH 4UIMB 4DKDC 3ZTNL 5HHQA 2ICWA 3A67H 4JLRA 4P49A 1F58H 2Q1EA 4PJ7A 2P24A 4DKEL 3EHBC 5JOPD 2VB5A 1AXTH 5MERB 3RDTD 3HC4H 5IHZA 1PG7W 1WZMA 5C7XL 4HS3A 4LEXL 1MPAL 1Q9LB 1YEEL 4MNGE 5F9JA 3V0VB 2W9LA 2MNUA 5BW7A 2PO6C 1KYOK 2YOCA 3I6LD 5IFHH 4PJEE 1C16B 4MNGB 1A3LL 4JZJB 3CMGA 1N2RB 4XGZB 3O2DA 3ZYOA 1OSPH 5TH2B 2GSIA 2RHEA 1IGFH 2W65A 4P2YA 1Z2KA 2OMBA 3VFOA 2X4SA 1U91A 4WHDA 3VWKA 1T1YB 2GJJA 3WBDA 4Z76B 4HUUB 5IW6B 2AXGA 1T04B 5SWZE 1WBYB 3LKPB 3KG5A 4YBLB 2MJWA 4OZ4B 4PJCF 3KPOB 4G3YH 4HZAA 3K4AA 2WQ8A 4QYOB 1PQZA 2VISA 1GHFL 1N59B 1OM3L 2AEWA 3MRGB 1ACZA 3P9WB 1JHKL 4QXTA 4ODUA 3EUUA 1MLBA 4XI5D 4XT1C 2RCSH 3K1DA 1ACYL 4APQA 3RRQA 4NO0D 4M7LT 3X11A 3AS2A 3CPLA 4Q9RH 3TC9A 2VLKD 3FOLB 4YHML 5IGXH 4MD4B 2GIYA 4FQCL 5EBGA 1VDGA 1VERA 1ZLVK 2HFGH 2FJGA 4B7IA 1F4XL 3MRRB 3RVUC 2J2ZA 4OCRH 4JREC 1O5DT 4O02L 2BVYA 2COQA 3GHBL 1P7QA 3OKLB 1XCQB 4G8EA 1GC1L 4WI9A 4PJGB 4WRLA 2V9RA 3DLQR 1SY6L 1BWWA 4TULH 4ETQA 1G9MC 3IDJB 3BD5A 5C1MB 1YMMD 4JRYB 2XKNB 4I0PD 4PJ9C 1GGCL 1PW3A 1MLBB 1H5BA 2KDGA 1G7QA 4ZSOB 3BSZL 3G6AA 5IK3A 4GUPB 4JFXA 4N9GA 2Y7QB 3HCVB 5DDHA 1ZSDA 1JN6A 5F1NB 3FRPG 4TN9A 4D9QE 1JGLH 1WUNT 4JFZL 4P23A 1H3VA 2EE3A 4WHTA 3MRHB 3RKDD 2XZQH 2X4RB 1IILE 1U8QA 4NKMB 3D69A 5JORB 3DHJA 3D85B 2OM5A 3LB6C 3U30C 5TF0A 4NNXB 1MWAL 3QUMA 3O45B 1XCQA 4JR9H 5LGHL 3MLYH 3T2NH 5ICZA 2WIIB 4GAYA 4WW2F 4FQPA 4WV1C 1IM9D 4B41A 1C08A 5CSGA 3QQ9C 2WNGA 1G7LA 2X4UA 4GRMA 2IAMD 1RMFL 4FXGB 4G8GA 4ZTPL 2NY1B 5CINH 3KXFD 4UV4H 1FPTH 4R4FL 5JNYA 3WFCL 1LO2H 3L7FA 5H94A 3AB0C 4HKJA 2CJUH 3HR5A 1OAKL 3VFVA 1Q1JL 1JUFA 4LLUA 1DLFL 1KFAL 1S5HA 1GSMA 4RAVB 2FRGP 3T8XB 3OF6D 5C0GB 2X4RA 4NKMA 3S36H 4K8RC 1DE4A 2A74A 5J12C 4FQ2L 3GUTB 5DC9B 5F8RC 5HVGB 4F7MB 4OCYL 2NX5A 4JFED 2YC1A 1KIUA 3EO1A 3MRLA 4OCWH 2ZCLH 3DMMC 2NW3B 3QH3A 1JNLL 1A6WH 1HSBB 1ERNA 3SDDB 3ARED 3VXMA 4NN6B 1VFAB 4OZFG 3C8KB 5FFLA 4XZUA 5F6HI 3MNVB 1JPGB 4LHUA 1YMMA 4FXLA 4HKJB 4XRCB 2VL5A 1IGYA 4L9DA 5E4EC 1FG9C 1ZKAA 1AQDB 4MQXD 1Y0LB 4AT6A 4PGBB 2HG5A 5C0BA 4Z7WA 1T83A 2Z8WC 5D7IB 3OXRB 4LPCA 5F9DC 1KEML 4LHJB 3PL6C 3QPQD 1J87A 1DVFD 1RULL 3PABB 4UT6L 1G6RB 4PFEA 4GKSB 3MRPB 4YHOL 2E9JA 2Z31C 4YPGA 3HC3L 3OKEA 4JM4H 4U6VL 3RDTB 5JQ6L 1A5FH 3GJFK 5F1KC 3UTTB 4M6OL 4OLYL 2H8PB 5EOTB 3GMRB 5IFAH 1E6OL 2B4CH 2Q8AL 1T6WA 3K7UA 1NAMH 5D6CA 1KIQB 2CO7B 4PYGA 2VXQH 4V1DB 1FORL 2VKWA 3BP4B 4K3HA 3SDAA 3S5LA 5KSAB 2B5IB 3ULSB 3MFFA 2V7HB 3MLTA 5F88A 1VFOA 1CFTA 5FDYA 1TJHL 1MOEA 3QDJD 4X0KB 3TZVD 1WBXB 3EOBA 4NWUL 2FO4B 3GM0A 1S7UA 2CKNA 4M7KL 4PUBH 4U31A 1OAQL 3QQ4B 4Y4FB 5EZLA 3OAZH 5IMOB 3ABZA 3LQZB 4OV5A 5D1XC 2P48B 2Z31A 1ZEAL 5CINL 3LIZL 3ALXA 2HTKC 3EOAB 2AABH 4HFWA 3UTTA 3W0WB 2N7BA 4RA3A 3WN5C 3KYKL 4AYFA 1NCAL 3O6MH 4LLDA 3WFZA 5EOQH 2BJMH 2GUOB 1RZ8A 2X89A 3IDXL 5T1DL 3MV7D 4NRYB 4XMLL 4K55A 1A6VL 4Y5VB 3DHMA 3IDGA 5F9WB 1KACB 5CD5C 4BUHA 5JORA 2YZ1A 4N0YL 3UPCA 2J7LA 3GSNH 4V2CB 1IFHL 2DLFH 3EJZC 5GGRA 4ERSL 4JFEE 1A6ZA 3RWHA 2XA8L 3LKOA 1DDHA 1CE1L 3KLSA 3F7RA 1LDPL 4EDXA 1QYGL 1DFBL 3RU8L 3D25A 2L7UA 4Q7DA 4LLWA 2QSTA 4XP6H 1F4XH 3V4VL 2AK4E 2BY0A 4XHQA 1EX0A 3ZL4H 3IDMA 4YUEL 2CRMA 4FZEH 5HHMD 3T77A 1TQCB 3O4LD 1JZ8A 3BN9D 3RBSA 3BEWB 3L7FB 2VRAA 4H25A 3MBEB 3HE6C 4LPYA 1T5WA 3I02A 2O61B 1D9KA 4PGZA 4QLRA 1D5BB 3OAZK 5BQ7A 3A6OA 5T1KA 4XCFL 3BEVB 1R3LA 3LPGA 1NMAH 3BZFB 4OIIL 1C8PA 1DEEB 2P43B 1CXLA 4CMMA 2PO6B 5ISZD 5IOPB 2YD1A 2FZ3A 3EYUL 4PG9A 4MHHI 3ILQD 5D96C 2N4IA 2R56L 4CMHB 4ZOEA 1K5NB 1VFAA 4FQQB 2FJHB 2Z31D 4Z5RB 2DI7A 4N1HB 4XC3L 2X9XA 5D70H 3DV4A 3DMMB 2R1XA 3LH2H 3CFEB 3QJFB 4X6CA 4ZPVB 3C6LC 1WISA 1GIGH 3DX8B 5HHXH 4O2FA 2J12B 4Y7MA 1IEAB 3D39B 4BH8A 4JFQA 4H8WH 4WUUE 3R0MA 1JIBA 3WLWD 2FLRT 3EYFA 3MV7A 3H7LA 4RQQA 1K8DA 4JO1H 3PL6B 3TH2T 8FABA 2QKIB 3CLFH 4KAQL 3DXAD 1RZFH 1G7MA 3STZB 1AGEA 2E7HA 1GGBL 1LE5B 2Q8BH 3KPMA 2LAAA 3NFNA 2FJHA 1XGUB 2JK5B 1LEIB 2XN9A 1IQWH 3T0AA 1MHHB 3PWVB 2GT9A 4QGTA 1IMHC 3H3PL 5IFJB 