3BE3A

Crystal structure of a protein belonging to pfam duf1653 from bordetella bronchiseptica
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
77
structure length
77
Chain Sequence
MQDFRPGVYRHYKGDHYLALGLARADETDEVVVVYTRLYARAGLPMSTRLLRIWNETVDTGAGPQPRFAYVGHVTPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a protein belonging to pfam DUF1653 from Bordetella bronchiseptica.
rcsb
source organism Bordetella bronchiseptica rb50
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 12
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07866 DUF1653 Protein of unknown function (DUF1653)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.320 Mainly Beta Roll SH3 type barrels. DUF1653-like domain 3be3A00
3BE3A
chains in the Genus database with same CATH superfamily
5EC7A 2XI9A 1H3HA 1VIEA 1J3TA 1QVFA 5KYXB 3E9FA 3RESA 3CC7T 3EAEA 5KE3A 3M5AA 4M77E 3VS7A 2YLBA 1R0CB 4M7AE 4OB1B 2JTFA 2PU9B 3QKJA 2ESWA 1G3SA 1X43A 3PFSA 3X20B 3SWNB 3SFMA 1RAFB 5LJ3h 2QQ9A 1WXBA 3RR6A 1WI7A 1ZLMA 4LUEA 1VQ4A 4E2FB 2EPDA 3FJ5A 1W2BP 1RAEB 2E6NA 3QWXX 1K73R 3EFOA 1BIBA 1V29B 2A7YA 5C0MA 5A0GA 2JOYA 3L2QA 2VB6A 1QW1A 2BZ8A 2DRMA 4J6XA 4HKEA 1T3SA 5GANh 4X9CA 4F04B 1Y57A 1MV0B 3JCMP 2KRNA 2QK0A 2VXFA 5GANg 3I55A 5IT9E 1Q86C 2LNVA 3LH5A 3UDCA 4ZTJA 4ZGJB 4AMCA 1Q82U 3QDFA 1U3OA 3MEVA 2YLCA 4AT1B 2XDBA 4OB0B 1KQSA 2WACA 1QQJA 5HCKA 1QP2A 3I9QA 1GCQA 1ZX6A 2FRWA 2CSIA 1MUZA 1JO8A 2OTLA 2QQSA 2ZCFB 2G3RA 1IGQA 4JPBW 3PE0A 5AT1B 2D8JA 3VUBA 2QXFA 5J3BA 4BE0A 2D6FA 1WQWA 4M7DC 2FRYA 2PZ1A 2E6ZA 1KQ2A 3V7CA 2K3YA 4LDVA 2YDLA 4ESRA 3HKSA 1FYNA 2AZSA 3GPLA 1ACMB 2EYZA 3M0SA 3JSCA 1LVKA 4R56A 1YWOA 3CCLT 4PJLA 1VQ7Q 3CCET 1VQOA 1OULA 2F2WA 4OVAA 4C0DB 5KYYA 1GRIA 1X27A 4J83A 3CMAA 1Z9QA 2RJCA 4RTZA 2E41A 4PJOG 3CCVQ 1FMVA 2KYMA 2HL5C 4DOWA 3EGUA 2EQIA 1AZGB 3SDZA 4PJOC 1LCKA 2KI7A 4PLLA 1VQMT 3QPHA 3JCMg 2OX7A 1Q81R 4E7LA 3M59A 2QASA 3BFMA 3CC7A 2HEQA 1IHVA 1ABOA 1GCQC 1RLPC 4M7AG 1X6BA 3JCMW 4OMNA 3CCUA 4FYWB 3REAB 4C5IA 2M16A 3EHRA 4FYXB 2L3QA 2X4XA 1NEBA 3UPUA 1HSQA 2FYKA 2PUOB 1RAHB 4BY6B 2QA4T 4J9GA 1FX7A 2C06A 1K8AU 1UJYA 4Z89A 1XOVA 4KH0B 2P4TA 3FLGA 3HHTB 2OTLQ 3EG2A 1YJWQ 2F1LA 3MHXA 3VS4A 4DEXA 4JDSA 4F7UA 4RTTA 3I56T 2ECZA 4QVZA 1IRXA 2MI6A 1JJ2A 4Q5WA 2GF7A 3GP8A 1G3TA 3KFVA 4E7JA 1M27C 1OPLA 1K8AC 1Y96A 5FRNA 2EWNA 3MCAB 2RQUA 2DA9A 2LVMA 4C8QB 1X01A 4KGZB 1PG5B 4ZGEB 3TCJA 2RPNA 1KD1C 2EFIA 4QKUA 1CKAA 2DKGA 1LPLA 5L23A 2CUDA 1OZ3A 2A0FB 4Z88A 1AWWA 2F5KA 1IB8A 1WHMA 2FHDA 1RUWA 1AWXA 2DIQA 3EG9A 4KUDK 1MNEA 1BI3A 2DAQA 1QCFA 2VVKA 3H41A 5LJ3j 1SEMA 2EKOA 1ZSGA 2JS0A 2EYWA 4IIMA 2DF6A 2CH4A 2E5QA 4E7SA 3CCLA 3H0HA 2YSQA 4BI4A 3CCEA 2DPPB 2NLUA 5CKBA 5FLXE 1W2BS 3M0RA 1AEYA 1U1TA 3RNJA 1UGVA 2LRQA 1M30A 2EYQA 3OYHA 1JEGA 2D1XA 2IIMA 4EIKA 1VQMA 3HPWA 1QKWA 1KHCA 1YI2T 3P8DA 1W70A 2V8IA 4F7UE 4HA8A 1W1FA 4EMHA 3EG0A 1ZSZA 2K6DA 3F70A 5GAOr 2KY9A 5GAOl 1YJNA 2W10A 5CR2A 3J81E 2E4HA 5FWCA 1A0NB 3GOXA 2KDSA 5CCAA 1PKTA 3PIPA 5IXBA 3A8MB 2QA4A 2R5MA 3HFNA 5I2MA 3O8VA 3L42A 1VQ5Q 1EX4A 1HYOA 3DLLA 4IUTA 4FM4B 2K5IA 5LL6S 2VV5A 2D9TA 1W2BA 2KBTA 3M9QA 1R8OB 5GAOp 5FU7C 3VS2A 5I21A 4XU3A 1G83A 5CKEA 3M53A 1X6OA 4QVDA 3JCMQ 3NTHA 5FW9A 3OS2A 1UE9A 4XTYA 3CC2Q 2H3JA 3LWHA 4EPCA 2GQIA 2XICA 3PMIA 1N8RR 1JJ2S 4E7IA 8ATCB 3CMEA 1K4US 3NTIA 1SSFA 3CEYA 3BE3A 2RA2A 2KT1A 3R6NA 1PWTA 1OX8A 3H9NA 1HJDA 4AG1C 2E70A 1UB4A 1RACB 2M1HA 3OS1A 3CCJQ 1YITT 2O4XA 4OGCA 2MWOA 3V7RA 7AT1B 4EDUA 5LJ5f 1QVFS 3WVDB 3JCMh 5A0DA 2JVVA 1VYUA 3A8HB 3OS5A 3QJYA 3OYAA 5DY9A 5IH2A 4J5YA 2P0KA 4J6YA 4EMKC 4N4HA 4HVVA 1Y7XA 2V8JA 2XU8A 4HVUA 1VQ6A 2RI3A 4O5VA 5LJ5j 1S72Q 3V8KA 3Q1JA 3OW2A 2J7IA 3EFSA 4JJNK 3V7SA 2VUBA 4C92F 3RMQA 3NGPA 4M75G 5GAOq 4L6V5 2VYTA 3SHWA 1O9SA 5GMKe 1NJIR 1PD1A 2OI3A 2M0YA 2HAXA 3LH0A 2ENMA 2MYSA 2ZPIB 1HK9A 2OTJT 4M7DE 3UF4A 1Q86R 4LDWA 1YCSB 3ER0A 3CPWP 4GY5A 3TU4K 4RG2A 5GAN4 2KNBB 1UG1A 4ZN1A 1BBZA 4QQGA 1YJNT 2ROTA 1WGSA 3EGXB 3SB2A 4JRPA 1TSFA 