3BE3A

Crystal structure of a protein belonging to pfam duf1653 from bordetella bronchiseptica
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
77
structure length
77
Chain Sequence
MQDFRPGVYRHYKGDHYLALGLARADETDEVVVVYTRLYARAGLPMSTRLLRIWNETVDTGAGPQPRFAYVGHVTPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a protein belonging to pfam DUF1653 from Bordetella bronchiseptica.
rcsb
source organism Bordetella bronchiseptica rb50
molecule tags Structural genomics, unknown function
total genus 12
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07866 DUF1653 Protein of unknown function (DUF1653)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.320 Mainly Beta Roll SH3 type barrels. DUF1653-like domain 3be3A00
3BE3A
chains in the Genus database with same CATH superfamily
2RHZA 2OTLT 2O31A 1YJWA 1LNXA 3M0RA 3N5BB 1YJNA 2KT8A 3CCUQ 2EJGA 1UB4A 3PIPA 1TG0A 1IXDA 2CH4W 2J7IA 4R0KA 3ZFJA 4J5YA 1NG2A 2LP5A 1Q7YU 4PJOA 1VQKT 3QYGB 4N0AC 4R55A 2E5QA 1K9MC 2MAMA 4X9DA 5GMKl 2RQWA 1ACMB 1G3YA 1QVGP 1E6GA 2OI3A 1I0CA 3CPWA 1OPLA 3M55A 1VQPQ 3OS5A 2RPNA 5D6YA 1K8AR 1BIAA 4O6JA 1M2VA 4CI0C 2DA9A 3EGUA 5DM7R 2EBPA 1Q81C 3V8KA 2O9VA 3UT1A 3OYKA 2GFUA 2E6ZA 3G4SA 1D0XA 1TUGB 1SSFA 2ZCFB 3FJ5A 5KYUA 4MMLA 4X9CA 2IIMA 2FYKA 1P92A 2DEUA 5IAYA 4AG1C 1ZUYA 5CQYA 3PMIA 2DZ9A 3ZEHA 3CCJA 1N6AA 1JU5C 2VKNA 3JCMh 3M59A 2CUBA 4HKEA 2DIQA 2A08A 1YP5A 3BE3A 1BBZA 1R8OB 4LUDA 1WZOA 5HK0A 2EFIA 5CVIA 2J6FA 2P0PA 3CXCP 4C92E 3PNWC 1KQSA 3CCET 3X26B 3TQ7P 2DNUA 2PVDB 3AT1B 1Y57A 5KYNA 2LJ1A 4F16A 2ZPBB 1BI0A 5GAN5 2HSPA 1M5Q1 4LD6A 3MJXA 3P8DA 1QLYA 4TVRA 1WXBA 2BE9B 3L2UA 4PFOA 1K8AC 3CC7Q 3M9QA 5GAOl 2EPDA 3VYHB 4YTLA 1JJ2A 3JB9F 4ZTJA 4DBRA 2QQAA 2ZPFB 3I56T 3O5ZA 4J9EA 2V8IA 2JS0A 3HRUA 3VS1A 6AT1B 1VQOQ 3E2UA 1U1SA 4RTVA 3CCRT 4J9BA 3LX7A 4J7FA 4LDWA 4DA4A 2AZVA 1VQ8T 2QGFB 1M1KR 2JOYA 3T9NA 5FROA 2LTOA 5KYWA 1NPRA 4M75F 2DL8A 4AFQC 3QZ9B 5HY6A 1QP3A 4M78B 4EMGA 3M5AA 2F5KA 2DX1A 1KQ2A 5FRMA 3IQLA 1N27A 1YWPA 2J05A 5IN1A 3VRYA 5HK3A 1BU1A 3MCAB 3E9GA 3META 2WSEE 1MGQA 2QA4A 4AT1B 2IVWA 2RB6A 2KMTA 2DERA 4PJOB 2DF6A 1IB8A 2XK0A 3CC4Q 2JUFA 2E12A 4MDXA 4F14A 3OW2P 2L3RA 4MDWA 1RAGB 5GANg 2E3IA 3G71A 1VQ6A 2RK1A 5FU7B 2ED0A 3EG0A 1M2VB 3M0QA 1BKBA 2QDLA 3LW5E 2DXBA 2XG8D 4FYVB 4WTOB 5GAMe 5GAN3 1MMGA 2LQKA 4XU1A 3L2ZA 5KYUB 3EHQA 2EQUA 2JW4A 1QCFA 2DD5A 1M1KC 1TU0B 2HSEB 1W1FA 2ECZA 3QPHA 3QDRB 1OX8A 1XNIA 3CC2Q 2E6NA 4RTZA 2MYSA 1N9RA 1H3HA 1UGSB 4RG8A 4FYWB 2DVEA 2HDAA 2F2VA 3EH1A 5D6WA 4M75A 2QK0A 4M78D 3FB9A 1TSFA 5LJ3j 1MNDA 3PTAA 2CDTA 2CP6A 1PKTA 2O01E 3QJ6A 1S72Q 2O9SA 3OS1A 4PJOD 1AT1B 4E6RA 2ROLA 1O9SA 4F7UF 1QCNA 1VQLA 1VOMA 3CCSA 3OB9A 4CC4B 1AVZC 3MP1A 2E64A 2DPPB 2VB6A 3TSWA 3CMEA 2A37A 1BIBA 1H3ZA 4D8DA 1M9SA 4E7ZA 2EJ9A 2CSIA 1YN8A 4DQ2A 3MEWA 5KCOA 2KAFA 3E1SA 4BY6C 3NTKA 2RI2A 4J9GA 4BACA 3SWNC 3OYIA 3EAEA 4XQ3A 2K79A 5IHIA 2HMAA 3VUBA 3CBMA 3JCMJ 3QHSA 1D1BA 5GAMf 1YITT 4M7DF 4Y91A 2RJEA 3M0PA 4LD9K 3X28B 2QG9B 2JZ2A 1WHKA 2GF7A 4IURA 4JRKA 2GNCA 2CP7A 4OMNA 4A54A 2X3XD 5KE3A 2JM9A 1CKAA 2KGTA 4PJOG 4XU2A 5CQXA 4RUGA 1SRMA 4C8QE 2HD0A 5IT9E 3GBQA 4QQ6A 3FIFA 1B34A 2A0FB 3EG3A 1S1NA 4J8OA 5IXBA 5CKHA 3CMAT 4BDYA 1VQMT 1BI2A 2MF2A 3OY9A 3I56A 3LWIA 2D8JA 1XQHA 1M1FA 4PNOA 2OX7A 3RKXA 1CKBA 1WJSA 4JLIA 3ZL7C 3M0SA 4NS5A 5GANd 2LNVA 3NTIA 3CCRA 2LMJA 4BE0A 1PM3A 2DYBA 1X43A 2RMOA 4M77F 1PRMC 3INZA 1QWFA 2KI7A 1VQ8A 4F7UA 2FZCB 4E7HA 1PCXA 2K3YA 3I35A 3QXEB 4EMKC 5D7UA 2QQSA 4C92F 2NUPA 3VS7A 2QQBA 4KH0B 2M0YA 4OB1B 3I5SA 1IGUA 2HKQB 2RQTA 3S3MA 2R5MA 2YRDA 1KD1U 2JNGA 4ZGJB 3A8HB 1JXMA 2CGHA 1GFDA 3SHWA 1W6XA 4PLIA 2E10A 1ZBJA 3OBYA 1O75A 1J3TA 2LRQA 4LXCA 3M4YA 3CCLQ 5LJ5j 4ME7A 4M75B 2M1HA 2EYQA 2LVMA 2W0ZA 4M7DA 2GCXA 4XTXA 5ECAA 2KE9A 4IUQA 2DJQA 4BI4A 4QT7A 3VS6A 3JCMe 1I81A 3NMZC 2DRKA 2BZXA 4OMLA 4OMQA 1QKXA 2W10A 1KQSS 1M3AA 2KY9A 2DD4A 1VYVA 1N8RR 3MO8A 5GAN7 1QP2A 2JN0A 4M7AE 3KUFA 2P4RA 3HKSA 1ZA1B 1NLOC 1OU8A 3OYBA 3MEUA 