3BE3A

Crystal structure of a protein belonging to pfam duf1653 from bordetella bronchiseptica
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
77
structure length
77
Chain Sequence
MQDFRPGVYRHYKGDHYLALGLARADETDEVVVVYTRLYARAGLPMSTRLLRIWNETVDTGAGPQPRFAYVGHVTPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a protein belonging to pfam DUF1653 from Bordetella bronchiseptica.
rcsb
molecule keywords Uncharacterized protein
source organism Bordetella bronchiseptica rb50
molecule tags Structural genomics, unknown function
total genus 12
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07866 DUF1653 Protein of unknown function (DUF1653)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.320 Mainly Beta Roll SH3 type barrels. DUF1653-like domain 3be3A00
3BE3A
chains in the Genus database with same CATH superfamily
1ZSZB 2ABLA 2JOYA 2PTKA 1WXBA 2RHYA 2PVOB 2QTXA 4N0AA 3VU3C 2K3YA 2KRMA 3LW5E 4FU6A 5GAOr 3I56T 3PVLA 2ZPBB 2BE9B 3CCSA 2ZCFB 3QUIA 2HZYA 4DBFA 1QLYA 3FEOA 3MEUA 2X9HA 1SEMA 1S72A 1Y96A 2EGCA 4M7DD 1SHGA 3OYFA 1PKSA 2DE0X 2CGHA 5GAMf 3RBBB 4E7SA 2RH2A 5LJ3j 1PHTA 2LTOA 1K8AC 2ZGWA 1KSWA 4ANJA 2LNVA 1QCFA 4KUDK 4PJLA 4FW2A 3I9QA 4C92E 2DVEA 4FYYB 3C94A 1YI2T 2ED1A 3X25B 2CT3A 2YDLA 2KT1A 2DXCA 2QG9B 4RCBA 4A4EA 3EFOA 3S3OA 1N8RC 2X51A 1OX9A 4PLLA 4WF2A 1YHQQ 2JN0A 2BKDN 5GMKe 2W10A 2FL7A 1OX8A 3CMEQ 2L89A 4QQGA 2XG8D 3EG9A 3CC7Q 4OMLA 1RABB 1M1KU 1VQPA 5J3BA 2RJDA 1SG5A 3I5RA 3CCMA 2SEMA 4JS5A 4R0KA 2MF2A 3OYDA 3JAME 4JUVA 3VS3A 2EQIA 5KYWB 5CAIA 1UGPB 3L2WA 1I81A 4CC7A 4M78G 2A7YA 1JB0E 1D1BA 2HKNA 5CKEA 3J80E 3G6ET 2PVGB 1K9MU 4HXJA 3KFVA 4Y28E 4NS5A 4M7AF 1IO6A 4C5EA 2M9UA 2JJ9A 4M77A 4OMOA 1BKBA 4M75A 4ZN3A 4OB2B 4YTLA 5GAN4 4PJMA 2EQJA 1ZBJA 2E4HA 2YT6A 4KH0B 2PVDB 5LJ3g 2AIRB 3C12A 2A3LA 1C1AA 4J9IA 1MUZA 4KGVB 3NHNA 2FRYA 1EZZB 4C8QA 1OU9A 2LDMA 4FIBA 2EYQA 2H3JA 3PT9A 3F70A 2K3XA 1RADB 4OGCA 5LJ3e 3CCST 1QKXA 1YWOA 2JXBA 3JB9G 1TH7A 2L3PA 2FZKB 3GOXA 2L3SA 4KUIA 1XJWB 3CCRA 1UGRB 3QZ9B 3UDCA 5DY9A 3QZ5B 5IHKA 2ESWA 3CBMA 1PG5B 4DBHA 3CCEQ 2QGFB 2KNBB 5HY6A 4J9FA 4BI4A 2EAYA 1QVGP 4JLIA 3WVDB 5C0MA 1JEGA 3VS6A 3E2UA 4II1A 1ACMB 4E47A 3G4SQ 4ZN1A 1YJNQ 3TEEA 2LJ1A 2JT4A 1IRXA 2FYKA 1WGSA 2ZPFB 1IHWA 1PM3A 2A08A 2CT4A 2V26A 2VV5A 1WHJA 4ME7A 5GANh 2EJGA 3VS2A 2CP7A 2RPNA 5GAN8 4F16A 4EMKA 1K8AU 5CO7A 2LQKA 2IIMA 1BBZA 1X2KA 3DB3A 5KH6A 1YCSB 1TG0A 5LL6S 1X27A 1PCXA 1VQPT 1ZHIA 1IHVA 2EYZA 4AFUC 3CCUA 4OMQA 1MV3A 3X28B 1KD1R 3CCMT 3Q1JA 5FLXE 3G71Q 4LDXA 2E41A 2DKGA 2NUZA 3DLLA 5DLQE 1B7TA 4ZGJB 4C92B 5AYFA 1W6XA 1TWBA 4A4GA 3V8JA 1MNDA 5GAN7 3GBQA 1B07A 3EGXB 3LWHA 2QEXQ 3A8MB 3E9GA 1JO8A 3FB9A 3VRZA 3M4GA 4DA4A 5EG2A 2DTOA 3JCMg 1Q82U 1S72Q 1PRLC 2VUBA 2AKKA 4E7LA 1VQLQ 1WHKA 1K0SA 1A0NB 4IIOA 1WZOA 4C5GA 3LX7A 2VYTA 5CQXA 5D6XA 3JCMe 3CCJQ 4GBQA 4D8DA 2JUFA 4M7DA 1PSEA 4ZGEB 1MMDA 1MMAA 1WFWA 3M56A 1R0BG 4QVDA 1OEBA 2M51A 2L2PA 1IB8A 1VYUA 3L2VA 4HT9A 4E7JA 2O4XB 5KYUB 3CC4Q 3RKWA 1AD5A 2HQEA 2PUKB 4OMMA 4HCBA 3CCRT 4C5HA 2KEAA 2K5IA 1GL5A 3PIOA 3R6NA 1M5Q1 1B3QA 4A4HA 1U1TA 3H0IA 4BE2A 2DYIA 1G83A 1G3YA 1VQPQ 4FSSA 1QVGS 4RTXA 2KGTA 2X4WA 3CCMQ 2LNHB 4QVZA 1O75A 1UUEA 2RQVA 1BI0A 2JW4A 2DZCA 1AT1B 2R5MA 4J8OA 3VYHB 4F7UF 4PJOE 1JJ2A 1KC8R 2PNIA 2RHXA 1UHCA 1E6HA 2L3RA 5LJ3f 3JCMc 2DM1A 1VQ9Q 1T3LA 5GANj 2KSSA 2KQWA 3A8OB 3OYIA 1B34A 2JZ2A 2WSCE 2DZ9A 4XTWA 1X6BA 2DILA 3CCUT 5KYNA 5EC7A 1WHLA 4RTVA 3FIFA 2HD0A 3OSVA 3QJ6A 4M7AB 4E7IA 3TSZA 2YRCA 1LVKA 1BCOA 4C0DC 5IAYA 1RAAB 3JCMP 2HAXA 2O9VA 1M8MA 3OMGA 2LT1A 3OS5A 1JXOA 4JRPA 2D1XA 2GQIA 3SB2A 4J9HA 4RUGA 3M57A 3RNJA 4B9XA 2ENMA 2A37A 2JNGA 4XQ3A 3UWNA 4CC2A 1YNZA 2HSEB 2KBTA 3BDUA 2DIQA 1UB4A 4HCKA 4IIMA 3CCRQ 1Q81U 1YHQA 5D6YA 2EGEA 2L8DA 2DF6A 1N8RR 3MPUB 3CMEA 3NTKA 4AFSC 3CC7A 4A4KA 3EG2A 4QQDA 1VUBA 4BY6B 2V8JA 2DL7A 1M90C 4EIKA 4J9CA 3HRSA 1VQMQ 1RUWA 1GBQA 1M9SA 4C0ZA 4OMNA 3A8LB 5LJ5h 1M2VA 2CSQA 1X75C 1H641 1WPYA 2EJ9A 2WSEE 4X9CA 1NJIR 4CI0C 4M78C 