3BE3A

Crystal structure of a protein belonging to pfam duf1653 from bordetella bronchiseptica
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
77
structure length
77
Chain Sequence
MQDFRPGVYRHYKGDHYLALGLARADETDEVVVVYTRLYARAGLPMSTRLLRIWNETVDTGAGPQPRFAYVGHVTPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a protein belonging to pfam DUF1653 from Bordetella bronchiseptica.
rcsb
source organism Bordetella bronchiseptica rb50
molecule tags Structural genomics, unknown function
total genus 12
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07866 DUF1653 Protein of unknown function (DUF1653)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.320 Mainly Beta Roll SH3 type barrels. DUF1653-like domain 3be3A00
3BE3A
chains in the Genus database with same CATH superfamily
3X20B 3JCMX 1HSQA 5GAOl 4PJOC 5GAMh 1K73C 2QDYB 1VQ9Q 1W70A 1Q82R 2LDMA 2EYQA 4KH0B 4C8QB 3CCQQ 2JTEA 4BI8B 2LCSA 2WACA 3WVDB 2J06A 3EHQA 2E64A 2LQWA 4RTYA 2Y4XA 5GAN5 1D0YA 1P92A 1VQ8T 2WSCE 2KROA 4OMPA 1RLPC 1LOJA 2KI7A 5DLOA 2EGCA 3CCUQ 4IURA 1BK2A 1MV0B 1ZUKA 2DF6A 1TUGB 1WHLA 1WXTA 4FYXB 4E7ZA 3JB9H 3P8DA 1QVFP 4KGZB 1AWOA 2PZ1A 5A0LA 5FRNA 2E65A 2RQUA 1WZOA 3UT1A 1X27A 1MMDA 2DA9A 2AKLA 2LC4A 5IHKA 2CP2A 2ED1A 1MNEA 4BE2A 3ZBDA 2RQWA 1U1SA 3LYIA 5A0DA 4A4EA 1G3WA 2DL8A 4HCCA 4PJOB 1FXXA 1K8AC 2EQJA 2X35A 4PLLA 2FPEA 4ELYC 2DNUA 4JJDA 2M1HA 4A4FA 2R5AA 4DEYA 5CKHA 5CKDA 3SDZA 4E7HA 1K73R 1YJWQ 4JJCA 2ESWA 3M55A 5GMKj 3P8HA 3RBBB 1X2QA 5J3BA 4VUBA 1M90U 4X9DA 4R0KA 1D09B 2CT3A 1XOVA 1AWXA 4OF1A 2DTOA 1SRLA 4C8QD 1R0CB 3HFNA 1V1CA 3OW2P 2RNAA 2XMFA 3A1PA 2EWNA 1I5OB 1K9MU 3Q1JA 4JZ4A 5KCOA 3HP9A 3M5AA 2MPXC 2PUKB 1YJNQ 2CS7A 4ZGJB 1CKBA 1PG5B 4LUEA 1HK9A 3SWNC 3QJYA 2CZ1B 2DRKA 2QGGA 1PRMC 3L2RA 2JVVA 1GXIE 2A36A 4PJLA 3RERA 3QZ5B 3R6NA 1U06A 1FMVA 4QQDA 4E47A 4C5IA 1Q81R 3UPUA 1Y96A 3CD6Q 4C5HA 3CEYA 4C0ZA 3CCMA 3UA6A 1M2VB 1UE9A 4FW2A 3FC3A 1UGVA 4PLIA 4PJOD 3SB2A 1WHMA 3CCJQ 3CC4A 2KE9A 2OAWA 1O75A 2CUBA 4M77E 1T0HA 1UDLA 5ECAA 1ZSZA 2CUDA 3QSUA 1TG0A 1YFNA 5D6XA 3V8LA 4Z8AA 5HK3A 1M2OA 1XTDA 2RH2A 2GCXA 4CC4B 1KQSP 5LJ5f 3CPWS 1G2BA 1ZSGA 1WJSA 1FX7A 4C92F 2AZSA 3JB9G 3NTKA 5FLXE 1YHQA 3SWNB 2RN8A 4DOVA 1TH7A 2E10A 4M7DE 2YUOA 1VQ8A 4C92G 5KYYB 3EH1A 2HKNA 1RI9A 2K3XA 1PD0A 4F7UA 1VQ7Q 1EIFA 1OPLA 1UGRB 4GY5A 2DO3A 1B34B 1IO6A 4KULA 3L42A 5LJ3e 1WHKA 2HNIA 3NTHA 9ATCB 1T3LA 2O31A 2XHCA 5GAMg 2QTXA 2KR3A 4L6V5 4ORZA 4J9DA 3CCRA 3MKDA 1WLPB 1D3BA 1TUDA 5FU6C 4M78A 2LTOA 3U23A 3HRTA 1I81A 1X6GA 1BCOA 1I1JA 2K3YA 4MZTA 4IUPA 2OTLQ 1I4K1 3X26B 4FL6A 4B9XA 3J7AF 5LJ5h 4L59A 1WFWA 1QCOA 2EYXA 2YLCA 2HAXA 3EFOB 2EFIA 2XI9A 4QQ6A 1WJQA 2CP5A 3EGXA 3RIRA 1NZ9A 1R8OB 3QYGB 3G6ET 1TOVA 1NBEB 3DB3A 3G71T 3EG2A 4HCZA 4N0AA 8ATCB 4FT4A 1WI7A 1RAHB 2RHIA 4LUDA 3LLRA 3M58A 2DL5A 3QIIA 4M78F 3UATA 2K79A 3C95A 3CPWA 1MMGA 5KH6A 2K4YA 3LH5A 4LXCA 4JDSA 4M75F 2HD0A 1B7TA 2EQUA 1ARKA 3A98A 2COWA 1I8FA 1VQ9T 1BI2A 4J9IA 4DOWA 2HMAA 3VRYA 5CAIA 3CCQT 5FU6B 2BE7D 2EQIA 3HRUA 1QKXA 3EFRA 2E41A 4M75G 4KRTA 4C5GA 2QQBA 1T3SA 4M7AF 4L5GA 1N5ZA 3H0HA 1ZUYA 2OTJA 1TTHB 3CCUT 1S72T 4RKUE 1KIKA 1M90C 2DEQA 4OMMA 1ZBXA 3CCVA 1E6HA 1OQKA 4CC2A 4GBQA 2E6ZA 4AFSC 1M3AA 4F16A 1VQNQ 1EX4A 2R58A 2CT4A 3CCLQ 3QG1A 1XQHA 1JJ2P 3CC7T 1K9MC 3NMZC 3OYCA 2EGEA 4X9CA 3WVEB 1KK7A 4FIBA 1G83A 4AFUC 1M8MA 1HXDA 2QG9B 2DJQA 1OU9A 4QQGA 3KFVA 2P0QA 3VV0A 2J7IA 3G4SA 4QT7A 2L5QA 1RABB 4HVWA 1ZSZC 2QDLA 2ECZA 1YJWT 3MCAB 3S3OA 5CIUA 3OS2A 4QVZA 1OV3A 3OBWA 2HL3A 2DEUA 5FROA 2EQKA 2KXDA 1VQMQ 2FHDA 2YLBA 3JB9J 1OZ2A 3MO8A 2ZPBB 2DIGA 2LNHB 4LDWA 1AZGB 3GNFB 2DBMA 4E7SA 1Q81U 1AZEA 3DKMA 1UGSB 2V8IA 1V76A 4O5VA 1M3BA 1QVPA 2OX7A 4C8QG 7AT1B 1Y96B 1IRXA 2W0ZA 5DLQE 1M90R 2FL7A 3PFSA 2M51A 1RLQC 5C0MA 2G3RA 1VQOQ 3N5BB 2YT6A 2DBKA 2OTJQ 1H92A 1OX8A 1MGQA 3LGFA 4XU1A 3RUXA 1NJIC 2CZ6B 4PFPA 3EAEA 5EG2A 5KYXB 2RM4A 1QKWA 4NOYA 3OY9A 1G3YA 3BDLA 2LQ8A 1IHVA 1QVFS 3PNWC 5LJ3f 4M78C 1ZSZB 3EGDA 2ROTA 2VUBA 