3BE3A

Crystal structure of a protein belonging to pfam duf1653 from bordetella bronchiseptica
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
77
structure length
77
Chain Sequence
MQDFRPGVYRHYKGDHYLALGLARADETDEVVVVYTRLYARAGLPMSTRLLRIWNETVDTGAGPQPRFAYVGHVTPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a protein belonging to pfam DUF1653 from Bordetella bronchiseptica.
rcsb
source organism Bordetella bronchiseptica rb50
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 12
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07866 DUF1653 Protein of unknown function (DUF1653)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.320 Mainly Beta Roll SH3 type barrels. DUF1653-like domain 3be3A00
3BE3A
chains in the Genus database with same CATH superfamily
2ZZDA 3CCSA 2RJDA 2E1HA 1KQ2A 2X4WA 4J7IA 4DA4A 1BBZA 1VQKT 1K76A 2KEAA 4L59A 5GMKe 4BI4A 1VUBA 1QKWA 3NHNA 4HKEA 3FJ5A 3OY9A 1AWWA 4DBQA 3JCMV 2LDMA 2RK1A 4FYXB 2VASA 1H92A 2LZ6B 5GAOl 1SHGA 1ZX6A 4QVDA 1Y07A 1OI1A 1RACB 3QZ9B 1ZLMA 3HTRA 1ZUYA 5FRMA 1M2VA 2BZ8A 2EFIA 3VS2A 2J6FA 3M5AA 4DEYA 2WSEE 2A3LA 4DBRA 2HQXA 3VKIA 3QIIA 1SSFA 2M16A 4XTUA 1VQLA 4RTWA 2EVRA 2K5LA 3JCMc 5IXFA 1KJWA 2F1LA 3M0PA 5LJ5h 1UGVA 5GAOn 2DJQA 3C0CA 3QZ5B 2J6OA 1KK7A 1WXTA 4MDXA 3GP8A 1B7TA 2RK2A 4A54A 3CPWA 1QWEA 2CSQA 2D6FA 2IIMA 1Q81U 4F04B 2OAWA 4M77F 5KYWA 2QA4T 4M7DD 5D7UA 1FXXA 2RF0A 2DTIA 4M7AD 2RHXA 2ROTA 1QKXA 4C0DC 2CSIA 3CQTA 1BI2A 4V2SA 1NPRA 2E65A 3LYIA 1W6XA 4CC3A 1ZQ1A 3JRZA 2LVMA 1ABOA 1I8FA 2M1HA 1M1KR 2RHZA 5FRNA 1I5OB 4L5GA 2XD0A 4J9CA 2OTJA 3GNGA 5CR2A 3I5SA 3RR6A 4ZTFA 2OTJQ 3HFOA 3QBYA 4XU1A 1KIKA 1D1CA 2EJGA 2VGNA 2DILA 5LJ3h 5A0LA 4PFZA 2DXUA 2EYWA 1VQPQ 2FZGB 2CZ6B 4OB1B 3OMGA 2E5KA 5GANh 3RMQA 4LDVA 4JS4A 5KYXB 2DXBA 4PJMA 1AT1B 2J6KA 5C0MA 1WPYA 4C92G 1R0CB 5CIUA 4B9XA 4E2FB 2E12A 1SRLA 1XJWB 2A0FB 2GGRA 5IT9E 3A5ZB 2HD0A 3RBBB 4M77C 2HQHA 3G71A 3CCRQ 2RJEA 3E9GA 2F69A 4IUUA 4MZTA 3JB9D 1QCOA 4PJOA 2JTMA 2WSFE 5CAIA 3OS0A 4AMCA 5GANd 4QQGA 4ELZC 1LNXA 3J7AF 1AWOA 4M75B 2FG0A 2COZA 2CP7A 3MP8A 3VS7A 1WXUA 4M7AB 1WJQA 1PD0A 4C92B 4ZTJA 4F7UG 1LOJA 2G3RA 1N6AA 4OB3B 1YI2A 1D3BA 1YITT 3CBMA 5CKBA 2RM4A 1QVGA 1NLPC 4JRIA 1TTHB 4QKUA 4FSSA 3GIBA 1WIEA 3INZA 1B3QA 2ZPBB 4BE0A 3A8OB 4LNPA 4LDXA 2D8JA 2DEQA 3I55Q 1VQNT 4BACA 1OOTA 1SSHA 3LGLA 5LJ5j 4M7AA 2RB6A 2K2MA 1TUGB 2JM8A 1NE8A 1W4SA 1G3WA 1PSEA 1NEBA 1RAIB 2XI9A 1RADB 2K3BA 3V8KA 3S6WA 3QUIA 4LDUA 2LCCA 4EMKC 5GMKl 3FC3A 3EGDA 1BIAA 2QTVA 1XQHA 3QSUA 8AT1B 1GBRA 2PZ1A 3EGXA 4CRIA 3JCMe 1HK9A 2KE9A 5LJ5g 3SFMA 2EJFA 2R57A 4M77E 2EW3A 4XU3A 1M90C 1IXDA 2GQVA 2L3QA 2RJCA 4Y91A 1I0CA 3Q1JA 4XU0A 4HCCA 2EKOA 3CCET 2KGTA 4E7LA 2LP5A 1VQ9A 1Z9QA 2QEXT 3WVDB 1BKBA 5KYWB 1RAEB 3KUFA 1G3YA 3CEYA 1M8MA 1HXDA 3G7ZA 3HSBA 4OMLA 4C8QE 2VGMA 4PJNA 1VQ7A 1YI2Q 2JJ9A 5GAMf 1U06A 1VOMA 5I21A 1VYUA 5KH6A 3OYEA 2CREA 2KNBB 3JCMg 4GY5A 2YUQA 2LX9A 2YRVA 2X4YA 1K73C 1TUDA 1PRMC 2MK5A 4N4GA 1VQ9Q 5KYYA 1Q95G 3EFRA 1GCQA 1VQMA 1H3ZA 3M9QA 2CKKA 3C95A 4AG1C 1Y57A 4D8DA 1IGUA 1QW1A 1NG2A 5CKHA 1M90U 2DJZA 2K7AA 4LXCA 2M9UA 1WHHA 5KE2A 2DPPB 3OYAA 2RQTA 3GOXA 2HKNA 4MZMA 4BB7A 2JTEA 4O6JA 4J9GA 1QVFA 1B07A 2J05A 2RPNA 3CCQT 2YDLA 4Z89A 2ABLA 2DFUA 1YN8A 2CDTA 4PKCC 2P0PA 4N4IA 4ZN1A 1YITQ 3J80E 3EHQA 1FMKA 2C0TA 4EDUA 1TU0B 3JCMP 3VS6A 3QDFA 4O5VA 4CC4B 5LJ3d 2GF7A 1VQOT 4F7UA 4QVZA 3H8ZA 4XTXA 3SWNC 3JB9F 2VWFA 4GBQA 3QXEB 3M53A 1VQNQ 4IUTA 4KH1B 3I55T 2LX7A 1QVFP 2PUKB 1AHJB 1MNDA 1XNIA 4M75G 3SDZA 2LTOA 3JB9G 1PNJA 1UHCA 2L3PA 1OZ2A 1YHQT 5FWCA 2HL3A 4PLLA 2K5IA 4LDYA 1OX9A 3VUBA 1UGSB 3FEOA 5GAOr 1WNLA 5GAMg 3OSVA 4X9CA 1UG1A 2HDAA 2M51A 3P8BB 1H641 2L3RA 3L1AA 1GCQC 3FRNA 2P4RA 2CUBA 4J8OA 2D1XA 3MO8A 2PVDB 3MEUA 3NTHA 1MMGA 1PRLC 4A4KA 2YUPA 2F5TX 2KSSA 1AZEA 4JJBA 2YUOA 3EGXB 1E6HA 4BI8B 5IXBA 2RI5A 3L42A 1EIFA 5I22A 5GAOq 2CP3A 1PC0A 3G6ET 1N8RC 1PCXA 2X35A 2O4XB 2OTJT 2CZ1B 2JM9A 4KUIA 3ZL7C 3CCVA 4KRTA 1K9MR 4HT9A 2KVQG 