3C95A 4DBQA 1G3WA 1S1NA 1NZ9A 3OYGA 5HKCA 4OGEA 2OTJQ 2E1HA 1WQ7A 4EDUA 1Q86C 1WA7A 2EKHA 5GMKl 7AT1B 3H41A 3RIRA 1VOMA 1VQKA 4J7IA 4JPBW 2KY9A 1WQWA 3M0PA 1FX7A 3RMQA 1BB9A 4LDVA 2COWA 2M16A 2YXYA 3M58A 4JJBA 1AOJA 3GPLA 3M0QA 2EW3A 2JTFA 3QIIA 3VRYA 1UHFA 3CPWA 2M02A 2G6FX 4EMHA 4DBRA 2EYYA 1R0CB 1RLPC 4BI3A 1RAGB 2JVVA 1ABOA 4J7FA 3M4YA 4ZTFA 2KXCA 3SD4A 3S6WA 2RQTA 2M0OA 4M77F 1HXDA 2NUTB 4DOVA 4HT8A 1IZ6A 4A54A 2GFUA 3MHXA 2DERA 3CCEA 2GTJA 1UFFA 1Y57A 5KE2A 2R58A 4O5VA 3RUXA 1YJ9Q 5FU7B 3LLRA 4XK8E 5A0GA 2QTVA 4C92D 1M3CA 1W2BA 3X20B 2BTTA 2YLCA 4PJOB 3JCMJ 3ZL7C 3CBPA 1RAHB 2ECZA 3G4SA 4LUEA 1YJNA 2E6NA 5GAOl 1YFNA 3ME9A 4LXCA 1FMKA 4F7UA 1G8XA 1XNIA 2GF7A 3SHWA 2B86A 3CC2A 3CCQQ 1N5ZA 2QQBA 1YHQT 4QKUA 1BI3A 1Y07A 3VKIA 1VQ5Q 5HK3A 3CMET 2J6FA 4M78F 3CC7T 2VGMA 2LQNA 2PU9B 4LNPA 1HK9A 4OVAA 3FJ5A 2DBKA 2L0AA 3RKXA 4F04B 2BUDA 3I55Q 3M5AA 5CKDA 3G71A 1D09B 2WSFE 2ATCB 2FPFA 4M75E 1QQJA 1C6VX 3L42A 4JS4A 5GAOn 1VQOA 2LVMA 2JMCA 5FU6B 5LJ5j 2A0FB 2RB6A 2X4JA 4KGZB 1M3AA 1NLOC 2QEXA 2DRMA 4HKEA 2AT1B 1I0CA 4C8QE 5FROA 2K6DA 1D1AA 1K73C 1ZSGA 2LX9A 2RI2A 4JJCA 1M90U 2VC8A 3L2ZA 5CVIA 1VQKT 2RHIA 2NYSA 3EG1A 1VQLA 2DD5A 3RDVA 2CSIA 5FW9A 3JB9F 1NPRA 2F2WA 1WIEA 4CC4B 2V1RA 3CCJA 1M4ZA 3SWNC 5J26A 2HBWA 4ORZA 3EGUA 1RL2A 2L3QA 2OTLQ 3H0FA 1Q86U 3G7ZA 5GAN6 1KG1A 3V7CA 4PL6A 3QJYA 1Q7YC 3SEMA 2XIDA 3OYLA 3CC4A 2X4YA 1F1BB 2OAWA 3CCET 4BACA 3VUZA 3CD6Q 4IUTA 3L1AA 1M2OA 1VA7A 2Z0WA 3WXMB 2FG0A 2DEQA 1I4K1 3BFMA 2MWOA 1Y96B 4VUBA 3OW2P 1G3SA 4OMFB 3DB4A 4M7DF 5GANf 3RESA 3LWIA 1KFZA 1Q82C 3OS2A 1QP2A 3G4ST 4R56A 1YJNT 4C8QG 3CXCA 1VIEA 3JCMd 3OMCA 1BYMA 3EAEA 1V29B 4RTWA 3CC2T 2CUDA 2CZ1B 1BI2A 3UT1A 4LE9A 4AG2C 2JS2A 3QWXX 4MDWA 3VS5A 1VQ9A 3EFOB 2Y90A 1G2BA 5A2QE 3NTIA 4NL2A 3CCVA 4CC3A 2YLBA 3L2RA 2LCSA 5GAN3 1VQKQ 4J9EA 2GCXA 2DK3A 4C92G 1WHGA 1O9SA 4FYWB 3G71T 3EG9B 4Z8AA 4HCCA 3IQLA 1ZA1B 2E12A 1LNXA 2RHZA 1MGQA 1VQOT 2YRVA 3CCLQ 3EHRA 3J81E 2RD1A 4HVUA 2YWWA 5A0LA 2HL3A 1EIFA 2YUOA 4MZMA 4JDSA 3DKMA 2QEXT 4FL6A 2I0NA 3NFCA 3N5BB 2QYZA 3H6ZA 2KRSA 2J05A 2KK4A 3M53A 4IURA 2JM8A 1JRIA 1OPLA 1TUDA 1S72T 1R8OB 2HMAA 1VQLT 3NPFA 1WX6A 2PQWA 2X3WD 4XTZA 2O2OA 5GAMh 4QW2A 1D0ZA 4M77B 4M78A 4PNOA 3L2QA 4M75B 4XTYA 3CCJT 4M7AE 1OZ2A 1KIKA 4OB0B 1J3TA 1KQSA 2NUPA 3J7AF 4IUUA 4BI8B 4HA8A 2E5QA 5KCHA 4XTUA 1K73U 3VS1A 3PTAA 2DTHA 3UATA 4OP0A 2EYWA 2RQRA 4JJDA 3ULRB 1VQMA 2DJQA 1JXMA 1XOVA 4BDZA 4C8QB 3MP1A 3CC2Q 2XDPA 3CC4T 5KYXA 2HNIA 3C4SA 1RI0A 1WLPB 4KGXB 1TSFA 4J6WA 2KDSA 2F2VA 2OTJA 4ZGDB 2DLPA 1X6OA 2XK0A 2ZPEB 2F5TX 1UGQB 2R57A 1NE8A 5I21A 3OW2S 1Q7YU 4L5GA 1KHCA 1Q81C 5GAMd 1WHMA 1ZSZC 2EYXA 4FSXA 4OB3B 3S3NA 4PJOD 1VQOQ 2SRCA 4L59A 3EG0A 1HD3A 4V2SA 3VJPA 3BDLA 2DEUA 1G5VA 3M59A 2P0PA 2CKKA 2DXBA 4JJNK 1UGSB 5FWCA 4N4GA 1QVFA 2VKNA 2ZPHB 2RF0A 1VQ9T 5CK9A 3VV0A 2G3RA 2DL4A 1VQ6Q 3REBB 1M27C 4M7AG 2GFAA 1UJ0A 1M1KR 3OYKA 2DL8A 5KYYA 4EMKB 2RQWA 1GCPA 2GQVA 2QQSA 5GAOp 3TU4K 3FDRA 1LCKA 4Z02A 3CMAQ 1YJ9A 1UE9A 3EGDA 5D7UA 2ROTA 4ZTJA 3VS4A 5C6SA 2DNUA 1NJIU 3SDZA 3E1SA 1K9MR 1TOVA 2QQ9A 2DAQA 3RR6A 4D8KA 1MMNA 1T3SA 2V1QA 3CEYA 5ECAA 2DYBA 2LCLA 2GGRA 1W70A 1KK7A 1H8KA 2EJFA 4XTVA 5GJWB 4ELYC 1EX4A 3CCQA 1OV3A 4IUQA 2FZCB 1NYGA 1VQ5A 1YN8A 2OX7A 5LJ5f 2HEQA 2CH4W 1MNEA 2DIGA 1N9SA 2NLUA 2H3EB 5M9OA 2YSQA 2O9SA 2RI5A 1K9AA 4N4HA 1NEBA 5D6WA 2ED0A 3I55A 4E7HA 1P92A 4D6WA 1RACB 1VQMT 2LQWA 3OS0A 4M7DB 2JMAA 2MYSA 4EMGA 2R5AA 3INZA 4MDXA 1D3BA 3SWNA 3EG3A 4PJJA 2AZSA 1ZX6A 3ZBDA 3OS1A 3CCVQ 2KVQG 2RK2A 2OTJT 2GTOA 1UDLA 2E5KA 3QDFA 3FC3A 1AWJA 2K2MA 5KCOA 1NG2A 1K1ZA 2RO0A 1X6GA 3NMZC 1ZBXA 1BK2A 2E64A 2LP5A 2RHUA 4L6V5 4XAXB 3R6OA 1SSHA 3LH5A 1N9RA 1QWEA 2KAFA 1CSKA 2HCKA 2J6OA 4MMLA 3TVTA 1OOTA 1OU8A 2X35A 5DLOA 1U8RA 3X24B 2OTLA 1K8AR 4LDUA 4HCZA 1GXIE 3V7RA 2GNCA 4FM4B 1FMWA 3QXEB 3D7SB 1UECA 3PIPA 3OY9A 1VQ4Q 1N6AA 1HYOA 2FPDA 2ZAEA 1QCNA 4F7UE 3HKSA 5GMKh 2O88A 3CD6A 2E10A 3V8KA 1B34B 1FXXA 1WYXA 1TUGB 1X2QA 1YJ9T 1WNLA 2CP5A 