2K9GA 4Z02A 1JJ2S 2Y4YA 3M0UA 3S3NA 2QYZA 1VQPT 1AOJA 2DE0X 4JS4A 4M77A 1IGQA 2FRYA 3RUXA 3JB9D 1SHGA 2KYBA 4A4KA 3I55T 4JZ4A 2M02A 4GBQA 3JCMc 2XDPA 1QMCA 1T0HA 2QAZA 4GLMA 4E7LA 3WVEB 5DLOA 4C92A 3HRSA 2AT1B 1RAEB 2VXFA 2CSQA 2E1HA 1Q86R 1RL2A 2L8DA 1KJWA 2PVGB 1GXIE 5CKEA 4J6XA 1YJWQ 4PJJA 4NOYA 3LGFA 4Z8AA 4F04B 1U06A 2LCCA 3Q1JA 4C5EA 3KXTA 1YJNQ 1GCQA 4OB0B 2L0AA 2D9TA 4M75D 3OYCA 1UE9A 1OYXA 2HL5C 4BB7A 4J9HA 2IPOB 2VC8A 5GMKi 2XDDA 1BCOA 2AZSA 3C4SA 1B34B 3REAB 3FLGA 5FW9A 3G6EA 3L1AA 1QVFP 1N8RC 2K5LA 4MZMA 2K7AA 4J9FA 5CR2A 2GTJA 1M1GA 4PJMA 3JCMf 1X01A 1LOJA 2VXEA 3CCVT 4MMKA 4WF2A 2VYTA 1W2BP 2HBWA 4KBMB 4IKFA 1WFWA 1OX9A 3G1JA 5IHKA 1RAHB 2K5IA 4F7UB 2M16A 2CUDA 3G4SQ 2VUBA 3RMQA 2QASA 5CCAA 2COYA 4N4HA 1YITA 2NUPB 1HD3A 1FMKA 3OYMA 3SEMA 3CD6A 1RABB 2V1QA 4AMCA 1X6GA 3FC3A 2DBMA 2C0IA 2DTOA 1FYNA 3OMCA 1Q86C 3VYGA 2QEXQ 4M7AG 4XTUA 4E7KA 2XI9A 2HQXA 4GLKA 3UPUA 2KRMA 4JRIA 3JB9I 2BUDA 1WHLA 3E9FA 2HQHA 2LQWA 4RTYA 1H641 4M7DB 1OQKA 4OMMA 1WQ7A 1UFFA 1Q82R 1ZSZA 4KGXB 1E6HA 3CPFA 2RI3A 1KC8U 4A4FA 3FJPA 2QI2A 1M8VA 4C5GA 1GRIA 3EG2A 4JLGA 4K11A 1RLPC 3WXMB 2Z0WA 2X9HA 2ZPHB 1BCMA 1M4ZA 2CH4A 2GFAA 4OGCA 4LDVA 3JCMV 1YHQT 4L59A 2KROA 1C6VX 1VQ5T 3J81E 4C0ZA 3GIBA 2KYMA 2RN8A 4M77B 1TH7A 2MI6A 3PMTA 2OJ2A 4AG2C 1G83A 2F69A 1PRLC 3SDZA 1G3WA 2C0OA 1BI1A 1X69A 2JM8A 4JS5A 4JJCA 3GOXA 4C92B 2EYYA 2YUOA 5FU6B 5GANe 1N5ZA 1LJOA 3JB9H 2EYWA 2OTJT 2LDMA 2DO3A 3QWXX 2V1RA 3A1PA 1Q82C 4FSSA 3P8BB 1D09B 2NUZA 5IH2A 2F5TX 3PE0A 3HRTA 2FZKB 4M4ZA 2QA4Q 5LJ3g 1JEGA 4M7DD 2QQ9A 3JRZA 1ZBXA 1SKUB 2G3RA 3PT9A 4J9DA 3A8LB 4HT9A 2RI5A 4EPCA 2V8KA 8AT1B 2G6FX 1K4US 1KQ1A 2RH2A 2RQVA 2XMFA 1EIFA 2FPFA 4C8QC 2DL5A 3VU3C 4FIBA 1HK9A 5CKDA 3CBPA 1VQPA 5IHNA 1VQNT 3TVTA 2DJZA 4WCIA 4E47A 2RJFA 2X4WA 1S72T 1U5SA 2DILA 1H8KA 2EQIA 4KUIA 2C0TA 3KBGA 4LDYA 2O2OA 2VASA 3RESA 3I55A 4B9WA 5FWCA 1VIEA 1VQ4A 3QWYA 2D1XA 1ZSGA 5DY9A 3OA6A 1SRLA 1YI2T 2RQRA 2E41A 3X24B 1YJ9T 1AWJA 4QQGA 1JBMA 2LQNA 2RQUA 4M77D 2GBQA 4HCKA 5A0GA 2ZPGB 1YIJT 2XHCA 1FXXA 4PJLA 5KYYA 1TUCA 4RG2A 3OYEA 3PVQA 1TUDA 3OYAA 1RI0A 4C92D 1D1AA 1K1ZA 2JMCA 1X75C 4M7DG 4C0FA 4FSXA 4C0DC 4PFPA 1NYFA 1T3SA 4EDUA 1VYUA 4CC3A 1W70A 3S6WA 5GANf 2JJ9A 2NUTA 3GF5A 1ZSZB 4PL6A 3CPWP 1WHJA 1WHGA 2ENMA 1I07A 3CCVA 2DXTA 4D8KA 3OSVA 2ZPIB 1UGPB 1RI9A 4DEYA 3MP6A 4C5HA 1ABQA 4LN2A 5L23A 1VQLQ 3GP8A 3WVDB 3CCSQ 1MHNA 4RTXA 5LJ3h 1K9AA 1BK2A 3HHTB 4DOWA 2NYSA 4PJOE 2CT3A 3CMEQ 2LT1A 5GAOn 3GLXA 4M77G 4ORZA 4M7AC 1VQ7T 2KT1A 1UEBA 2M51A 2KNBB 1QVGS 3V8JA 2OTLA 4PLLA 1KSWA 2O4XB 2MMPA 2KVQG 3H0HA 2KXDA 4IIOA 4LDXA 4N4IA 3OYLA 2LCLA 4L6V5 1SSHA 1F1BB 5KYXA 1KIKA 2ESWA 1VQKA 2VWFA 2BZYA 4OMOA 3OYFA 2LJ3A 2A36A 2HBPA 4DBFA 4BI8B 3CCQT 2CS7A 3BFMA 2KR3A 1TTHB 1OOTA 2FVUA 5GMKh 1Y07A 4ATOA 1N8RU 1OV3A 3CEYA 1X27A 1QWEA 4E7SA 3AHUA 5LJ3d 1DJ7B 3QDFA 4A4GA 2BKDN 2J6KA 3I56Q 3DKMA 4IUPA 1IHVA 4FT4A 1V1CA 4PK4A 1YHQA 3RKWA 4ZN3A 1SPKA 1VQ5A 4X34A 3CXCS 2P84A 2LCSA 4P5NA 4J9IA 2JT4A 2H3JA 1NEGA 5GANh 2RF0A 4JUVA 1M90R 1VQ8Q 5I2MA 4XTYA 2X35A 4VUBA 1D1CA 3VRZA 3JCMX 2LNHB 4OB3B 3J7AF 1Z9ZA 4M78G 1B7TA 1YWOA 1Q86U 1GFCA 1PSFA 2OTJA 2BIVA 3VUZA 2LC4A 3LLRA 2PQWA 3X20B 3JV3A 3CCEA 3E19A 5KYYB 3U23A 4OMPA 2SRCA 1K9MU 2RNAA 1PKSA 3A8OB 3SD4A 3R6NA 4FU6A 1AHJB 3HSBA 2CZ0B 2NUTB 1C0MA 3SWNA 1VQ9T 2MWOA 3L2WA 2ZPEB 4C0GA 3QSUA 4IIMA 4XAXB 2F1LA 1OPKA 1Q81U 3VS5A 1VQNA 2CYZB 1YJNT 1I4K1 1G2BA 1QW1A 1PG5B 1RLQC 1YCYA 5D6XA 3UF4A 2EWNA 2J06A 1YI2A 5KCHA 1YJ9A 1WLPB 1M90C 1WHHA 4RTWA 4D6WA 1QVFA 2AIRB 2A28A 1RAAB 1SHFA 1YCSB 4FYYB 1ZUKA 4XTWA 2P0QA 4XTZA 4HCCA 2YRCA 3OW2S 1YIJA 2BE7D 3CCMQ 1W2BA 1MMNA 1JXOA 3VS4A 5GAN8 1PC0A 2YLCA 3C12A 5GJWB 3UWNA 3G4ST 3V7RA 2EGEA 2X4JA 3SB2A 5KYXB 1Q82U 2MCNA 1D3BB 5CKBA 1HJDA 1X6BA 3LGLA 2AHJB 2VGNA 3P8HA 1ZUUA 1WJRA 4EMKA 1JRIA 2L3SA 1IRXA 4AFSC 1M3CA 2QEXT 1K8AU 4LNPA 5GAOr 3QZ5B 3PIOA 3PFSA 5LJ5d 1WJQA 3CCUT 1IHWA 2DL4A 4ZGEB 1OU9A 3G6EQ 4J6YA 4M75E 3ASKA 4CC7A 2YSQA 4A4EA 