3BDYH

Dual specific bh1 fab in complex with vegf
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
216
Chain Sequence
SEVQLVESGGGLVQPGGSLRLSCAASGFNIKDTYIHWVRQAPGKGLEWVARIYPTNGYTRYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Variants of the antibody herceptin that interact with HER2 and VEGF at the antigen binding site
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
molecule keywords Fab Fragment -Heavy Chain
total genus 43
structure length 216
sequence length 221
ec nomenclature
pdb deposition date 2007-11-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bdyH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bdyH01
5FYLD 4KRPC 4PJ5E 4OLUH 4UMGA 4UOJA 4M3JA 3PWUA 4NUJB 1JMZA 3WFEL 4NBXB 2DQIL 2ESVA 2NXZB 4JY5H 5D1QD 1H8NA 3UPRA 4XT1C 1T6VN 4FOMA 5FM5O 3KLSA 4OLVL 2IAMD 3P30L 5EBMA 1FLRH 4FQCH 4YPGA 3H7BA 4M1GL 1HXMB 1QLFA 3HUJE 1RIVL 3PE9A 2AEPH 2DQCH 3E6FB 4Y2DD 3B5GA 4QCIA 2Q1EA 4E41B 3BUTA 2H8PB 3IDNA 3C6LA 2PTTA 3U0WL 4PJDF 3BKYL 4LP4A 4P49A 1WAAF 1OSZA 3W9DA 4JFFD 4HIHB 4AQ1B 2ZSVA 3MLRL 2YXFA 2YBRA 3L3JA 4R3SB 5T3ZE 1YJDC 2ZG3A 4Y19A 4P9HC 4S0TD 4L4VD 4QY8A 4Y16D 1PDKA 4IOIA 3U46B 4J2XA 2KBGA 2Y25A 1B88A 1XFPA 1CLOH 3SDXE 3KLHC 2IMMA 1DQLH 3IXAA 2YWYA 1U8NB 1CICC 1U3HA 5DMKB 2JKXA 4PG9A 3IRPX 3OWEA 4F7PA 2OTUA 2AEPL 2HT2D 1AKJD 4LVHC 3PGCA 1GVIA 4K9EH 3KJ6H 5IVZB 1V7NH 1CQKA 5E2WH 4CJ0A 5AWNH 3BP4B 5AD0A 5C0DB 2JB6B 4I9WD 5HPMB 2BVPB 2N7BA 5GZOC 4HJJL 5IQ7H 5DJZB 1NKRA 3BH8A 4G80A 3D3VD 1IAIH 4YIQA 4ZOAA 3Q2CA 1JZ5A 1A4JA 5IVOA 4LGRB 5DHYB 3B9KA 4WFHD 3D0LA 4QF1A 1CU4H 5GHWL 3W0WE 3KNBA 5FYJL 1NFDF 4FZ8H 5DYOB 5JW5A 2A73B 4M6ML 3L3HA 1N59A 1A1OB 2LAAA 1OPGL 1K4CB 4XNYL 3KPRA 1R3LA 1Q0XL 3MRFB 2P7TA 4LOUD 3HMXH 3B4NA 4ZFOL 3D39A 2YSSA 4NC2B 1CLYH 1YA5A 5K9QI 2IADA 4AT6A 1MFCL 2J5LB 4PJXF 3KS0H 1GZPA 3HRPA 4YNYA 4KI5D 4U1MA 5KZCD 3O2VL 4AEHH 2IBBA 1WICA 3LAFA 5A1AA 1BVKA 1QBAA 3VGAB 1GC1L 3ORJA 3KHOA 3G5ZB 1WCBA 5C08A 3PGDA 3NZHH 3RVVC 4U1SA 4XCEA 3L1OH 5D8JH 2VERN 2LU7A 2PW2A 4G8GA 1BQLH 4FZEL 1NCDL 2EIBA 1OLLA 1IEAA 3ZE2E 4R4BB 4V1DB 1BZQK 2CRYA 2APXA 4U0RC 5FM4A 1FVCA 1F4YL 1RURL 3P73A 3LIZL 4TRPH 3RWGA 1AKJB 4LCUB 3QDMB 1MREL 3U6RA 3O3EB 4P48A 3LB6D 1GGBL 5DUPL 2R15A 2OQJA 1D3CA 3LRSB 5D93C 3P9LA 2WIIA 5GRJL 4BK5A 5I1IL 1KJMB 3MNVA 2F9BT 1CDYA 3MRKB 5ERWA 2IALB 3EYQC 5EO1A 3ZE2F 3WN5B 2VLKD 1XR8A 3N1FC 1OM3H 5JTWA 1EFXA 5IM7B 4MXVF 1HI6A 4NN5B 3I75B 4OD2A 3OTTA 2FHBA 3KXFD 3GMLA 1W8OA 2HKHL 4HS6B 3UTTB 5C0BD 3BPNC 2FWOB 3HR5B 4K07A 2GYSA 1WIUA 4OLZL 4YDJA 5J9PB 2X42A 2AQ2A 4LCWA 1G7JB 5KS9B 2GSGB 2VXTL 4DGVH 1T5WB 2DI8A 2XG5A 3SDAA 3L3IB 1D6EB 3NFSH 2FX7L 3WKMH 3QPXH 3VWJA 1L9MA 4CVXA 3GBML 5CEYB 5CBEB 5AYQA 4MXVE 4ISVB 2FX9H 3S37H 4QNPE 3IAQA 1KCSH 1J0HA 1N2RA 1A9EA 4F58L 3OAYK 2KQNA 3QUZD 5GRUH 4OLYH 1MAJA 4I2XB 5DZOA 3OKEA 4IMKC 3VW3L 2XG4A 1XCTB 1AGDB 1WWAX 2ZNXA 4MA8L 4PP1C 3DSFH 3KR3H 3QZWG 4LOUC 4S2SB 3KYNA 1BD2A 2ZOKA 2HWZL 5ESAB 5JMOC 1AHWC 4EN3A 1CXLA 3G5ZA 4HKJB 2ZSWA 4G9FE 5DA0B 3UYRL 2YD6A 5ID0A 3MUY1 3L5WA 4KQ3L 1BJ8A 4P3CH 3AU1B 4MGXA 2X4OB 4GRWE 3HNTH 1OARH 3FFCD 1J1PL 2QJDA 1OW0C 3RY6C 3DXAD 3IDMA 4BSWB 4U1MB 4LBEA 4NNPH 5DSCB 3FJTA 2HT4C 1HKLH 4GKZA 4N90D 3ZDXF 4PJEB 1Q1JL 3IDJB 1KJ3L 3U30C 1FBIH 4YHIB 2NY0C 3MXWH 3I85A 2YSSB 3ZYOA 3OJ2C 1ZV5A 2G60L 2Y4SA 4LQFH 4CNIA 5J12C 1EV2E 1I8KA 1RHHB 2RCSH 3OKMA 3E6HB 3KWWB 5IK3B 2FB4L 4ODBD 4RISH 3BDYL 4JG0L 5HHPB 1YJDH 1J5OH 4OCXL 3P40A 4KI1A 4WUUA 1WAAE 3VFGL 3D0LB 4QF1B 4PJHA 4OF5A 1CDGA 4JKMA 2VXSH 2AJSH 2E7CA 3BEVA 3EZ8A 2JJUA 3LKNA 4QGTA 1A4JB 4YIQB 3K4ZA 4FFWC 5E2UL 2QV2A 2GW5A 1MY5A 3U36A 4Q9QH 5HVWA 5AYUH 4HCRL 3NZ8B 4DAGL 5DMGD 3E3QE 3DETC 4U2YA 4X6EA 3I6LE 2Y72A 5ANMA 3GBMH 2XTLA 4MS8D 4HFUH 1FFPB 1XF3B 3V5KB 5JQ6L 4YEFA 1BOGB 3QO0B 3FQUB 3I9GL 5EZJB 1KTRL 4TUOA 4JE4B 4UINL 3PL6D 1CT8B 3OXSB 4IOIB 4R96A 1UWEH 5F21B 5I17A 2CXGA 4FQXA 3DARA 1G7LA 4GXUM 4Y1AD 4WTWA 2IPUG 4NQEA 1PLGH 4Y2OA 5ADOH 5J1AB 4YZFE 4LGSB 4OQTH 4OCWL 2FBJH 3HC0A 3L1OL 4PJDE 3HE6A 1QLFB 2JJWA 3NACL 4A6YL 5HGBA 2PCPA 2ITCB 2EXYD 2OR7A 5EU7C 3UTSB 4YXLH 3WD5L 5I1AB 5BW7A 4X9IA 4ZO7A 4TVPE 1U92B 3NBNA 3A0OA 3CZFB 4NJAH 1RUAL 1I7UA 4DVBA 1OWRM 5FHAH 2EZ0C 4J4PA 1F4YH 1RURH 4G6AC 2VXVL 2IQ9L 5FDWB 3T77A 1NC4D 3RIAF 4BZ1H 2M1KA 2PR4L 1A22B 2VDQH 3QI9C 2EDKA 4JFPB 5HPOA 4Z7VE 5EBGA 2BSSA 3REVB 1F4XH 3VFWA 1JGLL 5EIVA 4CMHC 2ICEA 1BEYH 1CZ8L 5FUOH 2APBA 2BDNH 4GH7B 3QI9A 5I9QC 2A6IB 4YGVA 1E4KC 3UZQA 4UDUB 2EDTA 1XF1A 3F7YA 5FOJA 5IB3A 3NIFE 4EXKA 1YQ2A 3TZVA 4I18A 5D1XC 1JPST 3ES6B 1ZTXL 3TZVB 3V0WL 1PLGL 2IG2H 4FFWD 1LDPH 1Z5LA 1UVQB 3NGBC 4GRLA 1M6OA 4LDLB 3ZTJH 5JQHC 1VCAA 4YGVB 5I16A 2I60L 1IAKB 2FR4A 1WCQA 4XMLL 2NY3B 3S97C 5J6GB 4APQD 3DETD 5FYKH 2HT3D 2G75B 5SWSB 4L4TB 3REVA 3SKMA 2AP2A 4E9LA 5JOPD 2XZQH 4JFPA 4X5XB 2P49B 4KC3B 1OQXA 2DLHA 4JPWL 5D72L 3M07A 2MSPA 1LO0H 4XGZB 4NPYA 3BKYH 4P5MA 4KKLC 1KIRB 1PFCA 1HN1A 5EN2A 5FDWA 4A6YA 1SBBA 5DDHA 4I3SL 1TJGH 3TNMA 3SE9H 3ETBF 2ESVD 5D1QA 4P23C 3H0TB 2Y5TB 4FXGA 4K3DL 5K9JL 5K9OB 5D7JD 5C09B 3P9MB 2R29H 1KGCE 3MJ9L 1JPSL 