5EC7A 2AKKA 1R8OB 3IQLA 2ZGWA 1UHFA 3CCVT 3JCMW 2YT6A 1QP2A 3HP9A 4DOWA 1PKTA 3CMEA 1HD3A 3H41A 3F70A 2P0KA 5GJWB 2AHJB 3QDRB 2VKNA 2E6ZA 4IUVA 5GAN4 1BCMA 2RI3A 3RKYA 1JQQA 3CCUQ 2OX7A 2ZPGB 3A8GB 4Y28E 1IGQA 4J9FA 4OMPA 4J6XA 4EMGA 1N8RU 1X2KA 2RHYA 2GNCA 2LNVA 4OB2B 1SEMA 2DL3A 2QDLA 4D8KA 1O9SA 1TSFA 2KRNA 3EG9A 1VIEA 2QA4Q 3HFNA 5A0GA 2IPOB 2KR3A 3R6OA 2LQKA 4ME7A 2EPDA 1UEBA 1YBYA 4RTXA 2VXFA 2BTTA 4Z88A 1UGRB 3M0TA 3VS4A 2A7YA 4PJOB 4R55A 1RAFB 4AG2C 4HXJA 2DEUA 5LJ5d 3FIFA 1CKAA 4PNOA 4HT8A 2JOYA 3WXMB 1KHIA 4AFQC 2JXBA 4FIBA 1RI0A 2MF2A 1I07A 1LJOA 3DLMA 3OYJA 1OU8A 2DYBA 3MP1A 1WQWA 2KK4A 1Q7YR 1Q81R 2DYIA 1M30A 4C92F 1YJNA 3EG1A 2KBTA 4M77A 4XTYA 1W2BS 2O9VA 4M75C 2C06A 6AT1B 2H8HA 3L2VA 1I5LA 4F17A 3E19A 2DZCA 4E7SA 1TWBA 2QGGA 4JZ3A 4FYYB 5D6XA 1MMDA 4X1VA 3G4ST 4ELYC 3QWYA 3SD4A 3QYHB 1VQLT 2DF6A 4C0FA 1Q82C 4Q5WA 4K11A 4C8QA 4NL3A 3MPUB 4PK4A 4WTOB 1VQKQ 2KT8A 3ZFJA 2IG0A 2RD1A 4FYWB 3EGDB 3HRSA 1H8KA 5ECAA 2L5QA 2FPEA 3GPLA 1YJ9T 1TH7A 1X6GA 4P5NA 1X6BA 1FYNA 2XK0A 2M0YA 1X75C 2K2VA 1D1AA 2DBMA 4RTVA 4HA8A 3I55A 1FMWA 3CC7A 4X9DA 2LT1A 3E2UA 2ENMA 1BIBA 2LNHB 2DVJA 5KYUA 1YJWT 2X3XD 4KT0E 5DLQE 3ASKA 1VQOA 3PIOA 4FU6A 2BKDN 1IRXA 3CCST 1WHLA 1WLPB 4PLIA 3C4SA 2F2WA 2OAUA 2XKOC 3OYBA 1AZGB 4BE2A 2YHTA 2D0NA 2MI6A 5KCOA 3H0FA 3VJPA 3OBYA 1WQ7A 2QYZA 2O9SA 4LD9K 1N9RA 1HJDA 2FL7A 4JDSA 4XQ3A 3M55A 3HKSA 2LCLA 2LJ3A 3V8JA 2XICA 4BD3A 2A37A 1X6OA 2Y4XA 3QG1A 2P0QA 2PVGB 3FLGA 1UTIA 2DRMA 4M7DE 1AWXA 1M3CA 2DRKA 1KSWA 4JJCA 4JS5A 3MP6A 2CH4A 2O4XA 1VQMT 3CD6Q 4C5GA 4EMKB 2VXEA 2LCSA 3M4YA 5IHNA 2X4XA 4DBFA 5GAOm 1KG1A 4XTWA 4D6WA 1Q86C 4A4GA 4C8QD 4A4EA 5DY9A 3V7CA 5DLOA 3I56Q 2DETA 4J9IA 1RABB 2J06A 5FROA 3JAME 2EBPA 5I11A 1D0YA 5EG2A 4E7KA 3NTIA 1UJYA 1EX4A 3CXCA 4M78E 1LCKA 2HAXA 1VQ7Q 3H0HA 3EFSA 1YCSB 2L89A 4M75A 1V29B 3OBWA 4M7DG 1S72T 4OMNA 2QEXA 3TEEA 8ATCB 3JCMQ 3H6ZA 3C12A 1M3AA 4LD6A 1Q81C 4FW1A 1QQJA 3A98A 2MOXA 3JCMd 1D1BA 5GMKm 1OZ3A 5GAN6 3NFCA 4OMQA 3A8LB 1KQSA 1N27A 1G8XA 3PE0A 1SRMA 1TG0A 1VQ5T 4KGXB 1PM3A 2ZPIB 3S3NA 5CKDA 3EG9B 2DBKA 2F5KA 3TCJA 5AT1B 3CC4Q 2XMFA 4M7DC 4M78G 2YUNA 1CSKA 3OYKA 4KH0B 3UDCA 1BYMA 2HMAA 1LPLA 5IAYA 5FU7C 1KHCA 4IURA 4M7DB 3TU4K 3BY7A 4M7AG 1ACMB 1PKSA 1OYXA 4E7HA 3REAB 1T3SA 3BW1A 2EAYA 2K6DA 3RMSA 1WHKA 2GFUA 1D09B 3CPWS 2XDBA 2JNGA 2EWNA 2CZ7B 2VVKA 2ZPHB 3RERA 5HKCA 1WZOA 3OA6A 1G3TA 4C92C 3BDLA 1AVZC 1Y0MA 1JXOA 1UDLA 3BFMA 3SWNA 2KY9A 4M77G 5FU6C 3CCMT 4M7AE 3LW5E 2K57A 2MMPA 1SPKA 2K3XA 4E6RA 4ZGJB 2K5FA 3JV3A 2XDPA 2K4YA 2DNUA 1Q86U 2H3EB 1U5SA 4LUEA 1MV3A 4PJOD 2DKGA 4NOYA 4KGVB 3M56A 3LWHA 2FPDA 2DK3A 2HSPA 2F2XA 2A36A 3JB9H 1WA7A 3MHXA 1HSQA 1IHVA 2YWWA 3GNFB 1NYFA 2COYA 1XTDA 2FRWA 5LJ3g 4KGZB 4M77D 2GBQA 1OU9A 1MGQA 1YIJQ 2JUFA 5IHKA 1TS9A 2BUDA 1VQ6Q 2EKHA 2ROLA 2A08A 2W0ZA 2DL7A 1MNEA 2J7IA 4J83A 1EFNA 4EMHA 2W10A 4B9WA 3JSCA 5KE3A 5CKFA 4C5IA 1JXMA 3SB2A 2LQ8A 3EFOA 4JLIA 5FWBA 3QJYA 2QQ9A 4LUDA 1ZUUA 1NLOC 1VQPT 2V8KA 3WVEB 3CCLQ 4N4HA 2R5MA 2HBWA 3JCMJ 1PG5B 3A1PA 2JT4A 2RQUA 1KQSS 3JCMf 3S3OA 1TOVA 2O31A 3G4SA 1YWOA 3OW2A 2NUTB 1G3SA 3X25B 4IUPA 4AFZC 2DIGA 3P8DA 1OV3A 4QT7A 2ATCB 1WJSA 5LJ3f 3OW2S 2K3YA 1PWTA 3R6NA 2PVOB 2DX1A 1UFFA 1K8AU 1T0JA 4OP0A 3EH1A 4ZNXA 1QVGS 4II1A 1MMNA 4JZ4A 4B6MA 2EQMA 3ZEHA 3UWNA 3OYCA 5GANj 4C92A 3CC7T 3MCAB 2O88A 4C8QF 4RTUA 2LJ0A 3LGFA 3JB9I 1K9MC 2FEIA 9ATCB 2BIVA 4M78F 3UPUA 2ZPEB 4C0ZA 3CMAT 2YSQA 3AT1B 1Q82U 2P84A 3PFSA 2CP5A 2RMOA 3RKWA 5GANg 4BY6C 3CPWP 4X34A 2FO0A 1VQ8T 2NLUA 1WHJA 2I2LA 2X9HA 4M78D 3CCUA 1ZUKA 2ZCFB 4NS5A 2GTJA 4M7DA 1YFNA 1IO6A 2ESWA 3DB3A 1W2BP 4F7UF 1VQ4Q 2COWA 2XIDA 3BDUA 5GAMe 3PNWC 4RTYA 1M1GA 3CMET 5GANe 5LJ5e 2KYMA 1T0HA 1VQ8Q 1NJIU 3PMIA 4PJOC 2E64A 1UGQB 1QP3A 3CCMA 4BUGA 4OMOA 2O2OA 2HEQA 3X20B 3UT1A 4Y92A 4EPCA 4PL6A 2RA2A 2EYYA 2QAZA 2SEMA 2KYBA 3E1SA 2EYXA 2XHCA 1KD1U 3SEMA 2LC4A 4C8QG 3REBB 2JMAA 5I2SA 5LL6S 3E9FA 3CD6A 1AD5A 3CC7Q 4IIMA 1VQ6T 2JZ2A 1IHWA 1SG5A 3EH2A 5GAN7 