3A98A 4GLMA 2CSQA 3CMEQ 4DOVA 4AFUC 2DJQA 4M4ZA 1K73C 1VQ8Q 1ZUUA 3I56Q 4MZTA 4NL2A 3CCVA 3ZFJA 2R5AA 5M9OA 3C4SA 3GNFB 5CKDA 2DZCA 3NMZC 3OW2S 3CXCA 3DLMA 4DEYA 1GL5A 2LT1A 4RUGA 2EKHA 5KYWB 4VUBA 4L5GA 2XDPA 2ZAEA 1Q81U 4DBQA 4ZTFA 3QHSA 3CBMA 2GQVA 4C92D 4J7IA 4ANJA 3GBQA 1XNIA 4FW2A 3QG1A 5FWBA 1X2QA 2LJ1A 2RHZA 2BKDN 4A4FA 1D09B 2YRDA 2ZZDA 3VV0A 2LP5A 4BI3A 2Z0WA 1UGRB 1V76A 2RI2A 3REBB 1OU9A 1BB9A 2RHIA 4P5NA 4A4HA 1BCMA 5AYFA 1SKUB 2AZVA 4JLGA 4C8QE 4D8KA 2RM4A 1ZA2B 1JXOA 3SEMA 2RD1A 1YHQQ 1VYTA 3CBOA 2M02A 1X69A 5GMKm 1GXIE 3L2UA 1N6AA 5CKHA 1YIJA 4M7AF 4YTLA 2RHXA 2EYYA 2KR3A 2JN0A 3VS3A 5LJ3f 3S3OA 1YI2Q 1PSEA 2F2VA 4WF2A 5GAMe 2C0IA 4FU6A 2ABLA 4C8QG 3CCST 1DJ7B 4A4GA 1G3WA 4XTWA 3GLXA 3EHQA 1VQ8A 3MEWA 3I56A 1MMAA 3T9NA 4QT7A 4CI0C 4C92G 3G6ET 1K76A 2COZA 1BIAA 4M7AC 3OYLA 3GNGA 1T0HA 2PUKB 4LE9A 5LJ5h 3VS5A 2OTJA 1UGPB 5GAMj 1YWPA 2CP3A 1WYXA 2IPOB 4C5EA 3A8OB 3AT1B 2BE9B 2L8DA 2GGRA 2X3XD 2DJZA 4JJBA 2B8AA 2MPXC 4AG2C 1JBMA 5A0LA 3L2ZA 1VQLA 4RG8A 3FRNA 5LJ5g 1RAGB 1WXUA 4C0ZA 1M1KU 2DYBA 1UUEA 4M75F 5GAMg 2DEQA 3CC2T 1G8XA 2GFUA 2LQWA 2COWA 4HCKA 1T3LA 4C8QA 5DLQE 2PVDB 1YCYA 1VQNT 2K7AA 3PVQA 2A36A 3OA6A 5KYYB 3JB9H 3JB9J 1WJSA 1GFDA 1KC8U 2RQWA 2VWFA 2XK0A 1N8RU 3DB3A 4E7KA 1F1BB 1WX6A 4HXJA 4Y92A 1M90U 5GJVB 1N9RA 2ZPBB 4F17A 5KCOA 4OMMA 2G6FX 2E3HA 5J26A 2LQNA 2CP5A 1PRMC 3L1AA 5GAN2 4DBHA 4WTOB 4ZNXA 1KQ1A 2I0NA 3RUXA 3OYCA 1UGSB 3LWIA 1YJ9T 1QVGS 2CP6A 2CREA 5GAMf 5A2QE 2GFAA 3OYGA 2PQWA 1E6GA 2HBWA 2XG8D 1AVZC 1UGQB 3C95A 4HCZA 3RIRA 3L2RA 4A54A 2MOXA 4L59A 5GAN8 3G71Q 2JM9A 2E1HA 4A4KA 4BDZA 4RTWA 4PFZA 1YIJT 2CS7A 3LYIA 2DXCA 3EG1A 4X9DA 1D1CA 5D6YA 2MMPA 1UFFA 2JS2A 2K2MA 5CIUA 5FROA 2L89A 1IGUA 5GANf 2BE7D 4M7DD 1KQSP 4ME7A 3VRYA 2K4YA 2CKKA 1VQ9T 1M90R 2DEUA 1WLPB 2Y4YA 1M3BA 3M4GA 3OW2P 2DM1A 1WFWA 5GMKl 2L2PA 1OZ2A 2DX1A 3CC4Q 2CUBA 4RTXA 3G4SA 1KC8R 3CCMT 2DD5A 1BK2A 4FW1A 3OB9A 1JRIA 1LJOA 1S1NA 4PFPA 2LCCA 3CCJA 4B9WA 1IXDA 1OPKA 1VUBA 2OAUA 3CCQQ 2DTHA 1MV3A 2WSFE 2DXTA 2K79A 4C0FA 1Y0MA 2QTXA 4J9CA 2ZPEB 4LXCA 1PC0A 4KH1B 1VQ6Q 2A3LA 5GAMh 2IVWA 2JM8A 4OMFB 1OQKA 4PJJA 4XTVA 3CC2A 1BU1A 2IG0A 4HCBA 4KUIA 1RADB 1AD5A 3VUZA 2EJGA 4KRTA 2XIDA 1Q7YC 5I11A 1NPRA 1P92A 2Y4XA 4OGEA 4M75C 4J9HA 2X4WA 4IUUA 1AHJB 3QUIA 4N4GA 4A53A 1XQHA 2HSEB 3QXEB 2WSEE 3HRTA 4LN2A 2O4XB 3CCRA 2LX7A 3JCMV 2XDDA 2DBKA 3QZ9B 1YHQT 4M7AD 4JJCA 4IUQA 2FZCB 3H0IA 1M5Q1 2GNCA 3CPWA 2YUPA 2EVRA 2RQRA 2O01E 1VYVA 4HVWA 2LX9A 1D3BB 2XD0A 4OMQA 3CCUT 1KD1R 1RAIB 5CQYA 1FMKA 2JT4A 2ZPHB 3H0FA 3PIOA 4E7ZA 3LW5E 3CCSQ 2LJ3A 3O5ZA 2ATCB 3SWNA 1FMWA 3H8ZA 2RQVA 5CKFA 2QEXA 2J05A 4J9DA 1K9MU 3CCVT 1VIFA 1Y07A 3G6EQ 1MMNA 1M1FA 3CXCP 2L3PA 3FC3A 2D8HA 4CC2A 1KD1U 2NUPB 1VA7A 2LDMA 2DRKA 1UHFA 4LDYA 4M7DA 4JJDA 1KIKA 1IZ6A 1PHTA 4MZPA 3V8JA 4JRIA 2DMOA 2NUTA 4XTZA 2HKNA 3QZ5B 1GCPA 3PT9A 4OB3B 3LX7A 1AT1B 2ZPFB 4PJOA 4IIOA 1GBRA 3I5RA 4XTXA 4RTVA 2FPFA 5LJ3e 4BB7A 1K0XA 4C92B 3TSZA 1VQNQ 3EH2A 2DK3A 2HQEA 3ZBDA 4M78G 1TTHB 1C1AA 1KFZA 1OV3A 2AT1B 4HT8A 2KRSA 4Y91A 3M0TA 1D1BA 4JLIA 5FU6B 3HSBA 3BDUA 2LQ8A 5HY6A 2QAZA 2RJDA 2CP0A 2MWPA 5KYWA 3L2VA 4J6WA 2K5LA 2YUOA 4Z8AA 2QYZA 1TS9A 4ELZC 3TREA 2NUZA 4PK4A 3C12A 3ZL7C 2FL7A 3MEUA 3EG3A 3NPFA 2YRCA 4IUVA 3M58A 3CCSA 1K1ZA 4E47A 1VQKQ 4M7AB 3EG9B 1YJ9Q 4PFOA 1OU8A 1SSHA 2KXDA 5CVIA 1D0YA 1ZA1B 3UA6A 4PL6A 3MEAA 4PJMA 4KBMB 2JXBA 1V1CA 1I81A 1SPKA 1D3BA 3S6WA 1QKXA 1WIEA 4NS5A 3MKDA 4BDYA 1YHQA 1U1SA 4FIBA 1I0CA 1N8RC 3CD6T 4QW2A 1YNZA 2J6OA 2HNIA 4NOYA 2RJEA 1SF9A 2C0TA 1WNLA 1VQPA 5GAOm 1TUDA 3CXCS 4M7DF 3M55A 1HXDA 3MPUB 2CYZB 1BYMA 2K5FA 3JB9D 5IAYA 1VQ7A 1VQ9Q 2DETA 1T0JA 2VC8A 5DLOA 1WQ7A 1WHGA 2K3XA 1EIFA 4M7DB 1CSKA 4C92C 3CCMQ 4M77D 5L8RE 4DA4A 2F2XA 3OMGA 1YITA 2NUPA 1D0ZA 4RCCA 2E65A 2O9SA 2ED0A 3UA7A 3KXTA 1YN8A 2RH2A 2AHJB 2QDLA 2Y90A 2JMCA 2J6FA 4MMLA 3I5SA 4J9IA 5LJ5d 1KJWA 3OMCA 3QO3A 2JNGA 1VQ6T 2EJ9A 3OSVA 3CQTA 2CZ0B 1G3YA 4V2SA 2O88A 9ATCB 3OYIA 4AFZC 3MP1A 3A5ZB 