3BEDA

Mannose/sorbose specific iia subunit of phosphotransferase system from enterococcus faecalis
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
132
structure length
130
Chain Sequence
b'MPKLILMSHGRMAEETLASTQMIVGELADAAIVSMTAEDGLSGTQAKLAAILKEAGNVPTLVLADLGGTPCNVAMMAMGTYPQLRVVAGLNLAMAIEAAVSPVENVDELAAYLTQIGQSAVTTIDLPELT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTS system, IIA component
publication title X-Ray Crystal Structure of Mannose/sorbose specific IIa subunit of phosphotransferase system from Enterococcus faecalis.
rcsb
source organism Enterococcus faecalis
molecule tags Transferase
total genus 31
structure length 130
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03610 EIIA-man PTS system fructose IIA component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.510 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphotransferase system, mannose-type IIA component 3bedA00
5T3UA 3MTQA 2JZOA 3CT6A 1VSQA 3GDWA 4TKZA 5IM4F 3IPRA 1PDOA 3B48A 3GX1A 3CR3C 2JZNA 1VRCA 3BEDA 3LFHA
chains in the Genus database with same CATH superfamily
1YZTA 2ZYGA 4IOMA 4BZQA 5KSYA 1CUAA 1YWGO 4Q5IA 1IJFA 3CIFA 5KYUB 3T5AA 3U56A 2IYEA 5LP6C 3S4YA 3R9IA 2ZIXB 4E5PA 3N3BC 3NGXA 2ZQ5A 3RAJA 4UTVA 1UQUA 5ALXA 5DWVA 4LY6A 3MIIA 2XYGA 2BW0A 3N8NA 1D3AA 4DLPA 1ND6A 3G9UA 1ACLA 3W9BA 4R16A 5E3HA 3B52X 1CQXA 3E27A 4D0RA 2DYKA 4DIOA 2OMEA 3RUIA 3UATA 5KQGA 4DQKA 1TK3A 4X66B 1SXHA 3FPEA 3M4XA 5K0ZA 3FPCA 5FWXB 4U7JA 2Y1WA 4N5HX 3RQSA 4DUGA 1FZTA 1ABFA 2IIBA 1I2AA 3A4LA 3RUAA 4RLQA 1G42A 4R8VA 2FMHA 3T1YB 1XOIA 3QMPA 4QPJC 3V4OA 1G5TA 2F4VB 5TR9A 1DC3A 2IIPA 4MJ3A 3GJ8A 1KGDA 5DV9A 1J2JA 1V11A 2CVFA 1ZEJA 2XADA 1FTYA 5IRCD 2ZUEA 3EPPA 3Q3GE 1CJKC 2V58A 4RADA 2HLDD 3UJ6A 4EA6A 2W8ZA 3IUNA 4J29A 1EB9A 3RABA 1VGQA 5ADHA 5EJ5A 2QUZA 2PSHA 2XVXA 3K9NA 2JH8A 3MGBA 3F6BX 3KOWA 2GZ2A 4LQ4A 4NOKA 3GVHA 4V0NA 1BEUB 5GONF 2PZFA 4XUCA 4EGAA 3QVMA 4A9AA 1DUVG 3PGJA 2IV7A 1W5AA 3VTAA 1KJWA 2BKUA 3G5UA 3GMSA 2WWGA 4YQEA 1NPTO 3K0AB 1WP4A 4D96A 4BX9A 3SHTA 2FUG6 4GWGA 4IF6A 3EDMA 3VPGA 2CJWB 2P2YA 1K27A 1TDJA 3J81A 3V7UA 3TIGA 4JVLA 2MSNA 4ZEXA 1GKKA 1AURA 3GP8A 5IFKA 1OI3A 1OWLA 2BE7A 3DFMA 4UE2A 5CLQA 4IVNA 2Y2UA 4BN4A 2ZT6A 5F1KA 2QYTA 4XB6B 2JFHA 4GMGA 3D4IA 1T6BY 3CLHA 3CX3A 2CVZA 4KG7A 5IWCA 3OWOA 4D9MA 1OU4A 4Q3BA 2HADA 3GJ7A 1SHLA 4S0ZA 1AKUA 4X7RA 2C98A 1TUEA 2C96A 3H83A 2GERA 1SPBS 3V4SA 4CDRA 1GSAA 1IM8A 2IXGA 2VQSA 4LVCA 2R00C 3I5MA 1GNTA 3OIYA 2AYYA 521PA 3O1IC 4Y2PA 3KUUA 4PG6A 2F8MA 2PJUA 1XZMA 2XZOA 5A3VA 1T6ZA 3NHRA 3TQRA 3DL0A 4CM9D 2HO4A 3MXOA 4P4SB 5C51B 4TWJA 1CUUA 3OY7A 4RXMA 1D1QA 1MT0A 1KFBB 3AM3A 3DW1X 2ZTHA 2HLDA 4PV7A 3I2KA 3RODA 3UBMA 4L16A 4DARA 4WI1A 1X87A 4A82A 2CUKA 4O8CA 1RHUA 3JXEA 1J56A 2JEYA 4W5HA 1KBZA 1WCV1 2BMAA 4PYLA 1FTSA 4ZPJA 1OW3B 3I45A 2WD7A 3I05A 3NGMA 4II7A 4KWTA 4MMXB 4OM8A 3UICA 3JZMA 4L5YA 4AJLA 3CH6A 1T4MA 3JS5A 3ANTA 3EVAA 2XF8A 1E99A 3Q7EA 4GKBA 2XNCA 4FYYA 3M6MD 2PL9A 3Q3VA 3M9LA 5FBZA 2JBAA 2YIMA 4HWRA 1F7VA 3WKAA 3OTQA 1JIXA 2V7QD 1XCOA 3K20A 4WA8A 3SCZA 1FVFA 3FWKA 3NNNA 4Y2UA 3DAYA 1S9HA 3T5DA 3GVIA 3JD2A 2XUQA 4FWBA 4BRUA 2QGNA 3M7IA 3BRCA 3HGMA 2QT0A 1BVUA 4P2BA 4Y6OA 5DRYA 3IXQA 5EP2A 1JNXX 5K3CA 1MW9X 4Y2VA 5LZ8A 3A1VA 2J5XA 2BI7A 1DPFA 4TRJA 3UMGA 2GXUA 4QU9A 4S3MA 3L8EA 1QIJA 4AWAA 5ALDA 3DDSA 3MXTA 3SDBA 4MA0A 5DX0A 1ZVMA 2PV0A 4Z99A 2OQVA 1GXSB 3X0DA 4EUSA 5HIKA 1II8A 4W9RA 3SS8A 3OZTA 2P9BA 3E4CA 1NHGA 1ITZA 1RRGA 1V8OA 3P9QA 3QHQA 4JQZA 3U80A 3BERA 1JQJC 3BMNA 3H5IA 3U4IA 4MMZB 4A1FA 2WA2A 5BV8A 1CVIA 5HRAA 5IM4A 2ENUA 1Y3BE 3V4LA 4CM9A 3KB1A 4AF6A 5A3JA 1SKQA 1ZZGA 1Y89A 4QOIA 1W5TA 2XVZA 1X94A 3WLSA 1M6WA 3PUZA 3GT7A 5JCZA 4B4WA 2XOEA 4MV1A 3H5AA 3SVLA 1T5OA 4OXNA 2QLNA 2H52A 1DQZA 2ODBA 4PZ9A 3KE8A 1BVHA 4CN8A 3W4IA 4HVTA 4J0GA 3A2LA 4BP9A 2YZ7A 2Z2YA 3QF4B 4J90A 2C7VA 2MJLA 1EQUA 2XTNA 1DJPA 3DYVA 5JOQA 2PUEA 1T9KA 1Y6RA 4L9RA 4MPDA 2G8NA 1A7JA 2BR4A 2G76A 3PRJA 4YJ2A 2RJOA 4NBTA 5HIAA 1KPGA 1U1GA 2E18A 1A98A 4M98A 3S2SA 4Z54A 5JDIC 5CT5A 2FDCA 2R8RA 3WGLA 4XJTA 1OFIA 2GYYA 1BE8A 4BS9A 1FFCA 3CNQS 4DPMA 4KXXA 1WVGA 1YOBA 3HMKA 1SIUA 3K94A 4RF2A 5HBGA 4ED9A 4DHWA 3DBLA 3O31A 3V8VA 4EY6A 1W0CA 1XAJA 1GL7A 3E6AA 4GVXA 3WI7A 1WDWB 4DDHA 1ZMRA 5T67A 1TQ4A 3QIAA 4MUYA 1B1AA 2Q5FA 3LQ2A 3DAPA 1R5NA 4TXHA 1R5OA 2DOKA 1CRPA 1YRAA 4DJJA 2ZRNA 5TXGA 4XJVA 1ZJWA 1P0IA 1C7FA 3I9NA 3IPAA 4L07A 3STUA 3V1UA 2B37A 1DHRA 4DLBA 2Q3EA 3GT3A 4GKAA 4HH3C 5AVXA 4KTTE 4JLBA 5REQA 1LDNA 1KVTA 1U9YA 3ITNA 1KSJA 3VNBA 3CLTD 3THWA 1NU6A 2XTZA 1MV8A 3C6BA 1KP2A 4NS4A 1RXUA 5U9CA 1G3QA 1SKMA 1O96A 1R9GA 4LCBA 3FGOA 5IDVA 1MQ9A 1NUQA 5HJ2A 2CNWD 2VA9A 4O2AA 3EFOA 4B3BA 1GEGA 2HKIA 1MOZA 5H0IA 3UKJA 1WHSA 2QMZA 3NM6B 4LRUA 1NF8A 1XQXA 