5HGAA 4UT9L 4E9LA 4W70A 4L8SA 4LVEA 3UTTD 1MIEH 25C8L 1FVCA 5E8PB 1PG7X 2V5SA 5I1LB 4LCCB 2NYYD 3WFHA 3GSOB 2F5AL 5I1CH 1CBVL 3BPOC 2JTDA 2CJUL 1S7SA 1WEJL 1YYLH 3IU4L 3UYPA 4X0KA 1DVFB 3QFJE 1EZVX 3CIQA 3V0VA 5IHBA 3Q5OA 3UX9B 4B7LA 4QHLA 3CXDL 3P0YH 1X6LA 1CTNA 5F7HA 4NQXA 2DTMH 1MUJA 3ARBC 3MCKB 4XGZA 4MMXC 3KWWA 4ZFZB 1AGFA 2CK0H 4CNIA 3TN0D 4KGLA 3QWOA 3NN8B 5I2IB 5JR1L 1XIWD 2NX5B 4TVPD 1MLCA 3MREB 4KK8C 3WNMA 1OPGH 2YRLA 1X5IA 1BD2A 2WBKA 4PRIB 4ZOCA 3CSBA 4R96B 3BZ4A 3PWUB 2VWEE 4QRRA 2JKXA 4RDQF 2W59A 4C56A 5DO2C 4QY8B 1CGSH 1QHOA 3O41B 2B1AL 5D93C 3VFRB 3DX6A 1CFSA 3NCFB 5EO9B 5CEZD 3L5IA 1S9VA 4GRWE 1DQLH 1PY4A 3CFKB 4O51A 2FJFB 1AQDA 2EDYA 2Q86B 5D1ZB 1QO3B 3FQXB 1NEZB 5H35A 2HJKA 4L5FL 5C0JB 4OZFA 3NFPB 4LVHB 4PJCB 3KPSB 4JJHA 4KHXH 4HMDA 3SKNB 2NY1D 2F54A 5MEPB 1QLEL 2ZUUA 4QRRE 2BY2A 3MV9D 4CL7A 3ARFB 4JB9H 1FL3B 1DQML 1VFMA 1WT5A 3BJLA 4BZYA 2C5DC 1H3TA 1ED3B 4M62L 1M71A 2WM0A 3OKOB 3IFLL 4MZ2A 4HCRA 2C3VB 5TPWH 3T0DA 1G6VK 4PLJD 3GSXA 3IDNB 2Q76B 5IK3B 4I18A 2VXTH 4YGVB 3UJJL 5BV7C 5D1ZA 4F7PB 1N6QH 2R0KL 3B43A 1RMFH 2DBJA 5GSRB 3D3VD 4PBXA 5DI8B 5DURD 1W0VB 2OX5A 3QUZC 4QHMB 5EC1B 3QUXC 5IF0B 1HQRB 5I1KL 1G84A 5ESVB 4P48A 2R4RH 4HIXH 1A02N 4NO3A 4OZHA 5IB2B 1EO8H 1EGJL 3NTCL 1BQUA 3EJYC 2I26N 2RFXB 4OFIA 4NNYA 5D1XA 3CDGA 5B21A 5BOPA 1TQBC 1K8DB 5GS0C 2DYPA 5CAYB 3OTTA 2ICCA 4EN3C 1OAUL 3DRQB 3TM6A 2VZOA 5KAQG 4RIRB 2OTWB 3UZQA 3PWJB 3FRPA 3RVWC 4RGNB 3P73A 1NGWA 1EGJA 5CGYC 5F9OH 3T2PA 4KQ4H 3CH8A 2VIRA 5INDA 2JK5A 3GIZL 1N0LA 2EIZA 1MJ8H 1FNFA 3MLWL 4PJ8B 4X4MA 2DWEB 3I6KA 4EOWH 4AEEA 4Y4FC 4P57B 5JXAL 2MMXA 4KV5E 3QDJE 4G7YL 2H3NA 3L3KB 4Z7VB 1PD6A 4W4OC 1AE6H 1MFAL 2Y9RT 3OR6A 4LCYB 1EFXD 1AE6L 1SY6H 4NZTH 4KROD 5MENA 4YEEA 1CGTA 1L6XA 5LQBH 1FORH 4EJ1C 3OAUL 3NGBC 1WFTA 3VXSD 5FIEA 3VFPA 1RV6X 3BPOB 5AZ2H 5GXBB 4JM2D 2ICWJ 2R1YB 4PUBL 5HYIA 3SKOA 1IKFL 1H3XA 4XWGH 1RHHB 3F7VA 3OBAA 4KKLD 5F7KC 4G8IA 43C9A 3BISA 4OZGE 1G9MH 2ZCKL 5FGBA 2YA1A 1EUTA 3QIWB 1JZ5A 1M7XA 4UOJA 2H41A 5CD3B 1OWWA 1LEKA 3NIFE 1JGVH 3B9KC 4ZFGL 3FCTB 4ZTOL 1JI1A 1N4XL 3OJMB 2H6PA 5M95B 1BIHA 2J1KA 4QCIB 3MLXL 5I74B 4JFOA 1MCPL 3CCHB 3TIEA 1A3LH 5HYQB 3FMGL 4ZXBC 4QRPD 3QNZA 5F21B 1TTUA 3EYQD 1BVKB 1VKXB 1JNHB 1RZ7H 5JW5B 1NCDL 2GJ6B 4P4KB 3LZFH 4WFGE 3MUGB 4UDUA 1A6AB 2FH6A 3IF1A 3RKDC 4R3SB 1HDMB 4HUVB 5DSCA 3TCLA 2UV3A 5D1ZD 5DFVD 1I8IA 4J4PA 4RQQB 1BEYL 2E7CA 4XC1H 3VFUA 3S6CA 1I85A 2O5YL 4NQDD 3M8OH 1FO0L 3E3QE 1XIWB 2NX5D 5IBLD 5DLML 1FV1A 1F4WL 3OKDB 4WI2A 3FN0L 2YPLB 4I48B 4K7FB 4OSUH 3V4PL 2CDEB 3FCTA 1G7JB 4NHCL 3GMQB 2OZ4A 3N50A 2HFEA 4LCUB 2X44D 4GW5A 4ODHH 2ZSVB 2QHRL 1YMHB 3CNKA 3JVGC 5J11B 1NAKL 1B4JL 5FYLL 3WIFB 3DX9B 4APQB 5HHNB 2ATPB 1GOFA 3HZVB 2E7LA 4P2RB 4RFOL 4TUKH 4YFEA 2N1KA 3JZ7A 1RUPL 3A0OA 4JO4H 4PJDE 1ES0A 2CD0A 2QBWA 1G7IA 5C6WH 5F9JB 2IH1A 4P2RE 1Q0XH 2QHLA 3RVWD 2EYRA 1CF8L 2M26A 5C08E 5IQ7L 1AD0B 1AFVL 4FRWA 3K74B 4NIKB 5CUSL 3TA3C 1MFAH 5AWNL 4GH7B 4M5YH 4RNRB 3RL2A 4XVSH 2DM3A 3OJ2C 1BAFH 5TFSH 3TF7C 3F65A 3VXNA 3EYQC 2X41A 4NPYB 2W0FB 1I8LC 2H1PH 3PHOB 4XCNA 2EE9A 5CEYA 3QUXD 5FDWA 3EO0A 5B38A 2O5XL 4OZHF 1QSZA 1RFDH 3BP6B 3MV01 2VLRE 5KJRH 1OP5K 4JG0L 1C1EH 4FQLL 4M7ZB 4M8QB 1GZQA 2R8SH 1K6QL 3PXJA 4NQVB 3BN9C 5F7UA 3GMNB 2F53A 3TV3H 1WBXA 3EOBB 4HIHA 4XCCL 2FATH 4JDTL 1DQDH 3BH8B 4OGXL 5EOCH 2E9IA 3RZWA 1KGCE 5T1MA 3RI5K 4X7EC 1TZIA 3WFDH 1LD9A 4JY4B 1UM5H 5DHXB 4NRZB 4MA3A 3EJZD 3QA3B 4IRJD 2D0GA 1NUFA 1DQMH 1RZFL 5CLTA 3VH8B 2HH0H 4LNRA 1TVHA 4DZ8A 4D0DA 4WFGD 4KMLB 5IKCA 3V4PH 5DJYA 4MAYB 1G7HB 3DOSA 1N59A 4HIEA 1S5IL 3QEQD 5HGDB 4S0SD 2XIDA 4GXVH 3CFIC 3DUSB 1I8MB 3O2DL 1ZK9A 8FABB 1SHMA 4EI5B 1QLRA 5LCVL 4KY1L 2ERJB 2ADIB 1SYVA 4FQ1H 2ZCLL 5DZLA 1ZWIA 3O4LB 2WP3O 2IPUG 5DZNA 4ZNCD 4K9EH 3G08B 4JN1H 1N5AB 1RUKH 1ZTXL 4RX4D 3S37L 1OP5H 4JPKH 5IB3A 3UMTA 5HGHA 3PNWB 4JN2A 4LSUH 2DQHH 1KCSH 1F11B 4UBDD 1TVHB 1DQLL 4YO0B 5DVOA 4I5BB 1MAMH 1DANU 1OB1B 