1I7RB 2L0DA 4QRTB 3GSQA 1TNMA 4WW1B 5TJWK 4OI8A 4ETYA 3ARDC 1GHFL 2XQBL 4Z5RA 3BPOB 1AE6H 2NNAA 2YR3A 4HK0B 1I1RA 5DTFA 5F1NA 4LVOB 3QO1B 2MCPH 5T1KA 1YQVL 2ZUXA 3JUYA 4PRID 4CADA 1CD1B 5E8DH 3INUH 5ETUB 3CU1A 4UT7L 4J1UA 1FP5A 1RQ5A 5J1AA 3O8XB 4I13B 1I9RH 3QH3A 4L3CB 4G3YH 4NQEB 2R8SL 1HWGB 3G5XA 4Y16A 3FQXA 4I3SH 2IF7A 4Y5YC 1WFOA 5IHZA 4Q2ZB 3N9GH 1NAMH 1IM9B 4NN7C 5IFJB 3MLTB 4G6KL 4U1GC 2YN5A 1E28A 1EMTL 3F7RA 3ZTNH 4Q97A 5SWQA 1U3HD 1KFAH 2B1AL 3V6OC 5KG9B 2HFEB 2E8ZA 4ODVL 5TFSH 1CDHA 5IHUH 2CIIB 1W72H 3HG1D 1W0WA 2VDOL 5IWLC 3V5KA 1LO5B 4FQIL 3CFDB 4KKAC 4D9LL 1OB1B 2VB5A 1RUMH 4GG6B 3OKNB 5C0CA 4PJCE 3VG0L 5IW6B 3H9SA 4WCYH 4J3VA 3P0YL 5C0GB 4O51B 5I1HL 4DVRH 1NFDA 4KJQC 2QQNL 3QRGH 5TDPB 4P5KB 1V3LA 1S7XA 4ZO6A 2AXGB 3C5ZC 2COQA 2LE9A 5BVPL 1WV7T 3K8LA 4JKLA 4QRPE 4RGOL 1CE1H 4JR9L 4RQQB 5D1ZA 2F15A 1FHGA 1GC1C 4LAQL 5F97E 3EYVA 3WJJA 4CNIB 1I3VA 3OBAA 3E8UH 4OTXH 5JHDA 2HH0L 1N5YL 1WC7A 4HF5L 3BDBA 4HV8A 4EDXB 1PZUB 4YHZH 5E7BA 4YDLC 3HE7B 1OTSD 4ZFGH 1ETZB 2CGRL 1RUPL 4X9FA 5GGVH 1N26A 2GJZB 5JXAH 4PV9A 1AC0A 4IOFD 3EYVB 3O4LD 4G8GD 4KV5F 4MJ2A 3LQZA 1I7TA 4XPFL 4PS4L 2XWTA 4EN3B 2ZOKB 4JQVC 2QHRH 2NY0B 5B21A 4A6YH 2EKSB 3R8QA 1INDL 4Z8FH 3X14B 1VADA 3GFUA 3RVUC 3V7MA 2AKRA 5F1SA 1RZKC 2I26N 1AO7E 5IFAL 3QNXB 2C3HA 5KSUB 1ZHLA 4FTVA 4FG6C 2D9CA 3OQ3B 4JN2A 1DLHB 1UYWH 4KVNH 5CEZH 3HG1B 3UTZB 4JFDA 3NA9H 5C0CB 4IBLT 5CJ8A 4I5BB 3HAEB 1HQRA 3I6KA 4YFDB 2IAMA 2DAVA 1C16B 1EFXD 1LO5A 4QWWC 1DQDL 3GMQA 2EYRA 5DHXB 3SDDC 2AJVH 1H8OA 4YFEA 2YD9A 12E8H 1X7QB 1U3HC 2CMRL 5B39G 2VXUH 7FABL 1N8ZB 1TQCC 3QDME 5BO1H 3GKZA 3IDGB 1J8HB 2EE2A 1JHKH 5M95B 4JFFA 4F8TA 4I77H 3FQXB 4U6HB 3FT2B 1Z9OA 3F6LA 1DLFL 1XR8B 1IGYB 2Z31A 4PTTA 4U31A 3WO4B 1CK0H 2OSLA 1PKQA 4JRYE 3EO0A 3PHQB 5DJ2B 3G04A 3RPKA 3MNVB 4ODTL 4DGYL 5HXMA 4HWBH 2EO1A 4TOYL 1L9NA 3J8F7 3CLEL 2XZQL 3KPLA 1D7FA 4XXCC 2HJFB 5GS0D 1KEMH 3TN0A 4BSVA 1EHNA 1AKJA 2WBWB 5D1QC 1IC5L 2GTZB 3D6GA 1BD2D 4X7CC 5LAXB 1BZ9B 4LQFL 1FNHA 4EN3C 4MD4A 4IIQB 3WN5C 5C09A 1A6TA 4HHAB 1UXWB 4M5YH 4U1HB 3WFHB 4NFBA 1TDQA 2P8LA 3ARDA 4GAGL 5D7KD 4Z77A 2XTJB 3BJLA 5EN2B 3FFCA 1FNEB 1D6VH 5C0AB 1QZ1A 5A40E 4WHTA 1XZ0A 5F6HJ 2Y06H 1DBBH 3INUL 4ZFFB 4JJ5B 4OFKA 2J4WH 3GRWH 2CJUL 1FL3B 3UEZA 3NMEA 4NWUL 2EDFA 4LSPL 1U8QB 2Q76A 5E8EA 1LP9B 1WZLA 4Q58C 3QIWD 2J2ZA 4HKXA 5A2LH 1N6QH 3EO1B 1ZA6B 5TDNB 2NX5E 4M61B 2WP3T 5FO8B 1CICD 4KXZH 3T0EA 5EIQA 3CDGB 2BHUA 3N1PC 1SY6A 3GB7A 3HZVB 2EDYA 5IWLA 4PY8J 1N3NA 4NC1C 1RZIA 3H42L 4WUKL 3U7YH 1Z6JT 1KCVL 4NNYB 1U8OA 5DHYA 5CBAB 1FO0A 3MV8B 3L3KB 4Z7VB 2ICEB 2OZ4H 4M7ZC 3DECA 1H3VA 4PJFA 4OM1L 3VFUA 1SJXA 2R4RL 4MD0B 1BBDH 4O4YL 1YEDA 3VRLE 2UWEE 3FRUB 3O0RH 5F88A 3PL6A 4CUCA 1RZ7L 3QIWB 2O5ZH 1F00I 3LV3B 3VU2A 1EDQA 2PUQT 1S7TB 3QEQB 4ESKA 1R5VA 2NY2B 3Q0HA 5HHOA 1A7PH 1KLUB 4NCDA 2D4DA 3UP1A 3GSWA 2C4FT 2QADC 4QY8B 3B9VA 1H5BC 4Y19B 2Z0BA 4YDVA 1Q0YL 3SKJH 2VE6B 1HCFX 5EO0B 5DEFB 4FFVC 4OF6A 1C08A 2UZIL 3K3QA 3C6LB 4MNGA 2Y07L 4O00A 4WUKH 2ICWA 1MFCH 4P2RD 4NUGL 1YMHA 1BM3L 3THMH 3S8WA 1DUYA 3F6IA 4O2FA 3SQBA 5EWIH 4N0CC 4HWUA 2QBWA 3BKMH 3MC0A 4IHOB 3OF6D 4P23B 5E1HB 2V17L 1QLEH 4Y8DC 3OXSA 4JAMB 3ARYA 3ZKMD 3QUZA 1RUML 3V0VA 1ZGLP 1Q0YH 5A3ID 3T08A 1YZZA 4GW1B 3V2AR 4JG0H 1F8TL 3EJYC 3U4EA 3RWDA 1LEGA 4JY4A 4S1QL 1RZKH 1UB5A 3P0VH 3AC0A 1P5VA 1R3IH 1NUFA 3GMPB 1XGPA 3S36L 1NMBH 2WBJC 3CC5A 1QHOA 4PRPB 2R56L 3U36B 3T04D 1O0VA 3MFGB 3SBWA 5D7LB 3LEXB 4PGZA 1PEZA 2DBJA 2P42B 1ZAGA 3DXAA 2E7MA 4YHKL 1RIUH 4XWGH 4PJHB 1U8PB 4G6ML 4NNXA 2BSTB 4FRWA 3OZ9H 3O8XC 4KXZI 2DQDL 3SBWC 3OPZH 1PX3A 2UWEA 3LEYH 4OT1H 1GGIL 4F37K 1FDLH 1Q94B 1S9WA 5I8KH 5L8KB 2QQKL 2Q7NA 4F2MB 5D7KE 5C0RH 4I0PD 5I15L 3PQYE 4JQIL 3CFBB 1T0MB 4XP1L 4DTGH 2B7DT 4HS3B 3R06B 2WINB 5HHVH 3QUMA 5I8CB 2FEEI 3GSOB 5BV7L 1B0RB 2P5EE 3B2VH 2AS5M 1LE9A 1JWUA 4OZGF 4BA8A 5F96H 1BAFH 2DQCL 4H26A 4P9MH 4GQPH 2R1WB 1Q9LB 4HX1B 2ZPKH 4F58H 1M71A 2IGFL 5C0EB 4BSJA 4XC3L 4HGWB 3HS0B 3LN4B 5GS3A 5GIRB 5DJ6B 1T83C 3C60A 1NGPL 3EFFB 5ESAA 2BCKB 5BV7B 3TIEB 2OTWA 4FFYL 1FFQA 1P84K 4QO1A 1RIUL 4XWGL 2P48B 1O5DT 4NQDB 5JA8B 1R6VA 4MQXC 3CK0L 5H94A 3HC4L 3M45A 5HVFB 4I2XA 3BSZH 4BH8A 2DQGL 1A6UH 4OUUB 1JHLL 3RWCB 2DMCA 4CVXB 5DEGA 4FQQB 4HLZH 2R0KH 2Z8SA 3Q48A 3ZTJG 2E9BA 5CWSA 2C4FU 1ZT1B 2H2PD 3IU3B 2BRRL 2YEZA 1GSMA 4QRSA 2HLAB 3IGAA 4PJ5A 2ENYA 2FWOA 4A2MA 4FQHB 3ULVE 1MJ7H 4NRYA 2A77H 2WBJB 2YRLA 5C3TA 2OL3B 1MNUL 2NY4B 4GG8A 5ENWA 4LSRL 3WEXB 2FJHA 2AEWA 3BIBX 2ZJSL 1FSKC 4P46A 4JN1H 1F6LL 1W72B 4KTDL 3AS2A 1T03L 3VGBA 4NRXB 1WBZB 1R0AH 5T1LD 5CCKL 4H8WH 5C0IB 3QEQD 3PDOB 2YWZA 4UNVA 5D70H 4QOKD 4XPHL 3OAUL 3MRJA 1IBGH 4LHJB 2BY2A 1V5JA 1G9NL 4KK8D 5ELIA 4LCUA 5FV2A 5DRXB 2RB8A 1IGJB 1BZ7B 4K7PH 4M7KL 4NHCL 5D1ZD 1IEAB 3M8OL 3PHOB 3BQUC 3O45B 4ODHH 1ND0B 2X6MA 4NYLA 5IP4A 2D7OA 3C6LC 3X11A 5JHDD 1WBYB 3QI9D 4POZC 4G43B 3V4VH 1TNNA 4O5LH 4OCLC 25C8H 2BVTA 3WO3B 4RZCA 2FO4A 1IEBA 1MFEL 1VKXB 1E4WH 4LEXH 1NBZA 1FZJB 4U3XA 4JGMA 4PRHE 1PG7X 3PWLA 2VLMD 3S7GA 5IMLA 1RJYB 3IB4A 5F7DA 1KYOK 5E4EC 1LK3H 2VSCA 3D2UD 2NW3B 