3L2ZA 3SHWA 5KYYB 3CCMQ 2FHDA 1WFWA 4ZGDB 2HSEB 1YJNQ 1WI7A 2X4JA 1RAGB 3CBPA 2RQWA 3UF4A 4OMFB 1SHFA 4F14A 5GAMj 1QCNA 3X24B 5D6WA 2AKLA 1K8AC 2L8DA 1G5VA 3LH5A 4RCCA 4PJOF 3ER0A 4QQDA 3CXCP 1VQ5A 3C94A 2K9GA 4N0AC 4JJNK 1OX8A 3GLXA 5I2MA 4C8QB 1VQOQ 1AOJA 1ZBJA 2E41A 5IH2A 2CP2A 1ZSZB 4J9EA 3I56A 1WXBA 3VUZA 5KYXA 2HQEA 3PVQA 1RAAB 2R5AA 3D7SB 1MUZA 4A53A 1C1AA 2MIOA 3CCJT 1YIJT 2DL4A 2OJ2A 3L2UA 3A8HB 3VRZA 5LJ3j 2KAFA 1K0XA 5GMKh 3CCQA 4FT2A 3G71Q 4FT4A 4ORZA 2VV5A 2KI7A 2ZPFB 3KFVA 1M90R 2FB7A 4OGCA 1M1KU 2OTLA 2XU8A 1Z9ZA 3A8MB 3OYMA 1TUCA 1JRIA 3TSWA 3OW2P 3M0QA 2VYTA 4OB0B 4JRQA 2I0NA 4LDWA 2V26A 1BB9A 5KYUB 3CC4T 4C8QC 2KXDA 1VA7A 1NEGA 4J9BA 4ESRA 1VQ5Q 3BE3A 2PUOB 1YCYA 2KRMA 5KYNA 5AYFA 3QYGB 3OS1A 1KC8U 2HL5C 3EG0A 1ZSGA 2NYSA 2KRSA 1BCOA 1C0MA 1I4K1 2EGAA 3OYIA 4XTZA 5GMKi 3TQ7P 4DBHA 2DO3A 2OTLQ 4KBMB 1VQ7T 3JCMX 3CCRA 2P4TA 1ZA2B 2GFAA 3CC2A 3RUXA 2RHUA 4E47A 3TVTA 1U3OA 2DA9A 2QQRA 5CO7A 1M27C 1WYXA 1C6VX 2O01E 1E7OA 5GJVB 1P92A 1QVGP 2RQVA 4XU2A 4F7UB 3VYHB 2K79A 1RUWA 4ATOA 3FJPA 3JCMh 2NUTA 3DKMA 1J3TA 2CZ0B 3KXTA 3L2QA 2AZVA 4RTTA 2JS0A 2MAMA 4DEXA 1N9SA 3EFOB 3OYYA 1QLYA 2QDYB 2CYZB 5GAOp 5GAMh 4C92E 3ME9A 1QVFS 3L2RA 5FU6B 1M1FA 3OYLA 4PJLA 2OTLT 2GCXA 2Y90A 1M5Q1 1OPLA 2EGEA 4BE1A 2RJFA 4JRKA 2MPXC 1GFCA 4R0KA 3T9NA 2E10A 1S1NA 1GCPA 2QI2A 4J9HA 2Y4YA 4OMMA 2B86A 3UATA 3V7SA 1YJ9Q 2WSCE 3JB9J 1YJNT 2KQWA 1JJ2A 1V76A 4HVUA 2DL5A 3HPWA 5IHIA 3CCJQ 4JUVA 2PTKA 3CCRT 1RI9A 1WJRA 4TVRA 1UE9A 3CBOA 4XTVA 2QK0A 1VQLQ 5FU7B 3KBGA 3QKJA 2HZYA 3NTKA 1U1SA 1BK2A 5C6SA 1D3BB 1KQSP 2NUPB 4DOVA 4FCYA 4MMLA 1T3LA 3EGUA 4M78A 2E3HA 2RHIA 2BE9B 1NZ9A 4WF2A 3G71T 1KFZA 2PU9B 5J3BA 2CGHA 1YJ9A 1UJ0A 2ED1A 1G83A 3OSSC 2AT1B 1VYTA 5HCKA 3UA7A 3CMEQ 2RQRA 3G1JA 2FRYA 3M54A 1OQKA 3O5ZA 2YRDA 4C5EA 1OPKA 1VYVA 1VQ4T 1TXQA 5L8RE 4AFUC 1UB4A 4RG2A 3AHUA 1K9AA 1EZZB 2NWMA 1F1BB 1Y96A 3I9QA 1ZSZA 4YTLA 1X2QA 4ZN3A 4BDZA 1AEYA 2RN8A 4A4HA 4QW2A 2BZYA 4NL2A 2Z0WA 3QWXX 2MYSA 2L0AA 3CCJA 4A63B 2ECZA 2GTOA 4Z02A 2GQIA 3JCMb 4M77B 1X69A 5A2QE 1K73R 4Z8AA 2EQKA 5CCAA 2JVVA 1GL5A 2D9TA 3URGA 1K8AR 4PFOA 1K0SA 1MHNA 1WHGA 3L2WA 2FZKB 3HL8A 2H3JA 3OS2A 3X26B 2ZAEA 3PGGA 1BU1A 2VUBA 2LRQA 2BE7D 4A4FA 3M0SA 3OMCA 2IVWA 2JW4A 4IKFA 1HYOA 1FWZA 2VB6A 3PMTA 3VRYA 3QPHA 5FLXE 3U23A 3OS5A 5IN1A 3OQ5A 4JPBW 4OF1A 3QJ6A 1JU5C 1RLQC 3CXCS 1W2BA 4PJOE 5DM7R 1BI0A 3PIPA 2LQWA 1X01A 1KQ1A 1N5ZA 1WX6A 4J9DA 1YHQA 7AT1B 2M0OA 2DXCA 4JLGA 2DIQA 3LWIA 2CP0A 1VQ6A 1JB0E 2QG9B 3VS1A 1GFDA 1O75A 5FW9A 1ABQA 4J7FA 1YWPA 4LN2A 3PT9A 3J81E 2KDSA 2V1RA 3CCVQ 3M58A 3EAEA 1NYGA 4CC2A 2EIFA 2X51A 3MKDA 4E7ZA 1M1KC 4RG8A 2YRCA 2MWPA 3M57A 5CQXA 1X43A 3FDRA 2RNAA 2DE0X 4CI0C 3VU3C 4BI3A 1OEBA 2FVUA 3G6EQ 3M0RA 1NJIR 1D0ZA 2V8JA 2V1QA 4N0AA 1K9MU 3G6EA 4IUQA 1GRIA 4F7UE 4M4ZA 5GAMd 3NPFA 4XK8E 1DJ7B 4OVAA 4BDYA 1GBQA 3CMAQ 3LLRA 3HRTA 1KC8C 2PNIA 1SKUB 3TREA 3OYDA 1KD1R 3CCUT 1E6GA 4EMKA 1FMVA 5HY6A 2R58A 3RKXA 1VQPA 5GAN5 1VQ4A 1RAHB 3CCLT 5D6YA 1PHTA 4HVWA 2L2PA 4MZPA 2E4HA 4M7AC 3I5RA 4GLKA 3O8VA 2DTOA 5KCHA 4DQ2A 2QQSA 3H9NA 4KUDK 1N8RR 5A0DA 4ANJA 2CT4A 5HK3A 2QQBA 3HHTB 1JEGA 2JMCA 4AFSC 2EYZA 2LQNA 3DLLA 4HVVA 3VV0A 2DD5A 2JTFA 1MMAA 3MEWA 3H0IA 4M7DF 2QGFB 4F16A 3CC2T 2RH2A 2PQWA 1JO8A 4J6YA 4L6V5 1ARKA 2EQJA 1VQ9T 1V1CA 2CH4W 3QHSA 2BZXA 3CCQQ 3CCEA 3RIRA 2F2VA 1XOVA 4RMOA 4AT1B 3N5BB 1UECA 3EHRA 1M2VB 3GBQA 3RNJA 1IB8A 3CPFA 2QXFA 3VYGA 2DMOA 3LX7A 4RTZA 1Q7YU 1YHQQ 4C5HA 2WACA 3VS3A 4UC4A 2NUPA 5LJ5f 3OYHA 1K4US 2CT3A 1ZHIA 2DL8A 1R77A 2D0QB 1X27A 2AK5A 2G6FX 1VQNA 5CKEA 2VC8A 4E7IA 2QQAA 2HCKA 2DD4A 3V8LA 1NPPA 1YNZA 2KT1A 3VS5A 4RCBA 4C0DB 3M4GA 2MWOA 1FX7A 2DXTA 2B8AA 3EG2A 3MJXA 2EQUA 4HCZA 1Q7YC 4HCBA 4WCIA 4J6WA 1Y96B 2XG8D 3HRUA 1QMCA 1YI2T 1YITA 4R56A 3X28B 4BY6B 3LH0A 3S3MA 2YLBA 3THKA 1KC8R 2EQIA 4KULA 4C92D 1B34B 2FYKA 1W70A 2X3WD 2YLCA 2YXYA 1Q86R 4VUBA 1NJIC 3DB4A 2E70A 1M4ZA 1QVPA 4M78B 5GANf 2SRCA 3OB9A 3TSZA 1IZ6A 3ZBDA 5J26A 2M02A 1I1JA 2E3IA 