1TU0B 2DTIA 2LNHB 1YJ9A 1OYXA 2K57A 5IHNA 2HQXA 4FCYA 2CT4A 4DBFA 3OYMA 4CC4B 3QJ6A 4M78A 1FWZA 1N5ZA 1YJWA 4M78F 3JCMb 1NBEB 4J8OA 3NTKA 2VGNA 4JS5A 1XTDA 1Z9ZA 2VKNA 3VYHB 4BUGA 1JB0E 2DXBA 2EIFA 5GMKj 2DILA 2OJ2A 1H8KA 1TOVA 3CC4A 2KXCA 1BCOA 2L0AA 1G5VA 3EFRA 4AFSC 1I4K1 2X3WD 2L3SA 4M77F 1UECA 5D6WA 2HKQB 4B9XA 1VQ9A 1UDLA 3CCQA 4O6JA 1Q7YR 2CH4W 2BUDA 3U23A 4BE2A 2RI5A 2HCKA 3SD4A 2PVGB 4CRIA 4ZN3A 3QSUA 2YHTA 3HP9A 1K8AR 1QP3A 2X4YA 3R6OA 1NG2A 3CCJT 1YITQ 3G71A 4J9EA 4PJOF 2H3EB 2HSPA 2VGMA 4IKFA 1VQPT 3TSWA 1SHGA 1TXQA 1ZBJA 3HRSA 4F7UB 3IQLA 2QQAA 2JZ2A 1ZBXA 3OY9A 2X51A 1PD0A 2DL7A 2J6KA 4M75E 2A08A 3HRUA 2A37A 4UC4A 3LGLA 3P8HA 1KHIA 4FT2A 1TUGB 1D1AA 1JU5C 4R55A 3CBPA 2DE0X 4HT9A 3RDVA 5GJWB 3OYBA 2OAWA 3VKIA 1M9SA 3M0PA 2LC4A 1K9AA 3G1JA 2EGEA 3EFOB 2DD4A 2DNUA 4FSXA 1M90C 4BY6C 1MMGA 2QGFB 4LDUA 1ZUKA 2DL8A 2O2OA 1KK7A 4M78C 3OYJA 1QWEA 2E5KA 3MO8A 1OI1A 1LOJA 2W0ZA 1TG0A 4F16A 1ABQA 3E2UA 1WHLA 1YJNQ 4FYVB 2P0QA 1M8VA 1ARKA 2DTOA 1Q81C 4ATOA 4M78D 3D7SB 1B7TA 4PKCC 3RKYA 3C94A 1VQ8T 1YFNA 2FVUA 2QEXQ 1NPPA 4OF1A 2LQKA 3JCMc 5DM7R 2V1RA 2EGCA 2EQKA 3X28B 5HKCA 3CCLQ 1K0SA 2COYA 1BI1A 3UT1A 2MCNA 3JAME 4KULA 3WXMB 2F69A 3HTRA 2RHUA 3UWNA 2YUNA 4FT4A 5GAN5 3TQ7P 1RLQC 1IREB 1B34A 1AWOA 1VQ4T 1W4SA 5C6SA 3KUFA 2M51A 4NL3A 4RTYA 1VQMQ 1U8RA 3CD6Q 4RCBA 2FPEA 3FJPA 2O9VA 2X35A 3FDRA 1ZHIA 2EQUA 1GBQA 1Q86U 1UTIA 1ZQ1A 1AZEA 3JV3A 1R77A 2KK4A 4KT0E 1W6XA 2RB6A 3INZA 3H6ZA 5IHKA 1WJQA 2FG0A 2P0PA 3RBBB 1PCXA 1M3AA 4M77A 4ELYC 2EBPA 2YRVA 3RERA 1I5LA 3X24B 2RK1A 2VASA 2L5QA 4XAXB 2QG9B 1WXTA 2OTLT 2X4JA 3OS0A 4GBQA 4E6RA 2JTMA 2EQMA 5GANe 4M77G 4J7FA 4MMKA 2V1QA 4C92E 1G2BA 1VQLT 3DKMA 1VQKA 4LUDA 5CQXA 3RKWA 3BW1A 3EGDA 2FEIA 2K9GA 8AT1B 2QQBA 2RK2A 4BD3A 2YT6A 4PLIA 1E7OA 2CDTA 4ZGDB 1RI9A 1U5SA 4CC3A 2QDYB 1NJIU 1WDXA 3FEOA 1ZSZC 3LLRA 4C92A 1VQOT 3ASKA 1Y96B 4C5HA 2KE9A 3CPWS 2E12A 1R0BG 3TEEA 4EMKB 3HFOA 2HQHA 1M4ZA 2LJ0A 5IN1A 3PMTA 4DQ2A 1TUCA 4JUVA 2DVEA 2CP2A 1QWFA 5CK9A 4M77C 4JZ3A 1QVGP 3CD6A 1K73U 3OYEA 1N9SA 4EMKA 2DZ9A 1M1KR 4KGXB 2F5TX 3CCMA 1E6HA 5D7UA 2RNAA 1B34B 2E10A 4FSSA 1M8MA 2LTOA 1NYFA 1NE8A 1QLYA 3M57A 1S72A 2QTVA 1QCOA 2GBQA 2YXYA 2HL3A 1M2VB 3X25B 4JRKA 2HZYA 1QCNA 2M9UA 2M0OA 1GFCA 2YUQA 2GCXA 2JMAA 2EJFA 2E3IA 3ZEHA 4J9FA 5FRMA 2VXEA 3OYYA 4JZ4A 4M7AA 1N27A 4ORZA 3MP6A 4LD9K 3EGXA 5GMKh 4F14A 1NZ9A 1VQPQ 5I2SA 2RO0A 4M77B 2EAYA 1Q82R 4N0AA 4F7UF 3G4ST 2HBPA 5EG2A 2JUFA 3JRZA 1AOJA 4M75D 3PTAA 3M56A 1M3CA 4B6MA 1Q7YU 4PJOB 1C6VX 2HDAA 2ZGWA 2CZ1B 2DL5A 1O75A 1VQ5T 2FB7A 3MJXA 2DERA 1PKSA 1BKBA 1M2OA 1YIJQ 3JB9I 2K2VA 3M54A 1WHJA 3P8BB 3PVLA 2J06A 1XJWB 3GF5A 1YI2A 4D8DA 3RKXA 3VU3C 2B86A 2LZ6B 2WSCE 3NFCA 1SG5A 3SWNC 1WHKA 2V8KA 4GLKA 3JB9G 5J39A 2DL4A 3JCMX 3UATA 4C0GA 1NJIC 4CC7A 1QMCA 1LNXA 1RI0A 2L3RA 3CC4T 1JXMA 4F7UG 2EQJA 4JS4A 3VS6A 2LCSA 1EFNA 2RQTA 2JTEA 3LGFA 1PSFA 4KGVB 2QEXT 3M4YA 1QVPA 3QYHB 3OYFA 1KQSS 5CO7A 4EMGA 4M78B 3VS0A 3CCQT 2RJFA 1M1GA 1MGQA 2KROA 4RKUE 3CCRT 1TH7A 4XTUA 4XU1A 5GMKi 2KMTA 1H641 4OMPA 3META 5CAIA 3URGA 3S3MA 4C8QF 2KEAA 1NLOC 5IXFA 3J80E 3OSSC 1VQ4Q 2QI2A 4QQ6A 1HD3A 3I55T 2LMJA 4MZMA 4OP0A 1QVFP 4PNOA 2QGGA 1RAAB 4MDWA 1WJRA 1S72T 1SRMA 4LD6A 1ZUYA 4XQ3A 2YWWA 4C5GA 3WVEB 4BI8B 3CMAQ 2X9HA 3VYGA 1VOMA 2A28A 2R58A 1JQQA 2I2LA 2KGTA 2KT8A 3C0CA 2OTJQ 1I5OB 1PM3A 2D0QB 4X1VA 2P4RA 2SRCA 5FU7B 4TVRA 2FPDA 3JCMJ 3CC7Q 1B3QA 3FB9A 4FL6A 1NLPC 4QQDA 4Z02A 3CCUQ 4M7DG 3OBWA 5FU6C 1TWBA 1X6GA 3QBYA 1VQLQ 3CMET 3E1SA 3JCMe 4M75A 2LCLA 2GTOA 3NHNA 1UJ0A 1K9MC 2RN8A 1Q95G 3FIFA 2XMFA 5LJ3g 2EYXA 3VJPA 1MHNA 1K9MR 2FZGB 1OX9A 3EGDB 4Y28E 1I1JA 5KE2A 1NM7A 1WA7A 2GTJA 1Y71A 1NEGA 2AIRB 3ME9A 3QIIA 3TVTA 2MIOA 1VQOQ 5HK3A 5D6XA 1KC8C 2NUTB 2KRMA 2PTKA 3QWYA 3V8LA 2DLPA 2D0NA 4J9BA 2DFUA 3JCMd 5KYUB 5GAMd 5KYUA 1OEBA 2DO3A 2RHYA 4BACA 4QVCA 4IURA 2PNIA 2R57A 3S3NA 4FYYB 2PVOB 2RF0A 2MF2A 1YBYA 4IUPA 2AKLA 2DYIA 2DIGA 2CP7A 1M2VA 3PGGA 4WCIA 2JW4A 2KQWA 1UHCA 4JRQA 3AHUA 