3GJSA 5AKHA 2YL2A 3WDLA 1KS2A 4RACA 2PWZA 3A6GA 8AT1A 3EIUA 3OCXA 5CR9A 4CG2A 3ZBTA 3Q0EA 2J7PA 3ZCVA 3B1KA 3BHIA 4P6VF 5BO5A 3M8KA 4YVFA 1RXCA 1T9AA 5TVGA 1P73A 1WMDA 4BIIA 4DV1B 4LZWA 2PRKA 1ESZA 3VZRA 4MVXA 3RANA 1FCJA 3PU6A 3ZKAA 1EM6A 3NV9A 1NV8A 3QY0A 3TZCA 4K03A 4ER7A 4KDEA 2EFJA 2E4ZA 2HBYA 2PRIA 4FYWA 3DWGA 3PDCA 5FOXA 1W85A 3TPCA 1KU6A 4L3WA 4EP1A 4O4JB 5EHGA 2FEXA 4EARA 3DE6X 4G5XA 1GA1A 3ZDYB 4MYHA 1HLPA 2XDQA 4ENWA 3TIFA 4D02A 5TGDA 1O9BA 4MI3A 4DLTA 5DXFA 3ZJVA 2FEMA 3IPLA 2VO1A 3O8OB 4US1R 3T4EA 4BLVA 5EXEA 4GXNA 2G1KA 4AFNA 2X8JA 2Z2XA 5DH9A 3QELA 3SIXA 1XSEA 4LV5B 1VHTA 1Y8AA 1JH9A 1XELA 1ZITA 2FXVA 1N5OX 3CFYA 1EGAA 2SCUA 3OKFA 4EUHA 1BO6A 1P2BA 4KXVA 4ZFNA 3A4IA 5ALWA 2O8EA 5TMDA 4W5TA 4RPKA 2VNSA 3IP5A 3QKSA 1VYHA 3SIWA 4RBNA 2X9VA 1JWBB 4ROTA 3ROKA 2WHXA 1OYOA 3KTAA 3U49A 2HWUA 4I2VA 2V8OA 4OMDA 3RFFA 1Z2OX 3T7SA 5AVVA 4DMGA 3AIIA 1ZCAA 4RMJA 1HDEA 2OHXA 2XMCA 3IRVA 5PNTA 4ENQA 5JI2E 2HGSA 2W71A 5AXDA 1L7XA 3UJNA 3EPJA 5LA6B 1X1CA 3QFSA 3UCXA 2F3UA 1FDOA 3EXG1 1M2HA 2VNIA 3FHJA 1AS0A 1GIAA 1RMQA 1F0KA 2VPYA 2WAMA 4JLDA 4YNBA 3DKKA 1Y6JA 4QGGA 3VO2A 1FYFA 3ZWWA 4EM6A 5A2GA 1OBFO 1WZ2A 4DW8A 3ED1A 5JSQA 3OLVA 4MB0A 1FSFA 4J7AA 4N1AA 3PQEA 5JAOA 2GLXA 2A5GA 3JAWA 1ADCA 4CUKA 1L5QA 1WXWA 4HQFA 5L8VA 4PN7A 4KPGA 3FI0A 5H9WA 4P36A 5FPTA 3OQ1A 3DFIA 4ASUD 3QMMA 4KQIA 1T0HB 4IVPA 3WYGA 3X3HA 1N0HA 4B4OA 4QWWA 2ICAA 7REQA 3V34A 1HT3A 3DZFA 1QHYA 2GA9A 2J3KA 4CNBA 1DQNA 1G2OA 1XZEA 3OZIA 4P9NA 2XBLA 3ZU2A 4MPRA 3DP9A 4MIKA 3KDAA 1G38A 5JAPA 1CZKA 3THXA 1ZN8A 3TCNA 4EA9A 2CXXA 4GC9A 4OJYA 3T1QA 2WM2A 3UVEA 2XNSA 3GZJA 3TQTA 4CQLA 4MDYA 1NUPA 4C2TA 1DC5A 3ACBA 5KYYA 2CWWA 4DSUA 3TAHA 1Q0ZA 2C3MA 1GTG1 2W2XA 1UIRA 1MX9A 2JH9A 3FCYA 3P0FA 3H5VA 3JQ6A 4E5DA 1C8KA 3T3MB 2OHFA 3SXUB 3CLUD 1PUJA 3NU1A 1WKVA 5DLPA 3FCEA 1ISGA 2AN5A 2VDWB 1NQWA 5HKOA 1FSSA 4HMQA 5KUTA 2PVPA 3TMKA 3EIHA 3SEFA 3NHPA 2Z3ZA 2PL1A 1TT5A 2QLFA 3BHJA 3B8EA 5EHNA 1UKCA 2PTHA 3T5GA 2FPUA 4GPZA 5DTQA 4BIMA 3GRCA 1BVRA 1MO4A 2P5YA 1X8XA 5CBPA 5ALJA 1U0BB 2R7NA 1QIFA 3WL5A 4C08A 3I6QA 4AP5A 1BWRA 2FPGA 3K71B 1SC6A 4N12A 2KS6A 5IVIA 1QHSA 4MDHA 2RJ3A 2JGIA 4TL6A 3LK6A 1ZCFA 5EGSA 5JJIA 2GF2A 3RCBA 3CBQA 1E5VA 3IR5A 5J5AA 3DV9A 2H1FA 2VHEA 1N0UA 1W5FA 3NTRA 1DT5A 2X42A 4J49A 4R0VA 1HF3A 3NOVA 4I1RA 3EAFA 5HZMA 3PUJA 3I5XA 1WPGA 3R3SA 1UWVA 4IH1A 2DEUA 4YAOA 4O4IA 4RSHA 4H7KA 3EJ6A 1D0IA 3BXEA 1V41E 4O4HA 3KHUA 1SURA 1V5IA 3E9NA 3H84A 4NJEA 3LQQA 5AR1A 3UWMA 1H94A 1QGZA 4FMBB 4HWPA 1AZTA 3GMDA 4F93B 1C1HA 2N1BA 2O05A 3CRMA 3NHFA 3B9BA 1GZVA 1HORA 3SX2A 1VLQA 4KBYA 1QK4A 4L5JA 3SZUA 1CJVC 1U11A 4C5BA 1V95A 1SCUB 3ZX5A 1KH2A 1TJ3A 2FQXA 4UJ3A 4MQFA 3PYXA 2AHRA 2WZQA 5JY6A 3HEBA 1OFHA 3RASA 2CSXA 4U7DA 2QAGA 1C9DB 5G02A 3AOEC 5JQWA 3GVPA 4EAAA 3Q8KA 5AOAA 4YONB 2KW5A 1HYEA 2C97A 1QOPB 4HWOA 4YR7A 2JFUA 1RNLA 3FVRA 4PAMA 3V8NA 3C4JA 2E2WA 1G7RA 4KWHA 3NP7A 5D84A 5C8YF 3E1KA 1L4HA 4AKHA 1NR5A 2J6HA 2PVSA 3FSEA 3FRIA 3VDMA 1N6RA 1JMYA 4JYZA 2NP6A 3K1ZA 3LYHA 5KO2A 2GN9A 3P71T 5CTJA 3L0YA 2Q1TA 1Y8RA 2EDCA 5COAA 1E6LA 3FUXA 1U2TA 1XJWA 1YCFA 4KRFA 2UUAB 2I0FA 3MWJA 1ZHOA 1JBEA 1VCIA 3AL0C 4BYMA 4QBIA 1P0CA 1G8GA 4PLTA 1P1RA 1JMKC 1K5HA 2BTQB 2PGLA 3EDRA 4P33A 3HR8A 1PRYA 3OCCA 2M6KA 2BI4A 2Q5OA 1GAQA 1Y5RA 2BKXA 2YUIA 4JEUA 4B0PA 4XDGA 3KQHA 3BHNA 4FHEA 5ALLA 2ZJ4A 2GM3A 4CW7A 5LYYA 1V5GA 2OY0A 4CF3A 3WZ2A 2FRVA 2ZYUX 4L5BA 5ITZA 4WK4B 3I52A 2MSLA 1PDVA 3ZWKA 1SQ6A 4WE3A 3UNXA 2WSLA 1SR8A 1A0OA 1ZN9A 3OF5A 1AUOA 3P96A 4QYMA 3X1WA 2YOHA 5B7QA 3BRQA 3E9ZA 1O8CA 2WVAA 4HDMB 4A6XA 2ISCA 5K3BA 3TE7A 1O97C 4O3FA 2DFDA 1DRVA 3R3HA 2PZJA 5CX1B 4KH0A 3O4IA 2WMOB 1UJBA 4PX2A 4E5KA 1TD1A 2WKQA 4U02A 1R8SA 3WGHA 2CLCX 4UFOA 3ELDA 1YQQA 3ZVNA 2G1AA 3D0OA 2VF5X 2DPHA 2AHOA 2CHUA 2CZQA 2DBZA 2FWJA 2J7KA 1BRTA 2O3JA 3LUBA 2A3RA 3A1EA 2GCEA 1US8A 4RZXA 4AMYA 5KIAA 4JC8A 3T7AA 5BNWA 2BMWA 1KAEA 4PC1A 1V8DA 3AJEA 4HEQA 3OHSX 2L19A 3X1ZA 2YFQA 3IVMA 3H1FA 5H68A 2F67A 5IJAA 2A14A 1Y5NA 2RAVA 4YS6A 2J5BA 4TX1A 1LPPA 1P62B 5A5GA 4Z3OA 1XQ6A 5L4SA 3T34A 1OC2A 1L5NA 4LISA 1DZIA 2ERXA 4BVJA 1O6FA 2NXNA 3LUCA 1WU7A 4KACA 3UWOA 4ZP1A 1E58A 1KI7A 3ETJA 2HU8A 5C7YA 1HLGA 4IOLA 5H70A 1NWCA 4KW7A 2Q28A 1UK8A 4D0GA 3FKSA 4PZ0A 1XTIA 5BUSA 5T5QA 3I32A 4QELA 4I14A 5BYAA 1RM3A 3LA6A 1TMKA 4YR9A 2GPSA 3L07A 4IXNA 4RA9B 1DO8A 4UEQA 3LBIA 3UT5A 3ZGYA 1C7ZA 1CQIB 5AIAA 2G6TA 5L3ZA 2FLWA 2RONA 1MAHA 2VUIB 2CHQA 2NXEA 3RJ5A 4CODB 3ICVA 3UGQA 4EL5A 2HL6A 3B3AA 5HKKA 2VUHB 2QZZA 2I67A 3L9XA 1SVSA 3LGXA 1FLDA 3ND9A 2Q6VA 4U7PB 2PZLA 5E7IA 4DIEA 5FA6A 1JA9A 5C9ZA 4PS0A 1FIUA 4QULA 2X8WA 4XQ0A 2ECFA 3W8RA 1TNDA 4WNIA 3KR1A 5C32A 5HEKA 1S3FA 2BFOA 5TSDA 1C8VB 4C04A 4EPYA 1BIFA 1SFRA 4L8VA 1USIA 4Q1DA 1A4XA 5IT5A 2CYCA 2ZR7A 1AUXA 2H17A 3CKKA 