5GAN3 1IREB 3VS0A 1ZSZC 3CC4A 2CP6A 1JJ2S 3MEVA 1MV0B 1BI1A 5GAN2 4HCKA 2CUDA 1VIFA 3OYFA 3SWNB 1Y7XA 4FSXA 1CKBA 2XDDA 1R0BG 2HKQB 4CC7A 1YJWQ 2AIRB 3V7RA 3CD6T 3M0UA 2RI2A 2QEXQ 2E6NA 4M75D 2LMJA 4PFPA 5L23A 4M78C 3META 1S72Q 2DTHA 3CCEQ 1NM7A 3UA6A 5CVIA 5LJ3e 2RO0A 1PD1A 1YIJA 3MEAA 2MCNA 1H3HA 2FZCB 5HK0A 4FM4B 1JBMA 3I35A 4MDWA 1AWJA 3EG3A 1LVKA 3PVLA 2CS7A 2OI3A 2QA4A 1K1ZA 1QCFA 1M2OA 3I56T 4XAXB 3NGPA 5J39A 3RESA 3CC2Q 2LT4A 1KD1C 5CK9A 4J5YA 2DLPA 2FPFA 1M8VA 1RLPC 3M59A 1NBEB 1BI3A 3QO3A 1RL2A 1W1FA 3G4SQ 5GAN8 4RUGA 2DAQA 4FYVB 1S72A 1VQMQ 1M9SA 2DERA 3PTAA 1UUEA 1WGSA 3ULRB 2KROA 1PSFA 2C0IA 4EIKA 1Q82R 1WDXA 1WHMA 1JJ2P 1YJWA 4FL6A 2JN0A 1QWFA 3OYNA 3P8HA 1I81A 1VQ8A 2QASA 1G2BA 4LE9A 5M9OA 2D8HA 2HNIA 2QTXA 2DM1A 3GF5A 4QQ6A 2KXCA 4JRPA 5GMKj 4GLMA 2NUZA 1YP5A 2LJ1A 1ZA1B 2L3SA 3CMAA 1OULA 2DVEA 1UGPB 4MMKA 4IIOA 3CCLA 3CCSQ 4C0GA 2DZ9A 5CQYA 4PJOG 4ZGEB 1Y71A 4QVCA 2C0OA 1U1TA 2EJ9A 4M75F 3RDVA 3FB9A 2KMTA 1VQKA 3OYGA 1GXIE 4PJJA 4OGEA 4M7AF 2EGCA 1B34A 4E7JA 2V8IA 2A28A 2ED0A 1D0XA 2E5QA 1M3BA 4JJDA 1A0NB 1SF9A 1K73U 1ZBXA 2EYQA 2JS2A 4FW2A 2AZSA 2HBPA 3NMZC 4M75E 1U8RA 4RKUE
chains in the Genus database with same CATH topology
3BE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BE3 A; 
#chains in the Genus database with same CATH topology
 2ZZD A;  3CCS A;  2RJD A;  2E1H A;  1KQ2 A;  2X4W A;  4J7I A;  4DA4 A;  1BBZ A;  1VQK T;  1K76 A;  2KEA A;  4L59 A;  5GMK e;  4BI4 A;  1VUB A;  1QKW A;  3NHN A;  4HKE A;  3FJ5 A;  3OY9 A;  1AWW A;  4DBQ A;  3JCM V;  2LDM A;  2RK1 A;  4FYX B;  2VAS A;  1H92 A;  2LZ6 B;  5GAO l;  1SHG A;  1ZX6 A;  4QVD A;  1Y07 A;  1OI1 A;  1RAC B;  3QZ9 B;  1ZLM A;  3HTR A;  1ZUY A;  5FRM A;  1M2V A;  2BZ8 A;  2EFI A;  3VS2 A;  2J6F A;  3M5A A;  4DEY A;  2WSE E;  2A3L A;  4DBR A;  2HQX A;  3VKI A;  3QII A;  1SSF A;  2M16 A;  4XTU A;  1VQL A;  4RTW A;  2EVR A;  2K5L A;  3JCM c;  5IXF A;  1KJW A;  2F1L A;  3M0P A;  5LJ5 h;  1UGV A;  5GAO n;  2DJQ A;  3C0C A;  3QZ5 B;  2J6O A;  1KK7 A;  1WXT A;  4MDX A;  3GP8 A;  1B7T A;  2RK2 A;  4A54 A;  3CPW A;  1QWE A;  2CSQ A;  2D6F A;  2IIM A;  1Q81 U;  4F04 B;  2OAW A;  4M77 F;  5KYW A;  2QA4 T;  4M7D D;  5D7U A;  1FXX A;  2RF0 A;  2DTI A;  4M7A D;  2RHX A;  2ROT A;  1QKX A;  4C0D C;  2CSI A;  3CQT A;  1BI2 A;  4V2S A;  1NPR A;  2E65 A;  3LYI A;  1W6X A;  4CC3 A;  1ZQ1 A;  3JRZ A;  2LVM A;  1ABO A;  1I8F A;  2M1H A;  1M1K R;  2RHZ A;  5FRN A;  1I5O B;  4L5G A;  2XD0 A;  4J9C A;  2OTJ A;  3GNG A;  5CR2 A;  3I5S A;  3RR6 A;  4ZTF A;  2OTJ Q;  3HFO A;  3QBY A;  4XU1 A;  1KIK A;  1D1C A;  2EJG A;  2VGN A;  2DIL A;  5LJ3 h;  5A0L A;  4PFZ A;  2DXU A;  2EYW A;  1VQP Q;  2FZG B;  2CZ6 B;  4OB1 B;  3OMG A;  2E5K A;  5GAN h;  3RMQ A;  4LDV A;  4JS4 A;  5KYX B;  2DXB A;  4PJM A;  1AT1 B;  2J6K A;  5C0M A;  1WPY A;  4C92 G;  1R0C B;  5CIU A;  4B9X A;  4E2F B;  2E12 A;  1SRL A;  1XJW B;  2A0F B;  2GGR A;  5IT9 E;  3A5Z B;  2HD0 A;  3RBB B;  4M77 C;  2HQH A;  3G71 A;  3CCR Q;  2RJE A;  3E9G A;  2F69 A;  4IUU A;  4MZT A;  3JB9 D;  1QCO A;  4PJO A;  2JTM A;  2WSF E;  5CAI A;  3OS0 A;  4AMC A;  5GAN d;  4QQG A;  4ELZ C;  1LNX A;  3J7A F;  1AWO A;  4M75 B;  2FG0 A;  2COZ A;  2CP7 A;  3MP8 A;  3VS7 A;  1WXU A;  4M7A B;  1WJQ A;  1PD0 A;  4C92 B;  4ZTJ A;  4F7U G;  1LOJ A;  2G3R A;  1N6A A;  4OB3 B;  1YI2 A;  1D3B A;  1YIT T;  3CBM A;  5CKB A;  2RM4 A;  1QVG A;  1NLP C;  4JRI A;  1TTH B;  4QKU A;  4FSS A;  3GIB A;  1WIE A;  3INZ A;  1B3Q A;  2ZPB B;  4BE0 A;  3A8O B;  4LNP A;  4LDX A;  2D8J A;  2DEQ A;  3I55 Q;  1VQN T;  4BAC A;  1OOT A;  1SSH A;  3LGL A;  5LJ5 j;  4M7A A;  2RB6 A;  2K2M A;  1TUG B;  2JM8 A;  1NE8 A;  1W4S A;  1G3W A;  1PSE A;  1NEB A;  1RAI B;  2XI9 A;  1RAD B;  2K3B A;  3V8K A;  3S6W A;  3QUI A;  4LDU A;  2LCC A;  4EMK C;  5GMK l;  3FC3 A;  3EGD A;  1BIA A;  2QTV A;  1XQH A;  3QSU A;  8AT1 B;  1GBR A;  2PZ1 A;  3EGX A;  4CRI A;  3JCM e;  1HK9 