4J6WA 2ZPHB 3A5ZB 2YRVA 3CCJT 2FZCB 1PNJA 2LMJA 3G6EA 1OX9A 2ED0A 3VS3A 2RI3A 2NUZA 2EBPA 5CQXA 3G4SQ 2QK0A 4M7AC 5LL6S 1SEMA 4DQ2A 1W2BA 2CH4A 1PWTA 4II1A 1QWFA 2H8HA 2RJCA 3J80E 5GANd 4RMOA 4K11A 3C4SA 4F7UB 5LJ5g 5D6YA 1VQ9A 4C0GA 2A7YA 4QVCA 2KT1A 3CCQA 1YI2Q 3X24B 4FW1A 5FWBA 2V26A 5GMKe 3I9QA 3HHTB 4PJJA 2DYIA 5GMKm 4JS4A 2FYKA 1VIEA 3EH2A 2GF7A 3CXCA 1D3BB 2JZ2A 4OB2B 3OYIA 5LJ3h 1KD1U 3OW2S 2NUPB 3KUFA 3OB9A 1X75C 4F04B 2RB6A 2YUQA 2HQEA 4GLMA 3PVQA 2M16A 2DZ9A 2VXFA 2KY9A 5IN1A 1TS9A 1U1TA 2P4TA 5GAN6 4BUGA 2CREA 3PGGA 2LX9A 3EGXB 5CKBA 3QDFA 2QYZA 1C0MA 3V8JA 2QQAA 1KQ1A 4HVVA 3A8LB 1M1FA 1CSKA 1ZUUA 3I55Q 4DEXA 4NL3A 2KMTA 2KVQG 4F14A 2K2VA 1SSFA 1RACB 1BYMA 3G7ZA 1H3HA 4OMLA 4E7LA 1N6AA 4NL2A 2HKQB 3QKJA 1WQ7A 3UDCA 2DK3A 2EGAA 4PJOE 2YSQA 4JLIA 1KQ2A 2JJ9A 4RTWA 5GANh 1JB0E 4RUGA 4O6JA 1W2BP 1PHTA 5IXBA 5DM7R 2DTIA 4OMOA 3V8KA 4AFQC 1T0JA 2YXYA 1QVGS 4BY6C 3OMGA 1YHQT 1KQSS 2RMOA 4M78D 3HTRA 2PVDB 2F2WA 3I56Q 3OYYA 1YJNA 3CCEA 2DLPA 3HPWA 1WIEA 1E6GA 3H9NA 2V8KA 4Y92A 2O01E 3VYGA 4RCCA 4ZTJA 3C12A 4P5NA 4PFZA 1U8RA 2MYSA 3QUIA 3A8OB 3PE0A 4HT9A 3HKSA 2ABLA 3JSCA 1NPPA 3CD6A 3SFMA 3QO3A 4MZMA 3CCRT 4MDXA 4CC7A 4M7AD 2COZA 4WTOB 2KRNA 2KNBB 2VWFA 3ME9A 3MJXA 4EMGA 2D1XA 2MIOA 3URGA 1Q81C 2DM1A 3CCJA 2G6FX 3M56A 5GAN4 1VIFA 3CCLT 3C94A 2O9SA 2RQTA 4J9CA 1RAGB 4M77G 5GMKl 3QZ9B 4OB0B 2DL4A 1D1BA 1WHHA 3WXMB 4BY6B 2COYA 2AZVA 2E4HA 1BKBA 4ZGDB 1SF9A 2E5KA 1K76A 2ZPIB 5CO7A 4M7DF 2ZAEA 2L3PA 1M4ZA 1D0XA 2E70A 4F17A 1QCNA 2FO0A 3BFMA 4RTZA 3VS2A 1B3QA 1RAFB 4D6WA 2PVOB 1WDXA 2I2LA 2VASA 3MEUA 2IIMA 4M7DG 1UUEA 2VV5A 1WXBA 1VYUA 2J6KA 1QVGA 4IUVA 4AG1C 2BE9B 1VQMT 2BKDN 3CC2Q 3FIFA 2A0FB 2DL7A 1VQ7A 1TU0B 4NS5A 3VYHB 2CP3A 5CK9A 3QDRB 3UA7A 3CBMA 5IT9E 3CCEQ 3PMIA 1MV3A 4UC4A 2HQHA 1ABQA 2EPDA 2YWWA 3EGDB 4Z88A 4Z02A 4QKUA 4XK8E 2XDDA 2QA4Q 2OTJT 1PD1A 3ASKA 5HK0A 2DRMA 4XAXB 2RHUA 2DX1A 1VQ5A 2OJ2A 4C92A 5KE3A 4HA8A 1NLPC 1BI3A 3REBB 2OTLA 2GQVA 3OYDA 3CCVT 1I0CA 1PCXA 1KHIA 2Y90A 2D8HA 1QLYA 3TU4K 3BW1A 4DA4A 2ZGWA 2LCLA 5LJ3g 4HVUA 3M9QA 3RKXA 3ULRB 1KD1C 3EG0A 4JRQA 5CVIA 4FM4B 4J6XA 3M53A 3ZEHA 1YIJQ 2H3JA 1VQLA 3JB9F 1JJ2S 4OMNA 4BB7A 3RKWA 3UWNA 2XU8A 1E7OA 2M9UA 4JZ3A 1WXUA 3OQ5A 3G4ST 4OB1B 2NUTA 2SRCA 2EAYA 1PC0A 2QGFB 4XU0A 4JS5A 3JRZA 2A3LA 3OBYA 1ZLMA 2XDBA 4HKEA 2DD5A 2RHYA 2VYTA 2LJ0A 2XDPA 5GMKh 4FYVB 3CMAQ 1BI0A 1GRIA 2L3QA 1Q7YR 1YI2T 4LNPA 3SEMA 1NEGA 3JCMc 1AVZC 1VA7A 4EMKA 1BU1A 1ACMB 2D0NA 2MK5A 2X51A 3HFOA 5GAOn 1PSEA 2JXBA 5GANg 5IH2A 3JCMP 1Z9QA 2DL3A 5A0GA 2L3RA 2BZ8A 1UTIA 1UG1A 4J9EA 3MP8A 4ATOA 1VQ4Q 2X3WD 2LX7A 2IPOB 3L2QA 3OYLA 2L0AA 1WPYA 5A2QE 1VQ5Q 1I5LA 3L1AA 1VQNA 1AHJB 3LWIA 5FW9A 4M75A 1KD1R 2I0NA 3QJ6A 1OOTA 3CCLA 1SPKA 3MP6A 1H641 2C0OA 2X9HA 3OYJA 2GQIA 3I35A 3L2VA 4J8OA 1DJ7B 1J3TA 2JS2A 3I5SA 5D7UA 3JB9I 3I55T 2H3EB 4M7AA 1RAIB 1VQLQ 1QQJA 4Q5WA 4XTYA 2K5FA 2DJZA 3OYEA 1MUZA 1JO8A 3EG9A 2V1QA 1YWPA 5GAN2 5GANe 3OYAA 1JEGA 2ZZDA 1YWOA 1SRMA 2FRYA 1AD5A 3VS6A 3E19A 4B6MA 2V1RA 4BDZA 1VQMA 5KE2A 2YHTA 3E9GA 2KXCA 2O88A 4F7UG 2MMPA 4Z89A 4MZPA 4BDYA 2LT4A 1WHJA 2C06A 5KCHA 3AHUA 2GTJA 1F1BB 3OYBA 1M1KU 3J81E 2FVUA 2GFAA 3GP8A 1VYTA 3TCJA 3I56T 5I2SA 2M0OA 1VQOA 2K7AA 2DD4A 3ZL7C 4OGEA 3RKYA 2DTHA 3VS7A 1SHGA 1IREB 3OYGA 2EYYA 4OB3B 1XNIA 4HT8A 3OS0A 3V7SA 3NTIA 2MWOA 2QTVA 2EYWA 1KHCA 3TEEA 4IUTA 5C6SA 4C92C 5GAN8 1K0SA 4C0DC 3CBOA 3M54A 5CR2A 2D9TA 2ROLA 1ZA2B 1GFDA 4CI0C 1TWBA 2HZYA 4FT2A 4HXJA 1G8XA 2DXBA 2AHJB 4R56A 2RHXA 3A8GB 1WNLA 2KSSA 2XIDA 4JJBA 2JTFA 1Q95G 1YN8A 1Y7XA 2HL5C 3SD4A 3E1SA 1Y71A 2EJGA 3CPWP 1RAAB 4C8QF 1YI2A 4ZN3A 1YCSB 3M0RA 3EG3A 1QP2A 5L23A 1X01A 4J9FA 1U5SA 3BDUA 4F7UE 3CC2T 2K3BA 3OMCA 1MMAA 1BB9A 4C92B 1NYFA 3CMEA 4EMKC 2ZPEB 3JCMJ 1YJNT 3CCET 2LJ1A 4FYYB 4HCKA 2HQXA 4BE1A 5IAYA 1IXDA 4N4IA 2JUFA 5EC7A 4M78E 3TQ7P 1OPKA 2QA4T 4V2SA 4EDUA 2NYSA 3M0QA 1QCFA 4ANJA 4OP0A 3L2WA 4EPCA 3M57A 3PIOA 2GBQA 4XTXA 1PSFA 4A53A 2EIFA 3OYFA 3CCSA 3CD6T 1GL5A 1WGSA 