3HFML 3MYJB 5FYJE 3RWCB 2ADJB 5I74C 5DUML 4ZFFA 3E2HB 5DQ9A 3WEXA 5DRXA 3QCVH 5T1KD 3CUPA 2EDJA 3HN3A 2IPUK 4QTHA 3UCRA 3O11B 3SCMD 4ONFH 4S10A 2BNRE 3ALPA 1I9RH 3NIGF 4KRLB 4NCDA 5ISZA 3SJVD 4M3JA 5KBNC 4AMKH 4PR5B 4HH9A 3W5MA 1FC1A 4GS7C 4PTTB 4F7EA 4XNZC 1KCLA 3W9EA 2OK0H 3UBXB 5IMLA 2JJUA 1FL6B 2AEQL 1EHAA 4JY6A 2C7UB 3T0WA 4OLZH 4UTAH 1JZ3A 2BDNH 1ONQA 3DMMA 4PV9A 3PGDA 1KJ2H 5HJ3A 2IC2A 1A7PL 3N1GC 1ZOXA 4UV7H 2YEZB 4WO4D 2J6EL 4BQCA 2CKBA 1CLZH 1IL1A 5B39A 4G8GD 2BNRA 1YUHA 1PKQA 4PRHE 4PJ5E 5I6XB 2NY0D 1CFTB 2MOVA 5CS7A 3PWUA 3LMJL 2E27L 2X4PA 3E2HC 5DHVA 4F37K 1A4JA 3MJGX 4LLVB 1CTOA 3OXRA 1ZHLB 1C5BH 4Q9CA 2VDNH 3KS0H 3MLSL 3CVIL 3VFVB 4MA7L 3E8UL 3PWPD 4FXKB 3BZEA 2MKLC 1QBMH 2FJFA 4AZ8A 3VFSB 4XPBL 3MA7B 4UNVA 3DVNA 1NEZA 2UY7A 1FFOB 1A2YB 4OSUL 3UTZA 2GSIB 2W65B 5GGSA 2CDGB 1EJOH 3SKJH 3SBWC 4GKZB 5GISL 1HI6A 5C0JA 4F15B 1S9YA 5F9OL 1BQLL 5E8DL 2R0KH 5E8OB 1AY1H 2P8MB 4KHTH 4JFFA 5SWSD 3VXUB 1FL3A 3X12A 1K4CB 3QG7H 1CICA 3A6CL 4NO2B 3QI9A 1RUKL 4OF5A 1BBJB 3K2UL 2DKMA 4CVXB 3WKML 5K9JL 2CUMA 3N1QC 2B1HH 2C3VA 2C26A 1I8KB 3PJSA 5JHDA 4OLXH 4Z7VF 1CF8H 2BERA 4UUJB 4NO5A 4OM0H 2QQKH 2HFTA 5GS0H 4R4NC 4M5ZH 4ENED 4QF1B 4MLIA 3UTSE 4DCQB 3KWWB 3SOBL 5SWZD 2EEDA 5ILTL 3MA9H 5J8OA 1A6PA 3QWOB 2FWOA 3T0EE 4JFFE 4LHUD 5CJOH 1Q0YL 3TH3T 3OJDB 4LIQE 2AK4B 2YMXL 3TO4B 1G0DA 2FX8H 4P4RB 4P9HH 1P7QB 3OKLA 3KNBA 4LSQH 2YUZA 1G7JA 3OB8A 3ARSA 1JHLH 3KJ6H 3H7BA 4WWID 4E42B 2VAJA 4Y5VA 4DN3L 5EZOL 3IDGB 1F3RB 1YN7A 3IJYB 3L3DB 2W38A 3MXWL 5D7SH 1DEDA 3FFCE 4OQTH 1RZKL 2IWGA 4JY5H 2FEEI 5FYKE 5C09D 2HJFA 5T5FL 15C8H 1JN6B 3CZJA 2WANA 3P9MB 4L4VB 1D3CA 5HHMB 1AXIB 1K3ZA 2APTA 1NBZB 3OHXB 5HDBE 1KIPA 1L7TL 2VITA 1MCPH 5BCAA 4XPTH 3RWEB 2I27N 2A0LC 3VD7A 3MV9A 2ZPKL 3TPUB 2YWYA 3VWKC 5ID0A 1G1YA 3MQIA 5EWIL 1DBAH 3FL7A 5DA0B 1KJ3H 3TIDB 2EC9T 2HAZA 5F3HB 3MLZH 1P4BH 4E42A 2P4AB 4NDMB 5KSAC 1OAKH 3JWDL 1NFIA 2CXKA 5KJRL 3DJ9A 3DBXA 2JF1A 1UKSA 2D9CA 4KI5F 4X6BB 2BC4A 2YA0A 1CXHA 3OXSA 5H94B 3HAEH 4WUUB 4HK3J 3DIFA 2BOBB 1EV2E 4ZUVA 4L4TE 1S5HB 4PJGF 2D7OA 1JRHI 4PRBB 1BBDL 2X40A 3RUGA 3PWPA 1QFPA 4YDLC 1KIPB 4L3ED 4S1RH 4DKFH 4JO2H 3UTPE 1EHXA 1I1AD 1JGEB 1N6UA 3IFPA 4LCWA 1KN4H 3V6ZA 5CZVH 2A9NL 4OZGA 1ZT4A 3UTPD 4OFYA 5D1XB 5IMMB 3O3DA 5JDJA 2I60H 1MF2L 1EIBA 1U8OB 4G7YH 4O2FB 3UEZA 4LBEB 4PRNB 4BSWA 5HVHB 3R8BB 4UIKL 5CBEA 3RTQD 2C3XA 1JF6A 3LRSA 1CL7H 1MCIA 2D31A 4H25B 4KK6C 1GRWA 4HMCA 1DUYB 3CDCA 5A3ID 1X4XA 1HZHL 1F3DJ 2FGZA 2VUYA 4P4KA 4TULL 1YEGL 4GBXD 4KY1H 4ODHL 3O8XC 3G6DL 3T0ED 4I4WB 4QEGA 4L3CB 4Y5YB 4IEFB 3LY6A 1YDPB 2I07B 3QXDA 1NSNH 3V6BR 4JPWH 4S1QH 3AREC 3ZT5A 1SQ2N 2R4SL 3LQAC 4TOYL 1JCKA 3R1GH 4PG9B 2AKRA 3O8XD 5EG6C 1WAAA 3DX7B 3MXWH 4NKOA 3LH2L 4OZFH 4PJHA 3BKCH 3FO1A 4K8RD 1T2QH 5M94B 4R0LB 2FH8A 3LQAH 4KKAC 5INCA 3SDXE 3QXTA 4OLWH 1KCVL 1BPVA 1KXTB 1QO3A 3GJFB 3FMGH 1JWMB 3SQOL 1U58B 1KELH 4U6HB 2EDWA 4L3CA 4S1DC 1WBZA 3UBXG 4G6AC 3BO8B 3GNMH 1J8HB 4TSAH 1DBBL 4P2QA 4JE4B 1T1ZB 5FGCB 5DD6B 4LLAA 4X6CE 5IJVA 3NA9L 3QFDB 1RSFA 1X5KA 4JKWA 1G9ML 1YMME 4HX1A 4TNWK 3DX7A 1N4XH 4XPAH 3EOTL 2DQFA 1I3GL 1KCRH 4FQIL 1JZ6A 1QQDA 3PGFH 4HWBL 3RGVD 4I77L 4H88H 3P40A 1A6UL 3TA3D 1HXMA 1K2DB 4RFNC 2CKBB 2GSGA 4S1RL 4M9PA 4FHBD 5EN2B 5DI8A 2ADFL 5I17A 3RWDB 1AKJD 3SKMB 2YD6A 4PB9L 3NGBB 5HHPA 3QUMH 4WFHE 1BJ1J 3CGTA 3Q3GB 3OKYA 5C9KA 1RURH 2Q20A 1CGXA 3QO0A 4LKXA 1LO3L 4HUKB 5F44A 3B5HA 2IQAA 5DEGA 1UYWH 2YRPA 1ZVSA 4ETYA 5I18L 2Z91A 2F5BL 3RVUD 1NC4B 1H3WM 5F7MC 4K7PL 4MQ7A 2MHAB 4YXHH 5I1IH 3FB6A 4KV5F 1SM3L 2ZJSH 1CVSC 5CGTA 4EOWL 4TVPH 1U42A 1BWMA 4HMEA 3ZKMD 5JHLL 5GJTH 5I6XC 1BHGA 5C86A 2H9GB 3RPIA 2P5WD 4PRBA 3VE0A 2NCMA 1OSZB 1CE6B 3W39B 2DWDB 2P42B 2HA1A 2UZXB 3LD8B 4H8WC 2ERJC 2VDKH 1OTUC 1IAII 5EZLB 2K9UA 4F58L 3MV8B 2WIIA 4GAYB 2OR8A 5I75C 3RAJH 4NCC2 4OLWL 4LCYA 4MXWH 4NWUH 5DJ6B 4UILL 5D9SA 1BD2E 4QHNB 1BLNB 5HVHC 1YC8A 4AEHH 3RUGF 1CGUA 3LHPL 4Z7OF 4PJCA 1LNUA 4AEHL 3QJFA 