5AYUL 5EUOE 3U0PB 4J3OC 1JN6B 2R4RH 3QIUB 4UT7H 5I76B 1HK6A 3KDMA 1T7WA 5I6XB 4NDMA 1G9NH 4K3HA 1IGCL 1HSAB 1ZGLM 1H3XA 4FTVD 2M8XA 4GAJH 3BQUA 3VGDA 1QEWB 5CSGA 5JO5B 3JV6A 4PRDB 5A2FA 3VI4F 2UUDK 4JFDD 2XQBH 1MAKA 5D7JA 3LKQA 3OGCB 3QNZA 1JGDA 2GEEA 2X4QA 1E6OH 1TQCB 1FGVH 4AIZB 3RJDA 3MTRA 3CFCL 3QCTH 4F7PB 1AFVL 1PSKL 1S7UB 4Z0BH 4DOHE 4U7SA 4WCYL 3MGTB 3RWIA 3SDDB 4E0RB 4Y88A 3OAYH 5T1KD 3RNKA 3KJ4B 2C1PB 4MA3A 5CD3B 5EUKA 1R5IA 2DQEH 4ZUTB 2ZKHH 3L3JB 3MGAA 4XHQA 4HIHA 1MCIA 5E6ID 1CCZA 1OGAE 1YY8A 5C0CE 2VZ3A 1S7WB 3MJ7B 3MV8E 1A4KA 4KI5F 4Z7WA 1JYXA 5B8CC 4K8RD 3MOAL 2GK0A 1JZ3A 3QISA 4JFED 3ULSA 5C0FB 2CUMA 4N0YL 1X5ZA 3D85D 3G08A 1JZ4A 3G6AB 1KJVB 1NANH 1NPUA 4Z7WE 2W9LA 4U6YA 3UTTD 1WFUA 4R90L 1S7WA 3ARDD 5I73B 3SQOL 1WT5A 3QFJD 3UX9B 1NDMA 2WWMD 4JO2H 1UT9A 5TE7H 2IGFH 5D7IE 1EA9C 4NCC1 4I8DA 5DJXB 1G7QA 1XGUA 1SYSB 3PWVA 4GS7C 4WWKC 3BW9B 1SHMA 4WNQB 1GOHA 3RUGF 2R23A 3MBEC 3HR6A 3SE9L 4KJQD 5IMLB 4EIZC 2A6JA 4LHUG 4GUPA 3TBVB 4CN4A 1OP9A 3C5ZD 4U4BA 2MHAB 5HDLA 5CIPA 4U2ZA 3QDMD 3JWDC 3JWDH 2FIKA 4FP8L 4XPBL 3TIDA 2YK1H 1ZVSA 2QQKH 3QNZB 3MUHL 1HZHH 2E27L 3LEVL 3T0XA 4CRPA 1JMXA 3VRLF 5J7CC 1J0KA 2HRLA 3CNKA 3O11A 4ONHA 2L4OA 2DD8H 3IRZA 4HZLA 5L2KD 4JREC 4MNHA 3GI9L 2YKLL 3ZKXC 2Q86A 4YDIL 2X4NA 2ZUVA 3HMWL 2DBLL 5EU3B 3V7AE 5K33A 4JFQA 3KDMB 1JZ8A 2UYLA 4XCNA 1HCVA 3PHOA 4H0GA 4D94A 3MCKB 1LWRA 2XV6B 5IFHL 4ODWB 4P4RB 2A74A 1AJ7L 1IGJA 1RI8A 3CLFH 2Y9RT 1NUGA 4NO5A 2CUIA 4PD4K 1YEGL 5SX4I 3DVIA 4WWKA 4H25A 5GJSH 2UY6A 5GRJH 4LEOB 3ARFB 3MBEA 1DQML 4LEOA 2VLLA 4S1SH 35C8H 4M02A 4NJ9L 3S98A 2MKWA 4WWKB 4UB0H 3VGAC 4ZDHB 1CE1L 1W72A 4L8DA 1AD9A 4HXBL 3PF2A 1UZ6F 5SX5K 4PIRF 3OX8A 1WBYA 4KMTL 1N0LA 1IKNC 5FUCC 1HINL 1DN0B 1XGYL 2ZZUT 4LFHD 2FJFB 5HGAB 2X4NB 4QHKJ 1IEHA 4K94L 3E8UL 4OTXL 4D0CB 2M26A 4IOFC 5C6TH 3BAEH 3WFCL 3P2TA 1TQBC 3O6FC 3OF6A 5B22A 4QRPD 3K1DA 2UV3A 4HG4J 1MFAL 2WAHA 3VFNB 2FHCA 6FABH 5I1CL 2DIJA 4JANA 1FC2D 1FORH 2R1YB 2A6JB 4P9HH 3SO5A 2DS4A 4BYHA 3MA7B 4NQVB 1JF5A 3TBWA 5I1HH 4L1DA 3FN3A 5H94B 5T3ZD 5KN5B 3G9AB 3WJLA 1OPGH 3QFJB 2D9QB 3MYZA 5MENE 4UBDD 3RHWK 2WIMA 4G9DA 4KK5C 4N5EC 5CMAB 5FYLH 2FECL 3IKKA 3B2UC 4ORGB 4KV5E 2BVEA 3AVEA 4QWWD 2HLAA 4PJ5B 1Q9WB 3LN4A 1D5XA 2AK4A 4HH8A 4Z0XB 5J6HB 2XXCB 2JCCB 2HTLD 3WLWD 1WBXA 4G8EB 4KRLB 4DN4H 4X80L 1FG2B 3MRPA 2VOTA 4KROB 4LCWD 4FQQA 4U6TA 5D6CA 4RRPA 2VH5L 5I8OH 3ESUF 3C09B 1GOGA 5K59E 5K93A 1XCQB 3SDAD 5AZ2H 2LU4A 2XKNB 5I9QB 3HC4H 3LB6C 8CGTA 1BBJB 1GL4B 4RNRA 3VWJD 4E41E 1RVFL 1E6OL 4OV5A 1BJ1H 1FNLA 1IMHC 1D5ZA 4I3RL 4IRJB 2ZG1A 2WNGA 4ODUB 3TCLA 2YN3A 1NL0H 2VXQH 4N9GB 1MSPA 1QG3A 4JY5L 4HIIB 4HWEL 4I48B 3T0ED 1BX2B 2PN5A 4UTAH 4P57B 3RDTC 2VAAB 1NAMA 1J1XH 2O61A 5FYLL 2ITDA 2ADGA 4EN3D 1ZOXA 1C5DB 4ZS7L 4XMPL 43CAA 4PBXA 1U8LA 2X4QB 4YO0A 5C8JA 3PV6A 5GGSY 4ZFZB 1HIMH 5J13C 1BQHB 2X1OA 5BVJB 1MEXL 5JO5A 1II4E 4PJFF 5CGYD 5IMKA 4KK9D 3BQUB 4DJMA 5KSAA 4ZAKC 4F2MA 3IKCA 3T4YB 3BRDA 2F19H 3QCVL 1X4YA 3S34H 4ZPTB 3C5SA 4QXTA 3WHE1 5EU5B 1IQWH 3Q1SH 2VLME 4X4XB 2E6QA 2F5AL 3NN8A 5F7KC 4WUUD 2LQRA 2XRAH 4AM0B 4KDWA 5JNYB 1UH4A 4M9OA 3S35H 4S1QH 2YD8A 1NMCC 1NBZB 4R7NB 1G0XA 1Y6KR 4OZIF 4FFZL 4MVBD 2DQFB 1VGEL 5HYJE 5T5FH 2V9RA 3SE4C 2NY6D 4P2RA 1LO2H 4P46D 1LNUA 1AY1L 2YPLE 3VA6A 5DD6A 1U8MB 5D70L 1P1ZB 5T1LA 2X4TA 3EIFA 2Q3ZA 3QEQA 3NACH 2QL1A 3F65A 4LPWA 3E0GA 3FQWA 3EJZC 3HE6C 4XCYA 4FQLH 4QOKA 3RNQB 3WHE0 5EOQL 2D7PA 1TLKA 2P8PB 1T4KA 5DD3L 5F89B 1N4XH 5DFVC 1H8SA 4TYUA 4Q0XL 3IJHB 3LPFA 4NFCA 2BNRB 3PWPE 4OQ1A 3IJYB 2F19L 4JG1H 1MI5B 4BFBD 1AD0B 2E6JA 3W11D 1AI1H 1OWWA 4AIOA 1MVUA 1JFQL 4Y4FC 3MNZA 1CFTB 2VN7A 4JVUA 3ULUH 1ZT4A 1Q9OB 4KKCC 2RBLA 3QEUA 1ZLUH 4PY7A 4NN6C 2WBJD 2VDKL 1OGAB 2AJXH 5KZCB 1OP5H 4F9LC 1I3UA 5ILTH 4MS8C 3FAXA 4K9EL 4S1RL 5JUEL 3S3PA 2Y7QA 2V5TA 1IGML 2OL3A 3PNWB 4NKMB 1QQDA 4RAUB 2YXMA 4X7DC 2MJWA 4LL9A 1N5AB 4O2EB 3RVTD 3VFUB 5D5ME 1SY6L 2ATPA 2OX5A 4PJFB 5T1DH 1NC4A 1BREA 3IYLW 1T2XA 1MRFL 4Z7VF 1U8KA 1U42A 4DQOH 2ESVE 1BIIA 3L3KA 4NKDA 3SDCC 3DUUB 3E1F1 4Z7VA 4ELKA 3LD8C 2O5YL 3EJYD 4KK9C 5GGSA 5DK2B 1XZ0B 4EJ1C 1U58B 2J1KA 2NCMA 5SWSD 1PGRB 5KJRH 4OIIH 5JOFB 4P5TD 3GB7B 2EXYC 2QADB 3IFNL 2VLJE 2AJZB 1MJ7L 1DEEA 2OTWB 1E6JL 2AJSL 1U6AH 1LO0L 1CQYA 4H0HB 3WLBA 4D0BA 3BP7A 1OD7A 3TN0B 1LK2B 5FA3B 5FYJD 5DJ6A 1IKFL 1A0QL 2GCYB 3KPLB 4FQ1L 4DCQA 1F4WH 2J88L 4JDZB 4NZUL 2P45B 5CKGA 1U8QA 5E8EB 5E6ZA 2JJSA 1A2YB 4DW2L 3G04B 4X7SL 5F70A 2DDQH 3ZZ1A 2DLFH 5TPWH 5HYIA 3W0WA 3D87B 4LLDA 4Y4KB 3MRQA 1Y0LB 4HKBA 1U8HB 1XGQA 3PIQB 4G3YL 3RDTA 5HYQA 2MQ0A 4TPRL 3UBXG 2H32H 5I1JL 3KHQA 3NPSB 1YDPB 1G1CA 4OZHA 4PJ5D 3P0VL 4TSAH 5FHBH 5JDSA 2W65B 2P24B 1W0VB 4AEIL 4XPTH 3D85A 4W6YB 3VCLB 3IDIA 2H2PC 4Z76B 2X4SB 4CU8A 1R24A 3K74B 3EDFA 5DRNA 2PO6A 2R2EB 3RL2B 5GRXG 2VDPL 3IFNH 1OAQH 3CAFA 1CFNA 2NZIA 5E6IB 5HJ3B 3E2HC 4KKNA 4RA0C 3GMPA 2A0LC 1IGYA 2Z31B 4XHJD 4PJAE 3QG6A 1UB5B 1MCHA 3VWKC 3O2DH 4OGZA 2O93L 3X14A 2X7LA 2G5RA 1EEUA 2WBKA 1UJTA 2BNQB 1FFOA 3IDGA 5F7LB 3DTXA 5IR1A 3LQAH 1EJOH 3VI3E 1MFEH 4XZUB 5DVNA 1N7ML 1LMKA 4S1DC 4PREA 3RL1B 