3E7XA 3UV3A 2GBFA 3NDJA 2Q9CA 2F4NA 1ICEA 2P9TA 1G8SA 2JIZA 5IK2D 3UIEA 2CBXA 1YD7A 2P4EA 3MQ2A 3FH0A 1E0JA 1UH5A 2NZJA 1NLMA 3OE1A 4X1IA 2OCKA 3GLGE 1MIOB 2B98A 2D13A 4OGKA 3BT7A 1IHXA 4TV8F 4LW8A 2YVLA 3COWA 1P39A 4KXFB 4UTRA 1PNRA 1ZK2A 2F8LA 2H65A 3AHHA 4M22A 1JGTA 2XYPA 1PD1A 5K6AA 3EMBA 1K5GA 1U3FA 2AW5A 1L4KA 2QN8A 4B32A 4TQ9A 3MCAA 1P91A 1AM4D 3DOFA 2C2BA 2V7EA 4X85A 3H5WA 2FRXA 3NKVA 3OQPA 3F97A 2G4VA 4QGSA 1C0PA 5A4MS 3LMKA 2G70A 4I4TB 3RS7A 3E9YA 4HSEA 1L7EA 1RYZA 3KE9A 4EO9A 5M34A 3BAFA 4L57A 5FPYA 2GDJA 4F6LA 3T5TA 3ZYCA 4IFIA 1AVTA 2BFNA 3PF9A 4JYCA 3DFUA 4B35A 4GBED 4NG5A 5K7SA 1HBJA 4HNHA 1M83A 3PNVA 2IDMA 4KXLA 4LJYA 1U4NA 1T5IA 1Z0JA 3H2KA 3KJIA 3VPBA 1RXWA 1H8EA 5BVGB 1BCRA 2VBCA 1VIYA 4FT4A 3KVOA 3EEIA 4HF7A 1CEQA 1OC4A 3OCZA 2C57A 3AW8A 1A77A 3C8ZA 4TT3D 2VQDA 1P3JA 1X1EA 1UWCA 3CGGA 1RCTE 4LJSA 3IESA 2GARA 3G2NA 2LRHA 2FQ1A 3O0DA 4U2DA 3AHEA 4YRRA 5IJ0A 1I6MA 1BGXT 3QLJA 4D0SA 1N75A 2ID4A 4XCVA 1Z5VA 2QPTA 3COZA 4FFMA 1YJAA 5DJ5A 4J1TC 4R2IA 2FSGA 1JKJB 3S1SA 4MQ6A 1RIIA 2H07A 2C58A 3II6X 3O2SB 3ZHOA 1E2HA 5JXIA 2IXBA 1KA9H 2QRGA 4C2AA 4Y67A 5KOYA 4ZAWA 3GXOA 5ALVA 5JEDA 1FDUA 3SK0A 4XOUA 3UB4A 5AK3A 4B3SB 4R41A 5E0KB 5T41A 3RARA 4DCCA 1OTHA 2CE2X 3QUSA 2F64A 4NJMB 1ZD4A 4LHEA 4FDAA 3Q0TA 1PT6A 2QTZA 4MNTA 3RU7A 5LU8A 2WICA 1P61B 1UIMA 2WIDA 2Z1DA 4M1MA 1Z4JA 2AD5A 1QV9A 1W52X 3A7DA 1Z0FA 4U5QA 2H92A 3ZZ1A 3OOHA 1P0QA 4IFBA 1CUVA 1CJCA 1GCAA 2KI5A 1U3WA 5F51A 4D0NA 4DCUA 4WBNA 3DKRA 1C7QA 1WZIA 3SSNA 1BKYA 1I51A 1ZI9A 2LWIA 1T5SA 4H08A 5ALYA 1KAHA 3CB4A 4D4KA 5K09A 1TQ2A 1J0XO 2GMWA 3EDQA 3QEOA 4N49A 4QDXA 4CTNA 4HRVA 3DEHA 3DO5A 3G5MA 4S1NA 2J09A 4C0WA 4F6CA 5G1OA 3PGA1 5KYGA 4INOA 2YXDA 2YOGA 4DDVA 5INTA 3WOVA 3WXBA 4TT3A 5AOCA 3ZY3A 3WKDA 1NU8A 1NLYA 1HDCA 3W7VA 5JSUA 4F2PA 4Y9TA 3LP8A 4B3TB 3KL2A 3UGTA 4LFAB 1B3BA 4FGUA 1UWLA 5C7LO 4KX3A 3TKYA 1DS6A 1AS2A 1LFDB 4UPVA 4QDKA 3A4NA 2SHKA 5CEEA 2VDVE 2YQZA 2GKSA 2W37A 4BNLA 1MOSA 4TQGA 2JLQA 5I4KA 3IPXA 4F91B 1V11B 5ICEA 2OEPA 3QJYA 2Y0CA 4J1NA 3AR9A 4FWIB 1R6TA 1M8KA 1MRZA 1BJKA 3EGVA 4PPNA 4B3FX 4FN5A 3EIFA 1EWTA 1S02A 3UMFA 4NAVA 2WPDA 1C0EA 3H5TA 3BILA 1E2PA 3NBYC 4TTVA 4F5WA 4CKYA 2PL5A 1HDIA 3VO1A 4FYXA 1PFVA 1LU9A 1M73E 5AO9A 3TZHA 3R9KA 3UZUA 2XNKA 5B64A 3UBTA 5EIBD 1NFRA 1IM2A 2DTEA 4MRVA 1GUZA 3HGQA 4LYGA 4ZCTA 2CJFA 2YZ2A 3ZZ0A 4D0LB 1ORDA 5ARBA 1FJXA 5JAIA 4GECA 1QU3A 1ESDA 1JHUA 3ETHA 3E5MA 1GRCA 4XVUA 1EGHA 3H9QA 5ESWA 2C59A 4LQCA 3HU1A 4H7DA 1UK9A 4O4LF 2HAEA 3ZK9A 1LDMA 1L7PA 5ESRA 3LC0A 2PO7A 4RL4A 2PMFA 2GEJA 3VNQA 1NXSA 5J2UF 1D8AA 1OXVA 2I4NA 2XE4A 3O1JC 3UYLA 1YZYA 1UKVY 2VJCA 1JKIA 4WLOA 3B1WA 4RHEA 4D3ZA 2CE7A 3SJZA 1RCFA 2VP0A 3QRWA 3G59A 4II2A 4FFRA 2YCBA 5LWQA 4M8NE 1Y63A 4J43A 8ATCA 5LMZA 2JW5A 4D8XA 2NTNA 4DL9A 5A03A 2FB9A 1JA0A 3AX6A 5CT4A 2A9QA 5FWDA 1SXPA 3RS8A 5B37A 3ZDFA 1XD9A 1NW4A 1XZNA 3GX1A 3PGLA 1NNLA 1PJ8A 5K0SA 5IEJA 2FKAA 3QU9A 4UQPA 4LV6A 3CZAA 3F9RA 4DJFC 4RAOA 4FONA 3NTVA 4TTJA 2R47A 5FI5A 4RGYA 4B2IA 2REXB 4F45A 3IMCA 1U02A 3EG5A 2P69A 4C0XA 4HQRA 3T4UA 1RAHA 1YVRA 2MU1A 3GB9A 4M60A 4K6GA 1IOZA 1PT8A 1X7WA 4RJ2A 3FUTA 1EE1A 2CV2A 4JLUA 4E6EA 3MAAC 5CGZA 5EQTA 1Z0DA 2WD7B 1DPGA 4F2GA 4BAZA 1WCWA 5ALMA 1EJ2A 5DASA 5C53B 2Z4RA 3LL4A 3UOAB 4KK4A 3PK0A 2E4XA 1QIIA 3D6JA 4OHUA 3M6UA 2G9RA 3T38A 3TXYA 5AXAA 2LZ0A 5JIBA 4KK3A 1AZSC 2F62A 2JBAB 3MUNA 3W8FA 3I9JA 1YCGA 1NY5A 2W2LA 4BC0A 2AYZA 4RO0A 2VG8A 1JLSA 1JFFA 4BNDA 1N2GA 1A97A 1LZKA 4ETWA 1SG6A 3P9SA 1SHUX 5EG5A 3E0QA 1LX7A 4AQDA 3GCZA 4G5HA 3HDHA 2ZUCA 4US2R 2JFQA 3VYUB 4X71A 5CYFA 5C8XA 4GMXA 3WQBA 4LGVA 3SSOA 5IF3A 1IY8A 3VV3A 4AO6A 4CMHA 1WV1A 4M1SA 1YACA 3O4RA 1XRQA 1PEKE 3QV2A 4UBJA 3T3DA 1WM1A 4QPZA 5A9SB 5B57C 1FRVA 4W4TA 3PEVA 1II8B 1YHZA 2VHJA 2ZWPA 2UYHA 3AJRA 2Q4EA 1H4QA 1LF5A 2X0KA 4L95C 3BMNB 3ZDQA 5JCOC 1KHTA 3OQJA 3IBSA 3DP7A 3R6DA 4ARAA 1RMTA 3ZE0B 4ZI7A 1B43A 4DDMA 3A3YA 2WM8A 2OECA 2QL7A 1QIMA 2F3TA 5D3ZA 1YS2X 5JS8A 3C85A 4GEKA 3NW9A 1SUSA 2ODWA 2E87A 2KPOA 3EA0A 2PRYA 3K9QO 1WDKA 3O4FA 3QPAA 4II3A 1IE3A 4Y1GA 2QVXX 5JV5A 1LPSA 1RM5A 1T5LA 3CXRA 1WSBA 5CJPA 4I81A 1B73A 3FMGA 4IWYA 2VQ6A 1TAQA 3K70B 1P5HA 1XDDA 4GZ5A 1A8PA 4HN2A 3G5LA 1W96A 3W9YA 2Q50A 5HYVA 2EIXA 3IL2A 1KI1A 3SZLA 3GJQA 3PFIA 3R7NA 2FX5A 3GV0A 2O52A 4ALIA 4MJXA 1QNFA 1WNTA 1UKEA 1U0TA 1BD3A 1P2TA 1USKA 1KNXA 3SM3A 2UZ1A 3BD6A 4YJ2B 1CEEA 3QIVA 1EFUA 2XT6A 3CSUA 3LPMA 3LUJA 3IILA 5D87A 2G6BA 2FZCA 2Y1EA 1DCKA 5DXAA 2QTWB 3TOZA 5B36A 5K8CA 1YB6A 1T91A 3EXG2 3H8SA 3BF7A 1GG8A 3QWAA 3SJBA 2D4AA 3I1FA 2ZE7A 3L7LA 4K6OA 4RGBA 4WCVA 3CR7A 3G2PA 4YCSA 5MN5A 1D6MA 5DZSA 3DBLB 1GNVA 2DWPA 1UBNA 2DLCX 5C81A 1U8YA 2A86A 1JS1X 1UK7A 4OU5A 4KPUA 2XQVA 4R9SA 4MRRA 1QANA 2ZSBA 3QFHA 5IABA 2PKQP 3HI4A 3LCMA 1WA5A 3ORYA 5DDIP 