4X6CB 2BHZA 2YD4A 5CZXD 2IGFL 4YDLB 1X7QB 1OB1A 3MYJA 2JJTC 1IT9H 3ROOA 3V9FA 1GGBH 3TBSA 2UWEA 2IH3B 4KRPC 4H20H 4KAQH 5H8DA 1WCBB 1OP3K 1S7TB 1MFCH 4G3YL 3RDTC 4ZAKB 1AGCB 1OQOA 1T4KA 4E41B 5CJXC 3L3DA 4M93C 1EHLL 2AJSH 2R0ZL 3BT2H 1G7MB 3STZA 4IMLA 4P2QD 4XP5L 1KLUA 1HSBA 2ZCHL 1E4XH 3T3PE 3EDDA 1EHNA 2AJSL 2R0ZH 3BT2L 3I3DA 4X9IA 1BGXH 5GGQL 4Y4HA 3O6KH 4ZPTB 5EZJB 1T89A 4M61B 5FHAL 2EYTA 1G9NH 1WZ1H 5DEFB 3VFNB 4LOUC 4A6YL 1AI1L 5D5MA 1TMCB 2VXSH 3VD9A 3O6LH 1GGYA 1YNKL 3O3EA 2IADA 4YXKL 1A22B 4G43A 1KN2L 1RZ7L 3D2UB 3IRZA 4DUXA 5JW4R 3TNMA 5FXCH 1AP2A 1XMWA 2BOCA 1HXYB 1UJ3B 5JNYB 5IMKA 3Q6FA 3MYZA 3IFOA 3OX8B 5K9QI 4LSSL 4GBXC 1MJUH 1IE5A 3MBXL 1G0YR 1HOCA 1KT2B 2DAVA 3CMOL 4NKQB 3UO1L 2VTFA 2R15A 2ADIA 1WFUA 4LRIC 4KRPB 3LEXA 3I2CH 2OMNA 2K7QA 3QDME 4HLZG 3DV6B 1BMGA 1UXWA 2HP4A 3EOYG 5C09E 1SJHA 1S9WA 2F9BT 2I5YL 3ROLA 1D6EB 3AS1A 1FNEA 5C0CE 2E8YA 3V8OA 3MZTA 1RUML 4IRZH 4AEFA 2E6QA 5IQ7H 3VW3L 4XAKD 1AP2B 4Y4KC 3C08L 3MJ9H 4LCCC 3NACL 2CLRB 35C8H 3U9PL 1OGAD 3TFKC 1U93B 1MWAH 3NACH 1B9ZA 2HLAA 5I8KL 4KDTA 4LBEA 2VABA 2V9QA 4P9HC 5D71H 5E1HB 4BA8A 4IOIB 3LRSB 3QUKA 4PR5A 1OLZA 4RNRA 4HWEH 1PJ9A 4XVSL 2FX7L 4ODBD 2JB5L 3SQOH 1UEYA 1E28A 2EDDA 5JHDE 5JO5A 1T7XA 4ZS6D 3OKDA 2I9TA 3KPLA 4PLNC 2GT9B 1EEZB 4M62H 4C54A 3ZKQD 4U4BA 2VLME 2X1QA 5I30H 3E6FB 3S34L 1A7RH 4FG6C 3IDUA 3FT4A 4PJBE 4U3HA 4G42A 3F7YB 1MRFL 4HFUL 1P5UA 1N64H 2R9HD 3KVQA 2RCSL 1CR9L 1DQQA 1FFPA 4JAMB 1T7WA 1KCVH 4KJWD 5H2BA 3C8KA 4YHKH 5I16A 1BJ8A 1Q72L 2GFBB 3S5LB 4EDXB 3BQUD 5F88B 2XZCL 2PR4H 5C0EB 4S2SA 5ENWA 4AT6B 4K71B 4BFGA 4E5XB 3IJSA 3OV6A 2NY3B 2YD2A 3I84A 3EO9H 3L5XL 1KJ2B 3ZDXE 3FQTA 1JK8B 2WWMD 5JOFA 1INDL 1NGYB 4EI6A 1HHIA 3KPRE 2UVFA 4IJ3B 1TTGA 3BYYA 3B9KB 1J12A 2KL6A 1UXSA 5EFIA 3N0PB 4HDIB 1IC7H 1F3JA 1II4E 3MRNB 5GSVB 5DC0A 1A9BB 1TCRA 2DYPB 1KJVB 1QSEA 3BPCB 5TE4H 1A3RH 4MA1C 4HULB 3DX6B 3NPSC 5EO9A 2C1OA 4P3CH 4DGVH 1B6UA 3NCYS 2YK1L 1T20B 1RZGB 3RWGA 1N7MH 2HT2C 2B1HL 3IKCB 1G7IB 3B6SB 2AJUL 2H32A 3FFCD 3P77B 5GRVL 3LEYL 3JUZA 2OBGA 3PWNB 5ILTH 4P23B 4XPFH 5BJTB 3OL2A 4BQ9A 3QPXH 2NY5H 3FHQA 2GW5A 4KJQC 3D2UA 4G43B 3CSYA 3QA3A 1F02I 1KB5L 1O7SA 3RX7A 1FYTE 2E6PA 5ICYA 3ZZ1A 1PQZB 3W2DL 1UWXH 5HY9B 3F6LA 4PJDA 3BQUC 3TT1H 5JLZB 1NAMB 2C4FT 1WC7B 3VXNB 2NXYD 1TPXC 3OKOA 3PL6A 2WUBH 2VO5A 3UDWA 4BK5A 1S7VB 4NT6A 1A7OH 1U3ZA 1I4FB 2MFNA 5EOQL 5FOBB 3WN5A 4KZEH 1EEYA 4YFDB 4KUZH 4GRWF 4J4PC 5LGJA 4OQTL 1ZVYA 2A2QT 3OAYH 1L7TH 4WW2C 4Q6IA 4HG4J 1IC5L 2OR7A 2YA2A 5EU6A 3ULVE 4MJ5A 5GGVH 1WICA 2DQIH 2WINB 1NEZG 3LQMA 3D48R 4QWWC 4NRZA 4XI5C 4IRSD 5CJQL 4AIXA 1OAYL 3TFKD 2Z93B 2PF6A 4QTHB 1A6TA 5DUPH 4Q97A 1FE8L 3RY6A 2DD8H 3KDMA 3C6LB 1MREL 4OLEA 5C9JA 4TTDD 1Y0LA 5DVNA 4P5MB 2YKLH 3OPZL 3D1MC 2G75A 3IF1B 3UXFA 4CNIB 1WCBA 3MRKB 4FQXC 3C6SA 1JWUA 4TQEL 5MENE 4PJEA 3HRZB 4PV9B 3HI6L 3MLUH 3EYUH 1ZLUH 3O6LL 2H45A 2APXA 1F4YL 3ARDC 1RZJC 3FZUD 4DGVL 2WWMC 4FFZL 4U1MA 2HRLA 3GSOA 4WY7L 4BSVB 4ONHB 3O6FA 2NY2C 3IT8D 1T0PB 4NN6C 5DUMH 5AAWA 5AD0A 5IVXA 3EHBD 1UEMA 1T21A 3C60B 3HMXH 1KEMH 5JMOC 4PJIF 1WT5C 15C8L 3PQYE 2WLYA 4DK3A 1OOAA 5LVEA 5MP6H 3KLAA 4DFHA 3ULUF 2BRQA 3RWDA 5BS0B 3RZCD 3MRKA 4M1GH 2OQJB 2JJVA 3HAEB 5CJOL 2VAAB 5EIVA 1NGYA 3I50H 4N0CC 4QRSB 3AVEA 5BS0E 4ZFZA 1QFWI 1NCUA 3UZVB 3BRFA 1CDJA 4KK6D 1B4RA 5F3BB 2VWEC 4QYOA 2XI9A 5DJZA 5A2LH 1MHPL 2QV2A 2RGSA 3U0PB 4OM1L 2HWZL 3C5ZC 5L7XH 1QSFA 1WCQA 1NC4A 2A9ML 3L3JA 5D7LD 3BDYL 4LASH 2VZTA 1REIA 5IVXB 3RAJL 4FOMA 2OI9B 2C3HA 4LLDB 3V6FA 1MEXL 1MRFH 1XF2A 2ID5A 3B5GA 2QADD 1GPOL 2IPTL 4JFYA 4AG4H 2JLLA 2F5AH 2EH7L 3P4MA 4FMFA 4U2ZA 3QIUD 4X83A 1W72L 4UTBL 1B3JA 3CXHJ 3FFCB 4X8XA 3NTCH 1BFTA 1UVQB 2VQUA 1KLGB 5I75B 3MGTA 3MTRA 3KAAA 4XBGA 3RU8H 2F19L 5GGUA 4GKNB 1QBML 2KQMA 2AJXL 2I25N 4CVWA 3ARDA 5LKNA 3DVGB 2PXYA 3VFSA 3GJFH 4J3WA 4X5XA 1L9MA 3U0PA 1GCFA 3KPOA 4XAWL 3GI8L 5E8EB 5D2NB 4NKIL 1F4HA 3KNBB 2MCG1 4F3FB 3WL9A 3SDXF 2E3VA 4NP4H 