4QVDA 1NLPC 3VS0A 1IREB 3OYJA 1VQ7A 3D7SB 2JMAA 3DB4A 1QVGA 5FRNA 4J7IA 2Y4XA 1YFNA 2ATCB 2ABLA 4GY5A 1UHCA 1A0NB 3FEOA 5CK9A 1UHFA 3QYHB 2EVRA 3H0FA 1ZLMA 2BTTA 2OAUA 3CQTA 2C06A 3NFCA 1JO8A 1XJWB 1YITQ 2H8HA 1V76A 4HCBA 4N4GA 3CD6Q 1G8XA 3RBBB 2RJCA 2RHIA 3CCQA 1D0YA 3G7ZA 2EYXA 5GAMj 1UECA 4XU3A 1FMWA 4E7JA 3EG9A 2QGGA 2K57A 1LVKA 2FB7A 2IG0A 2DK3A 2MK5A 4J9CA 4Z88A 4RCBA 3I5RA 4BD3A 1RUWA 3EGXA 4BY6B 3SWNB 1GBQA 3CXCA 2DFUA 3TEEA 2KK4A 3HFOA 1GL5A 5I11A 2CP5A 4MZTA 4FCYA 3HL8A 2KXCA 4L5GA 2YUNA 1G3TA 1M30A 2DETA 4M78C 1TWBA 3JB9G 2RD1A 1M1KU 5A2QE 3V7CA 1NYGA 1KFZA 3CC7T 5I2SA 4Y92A 4F17A 1LPLA 1EX4A 3VJPA 2DL3A 2L89A 1GBRA 2KQWA 3TCJA 3CCJQ 3QO3A 3LH5A 5CO7A 5LJ3e 4PJOC 2EGCA 1VQOT 4C5IA 4M75G 4KUDK 1K76A 1K73R 2RO0A 1ZHIA 1C1AA 1W4SA 2QDYB 5FU7C 4FM4B 3L2RA 2PUKB 2WSFE 1VQ9A 2FG0A 5LL6S 1B3QA 3V7SA 3CMAA 1VQMA 2YLBA 3JCMb 1KD1R 2GQVA 2AK5A 4EMKB 3MHXA 4NL2A 2HNIA 4OF1A 2P4TA 2HKNA 4BE1A 4QVZA 3O8VA 3ER0A 3JAME 2DRMA 3GNFB 2KRNA 3DLLA 2P0KA 3QJYA 2Y90A 1BYMA 5GMKe 5J39A 4QW2A 2JTEA 5GAN6 1Z9QA 5FLXE 4M7DE 1M8MA 1IO6A 1TS9A 3CC4T 3H9NA 1WX6A 3OW2A 2DL7A 3X25B 1SG5A 2ZAEA 1B07A 3PVLA 4B9XA 4N0AA 1IZ6A 2RM4A 3M4GA 4QVCA 5KH6A 3H6ZA 4JZ3A 3KFVA 3I55Q 4C8QF 1VQ4Q 4OGEA 1BI3A 2CKKA 1VQLT 2O4XA 3JCMQ 3CCST 2KDSA 2FZGB 1E7OA 2ROTA 2DLPA 2E65A 2HZYA 1K73C 3CMET 3L2VA 3HP9A 1NE8A 4FT2A 1OZ3A 3OMGA 4ZTFA 2ZZDA 1QCOA 2FHDA 1EZZB 4LUEA 4XK8E 3BW1A 5LJ3f 3CC2T 2R57A 3EG9B 2F2XA 4HVWA 2QEXA 1KD1C 3EFOA 1WXTA 2LX9A 4M77E 1MV0B 3CCUA 2PZ1A 3OYNA 1AD5A 2XKOC 1ZX6A 2SEMA 3LH0A 4DOVA 3MP8A 3BDUA 3EGXB 1D0ZA 1I8FA 4BDZA 1I5OB 2HEQA 3GPLA 2DIGA 5AT1B 3CCVQ 1KK7A 2PUOB 4A63B 1UJ0A 3OBWA 2EQJA 3H8ZA 4ELYC 5GAOq 3G71Q 1VQ6Q 1T3LA 3VKIA 1M90U 4F7UG 2RHUA 3TREA 4AFZC 1WXUA 3FRNA 3JCMW 4KULA 3LYIA 3RIRA 1NJIR 2KBTA 4HT8A 2EYZA 2CZ1B 3M56A 4Q5WA 4CRIA 4KGVB 1KG1A 4QQDA 1WDXA 1N9SA 1QVFS 3QKJA 5LJ5e 3ULRB 2LZ6B 1G3SA 2OTLQ 2L3QA 4LDUA 2K6DA 2A7YA 2GQIA 2RJDA 3JCMd 3EGDA 1UG1A 2M0OA 5I21A 2M9UA 4C8QA 3F70A 3OYHA 1W2BS 5DLQE 1VA7A 4HCZA 3URGA 4M7AF 2RHXA 4DBQA 3OYDA 4XU0A 2HQEA 1VQKQ 3JSCA 2YDLA 5EC7A 3BDLA 4BI3A 3S3OA 4RMOA 4II1A 3VV0A 4R56A 3OYGA 3A5ZB 1T0JA 2K3BA 2H3EB 1NZ9A 4CC2A 2XU8A 2D8HA 2PNIA 4M78E 1VUBA 3RR6A 2DTHA 4KH1B 2CREA 4EIKA 3GNGA 4E7IA 1Y7XA 2X51A 3UATA 3M54A 8ATCB 3L2QA 5A0LA 4A53A 2PTKA 5IXFA 3CC7A 3UA7A 2WACA 1Q7YR 2F2WA 4HVUA 1NJIC 1WHMA 1YHQQ 1K0XA 4PFZA 1VQ5Q 1Y71A 4ZN1A 1KC8R 4M75C 1QVPA 1MMAA 2EQMA 2MWPA 2I0NA 2NWMA 1VQOA 1U1TA 2D0QB 1NM7A 1PD1A 2JTFA 1Y0MA 1UGRB 4C92G 2E4HA 1OZ2A 5CIUA 1ARKA 2RK2A 1LCKA 2CZ6B 2NLUA 2OTJQ 3OS2A 2FPDA 3RERA 2DM1A 3DLMA 2XIDA 4JJBA 2EQKA 2YRVA 1KQSP 1EFNA 1AZEA 2KEAA 3CCEQ 5LJ5f 1D3BA 4JJDA 4O5VA 4JRPA 1UDLA 3CCMT 3EG1A 4FYXB 1R0BG 1XTDA 3EFOB 3OYYA 4EMHA 5LJ5g 2E3HA 3M58A 2CP3A 5HCKA 4M7AA 9ATCB 2HCKA 3CCLT 2QQRA 2EIFA 5M9OA 1AWWA 3QIIA 1JJ2P 4HA8A 4NL3A 4Z89A 1PD0A 1FX7A 1Y96A 4E2FB 1ABOA 1OULA 4PJNA 3CC4A 3A8GB 1BB9A 4BE2A 1MUZA 1Q7YC 1UTIA 1VQNQ 5KE2A 1WGSA 4ZGDB 3CCRQ 1V29B 3UDCA 1PNJA 2JS2A 4Y28E 1KC8C 3JCMP 1AWOA 4QKUA 1YI2Q 1YJ9Q 3G6ET 2EW3A 1AZGB 4PKCC 4B6MA 2YHTA 3MEAA 1YIJQ 3CC2A 1MMDA 5GMKj 2MIOA 2YXYA 2YT6A 3EGDB 2B8AA 4C8QB 4MZPA 3EFRA 4FW1A 1WIEA 5KYWB 1UJYA 1RACB 2XDBA 1PSEA 2DAQA 1SEMA 3L42A 1NPPA 5AYFA 3EFSA 4KT0E 4RTUA 3CD6T 3ME9A 2DEQA 2DXCA 3TU4K 1U8RA 5J3BA 5GAMg 1KHCA 3MKDA 1JB0E 5I22A 1CSKA 1RADB 4RTTA 3CBOA 1YJWT 1WI7A 2LJ0A 2LT4A 2RA2A 2K3XA 5GANj 1S72A 2HAXA 4IUUA 2YUPA 2VV5A 5LJ5h 5FWBA 3A8MB 4ANJA 2DVJA 2BZ8A 3RNJA 2ED1A 2DYIA 3H41A 2OAWA 3C95A 2ZGWA 2CP2A 4ESRA 1JQQA 1X6OA 1VQ7Q 1KHIA 2CT4A 2EJFA 1H92A 4C0DB 3QG1A 5GAN4 3CPWS 1WQWA 3MPUB 3HFNA 3HTRA 1WYXA 1ZQ1A 3M57A 4M7DC 4X1VA 1K73U 4FW2A 3NGPA 3EHRA 2K5FA 1QKWA 2FEIA 3OQ5A 2QXFA 2B86A 4XTVA 3R6OA 2DBKA 3JB9J 3EH2A 3QBYA 2DKGA 4HVVA 5L8RE 3CCQQ 1HXDA 4J6WA 5J26A 5A0DA 1WA7A 3J80E 4OP0A 4JJNK 4C8QD 2CZ7B 2K2MA 2PVOB 3TSZA 3CCJT 3MEVA 1NEBA 2L3PA 4DBHA 2DMOA 2X4YA 4ZNXA 1NBEB 5GMKm 3C0CA 2X3WD 2GTOA 4M7AB 2V8JA 2D6FA 