4PJOG 3HTRA 4ELZC 3ZEHA 3P8HA 4JZ4A 3MCAB 2LJ3A 4E6RA 2F1LA 4RG2A 1IGQA 2QASA 1PD0A 4KH1B 1Q82R 2FRWA 2DO3A 3JCMQ 2DTIA 4OMPA 3CCQT 5GANg 1XQHA 2KROA 1QVPA 1T0HA 1QVFP 2E3HA 4RKUE 1VIFA 2BZXA 2F69A 1QP3A 5A0DA 2RJEA 2F2XA 5I2SA 1VQ5T 3GNFB 3QSUA 2RJFA 1AVZC 2LMJA 4JZ3A 5GANe 3JCMW 4M75D 3JRZA 4E7ZA 1AWOA 3I55T 2P4TA 3PMTA 4RTTA 4GLKA 4C92C 4DEXA 1QCOA 2CP0A 8ATCB 3HP9A 1KD1C 2MPXC 3CCLA 3LYIA 2FVUA 2XDBA 2D0QB 1RAIB 4C8QD 3U23A 4FT2A 3JSCA 5LJ3h 5IXBA 1M2VB 1SSFA 2MWPA 2CP2A 3HHTB 4GY5A 1YIJQ 4WTOB 6AT1B 5CQYA 3THKA 3UPUA 1YWPA 2E70A 2RI3A 3MJXA 2M1HA 2AKLA 1T0JA 1EFNA 4RG8A 2ZPGB 3MP8A 1UTIA 2C0IA 1U06A 1ZUKA 2LC4A 1K0XA 2YHTA 1VQNQ 2OTLT 4O6JA 4AG1C 2EQKA 2EQMA 4A53A 5IXFA 3GIBA 3MKDA 1JJ2P 1ZSZA 2J06A 1IREB 1PKTA 1W4SA 3A1PA 1PD1A 4HVVA 1IXDA 2LX7A 2OI3A 2A28A 4AMCA 1R77A 5LJ3d 2DL3A 3L2UA 3CD6T 4PK4A 2LRQA 2VGNA 3GP8A 4X1VA 2JS0A 3QDRB 1SF9A 1VYVA 3H0HA 4C0GA 3AT1B 2AZVA 1FMVA 1NLPC 2A36A 5I11A 1BCMA 3LGLA 9ATCB 4E7KA 4M77E 2H8HA 1YJWQ 1I8FA 4LN2A 5CR2A 1U3OA 2XICA 3S3MA 1AZGB 1ABQA 1QVGA 3HFNA 4CRIA 2MMPA 1ZUUA 4X34A 4C92F 2CZ0B 1YP5A 3M0TA 1Q81R 2OJ2A 5HK0A 1SKUB 3QYGB 4KT0E 2D6FA 1PSFA 3UF4A 1KC8C 1LOJA 1YCYA 1QVFS 2KYBA 3FRNA 4F7UB 2KI7A 1RAFB 2YRDA 5IHIA 2DMOA 4BE1A 1ZA2B 1VQ6A 2CYZB 3ER0A 4LD6A 2I2LA 3META 1SRLA 2K57A 1G3TA 4M7AC 1Y0MA 3I5SA 4QQ6A 3JCMX 1WHHA 3E9FA 4J6YA 4JLGA 2DXUA 2P0KA 3UA7A 3OYJA 1BIAA 1HSQA 1I5LA 3CMAA 3CQTA 3CCLT 3JCMh 3VS7A 1JBMA 2QGGA 3TREA 1VQ8Q 4M78E 1NM7A 3JB9I 1LPLA 1MV0B 4PLIA 1CKAA 4P5NA 1VQ7Q 4KULA 4BD3A 2RJCA 1NEGA 3TSWA 2IPOB 2CH4A 2XD0A 4QVCA 4J5YA 4MZTA 2ROLA 1AHJB 1GBRA 1I1JA 1PC0A 3WVEB 5KYWA 4B9WA 3I35A 2GBQA 2E3IA 1KD1U 1N27A 4M77G 1X69A 4XU2A 4M75G 4M7AD 3M0UA 1QKWA 2V8IA 1YITQ 2EIFA 2PUOB 3PFSA 3OA6A 3ZFJA 2QDLA 2XMFA 4BY6C 2CZ7B 2HDAA 1U5SA 3QHSA 2EWNA 1M1GA 3HPWA 3EFSA 1RAEB 3A98A 2MK5A 1DJ7B 5FRNA 4KBMB 4QT7A 5GAN5 2LZ6B 5LJ5g 1HJDA 3CPWP 2AHJB 2HQHA 3VUBA 4FYVB 4J83A 4J9DA 1JJ2S 1E7OA 2MIOA 4R55A 3CBOA 3HL8A 4RTUA 1NJIC 1QW1A 5LJ5e 1Y71A 2C0OA 1D1CA 1IGUA 3C0CA 3ASKA 4LD9K 1UG1A 8AT1B 2VB6A 2FPEA 3I56Q 2KT8A 1OQKA 3MP6A 4IKFA 3QBYA 3G1JA 2BZYA 4JRKA 1TTHB 1GFCA 2KRNA 3PE0A 1W2BP 5FWBA 1OYXA 2VWFA 2D8HA 1KQ2A 1V1CA 5GJVB 2VXEA 2DRKA 4M7DE 2K4YA 2K3BA 3JCMb 4RMOA 4C0DB 1PNJA 1VQ6T 4AFZC 3FJPA 1KJWA 1WDXA 3RKYA 1VQ4A 3A8HB 3O8VA 1I5OB 2QAZA 4X9DA 2CUBA 2EFIA 1WJRA 1YI2Q 3EFRA 4J9BA 2HBPA 5FU7C 3GF5A 3OBWA 3CMAT 5GMKm 1OI1A 1KC8U 4PJOC 2WACA 2K9GA 2OAUA 1AEYA 5CKBA 3OB9A 2XI9A 4BE0A 4RTYA 3OYMA 4B6MA 3REAB 2RK1A 2K7AA 4LDWA 2HSPA 4LDYA 1M30A 4F14A 2K5FA 4C92A 4Q5WA 1SHFA 3URGA 1M90R 4FT4A 2O31A 3OBYA 2FO0A 2QA4A 1RI9A 2PZ1A 2DL5A 2ZZDA 3AHUA 3EGXA 1XTDA 3HSBA 1JU5C 4PFZA 2QI2A 1UJYA 4F17A 2DD4A 3G6EQ 3UA6A 1Y7XA 1Q86R 3KXTA 4M7DG 2NWMA 2VVKA 4GLMA 4M78B 2COYA 2P4RA 5L23A 3M55A 2QK0A 2FEIA 2NUPB 5FU6C 2CREA 4OF1A 2B8AA 3OYNA 3CPWS 1QWFA 1KQ1A 4J6XA 2XDDA 1GCQC 1V76A 3MEWA 1N8RU 2V8KA 5GAOm 2X4XA 3PNWC 3RERA 4XU0A 3BW1A 3CCVT 5KYXB 2HKQB 2YUQA 4MZPA 2O4XA 4PKCC 1YIJA 5CCAA 4A63B 5KYUA 1M3BA 1OZ3A 2HQXA 3CCSQ 1BU1A 2J6KA 1TUCA 3A8GB 2Y4XA 4BUGA 2E65A 2C06A 4PFOA 1MHNA 3V8LA 1WXTA 1W2BS 5GANd 5IH2A 3CXCP 1VQNA 2HL5C 4PJOF 1TXQA 1UGVA 2L5QA 2DXTA 2FZGB 3T9NA 3QO3A 4N0AC 1D0YA 1OPKA 1AWWA 1FYNA 4XU3A 4A4FA 2QDYB 1GRIA 1VQ4T 3QKJA 4Z89A 2K2VA 4N4IA 2O01E 2RN8A 4OB1B 1ZQ1A 3EH2A 4UC4A 4DOWA 1Q95G 2CP3A 4E2FB 5GAMj 2W0ZA 5FRMA 3MEAA 5KYYB 2MCNA 1ARKA 1TU0B 2C0TA 2LJ0A 1YJWA 4M7AA 4IUVA 3EGDB 1C0MA 1BIBA 2DVJA 4AFQC 2VASA 2KXDA 1I07A 4PJNA 2EGAA 1FWZA 2KYMA 2QA4T 2DETA 3HFOA 4DEYA 3QWYA 2BZ8A 3TCJA 4TVRA 1H3HA 3EH1A 1Z9ZA 3OQ5A 3VYGA 3H9NA 2IVWA 4MMKA 4HVWA 2DPPB 4ESRA 1NPPA 1NYFA 3NTHA 1K73R 2EVRA 4FW1A 1KHIA 3MO8A 1MMGA 1VYTA 1KQSP 2LT4A 2D8JA 1PRMC 4XU1A 5CKFA 2QXFA 2YUNA 1AWXA 4XTXA 1VQ8A 5CIUA 1TS9A 2CS7A 3EHQA 3P8BB 1GFDA 3DLMA 2P0QA 2Y4YA 4Y91A 3KUFA 5I2MA 3LH0A 2KMTA 1VQ7A 1RLQC 2K79A 2KR3A 3JCMV 5IN1A 1SPKA 1D3BB 1YIJT 3SWNB 2RQUA 4LUDA 1Q7YR 3JB9H 3KBGA 2DBMA 4M77C 5GAMg 2FB7A 