3NMEA 2BY3A 2FGWL 4YJZL 1TVBA 5C08A 1T5WB 5TE4L 3VJ6B 1C12A 3I2CL 3G5VA 4GQ9L 4DGYL 1FZJB 1IC7L 3BX7C 3CX5J 2EXWC 4KZDH 4UNTA 4F7PA 4U6VH 5T3XH 5FYJU 5CILH 3U7AA 4CDGC 4HXBH 3K8LA 3OKKB 3RL2B 4XP4L 4UOW1 3BAEL 4G80A 4IDLA 4S2SB 1PEWA 4C83B 4U6YA 4TSCL 1WV7T 3O3AA 2MQ3A 3CVHH 3QCUL 4HPOH 4HSQA 5D2NA 4PJGA 1EO5A 2X1OA 5E1AA 3WFEH 2AI0L 4UQ3A 1HKFA 2GAZB 1TQCC 2ITCB 3RWJB 3T1FA 3DX8A 1NL0L 3ECBA 4HXAL 4JPWL 4S1QL 1S78D 2JE8A 4MJIA 3MV8D 3WE6B 1G7PA 1JYVA 1CD0A 3QIUA 5INDB 2X7LA 5F70A 3FB8B 1YZZA 3QYCA 2W9DH 2PYFB 4O2CA 4PJGE 3MRDA 1JYNA 1BQHA 3QUMB 3IAPA 1BLNA 3DYMA 5GGTL 3L1OH 5SWSB 1RU9L 1AGBB 1CDYA 5AUMA 3VI4F 1D6EA 1OTSD 5SX5K 4D0CA 3NFSH 5E1AB 1TJGH 4JDTH 1VADA 3EYVA 3JTTB 3MJ8A 5BW7C 1NCDH 4D8PB 1UH2A 2GJ6A 4IMKA 3SGJC 2P8PA 3HZYB 4BK4A 5CJQH 3HAEG 4JANB 1FO0A 3BP7B 1OSPL 1EO7A 1U92A 2YPKA 4R3SA 5C0AE 1MAJA 3GMLA 4R4FH 2R1YA 3HE6A 4AIOA 1N8ZA 3WS3A 4WW1A 5J13B 4P2QB 1UA6L 4MA7H 3WO3B 1IGJA 4HUMB 5C07D 3U9UB 5IOPA 1SBBA 5DUPL 4LLVA 1S7XB 3FB7B 4I0PC 5FOBA 2NNAA 5CHNA 4EIZC 5EB9A 5T33H 1A6VH 4MNQA 3HMWH 3VD5A 2E5EA 1OPGL 2JJSC 1AY1L 5FEBA 2DI9A 3L3JB 2H6PB 2OSLA 4KROB 3ARQA 5IQ9B 1KOAA 4N0UE 3HZKA 4Z9KB 3GIZH 5DRWB 4Z7VA 7FABL 3RJQB 5CKGA 1NANI 5J6GB 2JIXA 1U36A 5BRZD 3VFMB 1NGZA 4IOFD 4ODTH 5JZ7C 3DXAB 1Z5LA 4XXCC 3QIBA 1PDKA 3D9AL 4NQEA 1M05A 3ETBF 1ZHKB 1KB5H 1KTRL 5JTWA 2R2BB 4RISH 4ZS6C 3VFPB 4QXGL 5E9DA 3QDAA 5HVWA 4M6AA 1A6TB 3VXOB 2HLFD 5FKPB 4LP4A 2F15A 1XIWA 4XNUL 4GSDL 4XTRC 2W9EH 6FABH 5I76B 3FTGB 2J8UA 3EYOA 2VQ1B 2W60B 5JQ6H 2AK4A 4YBQD 4L9LC 3AU1A 5DJ0A 4LU5L 4NQEE 1FDLL 1Z0NA 2LVEA 2ORBH 4XPFL 3B9KA 4LSRL 1CD1B 1PVHA 1R24B 1U9KA 2R69H 2VDOH 3MOQA 4MA1B 4ZUWA 1P9MC 2WWKO 4JFOB 5L7XL 5IJKA 1YPZA 5T5FH 1W2KT 4Y19E 5A2JH 3W9DB 2F53D 4F33A 4NQCD 2X1XR 3C60A 1E28B 5GHWL 1ZT7B 2IEPA 3V5KB 5GRZA 1TJIH 2WBJB 3ARVA 3IXAB 3RVVC 4OKVB 2XYCA 4MQTB 4XC1L 4KXZH 3V5DA 4NC1C 3IDIA 4WTXA 1FIGH 4JPVL 2QR0A 4KQ3H 2VLLB 1T83C 1E4XI 2Y06H 1Z6JT 1LHZA 3ROOB 5IB2A 4ZUUB 5KN5B 2EC9U 1RK1B 2Q3ZA 4Z7QF 5K9QG 1QR1A 2PW2B 2GUOA 1IGTB 2A6JA 1RVFL 3DROA 4WHYH 1FH5H 3BP6A 1FLRL 2PUQT 3SKJL 2MPAH 1NJ9B 2BNQA 3GSWA 5ANMA 4N0UB 4G9FD 5D1QD 5TE7H 4DWHA 3E0GA 2AJYL 1CE1H 2Y5EA 4KZDL 4IRSB 2X1WL 4JHBA 2CSPA 1SEBB 3DVFA 3KR3L 4JDZA 4OCSH 5GGRB 2D7QA 1HKLL 4WGVB 2N56A 3WN5B 4GQ9H 5FHBH 2WK2A 3P3YA 3IXAA 1XGPB 5B3NA 2AJZA 1EEYB 3BE1L 5K9JH 2GHWB 5J3HD 3CC5A 1Y18B 3QFJD 4ZXBA 2A73A 3DVIA 2QQQA 4HK0A 2D7MA 4PJ8A 1HSAA 1T1YA 2CIIA 4MHHG 3FFDA 1CFVL 1DL7H 5E2VH 4YC2C 1Q9KB 1ZMYA 3C2AL 3TA3A 2I60L 1XF5B 1LWRA 4LCWB 5HPOA 3GI8H 3T3ME 2MWCA 2W0LA 1SYSB 3IETB 3OSKA 2YN5A 2HVJA 4WW2A 3Q6FB 3QAZB 4IMKC 3RQ3A 3D9AH 3IXTA 1IGTA 1IAIH 3RGHA 4NHUB 5ACZB 4RFNB 1CL7L 1X4YA 4K3JL 1RZKC 4OQTA 4J3VA 5DHVH 5JIHA 3T65A 3M17B 1JPFA 3FONB 4K3JH 1YEIL 5F89A 3RIAF 3WL9B 3MNWA 5FUCE 4JM2A 5E94A 4HH9B 1OT1A 3DV6A 4GAGH 1HNFA 4JDZB 5EIQA 1RUQL 3DUSA 5I73B 1I8MA 1R5VB 2ZWLT 4P46D 2BSTA 5GJTL 3QNYB 1VA9A 5IF0A 1OHQA 4NQVA 43C9B 3FB5A 2X09A 2CUIA 3PHQA 2H2PD 2Y07L 1JGDA 4D9LH 3ZSSA 3HB3D 1I85C 2EZ0D 2HWZH 4OD2A 4TNWF 3VFWB 3VWKD 5EU4A 4PJ9D 5HY9A 2R2HB 5EUOE 3UAJC 2DJSA 3O3EB 5DUBB 3T2NL 5FB8A 1NGZB 3W0WE 2VLRA 2E27H 4XCEB 4JY4A 3INUL 3GK8L 2CLZB 4M6NL 5DF0A 5CEZE 5TF1L 2LTQB 1S7QB 2PYEE 3IFNH 4CVZA 4CW1A 2QSQA 3OKNB 2EXWD 1YEFL 3QISA 1FNHA 3GBNL 2R0WH 1JTPA 2X4OA 4QO1A 5HI4C 4JDVB 5IHUL 5E5MB 3ZYJA 4JPVH 3UAJD 1EFQA 4C56E 1NC2B 1I1FA 3I6KB 4XH2B 4KJQD 4ZFGH 2FIRT 1I7TB 1PSKH 1XGUA 2Q8BL 4QRSA 3V6ZB 4MXQD 2VMFA 1BECA 3GMPA 1NLBL 2OXHA 1R6VA 4MJ5B 5DJXB 5F3BA 4RAUA 1DQQB 1FNSH 2P24B 1PLGH 1NBYA 1W72B 4JGJA 2D0HA 3S37H 4PJFB 4PJAA 2APBA 4Y4KA 3WHE1 3NCEB 1NUGA 2A1WH 4IHOA 2XQYG 1QSFB 4A2LA 4Z7NF 4OI7A 3MJ8B 4HS6A 1J8KA 3VGAC 2HTLC 4LPVA 1MAML 4XP6L 3SGEH 3V6FB 5ENWB 1QSFE 2R0LH 2PKDA 2R39A 5DQ9B 2QADC 1U8NA 2LTQC 4L4VD 1T0MB 1S5IH 4JCLA 2QJDA 3O4OB 2YHGA 1VEPA 3C6SB 2B2XH 1KG0B 1W0YT 5MEQB 4JFPB 2DQUL 3FQUA 1ZANL 2GITB 3TYFB 3HNVH 1UVQA 