2FL7A 4IUTA 5CAIA 4UC4A 1X2QA 3PGGA 4KGZB 1XOVA 1X2KA 4JPBW 2AKKA 5C0MA 3UA6A 2JXBA 1I1JA 2QTXA 2MPXC 4LE9A 4M77C 4RKUE 2E70A 1Y96B 2V26A 3NTHA 5GAMh 4J83A 2KRSA 2YUQA 1Q95G 4C92C 3OSSC 2GGRA 5FU6C 2AKLA 1HYOA 2FO0A 2A3LA 3OS0A 1G5VA 1WNLA 1PHTA 2HL3A 3DB3A 4A4HA 4RCCA 4OB2B 1UGQB 1GCQC 2LX7A 1VIFA 3RDVA 2JVVA 2EKHA 2WSCE 3C94A 3THKA 3ZBDA 4M78F 4ELZC 4C8QG 1R0CB 4JDSA 3QUIA 5GJVB 1OI1A 3CCMA 5HKCA 4DEXA 2E5KA 2QTVA 1VYTA 2J6OA 1FWZA 3V8LA 3BY7A 3REBB 1R77A 1VQ4T 2XD0A 2EAYA 3NPFA 4AFUC 1RAIB 4OMFB 4JRQA 1I5LA 2YWWA 4IUVA 3H0IA 3CCLA 5GAOp 2EGAA 3FDRA 4PJOF 1VQ9Q 1TOVA 2LQ8A 1GCPA 3CMAQ 1VQMQ 3HPWA 2K4YA 1U3OA 5GAN2 1HSQA 1M2OA 5GAMd 2DXUA 3RMSA 2VGMA 2R5AA 2JTMA 5GAOm 4M7AD 1SF9A 4V2SA 1FMVA 2X4XA 1M27C 1OEBA 1QQJA 1UGVA 1WPYA 1ZA2B 1TXQA 1K9MR 2COZA 1NJIU 2PU9B 2L5QA 2QA4T 3NHNA 3M0TA 3I9QA 2CP0A 1UUEA 1MV3A 7AT1B 1AWXA 2COWA 2EKOA 1K0SA 3A98A 3VS3A 1RAFB 1YBYA 1YNZA 4OVAA 2FRWA 3SFMA 2VVKA 3VS2A 2L2PA 1Q81R 2XICA 3JCMg 3LWHA 3G71T 1VQ6T 1M3BA 2I2LA 2DTIA 5C6SA 4HXJA 1MNEA 1ZSZC 2R58A 5EG2A 2O88A 4BUGA 2MOXA 5CKFA 4FL6A 2K2VA 3RKYA 4F7UE 4KRTA 2D0NA 2KSSA 1AEYA 2RHYA 3M53A 4M78A 1PWTA 2DZCA 2FPEA
chains in the Genus database with same CATH topology
3BE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BE3 A; 
#chains in the Genus database with same CATH topology
 2RHZ A;  2OTL T;  2O31 A;  1YJW A;  1LNX A;  3M0R A;  3N5B B;  1YJN A;  2KT8 A;  3CCU Q;  2EJG A;  1UB4 A;  3PIP A;  1TG0 A;  1IXD A;  2CH4 W;  2J7I A;  4R0K A;  3ZFJ A;  4J5Y A;  1NG2 A;  2LP5 A;  1Q7Y U;  4PJO A;  1VQK T;  3QYG B;  4N0A C;  4R55 A;  2E5Q A;  1K9M C;  2MAM A;  4X9D A;  5GMK l;  2RQW A;  1ACM B;  1G3Y A;  1QVG P;  1E6G A;  2OI3 A;  1I0C A;  3CPW A;  1OPL A;  3M55 A;  1VQP Q;  3OS5 A;  2RPN A;  5D6Y A;  1K8A R;  1BIA A;  4O6J A;  1M2V A;  4CI0 C;  2DA9 A;  3EGU A;  5DM7 R;  2EBP A;  1Q81 C;  3V8K A;  2O9V A;  3UT1 A;  3OYK A;  2GFU A;  2E6Z A;  3G4S A;  1D0X A;  1TUG B;  1SSF A;  2ZCF B;  3FJ5 A;  5KYU A;  4MML A;  4X9C A;  2IIM A;  2FYK A;  1P92 A;  2DEU A;  5IAY A;  4AG1 C;  1ZUY A;  5CQY A;  3PMI A;  2DZ9 A;  3ZEH A;  3CCJ A;  1N6A A;  1JU5 C;  2VKN A;  3JCM h;  3M59 A;  2CUB A;  4HKE A;  2DIQ A;  2A08 A;  1YP5 A;  3BE3 A;  1BBZ A;  1R8O B;  4LUD A;  1WZO A;  5HK0 A;  2EFI A;  5CVI A;  2J6F A;  2P0P A;  3CXC P;  4C92 E;  3PNW C;  1KQS A;  3CCE T;  3X26 B;  3TQ7 P;  2DNU A;  2PVD B;  3AT1 B;  1Y57 A;  5KYN A;  2LJ1 A;  4F16 A;  2ZPB B;  1BI0 A;  5GAN 5;  2HSP A;  1M5Q 1;  4LD6 A;  3MJX A;  3P8D A;  1QLY A;  4TVR A;  1WXB A;  2BE9 B;  3L2U A;  4PFO A;  1K8A C;  3CC7 Q;  3M9Q A;  5GAO l;  2EPD A;  3VYH B;  4YTL A;  1JJ2 A;  3JB9 F;  4ZTJ A;  4DBR A;  2QQA A;  2ZPF B;  3I56 T;  3O5Z A;  4J9E A;  2V8I A;  2JS0 A;  3HRU A;  3VS1 A;  6AT1 B;  1VQO Q;  3E2U A;  1U1S A;  4RTV A;  3CCR T;  4J9B A;  3LX7 A;  4J7F A;  4LDW A;  4DA4 A;  2AZV A;  1VQ8 T;  2QGF B;  1M1K R;  2JOY A;  3T9N A;  5FRO A;  2LTO A;  5KYW A;  1NPR A;  4M75 F;  2DL8 A;  4AFQ C;  3QZ9 B;  5HY6 A;  1QP3 A;  4M78 B;  4EMG A;  3M5A A;  2F5K A;  2DX1 A;  1KQ2 A;  5FRM A;  3IQL A;  1N27 A;  1YWP A;  2J05 A;  5IN1 A;  3VRY A;  5HK3 A;  1BU1 A;  3MCA B;  3E9G A;  3MET A;  2WSE E;  1MGQ A;  2QA4 A;  4AT1 B;  2IVW A;  2RB6 A;  2KMT A;  2DER A;  4PJO B;  2DF6 A;  1IB8 A;  2XK0 A;  3CC4 Q;  2JUF A;  2E12 A;  4MDX A;  4F14 A;  3OW2 P;  2L3R A;  4MDW A;  1RAG B;  5GAN g;  2E3I A;  3G71 A;  1VQ6 A;  2RK1 A;  5FU7 B;  2ED0 A;  3EG0 A;  1M2V B;  3M0Q A;  1BKB A;  2QDL A;  3LW5 E;  2DXB A;  2XG8 D;  4FYV B;  4WTO B;  5GAM e;  5GAN 3;  1MMG A;  2LQK A;  4XU1 A;  3L2Z A;  5KYU B;  3EHQ A;  2EQU A;  2JW4 A;  1QCF A;  2DD5 A;  1M1K C;  1TU0 B;  2HSE B;  1W1F A;  2ECZ A;  3QPH A;  3QDR B;  1OX8 A;  1XNI A;  3CC2 Q;  2E6N A;  4RTZ A;  2MYS A;  1N9R A;  1H3H A;  1UGS B;  4RG8 A;  4FYW B;  2DVE A;  2HDA A;  2F2V A;  3EH1 A;  5D6W A;  4M75 A;  2QK0 A;  4M78 D;  3FB9 A;  1TSF A;  5LJ3 j;  1MND A;  3PTA A;  