3C5ZA 4IDLA 3S88H 2GITB 1SM3L 2EYRB 4MYWB 3ZKNC 3GMQB 3VJ6B 3MV9B 2BC4B 1KN4L 3SE4A 4KHTL 5CLTA 3PWNA 2OI9C 1KIPB 4R0LC 2DYPA 3WIIL 1JV5B 4L8BA 4MA1C 4EBQH 2HRPH 2W60B 5ADOL 4Z95L 3V95A 3WL9A 4Q9RH 3HZMB 3QHZL 2HYMA 4MNGB 5BS0D 4XMKL 3HMWH 4DN3H 4OF3A 5CINH 5I1DA 5DO2D 3GHBH 4PJDA 1ZS8A 4Z7NE 4PJ8C 3D18A 2VZVA 3CFKA 5MEPA 2HJLA 2BXYA 5KW9L 5E6YA 2DLTA 1E4XI 5IKCB 5T5FL 3LHPH 3WXWH 1X5YA 1EVTC 3RY4A 1KUMA 4DUVA 2MQ3A 4PV9B 1CLYL 3FB5B 5JHLH 3T0BA 3BQUD 3EDDA 4XNQB 2CR6A 2VO5A 3MRRB 5D8JL 1RUQH 5IW6A 2XY1A 2CDEA 2HVKA 3QJHA 1ZVYA 3ULVC 3RTQA 4HSQA 3VXSB 3PWNB 4F7EA 2AERT 3QULA 5HI5C 1JTTA 1VEMA 3F58H 2CLZA 3DX8A 4XPHH 3SEPA 4ZTPL 3HI5H 2X4UA 4GMTH 2QEJA 3D48R 4OZFA 5E99H 1P4BL 2JELL 3MUGA 4M6NH 5IMMA 5INDB 1MCEA 5FXCH 5JOEA 5A16A 4YBLC 4EI5C 1OAZH 3OR6B 5BZDB 5HHXH 2I07A 4Q2ZA 5T3XH 2V2XB 3BZEA 4X0KA 2X7LB 2WWKO 3FO9A 5BW7C 4M93B 1LO3L 2GTWA 4YK4B 3QWRD 4P2QD 1T20A 2YC1A 3P0YH 2BNQD 1NFDB 4H1LB 1FE8L 3DVFA 1CFNB 5E6IA 3EO1A 5F7YC 2X9WA 5FOBA 2P8MA 4TVPD 2A0LD 1CTOA 4HK0A 2Q7YB 5JMRA 1I8IB 4DKEH 3I6GB 2R0ZL 4UINH 3SJVB 3FQTB 1A64A 4XP9H 4AEFA 1TZGL 4ODVH 5IBLD 2ZP0T 1W0WB 3UAJD 5DT1L 1MJUL 3TYGL 4J3WA 4FP8H 3D85B 4ODSH 3B6SB 1AR1D 3P9MA 1QHPA 4DGYH 4MX7A 5E5MA 3DVGB 2Y5TA 4FXGB 1MFNA 4P3DA 1M7IA 3QIBC 3DO3A 4G7YH 4IOSD 5IFJA 5JXED 1KIRA 3G6JF 2DIAA 5KTEL 1MQ8A 3MRQB 1OAKL 1EIBA 2W9DH 5DQ9A 4Y4KA 4H20L 4NC1E 3ARBA 5TGBA 3UZVB 5H37G 1CFSA 4GKNB 4CADB 2XWJA 4EI6B 3WDHA 1AP2A 1FFNB 1HHJA 4JM2F 5E6IC 5I16B 4OF0A 2VLRD 2YHGA 3VGHA 2CKBB 3QBTB 4X5WB 5F7HA 4OD3L 3F5WA 2C5DC 5ISZA 4TUJA 3PV7A 3GSNH 2JCCE 5EU6B 3H0TA 3MREA 5IB3B 1NBQA 1J8HA 3LDBC 1NCCH 2OJEA 5L2JA 4DZBA 4P5MB 5B4MC 1XGRA 1G6RB 4Y5YB 2OLDA 3P11L 2DQIH 5DHVB 3DVNA 1CTNA 3GIVB 3TT3H 4RWYL 2BFVH 4PB9L 2XNAA 4R2GD 5I74B 1MCLA 3SKMB 1U8KB 2NZ9D 4ETQB 4YDLB 3HMXA 4RMRA 2G75A 1NC2B 3B8SA 3CSPA 2H3NA 3F8UB 2HVKB 3TFKD 4XAKE 4WWKD 3UZEA 5HTSA 4XNQA 3RWHA 1VDGA 1DQJA 4H1LA 3QCTL 3GK8H 2D0FA 3MBED 4GRLB 2QKIA 3H3PL 3NCYP 3DXAE 1VADB 5DZNA 4DVBB 1NAKL 4XPGH 5GS1B 1ZGLA 1LHZA 4GKOA 4K7FA 1ACYL 1KCUH 4MXWH 3Q6GH 1VFAB 4M43H 4LAQH 1LO2L 1MI5A 4M7LL 1H9VA 3SY0A 3L7EA 3VFVB 1MPAH 1CGUA 4UNTA 5FM8A 2MKLC 4DKFH 4KUCD 1UWXH 1UYWL 3V6OA 1FYTD 3RA7L 3EFDL 1MCPL 3RTQB 4RMQA 43C9B 4LIQL 4JN1L 3B9AA 1KIPA 2BERA 3NOIA 5DMYA 4NP4L 2DM4A 4IRSD 1JGEB 1NQBA 5E2TL 3T77B 5TH2A 1MCOL 4J4PC 2RFXB 1MHCB 3TO4C 3TJEH 5DXWA 2GITA 4ELMB 3ROLB 1D5BA 2VLJB 1ZA3A 1UWGH 3AROA 2HLFC 4PS4H 4RMSA 4RQQA 4JG1L 5D1ZB 1BWWA 3QG7H 4N8VA 3RI5F 1GAFH 3I9GH 3GMNA 1RJLB 3WS6C 3LQAL 4L4VB 2Q87A 8FABB 1X4XA 1FRGH 2BVQB 1AH1A 3C8KB 3ZYJA 3HC0B 5C92A 1QACA 2DI9A 2A9ML 1EJ6A 4QTIH 3QUXC 4M03A 3KPRE 2HG5B 4E41D 1T5XB 4EUPG 4N9OB 4XPAL 2XN9B 3EOAB 2CK0L 2UUDH 4PRNA 1R24B 1CN4A 1K9TA 4XWOC 2X4SA 4ZPTA 2AV1A 2J6EA 3P4LA 1CDJA 2IPTH 3LPGA 3IKCB 1W0VA 4LSPH 4X6DA 5HYEA 5K9KA 4OZHB 3ROOB 2W38A 1BOGA 3UYOD 5DURB 3BPCA 3BZ4B 5IR1B 4WJ5A 1XF3A 4XTRD 1QRND 1NGWA 4ZFZA 3PIQA 4OCRH 4TQEH 2BJMH 1CLCA 5I18L 3AXLA 2GJ6D 3L95B 1VACB 1ERNA 5BV7H 1YC8A 2AXFB 3TVMB 3V9FA 4C4KO 3VG0H 3IDMB 2V5SA 3VXUD 4KK5D 2EIDA 3QIBA 1EUUA 2IQAA 1CDUA 3BEVB 1GZQB 3TLRA 3HZKA 3U9PH 2GSIB 2XI9A 1Y18B 1TJIH 4HKJA 2XZCL 3GSNA 2J88H 2R0WL 1MEXH 2BNUA 4QRTA 3HI6L 4N9GA 1A0QH 1UA6H 2E9IA 4TNWF 1AQDA 4RGND 3U1SH 2AQ3A 4GXVH 1AGDA 3E6HA 3KWWA 4NN6B 5IK3A 2I60H 1TETL 5JDSB 3DV4A 3S5LA 3GSNL 1IAII 1RU9H 3VFTA 3MRHB 5JOFA 1SQ2N 4Q7DA 1HKLL 1IT9L 5FGCE 4YHIA 4AJ0A 5F7UA 1G1YA 4HQQH 1T1YA 2D7MA 4HKBB 2Z93A 5T3XL 4FFYH 3KYKH 5CILL 3W0WD 4YXHL 1AGBA 1SJHA 3DURB 3VFRB 4BSWA 1QVOA 3RTQC 5E99L 1ODAA 5LGJB 1ADQL 2IAND 4LLYA 5KS9A 1FPTH 5IQ9B 3H3BC 1YEHL 1I8LC 2H26A 3VD4A 1WZKA 1FZMB 2JK5A 4WVRA 1QFUL 5CSBA 1LQSR 4ORGA 2WQ8A 1RVFH 3TBTA 5CIPH 4JHZA 3LSOA 4HPYH 4C55A 3UO1L 4KZEH 1B90A 1U8JA 2BJML 5F9OL 4K9EC 4LSTL 3WN5A 1BM3H 2VDRL 4LK4A 3THML 3KLAA 5ERWB 1U41A 5IFAH 1XH3A 3MNZB 4CW1B 2Y07H 3SGEI 1S9VA 5GGSB 2WIIB 3WFEH 3P9LB 3UDWA 1JRHL 2OQJB 2VAJA 5D9SB 1YYML 1KG0A 4NBZB 1A7OH 1ES0A 2APTA 1QRNB 1CBVL 2VYRE 1GGCH 1JWMB 2EIEA 5EG6C 2OYPA 2NXYD 3FTGA 4LLVB 5J9PA 4LNRA 3MJ9A 4OQTL 1U8IA 1Z9LA 3MLZH 3T65B 5CJXC 2YD2A 3GNMH 4QOKB 2C3WA 1CFVL 3QXUA 4FQJH 1MELA 5DFVD 5ALBH 3NCJH 5C9KA 1PBYA 1MCPH 4TTDD 1OGAA 3SKOA 1FIEA 4K71B 3QEUB 2ADFL 2DYPD 5ALCH 1OQOA 5FUOL 4RFNC 3CH8A 1CGYA 2FYYB 2V7HA 1ZLWH 2BVOA 1HZHL 4JFXA 2FJGB 3T2NH 3SJVE 2VUOA 3S96B 2XY2A 5ACZB 5GS0H 2XA3A 4LRIC 2F53B 4DK3A 2P7TB 4YBQD 5F1KC 1QSED 5D2NB 5F89A 1JHTB 1MCNA 3RQ3A 4JM2B 3BN3B 3H8NA 1RZ8A 1G7LB 1CFQA 3LN5A 4KZDH 2AW2A 3MV9E 3FQWB 2HH0H 2BK8A 2PF6A 3T4YA 1KEGH 4HH9A 5ITFB 4PGDA 1OVZA 1P53A 5BVJA 1EO8H 1BQHA 2WLYA 5FFLA 4MNGE 2BVPA 3RTQD 3NTCL 2CJUH 4PJIE 1NH6A 1CD9B 1OAYL 3NCJL 3FN9A 3PGCB 3CJJA 3NZ8A 3AY4A 3MV8D 3ARZA 4H8WC 2IFGA 5DMKA 2E3VA 3DYMA 1RZFL 3MV01 3K2UL 1JPTL 1ZE3C 1NAMB 1UM4H 1QR4A 4PLNC 1TTUA 2HMIC 4ENEC 4QXTB 1Q9KB 3ZYIA 3ILQC 4EIGB 3QWRA 4P2QA 5JW5B 3D2UA 1A6ZA 3TCLB 1D5ZB 4HT1L 1BOYA 4U6VL 2OZ4A 4OV5B 3IDUA 3CSBA 4GSDH 5ICZB 2H8PA 4MAYA 5I66B 4H20H 1NAML 3F12A 3N9GL 4ZUSB 1NCAH 4FQXC 3LKSA 4PJEF 3IDJA 4R97C 1KPUB 1S7VB 