2OI3A 4LD6A 4PJOF 1OEBA 4M75C 4PNOA 1N9RA 2FPDA 1FYNA 3I55A 1BBZA 2JMCA 4D8DA 5GAOm 1W6XA 5J26A 1X69A 2ATCB 1I07A 3QXEB 4M7AE 1AOJA 4GLKA 4PJOG 2MAMA 1Q7YU 2AT1B 1YIJT 2DMOA 1RI0A 4LDUA 1N8RU 2XG8D 4ELZC 4R55A 2J6FA 3PIPA 4RG8A 5HCKA 1PKSA 2KBTA 2DETA 3E9FA 1NM7A 2CDTA 3OS5A 2K57A 2XICA 4ZGEB 2RQVA 3JB9D 5GAMj 1X6BA 1YP5A 4JPBW 2BTTA 4OVAA 3KBGA 3CMAT 5GANf 3JCMb 3I56A 3M0PA 1KJWA 4C92D 1K1ZA 4M78B 3OSVA 1VQ7T 3CMEQ 2LNVA 1VQ6A 4M75B 3FEOA 5GAMd 1PM3A 4YTLA 1VYVA 5M9OA 1UHCA 5I21A 4A63B 3TSZA 4BE0A 2LZ6B 1OU8A 2WSFE 1QW1A 1SG5A 1FMKA 1YJ9A 2BZYA 4KT0E 5KYNA 3GPLA 1VQ4T 1VOMA 3A8MB 2M02A 2QEXA 4XTWA 4IKFA 1SKUB 3JV3A 4AFZC 2YUNA 2L2PA 2L89A 4Y28E 3O8VA 1VQ5T 2MI6A 4M7AB 1QVFA 3CCSQ 4CRIA 2K6DA 4KUDK 2OTLT 1K0XA 5KYYA 3QWXX 4X34A 1GBQA 1FMWA 3EFSA 3EG9B 2FPFA 3GLXA 2IG0A 5J39A 1UJ0A 3MEWA 5KYWA 5L8RE 2XD0A 3JCMd 3CBPA 1SSHA 2KYBA 1W1FA 1VQLT 2E3IA 2GFUA 2X4YA 2J6OA 2EQMA 1H8KA 2F1LA 3THKA 1IGUA 1YITQ 1BIBA 5IHNA 4BI4A 2X4XA 2DAQA 3PTAA 3PMTA 4LD9K 2EYZA 1VQKQ 4WF2A 2KT8A 4JLGA 4ESRA 3JAME 4M77A 3JCMV 4BD3A 4FSSA 4C5EA 1G3SA 2XK0A 3TSWA 2KYMA 5I22A 4KUIA 4IUUA 3CC2A 3VKIA 4TVRA 4E7IA 1TSFA 3PVLA 2EJFA 4FYWB 4OMQA 1W4SA 3M0UA 1M3CA 2FEIA 4XU2A 3CXCP 3NGPA 4PKCC 4RTTA 2YRCA 1GFCA 3MHXA 3GNGA 1RUWA 4FCYA 3M59A 4M75D 4XTVA 2LJ3A 1H3ZA 3OW2A 1XJWB 1VQ6Q 2QA4A 3FJPA 2VC8A 4M7DA 1ZBJA 2F2XA 3UF4A 1KSWA 1R77A 3MEVA 1YJ9Q 3V7CA 2RA2A 3VRZA 2QEXQ 4M77F 4LN2A 1D1AA 1NLOC 1M1KR 3R6OA 2D0QB 2LCCA 1KC8U 1S72Q 3JCMW 2HCKA 5KYUA 1VQNT 2YUPA 1V29B 3RDVA 1Q86R 2JS0A 2QQRA 1G3TA 2O9VA 2KRSA 1B07A 2VKNA 4WCIA 4XQ3A 2FRWA 3JCMh 1YIJA 5FRMA 2QQSA 3CC7Q 3VS4A 3S6WA 2P84A 2CGHA 3F70A 5CKFA 2ZCFB 2PNIA 1EFNA 4IIOA 5CQYA 2P0PA 3CQTA 4N4GA 4JRKA 2JN0A 2PU9B 3VS0A 2DPPB 3OYNA 2RI5A 3OYHA 3CMAA 2M0YA 1R0BG 4RTVA 3OYKA 3BE3A 4JUVA 3FDRA 2DE0X 2RO0A 1WA7A 2D8JA 1KQSA 1UGQB 1YBYA 3H0FA 5FWCA 1M1GA 4E7JA 1Q7YC 2DXTA 1N8RC 2FB7A 3S3MA 2MCNA 3G1JA 2EKOA 3RESA 1LCKA 2J05A 4E6RA 1KFZA 1VQOT 1VQ4A 4MMKA 4X1VA 4IUQA 2EVRA 1RL2A 3QBYA 3INZA 2JM9A 4LDVA 1HD3A 1QWEA 3ZFJA 2F5KA 4KGXB 1IB8A 2CP6A 3GBQA 2HSEB 1JQQA 4A4GA 4DBFA 4DBHA 4PK4A 1VQPA 3H41A 4QW2A 1RAEB 5LJ5j 3T9NA 3I5RA 3NFCA 1K8AR 1U3OA 4A4HA 2YRDA 2NWMA 1FWZA 4A54A 4HCBA 1GCPA 1Y0MA 1OYXA 2DXUA 3CPFA 3FLGA 5CCAA 1BCMA 2CP0A 5KYXA 1K9AA 3PT9A 2O4XA 5LJ5d 2BIVA 1JXOA 4CC3A 3NHNA 2RQRA 8AT1B 2FZKB 1PRLC 2KK4A 2VGMA 2F69A 2MWPA 4FSXA 1IGQA 1QVGP 4M77C 4JRIA 2B8AA 1N8RR 3ER0A 1WYXA 2A37A 1GCQA 1JBMA 4PFOA 2CYZB 1NJIU 2DYBA 5AT1B 1M5Q1 2A28A 2CP7A 1UJYA 2RI2A 1D1CA 5D6WA 4XTZA 2E6NA 3CMET 5GAOq 1Y57A 4C0FA 2HBPA 4B9WA 2DKGA 3VS1A 2QXFA 5GAN7 2LQKA 4M7DC 2DZCA 4JJNK 1M9SA 4XU3A 1A0NB 5GMKi 3NPFA 5KYWB 2CZ7B 3JCMQ 2GTOA 2Z0WA 2LP5A 1ZQ1A 2ZPFB 3REAB 2A08A 3CCST 1TXQA 5HY6A 2SEMA 3EHRA 1D0ZA 1AEYA 5GJVB 2PQWA 1NYGA 1VQPQ 2AKKA 1M30A 2NUPA 2C0IA 2PVGB 3M0TA 1ZX6A 1JU5C 1NEBA 2C0TA 2ZPGB 1X2KA 4M77B 2JW4A 4J9HA 3CCMQ 1IZ6A 4KGVB 1JJ2A 4EIKA 1O9SA 1OZ3A 2DVJA 2E1HA 3LW5E 2HBWA 2K5IA 2JMAA 1YNZA 4M4ZA 3CC4Q 2CKKA 4F7UF 3X28B 2X4WA 1HYOA 4RTUA 4J7IA 1YITT 1Q82U 1KC8C 2NLUA 1N9SA 4ME7A 4AG2C 4J9BA 1Y07A 1VQKT 1EZZB 4J5YA 2LT1A 3FJ5A 2W10A 4LE9A 4J6YA 3JCMg 3OS1A 3E2UA 4KH1B 4M7DB 4KBMB 4ZTFA 1HJDA 2X3XD 2RK1A 1QMCA 3H6ZA 5DY9A 3O5ZA 1YHQQ 5GAMe 3V7RA 2JTMA 3QYHB 3BY7A 1Q86U 1MHNA 3MP1A 4IIMA 5KYUB 4M78G 2EW3A 3OYMA 1ABOA 1PKTA 1VQ6T 1VQ8Q 1OULA 3FB9A 4QVDA 4C92E 2DIQA 2QAZA 2RJEA 3HSBA 1WQWA 1AWJA 2FZGB 1YJ9T 2VVKA 3GF5A 1YCYA 2QEXT 2K2MA 4C8QA 3GOXA 3AT1B 1BI1A 4DBRA 1WJRA 1JXMA 2RJDA 2RHZA 2HDAA 1OI1A 4M7AG 3CCRQ 4MMLA 1UHFA 1X43A 2RF0A 3JCMe 4M77D 3M0SA 3VU3C 2FG0A 1K73U 1S1NA 1KC8R 5GAN3 2BUDA 4J7FA 4JRPA 1MNDA 2GGRA 2QASA 3RR6A 2RD1A 3OA6A 1LPLA 1VUBA 6AT1B 3M4GA 2F2VA 4FU6A 2AIRB 1UECA 2L8DA 1C6VX 1GBRA 2EJ9A 2CZ0B 2HSPA 1KG1A 4PJMA 3RNJA 1W2BS 2JNGA 4M7DD 1X6OA 3QPHA 2LQNA 1CKAA 4PJOA 2XKOC 1LVKA 2L3SA 2RPNA 2BZXA 1M8VA 2CH4W 3L2ZA 2E3HA 1UB4A 3RMSA 2LVMA 1GCQC 2P0KA 2X4JA 5AYFA 4J83A 4C0DB 2KRMA 2D6FA 5LJ3j 5GAOp 1SHFA 