A;  2KE9 A;  5LJ5 g;  3SFM A;  2EJF A;  2R57 A;  4M77 E;  2EW3 A;  4XU3 A;  1M90 C;  1IXD A;  2GQV A;  2L3Q A;  2RJC A;  4Y91 A;  1I0C A;  3Q1J A;  4XU0 A;  4HCC A;  2EKO A;  3CCE T;  2KGT A;  4E7L A;  2LP5 A;  1VQ9 A;  1Z9Q A;  2QEX T;  3WVD B;  1BKB A;  5KYW B;  1RAE B;  3KUF A;  1G3Y A;  3CEY A;  1M8M A;  1HXD A;  3G7Z A;  3HSB A;  4OML A;  4C8Q E;  2VGM A;  4PJN A;  1VQ7 A;  1YI2 Q;  2JJ9 A;  5GAM f;  1U06 A;  1VOM A;  5I21 A;  1VYU A;  5KH6 A;  3OYE A;  2CRE A;  2KNB B;  3JCM g;  4GY5 A;  2YUQ A;  2LX9 A;  2YRV A;  2X4Y A;  1K73 C;  1TUD A;  1PRM C;  2MK5 A;  4N4G A;  1VQ9 Q;  5KYY A;  1Q95 G;  3EFR A;  1GCQ A;  1VQM A;  1H3Z A;  3M9Q A;  2CKK A;  3C95 A;  4AG1 C;  1Y57 A;  4D8D A;  1IGU A;  1QW1 A;  1NG2 A;  5CKH A;  1M90 U;  2DJZ A;  2K7A A;  4LXC A;  2M9U A;  1WHH A;  5KE2 A;  2DPP B;  3OYA A;  2RQT A;  3GOX A;  2HKN A;  4MZM A;  4BB7 A;  2JTE A;  4O6J A;  4J9G A;  1QVF A;  1B07 A;  2J05 A;  2RPN A;  3CCQ T;  2YDL A;  4Z89 A;  2ABL A;  2DFU A;  1YN8 A;  2CDT A;  4PKC C;  2P0P A;  4N4I A;  4ZN1 A;  1YIT Q;  3J80 E;  3EHQ A;  1FMK A;  2C0T A;  4EDU A;  1TU0 B;  3JCM P;  3VS6 A;  3QDF A;  4O5V A;  4CC4 B;  5LJ3 d;  2GF7 A;  1VQO T;  4F7U A;  4QVZ A;  3H8Z A;  4XTX A;  3SWN C;  3JB9 F;  2VWF A;  4GBQ A;  3QXE B;  3M53 A;  1VQN Q;  4IUT A;  4KH1 B;  3I55 T;  2LX7 A;  1QVF P;  2PUK B;  1AHJ B;  1MND A;  1XNI A;  4M75 G;  3SDZ A;  2LTO A;  3JB9 G;  1PNJ A;  1UHC A;  2L3P A;  1OZ2 A;  1YHQ T;  5FWC A;  2HL3 A;  4PLL A;  2K5I A;  4LDY A;  1OX9 A;  3VUB A;  1UGS B;  3FEO A;  5GAO r;  1WNL A;  5GAM g;  3OSV A;  4X9C A;  1UG1 A;  2HDA A;  2M51 A;  3P8B B;  1H64 1;  2L3R A;  3L1A A;  1GCQ C;  3FRN A;  2P4R A;  2CUB A;  4J8O A;  2D1X A;  3MO8 A;  2PVD B;  3MEU A;  3NTH A;  1MMG A;  1PRL C;  4A4K A;  2YUP A;  2F5T X;  2KSS A;  1AZE A;  4JJB A;  2YUO A;  3EGX B;  1E6H A;  4BI8 B;  5IXB A;  2RI5 A;  3L42 A;  1EIF A;  5I22 A;  5GAO q;  2CP3 A;  1PC0 A;  3G6E T;  1N8R C;  1PCX A;  2X35 A;  2O4X B;  2OTJ T;  2CZ1 B;  2JM9 A;  4KUI A;  3ZL7 C;  3CCV A;  4KRT A;  1K9M R;  4HT9 A;  2KVQ G;  5EC7 A;  2AKK A;  1R8O B;  3IQL A;  2ZGW A;  1UHF A;  3CCV T;  3JCM W;  2YT6 A;  1QP2 A;  3HP9 A;  4DOW A;  1PKT A;  3CME A;  1HD3 A;  3H41 A;  3F70 A;  2P0K A;  5GJW B;  2AHJ B;  3QDR B;  2VKN A;  2E6Z A;  4IUV A;  5GAN 4;  1BCM A;  2RI3 A;  3RKY A;  1JQQ A;  3CCU Q;  2OX7 A;  2ZPG B;  3A8G B;  4Y28 E;  1IGQ A;  4J9F A;  4OMP A;  4J6X A;  4EMG A;  1N8R U;  1X2K A;  2RHY A;  2GNC A;  2LNV A;  4OB2 B;  1SEM A;  2DL3 A;  2QDL A;  4D8K A;  1O9S A;  1TSF A;  2KRN A;  3EG9 A;  1VIE A;  2QA4 Q;  3HFN A;  5A0G A;  2IPO B;  2KR3 A;  3R6O A;  2LQK A;  4ME7 A;  2EPD A;  1UEB A;  1YBY A;  4RTX A;  2VXF A;  2BTT A;  4Z88 A;  1UGR B;  3M0T A;  3VS4 A;  2A7Y A;  4PJO B;  4R55 A;  1RAF B;  4AG2 C;  4HXJ A;  2DEU A;  5LJ5 d;  3FIF A;  1CKA A;  4PNO A;  4HT8 A;  2JOY A;  3WXM B;  1KHI A;  4AFQ C;  2JXB A;  4FIB A;  1RI0 A;  2MF2 A;  1I07 A;  1LJO A;  3DLM A;  3OYJ A;  1OU8 A;  2DYB A;  3MP1 A;  1WQW A;  2KK4 A;  1Q7Y R;  1Q81 R;  2DYI A;  1M30 A;  4C92 F;  1YJN A;  3EG1 A;  2KBT A;  4M77 A;  4XTY A;  1W2B S;  2O9V A;  4M75 C;  2C06 A;  6AT1 B;  2H8H A;  3L2V A;  1I5L A;  4F17 A;  3E19 A;  2DZC A;  4E7S A;  1TWB A;  2QGG A;  4JZ3 A;  4FYY B;  5D6X A;  1MMD A;  4X1V A;  3G4S T;  4ELY C;  3QWY A;  3SD4 A;  3QYH B;  1VQL T;  2DF6 A;  4C0F A;  1Q82 C;  4Q5W A;  4K11 A;  4C8Q A;  4NL3 A;  3MPU B;  4PK4 A;  4WTO B;  1VQK Q;  2KT8 A;  3ZFJ A;  2IG0 A;  2RD1 A;  4FYW B;  3EGD B;  3HRS A;  1H8K A;  5ECA A;  2L5Q A;  2FPE A;  3GPL A;  1YJ9 T;  1TH7 A;  1X6G A;  4P5N A;  1X6B A;  1FYN A;  2XK0 A;  2M0Y A;  1X75 C;  2K2V A;  1D1A A;  2DBM A;  4RTV A;  4HA8 A;  3I55 A;  1FMW A;  3CC7 A;  4X9D A;  2LT1 A;  3E2U A;  2ENM A;  1BIB A;  2LNH B;  2DVJ A;  5KYU A;  1YJW T;  2X3X D;  4KT0 E;  5DLQ E;  3ASK A;  1VQO A;  3PIO A;  4FU6 A;  2BKD N;  1IRX A;  3CCS T;  1WHL A;  1WLP B;  4PLI A;  