4C8QC 1QVGA 2BTTA 4DBRA 5LJ5e 3L2WA 2BZXA 3BDLA 4K11A 1JJ2P 2BIVA 5GAN3 2EGAA 5IHIA 3M0QA 1VQ7T 1VQKT 3CCEQ 2RMOA 1FXXA 4HCCA 1ZSZB 2DL3A 2KYBA 3VS1A 1OOTA 5KH6A 2K3BA 1MNDA 3OYNA 4A63B 3G4SQ 3QDRB 3JCMf 2XKOC 4N0AC 1SRLA 1C0MA 2KVQG 2DXUA 2HD0A 1B07A 1WHHA 1IHWA 2AK5A 2QQRA 4RMOA 4N4IA 4PJOE 3G7ZA 5GANj 2C0OA 1H3ZA 1AWJA 1X75C 2EW3A 4M75B 2KAFA 4XU0A 3RMSA 2ROLA 3MP8A 4PJOD 1I8FA 4A4EA 4X34A 3DB4A 6AT1B 2LT4A 2O31A 1KSWA 3VRZA 3A8LB 2ED1A 1WPYA 1NYGA 2FZKB 4LNPA 3KBGA 3QYGB 4XK8E 5GAOn 3ULRB 2MK5A 2P84A 3OBYA 5GAN7 1PRLC 4LDXA 3EH1A 2H8HA 2V26A 2QA4Q 4OMOA 1X2KA 2DBMA 3E19A 3G6EA 4XU2A 1SHFA 1KG1A 3J7AF 2HMAA 1H92A 2NYSA 3E9GA 1PNJA 4OB2B 2FO0A 4AFQC 5GANd 1YJWT 5ECAA 1U06A 2NWMA 1Q82C 3A1PA 3PNWC 2DVJA 3M0UA 2CT3A 2XHCA 1IO6A 2CGHA 1MMDA 2ZPGB 3CPFA 3CCRQ 1CKBA 2E64A 4MDXA 1I07A 4D6WA 4C8QD 2AKKA 5KYNA 2CZ7B 1EZZB 3A8GB 3I35A 4BE1A 1D0XA 3I55Q 4II1A 2JJ9A 1RL2A 1UEBA 3OYKA 3HL8A 5HK0A 3JB9F 4RTUA 3THKA 2BZYA 1YP5A 4PJNA 1WZOA 1VQNA 5LJ3d 3N5BB 3OYDA 4R0KA 2KSSA 1BI2A 5I22A 3X26B 1BI0A 4C0DC 2CZ6B 3CMAT 3G71T 5KYXA 4M78E 3GIBA 1M1KC 5GAN6 2SEMA 1VQ5A 3BY7A 3OQ5A 2MAMA 4OMLA 1RABB 4E7HA 5KCHA
chains in the Genus database with same CATH topology
3BE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BE3 A; 
#chains in the Genus database with same CATH topology
 5EC7 A;  2XI9 A;  1H3H A;  1VIE A;  1J3T A;  1QVF A;  5KYX B;  3E9F A;  3RES A;  3CC7 T;  3EAE A;  5KE3 A;  3M5A A;  4M77 E;  3VS7 A;  2YLB A;  1R0C B;  4M7A E;  4OB1 B;  2JTF A;  2PU9 B;  3QKJ A;  2ESW A;  1G3S A;  1X43 A;  3PFS A;  3X20 B;  3SWN B;  3SFM A;  1RAF B;  5LJ3 h;  2QQ9 A;  1WXB A;  3RR6 A;  1WI7 A;  1ZLM A;  4LUE A;  1VQ4 A;  4E2F B;  2EPD A;  3FJ5 A;  1W2B P;  1RAE B;  2E6N A;  3QWX X;  1K73 R;  3EFO A;  1BIB A;  1V29 B;  2A7Y A;  5C0M A;  5A0G A;  2JOY A;  3L2Q A;  2VB6 A;  1QW1 A;  2BZ8 A;  2DRM A;  4J6X A;  4HKE A;  1T3S A;  5GAN h;  4X9C A;  4F04 B;  1Y57 A;  1MV0 B;  3JCM P;  2KRN A;  2QK0 A;  2VXF A;  5GAN g;  3I55 A;  5IT9 E;  1Q86 C;  2LNV A;  3LH5 A;  3UDC A;  4ZTJ A;  4ZGJ B;  4AMC A;  1Q82 U;  3QDF A;  1U3O A;  3MEV A;  2YLC A;  4AT1 B;  2XDB A;  4OB0 B;  1KQS A;  2WAC A;  1QQJ A;  5HCK A;  1QP2 A;  3I9Q A;  1GCQ A;  1ZX6 A;  2FRW A;  2CSI A;  1MUZ A;  1JO8 A;  2OTL A;  2QQS A;  2ZCF B;  2G3R A;  1IGQ A;  4JPB W;  3PE0 A;  5AT1 B;  2D8J A;  3VUB A;  2QXF A;  5J3B A;  4BE0 A;  2D6F A;  1WQW A;  4M7D C;  2FRY A;  2PZ1 A;  2E6Z A;  1KQ2 A;  3V7C A;  2K3Y A;  4LDV A;  2YDL A;  4ESR A;  3HKS A;  1FYN A;  2AZS A;  3GPL A;  1ACM B;  2EYZ A;  3M0S A;  3JSC A;  1LVK A;  4R56 A;  1YWO A;  3CCL T;  4PJL A;  1VQ7 Q;  3CCE T;  1VQO A;  1OUL A;  2F2W A;  4OVA A;  4C0D B;  5KYY A;  1GRI A;  1X27 A;  4J83 A;  3CMA A;  1Z9Q A;  2RJC A;  4RTZ A;  2E41 A;  4PJO G;  3CCV Q;  1FMV A;  2KYM A;  2HL5 C;  4DOW A;  3EGU A;  2EQI A;  1AZG B;  3SDZ A;  4PJO C;  1LCK A;  2KI7 A;  4PLL A;  1VQM T;  3QPH A;  3JCM g;  2OX7 A;  1Q81 R;  4E7L A;  3M59 A;  2QAS A;  3BFM A;  3CC7 A;  2HEQ A;  1IHV A;  1ABO A;  1GCQ C;  1RLP C;  4M7A G;  1X6B A;  3JCM W;  4OMN A;  3CCU A;  4FYW B;  3REA B;  4C5I A;  2M16 A;  3EHR A;  4FYX B;  2L3Q A;  2X4X A;  1NEB A;  3UPU A;  1HSQ A;  2FYK A;  2PUO B;  1RAH B;  4BY6 B;  2QA4 T;  4J9G A;  1FX7 A;  2C06 A;  1K8A U;  1UJY A;  4Z89 A;  1XOV A;  4KH0 B;  2P4T A;  3FLG A;  3HHT B;  2OTL Q;  3EG2 A;  1YJW Q;  2F1L A;  3MHX A;  3VS4 A;  4DEX A;  4JDS A;  4F7U A;  4RTT A;  3I56 T;  2ECZ A;  4QVZ A;  1IRX A;  2MI6 A;  1JJ2 A;  4Q5W A;  2GF7 A;  3GP8 A;  1G3T A;  3KFV A;  4E7J A;  1M27 C;  1OPL A;  1K8A C;  1Y96 A;  5FRN A;  2EWN A;  3MCA B;  2RQU A;  2DA9 A;  2LVM A;  4C8Q B;  1X01 A;  4KGZ B;  1PG5 B;  4ZGE B;  3TCJ A;  2RPN A;  1KD1 C;  2EFI A;  4QKU A;  1CKA A;  2DKG A;  1LPL A;  5L23 A;  2CUD A;  1OZ3 A;  2A0F B;  4Z88 A;  1AWW A;  2F5K A;  1IB8 A;  1WHM A;  2FHD A;  1RUW A;  1AWX A;  2DIQ A;  3EG9 A;  4KUD K;  1MNE A;  1BI3 A;  2DAQ A;  1QCF