4D8KA 5I2MA 1NPRA 2DILA 3CXCS 3HRSA 4RG2A 2VGNA 1WX6A 3MEAA 2Y4YA 2F5TX 1UGPB 4M75E 1K8AU 2R5MA 2CSQA 2VXEA 4AT1B 3VUBA 1JRIA 3C0CA 4Y91A 5LJ3d 3IQLA 4RCBA 2MOXA 1WHGA 4E7KA 4J9GA 2NUTB 4LDYA 1K9MR 2O4XB 3M4YA 2DERA 2KQWA 3DLMA 3CCVQ 3A8HB 3VJPA 2RJFA 2HEQA 2JOYA 1AWWA 2QQ9A 3HL8A 5GJWB 2JT4A 2R57A 5I11A 1LJOA 1YITA 2P4RA 2KDSA 3DLLA 4BACA 4OGCA 4EMKB 5GANj 3QWYA 1VQKA 3G71A 1ZA1B 4DBQA 2MF2A 2EKHA 3LX7A 3QHSA 2IVWA 1M2VA 3LWHA 2CSIA 3META 3FRNA 3LH0A 5IHIA 2O2OA 2B86A 5GAOr 4N0AC 3OSSC 5FU7C 2PUOB 2E5QA 1AT1B 3DB4A 2AK5A 3EG1A 4LDXA 3MPUB 3P8BB 2DXCA 2YDLA 3LGLA 2OAUA 1RADB 5HKCA 1G5VA 3KXTA 2KAFA 1QP3A 4N4HA 3SHWA 1Q82C 3VS5A 3S3NA 1Z9ZA 2RK2A 3EGUA 3SWNA 3CCUA 2KGTA 4PJNA 2LRQA 4MDWA 4AMCA 1NJIR 4C8QE 1C1AA 2WSEE 5GAMf 1S72A 3H0IA 3D7SB 1NG2A 3VUZA 2DFUA 1TUCA 2V8JA 3RMQA 1K4US 4ZNXA 2GNCA 2K9GA 4C8QC 1N27A 1M1KC 2K5LA 5IXFA 1NE8A 2PTKA 1MMNA 1B34A 3L2UA 1VQPT 2JM8A 1UEBA 1M27C 3CC7A 1Q86C 4XTUA 3TREA 4BI3A 3TVTA 5FU7B 4A4KA 2DVEA 4EMHA 3CCMT 5LJ5e 4E2FB 5CKEA 3CC4T 1ZHIA 4OMFB 3G6EQ 3GIBA 4PL6A 3JCMf 3G71Q 1BIAA 1IHWA 1YJWA 2VB6A 1UFFA 2KEAA 4ZN1A 2E12A 2QI2A 3X25B 2ENMA 4RTXA 3H8ZA 3EFOA 1LNXA
chains in the Genus database with same CATH topology
3BE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BE3 A; 
#chains in the Genus database with same CATH topology
 3X20 B;  3JCM X;  1HSQ A;  5GAO l;  4PJO C;  5GAM h;  1K73 C;  2QDY B;  1VQ9 Q;  1W70 A;  1Q82 R;  2LDM A;  2EYQ A;  4KH0 B;  4C8Q B;  3CCQ Q;  2JTE A;  4BI8 B;  2LCS A;  2WAC A;  3WVD B;  2J06 A;  3EHQ A;  2E64 A;  2LQW A;  4RTY A;  2Y4X A;  5GAN 5;  1D0Y A;  1P92 A;  1VQ8 T;  2WSC E;  2KRO A;  4OMP A;  1RLP C;  1LOJ A;  2KI7 A;  5DLO A;  2EGC A;  3CCU Q;  4IUR A;  1BK2 A;  1MV0 B;  1ZUK A;  2DF6 A;  1TUG B;  1WHL A;  1WXT A;  4FYX B;  4E7Z A;  3JB9 H;  3P8D A;  1QVF P;  4KGZ B;  1AWO A;  2PZ1 A;  5A0L A;  5FRN A;  2E65 A;  2RQU A;  1WZO A;  3UT1 A;  1X27 A;  1MMD A;  2DA9 A;  2AKL A;  2LC4 A;  5IHK A;  2CP2 A;  2ED1 A;  1MNE A;  4BE2 A;  3ZBD A;  2RQW A;  1U1S A;  3LYI A;  5A0D A;  4A4E A;  1G3W A;  2DL8 A;  4HCC A;  4PJO B;  1FXX A;  1K8A C;  2EQJ A;  2X35 A;  4PLL A;  2FPE A;  4ELY C;  2DNU A;  4JJD A;  2M1H A;  4A4F A;  2R5A A;  4DEY A;  5CKH A;  5CKD A;  3SDZ A;  4E7H A;  1K73 R;  1YJW Q;  4JJC A;  2ESW A;  3M55 A;  5GMK j;  3P8H A;  3RBB B;  1X2Q A;  5J3B A;  4VUB A;  1M90 U;  4X9D A;  4R0K A;  1D09 B;  2CT3 A;  1XOV A;  1AWX A;  4OF1 A;  2DTO A;  1SRL A;  4C8Q D;  1R0C B;  3HFN A;  1V1C A;  3OW2 P;  2RNA A;  2XMF A;  3A1P A;  2EWN A;  1I5O B;  1K9M U;  3Q1J A;  4JZ4 A;  5KCO A;  3HP9 A;  3M5A A;  2MPX C;  2PUK B;  1YJN Q;  2CS7 A;  4ZGJ B;  1CKB A;  1PG5 B;  4LUE A;  1HK9 A;  3SWN C;  3QJY A;  2CZ1 B;  2DRK A;  2QGG A;  1PRM C;  3L2R A;  2JVV A;  1GXI E;  2A36 A;  4PJL A;  3RER A;  3QZ5 B;  3R6N A;  1U06 A;  1FMV A;  4QQD A;  4E47 A;  4C5I A;  1Q81 R;  3UPU A;  1Y96 A;  3CD6 Q;  4C5H A;  3CEY A;  4C0Z A;  3CCM A;  3UA6 A;  1M2V B;  1UE9 A;  4FW2 A;  3FC3 A;  1UGV A;  4PLI A;  4PJO D;  3SB2 A;  1WHM A;  3CCJ Q;  3CC4 A;  2KE9 A;  2OAW A;  1O75 A;  2CUB A;  4M77 E;  1T0H A;  1UDL A;  5ECA A;  1ZSZ A;  2CUD A;  3QSU A;  1TG0 A;  1YFN A;  5D6X A;  3V8L A;  4Z8A A;  5HK3 A;  1M2O A;  1XTD A;  2RH2 A;  2GCX A;  4CC4 B;  1KQS P;  5LJ5 f;  3CPW S;  1G2B A;  1ZSG A;  1WJS A;  1FX7 A;  4C92 F;  2AZS A;  3JB9 G;  3NTK A;  5FLX E;  1YHQ A;  3SWN B;  2RN8 A;  4DOV A;  1TH7 A;  2E10 A;  4M7D E;  2YUO A;  1VQ8 A;  4C92 G;  5KYY B;  3EH1 A;  2HKN A;  1RI9 A;  2K3X A;  1PD0 A;  4F7U A;  1VQ7 Q;  1EIF A;  1OPL A;  1UGR B;  4GY5 A;  2DO3 A;  1B34 B;  1IO6 A;  4KUL A;  3L42 A;  5LJ3 e;  1WHK A;  2HNI A;  3NTH A;  9ATC B;  1T3L A;  2O31 A;  2XHC A;  5GAM g;  2QTX A;  2KR3 A;  4L6V 5;  4ORZ A;  4J9D A;  3CCR A;  3MKD A;  1WLP B;  1D3B A;  1TUD A;  5FU6 C;  4M78 A;  2LTO A;  3U23 A;  3HRT A;  1I81 A;  1X6G A;  1BCO A;  1I1J A;  2K3Y A;  4MZT A;  4IUP A;  2OTL Q;  1I4K 1;  