5GZ6A 1WR8A 3F5MA 3FNIA 4TZ6A 4EMUA 2JGNA 3O1HB 1G9TA 4NFSA 1QHHA 3OD5A 4FIDA 3TOCA 2PSSA 4YI3A 1NRIA 4Y1RA 1SXIA 5FOTA 4MYRA 4YRKA 5REQB 2UXDB 1WVIA 4LV8B 1JHOA 4OXKA 1ZIXA 1U0OC 2H7CA 4RTMA 1BA2A 2QMOA 2AFIE 3ESRA 1B41A 4OL9A 3ZCQA 1X74A 5TQ2A 4QPDA 4CMKA 3THWB 4LXTA 4A23A 5IKOA 1PNVA 1W4BA 5HM8A 5DM4A 1O96B 2Q6IA 3HJTA 4O2AB 1M72A 1NXQA 2XODA 3EFOB 4ZC8A 3W5IA 1WHSB 2PG3A 3NH6A 4RVHA 4P0QB 2KYRA 1KEKA 4HQOA 5BN3A 3SBXA 3VOBA 1JEYA 4X45A 4NU8X 1I3NA 1CQWA 4DZTA 1ZD5A 4FGJA 2ECKA 2HXGA 2VJPA 1AT1A 4RY9A 3V8BA 2Y27A 3L8HA 4L1KA 2OHHA 2KLHA 4M9RA 1ZM9A 2LCIA 1KU0A 4XD2A 5FTNA 4F71A 1RXVA 4ZQFA 1JG2A 2EKDA 4Y2XA 2VJLA 4MWZA 1W85B 3S27A 3C14C 4B48A 5IBCA 3FWPA 3TVDA 1E79D 2IU4A 3TF5A 4Y2RA 4LJ5A 5CK4A 5ER9A 2OCGA 4G41A 2XDQB 1ZK1A 1ZH8A 2ZI7A 1JBQA 3RT9A 5HJ7A 3FDXA 1NN0A 3SVTA 1E1RA 2I33A 3OFKA 3AHFA 3HUUA 3GU3A 3KLNA 4LI0A 5K9ZA 2ALJA 2QE6A 4K9QA 4RMIA 3WYBA 1VSUA 2IH5A 5T4FA 2X8JB 2EX4A 2JBWA 3ESQA 1S7CA 2W2TA 3IMFA 3OLWA 1H66A 3QELB 4Q6BA 2OE2A 1PL7A 1F12A 4KYVA 3V8PA 2FPKA 3IHLA 2HIAA 2P1ZA 4O2LA 3BFXA 1YHYA 3R1IA 2SCUB 3E3AA 3SZGA 3PHLA 2O8EB 4F4IA 1E66A 3UKOA 4B4UA 3QKSB 4GM4A 3WJ7A 3GWGA 1DXYA 2EKZA 1D4FA 1F2UA 2OLEA 1JILA 5BW8A 1XRMA 3KTAB 3VMMA 5IVKA 4GM0A 3TJRA 3EXFA 5L51A 1QK3A 3LF1A 2HK9A 4ARSA 4MITA 3C8UA 4UEKA 1E3IA 1UPUA 3AHIA 4UNNA 3KFLA 1M5TA 3TR0A 2Y2VA 3WLIA 2MCFA 1T15A 2PX3A 5DI3A 3LCRA 2XI4A 1ZH4A 2C1ZA 1AQUA 1JAIA 2OWDA 4NBRA 2FPRA 2PUFA 4U7TB 1OZ0A 1QVVA 5J4LA 3EF3A 4H17A 3CPEA 1IN5A 4TQUS 1Y4ZA 2H2DA 2YRFA 3JAWB 1UP4A 1ECPA 1YONA 4MWGA 1ZIDA 3HXKA 5F2EA 2B35A 2ZANA 4OFBA 4XJXA 5EZ5A 2XCSB 3ROPA 1QE3A 2XZDA 1Y1KE 4H2DA 1TTQB 1VXRA 4IFEA 3U3OA 3WXMA 7REQB 2XGOA 2H4ZA 2K6GA 5EZYA 3VV2A 4PIMA 4W5QA 2WV7A 4M0DA 3UB2A 2X0EA 4V0KA 4WHMA 2ZJ8A 4R31A 2W6IA 5H3LA 5BPHA 3ZDBA 1V1MA 4N03A 3THXB 1J2EA 1R10A 4CDGA 2EFHB 4U9HS 4CQLB 4PHCA 1THMA 4IOKA 1F8YA 3ETNA 3QHPA 5KYYB 2PJRA 3WL6A 2WZBA 4JLAA 1Q0RA 2W4MA 3D1JA 1O6GA 4TN5A 5IYZF 2H18A 1I4TD 2JA2A 1G3IA 4JHXA 3OJCA 4ZIRA 4EY8A 4MS4A 2O8FA 1NAHA 1Z0AA 2C29D 5F9HA 4PFSA 2Z6VA 3WNDA 3L7AA 1TT5B 4RV5A 3U3ZA 2HV8A 4R5HA 4C5CA 3NR2A 3SFZA 4QM7A 1GZ5A 1QIHA 3JSAA 2C8LA 4MWTA 4J0HA 3TSCA 1OX6A 4EPVA 2ZZNA 2G0TA 5DEIA 1GN9A 3G6KA 4QPCA 5CBPB 2X77A 1P9WA 4FZJA 4HBZA 4DY4A 4EY7A 2OCLA 2YZMA 4BZWA 1ZPDA 2FPGB 4NBWA 4KFCA 2JDID 2W98A 2PR2A 5HQTA 1OX5A 2Z56A 1KSGA 3SEZA 4RFVA 3S2UA 2A7XA 2QQ0A 3L4KA 1Y6GA 1S3SA 3OE7D 5D85A 3DDNA 3FNEA 2P67A 4PVDA 5H59A 3WQHA 1Y4UA 4RE6A 3UHFA 4CT5A 3VZPA 3A1NA 1G6OA 4QIHA 2VA8A 1A8UA 3DZHA 4NDAA 2JK1A 3NWEA 3AETA 3LKZA 5A4JA 5J43A 4O4IB 5JMTA 5KHLB 3C3MA 1A9RA 3ZQ6A 3GPDG 5KJ6A 2BBOA 2ETVA 2ZJ0A 5JD4A 1IWBB 5AK5A 4O4HB 4RU1A 4L3OA 4Q4LA 1O94D 2WWRA 2P9YA 3K32A 3OX3A 4NJEB 1EIWA 4MUJA 5HXAA 1HZJA 3QBEA 4XWTA 4BKMA 3RYFA 2CHFA 2CLIB 1HH4A 4MEBA 2Q6LA 3FDZA 3SS7X 3IODA 5HE9A 2FFJA 4GQAA 4XQEA 4DV0B 2AEMA 3S99A 2WI8A 4MQFB 2D5LA 4JP1A 1GUBA 5ARCA 3KZ1E 1P8JA 2C95A 3DD1A 3QTLA 2QAGB 3T06B 3OD1A 2FR1A 4NU6A 3LAWA 3OBBA 4GRIA 1WRBA 3UWPA 4HWGA 3ZKWA 5KYXA 3KWFA 3I76A 5GV7A 2C2HA 3KJZA 1DAHA 3LZ6A 4RVOA 2FDRA 2QV7A 1O77A 5E95A 5FADA 4PRKA 5I7HA 4MSUA 2FP4B 1YBAA 4R9VA 3K4HA 5EMJA 1PTKA 5HOQA 5LMUB 3U6BA 1QRTA 3HO6A 4Q1EA 5L3SA 3J7AC 1SRRA 3CEMA 1LK5A 2Q3CA 3PQDA 2MYUA 5E9AA 1GAXA 5IHPA 3ZWAA 4BE4A 3QVGA 1PGOA 1X7DA 3HCAA 4DCOA 3VDRA 1Y8RB 1YQGA 1Z56C 2J3QA 4OEHA 2R2GA 3ZIAD 4A8JA 2PT7A 1SCBA 2WOJA 3LBNA 3FI9A 5KQRA 1YJ5A 5ALTA 2JDIA 1WCXA 4UQLA 1IN4A 5J1TB 5E1DA 2JJYA 4C4RA 2OC4A 3OURA 1U3DA 1CF9A 1XHFA 3LI2A 2M98A 2YRWA 4TV9F 1ZCBA 4R2LA 4CHTA 2WAXA 4G3XA 3ZCPA 4CKZA 3IJ5A 4N5NA 3DL2A 4I5GA 1ISRA 4R8KA 4K26A 4IILA 4KE7A 1PZMA 3KX2A 4R2MA 3AR5A 4JVNA 3DMNA 1SU8A 1CIPA 1OWOA 5ITZB 1HNNA 4INJA 2A1UA 4JYBA 4ZDWA 4B17A 4DEYA 1RQNA 2B4QA 3K0BA 2D1QA 1O94A 3DJYA 2YVQA 1M2WA 2GWRA 4X95A 4YH1A 5E9WA 2YRXA 2CDBA 5DTJA 1FTWA 1R0XA 2JLAA 3JR3A 4WFKA 1OIWA 3HU5A 2D7JA 1QF9A 4PIPA 2VYND 1CJMA 1E7QA 4NMLA 3UWSA 5GJWC 4FZ3A 1L3CA 3HYSA 1LBQA 4YQFA 3QVWA 3VAAA 2PS9A 3VPXA 2Q3DA 4O2RA 1C4XA 1X7XA 2GD0A 4JEHA 2W2NA 4KQCA 2NWQA 1FQKA 4DOMA 1XNJA 4NDNE 1ZVJA 3W5VA 4KUEA 3VISA 1US8B 2V96A 4IDGA 4MWCA 5LKRA 5KI6A 4BGEA 5HUHA 2LR0A 4LC1A 2N75A 1GTSA 3Q9LA 1T1JA 3GLRA 4Q15A 3D7NA 1AK2A 4W8OA 4B6GA 3TRJA 2RB5A 1G21A 2G80A 2H4FA 2XT0A 3KEQA 2ZUBA 3LPDA 4I8DA 3KTOA 1AB5A 5P21A 3U0BA 3V9AA 1D7OA 4JI7B 3FTFA 3EBOA 2RGDA 1ISHA 4FDTA 1UAGA 4CIBA 1IQUA 1RADA 1N2CA 5HMLA 4OHKA 2PCJA 1OXTA 3EDOA 4FBLA 3PQFA 3GLHA 4AICA 1X1TA 4X3OA 5FUMA 4M8IA 4U2CA 1LS1A 2IZ7A 2XQFA 1W35A 3Q2KA 4IPTA 4Q9DA 4ER0A 4KQGA 4LRXA 4FEGA 4C2UA 4QRDA 3R0IA 3ROEA 1MCZA 4DCMA 3QUCA 2WKSA 5F9FA 4QUEA 1SN7A 4D26A 1JR3D 1T5HX 1C1YA 1FFHA 2BFMA 2PDAA 4LRWA 5EFOA 1XO1A 1EPUA 2R3SA 5AM1A 4B71A 2W2PA 4JP3A 2NU6A 2D06A 3PQ2A 2WM9B 4XEHA 5ESDA 3UT5B 1XLTA 