A;  2VVK A;  3H41 A;  5LJ3 j;  1SEM A;  2EKO A;  1ZSG A;  2JS0 A;  2EYW A;  4IIM A;  2DF6 A;  2CH4 A;  2E5Q A;  4E7S A;  3CCL A;  3H0H A;  2YSQ A;  4BI4 A;  3CCE A;  2DPP B;  2NLU A;  5CKB A;  5FLX E;  1W2B S;  3M0R A;  1AEY A;  1U1T A;  3RNJ A;  1UGV A;  2LRQ A;  1M30 A;  2EYQ A;  3OYH A;  1JEG A;  2D1X A;  2IIM A;  4EIK A;  1VQM A;  3HPW A;  1QKW A;  1KHC A;  1YI2 T;  3P8D A;  1W70 A;  2V8I A;  4F7U E;  4HA8 A;  1W1F A;  4EMH A;  3EG0 A;  1ZSZ A;  2K6D A;  3F70 A;  5GAO r;  2KY9 A;  5GAO l;  1YJN A;  2W10 A;  5CR2 A;  3J81 E;  2E4H A;  5FWC A;  1A0N B;  3GOX A;  2KDS A;  5CCA A;  1PKT A;  3PIP A;  5IXB A;  3A8M B;  2QA4 A;  2R5M A;  3HFN A;  5I2M A;  3O8V A;  3L42 A;  1VQ5 Q;  1EX4 A;  1HYO A;  3DLL A;  4IUT A;  4FM4 B;  2K5I A;  5LL6 S;  2VV5 A;  2D9T A;  1W2B A;  2KBT A;  3M9Q A;  1R8O B;  5GAO p;  5FU7 C;  3VS2 A;  5I21 A;  4XU3 A;  1G83 A;  5CKE A;  3M53 A;  1X6O A;  4QVD A;  3JCM Q;  3NTH A;  5FW9 A;  3OS2 A;  1UE9 A;  4XTY A;  3CC2 Q;  2H3J A;  3LWH A;  4EPC A;  2GQI A;  2XIC A;  3PMI A;  1N8R R;  1JJ2 S;  4E7I A;  8ATC B;  3CME A;  1K4U S;  3NTI A;  1SSF A;  3CEY A;  3BE3 A;  2RA2 A;  2KT1 A;  3R6N A;  1PWT A;  1OX8 A;  3H9N A;  1HJD A;  4AG1 C;  2E70 A;  1UB4 A;  1RAC B;  2M1H A;  3OS1 A;  3CCJ Q;  1YIT T;  2O4X A;  4OGC A;  2MWO A;  3V7R A;  7AT1 B;  4EDU A;  5LJ5 f;  1QVF S;  3WVD B;  3JCM h;  5A0D A;  2JVV A;  1VYU A;  3A8H B;  3OS5 A;  3QJY A;  3OYA A;  5DY9 A;  5IH2 A;  4J5Y A;  2P0K A;  4J6Y A;  4EMK C;  4N4H A;  4HVV A;  1Y7X A;  2V8J A;  2XU8 A;  4HVU A;  1VQ6 A;  2RI3 A;  4O5V A;  5LJ5 j;  1S72 Q;  3V8K A;  3Q1J A;  3OW2 A;  2J7I A;  3EFS A;  4JJN K;  3V7S A;  2VUB A;  4C92 F;  3RMQ A;  3NGP A;  4M75 G;  5GAO q;  4L6V 5;  2VYT A;  3SHW A;  1O9S A;  5GMK e;  1NJI R;  1PD1 A;  2OI3 A;  2M0Y A;  2HAX A;  3LH0 A;  2ENM A;  2MYS A;  2ZPI B;  1HK9 A;  2OTJ T;  4M7D E;  3UF4 A;  1Q86 R;  4LDW A;  1YCS B;  3ER0 A;  3CPW P;  4GY5 A;  3TU4 K;  4RG2 A;  5GAN 4;  2KNB B;  1UG1 A;  4ZN1 A;  1BBZ A;  4QQG A;  1YJN T;  2ROT A;  1WGS A;  3EGX B;  3SB2 A;  4JRP A;  1TSF A;  3A98 A;  4GLM A;  2CSQ A;  3CME Q;  4DOV A;  4AFU C;  2DJQ A;  4M4Z A;  1K73 C;  1VQ8 Q;  1ZUU A;  3I56 Q;  4MZT A;  4NL2 A;  3CCV A;  3ZFJ A;  2R5A A;  5M9O A;  3C4S A;  3GNF B;  5CKD A;  2DZC A;  3NMZ C;  3OW2 S;  3CXC A;  3DLM A;  4DEY A;  1GL5 A;  2LT1 A;  4RUG A;  2EKH A;  5KYW B;  4VUB A;  4L5G A;  2XDP A;  2ZAE A;  1Q81 U;  4DBQ A;  4ZTF A;  3QHS A;  3CBM A;  2GQV A;  4C92 D;  4J7I A;  4ANJ A;  3GBQ A;  1XNI A;  4FW2 A;  3QG1 A;  5FWB A;  1X2Q A;  2LJ1 A;  2RHZ A;  2BKD N;  4A4F A;  1D09 B;  2YRD A;  2ZZD A;  3VV0 A;  2LP5 A;  4BI3 A;  2Z0W A;  1UGR B;  1V76 A;  2RI2 A;  3REB B;  1OU9 A;  1BB9 A;  2RHI A;  4P5N A;  4A4H A;  1BCM A;  5AYF A;  1SKU B;  2AZV A;  4JLG A;  4C8Q E;  4D8K A;  2RM4 A;  1ZA2 B;  1JXO A;  3SEM A;  2RD1 A;  1YHQ Q;  1VYT A;  3CBO A;  2M02 A;  1X69 A;  5GMK m;  1GXI E;  3L2U A;  1N6A A;  5CKH A;  1YIJ A;  4M7A F;  4YTL A;  2RHX A;  2EYY A;  2KR3 A;  2JN0 A;  3VS3 A;  5LJ3 f;  3S3O A;  1YI2 Q;  1PSE A;  2F2V A;  4WF2 A;  5GAM e;  2C0I A;  4FU6 A;  2ABL A;  4C8Q G;  3CCS T;  1DJ7 B;  4A4G A;  1G3W A;  4XTW A;  3GLX A;  3EHQ A;  1VQ8 A;  3MEW A;  3I56 A;  1MMA A;  3T9N A;  4QT7 A;  4CI0 C;  4C92 G;  3G6E T;  1K76 A;  2COZ A;  1BIA A;  4M7A C;  3OYL A;  3GNG A;  1T0H A;  2PUK B;  4LE9 A;  5LJ5 h;  3VS5 A;  2OTJ A;  1UGP B;  5GAM j;  1YWP A;  2CP3 A;  1WYX A;  2IPO B;  4C5E A;  3A8O B;  3AT1 B;  2BE9 B;  2L8D A;  2GGR A;  2X3X D;  2DJZ A;  4JJB A;  2B8A A;  2MPX C;  4AG2 C;  1JBM A;  5A0L A;  3L2Z A;  1VQL A;  4RG8 A;  3FRN A;  5LJ5 g;  1RAG B;  1WXU A;  4C0Z A;  1M1K U;  2DYB A;  1UUE A;  4M75 F;  5GAM g;  2DEQ A;  3CC2 T;  1G8X A;  2GFU A;  2LQW A;  2COW A;  4HCK A;  1T3L A;  4C8Q A;  5DLQ E;  2PVD B;  1YCY A;  1VQN T;  2K7A A;  3PVQ A;  2A36 A;  3OA6 A;  5KYY B;  3JB9 H;  3JB9 J;  1WJS A;  1GFD A;  1KC8 U;  2RQW A;  2VWF A;  