3X26 B;  4FL6 A;  4B9X A;  3J7A F;  5LJ5 h;  4L59 A;  1WFW A;  1QCO A;  2EYX A;  2YLC A;  2HAX A;  3EFO B;  2EFI A;  2XI9 A;  4QQ6 A;  1WJQ A;  2CP5 A;  3EGX A;  3RIR A;  1NZ9 A;  1R8O B;  3QYG B;  3G6E T;  1TOV A;  1NBE B;  3DB3 A;  3G71 T;  3EG2 A;  4HCZ A;  4N0A A;  8ATC B;  4FT4 A;  1WI7 A;  1RAH B;  2RHI A;  4LUD A;  3LLR A;  3M58 A;  2DL5 A;  3QII A;  4M78 F;  3UAT A;  2K79 A;  3C95 A;  3CPW A;  1MMG A;  5KH6 A;  2K4Y A;  3LH5 A;  4LXC A;  4JDS A;  4M75 F;  2HD0 A;  1B7T A;  2EQU A;  1ARK A;  3A98 A;  2COW A;  1I8F A;  1VQ9 T;  1BI2 A;  4J9I A;  4DOW A;  2HMA A;  3VRY A;  5CAI A;  3CCQ T;  5FU6 B;  2BE7 D;  2EQI A;  3HRU A;  1QKX A;  3EFR A;  2E41 A;  4M75 G;  4KRT A;  4C5G A;  2QQB A;  1T3S A;  4M7A F;  4L5G A;  1N5Z A;  3H0H A;  1ZUY A;  2OTJ A;  1TTH B;  3CCU T;  1S72 T;  4RKU E;  1KIK A;  1M90 C;  2DEQ A;  4OMM A;  1ZBX A;  3CCV A;  1E6H A;  1OQK A;  4CC2 A;  4GBQ A;  2E6Z A;  4AFS C;  1M3A A;  4F16 A;  1VQN Q;  1EX4 A;  2R58 A;  2CT4 A;  3CCL Q;  3QG1 A;  1XQH A;  1JJ2 P;  3CC7 T;  1K9M C;  3NMZ C;  3OYC A;  2EGE A;  4X9C A;  3WVE B;  1KK7 A;  4FIB A;  1G83 A;  4AFU C;  1M8M A;  1HXD A;  2QG9 B;  2DJQ A;  1OU9 A;  4QQG A;  3KFV A;  2P0Q A;  3VV0 A;  2J7I A;  3G4S A;  4QT7 A;  2L5Q A;  1RAB B;  4HVW A;  1ZSZ C;  2QDL A;  2ECZ A;  1YJW T;  3MCA B;  3S3O A;  5CIU A;  3OS2 A;  4QVZ A;  1OV3 A;  3OBW A;  2HL3 A;  2DEU A;  5FRO A;  2EQK A;  2KXD A;  1VQM Q;  2FHD A;  2YLB A;  3JB9 J;  1OZ2 A;  3MO8 A;  2ZPB B;  2DIG A;  2LNH B;  4LDW A;  1AZG B;  3GNF B;  2DBM A;  4E7S A;  1Q81 U;  1AZE A;  3DKM A;  1UGS B;  2V8I A;  1V76 A;  4O5V A;  1M3B A;  1QVP A;  2OX7 A;  4C8Q G;  7AT1 B;  1Y96 B;  1IRX A;  2W0Z A;  5DLQ E;  1M90 R;  2FL7 A;  3PFS A;  2M51 A;  1RLQ C;  5C0M A;  2G3R A;  1VQO Q;  3N5B B;  2YT6 A;  2DBK A;  2OTJ Q;  1H92 A;  1OX8 A;  1MGQ A;  3LGF A;  4XU1 A;  3RUX A;  1NJI C;  2CZ6 B;  4PFP A;  3EAE A;  5EG2 A;  5KYX B;  2RM4 A;  1QKW A;  4NOY A;  3OY9 A;  1G3Y A;  3BDL A;  2LQ8 A;  1IHV A;  1QVF S;  3PNW C;  5LJ3 f;  4M78 C;  1ZSZ B;  3EGD A;  2ROT A;  2VUB A;  4J6W A;  2ZPH B;  3A5Z B;  2YRV A;  3CCJ T;  2FZC B;  1PNJ A;  2LMJ A;  3G6E A;  1OX9 A;  2ED0 A;  3VS3 A;  2RI3 A;  2NUZ A;  2EBP A;  5CQX A;  3G4S Q;  2QK0 A;  4M7A C;  5LL6 S;  1SEM A;  4DQ2 A;  1W2B A;  2CH4 A;  1PWT A;  4II1 A;  1QWF A;  2H8H A;  2RJC A;  3J80 E;  5GAN d;  4RMO A;  4K11 A;  3C4S A;  4F7U B;  5LJ5 g;  5D6Y A;  1VQ9 A;  4C0G A;  2A7Y A;  4QVC A;  2KT1 A;  3CCQ A;  1YI2 Q;  3X24 B;  4FW1 A;  5FWB A;  2V26 A;  5GMK e;  3I9Q A;  3HHT B;  4PJJ A;  2DYI A;  5GMK m;  4JS4 A;  2FYK A;  1VIE A;  3EH2 A;  2GF7 A;  3CXC A;  1D3B B;  2JZ2 A;  4OB2 B;  3OYI A;  5LJ3 h;  1KD1 U;  3OW2 S;  2NUP B;  3KUF A;  3OB9 A;  1X75 C;  4F04 B;  2RB6 A;  2YUQ A;  2HQE A;  4GLM A;  3PVQ A;  2M16 A;  2DZ9 A;  2VXF A;  2KY9 A;  5IN1 A;  1TS9 A;  1U1T A;  2P4T A;  5GAN 6;  4BUG A;  2CRE A;  3PGG A;  2LX9 A;  3EGX B;  5CKB A;  3QDF A;  2QYZ A;  1C0M A;  3V8J A;  2QQA A;  1KQ1 A;  4HVV A;  3A8L B;  1M1F A;  1CSK A;  1ZUU A;  3I55 Q;  4DEX A;  4NL3 A;  2KMT A;  2KVQ G;  4F14 A;  2K2V A;  1SSF A;  1RAC B;  1BYM A;  3G7Z A;  1H3H A;  4OML A;  4E7L A;  1N6A A;  4NL2 A;  2HKQ B;  3QKJ A;  1WQ7 A;  3UDC A;  2DK3 A;  2EGA A;  4PJO E;  2YSQ A;  4JLI A;  1KQ2 A;  2JJ9 A;  4RTW A;  5GAN h;  1JB0 E;  4RUG A;  4O6J A;  1W2B P;  1PHT A;  5IXB A;  5DM7 R;  2DTI A;  4OMO A;  3V8K A;  4AFQ C;  1T0J A;  2YXY A;  1QVG S;  4BY6 C;  3OMG A;  1YHQ T;  1KQS S;  2RMO A;  4M78 D;  3HTR A;  2PVD B;  2F2W A;  3I56 Q;  3OYY A;  1YJN A;  3CCE A;  2DLP A;  3HPW A;  1WIE A;  1E6G A;  3H9N A;  2V8K A;  4Y92 A;  2O01 E;  3VYG A;  4RCC A;  4ZTJ A;  3C12 A;  4P5N A;  4PFZ A;  1U8R A;  2MYS A;  3QUI A;  3A8O B;  3PE0 A;  4HT9 A;  3HKS A;  2ABL A;  3JSC A;  1NPP A;  3CD6 A;  3SFM A;  3QO3 A;  4MZM A;  3CCR T;  4MDX A;  4CC7 A;  4M7A D;  2COZ A;  4WTO B;  2KRN A;  2KNB B;  2VWF A;  3ME9 A;  3MJX A;  4EMG A;  