2RA2A 4M75C 4BB7A 4K11A 3NGPA 3MEVA 2KE9A 3GNGA 1YITA 1YBYA 5L8RE 2EPDA 2EQUA 2XU8A 2M0YA 3OYBA 2VXFA 1VQNT 3QG1A 5GAMe 2K5LA 2IG0A 2LCCA 4AT1B 4C8QC 3CXCS 2LQ8A 5AT1B 4RCCA 2BIVA 3E19A 2QA4Q 3OYEA 2XHCA 3X26B 4J9GA 1W1FA 1AZEA 3OYYA 4ZNXA 2ZPIB 3BE3A 4ATOA 1X01A 3M9QA 4PFPA 4M77D 4C0FA 3RMSA 2YUPA 3OYHA 5KE3A 2NUTA 2QQAA 4JRQA 1BI1A 3QYHB 2EBPA 3I56A 1YJWT 4DQ2A 4EPCA 2RM4A 5IT9E 3CCUQ 4WCIA 3OW2A 1LJOA 1UEBA 1WJSA 4F7UG 1M8VA 2COZA 1QMCA 3VS0A 4PJOA 3JV3A 1WI7A 1D0XA 2D9TA 2E6ZA 3JCMf 1E6GA 2DJZA 3HRUA 4EMKC 4NL3A 4KRTA 5GMKi 4IUPA 2AK5A 1H3ZA 4C5IA 5DM7R 1M1KC 1YI2A 2CP6A 2JM9A 5LJ5d 3BY7A 3P8DA 4M78D 1NBEB 2QQRA 3M0RA 1WJQA 3O5ZA 1ZUYA 3PGGA 3V7SA 1KQSS 1VQ8T 4M75F 1SRMA 3OSSC 2XKOC 5I22A 3A5ZB 2JTMA 1VQ7T 2FHDA 3LGFA 3PVQA 1K76A 4M4ZA 3GLXA 5GAN2 1K9MC 1Z9QA 2CDTA 2DFUA 4FCYA 4FYXB 2JTEA 2CZ6B 2RMOA 4C8QF 2BE7D 2RNAA 3SFMA 2F5KA 5IHNA 5J39A 4JRIA 3H8ZA 4NOYA 3M0SA 3M54A 2D0NA 1CKBA 2EKOA 1GCQA 2X3XD 5GMKj 1H92A 2MAMA 2DX1A 1U1SA 1YITT 1OULA 1PWTA 3G6EA 1X43A 4Y92A 1WXUA 2MI6A 2MOXA 5CKHA 3CPFA 3JB9D 3FLGA 4RTZA 3JB9J 3QPHA 4M7DC 5HCKA 4BDYA 2DA9A 1K4US 3TQ7P 3HRTA 1JQQA 4Z88A 1M1FA 3OYAA 1ZLMA 3OYCA 2J7IA 2P84A 3PMIA 5GAOq
chains in the Genus database with same CATH topology
3BE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BE3 A; 
#chains in the Genus database with same CATH topology
 1ZSZ B;  2ABL A;  2JOY A;  2PTK A;  1WXB A;  2RHY A;  2PVO B;  2QTX A;  4N0A A;  3VU3 C;  2K3Y A;  2KRM A;  3LW5 E;  4FU6 A;  5GAO r;  3I56 T;  3PVL A;  2ZPB B;  2BE9 B;  3CCS A;  2ZCF B;  3QUI A;  2HZY A;  4DBF A;  1QLY A;  3FEO A;  3MEU A;  2X9H A;  1SEM A;  1S72 A;  1Y96 A;  2EGC A;  4M7D D;  1SHG A;  3OYF A;  1PKS A;  2DE0 X;  2CGH A;  5GAM f;  3RBB B;  4E7S A;  2RH2 A;  5LJ3 j;  1PHT A;  2LTO A;  1K8A C;  2ZGW A;  1KSW A;  4ANJ A;  2LNV A;  1QCF A;  4KUD K;  4PJL A;  4FW2 A;  3I9Q A;  4C92 E;  2DVE A;  4FYY B;  3C94 A;  1YI2 T;  2ED1 A;  3X25 B;  2CT3 A;  2YDL A;  2KT1 A;  2DXC A;  2QG9 B;  4RCB A;  4A4E A;  3EFO A;  3S3O A;  1N8R C;  2X51 A;  1OX9 A;  4PLL A;  4WF2 A;  1YHQ Q;  2JN0 A;  2BKD N;  5GMK e;  2W10 A;  2FL7 A;  1OX8 A;  3CME Q;  2L89 A;  4QQG A;  2XG8 D;  3EG9 A;  3CC7 Q;  4OML A;  1RAB B;  1M1K U;  1VQP A;  5J3B A;  2RJD A;  1SG5 A;  3I5R A;  3CCM A;  2SEM A;  4JS5 A;  4R0K A;  2MF2 A;  3OYD A;  3JAM E;  4JUV A;  3VS3 A;  2EQI A;  5KYW B;  5CAI A;  1UGP B;  3L2W A;  1I81 A;  4CC7 A;  4M78 G;  2A7Y A;  1JB0 E;  1D1B A;  2HKN A;  5CKE A;  3J80 E;  3G6E T;  2PVG B;  1K9M U;  4HXJ A;  3KFV A;  4Y28 E;  4NS5 A;  4M7A F;  1IO6 A;  4C5E A;  2M9U A;  2JJ9 A;  4M77 A;  4OMO A;  1BKB A;  4M75 A;  4ZN3 A;  4OB2 B;  4YTL A;  5GAN 4;  4PJM A;  2EQJ A;  1ZBJ A;  2E4H A;  2YT6 A;  4KH0 B;  2PVD B;  5LJ3 g;  2AIR B;  3C12 A;  2A3L A;  1C1A A;  4J9I A;  1MUZ A;  4KGV B;  3NHN A;  2FRY A;  1EZZ B;  4C8Q A;  1OU9 A;  2LDM A;  4FIB A;  2EYQ A;  2H3J A;  3PT9 A;  3F70 A;  2K3X A;  1RAD B;  4OGC A;  5LJ3 e;  3CCS T;  1QKX A;  1YWO A;  2JXB A;  3JB9 G;  1TH7 A;  2L3P A;  2FZK B;  3GOX A;  2L3S A;  4KUI A;  1XJW B;  3CCR A;  1UGR B;  3QZ9 B;  3UDC A;  5DY9 A;  3QZ5 B;  5IHK A;  2ESW A;  3CBM A;  1PG5 B;  4DBH A;  3CCE Q;  2QGF B;  2KNB B;  5HY6 A;  4J9F A;  4BI4 A;  2EAY A;  1QVG P;  4JLI A;  3WVD B;  5C0M A;  1JEG A;  3VS6 A;  3E2U A;  4II1 A;  1ACM B;  4E47 A;  3G4S Q;  4ZN1 A;  1YJN Q;  3TEE A;  2LJ1 A;  2JT4 A;  1IRX A;  2FYK A;  1WGS A;  2ZPF B;  1IHW A;  1PM3 A;  2A08 A;  2CT4 A;  2V26 A;  2VV5 A;  1WHJ A;  4ME7 A;  5GAN h;  2EJG A;  3VS2 A;  2CP7 A;  2RPN A;  5GAN 8;  4F16 A;  4EMK A;  1K8A U;  5CO7 A;  2LQK A;  2IIM A;  1BBZ A;  1X2K A;  3DB3 A;  5KH6 A;  1YCS B;  1TG0 A;  5LL6 S;  1X27 A;  1PCX A;  1VQP T;  1ZHI A;  1IHV A;  2EYZ A;  4AFU C;  3CCU A;  4OMQ A;  1MV3 A;  3X28 B;  1KD1 R;  3CCM T;  3Q1J A;  5FLX E;  3G71 Q;  4LDX A;  2E41 A;  2DKG A;  2NUZ A;  3DLL A;  5DLQ E;  1B7T A;  4ZGJ B;  4C92 B;  5AYF A;  1W6X A;  1TWB A;  4A4G A;  