2XK0 A;  1N8R U;  3DB3 A;  4E7K A;  1F1B B;  1WX6 A;  4HXJ A;  4Y92 A;  1M90 U;  5GJV B;  1N9R A;  2ZPB B;  4F17 A;  5KCO A;  4OMM A;  2G6F X;  2E3H A;  5J26 A;  2LQN A;  2CP5 A;  1PRM C;  3L1A A;  5GAN 2;  4DBH A;  4WTO B;  4ZNX A;  1KQ1 A;  2I0N A;  3RUX A;  3OYC A;  1UGS B;  3LWI A;  1YJ9 T;  1QVG S;  2CP6 A;  2CRE A;  5GAM f;  5A2Q E;  2GFA A;  3OYG A;  2PQW A;  1E6G A;  2HBW A;  2XG8 D;  1AVZ C;  1UGQ B;  3C95 A;  4HCZ A;  3RIR A;  3L2R A;  4A54 A;  2MOX A;  4L59 A;  5GAN 8;  3G71 Q;  2JM9 A;  2E1H A;  4A4K A;  4BDZ A;  4RTW A;  4PFZ A;  1YIJ T;  2CS7 A;  3LYI A;  2DXC A;  3EG1 A;  4X9D A;  1D1C A;  5D6Y A;  2MMP A;  1UFF A;  2JS2 A;  2K2M A;  5CIU A;  5FRO A;  2L89 A;  1IGU A;  5GAN f;  2BE7 D;  4M7D D;  1KQS P;  4ME7 A;  3VRY A;  2K4Y A;  2CKK A;  1VQ9 T;  1M90 R;  2DEU A;  1WLP B;  2Y4Y A;  1M3B A;  3M4G A;  3OW2 P;  2DM1 A;  1WFW A;  5GMK l;  2L2P A;  1OZ2 A;  2DX1 A;  3CC4 Q;  2CUB A;  4RTX A;  3G4S A;  1KC8 R;  3CCM T;  2DD5 A;  1BK2 A;  4FW1 A;  3OB9 A;  1JRI A;  1LJO A;  1S1N A;  4PFP A;  2LCC A;  3CCJ A;  4B9W A;  1IXD A;  1OPK A;  1VUB A;  2OAU A;  3CCQ Q;  2DTH A;  1MV3 A;  2WSF E;  2DXT A;  2K79 A;  4C0F A;  1Y0M A;  2QTX A;  4J9C A;  2ZPE B;  4LXC A;  1PC0 A;  4KH1 B;  1VQ6 Q;  2A3L A;  5GAM h;  2IVW A;  2JM8 A;  4OMF B;  1OQK A;  4PJJ A;  4XTV A;  3CC2 A;  1BU1 A;  2IG0 A;  4HCB A;  4KUI A;  1RAD B;  1AD5 A;  3VUZ A;  2EJG A;  4KRT A;  2XID A;  1Q7Y C;  5I11 A;  1NPR A;  1P92 A;  2Y4X A;  4OGE A;  4M75 C;  4J9H A;  2X4W A;  4IUU A;  1AHJ B;  3QUI A;  4N4G A;  4A53 A;  1XQH A;  2HSE B;  3QXE B;  2WSE E;  3HRT A;  4LN2 A;  2O4X B;  3CCR A;  2LX7 A;  3JCM V;  2XDD A;  2DBK A;  3QZ9 B;  1YHQ T;  4M7A D;  4JJC A;  4IUQ A;  2FZC B;  3H0I A;  1M5Q 1;  2GNC A;  3CPW A;  2YUP A;  2EVR A;  2RQR A;  2O01 E;  1VYV A;  4HVW A;  2LX9 A;  1D3B B;  2XD0 A;  4OMQ A;  3CCU T;  1KD1 R;  1RAI B;  5CQY A;  1FMK A;  2JT4 A;  2ZPH B;  3H0F A;  3PIO A;  4E7Z A;  3LW5 E;  3CCS Q;  2LJ3 A;  3O5Z A;  2ATC B;  3SWN A;  1FMW A;  3H8Z A;  2RQV A;  5CKF A;  2QEX A;  2J05 A;  4J9D A;  1K9M U;  3CCV T;  1VIF A;  1Y07 A;  3G6E Q;  1MMN A;  1M1F A;  3CXC P;  2L3P A;  3FC3 A;  2D8H A;  4CC2 A;  1KD1 U;  2NUP B;  1VA7 A;  2LDM A;  2DRK A;  1UHF A;  4LDY A;  4M7D A;  4JJD A;  1KIK A;  1IZ6 A;  1PHT A;  4MZP A;  3V8J A;  4JRI A;  2DMO A;  2NUT A;  4XTZ A;  2HKN A;  3QZ5 B;  1GCP A;  3PT9 A;  4OB3 B;  3LX7 A;  1AT1 B;  2ZPF B;  4PJO A;  4IIO A;  1GBR A;  3I5R A;  4XTX A;  4RTV A;  2FPF A;  5LJ3 e;  4BB7 A;  1K0X A;  4C92 B;  3TSZ A;  1VQN Q;  3EH2 A;  2DK3 A;  2HQE A;  3ZBD A;  4M78 G;  1TTH B;  1C1A A;  1KFZ A;  1OV3 A;  2AT1 B;  4HT8 A;  2KRS A;  4Y91 A;  3M0T A;  1D1B A;  4JLI A;  5FU6 B;  3HSB A;  3BDU A;  2LQ8 A;  5HY6 A;  2QAZ A;  2RJD A;  2CP0 A;  2MWP A;  5KYW A;  3L2V A;  4J6W A;  2K5L A;  2YUO A;  4Z8A A;  2QYZ A;  1TS9 A;  4ELZ C;  3TRE A;  2NUZ A;  4PK4 A;  3C12 A;  3ZL7 C;  2FL7 A;  3MEU A;  3EG3 A;  3NPF A;  2YRC A;  4IUV A;  3M58 A;  3CCS A;  1K1Z A;  4E47 A;  1VQK Q;  4M7A B;  3EG9 B;  1YJ9 Q;  4PFO A;  1OU8 A;  1SSH A;  2KXD A;  5CVI A;  1D0Y A;  1ZA1 B;  3UA6 A;  4PL6 A;  3MEA A;  4PJM A;  4KBM B;  2JXB A;  1V1C A;  1I81 A;  1SPK A;  1D3B A;  3S6W A;  1QKX A;  1WIE A;  4NS5 A;  3MKD A;  4BDY A;  1YHQ A;  1U1S A;  4FIB A;  1I0C A;  1N8R C;  3CD6 T;  4QW2 A;  1YNZ A;  2J6O A;  2HNI A;  4NOY A;  2RJE A;  1SF9 A;  2C0T A;  1WNL A;  1VQP A;  5GAO m;  1TUD A;  3CXC S;  4M7D F;  3M55 A;  1HXD A;  3MPU B;  2CYZ B;  1BYM A;  2K5F A;  3JB9 D;  5IAY A;  1VQ7 A;  1VQ9 Q;  2DET A;  1T0J A;  2VC8 A;  5DLO A;  1WQ7 A;  1WHG A;  2K3X A;  1EIF A;  4M7D B;  1CSK A;  4C92 C;  3CCM Q;  4M77 D;  5L8R E;  4DA4 A;  2F2X A;  3OMG A;  1YIT A;  2NUP A;  1D0Z A;  4RCC A;  2E65 A;  2O9S A;  2ED0 A;  3UA7 A;  3KXT A;  1YN8 A;  2RH2 A;  2AHJ B;  2QDL A;  2Y90 A;  2JMC A;  2J6F A;  4MML A;  3I5S A;  4J9I A;  5LJ5 d;  1KJW A;  3OMC A;  3QO3 A;  2JNG A;  1VQ6 