2D1X A;  2MIO A;  3URG A;  1Q81 C;  2DM1 A;  3CCJ A;  2G6F X;  3M56 A;  5GAN 4;  1VIF A;  3CCL T;  3C94 A;  2O9S A;  2RQT A;  4J9C A;  1RAG B;  4M77 G;  5GMK l;  3QZ9 B;  4OB0 B;  2DL4 A;  1D1B A;  1WHH A;  3WXM B;  4BY6 B;  2COY A;  2AZV A;  2E4H A;  1BKB A;  4ZGD B;  1SF9 A;  2E5K A;  1K76 A;  2ZPI B;  5CO7 A;  4M7D F;  2ZAE A;  2L3P A;  1M4Z A;  1D0X A;  2E70 A;  4F17 A;  1QCN A;  2FO0 A;  3BFM A;  4RTZ A;  3VS2 A;  1B3Q A;  1RAF B;  4D6W A;  2PVO B;  1WDX A;  2I2L A;  2VAS A;  3MEU A;  2IIM A;  4M7D G;  1UUE A;  2VV5 A;  1WXB A;  1VYU A;  2J6K A;  1QVG A;  4IUV A;  4AG1 C;  2BE9 B;  1VQM T;  2BKD N;  3CC2 Q;  3FIF A;  2A0F B;  2DL7 A;  1VQ7 A;  1TU0 B;  4NS5 A;  3VYH B;  2CP3 A;  5CK9 A;  3QDR B;  3UA7 A;  3CBM A;  5IT9 E;  3CCE Q;  3PMI A;  1MV3 A;  4UC4 A;  2HQH A;  1ABQ A;  2EPD A;  2YWW A;  3EGD B;  4Z88 A;  4Z02 A;  4QKU A;  4XK8 E;  2XDD A;  2QA4 Q;  2OTJ T;  1PD1 A;  3ASK A;  5HK0 A;  2DRM A;  4XAX B;  2RHU A;  2DX1 A;  1VQ5 A;  2OJ2 A;  4C92 A;  5KE3 A;  4HA8 A;  1NLP C;  1BI3 A;  3REB B;  2OTL A;  2GQV A;  3OYD A;  3CCV T;  1I0C A;  1PCX A;  1KHI A;  2Y90 A;  2D8H A;  1QLY A;  3TU4 K;  3BW1 A;  4DA4 A;  2ZGW A;  2LCL A;  5LJ3 g;  4HVU A;  3M9Q A;  3RKX A;  3ULR B;  1KD1 C;  3EG0 A;  4JRQ A;  5CVI A;  4FM4 B;  4J6X A;  3M53 A;  3ZEH A;  1YIJ Q;  2H3J A;  1VQL A;  3JB9 F;  1JJ2 S;  4OMN A;  4BB7 A;  3RKW A;  3UWN A;  2XU8 A;  1E7O A;  2M9U A;  4JZ3 A;  1WXU A;  3OQ5 A;  3G4S T;  4OB1 B;  2NUT A;  2SRC A;  2EAY A;  1PC0 A;  2QGF B;  4XU0 A;  4JS5 A;  3JRZ A;  2A3L A;  3OBY A;  1ZLM A;  2XDB A;  4HKE A;  2DD5 A;  2RHY A;  2VYT A;  2LJ0 A;  2XDP A;  5GMK h;  4FYV B;  3CMA Q;  1BI0 A;  1GRI A;  2L3Q A;  1Q7Y R;  1YI2 T;  4LNP A;  3SEM A;  1NEG A;  3JCM c;  1AVZ C;  1VA7 A;  4EMK A;  1BU1 A;  1ACM B;  2D0N A;  2MK5 A;  2X51 A;  3HFO A;  5GAO n;  1PSE A;  2JXB A;  5GAN g;  5IH2 A;  3JCM P;  1Z9Q A;  2DL3 A;  5A0G A;  2L3R A;  2BZ8 A;  1UTI A;  1UG1 A;  4J9E A;  3MP8 A;  4ATO A;  1VQ4 Q;  2X3W D;  2LX7 A;  2IPO B;  3L2Q A;  3OYL A;  2L0A A;  1WPY A;  5A2Q E;  1VQ5 Q;  1I5L A;  3L1A A;  1VQN A;  1AHJ B;  3LWI A;  5FW9 A;  4M75 A;  1KD1 R;  2I0N A;  3QJ6 A;  1OOT A;  3CCL A;  1SPK A;  3MP6 A;  1H64 1;  2C0O A;  2X9H A;  3OYJ A;  2GQI A;  3I35 A;  3L2V A;  4J8O A;  1DJ7 B;  1J3T A;  2JS2 A;  3I5S A;  5D7U A;  3JB9 I;  3I55 T;  2H3E B;  4M7A A;  1RAI B;  1VQL Q;  1QQJ A;  4Q5W A;  4XTY A;  2K5F A;  2DJZ A;  3OYE A;  1MUZ A;  1JO8 A;  3EG9 A;  2V1Q A;  1YWP A;  5GAN 2;  5GAN e;  3OYA A;  1JEG A;  2ZZD A;  1YWO A;  1SRM A;  2FRY A;  1AD5 A;  3VS6 A;  3E19 A;  4B6M A;  2V1R A;  4BDZ A;  1VQM A;  5KE2 A;  2YHT A;  3E9G A;  2KXC A;  2O88 A;  4F7U G;  2MMP A;  4Z89 A;  4MZP A;  4BDY A;  2LT4 A;  1WHJ A;  2C06 A;  5KCH A;  3AHU A;  2GTJ A;  1F1B B;  3OYB A;  1M1K U;  3J81 E;  2FVU A;  2GFA A;  3GP8 A;  1VYT A;  3TCJ A;  3I56 T;  5I2S A;  2M0O A;  1VQO A;  2K7A A;  2DD4 A;  3ZL7 C;  4OGE A;  3RKY A;  2DTH A;  3VS7 A;  1SHG A;  1IRE B;  3OYG A;  2EYY A;  4OB3 B;  1XNI A;  4HT8 A;  3OS0 A;  3V7S A;  3NTI A;  2MWO A;  2QTV A;  2EYW A;  1KHC A;  3TEE A;  4IUT A;  5C6S A;  4C92 C;  5GAN 8;  1K0S A;  4C0D C;  3CBO A;  3M54 A;  5CR2 A;  2D9T A;  2ROL A;  1ZA2 B;  1GFD A;  4CI0 C;  1TWB A;  2HZY A;  4FT2 A;  4HXJ A;  1G8X A;  2DXB A;  2AHJ B;  4R56 A;  2RHX A;  3A8G B;  1WNL A;  2KSS A;  2XID A;  4JJB A;  2JTF A;  1Q95 G;  1YN8 A;  1Y7X A;  2HL5 C;  3SD4 A;  3E1S A;  1Y71 A;  2EJG A;  3CPW P;  1RAA B;  4C8Q F;  1YI2 A;  4ZN3 A;  1YCS B;  3M0R A;  3EG3 A;  1QP2 A;  5L23 A;  1X01 A;  4J9F A;  1U5S A;  3BDU A;  4F7U E;  3CC2 T;  2K3B A;  3OMC A;  1MMA A;  1BB9 A;  4C92 B;  1NYF A;  3CME A;  4EMK C;  2ZPE B;  3JCM J;  1YJN T;  3CCE T;  2LJ1 A;  4FYY B;  4HCK A;  2HQX A;  4BE1 A;  5IAY A;  1IXD A;  4N4I A;  2JUF A;  5EC7 A;  4M78 E;  3TQ7 P;  1OPK A;  2QA4 T;  4V2S A;  4EDU A;  2NYS A;  3M0Q A;  1QCF A;  4ANJ A;  4OP0 A;  3L2W A;  4EPC A;  3M57 