3V8J A;  1MND A;  5GAN 7;  3GBQ A;  1B07 A;  3EGX B;  3LWH A;  2QEX Q;  3A8M B;  3E9G A;  1JO8 A;  3FB9 A;  3VRZ A;  3M4G A;  4DA4 A;  5EG2 A;  2DTO A;  3JCM g;  1Q82 U;  1S72 Q;  1PRL C;  2VUB A;  2AKK A;  4E7L A;  1VQL Q;  1WHK A;  1K0S A;  1A0N B;  4IIO A;  1WZO A;  4C5G A;  3LX7 A;  2VYT A;  5CQX A;  5D6X A;  3JCM e;  3CCJ Q;  4GBQ A;  4D8D A;  2JUF A;  4M7D A;  1PSE A;  4ZGE B;  1MMD A;  1MMA A;  1WFW A;  3M56 A;  1R0B G;  4QVD A;  1OEB A;  2M51 A;  2L2P A;  1IB8 A;  1VYU A;  3L2V A;  4HT9 A;  4E7J A;  2O4X B;  5KYU B;  3CC4 Q;  3RKW A;  1AD5 A;  2HQE A;  2PUK B;  4OMM A;  4HCB A;  3CCR T;  4C5H A;  2KEA A;  2K5I A;  1GL5 A;  3PIO A;  3R6N A;  1M5Q 1;  1B3Q A;  4A4H A;  1U1T A;  3H0I A;  4BE2 A;  2DYI A;  1G83 A;  1G3Y A;  1VQP Q;  4FSS A;  1QVG S;  4RTX A;  2KGT A;  2X4W A;  3CCM Q;  2LNH B;  4QVZ A;  1O75 A;  1UUE A;  2RQV A;  1BI0 A;  2JW4 A;  2DZC A;  1AT1 B;  2R5M A;  4J8O A;  3VYH B;  4F7U F;  4PJO E;  1JJ2 A;  1KC8 R;  2PNI A;  2RHX A;  1UHC A;  1E6H A;  2L3R A;  5LJ3 f;  3JCM c;  2DM1 A;  1VQ9 Q;  1T3L A;  5GAN j;  2KSS A;  2KQW A;  3A8O B;  3OYI A;  1B34 A;  2JZ2 A;  2WSC E;  2DZ9 A;  4XTW A;  1X6B A;  2DIL A;  3CCU T;  5KYN A;  5EC7 A;  1WHL A;  4RTV A;  3FIF A;  2HD0 A;  3OSV A;  3QJ6 A;  4M7A B;  4E7I A;  3TSZ A;  2YRC A;  1LVK A;  1BCO A;  4C0D C;  5IAY A;  1RAA B;  3JCM P;  2HAX A;  2O9V A;  1M8M A;  3OMG A;  2LT1 A;  3OS5 A;  1JXO A;  4JRP A;  2D1X A;  2GQI A;  3SB2 A;  4J9H A;  4RUG A;  3M57 A;  3RNJ A;  4B9X A;  2ENM A;  2A37 A;  2JNG A;  4XQ3 A;  3UWN A;  4CC2 A;  1YNZ A;  2HSE B;  2KBT A;  3BDU A;  2DIQ A;  1UB4 A;  4HCK A;  4IIM A;  3CCR Q;  1Q81 U;  1YHQ A;  5D6Y A;  2EGE A;  2L8D A;  2DF6 A;  1N8R R;  3MPU B;  3CME A;  3NTK A;  4AFS C;  3CC7 A;  4A4K A;  3EG2 A;  4QQD A;  1VUB A;  4BY6 B;  2V8J A;  2DL7 A;  1M90 C;  4EIK A;  4J9C A;  3HRS A;  1VQM Q;  1RUW A;  1GBQ A;  1M9S A;  4C0Z A;  4OMN A;  3A8L B;  5LJ5 h;  1M2V A;  2CSQ A;  1X75 C;  1H64 1;  1WPY A;  2EJ9 A;  2WSE E;  4X9C A;  1NJI R;  4CI0 C;  4M78 C;  3C95 A;  4DBQ A;  1G3W A;  1S1N A;  1NZ9 A;  3OYG A;  5HKC A;  4OGE A;  2OTJ Q;  2E1H A;  1WQ7 A;  4EDU A;  1Q86 C;  1WA7 A;  2EKH A;  5GMK l;  7AT1 B;  3H41 A;  3RIR A;  1VOM A;  1VQK A;  4J7I A;  4JPB W;  2KY9 A;  1WQW A;  3M0P A;  1FX7 A;  3RMQ A;  1BB9 A;  4LDV A;  2COW A;  2M16 A;  2YXY A;  3M58 A;  4JJB A;  1AOJ A;  3GPL A;  3M0Q A;  2EW3 A;  2JTF A;  3QII A;  3VRY A;  1UHF A;  3CPW A;  2M02 A;  2G6F X;  4EMH A;  4DBR A;  2EYY A;  1R0C B;  1RLP C;  4BI3 A;  1RAG B;  2JVV A;  1ABO A;  4J7F A;  3M4Y A;  4ZTF A;  2KXC A;  3SD4 A;  3S6W A;  2RQT A;  2M0O A;  4M77 F;  1HXD A;  2NUT B;  4DOV A;  4HT8 A;  1IZ6 A;  4A54 A;  2GFU A;  3MHX A;  2DER A;  3CCE A;  2GTJ A;  1UFF A;  1Y57 A;  5KE2 A;  2R58 A;  4O5V A;  3RUX A;  1YJ9 Q;  5FU7 B;  3LLR A;  4XK8 E;  5A0G A;  2QTV A;  4C92 D;  1M3C A;  1W2B A;  3X20 B;  2BTT A;  2YLC A;  4PJO B;  3JCM J;  3ZL7 C;  3CBP A;  1RAH B;  2ECZ A;  3G4S A;  4LUE A;  1YJN A;  2E6N A;  5GAO l;  1YFN A;  3ME9 A;  4LXC A;  1FMK A;  4F7U A;  1G8X A;  1XNI A;  2GF7 A;  3SHW A;  2B86 A;  3CC2 A;  3CCQ Q;  1N5Z A;  2QQB A;  1YHQ T;  4QKU A;  1BI3 A;  1Y07 A;  3VKI A;  1VQ5 Q;  5HK3 A;  3CME T;  2J6F A;  4M78 F;  3CC7 T;  2VGM A;  2LQN A;  2PU9 B;  4LNP A;  1HK9 A;  4OVA A;  3FJ5 A;  2DBK A;  2L0A A;  3RKX A;  4F04 B;  2BUD A;  3I55 Q;  3M5A A;  5CKD A;  3G71 A;  1D09 B;  2WSF E;  2ATC B;  2FPF A;  4M75 E;  1QQJ A;  1C6V X;  3L42 A;  4JS4 A;  5GAO n;  1VQO A;  2LVM A;  2JMC A;  5FU6 B;  5LJ5 j;  2A0F B;  2RB6 A;  2X4J A;  4KGZ B;  1M3A A;  1NLO C;  2QEX A;  2DRM A;  4HKE A;  2AT1 B;  1I0C A;  4C8Q E;  5FRO A;  2K6D A;  1D1A A;  1K73 C;  1ZSG A;  2LX9 A;  2RI2 A;  4JJC A;  1M90 U;  2VC8 A;  3L2Z A;  5CVI A;  1VQK T;  2RHI A;  2NYS A;  3EG1 A;  1VQL A;  2DD5 A;  3RDV A;  2CSI A;  5FW9 A;  3JB9 F;  1NPR A;  2F2W A;  1WIE A;  4CC4 B;  2V1R A;  3CCJ A;  1M4Z A;  3SWN C;  5J26 A;  