5ITBL 3THML 2V17H 3BP5A 3BVNB 3G9VA 3QG6A 3KS0J 4I0PA 4QTIH 4PTUB 5D2NC 1MQKL 2E9WA 3D87B 1IKFH 4FN0A 7FABH 3CCHA 3TIEB 3ZYZA 1NFDE 4JY6B 3BWAB 4Q2ZA 1MHCB 5HHQB 5AAMA 2BVPA 4R0LA 2UYLB 1X5FA 3JTSB 3X14B 5B8CB 2ZCKH 3LEVL 2ZOKB 1I1CA 4HJJL 1V7NH 5A16A 2VNCA 4HGWB 4XCCH 4OI8A 1N6VA 1AGDA 1A47A 4HUVA 1HWHB 1W0VA 4JVPA 1EAPA 1PKQB 1MCOL 3IS0X 3SJVB 5IW1B 4LEOB 2B4CC 5CJXA 5EBLA 4ODWB 2ZG2A 3Q0HA 5F6IB 3C8HA 1ZEAH 4BELD 3OKKA 2A83A 3VRJB 1PG7H 1T3FA 4NHUA 3X3FH 2XKNA 5ACMA 1A2YA 1IM9A 2OTWA 1WZLA 2BDNL 3KYMA 2FDBP 4KKBD 3QAZC 5BZWA 1QOKA 4HIIB 1G1CA 1JP5A 3MRGA 1BFVH 4UQ3B 1Z9OA 4O00A 4HKBA 5HI3C 1U8JA 4Z7UA 1GOGA 2Y36H 3O6ML 4YC2B 4XB7A 3B9VA 1U3HB 1UZ8A 2EYRB 3S35L 4C57C 5J56B 1I3GH 4FQIH 4B50A 1AD0A 1DR9A 4UTBH 4KK9C 3QI9B 1BQHG 3U7YL 3UTSB 4XNXH 4CVXA 3NIFF 1JGEA 1TCMA 1YECL 1I1YB 3LN9A 2XPGB 1OCWH 1NGXB 3C60C 3QRFM 4F7TB 3FB8A 4PJXA 4X6FA 4QGYA 2JELH 3E6HB 5AG8A 3TN0B 2B20A 5D7IE 4OCXH 4G8GB 4FXGA 3AY4A 5DD0L 4HAFA 1CT8B 1MCSA 1T22A 3ARFD 1EGJH 1Q0XL 1QFUH 3S96B 2NX5E 4O9HH 4ESKA 5L0QC 5FKAA 4O02H 4PP2A 2EE6A 3V6OE 4Z8FL 2ICEA 2M1KA 3PV6B 4K3EH 2G9HA 3RY5A 4PRIE 3RTQA 4MCYA 2A6KB 4PY7A 1JMXA 5T5NG 1OTTD 1CE6A 2QHRH 5DT1L 3SEPA 1B6DA 3W39A 1R5IA 3K0WA 1IJ9A 4J3UA 3C9NB 3VGFA 2JCCA 2APFA 4ZD3H 4KC3B 4LOUD 4N0CD 1NGXA 4F15C 2YUXA 2V6HA 2CKBL 4LIQH 3IYLW 4JZJC 4M93B 4MJ4A 4V1DE 2R1WB 2CRZA 1F6FB 2VR5A 4NNPL 3HC4L 3P4OA 4ZS7H 1IM3A 1BF8A 4JZNB 4LRNL 2AJZB 3UC0L 2D7TL 1UJTA 2GJZB 4FQXB 2FHCA 3DMMD 5F96L 1H8OA 4P2CG 3VFGL 4PP2B 5ALBH 3DARA 4M43H 2D2OA 3SE3A 3AFLA 3STLA 3WFBH 4YBLC 5AD0B 4HS6B 1Q9KA 1F00I 4U1JB 2PTVA 2VERN 4L8SB 4MJIE 2NY6D 3UTOA 1P7HL 1CIDA 5A2IH 5TF1H 1A14H 1MI5B 4OGXH 3BEVA 1WZKA 5IG7B 5JLZA 4MJID 4X99A 3MRIB 4OIAA 3GIVB 2ICES 3QDJB 3KYKH 3S34H 1XR8B 4I4WA 5HBBA 2AABL 1OTSC 2DQGL 3BPLB 2Y07H 4DKEH 4GG6F 1CD8A 1F3DH 2IAMC 3OKEB 4JFDD 1JNNL 4Z0XB 1QG3A 1MAKA 1J0YA 2JCCF 4WTWA 2OR9L 4WFFD 3GSNL 4LAQH 4D8PA 1W72H 4U1JA 3CH1B 3HI1B 2VZ3A 1XGYL 3EZ8A 3LMJH 1MNUH 2LQRA 5CZVL 3REWA 4BSVA 3QDMB 1FPTL 2YR3A 4M6ML 5ADPL 4JFFB 3EYFB 3MV7B 5C09B 2J8UE 2ADGB 2YBRB 3H9SA 7CGTA 3B2VH 5D7KD 4K9EC 3SE9H 1IGJB 1J18A 5KVGL 1ORQA 1X5ZA 3VFRA 1KGCD 1J8HA 2D0FA 3NH7H 3HNTL 4LP5A 3HNVL 1QKZH 2VE6B 4E5XA 3T3PF 2VSCA 1F4WH 3G5ZB 1I1FB 1PX3A 1WSST 4PD4K 3R8QA 1YEJL 3I75B 1EXUA 43CAA 3KJ6L 5GJSH 4Y2OA 5HHOE 3VRIA 2EDBA 1ZS8A 1K9TA 4OIIH 1IGIH 3SDCC 1A64A 1GZQB 3A6BH 3BPNB 2PW2A 4O2EA 1HNGA 3GFUA 3IRPX 4HV8B 4YX2L 5D5MF 1DSFL 5GS0D 3Q2CA 5SWZA 4MDIA 1A0QH 2F8VA 2RAMA 5DWUH 2NTFB 2HJFB 1HINL 5D7JD 3RA7L 3HG1A 3VGEA 2IG2H 3HE7D 1PY9A 4OLUL 4JRXE 3KXFB 3WIIL 4GAFB 1HSAB 2CIIB 4G6JL 2ZOLA 3MBEA 2H32H 3WIIH 4K3DH 3RTQB 4MD0A 3N85L 4F9LC 4WU5A 2RFXA 4XWGL 3QUZA 1IC4H 1YEKL 1KFAH 4U1SA 4M7LL 1CYGA 1N64L 2CLVB 2XTLA 2IANA 1BJMA 4J3OC 3QDGB 3BPNC 1ZA6B 4OAWB 4RGOL 3QULB 4DTGH 4HLZH 4JFDE 1OW0A 3MV7E 4ZUVB 3WFDL 1ZXQA 3P4MB 1AGDB 4Z0BL 3DO3A 1KJ2A 4U0QB 2YPLD 2D03L 4R26H 1VGKB 2ARWA 4OF8A 1T04A 3AMLA 3CVIH 1H5BC 2A6IA 5KS9E 1R3KA 2EDXA 1WK0A 2PXYD 4R90L 1R0AH 3L3GB 4HWBA 5DRXB 3KPQB 2WUCH 5ANME 4K2UH 5EU5B 2R2HA 4JKMA 3RGVB 1UXSB 1QRNA 3OX8A 3SN6N 1RJZB 3VG9C 4XMLH 2CRIA 5DVMA 4PREB 3BESR 3ECBB 4UB0L 3VFTA 3PP4H 4J7RA 4P3WA 1XR8A 3O2WH 4OTXL 4MWFA 1A6UH 3QCTL 4NWTL 1B4JH 2XKSA 1FYTB 2PN5A 3ARDD 1QLRB 4KI5C 1A5FL 2A9NH 1RQ5A 2WLZA 1U3HA 1UZ8B 5T3ZE 5BMFL 3PIQB 2R2EA 2AK1L 5F6IC 2EIDA 3S7GA 4XVTL 4YH6A 4BKLB 5TQ2H 5HYSB 3C08H 5SX4I 1E6JL 1MCEA 2G60H 5LWYL 4JVUA 1VEMA 5I1HL 2XV6B 1FVEB 3HRZA 1FFQA 1OARL 3HR5B 4ZPVA 5JQHC 4YO0A 1JFQH 4LLUB 1JPTL 1IKNC 1PYWA 3TNMB 4PREA 4ZFFB 4EVNA 3ARXA 1V7ML 1M05B 1GGCH 4JFXB 5DD5H 2VDLL 3ZLQC 2ZG3A 1J0IA 1LNUB 4I8DA 4QRRD 4OZIA 5ITFB 1NGWB 4U6TA 4L5FH 4I2XA 4MXQC 2BVQA 3O9WB 5FYJH 2Y5TB 4EI5C 2DTSA 3FO9A 5FYKH 2AEPH 4Y5VC 2A0LD 1T0MA 2OS7A 1I3VA 3S88L 4PJ9B 3KYOB 1RIHH 5EH1A 3TYGL 1A1NA 3S88H 3VG0L 5CMAA 4H1LG 4ZUTA 3H42H 2UVEA 4JKPH 5DUBA 5FB8B 3QFDA 4FQ2H 3VI4E 1F90H 4JO3L 2VDPL 