A;  3PIO A;  2GBQ A;  4XTX A;  1PSF A;  4A53 A;  2EIF A;  3OYF A;  3CCS A;  3CD6 T;  1GL5 A;  1WGS A;  2OI3 A;  4LD6 A;  4PJO F;  1OEB A;  4M75 C;  4PNO A;  1N9R A;  2FPD A;  1FYN A;  3I55 A;  1BBZ A;  2JMC A;  4D8D A;  5GAO m;  1W6X A;  5J26 A;  1X69 A;  2ATC B;  1I07 A;  3QXE B;  4M7A E;  1AOJ A;  4GLK A;  4PJO G;  2MAM A;  1Q7Y U;  2AT1 B;  1YIJ T;  2DMO A;  1RI0 A;  4LDU A;  1N8R U;  2XG8 D;  4ELZ C;  4R55 A;  2J6F A;  3PIP A;  4RG8 A;  5HCK A;  1PKS A;  2KBT A;  2DET A;  3E9F A;  1NM7 A;  2CDT A;  3OS5 A;  2K57 A;  2XIC A;  4ZGE B;  2RQV A;  3JB9 D;  5GAM j;  1X6B A;  1YP5 A;  4JPB W;  2BTT A;  4OVA A;  3KBG A;  3CMA T;  5GAN f;  3JCM b;  3I56 A;  3M0P A;  1KJW A;  4C92 D;  1K1Z A;  4M78 B;  3OSV A;  1VQ7 T;  3CME Q;  2LNV A;  1VQ6 A;  4M75 B;  3FEO A;  5GAM d;  1PM3 A;  4YTL A;  1VYV A;  5M9O A;  1UHC A;  5I21 A;  4A63 B;  3TSZ A;  4BE0 A;  2LZ6 B;  1OU8 A;  2WSF E;  1QW1 A;  1SG5 A;  1FMK A;  1YJ9 A;  2BZY A;  4KT0 E;  5KYN A;  3GPL A;  1VQ4 T;  1VOM A;  3A8M B;  2M02 A;  2QEX A;  4XTW A;  4IKF A;  1SKU B;  3JV3 A;  4AFZ C;  2YUN A;  2L2P A;  2L89 A;  4Y28 E;  3O8V A;  1VQ5 T;  2MI6 A;  4M7A B;  1QVF A;  3CCS Q;  4CRI A;  2K6D A;  4KUD K;  2OTL T;  1K0X A;  5KYY A;  3QWX X;  4X34 A;  1GBQ A;  1FMW A;  3EFS A;  3EG9 B;  2FPF A;  3GLX A;  2IG0 A;  5J39 A;  1UJ0 A;  3MEW A;  5KYW A;  5L8R E;  2XD0 A;  3JCM d;  3CBP A;  1SSH A;  2KYB A;  1W1F A;  1VQL T;  2E3I A;  2GFU A;  2X4Y A;  2J6O A;  2EQM A;  1H8K A;  2F1L A;  3THK A;  1IGU A;  1YIT Q;  1BIB A;  5IHN A;  4BI4 A;  2X4X A;  2DAQ A;  3PTA A;  3PMT A;  4LD9 K;  2EYZ A;  1VQK Q;  4WF2 A;  2KT8 A;  4JLG A;  4ESR A;  3JAM E;  4M77 A;  3JCM V;  4BD3 A;  4FSS A;  4C5E A;  1G3S A;  2XK0 A;  3TSW A;  2KYM A;  5I22 A;  4KUI A;  4IUU A;  3CC2 A;  3VKI A;  4TVR A;  4E7I A;  1TSF A;  3PVL A;  2EJF A;  4FYW B;  4OMQ A;  1W4S A;  3M0U A;  1M3C A;  2FEI A;  4XU2 A;  3CXC P;  3NGP A;  4PKC C;  4RTT A;  2YRC A;  1GFC A;  3MHX A;  3GNG A;  1RUW A;  4FCY A;  3M59 A;  4M75 D;  4XTV A;  2LJ3 A;  1H3Z A;  3OW2 A;  1XJW B;  1VQ6 Q;  2QA4 A;  3FJP A;  2VC8 A;  4M7D A;  1ZBJ A;  2F2X A;  3UF4 A;  1KSW A;  1R77 A;  3MEV A;  1YJ9 Q;  3V7C A;  2RA2 A;  3VRZ A;  2QEX Q;  4M77 F;  4LN2 A;  1D1A A;  1NLO C;  1M1K R;  3R6O A;  2D0Q B;  2LCC A;  1KC8 U;  1S72 Q;  3JCM W;  2HCK A;  5KYU A;  1VQN T;  2YUP A;  1V29 B;  3RDV A;  1Q86 R;  2JS0 A;  2QQR A;  1G3T A;  2O9V A;  2KRS A;  1B07 A;  2VKN A;  4WCI A;  4XQ3 A;  2FRW A;  3JCM h;  1YIJ A;  5FRM A;  2QQS A;  3CC7 Q;  3VS4 A;  3S6W A;  2P84 A;  2CGH A;  3F70 A;  5CKF A;  2ZCF B;  2PNI A;  1EFN A;  4IIO A;  5CQY A;  2P0P A;  3CQT A;  4N4G A;  4JRK A;  2JN0 A;  2PU9 B;  3VS0 A;  2DPP B;  3OYN A;  2RI5 A;  3OYH A;  3CMA A;  2M0Y A;  1R0B G;  4RTV A;  3OYK A;  3BE3 A;  4JUV A;  3FDR A;  2DE0 X;  2RO0 A;  1WA7 A;  2D8J A;  1KQS A;  1UGQ B;  1YBY A;  3H0F A;  5FWC A;  1M1G A;  4E7J A;  1Q7Y C;  2DXT A;  1N8R C;  2FB7 A;  3S3M A;  2MCN A;  3G1J A;  2EKO A;  3RES A;  1LCK A;  2J05 A;  4E6R A;  1KFZ A;  1VQO T;  1VQ4 A;  4MMK A;  4X1V A;  4IUQ A;  2EVR A;  1RL2 A;  3QBY A;  3INZ A;  2JM9 A;  4LDV A;  1HD3 A;  1QWE A;  3ZFJ A;  2F5K A;  4KGX B;  1IB8 A;  2CP6 A;  3GBQ A;  2HSE B;  1JQQ A;  4A4G A;  4DBF A;  4DBH A;  4PK4 A;  1VQP A;  3H41 A;  4QW2 A;  1RAE B;  5LJ5 j;  3T9N A;  3I5R A;  3NFC A;  1K8A R;  1U3O A;  4A4H A;  2YRD A;  2NWM A;  1FWZ A;  4A54 A;  4HCB A;  1GCP A;  1Y0M A;  1OYX A;  2DXU A;  3CPF A;  3FLG A;  5CCA A;  1BCM A;  2CP0 A;  5KYX A;  1K9A A;  3PT9 A;  2O4X A;  5LJ5 d;  2BIV A;  1JXO A;  4CC3 A;  3NHN A;  2RQR A;  8AT1 B;  2FZK B;  1PRL C;  2KK4 A;  2VGM A;  2F69 A;  2MWP A;  4FSX A;  1IGQ A;  1QVG P;  4M77 C;  4JRI A;  2B8A A;  1N8R R;  3ER0 A;  1WYX A;  2A37 A;  1GCQ A;  1JBM A;  4PFO A;  2CYZ B;  1NJI U;  2DYB A;  5AT1 B;  1M5Q 1;  2A28 A;  2CP7 A;  1UJY A;  2RI2 A;  1D1C A;  5D6W A;  4XTZ A;  2E6N A;  3CME T;  5GAO q;  1Y57 A;  4C0F A;  