2B7CA 1IONA 2ACEA 2GJ4A 3DDCA 3ELUA 2J3IA 3AMVA 3FPHA 4NQRA 5PGMA 1QFSA 2XUDA 3RFVA 1NURA 4D9CA 1BWSA 1S8NA 1OE0A 4RDCA 1HXHA 3ENQA 2C31A 4K7JA 4DR1B 3IUMA 5CVDA 2Y99A 2BMJA 4EOGA 1FTNA 3NBAA 1LPAB 1UBEA 2ZSHA 5EAIA 4CMJA 4UM9D 2HLNA 4U39A 3LW7A 4DNXA 2P35A 1RP1A 3BXOA 3ER6A 3Q1LA 4GUDA 3TZLA 2HSGA 2XPCA 1C80A 3INYA 5CU7A 3RRYA 4RKEA 2RC5A 4UCWA 2RHOA 3W2FA 4AT1A 2GM4A 5CVJA 2R48A 2GYUA 3O74A 2JJ1A 1CBUA 2WHQA 4MAFA 3VR4A 1GAEO 2O2SA 1AGPA 3K73O 4F1KA 3I73A 1E7WA 2IW3A 4FW8A 4AS3A 1A95A 2YCLA 4L50A 3V32A 2Q1XA 5KU7A 4UE6A 2IYPA 2E6UX 3DC2A 2C0CA 4LQLA 4X1IB 2XQKA 3WAKA 4A6PA 2WM3A 2V55B 3CF0A 3CH4B 2X2FA 4TMYA 3TGPA 2C7QA 3TB6A 3A9WA 1L1FA 3GGJA 6ADHA 2BJWA 5GV8A 4JUDX 4FYHA 1UJCA 1W8DA 1ZBQA 1JDZA 1SVMA 2FQYA 3QYAA 3UMVA 2AMYA 4BO8A 2BFWA 4KQJA 1FY2A 1CKEA 1MB3A 4YRIA 5BMVF 3CX6A 2GHIA 1D04A 1UOEA 3NEAA 1JR3A 4JJGA 2VDPB 3UV7A 4DNFA 1JXAA 1JZSA 1ACJA 3M6XA 5I7WA 1EFPA 4YP6A 5LOVA 3C6YA 1NPYA 1D2EA 3RHZA 4UZEA 5BOSA 1U65A 2HJHA 3A6DA 1PKXA 3QEMA 5CT9A 4YECA 4G65A 3O38A 2GEFA 3GD5A 1TM1E 4IDNA 2X0JA 3U17A 2DBYA 2WU4A 3IQIX 4Z2YA 5FB3A 4LJ7A 1BCRB 5DBOA 4JSTA 1WW3A 2O6LA 2V5UA 4FEEA 2I2FA 4GE3A 5WRFA 3BZBA 4OYHA 1ICIA 2H08A 3D8SA 3CYFA 1UWKA 2VHVA 5EKDA 3IDSA 2AXEA 1GT91 1SWWA 3K2IA 4RM2A 4RPLA 2P6OA 5IJ0B 1Y8ZA 4P0PB 5D3QA 5EE5B 3H9GA 3E9EA 3JVIA 5FCDA 5FL7D 4EDHA 4KGVA 4C4AA 2EW2A 1CY6A 3H2YA 2OXIA 3NYWA 2OO5A 4P92A 5EVJA 1U9IC 4F8EA 1PI3A 5BURA 2CHEA 4J1QA 4D98A 5SYNA 4LXUA 1W25A 4NMHA 2WU0A 1KPHA 2I1QA 3KELA 4FXPA 4N5LA 4PSAA 2FZGA 4BJ6A 1HLFA 1MGPA 1TCBA 4B9AA 1WXQA 1PNTA 3O82A 3C7AA 4YP5A 4RSRA 1YS7A 3N8KA 2X2OA 5D5QA 5ALPA 4DMUB 2JIRA 5HG0A 4Q93A 4WXHA 3SQWA 2W0SA 1XPOA 4LOJA 1G4UR 1UAYA 2M6RA 2CL5A 2V6BA 2I6TA 3L79A 3ZXUB 1IK6A 5CP8A 1APBA 2H57A 2NO0A 4RK1A 4XD7D 5C0OE 5BY2A 3DWFA 5F23A 5JI3E 3NV7A 2B5VA 4Y9UA 1N7HA 4RZSA 1NW9B 1G8HA 3B1FA 1M5UA 3EZ6A 2G09A 3FDIA 1EIZA 4L74A 3VOAA 5A5VA 4KO2S 1FFXA 3JWJA 3GO4A 5SYMA 3U4CA 3E35A 2HHJA 1VCNA 3CISA 5EEHA 1S01A 4AULA 2HU2A 4WBNB 3WMRA 1I32A 3KXIA 4FKBA 4CV1A 1QFXA 1D2GA 3AKDA 3EB9A 3KZOA 5AVRA 5KCZA 2J3HA 4QU0A 3VZQA 1N2OA 1G0OA 2QU7A 3WOHA 2OPHA 3BE8A 1T5BA 3BD8A 4TTQA 4PZDA 3T0GA 2D62A 1C2YA 3F4KA 3LLVA 4IZOA 1IH8A 3PHBE 5E3IA 5IWAB 3A9CA 4D4GA 3MS4A 2NVOA 2QG4A 2WD9A 1GRRA 3V4FA 2FG5A 2LIPA 2AFHA 3EMDA 3OZBA 4UAJA 1YRYE 5FL7A 5HFAA 4LZLA 4PZCA 5A9RA 1W6UA 4DV7B 1AZLA 2XA1A 4NFLA 2WU1A 3DEZA 5P8WA 3N0WA 1V45E 2PKYX 3OZSA 2X5KO 3FNRA 1YV9A 4IY1A 4S1WA 4C4OA 1O3YA 1XTJA 2RHLA 3ISJA 2AA3A 3PDUA 4ZRDA 2QE7A 2IWHA 1PT9A 3IEIA 4L28A 3RLIA 4Q34A 5EJ8A 2KE5A 2X8BA 3FOBA 4IGIA 4Q4AA 4Z49A 1XMIA 3OETA 4PYOA 1YB4A 3ZU5A 2HSEA 4AJOA 2QRPA 3BPSA 1D9XA 4MB2A 4YQYA 4ZVVA 4DQ0A 4DG8A 1E6CA 3F5DA 4RVNA 3KOZA 2RK6A 1XAHA 3VPHA 4PYJA 1UPTA 3IHWA 1ZD8A 1MO2A 5E1BA 3CSSA 4ETMA 2QTMA 5F1YA 2KX7A 1R2QA 4PQGA 3JATA 5H16A 2AXQA 3RVLA 1G9XA 5JRJA 1T1SA 2PX4A 3UG7A 1ZYUA 5MFZA 5J2TF 4ESVA 4HEJA 4TWRA 1RI5A 4ZQBA 1SBIA 3AY0A 3SDZA 5HKAA 2VNKA 2ASVA 2FCAA 1H0HA 3Q3JB 1ZESA 2N9UA 1KTIA 2V1XA 5KQLA 2OFPA 4EF6A 4LOAA 3E18A 4I0WB 4JEIA 4RH0A 3LWZA 3S44A 3WNVA 4ZZIA 3VVLA 1NBIA 5FT9A 4QVIA 2A0FA 1YIAA 4OI2A 1PYGA 4LOIA 5AI0A 3W2IA 3LYLA 3T5CA 1KQOA 5KNBH 1E69A 3KR0A 1CUHA 3IQFA 1RI4A 1ZCZA 3HYNA 3RSQA 2DY0A 1U8FO 2ZBFA 3GZNA 1HQDA 4LRSB 3WLOA 3FJOA 3CY6A 3ICEA 2PCLA 1T29A 4TVBA 3W3ZB 1IG3A 1OVGA 2CLFB 4K8RB 3EA4A 4TLEA 2ZIFA 1MFPA 1ZO8A 3HDVA 4ALMA 4QXAA 1F0NA 3JZDA 3PUYA 5CG1A 2WNSA 1CUZA 2GN2A 4UCFA 2ON6A 2ZBDA 1VIDA 3MCVA 3DAOA 2GASA 4P3XA 5EZ6B 1KC3A 3WYFA 2FXIA 4JQYA 5AVTA 1TLFA 2DPGA 3LF2A 3LX6A 1AXGA 1DBSA 3I6BA 1K88A 2WSMA 2IUTA 1XXHA 1JXOA 2YWJA 4NZ9A 4UPEA 1X7WB 3F3SA 2YXBA 1N7IA 2IV2X 1V71A 5G40A 3EIQA 1PR1A 3QM1A 5CURA 3L7BA 1RHRA 3F90A 2UUPA 3E3OA 1TFRA 1Z5UA 4R9RA 3ZTYA 4KKVA 1TYAE 2XCUA 1BFKA 3GARA 4E07A 4XB1A 4FM9A 1H9BA 3T1TA 3W8EA 3T54A 4N6OA 5FA5A 3V1LA 5FDFA 1U0JA 5KTMA 5F64A 5AJYA 3KJFA 1GU1A 5EESA 4HAVA 5HIJA 4N9WA 3SZOA 1JFFB 1JHVA 4BNDB 1YZKA 4P4UA 2A78A 1X3SA 3PI7A 4KPYA 3UAXA 5B3JA 3LOQA 3UOWA 2Y0BA 3FDFA 5JPCA 3M5PA 3I1YA 4FOSA 2PKQO 5T3YA 1GFZA 1M1UA 1GCOA 2AT1A 4IG4A 1UOOA 5BWOA 1W581 2C7BA 1ZOSA 3SHWA 4ZJUA 4EG7A 5F76A 5TPWA 2XCOA 1MN6A 3G0CA 3A37A 2IX9A 1J33A 3TW8A 4YT2A 1X42A 1HQCA 1AQLA 3P0RA 4QT4A 2YMMA 3L7OA 3S29A 2BTEA 1YIOA 4GKKB 5ILQA 2FRDC 4OFZA 2CDRA 1NE2A 2XIJA 4ZI7B 1C3EA 1NM5C 4XX1A 5GIPE 4I5FA 2JANA 3BREA 3PFWO 3KQSA 1TQHA 1JLLA 1II0A 1Z0ZA 2IHYA 3IQEA 3QP9A 3IA7A 1HPLA 3IQHX 3WO0A 5KWSA 4RULA 1CU1A 1ZSNA 2ZCUA 1QPGA 5IZCA 4RTSA 3SJ7A 5C1DA 1WDMA 3DMHA 2VHTA 1JQLB 1AKEA 2BHSA 1HI9A 4LSZA 4E14A 5CUQA 2UU9B 2IIVA 5LQAA 2VYQA 2KSQA 2PJDA 2AR7A 1NJFA 1IEQA 2JKVA 3OCJA 3UKDA 3B70A 2VP2A 4AUMA 1T13A 4GNRA 5K01A 3PPVA 4P81A 4TLCA 1YOVA 5JH7F 1EVLA 2QRJA 2ZBQA 3D2AA 2J3JA 3F5SA 1NBMD 2HPZA 4WAUA 5L3VA 