3AB0C 4JZNB 4KJYB 1OT2A 2GK0B 3DHMA 4PP1D 1FG2A 2PO6D 4CL7A 4JO1H 4LRNH 5BO1L 5C0AE 4XVSH 3SCMB 2K9UA 5F9WB 5C2UB 1MIEL 1BFOB 2W9EH 5HY9A 1YJDL 1J5OL 4XC3H 1MRFH 2Z4QA 4KK6C 1HHGA 2L7JA 3GJFH 5I1KL 3T3PE 2ED7A 3MNWA 4L5FH 3MJ9H 2PYFA 4OZFG 1YMMB 5IGXH 1LP9E 4IRJA 5GGRA 1J87A 2C1PA 4QRUB 2BVUA 2HKFL 3DOSA 4RNRB 5MERB 1MJ8L 2NX5B 4S1RH 4QCIB 1IGIH 1ZEAH 4MQ7B 5CHNB 1A9EB 1T2JA 4POUB 3MLSL 5FV1L 1CDIA 2WP3O 3LDBB 3MLVL 3V6ZA 4JFEA 4WENB 4R9HA 3LEYL 4OT1L 5DRZA 5I1IH 1J8HD 2WANA 3OB8A 4HEPG 3UJIL 2CKBH 5IB5A 5LXGH 1A02N 3F58L 4PJ9B 5DUPH 5DD1H 1QLEL 4UDTB 1BHGA 1TFHA 3X13B 4K94C 4PJXB 3UTTA 2IH3B 5BS0A 4CJ1A 3X3GL 2JJVA 5GGVL 1U91A 5FCUH 3QFJA 4L4VE 1EFXB 1T1XB 1X6NA 5IM7A 1EHLH 5JW3H 1T3FA 4JB9H 4BZ1L 3S3SA 3TBWB 5JHLL 5F7DB 5CP7B 5B38B 1TQBB 3JV4A 1F8TH 1YN6B 3PWLB 3QWQB 4TSBL 1WTLA 2PNDA 5KANI 5DO2C 1FV1B 1D5MB 2Y36H 1HQ4A 2YPVH 4LCYB 3LRSA 1JYNA 1IEBB 1BEYL 1CZ8H 3D39D 4GAJL 1T7XA 5B3JF 3EYFB 5CLWA 4HUVA 1ZHBA 3ILQD 2ADFH 1ORSA 1R3JA 4TVSa 5EO9B 2CLVB 3IVKB 4NM4L 1FNSL 5F6IC 3BPLC 1U36A 2UYLB 3FT3A 3WSQL 1QPPA 3MLWH 4EDWL 1HH9B 4XCEB 1HXYB 3FT3B 2CDFA 1A7NL 2K3TA 1QYGL 5C08D 2Q86B 3MV7E 1X9QA 3LZFH 4MD5A 3N0PB 2CLVA 1NCWH 3VXRE 3O11B 1ORSB 3ABZA 4S1SL 4Y4HC 4WU7B 1I7ZB 3O6KL 4KUZH 4CDGC 3MACL 3ZE1F 4IRSA 1P9MA 3C2SA 1S9XB 3E3QC 4ZOCA 2N56A 3DI3B 1DVFC 4PJ7F 5IOPA 1C12B 3T0WA 5AUMA 1MCOH 1S78D 5FECB 4Q9RL 1I4FB 3CFJA 1V3JA 3D39B 3O41A 1IC1A 1REIA 1NC2D 3ZKXB 1K4CA 1F5WA 5E8OB 1KN4H 1RZJH 4QXGH 5DR5H 4NO0D 1NDMB 4RSVA 4FQHA 2WUCL 4UDTA 1T0NB 2DN7A 5HI5D 1UCTA 4PJ9A 1NEZA 4UT6H 3KXFA 1GHFH 4HKZA 1X5GA 3MLRH 2XZAH 1UM6H 3IFLH 4J3XA 1ZVSB 4I3RH 2WW8A 4LSSH 3EGSA 2NXZC 3TEUA 3RWCA 4PRIE 1XT5A 1DBBL 5C0FA 3ZT5A 1YNLL 2WWKT 3WMSA 4P59L 5JIHA 1WEJL 3MZTA 4QRUA 1RIVH 5EZLA 2VITA 3QUKA 3WUWG 4OKDA 2KZ1B 2B20A 1TIUA 2PW1A 4KKBC 1A21A 3BP5B 5EOTA 2HT3C 4X9GA 4U1KB 5ISZD 1FZKA 2GY5A 3N50A 5GGQH 2HFFA 5DJCA 1TVBB 4BZ2H 5GIRA 4N1EA 1FIGH 1RK1B 5GRWA 5E08L 2NR6D 2AK1H 2NY1D 4M6OL 5IB1B 2FO1A 4HX1A 1MFBL 1D6VL 2AVGA 3U82B 3TCXA 5JR1L 4H26B 4K8RH 1MJ8H 5LGHH 1TPXC 4F57L 1RU9L 1I9IH 4F8QA 4ZS7H 4YHYC 1ZLSH 4OZGB 3IU4H 3F7VA 1ZT7A 5EBMB 3ULSB 2LTQC 2CKNA 1J1XL 4GKSB 3VWKB 1UA6L 4Q6IA 2QSCH 2E8YA 1JZ6A 5EU7E 4PBWD 3NFSL 2ZUUA 3QP3A 4NDMB 3JTTA 4MDJA 5D7IB 4PYHA 4P9ML 4LMQI 4G6FD 4M4RA 4LLWB 5EUKB 4AMKH 1P7QD 4MA3B 4NO2B 3DUHA 3RNKB 2F5BH 4OZIE 3RWIB 5HGHB 4E0RA 2HA1A 1EEZA 1FO0H 4H5SB 5KJRL 3IXTA 4EOWL 1GCFA 4LFHG 5HGHA 5E1AA 2E9WA 1XGPB 3BD5A 4OCSL 4JQIH 1HDMA 4JO4H 2FO4B 3WLWC 1T89A 2NY7L 2J8UF 5LG1A 3L6FA 4DEPB 3LRGA 4OCYL 3VFSB 4XP9L 3H3KA 3JTTB 5F93C 5FGCB 2NZ9C 4HH9B 1K8IB 4KKAD 4WTZA 1HSBA 3D69B 2H2SC 4HC1A 3QA3B 3SDAC 1V8HA 2D0HA 1UACH 2F54A 4PG2A 3QEHB 4IHOA 1LK3L 2EE9A 5KVDH 2L7UA 2VL4A 1ORQA 4PJ8A 2FEDC 4ZFGL 1BZ7A 2W0FB 2VDLL 3TBSB 4NM4H 1RJYA 4O4YH 4J8RA 1C5CL 3VXNA 5KSBF 3WNPA 2CO7B 5IB1A 3CCHB 2D7TH 4U05A 1QFOA 5ANME 3BHBB 1QSFE 4YHNA 1VKXA 1QBML 1EH9A 5DRWB 4OCYH 4RZCB 1WWWX 1OGAD 3MCG1 2CDGB 3JZ7A 2VLKB 3IT8D 4OM0H 5EOTB 4ODXA 2HT2C 2PYED 3MCLH 4HFUL 1NAKH 1LGVA 1HE7A 4KTDH 3GJEA 3WEXA 1S7TA 2XOTA 4PRHB 1EBAA 3WS3A 1P69B 4JRXB 1MHHB 3OJVC 4LSVH 3L9RB 3N06B 3X3GH 4J4PD 4H1LH 4QRSB 4ZAKD 2GUOA 4OFPA 4W4OA 4LNRB 4DFIA 3NABH 4MD0A 4ELMF 4F9LA 4AG4L 3C6SB 5BJTB 1KB9K 1QRNA 5MP6L 1QBLH 3MRLA 2DQUL 1OL0A 2BVYA 4UILH 3QCUH 4WI7A 1CD8A 2F54E 3K4DA 3RFZC 1ADQH 3CDFA 3PGFH 1LEIB 4PLKC 5DJDB 2UVEA 4R90H 5EH1A 4LHUD 5E00A 4QHUB 3VXUA 4CW1A 5JLZA 4NKIL 3U2SB 1BD2E 2EC9U 5C7XL 3OAZH 4HQQL 2PYEB 4Y4HB 2C1OA 4LDOB 3EO9L 3UXFA 5KVGL 2B8OT 3MRDB 3M17A 3QUXD 5FO8A 3I6LD 2FZ3B 5DVOA 5DLMH 3O3BA 3TIEA 3OV6A 5DD5H 3EFFA 2JB5L 4HLZG 3LCYA 4QXWA 2EDOA 1JNJA 4YR6A 3OR7A 3P0GB 2OK0L 4GRLD 3IU3A 3T1FB 1LP9A 4FQ1H 3EJZD 1T0PB 1FNAA 1VB9A 1JPFA 3HZYA 1RD6A 4ZUVA 1DE4A 1NMAL 3LQAC 4XXDB 3VFRA 4WU7A 1CXFA 1AGBB 5IT2L 1X3DA 5GGVY 1JWUB 2OR9H 2Q3AA 3HPJA 1Z3GH 1T1YB 3REWB 2WINA 5AEAA 5EULV 1HXYA 1WZ1H 3MRBA 5KANG 3GUTB 1KBGH 5C0JA 3CFBA 1UXWA 1A6TB 4HXAL 3KPPB 2AJYH 1RJCA 1UZ6E 4OFVA 4UIKL 2DM3A 3C60B 1CWVA 4ONGH 3OKDA 4NNXB 2OK0H 4X7TB 1S5IL 1IZJA 3MV9D 4LSUL 1GZQA 4PGBA 3FT4B 1V3KA 6CGTA 5CEXA 3ZDYF 1KXTB 3RAJH 2RR3A 5TQ2L 1Q9LA 2D31A 4UUJB 3W9EB 2OSLB 5HI4C 1LDPL 3L5JA 5CP7A 5B38A 3L95A 4PJBF 3GM0A 3RVTC 4MAYC 1KPVB 3ZSTA 1QSFA 4YHOH 4D8PA 2AGJL 2VDKH 4U6HA 3IF1B 3U1SL 2HFGH 7CGTA 2HJKB 1J0JA 3MRCA 4L9LA 1F3DH 4WJ5B 3VDAA 2VC2H 6FABL 2JIXD 3SDCD 5I8KL 1MH5B 3T3ME 1J7VR 4RDQG 3BPLB 4JAMA 4LQ1A 4X98A 4TVPL 4Z78B 1I85C 5EUOB 4RFEB 4YHYB 1RV6X 5EZIL 1CE6B 4XPFH 4LVEA 3FHAA 2AV1B 4L29A 5DI8B 4K94H 1UFUA 3UTZA 3HG1A 3WFDL 4XX1E 3Q3GA 5IEKA 4XRCB 5CHNA 4FZEH 5C0CD 5D96B 3OJMB 4TTDC 2DTMH 4X6CB 5C0BB 1JL8A 4KAQL 2AKRB 2AJVL 1AO7D 4GS7B 3S4SG 3UPAA 2XKSA 4YX2L 3LKPB 1Z2KA 1BF8A 3C09C 2PYFB 4Z7NF 4PJBE 1QO3A 3SOBH 4L9LB 1QSEA 3SE8H 4ZSOE 3BRFA 1F4XL 4RAVB 3IF1A 2FRGP 1UKSA 2CK0H 1BFOA 2ZUTA 3NCMA 1RMFH 2NXYC 5T1MA 3P4NB 2MFNA 1MAML 3HC3H 3B43A 4CN6A 1ZHKA 1I1AC 3MJ6A 4YBQC 3PL6B 4GBXC 1EUTA 2HRPL 1SEQL 5MI0C 3CXHK 4KJYA 3RWJB 2APFA 3WFDH 3ARBC 1AGFA 5D2LB 3KPSB 3V79C 1EBPA 3VFVA 3VXTB 