2HBW A;  4ORZ A;  3EGU A;  1RL2 A;  2L3Q A;  2OTL Q;  3H0F A;  1Q86 U;  3G7Z A;  5GAN 6;  1KG1 A;  3V7C A;  4PL6 A;  3QJY A;  1Q7Y C;  3SEM A;  2XID A;  3OYL A;  3CC4 A;  2X4Y A;  1F1B B;  2OAW A;  3CCE T;  4BAC A;  3VUZ A;  3CD6 Q;  4IUT A;  3L1A A;  1M2O A;  1VA7 A;  2Z0W A;  3WXM B;  2FG0 A;  2DEQ A;  1I4K 1;  3BFM A;  2MWO A;  1Y96 B;  4VUB A;  3OW2 P;  1G3S A;  4OMF B;  3DB4 A;  4M7D F;  5GAN f;  3RES A;  3LWI A;  1KFZ A;  1Q82 C;  3OS2 A;  1QP2 A;  3G4S T;  4R56 A;  1YJN T;  4C8Q G;  3CXC A;  1VIE A;  3JCM d;  3OMC A;  1BYM A;  3EAE A;  1V29 B;  4RTW A;  3CC2 T;  2CUD A;  2CZ1 B;  1BI2 A;  3UT1 A;  4LE9 A;  4AG2 C;  2JS2 A;  3QWX X;  4MDW A;  3VS5 A;  1VQ9 A;  3EFO B;  2Y90 A;  1G2B A;  5A2Q E;  3NTI A;  4NL2 A;  3CCV A;  4CC3 A;  2YLB A;  3L2R A;  2LCS A;  5GAN 3;  1VQK Q;  4J9E A;  2GCX A;  2DK3 A;  4C92 G;  1WHG A;  1O9S A;  4FYW B;  3G71 T;  3EG9 B;  4Z8A A;  4HCC A;  3IQL A;  1ZA1 B;  2E12 A;  1LNX A;  2RHZ A;  1MGQ A;  1VQO T;  2YRV A;  3CCL Q;  3EHR A;  3J81 E;  2RD1 A;  4HVU A;  2YWW A;  5A0L A;  2HL3 A;  1EIF A;  2YUO A;  4MZM A;  4JDS A;  3DKM A;  2QEX T;  4FL6 A;  2I0N A;  3NFC A;  3N5B B;  2QYZ A;  3H6Z A;  2KRS A;  2J05 A;  2KK4 A;  3M53 A;  4IUR A;  2JM8 A;  1JRI A;  1OPL A;  1TUD A;  1S72 T;  1R8O B;  2HMA A;  1VQL T;  3NPF A;  1WX6 A;  2PQW A;  2X3W D;  4XTZ A;  2O2O A;  5GAM h;  4QW2 A;  1D0Z A;  4M77 B;  4M78 A;  4PNO A;  3L2Q A;  4M75 B;  4XTY A;  3CCJ T;  4M7A E;  1OZ2 A;  1KIK A;  4OB0 B;  1J3T A;  1KQS A;  2NUP A;  3J7A F;  4IUU A;  4BI8 B;  4HA8 A;  2E5Q A;  5KCH A;  4XTU A;  1K73 U;  3VS1 A;  3PTA A;  2DTH A;  3UAT A;  4OP0 A;  2EYW A;  2RQR A;  4JJD A;  3ULR B;  1VQM A;  2DJQ A;  1JXM A;  1XOV A;  4BDZ A;  4C8Q B;  3MP1 A;  3CC2 Q;  2XDP A;  3CC4 T;  5KYX A;  2HNI A;  3C4S A;  1RI0 A;  1WLP B;  4KGX B;  1TSF A;  4J6W A;  2KDS A;  2F2V A;  2OTJ A;  4ZGD B;  2DLP A;  1X6O A;  2XK0 A;  2ZPE B;  2F5T X;  1UGQ B;  2R57 A;  1NE8 A;  5I21 A;  3OW2 S;  1Q7Y U;  4L5G A;  1KHC A;  1Q81 C;  5GAM d;  1WHM A;  1ZSZ C;  2EYX A;  4FSX A;  4OB3 B;  3S3N A;  4PJO D;  1VQO Q;  2SRC A;  4L59 A;  3EG0 A;  1HD3 A;  4V2S A;  3VJP A;  3BDL A;  2DEU A;  1G5V A;  3M59 A;  2P0P A;  2CKK A;  2DXB A;  4JJN K;  1UGS B;  5FWC A;  4N4G A;  1QVF A;  2VKN A;  2ZPH B;  2RF0 A;  1VQ9 T;  5CK9 A;  3VV0 A;  2G3R A;  2DL4 A;  1VQ6 Q;  3REB B;  1M27 C;  4M7A G;  2GFA A;  1UJ0 A;  1M1K R;  3OYK A;  2DL8 A;  5KYY A;  4EMK B;  2RQW A;  1GCP A;  2GQV A;  2QQS A;  5GAO p;  3TU4 K;  3FDR A;  1LCK A;  4Z02 A;  3CMA Q;  1YJ9 A;  1UE9 A;  3EGD A;  5D7U A;  2ROT A;  4ZTJ A;  3VS4 A;  5C6S A;  2DNU A;  1NJI U;  3SDZ A;  3E1S A;  1K9M R;  1TOV A;  2QQ9 A;  2DAQ A;  3RR6 A;  4D8K A;  1MMN A;  1T3S A;  2V1Q A;  3CEY A;  5ECA A;  2DYB A;  2LCL A;  2GGR A;  1W70 A;  1KK7 A;  1H8K A;  2EJF A;  4XTV A;  5GJW B;  4ELY C;  1EX4 A;  3CCQ A;  1OV3 A;  4IUQ A;  2FZC B;  1NYG A;  1VQ5 A;  1YN8 A;  2OX7 A;  5LJ5 f;  2HEQ A;  2CH4 W;  1MNE A;  2DIG A;  1N9S A;  2NLU A;  2H3E B;  5M9O A;  2YSQ A;  2O9S A;  2RI5 A;  1K9A A;  4N4H A;  1NEB A;  5D6W A;  2ED0 A;  3I55 A;  4E7H A;  1P92 A;  4D6W A;  1RAC B;  1VQM T;  2LQW A;  3OS0 A;  4M7D B;  2JMA A;  2MYS A;  4EMG A;  2R5A A;  3INZ A;  4MDX A;  1D3B A;  3SWN A;  3EG3 A;  4PJJ A;  2AZS A;  1ZX6 A;  3ZBD A;  3OS1 A;  3CCV Q;  2KVQ G;  2RK2 A;  2OTJ T;  2GTO A;  1UDL A;  2E5K A;  3QDF A;  3FC3 A;  1AWJ A;  2K2M A;  5KCO A;  1NG2 A;  1K1Z A;  2RO0 A;  1X6G A;  3NMZ C;  1ZBX A;  1BK2 A;  2E64 A;  2LP5 A;  2RHU A;  4L6V 5;  4XAX B;  3R6O A;  1SSH A;  3LH5 A;  1N9R A;  1QWE A;  2KAF A;  1CSK A;  2HCK A;  2J6O A;  4MML A;  3TVT A;  1OOT A;  1OU8 A;  2X35 A;  5DLO A;  1U8R A;  3X24 B;  2OTL A;  1K8A R;  4LDU A;  4HCZ A;  1GXI E;  3V7R A;  2GNC A;  4FM4 B;  1FMW A;  3QXE B;  3D7S B;  1UEC A;  3PIP A;  3OY9 A;  1VQ4 Q;  1N6A A;  1HYO A;  2FPD A;  2ZAE A;  1QCN A;  4F7U E;  3HKS A;  5GMK h;  2O88 A;  3CD6 A;  2E10 A;  3V8K A;  