5BWMA 1I3MA 3RU2A 1I1QB 4B4DA 1GZUA 2UZ1B 1A5ZA 3TQQA 1EGVB 1QGOA 3ANYB 3IRUA 3TINA 1NT4A 1TA0A 1HTBA 1TCVA 2DZDA 3H3XA 3KOYA 4V2IA 4BPRA 1FDRA 1XX6A 2CBGA 3FW1A 3L92A 4FR5A 3E7DA 2PMEA 1MA3A 3MWYW 2PNJA 1OH8A 2VJNA 2EP8A 3H8JA 4QVGA 4EYOA 1ATZA 2IP4A 1Z12A 3F2VA 1PWEA 1X1RA 2PUHA 1YUBA 2VHZA 4FGWA 5ITVA 4W9NC 2V3CC 3NASA 1XA4A 1DRJA 1I0LA 1U3GA 4KPUB 3F8TA 1U2SA 1FRNA 4H1UA 3PT5A 3SC6A 2OBYA 5LR6A 1X13A 5KHOC 3MERA 5JNRA 1JRLA 2Z30A 5FLYA 4BO1A 4OFWA 1WD7A 5DULA 4EHDA 4LK2A 4XUEA 2ZUFA 3VR6H 1R6BX 1TU0A 1XZCA 4KQXA 2AG1A 2IEGA 5B5SA 5CLLA 1QHHB 3HY4A 1J2TA 5DSTA 1TUIA 4Y1RB 3L8YA 5BNFA 2WG2A 3BGDA 1N2EA 4CCYA 3MJDA 1X77A 1BX0A 3R20A 4X8LA 3U1BA 1YXMA 1KQFA 1W34A 2FQWA 2BR3A 1JQBA 4X61A 4DV6B 4YB8A 1U4SA 1XIVA 3LYUA 4LYEA 4OP2A 5TQ2B 4UVHA 1ZGGA 1G3RA 4PZZA 4RHFA 5K0TA 1JJ7A 1J0CA 3TKAA 3U3XA 1M1ZA 1ADGA 4YQZA 3V2GA 2L18A 16PKA 1ZD1A 3HL0A 3ONEA 4GXRA 5JWRA 4K9DA 4TZTA 2X4IA 2J9XB 1LLCA 3ENVA 4G89A 5BN3B 2I3ZA 3OUZA 3WK7A 1T8PA 3WRYA 2AMJA 3IPYA 4RNCA 4BCCA 1JEYB 2AJLI 4DF3A 3GK3A 4RSGA 1G20E 1XJ0A 2H2GA 3FB1A 2BEJA 5IC6A 3OEHD 1NBMA 4URHA 4HNUA 5AUOB 5KYVA 3VR4H 2J8ZA 1DTWA 4C3UA 2REOA 3TN7A 2EGGA 5KOIA 3TMYA 2XGGA 2OHIA 2Y6VA 1BH2A 3AZOA 1BROA 2XQIA 2QG9A 3HCPA 4GI1A 1A9SA 3MLBA 2V6GA 5JXJA 3QXHA 4JBWA 5LKAA 2BSQA 1B26A 2IQIA 4Z4IA 1NLFA 1YS4A 4KQMA 4Q9JA 3HCWA 4Q82A 4PGAA 5LIPA 4BX3A 4DYHA 2VXOA 1GZDA 5EJFA 3NHAA 2O8CB 1DOZA 4KZPA 1UANA 2HJRA 4FX2A 4TWZA 3WSTA 4P0TA 4Q1BA 2D74A 1RBQA 2I8CA 4GPAA 1NNEA 5AXBA 3H1AA 5KHAA 1KIAA 4ZARA 4MKXA 4QYWA 2O2ZA 1FP1D 1TRKA 5FQOA 4F9TA 3SHOA 4KQWA 1CC1S 1QXSA 1OLUA 2J45A 3SQLA 3VDXA 1OCEA 2NUPA 4M6WA 2J85A 1NN1A 3T35A 3AI2A 4F3CA 3DCIA 1JJFA 3OT1A 4RUKA 2G72A 4HRYA 4HG2A 3QFFA 5AIBA 5ETJA 4F96A 3WFIA 1KAMA 2EZTA 1N9GA 1PQPA 1UDAA 1W75A 2IKSA 2XY4A 3FZEA 4M76B 5F4ZA 1KDPA 2C2XA 4A6DA 3S2FA 7YASA 1K2VN 2BJHA 4WZAA 1SBNE 3KWMA 1DKOA 2VAWA 1F2UB 4F2DA 5B3AA 3U4QA 4A0SA 2KBEA 3ZNOA 1JQDA 4FOLA 2VBGA 3N70A 3J81k 3GXBA 1YZHA 3EXFB 4L9WA 2WHRA 2PZAA 1T8RA 4HK4A 4JMLA 4RVGA 3WNZA 1NRXA 2GCPA 1C4KA 1QFMA 1RQLA 5EIFA 1ORRA 2XSZD 1MDFA 1KNQA 2WTNA 3CX8A 5EKTA 4X8HA 1DBRA 5J9FA 5SV2A 3ZH2A 2QHXA 3ZCSA 4N6NA 2P6UA 2QOEA 1VG1A 5DI3B 4MYDA 3TNDA 1S2IA 1Z82A 2I7VA 4IHKA 4P7KA 1T35A 1YFLA 4ZT7A 3W8DA 1EBFA 5HTOA 1P9RA 3OX4A 4K5QA 4KWIA 1YB7A 1N1DA 1JXQA 3ZUGA 2FR8A 3DQZA 3GLUA 1KPIA 3MW8A 3WMGA 4DV2B 3AXSA 3JQAD 5AM3A 3PEFA 3V7YA 3Q7RA 4YCCA 2WTEA 2YASA 4DR5B 1WMSA 2JK0A 2VCHA 1YQXA 2P1RA 4UHFA 1B16A 2FUEA 2IYSA 3W5JA 1ISPA 3EAGA 1W47A 4RD3A 4UCQA 5C3UA 4DSTA 3R3YA 1ONOA 4H27A 2MHCA 2TSYB 4P4GA 2C7PA 4C1NA 4P31A 3NH9A 1LSUA 1OFGA 3DHYA 4N0EA 5EZYB 1R16A 3LHIA 1GNQA 1UFQA 2A8YA 4OOFA 4UNPA 4KTVE 4JNKA 4R3NA 2I4LA 1UP6A 1V1MB 4HYEA 2WSYB 1QGAA 2FN9A 1C0LA 2QV0A 1WAMA 2R1UA 3CNEA 1B23P 3OTGA 1Z68A 3AHDA 3EVDA 3PA8A 4J16C 2OENG 5J4HA 1V26A 4W99A 3ZWPA 2PUGA 2AK3A 3LT5A 4WVLA 2B4TO 4DILA 4EQZA 5CXXA 2Z58A 1NXXA 3P19A 4L72A 2WF6A 2WILA 4YK7A 4U4AA 1PFWA 3GGOA 4DQDA 2M6SA 4U9UA 3BXHA 5FUWA 4MS4B 2B30A 4ZIRB 3OX1A 2YOFA 2O8FB 4TM7A 3K30A 1G5IA 5A1JA 1LTKA 5JMOA 1Y8QA 1YDHA 2GPNA 2XMGA 1QMPA 2O7QA 4PNHA 3UPDA 4JB0A 4DLZA 2HB6A 1NFQA 4EJ0A 1YRWA 4DJTA 1OIVA 1FNSA 2P79A 3AUUA 2JD2A 3E8XA 3M6AA 3BK1A 4UVIA 2PSJA 1CP3A 1NYQA 2J6BA 2ZJYA 1NJ1A 3KPUA 1XVVA 3LBFA 2R96A 1PTJA 1ZJ5A 2QD4A 4E2WA 4I08A 5GWXA 3SR3A 1LRKA 3WV4A 3WLRA 5HQ3A 5JTUA 3DMTA 1LZLA 2QT9A 4OU4A 3GAZA 4WOBA 2ZJ7A 3NBKA 3UUFA 2H2FA 5C2JB 2OORA 2D1SA 4KXWA 2NNLD 2R66A 3B82A 3O94A 4WLNA 5MF6A 2VNHA 4JXKA 1UZNA 2MOKA 3DVAA 4F1WA 1P7PA 3ADOA 4LWOA 3HYTA 3TQCA 4MV4A 3IHKA 3TQOA 2JAUA 1FF9A 3SG0A 3UGJA 3AETB 3KU1A 1YMVA 1XT6A 3VUEA 1OGJA 3BCSA 3WNBA 1UFKA 3I2YX 4FMDF 4CKXA 5CH5A 4HAIA 1NSFA 2XLBA 3ZV6A 3D4BA 1RLOA 2HNKA 4FQ8A 1VBNA 2ZP1A 3OJWA 3RYFB 3DE3X 4BO4A 3DHVA 3WAJA 3GYGA 4QAJA 3COJA 1XK6A 1ULBA 2IXEA 3FDZB 4G0UA 3F9IA 4AS2A 4KKXB 2I91A 3PFBA 1WJGA 3UFXA 1L5VA 1SU7A 3H9CA 1LJLA 4KLAA 4MP6A 5DM1A 1L4FA 3WIOA 2R44A 3UMRA 1PWXA 3AI3A 4QNRA 5B12A 3ND5A 2GEVA 3ZKWB 3ZE7A 5KYXB 2XV1A 4R8RA 4ROSA 2A0XA 4JLWA 1XMJA 5CDFE 1OI4A 1RJDA 4WFJA 2W6CX 4J3NA 5KDOA 2HDWA 4EB0A 3CTPA 3WWZA 1F4VA 2OGSA 1R00A 4X62B 3P5BA 4V0ME 5L3SB 4Y2TA 5T8KC 3D5QA 4PSKA 2GXQA 3ZH9B 1I3LA 3QVGB 4M38A 3LPCA 4FNAA 3WB2A 4AZ3B 4Q6WA 4A8JB 3F74A 3QX9A 5M3BA 1SZCA 1PVVA 3MFYA 1GL3A 2YS7A 3PJRA 3O8LA 2GHQA 3VKWA 2FLKA 4NMWA 4KYUA 2UZ3A 1LPNA 2QX8A 2QTAA 3GGGA 4L8WB 4E5VA 5CFNA 1ZQ9A 2NO5A 5LP6A 2FJUA 2H1HA 1EHCA 1GNLA 1QE0A 3NBUA 1I3CA 4TLBA 3GCWA 2QL6A 1EUQA 3G2QA 4LXIA 3ZGXA 2CLDX 1W36B 2HDNB 1AK9A 1F9EA 1RD4A 3AFOA 5CA1A 2D0IA 2QX4A 4G2TA 3WK8A 5C4GB 4WBXC 4WV3A 4CMAA 5B4VA 4JX9A 5G0VA 4XJSA 2A1UB 3HYCA 5A2QA 3H4TA 3BIWA 3AI1A 3SYKA 4DA7A 2VATA 1VZ2A 3QMWA 4AURA 4GXQA 2J30A 2FVYA 2JHCA 3K0CC 1YR7A 1KFCB 5JAQA 4NZOA 