2CDT A;  2CP6 A;  1PKT A;  2O01 E;  3QJ6 A;  1S72 Q;  2O9S A;  3OS1 A;  4PJO D;  1AT1 B;  4E6R A;  2ROL A;  1O9S A;  4F7U F;  1QCN A;  1VQL A;  1VOM A;  3CCS A;  3OB9 A;  4CC4 B;  1AVZ C;  3MP1 A;  2E64 A;  2DPP B;  2VB6 A;  3TSW A;  3CME A;  2A37 A;  1BIB A;  1H3Z A;  4D8D A;  1M9S A;  4E7Z A;  2EJ9 A;  2CSI A;  1YN8 A;  4DQ2 A;  3MEW A;  5KCO A;  2KAF A;  3E1S A;  4BY6 C;  3NTK A;  2RI2 A;  4J9G A;  4BAC A;  3SWN C;  3OYI A;  3EAE A;  4XQ3 A;  2K79 A;  5IHI A;  2HMA A;  3VUB A;  3CBM A;  3JCM J;  3QHS A;  1D1B A;  5GAM f;  1YIT T;  4M7D F;  4Y91 A;  2RJE A;  3M0P A;  4LD9 K;  3X28 B;  2QG9 B;  2JZ2 A;  1WHK A;  2GF7 A;  4IUR A;  4JRK A;  2GNC A;  2CP7 A;  4OMN A;  4A54 A;  2X3X D;  5KE3 A;  2JM9 A;  1CKA A;  2KGT A;  4PJO G;  4XU2 A;  5CQX A;  4RUG A;  1SRM A;  4C8Q E;  2HD0 A;  5IT9 E;  3GBQ A;  4QQ6 A;  3FIF A;  1B34 A;  2A0F B;  3EG3 A;  1S1N A;  4J8O A;  5IXB A;  5CKH A;  3CMA T;  4BDY A;  1VQM T;  1BI2 A;  2MF2 A;  3OY9 A;  3I56 A;  3LWI A;  2D8J A;  1XQH A;  1M1F A;  4PNO A;  2OX7 A;  3RKX A;  1CKB A;  1WJS A;  4JLI A;  3ZL7 C;  3M0S A;  4NS5 A;  5GAN d;  2LNV A;  3NTI A;  3CCR A;  2LMJ A;  4BE0 A;  1PM3 A;  2DYB A;  1X43 A;  2RMO A;  4M77 F;  1PRM C;  3INZ A;  1QWF A;  2KI7 A;  1VQ8 A;  4F7U A;  2FZC B;  4E7H A;  1PCX A;  2K3Y A;  3I35 A;  3QXE B;  4EMK C;  5D7U A;  2QQS A;  4C92 F;  2NUP A;  3VS7 A;  2QQB A;  4KH0 B;  2M0Y A;  4OB1 B;  3I5S A;  1IGU A;  2HKQ B;  2RQT A;  3S3M A;  2R5M A;  2YRD A;  1KD1 U;  2JNG A;  4ZGJ B;  3A8H B;  1JXM A;  2CGH A;  1GFD A;  3SHW A;  1W6X A;  4PLI A;  2E10 A;  1ZBJ A;  3OBY A;  1O75 A;  1J3T A;  2LRQ A;  4LXC A;  3M4Y A;  3CCL Q;  5LJ5 j;  4ME7 A;  4M75 B;  2M1H A;  2EYQ A;  2LVM A;  2W0Z A;  4M7D A;  2GCX A;  4XTX A;  5ECA A;  2KE9 A;  4IUQ A;  2DJQ A;  4BI4 A;  4QT7 A;  3VS6 A;  3JCM e;  1I81 A;  3NMZ C;  2DRK A;  2BZX A;  4OML A;  4OMQ A;  1QKX A;  2W10 A;  1KQS S;  1M3A A;  2KY9 A;  2DD4 A;  1VYV A;  1N8R R;  3MO8 A;  5GAN 7;  1QP2 A;  2JN0 A;  4M7A E;  3KUF A;  2P4R A;  3HKS A;  1ZA1 B;  1NLO C;  1OU8 A;  3OYB A;  3MEU A;  2K9G A;  4Z02 A;  1JJ2 S;  2Y4Y A;  3M0U A;  3S3N A;  2QYZ A;  1VQP T;  1AOJ A;  2DE0 X;  4JS4 A;  4M77 A;  1IGQ A;  2FRY A;  3RUX A;  3JB9 D;  1SHG A;  2KYB A;  4A4K A;  3I55 T;  4JZ4 A;  2M02 A;  4GBQ A;  3JCM c;  2XDP A;  1QMC A;  1T0H A;  2QAZ A;  4GLM A;  4E7L A;  3WVE B;  5DLO A;  4C92 A;  3HRS A;  2AT1 B;  1RAE B;  2VXF A;  2CSQ A;  2E1H A;  1Q86 R;  1RL2 A;  2L8D A;  1KJW A;  2PVG B;  1GXI E;  5CKE A;  4J6X A;  1YJW Q;  4PJJ A;  4NOY A;  3LGF A;  4Z8A A;  4F04 B;  1U06 A;  2LCC A;  3Q1J A;  4C5E A;  3KXT A;  1YJN Q;  1GCQ A;  4OB0 B;  2L0A A;  2D9T A;  4M75 D;  3OYC A;  1UE9 A;  1OYX A;  2HL5 C;  4BB7 A;  4J9H A;  2IPO B;  2VC8 A;  5GMK i;  2XDD A;  1BCO A;  2AZS A;  3C4S A;  1B34 B;  3REA B;  3FLG A;  5FW9 A;  3G6E A;  3L1A A;  1QVF P;  1N8R C;  2K5L A;  4MZM A;  2K7A A;  4J9F A;  5CR2 A;  2GTJ A;  1M1G A;  4PJM A;  3JCM f;  1X01 A;  1LOJ A;  2VXE A;  3CCV T;  4MMK A;  4WF2 A;  2VYT A;  1W2B P;  2HBW A;  4KBM B;  4IKF A;  1WFW A;  1OX9 A;  3G1J A;  5IHK A;  1RAH B;  2K5I A;  4F7U B;  2M16 A;  2CUD A;  3G4S Q;  2VUB A;  3RMQ A;  2QAS A;  5CCA A;  2COY A;  4N4H A;  1YIT A;  2NUP B;  1HD3 A;  1FMK A;  3OYM A;  3SEM A;  3CD6 A;  1RAB B;  2V1Q A;  4AMC A;  1X6G A;  3FC3 A;  2DBM A;  2C0I A;  2DTO A;  1FYN A;  3OMC A;  1Q86 C;  3VYG A;  2QEX Q;  4M7A G;  4XTU A;  4E7K A;  2XI9 A;  2HQX A;  4GLK A;  3UPU A;  2KRM A;  4JRI A;  3JB9 I;  2BUD A;  1WHL A;  3E9F A;  2HQH A;  2LQW A;  4RTY A;  1H64 1;  4M7D B;  1OQK A;  4OMM A;  1WQ7 A;  1UFF A;  1Q82 R;  1ZSZ A;  4KGX B;  1E6H A;  3CPF A;  2RI3 A;  1KC8 U;  4A4F A;  3FJP A;  2QI2 A;  1M8V A;  4C5G A;  1GRI A;  3EG2 A;  4JLG A;  4K11 A;  1RLP C;  3WXM B;  2Z0W A;  2X9H A;  2ZPH B;  1BCM A;  1M4Z A;  2CH4 A;  2GFA A;  4OGC A;  4LDV A;  3JCM V;  1YHQ T;  4L59 A;  2KRO A;  1C6V X;  1VQ5 T;  3J81 E;  4C0Z A;  3GIB A;  