1B34 B;  1FXX A;  1WYX A;  1TUG B;  1X2Q A;  1YJ9 T;  1WNL A;  2CP5 A;  4PJO G;  3HTR A;  4ELZ C;  3ZEH A;  3P8H A;  4JZ4 A;  3MCA B;  2LJ3 A;  4E6R A;  2F1L A;  4RG2 A;  1IGQ A;  2QAS A;  1PD0 A;  4KH1 B;  1Q82 R;  2FRW A;  2DO3 A;  3JCM Q;  2DTI A;  4OMP A;  3CCQ T;  5GAN g;  1XQH A;  2KRO A;  1QVP A;  1T0H A;  1QVF P;  2E3H A;  4RKU E;  1VIF A;  2BZX A;  2F69 A;  1QP3 A;  5A0D A;  2RJE A;  2F2X A;  5I2S A;  1VQ5 T;  3GNF B;  3QSU A;  2RJF A;  1AVZ C;  2LMJ A;  4JZ3 A;  5GAN e;  3JCM W;  4M75 D;  3JRZ A;  4E7Z A;  1AWO A;  3I55 T;  2P4T A;  3PMT A;  4RTT A;  4GLK A;  4C92 C;  4DEX A;  1QCO A;  2CP0 A;  8ATC B;  3HP9 A;  1KD1 C;  2MPX C;  3CCL A;  3LYI A;  2FVU A;  2XDB A;  2D0Q B;  1RAI B;  4C8Q D;  3U23 A;  4FT2 A;  3JSC A;  5LJ3 h;  5IXB A;  1M2V B;  1SSF A;  2MWP A;  2CP2 A;  3HHT B;  4GY5 A;  1YIJ Q;  4WTO B;  6AT1 B;  5CQY A;  3THK A;  3UPU A;  1YWP A;  2E70 A;  2RI3 A;  3MJX A;  2M1H A;  2AKL A;  1T0J A;  1EFN A;  4RG8 A;  2ZPG B;  3MP8 A;  1UTI A;  2C0I A;  1U06 A;  1ZUK A;  2LC4 A;  1K0X A;  2YHT A;  1VQN Q;  2OTL T;  4O6J A;  4AG1 C;  2EQK A;  2EQM A;  4A53 A;  5IXF A;  3GIB A;  3MKD A;  1JJ2 P;  1ZSZ A;  2J06 A;  1IRE B;  1PKT A;  1W4S A;  3A1P A;  1PD1 A;  4HVV A;  1IXD A;  2LX7 A;  2OI3 A;  2A28 A;  4AMC A;  1R77 A;  5LJ3 d;  2DL3 A;  3L2U A;  3CD6 T;  4PK4 A;  2LRQ A;  2VGN A;  3GP8 A;  4X1V A;  2JS0 A;  3QDR B;  1SF9 A;  1VYV A;  3H0H A;  4C0G A;  3AT1 B;  2AZV A;  1FMV A;  1NLP C;  2A36 A;  5I11 A;  1BCM A;  3LGL A;  9ATC B;  4E7K A;  4M77 E;  2H8H A;  1YJW Q;  1I8F A;  4LN2 A;  5CR2 A;  1U3O A;  2XIC A;  3S3M A;  1AZG B;  1ABQ A;  1QVG A;  3HFN A;  4CRI A;  2MMP A;  1ZUU A;  4X34 A;  4C92 F;  2CZ0 B;  1YP5 A;  3M0T A;  1Q81 R;  2OJ2 A;  5HK0 A;  1SKU B;  3QYG B;  4KT0 E;  2D6F A;  1PSF A;  3UF4 A;  1KC8 C;  1LOJ A;  1YCY A;  1QVF S;  2KYB A;  3FRN A;  4F7U B;  2KI7 A;  1RAF B;  2YRD A;  5IHI A;  2DMO A;  4BE1 A;  1ZA2 B;  1VQ6 A;  2CYZ B;  3ER0 A;  4LD6 A;  2I2L A;  3MET A;  1SRL A;  2K57 A;  1G3T A;  4M7A C;  1Y0M A;  3I5S A;  4QQ6 A;  3JCM X;  1WHH A;  3E9F A;  4J6Y A;  4JLG A;  2DXU A;  2P0K A;  3UA7 A;  3OYJ A;  1BIA A;  1HSQ A;  1I5L A;  3CMA A;  3CQT A;  3CCL T;  3JCM h;  3VS7 A;  1JBM A;  2QGG A;  3TRE A;  1VQ8 Q;  4M78 E;  1NM7 A;  3JB9 I;  1LPL A;  1MV0 B;  4PLI A;  1CKA A;  4P5N A;  1VQ7 Q;  4KUL A;  4BD3 A;  2RJC A;  1NEG A;  3TSW A;  2IPO B;  2CH4 A;  2XD0 A;  4QVC A;  4J5Y A;  4MZT A;  2ROL A;  1AHJ B;  1GBR A;  1I1J A;  1PC0 A;  3WVE B;  5KYW A;  4B9W A;  3I35 A;  2GBQ A;  2E3I A;  1KD1 U;  1N27 A;  4M77 G;  1X69 A;  4XU2 A;  4M75 G;  4M7A D;  3M0U A;  1QKW A;  2V8I A;  1YIT Q;  2EIF A;  2PUO B;  3PFS A;  3OA6 A;  3ZFJ A;  2QDL A;  2XMF A;  4BY6 C;  2CZ7 B;  2HDA A;  1U5S A;  3QHS A;  2EWN A;  1M1G A;  3HPW A;  3EFS A;  1RAE B;  3A98 A;  2MK5 A;  1DJ7 B;  5FRN A;  4KBM B;  4QT7 A;  5GAN 5;  2LZ6 B;  5LJ5 g;  1HJD A;  3CPW P;  2AHJ B;  2HQH A;  3VUB A;  4FYV B;  4J83 A;  4J9D A;  1JJ2 S;  1E7O A;  2MIO A;  4R55 A;  3CBO A;  3HL8 A;  4RTU A;  1NJI C;  1QW1 A;  5LJ5 e;  1Y71 A;  2C0O A;  1D1C A;  1IGU A;  3C0C A;  3ASK A;  4LD9 K;  1UG1 A;  8AT1 B;  2VB6 A;  2FPE A;  3I56 Q;  2KT8 A;  1OQK A;  3MP6 A;  4IKF A;  3QBY A;  3G1J A;  2BZY A;  4JRK A;  1TTH B;  1GFC A;  2KRN A;  3PE0 A;  1W2B P;  5FWB A;  1OYX A;  2VWF A;  2D8H A;  1KQ2 A;  1V1C A;  5GJV B;  2VXE A;  2DRK A;  4M7D E;  2K4Y A;  2K3B A;  3JCM b;  4RMO A;  4C0D B;  1PNJ A;  1VQ6 T;  4AFZ C;  3FJP A;  1KJW A;  1WDX A;  3RKY A;  1VQ4 A;  3A8H B;  3O8V A;  1I5O B;  2QAZ A;  4X9D A;  2CUB A;  2EFI A;  1WJR A;  1YI2 Q;  3EFR A;  4J9B A;  2HBP A;  5FU7 C;  3GF5 A;  3OBW A;  3CMA T;  5GMK m;  1OI1 A;  1KC8 U;  4PJO C;  2WAC A;  2K9G A;  2OAU A;  1AEY A;  5CKB A;  3OB9 A;  2XI9 A;  4BE0 A;  4RTY A;  3OYM A;  4B6M A;  3REA B;  2RK1 A;  2K7A A;  4LDW A;  2HSP A;  4LDY A;  1M30 A;  4F14 A;  2K5F A;  4C92 A;  4Q5W A;  1SHF A;  3URG A;  1M90 R;  4FT4 A;  2O31 