3SY0B 3JWNC 1Z9MA 3MRNB 3AREB 3MV8A 1VENA 2GAZA 4YWGL 4OLXL 3FB7A 1X4ZA 4W4OC 3O4LA 5DMGC 3CFIC 4JGJA 3GKWL 1X5AA 4U6XA 5JW4R 2JJTA 4OBRA 4HUXB 5CKAA 4FXLA 5F9OH 1I9JH 1FL6A 3HAEH 4AENB 3L3OB 1NGYA 5CZVL 1ZA6A 2P5ED 3BYTA 5F88B 3H9SB 1YEDB 4PV8A 4MAYD 3TPUA 2OMNA 3LRHA 1NC2A 4MXWL 4R97B 3MROA 5DF0A 4R26L 4LLQB 1EJOL 4JY6A 5GSRA 1OHQA 5A3IC 1MIEH 4IS6B 1LE5A 4HUNB 3DVNB 1NLDL 1FZOA 3TWCL 4HJ0C 2NYYD 3RZWA 1WUNT 3VXRB 5DK0A 2R29L 1JZ7A 4NM8L 4NQXA 3SO3C 4LLUB 2LAGB 3JVGC 3MREB 1JF1B 1P6AB 3B2VL 4XNYH 5F72S 3L3GA 5LVEA 1KJ3H 1JHTA 4K71C 4IM8A 5D71L 2CR3A 1UB6B 3KPSD 4KWUA 4UU9A 4C59B 4LKXB 2F8OA 4M61A 2AJ3A 4BSVB 5FYJH 2ADIB 3MYJA 1DBAL 2GT9A 3DRQB 3S96A 3VRIB 2Z31D 4HKXB 4MJ4A 2J3SA 4OUOA 1J8KA 4RISL 4DUWA 1KIQA 4U1IA 2Z8RA 5KVEL 1CFSB 3V52H 2W0KA 3WDIA 2VJXA 3S4SA 5IEHA 3ULVD 3RY5A 5I2IA 4RMUA 3RVWC 5DZLA 1N64H 5K9OA 4JFFB 1RZFH 3GGWB 1IL1B 4MJ6A 3ARGB 3DX9A 3QJFA 4MDIA 4TQEL 4WFFD 3QDJD 4NKIH 4RX4A 2OJZL 2ZCHH 2EYTA 4GBXB 4KHXL 3GSRA 1MFAH 4FQ2H 4Y2DB 4WW2F 4JKKA 3ZYZA 4BKLA 5HSFA 3CVHH 4X5XA 5JXEA 4DQOL 2WV3A 4U1JA 1C16A 4LP5A 1EGJL 4PB0H 4PUBL 5IW3A 4Y4KD 4ODTH 1R5WA 3I02A 2P8MB 4JDVA 2FR4B 4BZYA 1ITBB 3FO0L 4MQXD 2K7QA 5C70A 3PHQA 3EO0B 2J8UE 2EDXA 3GJFK 5J57B 2BOCB 3CH1A 3LD8B 4NM8H 2BX5A 2VH5H 3I3DA 2EXWD 1U8JB 3C87A 2VLRA 3FT2A 3SCMC 5ADPH 3WJLC 2LU3A 3HCVA 2Q6WA 3LKRA 4Q6YA 3LSOB 3L7FB 5IMMB 5IHLB 4CKVX 3ULVF 4OZGE 5I1LA 3C9NB 5DFTA 3FO2B 5MENB 1Q8MA 4YHKH 3O3UN 1V3MA 15C8H 5LGJA 5MHSD 3FQRA 2BSSB 4B7LA 3VXSA 2QSTA 5KSBB 3HAEA 1T83A 3LKOA 4JFDB 3MUJA 3DGCR 2CDEB 3T0VA 2J8HA 1H15A 3ZT7A 4UTBL 4B50A 5I0ZA 3VD3A 4NT6A 4FTVB 1MHPL 4WV1B 1HNFA 2ZUQC 4JO3L 3HNSH 4DKFL 1JNLH 5SX4H 1YEEL 4G8FA 2Z92A 1ZHNB 1OD9A 2AV7A 5M7QA 2EKSA 4M43L 4RIRB 1MRDH 2WZPD 5BQ7A 5EC1A 2FGWL 5HHOD 5D7LD 5CJQL 1ZS8B 3GSNB 3HE7C 2GSIA 5I1DB 2VZTA 1NGQH 4P5KA 3TO4A 4WEUD 1KN2H 1ZLWK 4XP4H 3FO1A 4OV6F 1GIGH 5JW3L 4FQLL 2AXFA 2C3XA 1T04B 2ORBL 3O6LL 3TVMA 1MI5D 4KQ4L 1GPOL 3OMZA 3V8OA 4PJCA 1UM5H 3QIUC 3QUXB 2ATKB 4ACPA 3UTQB 1TVBA 3CFDA 2OP4L 1KB5H 1KXQE 1RIHL 3BMVA 4M1CC 3BPCB 3CFEA 4Y4HD 4AEHL 4J3SA 5JORB 1FL5B 1JTPA 3CXDH 3C5ZB 3FB6B 3HTLX 4OCMC 4RBPK 1QTYT 3QUKB 4XZUA 4ZAKA 3NAAH 3PXJA 3O4OB 1PG7W 1SYVB 4URTB 4WY7H 5FHBL 3SE3A 4HUKB 5ANMB 4ONFL 3G5XB 1MCWW 3WIIH 3WUWB 1DSFH 3QH3B 2X09A 4PJCB 4O2CA 1MNUH 4WI9A 4K8RL 4TN9A 4LHUA 2F74A 3QQ4A 5E8DL 4UI2A 3LKNB 2EXWC 3JVGA 3ZSSA 1ACZA 4MXQD 1TJIL 2KQMA 2NY7H 3VH8B 2CIIA 4NN7B 3VCLA 4LSQH 4GAFB 1X5FA 4A2LA 3IFPB 2V2WB 4IRSC 3UPCA 1X6LA 5D71H 1A7BA 3AS1A 1NBVH 5K9JH 4A6YB 1I9RL 3SE3C 4PGJA 1HHHA 1BQSA 3A67L 1PVHA 2YA0A 1F11B 5ETUA 1CS6A 4I9WE 1UM6L 3WFZA 1IAMA 4LIQE 1YEHH 2CRZA 3BN9D 1OCWL 2GJ6A 4RGNE 3QO1A 5I1LB 2IPKB 4OLUL 1CGXA 4LRIA 1LK2A 1FNFA 5FA3A 4QRRB 1K8DB 1VHPA 3BP7B 1ZLVK 4LLMA 3QHTC 1I7RA 4DZ8A 1T2QH 5CZVH 3PP4H 2DJ4A 2FGZA 4G8IB 1JUFA 3DPBA 3C60D 1DSFL 3IAGC 5FYJU 3QDGD 1T6WA 4QNPF 4NPYB 2A6IA 3MRMB 2R4SH 4PJAB 3RUGA 4ELKB 1TZGH 1XIWC 1D5MA 3QZWB 3SDAB 3MACH 1QSFD 5F3HA 3ZHKA 5MP6H 4XMLH 5C0AD 5F9JA 2XNAB 2W59A 5H2BB 5BV7C 4YDJB 1CR9H 2JIXA 3SDCA 1N5AA 1T3FB 1FGNL 4HUWA 3C8DA 3HR5A 1F2XK 2VDQL 3D25B 4LSVL 1YUHA 1QFWH 2R1XA 4JZOA 5L9DL 1YNLH 5EA0H 2FBOJ 1VFBA 5DJ0B 3K7UA 5T3XD 1A7QL 4OGXH 3S37L 4ZTOH 1G6VK 2EDHA 5EO1B 4HF5H 4DZ8B 2QLVB 4X5WA 5EBLB 9CGTA 2V2TB 5HVHB 4JEGB 4LHQB 2CIKB 3SOBL 2NY5C 4XVTL 2PCPB 1S9YB 1IGCH 4JJHA 3DUSA 5JPMA 4EI6A 3K2MC 2EH8H 1KTKE 4XPAH 1DR9A 3WXVL 1AXTH 2DOCA 4QTIL 5I8EA 3RWEB 4R8WH 3RWGB 4UU9B 5ILTL 4FQJL 1KPRA 3FFDA 4YUEL 4HBCH 3VFPB 3V4UL 4Z7WF 2SEBA 2ZUWA 2V5MA 1D9KD 4PJ7B 4LLUA 4L8CB 4OF7A 1CR9L 5DK0B 2UZIH 3QIWC 3Q5TA 1OAUH 5DD1L 2YD3A 5J12B 1SM3H 3B6SA 1NEZG 5I1EL 5LXGL 1RK0A 4L8SC 4IS6A 3VXSE 3CDCA 1GGBH 1FFPA 3ZLQC 3AM8C 1KFAL 2B1AH 1EEYA 4ZPVB 2G9HB 1I8IA 1GZPB 2VDLH 2DQFA 2JLLA 5EIIB 5CP3H 3T0DA 2C3VB 1KV3A 3V4PL 1KGCD 3KPNA 3WHXA 4R8WL 4AM0A 5E4IA 4NO0B 5HHQA 1BFVH 3MX0A 3BKCL 2H32B 3FZUD 5J8OA 1A9BA 4WUUB 5BZDA 1NKOA 1AIFB 1ACYH 1KCUL 2EEAA 5INDA 4B0MM 4MSWA 1NSNL 2J7LA 4HWEH 2P5EA 2YK1L 5IMKB 1QA9A 2NLJB 3R1GH 1I8KB 2P46B 4OZHE 1JPGA 4PJIF 4Y89A 4JO1L 4LRNL 4JZJC 2H1PH 2X10A 2JB6A 5HPMA 2PXYA 1FAKT 3BP4A 4LVNB 3CZJA 5D2LA 2F5BL 4FHBD 5HDQH 2BHZA 3UO1H 3ULUF 3W39B 43CAB 2B4CL 5EZOL 1O7VA 4U1LB 3L5XH 3MMEA 3R0MA 4OBSA 1UJ3B 4R4FH 5DWUH 1U8NA 3FO1B 4MQSB 4X9BA 2F8XC 3A6CH 1OGTB 4FQIH 3QEQE 5I15H 4LCIL 5JIPA 5FYKD 5IKCA 1IAOB 4M8QA 1MIMH 4M93C 3CVHL 4GRLC 4L3EB 5E5UB 4HIIA 4I48A 2R0ZH 5E94A 1YY9D 2SEBB 1RULH 4G6FB 4JGUA 2IAMC 5MHSE 2Z92B 4LMQE 3KS0J 1KPRB 1F02I 1RHHA 5L7XL 1FE8H 3ZDZF 3MLPA 4XAKD 3HFML 4EEEA 5I8EB 4XMPH 3K8MA 3GSXB 2XKNA 1I1AA 1L7TH 1LO3H 3VWJC 3I50L 2DLFL 5TPWL 1H15B 5CBEA 4TUKL 3U9UA 3WCYA 3G9VA 1CVRA 2B2XH 2B5IC 2DM2A 3LKOB 5DSCA 3EHBC 3MA9H 2V2TA 3JSSA 2BC4A 5EB9A 1Y6NR 5EBLA 1PKOA 4JZJB 3FO2A 2BDNL 3AU1A 1A6VL 1BMGA 1IFHL 5GZNC 1JPSH 5EU6D 1J86A 1UKTA 4K2UH 5HVHC 1A3QA 5ECJE 3T65A 4P59H 1AFVH 3I75A 1IQDB 4OD2B 4Z0BL 2BSED 2IFFL 2ZCLL 5KN5A 3EYQD 4MA7L 1JNHB 2BOCA 1AXSA 1KG0B 4JANB 5F3HB 1KJMA 5GZOD 2YPLD 4CVZA 3ELAT 4I0PC 5EORL 4GW5A 3RUGB 