T;  2EJ9 A;  3OSV A;  3CQT A;  2CZ0 B;  1G3Y A;  4V2S A;  2O88 A;  9ATC B;  3OYI A;  4AFZ C;  3MP1 A;  3A5Z B;  1TU0 B;  2DTI A;  2LNH B;  1YJ9 A;  1OYX A;  2K57 A;  5IHN A;  2HQX A;  4FCY A;  2CT4 A;  4DBF A;  3OYM A;  4CC4 B;  3QJ6 A;  4M78 A;  1FWZ A;  1N5Z A;  1YJW A;  4M78 F;  3JCM b;  1NBE B;  4J8O A;  3NTK A;  2VGN A;  4JS5 A;  1XTD A;  1Z9Z A;  2VKN A;  3VYH B;  4BUG A;  1JB0 E;  2DXB A;  2EIF A;  5GMK j;  2DIL A;  2OJ2 A;  1H8K A;  1TOV A;  3CC4 A;  2KXC A;  1BCO A;  2L0A A;  1G5V A;  3EFR A;  4AFS C;  1I4K 1;  2X3W D;  2L3S A;  4M77 F;  1UEC A;  5D6W A;  2HKQ B;  4B9X A;  1VQ9 A;  1UDL A;  3CCQ A;  4O6J A;  1Q7Y R;  2CH4 W;  2BUD A;  3U23 A;  4BE2 A;  2RI5 A;  2HCK A;  3SD4 A;  2PVG B;  4CRI A;  4ZN3 A;  3QSU A;  2YHT A;  3HP9 A;  1K8A R;  1QP3 A;  2X4Y A;  3R6O A;  1NG2 A;  3CCJ T;  1YIT Q;  3G71 A;  4J9E A;  4PJO F;  2H3E B;  2HSP A;  2VGM A;  4IKF A;  1VQP T;  3TSW A;  1SHG A;  1TXQ A;  1ZBJ A;  3HRS A;  4F7U B;  3IQL A;  2QQA A;  2JZ2 A;  1ZBX A;  3OY9 A;  2X51 A;  1PD0 A;  2DL7 A;  2J6K A;  4M75 E;  2A08 A;  3HRU A;  2A37 A;  4UC4 A;  3LGL A;  3P8H A;  1KHI A;  4FT2 A;  1TUG B;  1D1A A;  1JU5 C;  4R55 A;  3CBP A;  2DE0 X;  4HT9 A;  3RDV A;  5GJW B;  3OYB A;  2OAW A;  3VKI A;  1M9S A;  3M0P A;  2LC4 A;  1K9A A;  3G1J A;  2EGE A;  3EFO B;  2DD4 A;  2DNU A;  4FSX A;  1M90 C;  4BY6 C;  1MMG A;  2QGF B;  4LDU A;  1ZUK A;  2DL8 A;  2O2O A;  1KK7 A;  4M78 C;  3OYJ A;  1QWE A;  2E5K A;  3MO8 A;  1OI1 A;  1LOJ A;  2W0Z A;  1TG0 A;  4F16 A;  1ABQ A;  3E2U A;  1WHL A;  1YJN Q;  4FYV B;  2P0Q A;  1M8V A;  1ARK A;  2DTO A;  1Q81 C;  4ATO A;  4M78 D;  3D7S B;  1B7T A;  4PKC C;  3RKY A;  3C94 A;  1VQ8 T;  1YFN A;  2FVU A;  2QEX Q;  1NPP A;  4OF1 A;  2LQK A;  3JCM c;  5DM7 R;  2V1R A;  2EGC A;  2EQK A;  3X28 B;  5HKC A;  3CCL Q;  1K0S A;  2COY A;  1BI1 A;  3UT1 A;  2MCN A;  3JAM E;  4KUL A;  3WXM B;  2F69 A;  3HTR A;  2RHU A;  3UWN A;  2YUN A;  4FT4 A;  5GAN 5;  3TQ7 P;  1RLQ C;  1IRE B;  1B34 A;  1AWO A;  1VQ4 T;  1W4S A;  5C6S A;  3KUF A;  2M51 A;  4NL3 A;  4RTY A;  1VQM Q;  1U8R A;  3CD6 Q;  4RCB A;  2FPE A;  3FJP A;  2O9V A;  2X35 A;  3FDR A;  1ZHI A;  2EQU A;  1GBQ A;  1Q86 U;  1UTI A;  1ZQ1 A;  1AZE A;  3JV3 A;  1R77 A;  2KK4 A;  4KT0 E;  1W6X A;  2RB6 A;  3INZ A;  3H6Z A;  5IHK A;  1WJQ A;  2FG0 A;  2P0P A;  3RBB B;  1PCX A;  1M3A A;  4M77 A;  4ELY C;  2EBP A;  2YRV A;  3RER A;  1I5L A;  3X24 B;  2RK1 A;  2VAS A;  2L5Q A;  4XAX B;  2QG9 B;  1WXT A;  2OTL T;  2X4J A;  3OS0 A;  4GBQ A;  4E6R A;  2JTM A;  2EQM A;  5GAN e;  4M77 G;  4J7F A;  4MMK A;  2V1Q A;  4C92 E;  1G2B A;  1VQL T;  3DKM A;  1VQK A;  4LUD A;  5CQX A;  3RKW A;  3BW1 A;  3EGD A;  2FEI A;  2K9G A;  8AT1 B;  2QQB A;  2RK2 A;  4BD3 A;  2YT6 A;  4PLI A;  1E7O A;  2CDT A;  4ZGD B;  1RI9 A;  1U5S A;  4CC3 A;  2QDY B;  1NJI U;  1WDX A;  3FEO A;  1ZSZ C;  3LLR A;  4C92 A;  1VQO T;  3ASK A;  1Y96 B;  4C5H A;  2KE9 A;  3CPW S;  2E12 A;  1R0B G;  3TEE A;  4EMK B;  3HFO A;  2HQH A;  1M4Z A;  2LJ0 A;  5IN1 A;  3PMT A;  4DQ2 A;  1TUC A;  4JUV A;  2DVE A;  2CP2 A;  1QWF A;  5CK9 A;  4M77 C;  4JZ3 A;  1QVG P;  3CD6 A;  1K73 U;  3OYE A;  1N9S A;  4EMK A;  2DZ9 A;  1M1K R;  4KGX B;  2F5T X;  3CCM A;  1E6H A;  5D7U A;  2RNA A;  1B34 B;  2E10 A;  4FSS A;  1M8M A;  2LTO A;  1NYF A;  1NE8 A;  1QLY A;  3M57 A;  1S72 A;  2QTV A;  1QCO A;  2GBQ A;  2YXY A;  2HL3 A;  1M2V B;  3X25 B;  4JRK A;  2HZY A;  1QCN A;  2M9U A;  2M0O A;  1GFC A;  2YUQ A;  2GCX A;  2JMA A;  2EJF A;  2E3I A;  3ZEH A;  4J9F A;  5FRM A;  2VXE A;  3OYY A;  4JZ4 A;  4M7A A;  1N27 A;  4ORZ A;  3MP6 A;  4LD9 K;  3EGX A;  5GMK h;  4F14 A;  1NZ9 A;  1VQP Q;  5I2S A;  2RO0 A;  4M77 B;  2EAY A;  1Q82 R;  4N0A A;  4F7U F;  3G4S T;  2HBP A;  5EG2 A;  2JUF A;  3JRZ A;  1AOJ A;  4M75 D;  3PTA A;  3M56 A;  1M3C A;  4B6M A;  1Q7Y U;  4PJO B;  1C6V X;  2HDA A;  2ZGW A;  2CZ1 B;  2DL5 A;  1O75 A;  1VQ5 T;  2FB7 A;  3MJX A;  