2GK6A 3LY5A 4PLYA 4ZK6A 5L9AA 3HB0A 3KETA 1MA0A 1RLMA 1ESMA 1NW5A 2VJQA 1ZM2A 3KO8A 4DLUA 1GY8A 3GIWA 3IDAA 4HGRA 3KQLA 1I5OA 1X7XB 1YGYA 2YY7A 3C41J 4TL7A 1Z38A 4NARA 2XWJI 4OMFG 1CRZA 3RFXA 3CX7A 2VJYA 2ABWA 4LKRA 4EW1A 2W2QA 4GR5A 4ISBA 3SYTA 3E22A 1A9TA 3JV7A 4JBHA 1T8YA 1DC8A 2ZT5A 3L18A 3ORRA 4JJ8A 2M1XA 3UJ3X 4J94A 1G21B 2FOIA 2Q62A 4KFRA 4F21A 2GAOA 3KZKA 5EHIA 1I2CA 2CMGA 4OLHA 2YC4C 1EDEA 1N2CB 1BHJA 5LZ2A 2Q3MA 1Q50A 2R6HA 3MTAA 4LDRA 4YRTA 1M2EA 1SCQA 1TKCA 2W83A 2WUFA 3GLHB 2NSJA 4DLWA 4RQAA 3QFRA 1QRAA 2DTDA 1AG9A 2QJRA 5GINE 4BFXA 1XVTA 2PBZA 2O5EA 5JADA 3EWAA 5HUQA 4N6GA 1W19A 3DZJA 3ML1A 2HIMA 3CM0A 3EEBA 2XXAA 3T99A 3GROA 4QICA 1XLVA 3FUCA 4PIVA 4BASA 2OCYC 3L6RA 1Y80A 1FFAA 2EEZA 4MARA 4NFHA 2WWFA 2KQUA 2NU6B 3Q2IA 4Q4DA 3REQA 3T7DA 1Z26A 4DLNA 4OGLA 4ACAA 2O0HA 4K88A 3DBHA 3QE9Y 1BDMA 4LZPA 1RPAA 1JVSA 1XPUA 5BN4A 5B4UA 2ZREA 4UXIA 3WIEA 2R00A 4TSKA 3P9XA 1UKAA 5K2MA 3SSMA 3JYPA 5BYKA 2HRBA 4OSOA 2CNDA 5C8VA 4EG0A 2A9JA 4X3CA 1D5WA 3DOEA 3JQGA 2PLNA 3EOAI 2M6LA 5L53A 2JCSA 2VTDA 3SC3A 3L02A 1HA3A 3EWSA 2JZNA 4IIBA 5DNVA 4EVQA 4JYPA 1GLGA 3GFVA 4KDCA 1Y3CE 1D2NA 3AR2A 2AOTA 2JC3A 1PJ4A 5JVDA 3OZWA 4OHXA 3KKZA 4HH1A 1QTNA 2RH4A 5LP1A 2NMVA 1BMFA 3PQCA 4H35A 1PT7A 4IRXA 4QHYA 4JD5A 5I3ZA 5C80A 1EKXA 1JFLA 4LI3X 1CB0A 2ZOSA 1CUYA 3PDJA 2MSEB 5M2QA 2P8JA 2O7RA 1SH7A 3COVA 3UK1A 2E89A 2PMCA 2VDMB 3IUYA 4WUVA 4PTLA 4AY4A 2IF2A 1M6NA 1JFRA 4R2XA 5IJ9A 1M66A 1HL3A 3K1TA 3M6VA 1CHNA 4M21A 4QBKA 3ICWA 1UBCA 5ESXA 5A62A 1M33A 3Q87B 3KJEA 4Z0PA 3OQ6A 1ZOLA 4CWAA 3QEJA 1V4BA 1FNCA 2HRQA 3IIEA 4DA4A 4C6TA 4OHPA 3ZNQA 4P93A 1UMKA 1I4OA 1NTRA 4H6WA 4OGFA 4HFRA 3CLVA 3A6HA 2FJPA 4B44A 4BBAA 1SUIA 1W5SA 1I2DA 1UOPA 2E4WA 4G5OA 4PX3A 5E8RA 2GZHA 4CTMA 4LVOA 1C29B 2D1RA 2XUJA 1EFPB 1FDSA 3SX4A 2VP5A 1Q2XA 2NVUA 2UVPA 3LPAA 5LOVB 1PJ3A 2JJQA 2EJVA 4YROA 3H3FA 1Q16A 2NT4A 4UD6A 1IJKA 4D99A 4YV0A 4V1CI 3QX7A 5BOSB 1YVPA 1ZNQO 1OWNA 3ZXXA 1YBVA 3QEMB 2ET6A 3MSXA 4KFTA 5KBYA 3CVWA 4DYVA 1NYTA 4UM9B 4OX9B 4G5SA 3BG5A 1GKLA 3QWHA 1KY4A 2WB4A 3NT4A 4TN1A 5GGYA 5G0WA 3NYQA 4RL6A 4PC2A 1X0VA 1FBTA 1JKFA 3IDQA 3HO8A 4M1EA 3ETLA 1LW6E 2PY6A 4NECA 4YUAA 1P1KA 1Y37A 3AQ4A 5GP1A 3WMEA 2MINA 4IHQA 1NJ5A 1W30A 4J2TA 1VPWA 1VE7A 3OCWA 3K0FA 2ZYVX 1CR6A 1GA4A 1EFKA 2YVKA 3GC6A 1V9SA 4ZU3A 3S55A 3F67A 3UTCA 2BMFA 2WG0A 2R7KA 4HADA 3NP9A 4BVAA 5TF0A 4RKQA 5JBIA 3M70A 4D41A 3VVCA 4D3SA 1A7UA 3CCFA 5JDIA 3PP8A 5DTMA 3T3EA 1VIAA 3ZPXA 5KKCA 4B40A 1VL8A 2FPSA 1DWOA 2PEYA 5DT2A 3RSLA 3PNPA 4OA5A 1GR1A 1J8YF 5LQKA 2I3DA 4DY6A 1FFXB 2ZAGA 3M6FA 3OFND 2DU8A 4ZAZA 2QT1A 4BRWA 3GUVA 2XYRA 4D82A 4J2OA 1Z6XA 3N74A 2WKWA 4PTYA 5T7BA 1RCUA 1SO8A 2HCFA 1NQOA 4PCLA 8GPBA 1A27A 3HHEA 4LYJA 5DYTA 4DG9A 2VN8A 2MSWA 1NVTA 4JKYA 2Z83A 1ZGJA 2R6DA 4ME6A 3W6OA 1Q1ZA 1AMUA 3MHPA 2FFRA 1E60A 3B6JA 2BCJQ 2VRNA 3A2MA 3HK2A 3DEAA 3IBTA 4LF4B 2QD2A 1PEAA 3CLSD 5AW1A 2RAFA 1SBZA 1AKWA 3BCUA 2SECE 2QUBA 3GBSA 3GEGA 4BU0A 4C6RA 1KK2A 4D9JA 2AFHB 2VCEA 4IV5A 5M7EA 1E1DA 2OG2A 2GT1A 3AFNA 4JN6B 4NHEA 1N34B 4FUTA 2GD6A 2NV0A 4URUR 2DUJA 2W7TA 1YCDA 4EA8A 3M6WA 3KNZA 1RAFA 1U0SY 5LD2C 1WE2A 2HYIC 4X1OA 1NUSA 1Z3CA 3N6XA 4Y9RA 1ZICA 1J90A 3A6KA 1H69A 4IF4A 4G0YA 4N0MA 3B51X 1NULA 1XWFA 2IF0A 3GG9A 3GMTA 3LUDA 4HO1X 4LVNA 1M7GA 2XVYA 5LLSA 3RUEA 4YAFA 4Q4AB 1WV0A 3ONVA 1PG5A 1JTVA 2BBWA 5DVZA 2J5KA 4BMDA 4K1XA 5CX1A 5IH7A 2GPJA 1PJBA 3P0IA 4XVCA 3SYRA 4CL2A 1YH3A 4YAJA 1P3DA 4P5EA 4OIFA 3ZWNA 5DNWA 3UH0A 1A3CA 4MGIR 1BXZA 1XTTA 3JATB 2Y1LA 3DC7A 4YFYA 3P52A 3T15A 3V97A 2P6PA 1I2ZA 4WNYA 2FG7C 3MWLA 3Q0IA 4MEAA 4RDHA 2GN4A 5SY4A 5HHTA 4ZAFA 2GVNA 2ZAMA 2O2JA 2ZCVA 1EX1A 3B3JA 3K16A 2I29A 3M6IA 4YWJA 2GPYA 3PNBA 3F8WA 3U5TA 4UTOA 3WHPA 4MYSA 3L5KA 3G82C 4M1YA 4UM8B 1RKQA 4G6ZA 4R69A 3FAZA 5F35A 2WWYA 4UXHA 4HPWA 1Z5ZA 2HT1A 2V3WA 2OM6A 1IZ9A 3BFKA 4A6EA 5ANRB 2Y68A 3GZNB 3PB3A 1PWYE 1TF2A 1ETUA 2PBFA 1PDOA 1MEOA 2AJTA 2FYTA 5IS2A 4DDKA 4QRHA 3L0OA 1IJEA 2P2GA 3OOJA 3MCWA 2Y1XA 3OLQA 3WIVA 2UZAA 2FEAA 3R6LA 4RVDA 3TBFA 1X86B 4XQCA 2CB0A 3GRVA 5IVDA 5IJWA 1X6VA 4OQQA 3MPOA 2ATEA 2PYIA 3LUHA 1RQ7A 1UMBA 3ND8A 1RAEA 5IKXA 1O95D 1D6NA 1W94A 3QVUA 5AJHA 2DFPA 1OREA 5KPDA 4Q9NA 1RAGA 5FBVB 2FA9A 3QLUC 4GBJA 4ZXFA 2GKGA 4WSOA 5EKUA 5ABPA 2IDJA 5GONA 1SUEA 1Z2AA 4CV2A 1FSGA 1XXHB 3IELA 5CFMA 3DEYX 1QG0A 1V5EA 4MHSA 5TF4A 3RPEA 1EG2A 2GRJA 4GZ6A 4QJBA 4LNHA 3RRFA 3QUQA 2JFYA 4W1RA 2YX1A 3HB1A 4Z7JA 4NZMA 4W1SA 1KEWA 3QWBA 4M83A 4E0BA 5JC1A 4OUKX 3AHGA 4WLUA 1ODTC 4A27A 1PG0A 2OZEA 1X1SA 1NATA 3AK4A 1CTQA 4R2HA 3UQZA 4BLQA 3HCCA 4WRRA 1V5WA 4KQ1A 5KSZA 1BE1A 4GVPA 4WA7A 3LWBA 3AY7A 4KN5A 3FUUA 1DWPA 3TI7A 1DIRA 1NG9A 4FEAA 1M2OA 1LUAA 1Q3KA 2EJWA 4R40A 2UUCB 3RU3A 2YFHA 5IAKA 5TE9A 1JG3A 4EA7A 1FEZA 2ACKA 3H11A 3TLEA 1VJRA 3FZQA 