4Z77A 3AC0A 1L9NA 1FH5L 1FLRH 4EDWL 2BY1A 4S1SH 3VGGA 1XCTB 2EKJA 4NQTA 1IRAY 4LL9A 2NY2B 3TBYA 3ARGD 3UYRH 4UDTB 5ETUA 4QRQB 4BYHA 2EZ0C 1WVZA 3QEQA 2H2PC 5IWLA 3AUVA 1F8TL 2WIMA 2G75B 4IOIA 3IJSB 1X5JA 1BZ9B 1L6ZA 3SDAB 5HDLA 2DDQH 3CLEL 3WUZA 1X5XA 5KVDL 4F7MA 5JO5B 1UH4A 1DP0A 4QT5A 2AXGB 2MQ0A 4KRMB 2ATKB 1JTTA 5M7QA 1IZKA 3N9GL 1UWXK 3TWCL 5ICXB 2NY4D 3OPZH 3DETD 4XNXL 2A6JB 5D7IF 1NMAL 2UY6A 4CDHA 3MCG1 2DJ4A 5C8JB 3F7YA 5DA4A 1TFHA 4HFWB 2BRRH 3HZKB 3KHQA 3HI5L 3T4AB 1RZGA 4S1DD 4PV8B 2GI7A 1MF2H 2AV7A 3I3BA 4EQ2A 3OJVC 2CH8A 4RFEA 3S97C 4Z7UE 1ZGLP 1S78C 3RKPA 5EIIB 4PBWD 5ESVA 4JQVC 2AJVL 3Q1SH 3ULUL 3ZHKA 5LBSL 4ELKB 5AZEH 4WIQA 5I8EA 5C0IA 5E9DB 4RISL 3D2UD 3QCVL 5IB1A 3HZMA 4HS8L 3ARGC 5BRZA 5A2FA 2WBJD 2OJZL 5KN5A 4MA3B 3X3GH 3OG6B 4LCWE 5KSUB 1KYOJ 3HZVA 4KROC 1WLHA 1J05A 4RGMC 3CK0L 5KTEL 3U82B 3RNQB 4P5KA 2VQ1A 3AROA 1UG9A 5C0RL 4DN3H 1ND0A 4HEME 3IJYA 3RP1A 5DD1H 2VXVL 4LLYA 3U6RB 1UADC 1HHKB 2D4DA 3ARWA 2R2EB 3MRHA 1CGVA 5FF6A 4LDOB 1ADQA 4TUJB 2BVUA 1BGXL 5GGQH 3QZWA 4XBGB 4HEPG 4Z0BH 2RJMA 4IDJL 1AXSA 3UYRL 2A83B 3CFJA 4CU7A 1AD9A 4KHXL 4CAGA 2G2RA 1Z9LA 1KIRA 1PYWB 4GRMB 3K4ZA 1RI8A 1UACL 4YXKH 4QRPA 1Z3GL 2B5IC 4J3TA 1MCCA 2HH0L 3S36X 4TRPH 1Z3GH 4ETQB 2D31B 4ZQKB 5JXEC 5EUOB 3IFLH 3EO9L 3L5XH 3C60D 4Q9QH 3IAGC 4I3GA 4JG1H 3FRUB 3EAKA 1INQB 2XXCB 3U0TB 4N8PA 1DE4B 4JZOA 5GSVA 3U7YH 3LN4A 4X9FA 2QQNL 3V4UH 5HSFA 3WXVH 4AQOA 5E8DH 2EIZB 4Z7NE 2NLJA 5IW3A 3OZ9H 1QA9A 2DLHA 4F57H 4X6FB 4K9EL 1S7XA 4TQEH 2AW2A 4IRJB 4Z7WE 2CIKB 4KJYB 4XP9H 1ZGLA 1LO4H 2R23A 1P53A 5IR1B 1KC5H 1J0KA 1QD0A 4ZXBB 4OLXL 2HKHL 4NUGL 4KTYA 2CMRL 4LPTA 2G60L 5LWYH 3ZL4L 4KMTL 4APQD 3T1FB 2A6KA 4DQOL 4K3EL 1HQ4B 1UYWL 3KLAB 4Z95L 4H0HB 2AI0H 1P2CA 3EFFB 3C87A 4PJFE 5AEAA 2X4NB 1OP3H 1SJEB 1I8IB 3CFDA 3GGWB 5DMIL 5ALCL 1OAXH 2IQ9L 2OJZH 1EUUA 2P5EE 3RL1B 3OGOE 3V7AE 2EEAA 3PWVA 1OAXL 2IQ9H 1BF2A 4G8IB 2BVOA 3AGVA 3O3UN 5IP4A 4K3GA 3FQRB 1ZLSH 2W0KA 3VA6A 4OLZL 4Q74A 2YXFA 3MA7A 4LMQE 3LS4H 3VFNA 2HKFH 1B0GA 3WIFA 2Q8AH 2YZ8A 1JGUH 4AG4L 1LP9E 2ZOKA 3SDCB 1XF1A 2CR3A 2H26A 4JJ5B 4N5ED 1TQBB 3EFFA 1NMBL 3PP3K 1UKTA 3SPVB 1CU4L 1CLZL 1DCLA 1FFPB 4U1GC 5I1KH 4AM0A 4A6YB 1DBAL 4AY0A 5JXEA 1KBGH 3GMOB 3AM8C 2AJXH 1BQSA 2WAHA 5J7CC 1LO0H 1QHPA 2GTZB 3VFUB 4HIXL 3WXWL 3UBXA 5ABDE 5I9QB 3ULVH 2QSCL 3E1F1 3VD3A 1OAUH 2Q7NA 1QEWB 3W0WA 4OF0A 1IEBB 4JFEA 5I1AB 3SGEI 4DUWA 1X6NA 3KXFA 5DRWA 2FYYA 1X9QA 5FYKU 4NJAL 5CIPA 1T6VN 2AJYH 3H9SE 1IQWL 3ULUC 5I15L 1YUHB 4FFWC 3ZE1E 2V2TA 5FHBL 4OCWL 2P46B 5FF6B 2DLGA 3H9SD 5JUEH 1IGCH 1J8HE 1QSED 1PX4A 5TH2A 4ACPA 1KN2H 5I0ZA 4PY8I 3VFOB 1KCSL 5CBAA 3OGCA 1WFOA 3SKMA 3PDGA 5F72S 3TP4A 3TLRA 3R0NA 4IM8A 2VLKB 3MRMA 4RRPG 3E3QC 3BJ91 2BK8A 5EULV 1C5DB 4WVRA 1U3HC 1YY8B 5DGRA 3UYOD 2EEBA 5HYJA 1Q9WA 5DLMH 1ITCA 4Y2DD 4Z7QE 5ADOH 3KYAA 3SDDC 2VDRL 1Y18A 1D5XA 4YHLL 3GSQB 5DEGB 2FJGB 5MP6L 3FTGA 2ITCA 3RWJA 1LEGB 3S4SB 5C6TH 3F58L 4F3FA 3HI6H 4YE4H 4JHAH 1MFNA 5LJYH 4HJGA 3C6LD 1S8DA 1TVDA 4I9WD 5IBUG 5F97E 4XVTH 5I16B 1CQYA 2QADB 3M1BB 2ORBL 2DIBA 2F58H 4FQJL 4J6RL 4Q2ZB 1TZGL 3MRQA 4ZFOA 1YNTA 1A7RL 4WUUA 1SMAA 1YY8A 2Q86A 1YEEH 3G08A 5FYJD 3BUTA 3K3QA 4JG0H 1CGSL 1WTGT 4G9FE 3SQBA 4FQQA 5I8KH 4UILH 4D9LL 1U2CA 1KENH 1GC1C 3LKNA 4KUCF 2MCPH 5GS2D 4PJXF 3KGRA 4JR9L 5JOFB 5L88H 5FECB 2OTPA 1U0QA 1VADB 4ZTPH 4Z76A 1KENL 3FB5B 2BNRD 4EIGB 1AO7E 3JV0A 1NANH 1DLFH 2J8HA 1OAYH 2BNQE 2ICEB 5GZOC 5D72L 4HGKC 5KTEH 2QSCH 2ZPKH 3P9LA 3WFCH 1U2HA 1A9BA 1TCRB 1VFBB 4U49A 2Y1VA 5SX4H 2IANB 3QDJA 3MLZL 2A9MH 5DJAA 4ZFOB 4LVNB 5J11C 3FB7A 3X11B 3C9NA 1UCTA 3PP4L 4POUB 1FNEB 2VYRE 3O4LA 4ZDHA 4R0LC 2OSLB 4RFOH 1CBVH 4H88L 3FT2B 3WSQH 1JZ7A 5D7LB 4WJ5A 5CMAB 2FLBT 4Y5XA 1PBYA 3BKJL 1RZJL 5KSBA 5IM7A 3M07A 4RAVA 3T65B 1HXYA 1UJ3A 5DD3H 2IF7A 3RHWK 4I13B 1D9KD 4YR6B 4WTZA 1S9XA 3PGCB 3HFMH 4Q9BA 3HCVA 4WDIA 4XWOD 5T1LB 3KPNA 4Z8FH 3HLAB 2QQNH 3SGDI 3VWJB 3L3IB 3VXME 5E9DD 3NA4A 3LN5B 