2KYM A;  2RN8 A;  4M77 B;  1TH7 A;  2MI6 A;  3PMT A;  2OJ2 A;  4AG2 C;  1G83 A;  2F69 A;  1PRL C;  3SDZ A;  1G3W A;  2C0O A;  1BI1 A;  1X69 A;  2JM8 A;  4JS5 A;  4JJC A;  3GOX A;  4C92 B;  2EYY A;  2YUO A;  5FU6 B;  5GAN e;  1N5Z A;  1LJO A;  3JB9 H;  2EYW A;  2OTJ T;  2LDM A;  2DO3 A;  3QWX X;  2V1R A;  3A1P A;  1Q82 C;  4FSS A;  3P8B B;  1D09 B;  2NUZ A;  5IH2 A;  2F5T X;  3PE0 A;  3HRT A;  2FZK B;  4M4Z A;  2QA4 Q;  5LJ3 g;  1JEG A;  4M7D D;  2QQ9 A;  3JRZ A;  1ZBX A;  1SKU B;  2G3R A;  3PT9 A;  4J9D A;  3A8L B;  4HT9 A;  2RI5 A;  4EPC A;  2V8K A;  8AT1 B;  2G6F X;  1K4U S;  1KQ1 A;  2RH2 A;  2RQV A;  2XMF A;  1EIF A;  2FPF A;  4C8Q C;  2DL5 A;  3VU3 C;  4FIB A;  1HK9 A;  5CKD A;  3CBP A;  1VQP A;  5IHN A;  1VQN T;  3TVT A;  2DJZ A;  4WCI A;  4E47 A;  2RJF A;  2X4W A;  1S72 T;  1U5S A;  2DIL A;  1H8K A;  2EQI A;  4KUI A;  2C0T A;  3KBG A;  4LDY A;  2O2O A;  2VAS A;  3RES A;  3I55 A;  4B9W A;  5FWC A;  1VIE A;  1VQ4 A;  3QWY A;  2D1X A;  1ZSG A;  5DY9 A;  3OA6 A;  1SRL A;  1YI2 T;  2RQR A;  2E41 A;  3X24 B;  1YJ9 T;  1AWJ A;  4QQG A;  1JBM A;  2LQN A;  2RQU A;  4M77 D;  2GBQ A;  4HCK A;  5A0G A;  2ZPG B;  1YIJ T;  2XHC A;  1FXX A;  4PJL A;  5KYY A;  1TUC A;  4RG2 A;  3OYE A;  3PVQ A;  1TUD A;  3OYA A;  1RI0 A;  4C92 D;  1D1A A;  1K1Z A;  2JMC A;  1X75 C;  4M7D G;  4C0F A;  4FSX A;  4C0D C;  4PFP A;  1NYF A;  1T3S A;  4EDU A;  1VYU A;  4CC3 A;  1W70 A;  3S6W A;  5GAN f;  2JJ9 A;  2NUT A;  3GF5 A;  1ZSZ B;  4PL6 A;  3CPW P;  1WHJ A;  1WHG A;  2ENM A;  1I07 A;  3CCV A;  2DXT A;  4D8K A;  3OSV A;  2ZPI B;  1UGP B;  1RI9 A;  4DEY A;  3MP6 A;  4C5H A;  1ABQ A;  4LN2 A;  5L23 A;  1VQL Q;  3GP8 A;  3WVD B;  3CCS Q;  1MHN A;  4RTX A;  5LJ3 h;  1K9A A;  1BK2 A;  3HHT B;  4DOW A;  2NYS A;  4PJO E;  2CT3 A;  3CME Q;  2LT1 A;  5GAO n;  3GLX A;  4M77 G;  4ORZ A;  4M7A C;  1VQ7 T;  2KT1 A;  1UEB A;  2M51 A;  2KNB B;  1QVG S;  3V8J A;  2OTL A;  4PLL A;  1KSW A;  2O4X B;  2MMP A;  2KVQ G;  3H0H A;  2KXD A;  4IIO A;  4LDX A;  4N4I A;  3OYL A;  2LCL A;  4L6V 5;  1SSH A;  1F1B B;  5KYX A;  1KIK A;  2ESW A;  1VQK A;  2VWF A;  2BZY A;  4OMO A;  3OYF A;  2LJ3 A;  2A36 A;  2HBP A;  4DBF A;  4BI8 B;  3CCQ T;  2CS7 A;  3BFM A;  2KR3 A;  1TTH B;  1OOT A;  2FVU A;  5GMK h;  1Y07 A;  4ATO A;  1N8R U;  1OV3 A;  3CEY A;  1X27 A;  1QWE A;  4E7S A;  3AHU A;  5LJ3 d;  1DJ7 B;  3QDF A;  4A4G A;  2BKD N;  2J6K A;  3I56 Q;  3DKM A;  4IUP A;  1IHV A;  4FT4 A;  1V1C A;  4PK4 A;  1YHQ A;  3RKW A;  4ZN3 A;  1SPK A;  1VQ5 A;  4X34 A;  3CXC S;  2P84 A;  2LCS A;  4P5N A;  4J9I A;  2JT4 A;  2H3J A;  1NEG A;  5GAN h;  2RF0 A;  4JUV A;  1M90 R;  1VQ8 Q;  5I2M A;  4XTY A;  2X35 A;  4VUB A;  1D1C A;  3VRZ A;  3JCM X;  2LNH B;  4OB3 B;  3J7A F;  1Z9Z A;  4M78 G;  1B7T A;  1YWO A;  1Q86 U;  1GFC A;  1PSF A;  2OTJ A;  2BIV A;  3VUZ A;  2LC4 A;  3LLR A;  2PQW A;  3X20 B;  3JV3 A;  3CCE A;  3E19 A;  5KYY B;  3U23 A;  4OMP A;  2SRC A;  1K9M U;  2RNA A;  1PKS A;  3A8O B;  3SD4 A;  3R6N A;  4FU6 A;  1AHJ B;  3HSB A;  2CZ0 B;  2NUT B;  1C0M A;  3SWN A;  1VQ9 T;  2MWO A;  3L2W A;  2ZPE B;  4C0G A;  3QSU A;  4IIM A;  4XAX B;  2F1L A;  1OPK A;  1Q81 U;  3VS5 A;  1VQN A;  2CYZ B;  1YJN T;  1I4K 1;  1G2B A;  1QW1 A;  1PG5 B;  1RLQ C;  1YCY A;  5D6X A;  3UF4 A;  2EWN A;  2J06 A;  1YI2 A;  5KCH A;  1YJ9 A;  1WLP B;  1M90 C;  1WHH A;  4RTW A;  4D6W A;  1QVF A;  2AIR B;  2A28 A;  1RAA B;  1SHF A;  1YCS B;  4FYY B;  1ZUK A;  4XTW A;  2P0Q A;  4XTZ A;  4HCC A;  2YRC A;  3OW2 S;  1YIJ A;  2BE7 D;  3CCM Q;  1W2B A;  1MMN A;  1JXO A;  3VS4 A;  5GAN 8;  1PC0 A;  2YLC A;  3C12 A;  5GJW B;  3UWN A;  3G4S T;  3V7R A;  2EGE A;  2X4J A;  3SB2 A;  5KYX B;  1Q82 U;  2MCN A;  1D3B B;  5CKB A;  1HJD A;  1X6B A;  3LGL A;  2AHJ B;  2VGN A;  3P8H A;  1ZUU A;  1WJR A;  4EMK A;  1JRI A;  2L3S A;  1IRX A;  4AFS C;  1M3C A;  2QEX T;  1K8A U;  4LNP A;  5GAO r;  3QZ5 B;  3PIO A;  3PFS A;  5LJ5 d;  1WJQ A;  3CCU