2HBP A;  4B9W A;  2DKG A;  3VS1 A;  2QXF A;  5GAN 7;  2LQK A;  4M7D C;  2DZC A;  4JJN K;  1M9S A;  4XU3 A;  1A0N B;  5GMK i;  3NPF A;  5KYW B;  2CZ7 B;  3JCM Q;  2GTO A;  2Z0W A;  2LP5 A;  1ZQ1 A;  2ZPF B;  3REA B;  2A08 A;  3CCS T;  1TXQ A;  5HY6 A;  2SEM A;  3EHR A;  1D0Z A;  1AEY A;  5GJV B;  2PQW A;  1NYG A;  1VQP Q;  2AKK A;  1M30 A;  2NUP A;  2C0I A;  2PVG B;  3M0T A;  1ZX6 A;  1JU5 C;  1NEB A;  2C0T A;  2ZPG B;  1X2K A;  4M77 B;  2JW4 A;  4J9H A;  3CCM Q;  1IZ6 A;  4KGV B;  1JJ2 A;  4EIK A;  1O9S A;  1OZ3 A;  2DVJ A;  2E1H A;  3LW5 E;  2HBW A;  2K5I A;  2JMA A;  1YNZ A;  4M4Z A;  3CC4 Q;  2CKK A;  4F7U F;  3X28 B;  2X4W A;  1HYO A;  4RTU A;  4J7I A;  1YIT T;  1Q82 U;  1KC8 C;  2NLU A;  1N9S A;  4ME7 A;  4AG2 C;  4J9B A;  1Y07 A;  1VQK T;  1EZZ B;  4J5Y A;  2LT1 A;  3FJ5 A;  2W10 A;  4LE9 A;  4J6Y A;  3JCM g;  3OS1 A;  3E2U A;  4KH1 B;  4M7D B;  4KBM B;  4ZTF A;  1HJD A;  2X3X D;  2RK1 A;  1QMC A;  3H6Z A;  5DY9 A;  3O5Z A;  1YHQ Q;  5GAM e;  3V7R A;  2JTM A;  3QYH B;  3BY7 A;  1Q86 U;  1MHN A;  3MP1 A;  4IIM A;  5KYU B;  4M78 G;  2EW3 A;  3OYM A;  1ABO A;  1PKT A;  1VQ6 T;  1VQ8 Q;  1OUL A;  3FB9 A;  4QVD A;  4C92 E;  2DIQ A;  2QAZ A;  2RJE A;  3HSB A;  1WQW A;  1AWJ A;  2FZG B;  1YJ9 T;  2VVK A;  3GF5 A;  1YCY A;  2QEX T;  2K2M A;  4C8Q A;  3GOX A;  3AT1 B;  1BI1 A;  4DBR A;  1WJR A;  1JXM A;  2RJD A;  2RHZ A;  2HDA A;  1OI1 A;  4M7A G;  3CCR Q;  4MML A;  1UHF A;  1X43 A;  2RF0 A;  3JCM e;  4M77 D;  3M0S A;  3VU3 C;  2FG0 A;  1K73 U;  1S1N A;  1KC8 R;  5GAN 3;  2BUD A;  4J7F A;  4JRP A;  1MND A;  2GGR A;  2QAS A;  3RR6 A;  2RD1 A;  3OA6 A;  1LPL A;  1VUB A;  6AT1 B;  3M4G A;  2F2V A;  4FU6 A;  2AIR B;  1UEC A;  2L8D A;  1C6V X;  1GBR A;  2EJ9 A;  2CZ0 B;  2HSP A;  1KG1 A;  4PJM A;  3RNJ A;  1W2B S;  2JNG A;  4M7D D;  1X6O A;  3QPH A;  2LQN A;  1CKA A;  4PJO A;  2XKO C;  1LVK A;  2L3S A;  2RPN A;  2BZX A;  1M8V A;  2CH4 W;  3L2Z A;  2E3H A;  1UB4 A;  3RMS A;  2LVM A;  1GCQ C;  2P0K A;  2X4J A;  5AYF A;  4J83 A;  4C0D B;  2KRM A;  2D6F A;  5LJ3 j;  5GAO p;  1SHF A;  4D8K A;  5I2M A;  1NPR A;  2DIL A;  3CXC S;  3HRS A;  4RG2 A;  2VGN A;  1WX6 A;  3MEA A;  2Y4Y A;  2F5T X;  1UGP B;  4M75 E;  1K8A U;  2R5M A;  2CSQ A;  2VXE A;  4AT1 B;  3VUB A;  1JRI A;  3C0C A;  4Y91 A;  5LJ3 d;  3IQL A;  4RCB A;  2MOX A;  1WHG A;  4E7K A;  4J9G A;  2NUT B;  4LDY A;  1K9M R;  2O4X B;  3M4Y A;  2DER A;  2KQW A;  3DLM A;  3CCV Q;  3A8H B;  3VJP A;  2RJF A;  2HEQ A;  2JOY A;  1AWW A;  2QQ9 A;  3HL8 A;  5GJW B;  2JT4 A;  2R57 A;  5I11 A;  1LJO A;  1YIT A;  2P4R A;  2KDS A;  3DLL A;  4BAC A;  4OGC A;  4EMK B;  5GAN j;  3QWY A;  1VQK A;  3G71 A;  1ZA1 B;  4DBQ A;  2MF2 A;  2EKH A;  3LX7 A;  3QHS A;  2IVW A;  1M2V A;  3LWH A;  2CSI A;  3MET A;  3FRN A;  3LH0 A;  5IHI A;  2O2O A;  2B86 A;  5GAO r;  4N0A C;  3OSS C;  5FU7 C;  2PUO B;  2E5Q A;  1AT1 B;  3DB4 A;  2AK5 A;  3EG1 A;  4LDX A;  3MPU B;  3P8B B;  2DXC A;  2YDL A;  3LGL A;  2OAU A;  1RAD B;  5HKC A;  1G5V A;  3KXT A;  2KAF A;  1QP3 A;  4N4H A;  3SHW A;  1Q82 C;  3VS5 A;  3S3N A;  1Z9Z A;  2RK2 A;  3EGU A;  3SWN A;  3CCU A;  2KGT A;  4PJN A;  2LRQ A;  4MDW A;  4AMC A;  1NJI R;  4C8Q E;  1C1A A;  2WSE E;  5GAM f;  1S72 A;  3H0I A;  3D7S B;  1NG2 A;  3VUZ A;  2DFU A;  1TUC A;  2V8J A;  3RMQ A;  1K4U S;  4ZNX A;  2GNC A;  2K9G A;  4C8Q C;  1N27 A;  1M1K C;  2K5L A;  5IXF A;  1NE8 A;  2PTK A;  1MMN A;  1B34 A;  3L2U A;  1VQP T;  2JM8 A;  1UEB A;  1M27 C;  3CC7 A;  1Q86 C;  4XTU A;  3TRE A;  4BI3 A;  3TVT A;  5FU7 B;  4A4K A;  2DVE A;  4EMH A;  3CCM T;  5LJ5 e;  4E2F B;  5CKE A;  3CC4 T;  1ZHI A;  4OMF B;  3G6E Q;  3GIB A;  4PL6 A;  3JCM f;  3G71 Q;  1BIA A;  1IHW A;  1YJW A;  2VB6 A;  1UFF A;  2KEA A;  4ZN1 A;  2E12 A;  2QI2 A;  3X25 B;  2ENM A;  4RTX A;  3H8Z A;  3EFO A;  1LNX A; 
#chains in the Genus database with same CATH homology
 3BE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...