2DER A;  1PKS A;  1BKB A;  1M2O A;  1YIJ Q;  3JB9 I;  2K2V A;  3M54 A;  1WHJ A;  3P8B B;  3PVL A;  2J06 A;  1XJW B;  3GF5 A;  1YI2 A;  4D8D A;  3RKX A;  3VU3 C;  2B86 A;  2LZ6 B;  2WSC E;  3NFC A;  1SG5 A;  3SWN C;  1WHK A;  2V8K A;  4GLK A;  3JB9 G;  5J39 A;  2DL4 A;  3JCM X;  3UAT A;  4C0G A;  1NJI C;  4CC7 A;  1QMC A;  1LNX A;  1RI0 A;  2L3R A;  3CC4 T;  1JXM A;  4F7U G;  2EQJ A;  4JS4 A;  3VS6 A;  2LCS A;  1EFN A;  2RQT A;  2JTE A;  3LGF A;  1PSF A;  4KGV B;  2QEX T;  3M4Y A;  1QVP A;  3QYH B;  3OYF A;  1KQS S;  5CO7 A;  4EMG A;  4M78 B;  3VS0 A;  3CCQ T;  2RJF A;  1M1G A;  1MGQ A;  2KRO A;  4RKU E;  3CCR T;  1TH7 A;  4XTU A;  4XU1 A;  5GMK i;  2KMT A;  1H64 1;  4OMP A;  3MET A;  5CAI A;  3URG A;  3S3M A;  4C8Q F;  2KEA A;  1NLO C;  5IXF A;  3J80 E;  3OSS C;  1VQ4 Q;  2QI2 A;  4QQ6 A;  1HD3 A;  3I55 T;  2LMJ A;  4MZM A;  4OP0 A;  1QVF P;  4PNO A;  2QGG A;  1RAA B;  4MDW A;  1WJR A;  1S72 T;  1SRM A;  4LD6 A;  1ZUY A;  4XQ3 A;  2YWW A;  4C5G A;  3WVE B;  4BI8 B;  3CMA Q;  2X9H A;  3VYG A;  1VOM A;  2A28 A;  2R58 A;  1JQQ A;  2I2L A;  2KGT A;  2KT8 A;  3C0C A;  2OTJ Q;  1I5O B;  1PM3 A;  2D0Q B;  4X1V A;  2P4R A;  2SRC A;  5FU7 B;  4TVR A;  2FPD A;  3JCM J;  3CC7 Q;  1B3Q A;  3FB9 A;  4FL6 A;  1NLP C;  4QQD A;  4Z02 A;  3CCU Q;  4M7D G;  3OBW A;  5FU6 C;  1TWB A;  1X6G A;  3QBY A;  1VQL Q;  3CME T;  3E1S A;  3JCM e;  4M75 A;  2LCL A;  2GTO A;  3NHN A;  1UJ0 A;  1K9M C;  2RN8 A;  1Q95 G;  3FIF A;  2XMF A;  5LJ3 g;  2EYX A;  3VJP A;  1MHN A;  1K9M R;  2FZG B;  1OX9 A;  3EGD B;  4Y28 E;  1I1J A;  5KE2 A;  1NM7 A;  1WA7 A;  2GTJ A;  1Y71 A;  1NEG A;  2AIR B;  3ME9 A;  3QII A;  3TVT A;  2MIO A;  1VQO Q;  5HK3 A;  5D6X A;  1KC8 C;  2NUT B;  2KRM A;  2PTK A;  3QWY A;  3V8L A;  2DLP A;  2D0N A;  4J9B A;  2DFU A;  3JCM d;  5KYU B;  5GAM d;  5KYU A;  1OEB A;  2DO3 A;  2RHY A;  4BAC A;  4QVC A;  4IUR A;  2PNI A;  2R57 A;  3S3N A;  4FYY B;  2PVO B;  2RF0 A;  2MF2 A;  1YBY A;  4IUP A;  2AKL A;  2DYI A;  2DIG A;  2CP7 A;  1M2V A;  3PGG A;  4WCI A;  2JW4 A;  2KQW A;  1UHC A;  4JRQ A;  3AHU A;  4C8Q C;  1QVG A;  2BTT A;  4DBR A;  5LJ5 e;  3L2W A;  2BZX A;  3BDL A;  4K11 A;  1JJ2 P;  2BIV A;  5GAN 3;  2EGA A;  5IHI A;  3M0Q A;  1VQ7 T;  1VQK T;  3CCE Q;  2RMO A;  1FXX A;  4HCC A;  1ZSZ B;  2DL3 A;  2KYB A;  3VS1 A;  1OOT A;  5KH6 A;  2K3B A;  1MND A;  3OYN A;  4A63 B;  3G4S Q;  3QDR B;  3JCM f;  2XKO C;  4N0A C;  1SRL A;  1C0M A;  2KVQ G;  2DXU A;  2HD0 A;  1B07 A;  1WHH A;  1IHW A;  2AK5 A;  2QQR A;  4RMO A;  4N4I A;  4PJO E;  3G7Z A;  5GAN j;  2C0O A;  1H3Z A;  1AWJ A;  1X75 C;  2EW3 A;  4M75 B;  2KAF A;  4XU0 A;  3RMS A;  2ROL A;  3MP8 A;  4PJO D;  1I8F A;  4A4E A;  4X34 A;  3DB4 A;  6AT1 B;  2LT4 A;  2O31 A;  1KSW A;  3VRZ A;  3A8L B;  2ED1 A;  1WPY A;  1NYG A;  2FZK B;  4LNP A;  3KBG A;  3QYG B;  4XK8 E;  5GAO n;  3ULR B;  2MK5 A;  2P84 A;  3OBY A;  5GAN 7;  1PRL C;  4LDX A;  3EH1 A;  2H8H A;  2V26 A;  2QA4 Q;  4OMO A;  1X2K A;  2DBM A;  3E19 A;  3G6E A;  4XU2 A;  1SHF A;  1KG1 A;  3J7A F;  2HMA A;  1H92 A;  2NYS A;  3E9G A;  1PNJ A;  4OB2 B;  2FO0 A;  4AFQ C;  5GAN d;  1YJW T;  5ECA A;  1U06 A;  2NWM A;  1Q82 C;  3A1P A;  3PNW C;  2DVJ A;  3M0U A;  2CT3 A;  2XHC A;  1IO6 A;  2CGH A;  1MMD A;  2ZPG B;  3CPF A;  3CCR Q;  1CKB A;  2E64 A;  4MDX A;  1I07 A;  4D6W A;  4C8Q D;  2AKK A;  5KYN A;  2CZ7 B;  1EZZ B;  3A8G B;  3I35 A;  4BE1 A;  1D0X A;  3I55 Q;  4II1 A;  2JJ9 A;  1RL2 A;  1UEB A;  3OYK A;  3HL8 A;  5HK0 A;  3JB9 F;  4RTU A;  3THK A;  2BZY A;  1YP5 A;  4PJN A;  1WZO A;  1VQN A;  5LJ3 d;  3N5B B;  3OYD A;  4R0K A;  2KSS A;  1BI2 A;  5I22 A;  3X26 B;  1BI0 A;  4C0D C;  2CZ6 B;  3CMA T;  3G71 T;  5KYX A;  4M78 E;  3GIB A;  1M1K C;  5GAN 6;  2SEM A;  1VQ5 A;  3BY7 A;  3OQ5 A;  2MAM A;  4OML A;  1RAB B;  4E7H A;  5KCH A; 
#chains in the Genus database with same CATH homology
 3BE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...