1A3RL 4LFHD 3BGFB 1NBVH 5DJ8B 3GRWA 1MFBH 4PD4J 1UB5B 1XR9B 4KK9D 5GIRB 3RY4A 1S3KL 1MFBL 5D2LA 5ICZB 1FDLH 4B0MM 4OKDA 5KW9H 5E8NB 5IM7B 5KSBB 1BD2B 3UC0H 5C0DA 1BJ1H 1CDUA 5IUSA 3U79A 3L9RA 1A6AA 5C0AB 1GH7A 2W9DL 4PRAA 1YPZB 1IC1A 5J1AA 4QXUL 2JJWA 4OZIB 4KFZC 1ZV5A 4LLQA 3HPJB 3HLAA 3INUH 4RGND 4WHCA 1OVZA 3SDCD 1C5DA 5JPNB 2VN7A 4MA8L 2W07A 1NPUA 4PG2A 3MRPA 2CDEA 3TGXA 5IG7A 2VDNL 3MLSH 3MACL 5HI5C 3D5OF 3GUTA 4POZD 4PJ5D 3ARUA 5JZ7D 4ZUSA 2M8XA 2EDEA 4XMKH 4OGYL 5D2LB 3TVMC 1BFVL 2ZUXA 2WQRA 1WIOA 4O5LH 2C1PB 3GM8A 4WWKA 4HKZA 5D6CB 4DVBA 1M1SA 3U7WL 4XBEL 4UZGA 3NZ8B 4KZEL 5I1GL 2EKSB 4J1UB 1YMMB 3QNZB 3ZE2E 2FECI 4MJ6B 2NPLX 1QTYT 1SY6A 4RAHA 2GY5A 5ADPH 4L4TD 2G5BB 4XVJH 4WI6A 1KBGL 3IKCA 2BRRL 1C12B 4ERSH 4L3EA 4OJFL 1C5BL 2H32B 3G6JA 5GRWA 1V3JA 4HK0B 1HCFX 4KRPD 1K85A 3QZWG 1NFDB 2LAGB 2EXYD 3D18A 3L3HB 4M3KB 2A6IB 3GRWH 3W5NA 3NH7L 5EBMB 2HYMA 2R2BA 1JZ4A 1INEL 3ZYIA 4WFEE 4QXGH 3BH8A 2QQLH 3VWKB 1NCCH 4PTUA 1RIUH 4HUUA 5IW6A 3TN0A 4NRYA 4JPIB 1ULVA 4NRXB 2Z35B 4ODSH 3IKKA 5IB5B 1MHCA 4M8QA 4QTIL 1J0JA 3HE7C 3CDFA 3HC3H 4L3EE 1MCKA 5D7JC 4I0CC 2Y7QA 4ZNEA 4TUKL 2P44B 2GCYA 3B3IB 3BKMH 4WGWB 4WHYG 1X5HA 4K7PX 5JW4N 1FRGL 4KGJA 3RWIB 1ZA3A 2NY4C 2BSRB 5ESAB 2OTUA 2FO1A 3PHQB 4P46A 2P47B 5FUOL 4R8WL 3UJIH 3IU3B 5FO8A 3KLHD 2F54D 2V7NB 3KPRB 1T4KB 4PP1D 5EC1A 4HAGA 4AIZB 1V8HA 2DB8A 3OR6B 1DLHB 4DZ8B 1A9EB 4UQ2B 5ALCH 3F7PC 2DJUA 3QRGL 2ENYA 1XF4A 3V6OC 2FX8L 4P9HL 5E08L 1N5YL 2ZP0T 4Z5RA 2DICA 1NQBA 4LKCB 4U6XA 4U05A 4YAQA 3EO0B 1MCNA 4QOKA 3JWOC 5D5MB 4OGYH 1I3RB 3ZO0A 4W6WB 2QR0B 3I50L 4XNQB 4NZRH 3KPNB 4XMPH 2F74A 3DBXB 3QHZH 1WAAE 4ZO8A 1DN2A 1PGRB 3D3VA 3HB3C 2X4NA 3NBNA 3UTSA 4JKPL 3GMNA 2BOBA 2APVA 1AO7B 2P49B 4NJAH 1HILA 3IU3A 3ARPA 4ZTOH 4CADB 3TYGH 4JRXA 3CD4A 4N0YH 1M7DA 4YHKL 2R8SL 5J1TC 1Y6KR 2A77H 1RJLA 1JHKH 3QEUA 4PG2C 3A6CH 4Y1AA 4FMKA 4A2MA 4M6MH 2ADJA 3QP3A 1WWWX 1OLLA 4PJAB 4Y4KB 2BFVH 4PRAB 2ILLA 5D4QA 3TBVA 1B0GB 1TNMA 2V2XA 1XH3B 3TBTB 1BVKA 1VKXA 5GS1B 3O9WC 4FFVC 1PZ5A 1WF5A 2ESVA 3OB0H 1BFOA 1YJDL 4ORZC 5HPMA 2XQBL 3U0TA 4QNPF 5ID1B 3V5HA 3SGKC 1NGPL 4RWHA 4CADA 4EI5A 2QSVA 1UB6A 3QCTH 4JGUA 5L2JB 4GSDH 1A4JB 5IT2L 3L95B 5J13C 4Q0XL 3QUKB 3O2WL 4X5WA 5T1LD 5CWSB 2RR3A 3BH9B 4WUKL 1O0VA 3JWOH 2GJZA 3BE1H 5B39B 1KV3A 1TENA 1MFEH 1LILA 1E4KC 1MI5D 4I5BA 4Z78A 5DK2B 5T3XD 3Q5YA 3DRTB 1URLA 3HZYA 3S37X 2PYEB 3L6FA 5JW4Q 5MEND 5ECJE 4JFYB 3WNOA 4NYLA 1AO7D 4NNPH 5CKAA 3UPRA 4KVCL 4QHLB 3ZT7A 1FZOA 3DUUB 1J1PL 4DGIL 1G6RL 1CICB 4YEFA 3VG9B 1FLTX 1OGTB 4PGBA 1JE6A 3QXAA 4M1GL 1KEGL 3P4NB 4EN3B 4C56B 1HIMH 4FZ8H 3ZE0E 5DMYA 4EUPA 1GIGL 3PJSB 3WV0A 5K9KA 2QLVB 4KI5E 3LIZH 1S9YB 5IESL 5CHNB 2V5MA 2Y5TA 1C16A 4MNGA 3QIWD 5HI5D 3VXSE 3TO2A 2J8UF 4WCYH 1Q9WB 2NY7L 3CVHB 1T5XB 4NZRL 1WFNA 3QG6B 4TSAL 3U7WH 2FWOB 3F8UB 4OB5H 5HDBF 5D8JL 2VDMH 4JY5L 3EOTH 5IHZB 3RDTA 1CK0H 4O5LL 1NCBL 2EH8L 2WP3T 1YMHA 2FHFA 5IVOA 4WI8A 4I77H 1D5IH 1JNLH 3LVEA 4JHWH 2FIKA 4RGOH 4WEBL 5AG9A 4YZFE 1J1OL 4NQDA 3BPCA 2PR4L 5E6IB 3VXRB 4GRWH 4JRYE 2HLFC 1NCWL 3DGCR 5FA3A 5CJBA 4H1LH 5D7JB 2JELL 2Z92A 5GGUB 2X4QA 3LKNB 4PRPE 4PJ8D 1T1XA 4UT7L 5I76A 5GS0L 3B2UC 1I3RA 5JPMB 2MSPA 3FAXA 2Z91B 5KVFH 1P7QD 3WJJA 3VDCA 4YHPA 4J8RB 4LVHC 4C59B 2EDHA 4MQXC 1R3LB 4RMRA 4AQ1B 1QLFA 1AO7A 4K94L 4LFHG 5CP7A 3ULVC 1XGTB 4NM8H 1F4YH 4RZCB 3QSKB 1MCLA 4OZHE 1SBSH 1UWGL 4GUPA 1JV5A 2XZAL 4JM2B 5E94B 5FO9B 2G5BA 3BKML 3P73B 5C0ND 1I1YA 2I24N 4MB3A 4EUPH 5DJDB 4LU5H 3GI9H 4HUNB 2NXYC 5I8OL 1FZMB 3CFBA 2IPKA 4KPHL 2BNUB 3X13B 3I9GL 4KDVA 4UAOB 1P4LA 3ZSTA 5EBLB 4NZTL 1H5BB 1OAQH 4LPUA 4G9DA 5DS8B 4X6BA 4WJ5B 4U33A 1MI5A 4G6KL 1TJHH 1WITA 3L3OB 1SJEA 5ID1A 4X4ME 4E0RA 2O61A 1QUNA 5CP7B 3SDYL 5LXGL 1IKNA 1KT2A 4GRWB 4PY7B 4M1DL 2OK0L 4N0UA 5DURB 3U9UA 3KYMB 4HT1L 4LRIA 5C0CD 4LGPB 2XWTB 4JFZH 5I1DA 5J57B 3C5SA 3I6GB 1H9VA 2WMPA 1MCWM 5IWLC 3BMWA 1SVCP 5IBTL 4PRHA 3WKNA 3VCLB 3SKOB 1C5CL 3FO2A 5DJDA 4U1KB 4