3C4S A;  2F2W A;  2OAU A;  2XKO C;  3OYB A;  1AZG B;  4BE2 A;  2YHT A;  2D0N A;  2MI6 A;  5KCO A;  3H0F A;  3VJP A;  3OBY A;  1WQ7 A;  2QYZ A;  2O9S A;  4LD9 K;  1N9R A;  1HJD A;  2FL7 A;  4JDS A;  4XQ3 A;  3M55 A;  3HKS A;  2LCL A;  2LJ3 A;  3V8J A;  2XIC A;  4BD3 A;  2A37 A;  1X6O A;  2Y4X A;  3QG1 A;  2P0Q A;  2PVG B;  3FLG A;  1UTI A;  2DRM A;  4M7D E;  1AWX A;  1M3C A;  2DRK A;  1KSW A;  4JJC A;  4JS5 A;  3MP6 A;  2CH4 A;  2O4X A;  1VQM T;  3CD6 Q;  4C5G A;  4EMK B;  2VXE A;  2LCS A;  3M4Y A;  5IHN A;  2X4X A;  4DBF A;  5GAO m;  1KG1 A;  4XTW A;  4D6W A;  1Q86 C;  4A4G A;  4C8Q D;  4A4E A;  5DY9 A;  3V7C A;  5DLO A;  3I56 Q;  2DET A;  4J9I A;  1RAB B;  2J06 A;  5FRO A;  3JAM E;  2EBP A;  5I11 A;  1D0Y A;  5EG2 A;  4E7K A;  3NTI A;  1UJY A;  1EX4 A;  3CXC A;  4M78 E;  1LCK A;  2HAX A;  1VQ7 Q;  3H0H A;  3EFS A;  1YCS B;  2L89 A;  4M75 A;  1V29 B;  3OBW A;  4M7D G;  1S72 T;  4OMN A;  2QEX A;  3TEE A;  8ATC B;  3JCM Q;  3H6Z A;  3C12 A;  1M3A A;  4LD6 A;  1Q81 C;  4FW1 A;  1QQJ A;  3A98 A;  2MOX A;  3JCM d;  1D1B A;  5GMK m;  1OZ3 A;  5GAN 6;  3NFC A;  4OMQ A;  3A8L B;  1KQS A;  1N27 A;  1G8X A;  3PE0 A;  1SRM A;  1TG0 A;  1VQ5 T;  4KGX B;  1PM3 A;  2ZPI B;  3S3N A;  5CKD A;  3EG9 B;  2DBK A;  2F5K A;  3TCJ A;  5AT1 B;  3CC4 Q;  2XMF A;  4M7D C;  4M78 G;  2YUN A;  1CSK A;  3OYK A;  4KH0 B;  3UDC A;  1BYM A;  2HMA A;  1LPL A;  5IAY A;  5FU7 C;  1KHC A;  4IUR A;  4M7D B;  3TU4 K;  3BY7 A;  4M7A G;  1ACM B;  1PKS A;  1OYX A;  4E7H A;  3REA B;  1T3S A;  3BW1 A;  2EAY A;  2K6D A;  3RMS A;  1WHK A;  2GFU A;  1D09 B;  3CPW S;  2XDB A;  2JNG A;  2EWN A;  2CZ7 B;  2VVK A;  2ZPH B;  3RER A;  5HKC A;  1WZO A;  3OA6 A;  1G3T A;  4C92 C;  3BDL A;  1AVZ C;  1Y0M A;  1JXO A;  1UDL A;  3BFM A;  3SWN A;  2KY9 A;  4M77 G;  5FU6 C;  3CCM T;  4M7A E;  3LW5 E;  2K57 A;  2MMP A;  1SPK A;  2K3X A;  4E6R A;  4ZGJ B;  2K5F A;  3JV3 A;  2XDP A;  2K4Y A;  2DNU A;  1Q86 U;  2H3E B;  1U5S A;  4LUE A;  1MV3 A;  4PJO D;  2DKG A;  4NOY A;  4KGV B;  3M56 A;  3LWH A;  2FPD A;  2DK3 A;  2HSP A;  2F2X A;  2A36 A;  3JB9 H;  1WA7 A;  3MHX A;  1HSQ A;  1IHV A;  2YWW A;  3GNF B;  1NYF A;  2COY A;  1XTD A;  2FRW A;  5LJ3 g;  4KGZ B;  4M77 D;  2GBQ A;  1OU9 A;  1MGQ A;  1YIJ Q;  2JUF A;  5IHK A;  1TS9 A;  2BUD A;  1VQ6 Q;  2EKH A;  2ROL A;  2A08 A;  2W0Z A;  2DL7 A;  1MNE A;  2J7I A;  4J83 A;  1EFN A;  4EMH A;  2W10 A;  4B9W A;  3JSC A;  5KE3 A;  5CKF A;  4C5I A;  1JXM A;  3SB2 A;  2LQ8 A;  3EFO A;  4JLI A;  5FWB A;  3QJY A;  2QQ9 A;  4LUD A;  1ZUU A;  1NLO C;  1VQP T;  2V8K A;  3WVE B;  3CCL Q;  4N4H A;  2R5M A;  2HBW A;  3JCM J;  1PG5 B;  3A1P A;  2JT4 A;  2RQU A;  1KQS S;  3JCM f;  3S3O A;  1TOV A;  2O31 A;  3G4S A;  1YWO A;  3OW2 A;  2NUT B;  1G3S A;  3X25 B;  4IUP A;  4AFZ C;  2DIG A;  3P8D A;  1OV3 A;  4QT7 A;  2ATC B;  1WJS A;  5LJ3 f;  3OW2 S;  2K3Y A;  1PWT A;  3R6N A;  2PVO B;  2DX1 A;  1UFF A;  1K8A U;  1T0J A;  4OP0 A;  3EH1 A;  4ZNX A;  1QVG S;  4II1 A;  1MMN A;  4JZ4 A;  4B6M A;  2EQM A;  3ZEH A;  3UWN A;  3OYC A;  5GAN j;  4C92 A;  3CC7 T;  3MCA B;  2O88 A;  4C8Q F;  4RTU A;  2LJ0 A;  3LGF A;  3JB9 I;  1K9M C;  2FEI A;  9ATC B;  2BIV A;  4M78 F;  3UPU A;  2ZPE B;  4C0Z A;  3CMA T;  2YSQ A;  3AT1 B;  1Q82 U;  2P84 A;  3PFS A;  2CP5 A;  2RMO A;  3RKW A;  5GAN g;  4BY6 C;  3CPW P;  4X34 A;  2FO0 A;  1VQ8 T;  2NLU A;  1WHJ A;  2I2L A;  2X9H A;  4M78 D;  3CCU A;  1ZUK A;  2ZCF B;  4NS5 A;  2GTJ A;  4M7D A;  1YFN A;  1IO6 A;  2ESW A;  3DB3 A;  1W2B P;  4F7U F;  1VQ4 Q;  2COW A;  2XID A;  3BDU A;  5GAM e;  3PNW C;  4RTY A;  1M1G A;  3CME T;  5GAN e;  5LJ5 e;  2KYM A;  1T0H A;  1VQ8 Q;  1NJI U;  3PMI A;  4PJO C;  2E64 A;  1UGQ B;  1QP3 A;  3CCM A;  4BUG A;  4OMO A;  2O2O A;  2HEQ A;  3X20 B;  3UT1 A;  4Y92 A;  4EPC A;  4PL6 A;  2RA2 A;  2EYY A;  2QAZ A;  2SEM A;  2KYB A;  3E1S A;  2EYX A;  2XHC A;  1KD1 U;  3SEM A;  2LC4 A;  4C8Q G;  3REB B;  2JMA A;  5I2S