A;  3OBY A;  2FO0 A;  2QA4 A;  1RI9 A;  2PZ1 A;  2DL5 A;  2ZZD A;  3AHU A;  3EGX A;  1XTD A;  3HSB A;  1JU5 C;  4PFZ A;  2QI2 A;  1UJY A;  4F17 A;  2DD4 A;  3G6E Q;  3UA6 A;  1Y7X A;  1Q86 R;  3KXT A;  4M7D G;  2NWM A;  2VVK A;  4GLM A;  4M78 B;  2COY A;  2P4R A;  5L23 A;  3M55 A;  2QK0 A;  2FEI A;  2NUP B;  5FU6 C;  2CRE A;  4OF1 A;  2B8A A;  3OYN A;  3CPW S;  1QWF A;  1KQ1 A;  4J6X A;  2XDD A;  1GCQ C;  1V76 A;  3MEW A;  1N8R U;  2V8K A;  5GAO m;  2X4X A;  3PNW C;  3RER A;  4XU0 A;  3BW1 A;  3CCV T;  5KYX B;  2HKQ B;  2YUQ A;  4MZP A;  2O4X A;  4PKC C;  1YIJ A;  5CCA A;  4A63 B;  5KYU A;  1M3B A;  1OZ3 A;  2HQX A;  3CCS Q;  1BU1 A;  2J6K A;  1TUC A;  3A8G B;  2Y4X A;  4BUG A;  2E65 A;  2C06 A;  4PFO A;  1MHN A;  3V8L A;  1WXT A;  1W2B S;  5GAN d;  5IH2 A;  3CXC P;  1VQN A;  2HL5 C;  4PJO F;  1TXQ A;  1UGV A;  2L5Q A;  2DXT A;  2FZG B;  3T9N A;  3QO3 A;  4N0A C;  1D0Y A;  1OPK A;  1AWW A;  1FYN A;  4XU3 A;  4A4F A;  2QDY B;  1GRI A;  1VQ4 T;  3QKJ A;  4Z89 A;  2K2V A;  4N4I A;  2O01 E;  2RN8 A;  4OB1 B;  1ZQ1 A;  3EH2 A;  4UC4 A;  4DOW A;  1Q95 G;  2CP3 A;  4E2F B;  5GAM j;  2W0Z A;  5FRM A;  3MEA A;  5KYY B;  2MCN A;  1ARK A;  1TU0 B;  2C0T A;  2LJ0 A;  1YJW A;  4M7A A;  4IUV A;  3EGD B;  1C0M A;  1BIB A;  2DVJ A;  4AFQ C;  2VAS A;  2KXD A;  1I07 A;  4PJN A;  2EGA A;  1FWZ A;  2KYM A;  2QA4 T;  2DET A;  3HFO A;  4DEY A;  3QWY A;  2BZ8 A;  3TCJ A;  4TVR A;  1H3H A;  3EH1 A;  1Z9Z A;  3OQ5 A;  3VYG A;  3H9N A;  2IVW A;  4MMK A;  4HVW A;  2DPP B;  4ESR A;  1NPP A;  1NYF A;  3NTH A;  1K73 R;  2EVR A;  4FW1 A;  1KHI A;  3MO8 A;  1MMG A;  1VYT A;  1KQS P;  2LT4 A;  2D8J A;  1PRM C;  4XU1 A;  5CKF A;  2QXF A;  2YUN A;  1AWX A;  4XTX A;  1VQ8 A;  5CIU A;  1TS9 A;  2CS7 A;  3EHQ A;  3P8B B;  1GFD A;  3DLM A;  2P0Q A;  2Y4Y A;  4Y91 A;  3KUF A;  5I2M A;  3LH0 A;  2KMT A;  1VQ7 A;  1RLQ C;  2K79 A;  2KR3 A;  3JCM V;  5IN1 A;  1SPK A;  1D3B B;  1YIJ T;  3SWN B;  2RQU A;  4LUD A;  1Q7Y R;  3JB9 H;  3KBG A;  2DBM A;  4M77 C;  5GAM g;  2FB7 A;  2RA2 A;  4M75 C;  4BB7 A;  4K11 A;  3NGP A;  3MEV A;  2KE9 A;  3GNG A;  1YIT A;  1YBY A;  5L8R E;  2EPD A;  2EQU A;  2XU8 A;  2M0Y A;  3OYB A;  2VXF A;  1VQN T;  3QG1 A;  5GAM e;  2K5L A;  2IG0 A;  2LCC A;  4AT1 B;  4C8Q C;  3CXC S;  2LQ8 A;  5AT1 B;  4RCC A;  2BIV A;  3E19 A;  2QA4 Q;  3OYE A;  2XHC A;  3X26 B;  4J9G A;  1W1F A;  1AZE A;  3OYY A;  4ZNX A;  2ZPI B;  3BE3 A;  4ATO A;  1X01 A;  3M9Q A;  4PFP A;  4M77 D;  4C0F A;  3RMS A;  2YUP A;  3OYH A;  5KE3 A;  2NUT A;  2QQA A;  4JRQ A;  1BI1 A;  3QYH B;  2EBP A;  3I56 A;  1YJW T;  4DQ2 A;  4EPC A;  2RM4 A;  5IT9 E;  3CCU Q;  4WCI A;  3OW2 A;  1LJO A;  1UEB A;  1WJS A;  4F7U G;  1M8V A;  2COZ A;  1QMC A;  3VS0 A;  4PJO A;  3JV3 A;  1WI7 A;  1D0X A;  2D9T A;  2E6Z A;  3JCM f;  1E6G A;  2DJZ A;  3HRU A;  4EMK C;  4NL3 A;  4KRT A;  5GMK i;  4IUP A;  2AK5 A;  1H3Z A;  4C5I A;  5DM7 R;  1M1K C;  1YI2 A;  2CP6 A;  2JM9 A;  5LJ5 d;  3BY7 A;  3P8D A;  4M78 D;  1NBE B;  2QQR A;  3M0R A;  1WJQ A;  3O5Z A;  1ZUY A;  3PGG A;  3V7S A;  1KQS S;  1VQ8 T;  4M75 F;  1SRM A;  3OSS C;  2XKO C;  5I22 A;  3A5Z B;  2JTM A;  1VQ7 T;  2FHD A;  3LGF A;  3PVQ A;  1K76 A;  4M4Z A;  3GLX A;  5GAN 2;  1K9M C;  1Z9Q A;  2CDT A;  2DFU A;  4FCY A;  4FYX B;  2JTE A;  2CZ6 B;  2RMO A;  4C8Q F;  2BE7 D;  2RNA A;  3SFM A;  2F5K A;  5IHN A;  5J39 A;  4JRI A;  3H8Z A;  4NOY A;  3M0S A;  3M54 A;  2D0N A;  1CKB A;  2EKO A;  1GCQ A;  2X3X D;  5GMK j;  1H92 A;  2MAM A;  2DX1 A;  1U1S A;  1YIT T;  1OUL A;  1PWT A;  3G6E A;  1X43 A;  4Y92 A;  1WXU A;  2MI6 A;  2MOX A;  5CKH A;  3CPF A;  3JB9 D;  3FLG A;  4RTZ A;  3JB9 J;  3QPH A;  4M7D C;  5HCK A;  4BDY A;  2DA9 A;  1K4U S;  3TQ7 P;  3HRT A;  1JQQ A;  4Z88 A;  1M1F A;  3OYA A;  1ZLM A;  3OYC A;  2J7I A;  2P84 A;  3PMI A;  5GAO q; 
#chains in the Genus database with same CATH homology
 3BE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...