T;  1IHW A;  2DL4 A;  4ZGE B;  1OU9 A;  3G6E Q;  4J6Y A;  4M75 E;  3ASK A;  4CC7 A;  2YSQ A;  4A4E A;  4QVD A;  1NLP C;  3VS0 A;  1IRE B;  3OYJ A;  1VQ7 A;  3D7S B;  2JMA A;  3DB4 A;  1QVG A;  5FRN A;  4J7I A;  2Y4X A;  1YFN A;  2ATC B;  2ABL A;  4GY5 A;  1UHC A;  1A0N B;  3FEO A;  5CK9 A;  1UHF A;  3QYH B;  2EVR A;  3H0F A;  1ZLM A;  2BTT A;  2OAU A;  3CQT A;  2C06 A;  3NFC A;  1JO8 A;  1XJW B;  1YIT Q;  2H8H A;  1V76 A;  4HCB A;  4N4G A;  3CD6 Q;  1G8X A;  3RBB B;  2RJC A;  2RHI A;  3CCQ A;  1D0Y A;  3G7Z A;  2EYX A;  5GAM j;  1UEC A;  4XU3 A;  1FMW A;  4E7J A;  3EG9 A;  2QGG A;  2K57 A;  1LVK A;  2FB7 A;  2IG0 A;  2DK3 A;  2MK5 A;  4J9C A;  4Z88 A;  4RCB A;  3I5R A;  4BD3 A;  1RUW A;  3EGX A;  4BY6 B;  3SWN B;  1GBQ A;  3CXC A;  2DFU A;  3TEE A;  2KK4 A;  3HFO A;  1GL5 A;  5I11 A;  2CP5 A;  4MZT A;  4FCY A;  3HL8 A;  2KXC A;  4L5G A;  2YUN A;  1G3T A;  1M30 A;  2DET A;  4M78 C;  1TWB A;  3JB9 G;  2RD1 A;  1M1K U;  5A2Q E;  3V7C A;  1NYG A;  1KFZ A;  3CC7 T;  5I2S A;  4Y92 A;  4F17 A;  1LPL A;  1EX4 A;  3VJP A;  2DL3 A;  2L89 A;  1GBR A;  2KQW A;  3TCJ A;  3CCJ Q;  3QO3 A;  3LH5 A;  5CO7 A;  5LJ3 e;  4PJO C;  2EGC A;  1VQO T;  4C5I A;  4M75 G;  4KUD K;  1K76 A;  1K73 R;  2RO0 A;  1ZHI A;  1C1A A;  1W4S A;  2QDY B;  5FU7 C;  4FM4 B;  3L2R A;  2PUK B;  2WSF E;  1VQ9 A;  2FG0 A;  5LL6 S;  1B3Q A;  3V7S A;  3CMA A;  1VQM A;  2YLB A;  3JCM b;  1KD1 R;  2GQV A;  2AK5 A;  4EMK B;  3MHX A;  4NL2 A;  2HNI A;  4OF1 A;  2P4T A;  2HKN A;  4BE1 A;  4QVZ A;  3O8V A;  3ER0 A;  3JAM E;  2DRM A;  3GNF B;  2KRN A;  3DLL A;  2P0K A;  3QJY A;  2Y90 A;  1BYM A;  5GMK e;  5J39 A;  4QW2 A;  2JTE A;  5GAN 6;  1Z9Q A;  5FLX E;  4M7D E;  1M8M A;  1IO6 A;  1TS9 A;  3CC4 T;  3H9N A;  1WX6 A;  3OW2 A;  2DL7 A;  3X25 B;  1SG5 A;  2ZAE A;  1B07 A;  3PVL A;  4B9X A;  4N0A A;  1IZ6 A;  2RM4 A;  3M4G A;  4QVC A;  5KH6 A;  3H6Z A;  4JZ3 A;  3KFV A;  3I55 Q;  4C8Q F;  1VQ4 Q;  4OGE A;  1BI3 A;  2CKK A;  1VQL T;  2O4X A;  3JCM Q;  3CCS T;  2KDS A;  2FZG B;  1E7O A;  2ROT A;  2DLP A;  2E65 A;  2HZY A;  1K73 C;  3CME T;  3L2V A;  3HP9 A;  1NE8 A;  4FT2 A;  1OZ3 A;  3OMG A;  4ZTF A;  2ZZD A;  1QCO A;  2FHD A;  1EZZ B;  4LUE A;  4XK8 E;  3BW1 A;  5LJ3 f;  3CC2 T;  2R57 A;  3EG9 B;  2F2X A;  4HVW A;  2QEX A;  1KD1 C;  3EFO A;  1WXT A;  2LX9 A;  4M77 E;  1MV0 B;  3CCU A;  2PZ1 A;  3OYN A;  1AD5 A;  2XKO C;  1ZX6 A;  2SEM A;  3LH0 A;  4DOV A;  3MP8 A;  3BDU A;  3EGX B;  1D0Z A;  1I8F A;  4BDZ A;  1I5O B;  2HEQ A;  3GPL A;  2DIG A;  5AT1 B;  3CCV Q;  1KK7 A;  2PUO B;  4A63 B;  1UJ0 A;  3OBW A;  2EQJ A;  3H8Z A;  4ELY C;  5GAO q;  3G71 Q;  1VQ6 Q;  1T3L A;  3VKI A;  1M90 U;  4F7U G;  2RHU A;  3TRE A;  4AFZ C;  1WXU A;  3FRN A;  3JCM W;  4KUL A;  3LYI A;  3RIR A;  1NJI R;  2KBT A;  4HT8 A;  2EYZ A;  2CZ1 B;  3M56 A;  4Q5W A;  4CRI A;  4KGV B;  1KG1 A;  4QQD A;  1WDX A;  1N9S A;  1QVF S;  3QKJ A;  5LJ5 e;  3ULR B;  2LZ6 B;  1G3S A;  2OTL Q;  2L3Q A;  4LDU A;  2K6D A;  2A7Y A;  2GQI A;  2RJD A;  3JCM d;  3EGD A;  1UG1 A;  2M0O A;  5I21 A;  2M9U A;  4C8Q A;  3F70 A;  3OYH A;  1W2B S;  5DLQ E;  1VA7 A;  4HCZ A;  3URG A;  4M7A F;  2RHX A;  4DBQ A;  3OYD A;  4XU0 A;  2HQE A;  1VQK Q;  3JSC A;  2YDL A;  5EC7 A;  3BDL A;  4BI3 A;  3S3O A;  4RMO A;  4II1 A;  3VV0 A;  4R56 A;  3OYG A;  3A5Z B;  1T0J A;  2K3B A;  2H3E B;  1NZ9 A;  4CC2 A;  2XU8 A;  2D8H A;  2PNI A;  4M78 E;  1VUB A;  3RR6 A;  2DTH A;  4KH1 B;  2CRE A;  4EIK A;  3GNG A;  4E7I A;  1Y7X A;  2X51 A;  3UAT A;  3M54 A;  8ATC B;  3L2Q A;  5A0L A;  4A53 A;  2PTK A;  5IXF A;  3CC7 A;  3UA7 A;  2WAC A;  1Q7Y R;  2F2W A;  4HVU A;  1NJI C;  1WHM A;  1YHQ Q;  1K0X A;  4PFZ A;  1VQ5 Q;  1Y71 A;  4ZN1 A;  1KC8 R;  4M75 C;  1QVP A;  1MMA A;  2EQM A;  2MWP A;  2I0N A;  2NWM A;  1VQO A;  1U1T A;  2D0Q B;  1NM7 A;  1PD1 A;  2JTF A;  1Y0M A;  1UGR B;  4C92 G;  2E4H A;  1OZ2 A;  5CIU A;  1ARK A;  2RK2 A;  1LCK A;  2CZ6 B;  2NLU A;  