A;  5LL6 S;  3E9F A;  3CD6 A;  1AD5 A;  3CC7 Q;  4IIM A;  1VQ6 T;  2JZ2 A;  1IHW A;  1SG5 A;  3EH2 A;  5GAN 7;  3L2Z A;  3SHW A;  5KYY B;  3CCM Q;  2FHD A;  1WFW A;  4ZGD B;  2HSE B;  1YJN Q;  1WI7 A;  2X4J A;  1RAG B;  3CBP A;  2RQW A;  3UF4 A;  4OMF B;  1SHF A;  4F14 A;  5GAM j;  1QCN A;  3X24 B;  5D6W A;  2AKL A;  1K8A C;  2L8D A;  1G5V A;  3LH5 A;  4RCC A;  4PJO F;  3ER0 A;  4QQD A;  3CXC P;  1VQ5 A;  3C94 A;  2K9G A;  4N0A C;  4JJN K;  1OX8 A;  3GLX A;  5I2M A;  4C8Q B;  1VQO Q;  1AOJ A;  1ZBJ A;  2E41 A;  5IH2 A;  2CP2 A;  1ZSZ B;  4J9E A;  3I56 A;  1WXB A;  3VUZ A;  5KYX A;  2HQE A;  3PVQ A;  1RAA B;  2R5A A;  3D7S B;  1MUZ A;  4A53 A;  1C1A A;  2MIO A;  3CCJ T;  1YIJ T;  2DL4 A;  2OJ2 A;  3L2U A;  3A8H B;  3VRZ A;  5LJ3 j;  2KAF A;  1K0X A;  5GMK h;  3CCQ A;  4FT2 A;  3G71 Q;  4FT4 A;  4ORZ A;  2VV5 A;  2KI7 A;  2ZPF B;  3KFV A;  1M90 R;  2FB7 A;  4OGC A;  1M1K U;  2OTL A;  2XU8 A;  1Z9Z A;  3A8M B;  3OYM A;  1TUC A;  1JRI A;  3TSW A;  3OW2 P;  3M0Q A;  2VYT A;  4OB0 B;  4JRQ A;  2I0N A;  4LDW A;  2V26 A;  1BB9 A;  5KYU B;  3CC4 T;  4C8Q C;  2KXD A;  1VA7 A;  1NEG A;  4J9B A;  4ESR A;  1VQ5 Q;  3BE3 A;  2PUO B;  1YCY A;  2KRM A;  5KYN A;  5AYF A;  3QYG B;  3OS1 A;  1KC8 U;  2HL5 C;  3EG0 A;  1ZSG A;  2NYS A;  2KRS A;  1BCO A;  1C0M A;  1I4K 1;  2EGA A;  3OYI A;  4XTZ A;  5GMK i;  3TQ7 P;  4DBH A;  2DO3 A;  2OTL Q;  4KBM B;  1VQ7 T;  3JCM X;  3CCR A;  2P4T A;  1ZA2 B;  2GFA A;  3CC2 A;  3RUX A;  2RHU A;  4E47 A;  3TVT A;  1U3O A;  2DA9 A;  2QQR A;  5CO7 A;  1M27 C;  1WYX A;  1C6V X;  2O01 E;  1E7O A;  5GJV B;  1P92 A;  1QVG P;  2RQV A;  4XU2 A;  4F7U B;  3VYH B;  2K79 A;  1RUW A;  4ATO A;  3FJP A;  3JCM h;  2NUT A;  3DKM A;  1J3T A;  2CZ0 B;  3KXT A;  3L2Q A;  2AZV A;  4RTT A;  2JS0 A;  2MAM A;  4DEX A;  1N9S A;  3EFO B;  3OYY A;  1QLY A;  2QDY B;  2CYZ B;  5GAO p;  5GAM h;  4C92 E;  3ME9 A;  1QVF S;  3L2R A;  5FU6 B;  1M1F A;  3OYL A;  4PJL A;  2OTL T;  2GCX A;  2Y90 A;  1M5Q 1;  1OPL A;  2EGE A;  4BE1 A;  2RJF A;  4JRK A;  2MPX C;  1GFC A;  4R0K A;  3T9N A;  2E10 A;  1S1N A;  1GCP A;  2QI2 A;  4J9H A;  2Y4Y A;  4OMM A;  2B86 A;  3UAT A;  3V7S A;  1YJ9 Q;  2WSC E;  3JB9 J;  1YJN T;  2KQW A;  1JJ2 A;  1V76 A;  4HVU A;  2DL5 A;  3HPW A;  5IHI A;  3CCJ Q;  4JUV A;  2PTK A;  3CCR T;  1RI9 A;  1WJR A;  4TVR A;  1UE9 A;  3CBO A;  4XTV A;  2QK0 A;  1VQL Q;  5FU7 B;  3KBG A;  3QKJ A;  2HZY A;  3NTK A;  1U1S A;  1BK2 A;  5C6S A;  1D3B B;  1KQS P;  2NUP B;  4DOV A;  4FCY A;  4MML A;  1T3L A;  3EGU A;  4M78 A;  2E3H A;  2RHI A;  2BE9 B;  1NZ9 A;  4WF2 A;  3G71 T;  1KFZ A;  2PU9 B;  5J3B A;  2CGH A;  1YJ9 A;  1UJ0 A;  2ED1 A;  1G83 A;  3OSS C;  2AT1 B;  1VYT A;  5HCK A;  3UA7 A;  3CME Q;  2RQR A;  3G1J A;  2FRY A;  3M54 A;  1OQK A;  3O5Z A;  2YRD A;  4C5E A;  1OPK A;  1VYV A;  1VQ4 T;  1TXQ A;  5L8R E;  4AFU C;  1UB4 A;  4RG2 A;  3AHU A;  1K9A A;  1EZZ B;  2NWM A;  1F1B B;  1Y96 A;  3I9Q A;  1ZSZ A;  4YTL A;  1X2Q A;  4ZN3 A;  4BDZ A;  1AEY A;  2RN8 A;  4A4H A;  4QW2 A;  2BZY A;  4NL2 A;  2Z0W A;  3QWX X;  2MYS A;  2L0A A;  3CCJ A;  4A63 B;  2ECZ A;  2GTO A;  4Z02 A;  2GQI A;  3JCM b;  4M77 B;  1X69 A;  5A2Q E;  1K73 R;  4Z8A A;  2EQK A;  5CCA A;  2JVV A;  1GL5 A;  2D9T A;  3URG A;  1K8A R;  4PFO A;  1K0S A;  1MHN A;  1WHG A;  3L2W A;  2FZK B;  3HL8 A;  2H3J A;  3OS2 A;  3X26 B;  2ZAE A;  3PGG A;  1BU1 A;  2VUB A;  2LRQ A;  2BE7 D;  4A4F A;  3M0S A;  3OMC A;  2IVW A;  2JW4 A;  4IKF A;  1HYO A;  1FWZ A;  2VB6 A;  3PMT A;  3VRY A;  3QPH A;  5FLX E;  3U23 A;  3OS5 A;  5IN1 A;  3OQ5 A;  4JPB W;  4OF1 A;  3QJ6 A;  1JU5 C;  1RLQ C;  3CXC S;  1W2B A;  4PJO E;  5DM7 R;  1BI0 A;  3PIP A;  2LQW A;  1X01 A;  1KQ1 A;  1N5Z A;  1WX6 A;  4J9D A;  1YHQ A;  7AT1 B;  2M0O A;  2DXC A;  4JLG A;  2DIQ A;  3LWI A;  2CP0 A;  1VQ6 A;  1JB0 E;  2QG9 B;  3VS1 A;  1GFD A;  1O75 A;  5FW9 A;  1ABQ A;  4J7F A;  1YWP A;  4LN2 A;  3PT9 A;  3J81 E;  2KDS A;  