3CUPB 3G5VB 3FT4A 4ZQKA 4D9QE 5KW9H 3W5NA 3MRMA 4R0LB 4PJHE 1ROWA 1S7RA 5C07D 4Y5XC 3QDMA 3U6RB 4RCAA 1P5UA 3QT2A 5CINL 4PR5B 4NIKB 4BKLB 5F7NC 2IANE 1I9JL 4R4BA 3WNNA 3TM6A 3V4VL 4PRAB 1DN0A 1P7HL 1I8LA 5L2KA 4LLMB 1INEL 1FORL 1G0YR 4QRRA 4KUCF 2XFXB 1VFUA 3BE1H 4L4TD 4HDIA 2P4AB 3AREC 3HPJB 4KK6D 1I1FB 3QQ9C 3FONA 3QNYA 2NW2A 2H26B 4L8DB 3W0WB 2P47B 1EO8L 3V8CA 4YDIH 2H41A 4LVNC 1A2YA 1SJHB 1MQKL 1KIQB 4O5LL 1GJIA 1CLZL 2R0LL 4K3EL 4XAWH 1I1AB 4M6AA 5EFIA 2H9GA 5LQBH 3VH8G 2X40A 1T03H 4MB5A 4BM7A 3QXWA 3NIDF 2AJZA 5H8DA 2ZCLH 4Z7UB 5TE6L 1I8MB 4M7KH 2HT4D 1N59B 5JDJA 4NQXB 4JFHE 2BNUB 4JFZH 5JLZB 5EU3A 3VXRA 1EO7A 4XP6H 4M5ZH 5DK2A 1EGJH 4PB0L 3HZKB 4TNWK 4YHPA 3AGVA 2IQAB 3TPKA 5L2KE 4NWUH 1IARB 1QP1A 5C0DA 5J11C 3BE1L 4C57C 4KKCD 2DIBA 3AXLB 1NDGA 4XVUC 3RZCB 1S7QB 4PV8B 2EO9A 3BIAX 5E70A 4XH2B 5GZND 1QUNA 3G5YB 2PXYB 4QRRE 4QRPA 2HKFH 5F1IA 3MRFA 4RWHA 1UXSB 3VXPA 3O6ML 1R3LB 1GGCL 3FB8A 4NNPL 4P2OD 4UQ2A 2AK1L 4FZ8L 1UGNA 3Q6FA 1MCQA 4PP2A 4PY7B 2XQYK 4X7SH 5DJXA 1F3RB 1Q9OA 2FIRT 3BKJH 1AGCA 4BZ2L 1G7IA 3O3DB 4NKQB 5CZXD 3KNBB 3QPQD 1N6UA 3CD4A 2FNBA 1OSZB 2XN9A 4MJIB 1DUZB 3SDXB 3SGDI 3CX5K 3QDJA 4NO0A 5HHQB 5E8PA 3PL6C 4XCCL 5TE4L 1MWAL 1E6JH 1HHKB 4FXKB 4MJID 4CMHB 1JK8B 1P2CA 3WNLA 4PJ9D 4TNVF 4HCRH 3KPNB 3PUCA 3WHXB 5KTEH 1KJVA 3C8KA 3OXRB 5CUSH 2VDML 5GS2D 4P5TC 3LMJL 1NBVL 1Z3GL 1P84J 5F71A 4I18C 4NZRH 1S3KL 1ZHKB 4XCYB 4WWID 5BXFB 1TTFA 3GHEL 2HTKD 4JPWH 5D72H 4N0FB 3FKUS 5GGTA 1IM3B 1GGUA 1P1ZA 4HUMB 1MWAB 2Z31C 1IJ9A 3OKLA 3ROLA 3A6BH 5D96C 3IS1X 2FB4H 4AYFA 1R5IB 2EH7L 2A6DB 3TBYB 2AI0L 1L7TL 3K4AA 4K3DH 1HDMB 4XXCA 4M48H 1X5XA 4W4NA 1YNKL 4OLWL 3DBXB 5EPMB 1LILA 1QSEE 2V9TA 4QT5A 3DYOA 2AJXL 4PLJD 5C7XH 3NN8B 3V52L 2J8OA 2IWGA 3U79A 1IE5A 2X70A 5B38G 2VIRB 4NQSA 3OGCA 2EC8A 4ALAH 3UJJL 4L4JA 4IRZH 1EXUA 2E9JA 3OG4B 5IG7B 3HCVB 4Q9CA 4HS8H 1KULA 1CG9A 4GJTB 3GI8H 1WLHA 4FABH 4Y4KC 1FVEB 1HSAA 4E42A 2P5WD 2AEQL 4YAQA 4M00A 3WE6B 2DLIA 1NCBH 2BY3A 1KLFA 4RGNB 1TVDA 4NP4H 4RFOH 3U0PA 2FD6H 2W1NA 4JDVB 1NCDH 5J06A 2IC2A 5F6HI 3VWKD 3NFPB 3NTCH 2AEIT 1HILB 2BXZA 1P7QA 3MJ8A 4U1JB 1SEBB 2ITDB 3RVXD 2CK2A 4K23H 1MRCH 1RJZB 4MJ5A 1IBGL 2JCCF 4X7TA 1XGRB 1AXIB 4K8RC 4DZBB 1QR1B 1UEMA 2HFFB 5DJCB 3TVMD 4KROC 5KVFH 5C6PB 4P5TB 4AK1A 1RZJL 3OG6B 1C5CH 4TUJB 3B3IA 3ZL4H 4NQTA 2VITB 4EVNA 5EZLB 5C0JB 4FMKA 2ZUQB 3QB7C 4KKLD 1NGXA 1X44A 2AXHA 2ICWI 3ARGC 3REWA 5IVNA 4HFWA 4CDHA 5LJYH 3EBAA 3MV7B 5D4QA 3WIHA 3U30B 4RAHA 15C8L 2APWA 5D7JC 3QG7L 3ZDXE 4M1CD 3GI9H 3TZVC 2YUVA 1H0DB 5DGRA 1KC5H 1MUJA 4ZO8A 4PJ8D 5E2JA 3UJIH 1ZKAA 1D9KA 2DWDB 3GMOB 1HWHB 1BGXL 1JRHH 1T22A 3OR7B 3EYOA 1MHPH 1GGYA 3RX8A 1MCKA 5INCA 4YHLH 3D39E 5AG9A 2BZDA 3MLWL 4EDWH 3MUZ1 2DLEA 3PP3H 1TZHA 2J6EH 3ZL4L 4MX7B 5E5MB 3RP1A 5TF1L 4WTZG 1G7HB 2ARWA 1FZOB 1LE5B 1HOCB 2PYEA 1JF6A 1T80A 2WBJA 5GSRB 3ARTA 4KRPD 3KYOA 2VXSL 3Q6GL 3U7AA 4G9FB 3VFNA 4KMQA 4ZMAT 4PLJC 3MXVL 4UV7L 2MCPL 1KSRA 2YEZB 5IOPB 2NY4D 1UH2A 3C08L 4IRSB 2UVFA 4XPTL 3U7YL 5DC9B 3P3YA 5T5NG 4FQ2L 4O2CB 2QSCL 4JDTH 4EOWH 2W9DL 3UMTA 2IPUK 3BGMA 1I9EA 1NFIA 4PRIB 3VXME 4X0KB 1WZ1L 4F9PA 4Y2DC 1RFDL 4JRXA 3G6JB 1OAQL 1SYVA 1QRNE 5A2KH 3T2OA 2R2BA 3TYFB 3RIFF 3GJEB 5IT2H 3P30H 3RRQA 1RULL 3ESVF 1AD9B 2BRRH 5GRVK 4JHWH 2CLZB 3DX8B 4P5TA 5AZEH 3O3AB 1FDLL 5SV3A 5IBLC 3JWOL 3EYFA 4C56E 1P4IH 1KJ2B 1ULVA 3QUXA 3CPLB 4LKCB 3KLHD 3RUGE 4G6MH 1WIPA 3TP4A 2Y23A 1SEBA 1MJJA 1KLGB 1HILA 3DHJA 4EXPX 1CK0L 2V7NA 3HFMH 4ZG1A 4HWZB 3RKDC 1WFTA 3TO4B 2R9HD 1LP9F 3CDYA 4ODWA 4XNMA 1B0RA 2DICA 4Y5XB 5D7IF 1Z0NA 1R3IL 5SWSE 3FOMA 1J0IA 5T3XE 5IF0B 1A7RH 2BMKB 2Z91B 5BS0E 4YAQB 3TJHC 3LKPA 1IKFH 4CVWA 1K8IA 1S9WB 4D9RE 1M7DB 4WFGE 3WL9B 3N85H 5DRZB 1QSZA 3U0WH 4NQSB 4XRCA 1KTLA 4ZXBA 1BVZA 1BFTA 4NO3B 4WEBH 4PJEE 1PY9A 5GISL 3ARFC 4QT5B 1K5NA 1YEIH 2K7PA 1NCAL 1WZMA 3FQRB 4XBEL 1FYHB 3O9WB 5J89A 2X1WL 5EPMA 4J6RH 2R23B 1OM3L 3OKKA 4PJIB 4ZOEA 4NO2A 3VDCA 3TBYA 2E5EA 2E6PA 3AM8A 3RWDB 3UTSE 1E4WL 1MH5A 1R3HA 2DWEA 3L7FA 3OPZL 3RIFK 3C8HA 1L7IH 1DQQA 3SKJL 2LV4A 3UC0L 2VLRB 1EZVX 1KPVA 1G7PA 5LCVL 4ZOBA 2D31B 2MPAH 3BUYA 4KMLB 2CGRH 5C07A 4X99A 4JHAH 1SEQH 2EIZA 3PABB 4F3FA 5TDOB 3O0RL 4R6UA 4X6CF 3RL2A 4AEEA 5GSVA 5E9DA 3STLB 1DEDA 2WM0A 5FYLE 2A38A 3QDJB 1FVDA 5CJBA 1A4KB 4ONOA 3SDXA 4YEEA 5FA4A 4MLIA 2P24A 3EJJX 3W81A 2GFBA 3O2VH 1W2KT 5JIKA 1S9KC 3O3DA 1RZGB 5IJKC 3ARGA 3DX9B 3QJFB 3BZFB 1Q9KA 4Y1AB 1AO7A 1UQSA 4MJIE 4HUUB 1Y0LA 1JNNL 1KB5A 4NGHL 1A1NA 1FO0L 5T5NF 3SJVD 1C5BL 1FNSH 3LV3A 1CXKA 4QRPB 2NY3D 4M7LT 4XXDA 5CGYC 1JPFB 3HZYB 3Q1SL 1FGNH 2R0LH 4JDZA 4QTHB 5DVLA 1EK3A 5A43C 2D03H 3OAUH 4JM2C 4D0BB 2VABA 4MCYB 2Y36L 4E5XA 5IHUL 4IMLA 2QTEA 2X2YA 1FO0B 1OAXH 1S8DB 5CCKH 3PWPD 4GG6F 3SKNA 3FRPG 3PQYD 3RVUD 3ZTNL 5DC0A 2KL6A 1RZIB 3MO1A 1LEKB 1CFVH 3MRGB 4DWHA 5KVDL 5I76A 1F6FB 3LH2H 3EOYG 1QFWL 4KTEH 3MO1B 1LEKA 2VR4A 1ZLSL 3VXUB 3VE0B 4GAGH 5C09E 2NW3A 3TF7C 5HYSB 1S8DA 4EUPH 4D9RD 2OBGA 1BIIB 3ARFD 1XGTA 1AC6A 3MLYH 1DN2A 4OD1H 4LSUH 5I75C 1NC4B 3H7LA 2XIDA 1CICB 4PGCB 5AUMB 3JWOH 3TPUB 2MWCA 2BVOB 2ZOLA 3JWOC 4QTHA 