2OTJ Q;  3OS2 A;  2FPD A;  3RER A;  2DM1 A;  3DLM A;  2XID A;  4JJB A;  2EQK A;  2YRV A;  1KQS P;  1EFN A;  1AZE A;  2KEA A;  3CCE Q;  5LJ5 f;  1D3B A;  4JJD A;  4O5V A;  4JRP A;  1UDL A;  3CCM T;  3EG1 A;  4FYX B;  1R0B G;  1XTD A;  3EFO B;  3OYY A;  4EMH A;  5LJ5 g;  2E3H A;  3M58 A;  2CP3 A;  5HCK A;  4M7A A;  9ATC B;  2HCK A;  3CCL T;  2QQR A;  2EIF A;  5M9O A;  1AWW A;  3QII A;  1JJ2 P;  4HA8 A;  4NL3 A;  4Z89 A;  1PD0 A;  1FX7 A;  1Y96 A;  4E2F B;  1ABO A;  1OUL A;  4PJN A;  3CC4 A;  3A8G B;  1BB9 A;  4BE2 A;  1MUZ A;  1Q7Y C;  1UTI A;  1VQN Q;  5KE2 A;  1WGS A;  4ZGD B;  3CCR Q;  1V29 B;  3UDC A;  1PNJ A;  2JS2 A;  4Y28 E;  1KC8 C;  3JCM P;  1AWO A;  4QKU A;  1YI2 Q;  1YJ9 Q;  3G6E T;  2EW3 A;  1AZG B;  4PKC C;  4B6M A;  2YHT A;  3MEA A;  1YIJ Q;  3CC2 A;  1MMD A;  5GMK j;  2MIO A;  2YXY A;  2YT6 A;  3EGD B;  2B8A A;  4C8Q B;  4MZP A;  3EFR A;  4FW1 A;  1WIE A;  5KYW B;  1UJY A;  1RAC B;  2XDB A;  1PSE A;  2DAQ A;  1SEM A;  3L42 A;  1NPP A;  5AYF A;  3EFS A;  4KT0 E;  4RTU A;  3CD6 T;  3ME9 A;  2DEQ A;  2DXC A;  3TU4 K;  1U8R A;  5J3B A;  5GAM g;  1KHC A;  3MKD A;  1JB0 E;  5I22 A;  1CSK A;  1RAD B;  4RTT A;  3CBO A;  1YJW T;  1WI7 A;  2LJ0 A;  2LT4 A;  2RA2 A;  2K3X A;  5GAN j;  1S72 A;  2HAX A;  4IUU A;  2YUP A;  2VV5 A;  5LJ5 h;  5FWB A;  3A8M B;  4ANJ A;  2DVJ A;  2BZ8 A;  3RNJ A;  2ED1 A;  2DYI A;  3H41 A;  2OAW A;  3C95 A;  2ZGW A;  2CP2 A;  4ESR A;  1JQQ A;  1X6O A;  1VQ7 Q;  1KHI A;  2CT4 A;  2EJF A;  1H92 A;  4C0D B;  3QG1 A;  5GAN 4;  3CPW S;  1WQW A;  3MPU B;  3HFN A;  3HTR A;  1WYX A;  1ZQ1 A;  3M57 A;  4M7D C;  4X1V A;  1K73 U;  4FW2 A;  3NGP A;  3EHR A;  2K5F A;  1QKW A;  2FEI A;  3OQ5 A;  2QXF A;  2B86 A;  4XTV A;  3R6O A;  2DBK A;  3JB9 J;  3EH2 A;  3QBY A;  2DKG A;  4HVV A;  5L8R E;  3CCQ Q;  1HXD A;  4J6W A;  5J26 A;  5A0D A;  1WA7 A;  3J80 E;  4OP0 A;  4JJN K;  4C8Q D;  2CZ7 B;  2K2M A;  2PVO B;  3TSZ A;  3CCJ T;  3MEV A;  1NEB A;  2L3P A;  4DBH A;  2DMO A;  2X4Y A;  4ZNX A;  1NBE B;  5GMK m;  3C0C A;  2X3W D;  2GTO A;  4M7A B;  2V8J A;  2D6F A;  2FL7 A;  4IUT A;  5CAI A;  4UC4 A;  1X2Q A;  3PGG A;  4KGZ B;  1XOV A;  1X2K A;  4JPB W;  2AKK A;  5C0M A;  3UA6 A;  2JXB A;  1I1J A;  2QTX A;  2MPX C;  4LE9 A;  4M77 C;  4RKU E;  2E70 A;  1Y96 B;  2V26 A;  3NTH A;  5GAM h;  4J83 A;  2KRS A;  2YUQ A;  1Q95 G;  4C92 C;  3OSS C;  2GGR A;  5FU6 C;  2AKL A;  1HYO A;  2FO0 A;  2A3L A;  3OS0 A;  1G5V A;  1WNL A;  1PHT A;  2HL3 A;  3DB3 A;  4A4H A;  4RCC A;  4OB2 B;  1UGQ B;  1GCQ C;  2LX7 A;  1VIF A;  3RDV A;  2JVV A;  2EKH A;  2WSC E;  3C94 A;  3THK A;  3ZBD A;  4M78 F;  4ELZ C;  4C8Q G;  1R0C B;  4JDS A;  3QUI A;  5GJV B;  1OI1 A;  3CCM A;  5HKC A;  4DEX A;  2E5K A;  2QTV A;  1VYT A;  2J6O A;  1FWZ A;  3V8L A;  3BY7 A;  3REB B;  1R77 A;  1VQ4 T;  2XD0 A;  2EAY A;  3NPF A;  4AFU C;  1RAI B;  4OMF B;  4JRQ A;  1I5L A;  2YWW A;  4IUV A;  3H0I A;  3CCL A;  5GAO p;  2EGA A;  3FDR A;  4PJO F;  1VQ9 Q;  1TOV A;  2LQ8 A;  1GCP A;  3CMA Q;  1VQM Q;  3HPW A;  2K4Y A;  1U3O A;  5GAN 2;  1HSQ A;  1M2O A;  5GAM d;  2DXU A;  3RMS A;  2VGM A;  2R5A A;  2JTM A;  5GAO m;  4M7A D;  1SF9 A;  4V2S A;  1FMV A;  2X4X A;  1M27 C;  1OEB A;  1QQJ A;  1UGV A;  1WPY A;  1ZA2 B;  1TXQ A;  1K9M R;  2COZ A;  1NJI U;  2PU9 B;  2L5Q A;  2QA4 T;  3NHN A;  3M0T A;  3I9Q A;  2CP0 A;  1UUE A;  1MV3 A;  7AT1 B;  1AWX A;  2COW A;  2EKO A;  1K0S A;  3A98 A;  3VS3 A;  1RAF B;  1YBY A;  1YNZ A;  4OVA A;  2FRW A;  3SFM A;  2VVK A;  3VS2 A;  2L2P A;  1Q81 R;  2XIC A;  3JCM g;  3LWH A;  3G71 T;  1VQ6 T;  1M3B A;  2I2L A;  2DTI A;  5C6S A;  4HXJ A;  1MNE A;  1ZSZ C;  2R58 A;  5EG2 A;  2O88 A;  4BUG A;  2MOX A;  5CKF A;  4FL6 A;  2K2V A;  3RKY A;  4F7U E;  4KRT A;  2D0N A;  2KSS A;  1AEY A;  2RHY A;  3M53 A;  4M78 A;  1PWT A;  2DZC A;  2FPE A; 
#chains in the Genus database with same CATH homology
 3BE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...