2V1R A;  3CCV Q;  3M58 A;  3EAE A;  1NYG A;  4CC2 A;  2EIF A;  2X51 A;  3MKD A;  4E7Z A;  1M1K C;  4RG8 A;  2YRC A;  2MWP A;  3M57 A;  5CQX A;  1X43 A;  3FDR A;  2RNA A;  2DE0 X;  4CI0 C;  3VU3 C;  4BI3 A;  1OEB A;  2FVU A;  3G6E Q;  3M0R A;  1NJI R;  1D0Z A;  2V8J A;  2V1Q A;  4N0A A;  1K9M U;  3G6E A;  4IUQ A;  1GRI A;  4F7U E;  4M4Z A;  5GAM d;  3NPF A;  4XK8 E;  1DJ7 B;  4OVA A;  4BDY A;  1GBQ A;  3CMA Q;  3LLR A;  3HRT A;  1KC8 C;  2PNI A;  1SKU B;  3TRE A;  3OYD A;  1KD1 R;  3CCU T;  1E6G A;  4EMK A;  1FMV A;  5HY6 A;  2R58 A;  3RKX A;  1VQP A;  5GAN 5;  1VQ4 A;  1RAH B;  3CCL T;  5D6Y A;  1PHT A;  4HVW A;  2L2P A;  4MZP A;  2E4H A;  4M7A C;  3I5R A;  4GLK A;  3O8V A;  2DTO A;  5KCH A;  4DQ2 A;  2QQS A;  3H9N A;  4KUD K;  1N8R R;  5A0D A;  4ANJ A;  2CT4 A;  5HK3 A;  2QQB A;  3HHT B;  1JEG A;  2JMC A;  4AFS C;  2EYZ A;  2LQN A;  3DLL A;  4HVV A;  3VV0 A;  2DD5 A;  2JTF A;  1MMA A;  3MEW A;  3H0I A;  4M7D F;  2QGF B;  4F16 A;  3CC2 T;  2RH2 A;  2PQW A;  1JO8 A;  4J6Y A;  4L6V 5;  1ARK A;  2EQJ A;  1VQ9 T;  1V1C A;  2CH4 W;  3QHS A;  2BZX A;  3CCQ Q;  3CCE A;  3RIR A;  2F2V A;  1XOV A;  4RMO A;  4AT1 B;  3N5B B;  1UEC A;  3EHR A;  1M2V B;  3GBQ A;  3RNJ A;  1IB8 A;  3CPF A;  2QXF A;  3VYG A;  2DMO A;  3LX7 A;  4RTZ A;  1Q7Y U;  1YHQ Q;  4C5H A;  2WAC A;  3VS3 A;  4UC4 A;  2NUP A;  5LJ5 f;  3OYH A;  1K4U S;  2CT3 A;  1ZHI A;  2DL8 A;  1R77 A;  2D0Q B;  1X27 A;  2AK5 A;  2G6F X;  1VQN A;  5CKE A;  2VC8 A;  4E7I A;  2QQA A;  2HCK A;  2DD4 A;  3V8L A;  1NPP A;  1YNZ A;  2KT1 A;  3VS5 A;  4RCB A;  4C0D B;  3M4G A;  2MWO A;  1FX7 A;  2DXT A;  2B8A A;  3EG2 A;  3MJX A;  2EQU A;  4HCZ A;  1Q7Y C;  4HCB A;  4WCI A;  4J6W A;  1Y96 B;  2XG8 D;  3HRU A;  1QMC A;  1YI2 T;  1YIT A;  4R56 A;  3X28 B;  4BY6 B;  3LH0 A;  3S3M A;  2YLB A;  3THK A;  1KC8 R;  2EQI A;  4KUL A;  4C92 D;  1B34 B;  2FYK A;  1W70 A;  2X3W D;  2YLC A;  2YXY A;  1Q86 R;  4VUB A;  1NJI C;  3DB4 A;  2E70 A;  1M4Z A;  1QVP A;  4M78 B;  5GAN f;  2SRC A;  3OB9 A;  3TSZ A;  1IZ6 A;  3ZBD A;  5J26 A;  2M02 A;  1I1J A;  2E3I A;  5GAN 3;  1IRE B;  3VS0 A;  1ZSZ C;  3CC4 A;  2CP6 A;  1JJ2 S;  3MEV A;  1MV0 B;  1BI1 A;  5GAN 2;  4HCK A;  2CUD A;  1VIF A;  3OYF A;  3SWN B;  1Y7X A;  4FSX A;  1CKB A;  2XDD A;  1R0B G;  2HKQ B;  4CC7 A;  1YJW Q;  2AIR B;  3V7R A;  3CD6 T;  3M0U A;  2RI2 A;  2QEX Q;  2E6N A;  4M75 D;  2LMJ A;  4PFP A;  5L23 A;  4M78 C;  3MET A;  1S72 Q;  2DTH A;  3CCE Q;  1NM7 A;  3UA6 A;  5CVI A;  5LJ3 e;  2RO0 A;  1PD1 A;  1YIJ A;  3MEA A;  2MCN A;  1H3H A;  2FZC B;  5HK0 A;  4FM4 B;  1JBM A;  3I35 A;  4MDW A;  1AWJ A;  3EG3 A;  1LVK A;  3PVL A;  2CS7 A;  2OI3 A;  2QA4 A;  1K1Z A;  1QCF A;  1M2O A;  3I56 T;  4XAX B;  3NGP A;  5J39 A;  3RES A;  3CC2 Q;  2LT4 A;  1KD1 C;  5CK9 A;  4J5Y A;  2DLP A;  2FPF A;  1M8V A;  1RLP C;  3M59 A;  1NBE B;  1BI3 A;  3QO3 A;  1RL2 A;  1W1F A;  3G4S Q;  5GAN 8;  4RUG A;  2DAQ A;  4FYV B;  1S72 A;  1VQM Q;  1M9S A;  2DER A;  3PTA A;  1UUE A;  1WGS A;  3ULR B;  2KRO A;  1PSF A;  2C0I A;  4EIK A;  1Q82 R;  1WDX A;  1WHM A;  1JJ2 P;  1YJW A;  4FL6 A;  2JN0 A;  1QWF A;  3OYN A;  3P8H A;  1I81 A;  1VQ8 A;  2QAS A;  1G2B A;  4LE9 A;  5M9O A;  2D8H A;  2HNI A;  2QTX A;  2DM1 A;  3GF5 A;  4QQ6 A;  2KXC A;  4JRP A;  5GMK j;  4GLM A;  2NUZ A;  1YP5 A;  2LJ1 A;  1ZA1 B;  2L3S A;  3CMA A;  1OUL A;  2DVE A;  1UGP B;  4MMK A;  4IIO A;  3CCL A;  3CCS Q;  4C0G A;  2DZ9 A;  5CQY A;  4PJO G;  4ZGE B;  1Y71 A;  4QVC A;  2C0O A;  1U1T A;  2EJ9 A;  4M75 F;  3RDV A;  3FB9 A;  2KMT A;  1VQK A;  3OYG A;  1GXI E;  4PJJ A;  4OGE A;  4M7A F;  2EGC A;  1B34 A;  4E7J A;  2V8I A;  2A28 A;  2ED0 A;  1D0X A;  2E5Q A;  1M3B A;  4JJD A;  1A0N B;  1SF9 A;  1K73 U;  1ZBX A;  2EYQ A;  2JS2 A;  4FW2 A;  2AZS A;  2HBP A;  3NMZ C;  4M75 E;  1U8R A;  4RKU E; 
#chains in the Genus database with same CATH homology
 3BE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...