3BP6B 4PJGA 2JE8A 5ICYB 3OB0K 5EORH 1HKFA 4O58H 2VXQL 5JQ6H 4HJJH 5IQ7L 1I1AD 1YY9C 4P2OA 3L9RA 1H3PH 2HFGL 4AENA 3I2CH 4PRHA 1V7ML 4OZ4A 3FONB 5HGDB 3SKOB 3ZE1E 5SX5H 3UTSD 5L2KB 4HPYL 3KPQB 4F7CB 1NCNA 1SBSH 4KVCH 4OIIL 3WFHA 3RKPA 5FM5M 3B5TA 3OHXA 3IDYB 5I1KH 4NCC2 5F1OB 1B6UA 3AREA 5C0RL 1UG9A 1NGZB 3IJYA 2BY0A 3STLA 1JGVL 1XF2A 3KPSA 4GG6E 2W0LA 3MRJB 3VGGA 2OJZH 3PABA 3U7WH 1T21B 5ISZE 3UJTH 1BAFL 1ORQB 4PJ8B 3PDOA 4QXGL 3UROR 4WU5A 3NA9L 4OQTA 5BCAA 4LPUA 1OSPL 3GJFA 3JV4B 4N0YH 3GSVB 3RNQA 2IG2L 5KVGH 4BUHA 3P4NA 4PTTB 1Q1JH 3ALXA 1G7PB 1DL7H 3L3DA 4KTEL 1UCBL 5KBNC 2FJHB 5E56A 4ODSL 4P9HL 1D5IL 5HGGS 2GQHA 1NLBL 2O5XL 3ZO0A 2ILLA 2OS7A 3HRZB 3HKFA 4F7TB 1F58L 3IGAB 2YUZA 1FZMA 4JRYD 2C4XA 3UYRH 2EDNA 4R7NA 4RX4D 3BH9B 1ZLUK 2V5YA 5JZ7C 3IXTB 1KTDB 3RIAK 1JPTH 4KY1H 3UBXA 2XTJE 3ULUE 5MEQA 5FK9B 4TRPL 3CFCH 1MLBB 4BFEA 3NH7H 5EU5A 1UADC 4QYOA 5FGBC 4ZNCD 4X6CE 5C0BE 1J0YA 1M7DA 1P6FA 1NGQL 3DV4B 3S5LB 1H3UA 4X98B 4Z78A 4GMSH 4DKDC 1GC1H 4I0CC 2EECA 2ARJQ 2I27N 2FGWH 5E94B 4X4YA 2BCKA 3VWKA 5C71A 3O2DA 1ZT7B 4H0IA 1QSFB 4XPGL 1JNLL 1CL7L 4PD4J 5MEND 1M71B 3I3EA 2X41A 3T3PF 1F4HA 2FBJL 1GIGL 3RHWF 2VLKE 1I85A 2VISB 3AUVA 3GK8L 1FH5L 4MB4A 1ZK9A 2VAAA 3VXMB 2I9TA 3KPSE 1KJ2A 4RGMC 3VXSD 3P4OA 1NGWB 1FYTA 3U0TB 4MAYB 5I66A 1MRDL 3CX2A 1I3RB 4LCWE 1KC5L 4WRLA 5K9KB 2W0PA 2ZWLT 3WD5H 4JM4H 4BUGA 5DUBB 1OAUL 4XMKH 2R2BB 3TYFA 2UWEB 1PG7H 3GUTA 3T3MF 3MRBB 2WUBH 1MVFA 1A9BB 3D1MC 4XVUD 5D1XB 4M62L 1HNGA 3FCTA 1T1ZB 3N1QC 3V4UH 4XNZB 4LF3B 2Y6SD 5D7LA 4JRYB 2DBLH 4N0CD 1RZJC 4ERSL 2AI0H 1WBXB 3H9HA 3UTOA 5CJXA 1BJ1J 1MCCA 3MOBH 1A8JH 2Z35A 3KXFB 5EIIA 1NEZB 4YR6B 3BWAB 3U4EB 3GMNB 1PQZA 4ONGL 2GKIA 3HRZA 3DRTA 4N8VB 5CMAA 1HOCA 4FFZH 2NTSP 4PGDB 5E8OA 2HFEA 3M17B 1BQUA 4BH7B 5SWQB 1D5BB 4ELMA 4LSTH 3DMMD 5INCB 4OIBA 4U3CA 3B8YA 1YYLH 5FF6A 1P4LB 4OKVB 4M7JH 3HG1E 1B0GB 1EFQA 1T22B 4M6OH 4NSKA 1YECH 3PJSA 1PEWA 4I0KA 1XF2B 2HTKC 2CLRA 4ENED 3MRLB 4NKOA 2X4RA 3P77A 1WTGT 2EZ0D 4KDTC 1INQA 2Q8AL 3QUML 4P4KB 5J0BA 4AEIH 4XCFL 3IDXL 2V7HB 5AZEL 1CDCA 5FB8B 2I5YL 2ID5A 4YC2C 2XYCA 2VE6A 4WW1A 1WISA 3GSQB 5AWNL 3HPLB 5HBBA 1EAJA 1IC7H 2VLRE 2DI7A 5DJ0A 1PW3A 1AQKH 1MFBH 5JR1H 1ZTXH 4ODXB 4OD3H 3TNMB 1FGVL 2CDGA 1YUHB 1YQVH 3HNVL 4PBVC 2X1XR 4L5FL 4AIXA 3BP6A 4N0UE 3VG9B 3HI1A 2RJMA 5H2BA 1HQ4B 4C56A 5J1TC 1ES0B 1QFPA 2IPTL 2KH2B 3D9AH 5D1XD 4HIXL 3S35X 1M4KA 5ESVB 4JFYA 4M7JL 4NNYA 1CGWA 1WEJH 1UM5L 3EYUH 4R2GB 1B6DA 5IB2A 3T1WA 2IH3A 2F54B 3TNNB 4GAYA 3CDGA 1T1WA 3I2CL 1CGSL 3D69A 4HD9A 3T0EB 1CG9B 1NLDH 4HZLB 1NMAH 4L3AA 4WHDA 2ZNWA 4IMLB 4O58L 2AQ1A 2PYEE 3NA4A 3H6JA 3V6ZB 4OLXH 3TIDB 1G7MB 3X3FH 2CRMA 2NY5H 1JTOA 1AP2B 1JWSA 3ZHDA 1T7YA 4GQ9H 2DQJH 1KJ2H 4ZNEE 4MQ7A 4H5SA 3VFWB 2BRQA 3DURA 4HK3N 5MERA 1IGMH 2DKMA 5TGBB 4LPYA 5KSBE 4M7ZB 4G42A 5IV2B 5DQ9B 2AJUH 1EZVY 1KYOJ 2Z93B 4U7KA 4ONFH 5EOCJ 1AO7B 1UQSB 1FNEA 5C0AA 3KYMB 3OKOA 3VD7A 3RWFA 3VFTB 1RZGA 4BFIA 4K7PL 3CVHB 4NHCH 32C2A 3VXUE 2BOBA 2CRIA 5KOVC 1MWAA 3OKLB 1CBVH 3IFPA 4HBQA 3RVXC 1UWEL 3CZFA 3SCMA 4MHHI 5DS8B 5I1EH 1OW0A 3RY6A 5BXFA 4U6YB 3BAEL 4OGYL 25C8L 2PXYC 3JTSA 4KK8C 5I1AA 4KROD 3D3VE 4QHLA 2HJFA 4JZNA 5JXAL 3F7VB 2ITCA 4OZGA 3DX7A 3ZKQD 1FH5H 5B39B 1G9MC 3FOLB 4ZUSA 1UH3A 5B4MD 1MCWM 4XP4L 4RFOL 4W70A 3I84A 5IROC 1VACA 4HEME 1CL7H 1T20B 3MCLL 1DUZA 3ARGD 1IQWL 2B1HL 2V2XA 1U95A 2I07B 3WYRA 2DQTL 4FQXB 3S6CA 1A6ZB 3PP3K 4WI8A 5I1GH 4P2QB 2J5LC 1FG9C 1MRCL 3MLUL 3TFKC 4IRZL 4XC1L 1LO4L 4UQ2B 5GJSL 5JA9A 1F3JB 1TVHA 1BFSA 4PJIA 2VZUA 3A6OA 3O2WH 2VWEC 1A6WL 5IVXE 3MLVH 1TXKA 4NN5C 3QXTA 3CLFL 5DJYB 4IJ3B 2F8VA 5I1JH 4AIZA 5C9JB 1EERB 2O5ZL 4UTBH 1NJ9A 1T04A 3TH2T 5I71C 3VGFA 1A14L 4DGIL 2DQJL 3GBLA 4WI6A 3EOTL 5GHWH 1QEWA 5C0NC 5L8JB 4LCCA 1JCKA 3CFKB 4PJBA 1EMTH 4ZNEA 5IF0A 1NUNB 1CFQB 3LN5B 2XWTB 1RZ8B 3A6CL 2VLJA 1C8PA 5D2NA 3DX6A 1D9KC 1WK0A 4XNMB 1IVLA 2GHWB 3RKDD 5EZOH 4Q9QL 2V5RA 2R9HC 3MQIA 2B4CC 5ACZA 1I4FA 3CFJB 4Y7MA 4WEBL 4EI5A 5FECA 4ZSOB 1DLFH 3HUJF 1F42A 5D7LE 4CU7A 3EYSH 4PJEA 4JDTL 4J12A 5FCSH 1MCJA 4ZXBD 3I3BA 3M1BB 1OP3K 1I7ZA 3O3AA 5CEZE 4PREB 3RL1A 3VRJA 2VZ1A 2OXGA 1VFOA 5D2LE 3PQYB 4OLZH 1VESA 3U4BL 1SMAA 1HH9A 3G6JA 1I3GL 4FQPA 3CGTA 3LMJH 4I4WA 4PRAA 1I75A 4WO4D 1S7XB 5JUEH 2J6EL 4PR5A 5EUOF 1JWMA 1MWAH 3V4PH 3S36H 2FEEL 4UZGA 4IRJD 1RZKL 1XF5A 3MR9A 3MGOB 3HI6H 1G9ML 3NPSC 1E4XL 1DTUA 4LCYA 3VWJB 5CFHA 3BT2H 3MBXL 3T4AB 2XN9E 4XNUL 1FJ1B 4AZ8A 3B5HA 3KYOB 1U3ZA 5LKNA 1AXSB 4OGAD 2C3GA 1FCCA 2D03L 3ILPB 5CJ5A 3H9SE 4LVHB 4LCWB 5F8QC 4F37F 4P46B 2OM5A 5IBUG 5GRZA 4F33B 3BPOC 2UZYB 5CGTA 5DJAA 4CVUA 4UNUA 2DLGA 2ORBH 3O6LH 5D6DA 4MJ6B 4KMTH 1IM9A 4JQVA 2H1PL 5F9DC 5IHZB 1N6VA 2D0GA 3IFLL 1PJ9A 5ISZB 3FMGL 2JELH 4M6NL 3PGFL 3QPXL 4J1UB 3Q5OA 5T3ZH 4X5LA 3T2NL 3VXOA 4WW2C 1QVOB 4TSCL 4UB0L 4UBDC 2DQUH 2I24N 4JFEB 5DUML 4MNQA 4AG4H 3MLXH 1KEGL 1KOAA 3HUJB 3U9UB 1LD9B 1WWBX 2YPLA 2GT9B 3O3EA 4TSBH 2NX5A 4YGAB 3MRHA 1G84A 5DGQA 3P73B 4OSUH 2NY3C 1JF1A 2EDWA 4PTUB 2C7UB 1WQVT 4PJ7E 5A2JH 4ZUUB 4XAWL 2DMBA 3EDEA 4L3EA 2B5IB 2QHRL 4CMMA 4XGZA 4FABL 1S5HB 3W5MA