5NULA 3WX0A 3VVBA 1RABA 2B99A 1VB3A 1A5AB 5IVPA 3RO7A 3QVTA 2VXBA 3BXZA 2IELA 3F98A 1PNOA 3M1YA 4PYRA 4Z8YA 1H9AA 1U99A 1WMBA 2OKGA 4ID3A 5EOVA 5TPWB 1RPJA 2GNPA 4EUNA 4C30A 3EE6A 5C5CA 3TW8B 5GJBA 1Y7LA 2Q1YA 3MQFA 3AVOA 3C5EA 1HX7A 4BQNA 1EDZA 4EECA 2AJDA 4Q02A 4C76A 1V0JA 4EK9A 3CVVA 2GN8A 4M1ZA 3HCNA 3K92A 1AUPA 1IATA 1SXJC 3DLPX 4RCZA 2IOQA 2HDHA 1JLLB 4UDYX 1W4AA 3JD3A 1VP9A 2VBFA 3E82A 2VKQA 3KXPA 2WF5A 2O4CA 3N3AC 3R6WA 2AOUA 3U09A 3QG1A 2G1UA 3VMFA 1CULC 1K9VF 2VRCD 2HI0A 4ENPA 1XTKA 3LIIA 1J0EA 3X1MA 2P1DA 5K03A 1WBDA 5LNK1 1KBOA 5BVHA 2CMHA 2XITA 3K6SA 2ODTX 2F7SA 4JI0B 1ZJ4A 3FOWA 3WGQA 1J6UA 1DFHA 1YOVB 5L4LA 5DO9A 4EYQA 2X0DA 4FYMA 4P08A 1X70A 3H99A 4YAEA 2TMKA 4BY9E 4YMWA 2V7XA 3DPIA 1PJLA 4CL0A 3P9KA 1K7SN 1R0WA 4KPFC 3O1LA 4YYZA 5KYWA 3BRWD 4OX9Y 3WLKX 1O97D 1DAGA 1QRSA 2RFLA 1OSNA 4EUFA 1F14A 1B8VA 3AQIA 3RLFA 1ZD9A 3D0RA 3EIXA 1L5FA 2JGEA 3ABSB 4QFBA 3AUTA 4ZI2A 5A6VA 2RGNC 4H0NA 2WA1A 3AOEA 1C3XA 2Q21A 4XX0A 4F5DA 3DDHA 3V00A 4UASA 3FRHA 4G0PA 1VPVA 2EHDA 3WO1A 4OLBA 2WMNB 2D0PB 2RG1A 3AUXA 2I5PO 2LCQA 4WEQA 2SKEA 5HNKA 3IAM6 3L8CA 3UJHA 2O48X 3GG2A 3FCUB 2EG5A 2ZRKA 3UGKA 3KVVA 5AM0A 3CBGA 5AUPB 2OYCA 2OYSA 3ULKA 4HB2A 4MO2A 4KYTA 2QJFA 1SXJE 2GZMA 1ZK4A 4MUEA 4K8OA 2WJWA 1YJBA 4CCYB 3EPKA 1AGRA 1NVEA 2EOAA 4IGFA 1S9DA 4JCCA 3LK7A 4WLVA 5ALGA 3U4AA 2ZRGA 3OKPA 1EESA 1FFSA 4ALLA 4DRZA 2V4UA 1G6HA 3LKVA 3W9SA 4LEIA 1OHHD 2FG6C 4R1QA 5KTSA 2AG5A 1QWOA 2C42A 1AU9A 4PPQA 3U6KA 2D5AA 3DMDA 1HM5A 2DUNA 3GFRA 4F86A 5A5FA 2Q1SA 1MD9A 2ADMA 5E2AA 3FYCA 3TPFA 1M6EX 4N7MA 4B2LA 1VDZA 4F5YA 5KVQA 1D4AA 3NOXA 1M0WA 1W2HA 1NRJB 3IT1A 5FPQA 2IHJA 2VHQA 4UPDA 4EKNB 4Y2SA 1DTWB 1H2ZA 2WJVA 2EERA 2YMPA 2LP4Y 2YVAA 1TVKA 2C5AA 2ACWA 2YMQA 1EDDA 3AL2A 3OF2A 4B6FA 3B2QA 3BRWA 5J4KA 8ADHA 2M32A 4PLGA 4DKXA 2E55A 2Q5IA 2WLTA 3A4VA 4INAA 1DNPA 2AQ8A 4AC9A 2BGWA 5AVUA 4W8HA 3O6VA 2XZLA 2B5WA 3EVFA 1HV8A 3A05A 3HA3A 1Y34E 1R6XA 2CD9A 2QIPA 2JBHA 2QR5A 2DPMA 1Q83A 1MXHA 3WLFA 4IQ8A 2GVZC 2FGJA 1B74A 3HSYA 3NHWA 4G8JA 4W1QA 4A2CA 4NXMB 1N2SA 1FU4A 4RD0A 1RFLA 4BQIA 3TM5A 2IT1A 3P8ZA 2V7TA 5AI4A 3EOZA 10MHA 1OLUB 1A4UA 4XIYA 2NUPB 4M6WB 2CYBA 2FMUA 2R6FA 5B58C 2VDQB 2XB6A 3OT1B 4RY8A 1QR2A 4HR7A 3SC4A 4AL4A 2HHCA 1ZD2P 1MT3A 3OY2A 5IKPA 1L4MA 2XRYA 4L9AA 4ND4A 1N9GB 1MRNA 3BB1A 3FZGA 2WFZA 3JR7A 1LK0A 2YYSA 3L0BA 1L7BA 2FX2A 5LYJF 4WZAB 1DBWA 3U3DA 4B2PA 2WYVA 3U4QB 2AC7A 4C3OB 3Q8MA 2C5FA 1FUUA 2OCDA 2ORIA 3A1CA 4GP9A 4LC0A 1IXYA 3ZD6A 3HBLA 5CLHA 5CM2Z 3FNFA 7MHTA 1VBFA 3FWYA 4PFKA 4RTKA 1D03A 2WIGA 4NYJR 2WWHA 4C4YA 3FKQA 1RC8A 1MZPA 3H0CA 4Z9FA 2DHDA 4KIFA 4IUBS 1EAYA 3U16A 1XWIA 4KQ6A 3QE2A 1MVLA 3AFGA 3GUUA 1LV7A 3AEKA 2C8VA 1AZWA 2R4TA 4IDQA 1K75A 4LWZA 4TL9A 3I6ZA 1XFDA 4OQNA 4H7IA 3R6GA 4ZCIA 2IOFA 2RK3A 2XMZA 3RK1A 3PBKA 1OFUA 1SUBA 1IDN1 4M0CA 4MYTA 4C7OA 3M9WA 5IKMA 1R0SA 2QSUA 5CB4F 3ITKA 1N4AA 2A9FA 1C50A 1QG2A 2A92A 2K7ZA 1AKRA 3SE0A 2GF9A 1GNRA 3N28A 3UXEA 1NQXA 2VZ0A 2W2MA 5TIIA 3K2EA 2PGXA 4N47A 5EHXA 3AR7A 2VZLA 2G36A 1LRJA 3CNNA 3C4QA 4D4JA 3I8XA 1VXOA 3LUPA 4X54A 2W90A 3NHUA 4LECA 1B93A 3ZUPA 1Z4IA 3ZS9A 5A02A 2W6MA 3KYBA 1AK1A 3S68A 3ADKA 5E1MA 2PVCA 1C2TA 4W7IA 2A9VA 1QCZA 3DT9A 5F77A 4H3SA 5JXWA 3F46A 2Q5LA 2XZTA 4GSYA 4DG5A 1XHEA 5ITSA 4XGKA 1YR3A 4X6LA 1L4NA 3KQMA 3GYBA 3K4PA 3E2PA 4MVJE 4ZT2A 5ES4B 2I1WA 4D6XA 1GUDA 5EE1A 1H3EA 5FBRB 1MDBA 2WVHA 1Y8QB 1NGSA 5I9LA 1W88A 2IEZA 4U9IS 5ECWA 2XCRB 1EQAA 1KO4A 1XAGA 4ZO6A 4YWHA 5CPBA 4BWYA 3M2TA 1DKLA 4NBNA 4H4EA 2P9EA 1R0YA 3IHTA 4Q05A 4YMTA 1JSXA 3WRXC 3PC8C 4JJ7A 1Z5GA 4OAPA 4R4JA 1T2AA 3LFTA 5JATA 2WUVA 2JCXA 1BHO1 4FYKA 5CT8A 1L4YA 3B7GA 2IYUA 3DVAB 4QT0A 1SRQA 2HXSA 3S40A 1MW8X 1D2RA 2IHBA 5I5EA 2PS3A 3R5TA 3I9V6 3QA9A 2XBUA 1JG6A 4D8YA 2X86A 3ZQ4A 1N6NA 4G26A 2AGVA 1NMYA 3ROXA 4AYTA 1DUSA 4Q3AA 3UUEA 1L4LA 4B81A 2QQFA 3LDHA 3QOYA 3AONB 4JU8A 2FH5B 5AFSA 1YZLA 4M4SA 2V1UA 3PXUA 1WZCA 2OHGA 3I8SA 4W82A 5FBHA 1QGUA 1FDVA 4J1TA 3TTVA 1WU8A 2A3NA 3CZMA 4QFMA 1Q12A 3FYDA 4JWTA 4V24A 3MT9A 1RZRD 4KREA 1FXWF 1TZCA 4N8DA 5UKDA 3CF4G 2CXUA 1GFWA 1F8UA 3MA0A 5NLLA 3UFXB 3W34A 4P82A 4NCBA 2AFRA 3MTEA 4P1ZA 3KEOA 1XF9A 2I1LA 3C6ZA 4J91A 2I4MA 3T7JA 4JUBA 1E4EA 4R2KA 3RBZA 4WIAA 3LXMA 3BTUA 1EVJA 1JHAA 1PR0A 3P20A 4Z1MA 2IHVA 1K4MA 4IUYA 1K8ZB 1TTPB 4A8PA 3WNQA 9ABPA 2QGFA 5CAEA 4AYXA 3ZZNA 1Y5MA 2Y6UA 4EHAA 1I24A 2ODQA 3ZDAA 1TVCA 1TZKA 4P53A 5A5DA 5IFLA 2VHWA 1F8FA 2FKNA 2DG2A 3ETEA 1E98A 1RVDA 1TMOA 4X0EA 4BKRA 2JI9A 4US0R 3UO8B 5KQPA 3CNLA 3MGCA 4L4SA 1OIXA 3FX2A 1PR4A 4TVOA 2YN2A 3DXYA 1W6RA 4RORA 4FSDA 3PJGA 3RYCA 3WK5A 4AXXA 5JCJA 1H1LA 1YQUA 4ZT6A 1IN6A 1D9ZA 2X7JA 5LP6B 3MINA 1CW2B 1FNMA 3JAKA 2AWNA 3F3YA 1T8WA 4GNKA 2J9YB 2PZBA 1T36A 4F84A 7GPBA 3KVYA 3GWZA 5DTIA 5CA1B 3HB5X 1HFEL 2BZGA 1N5JA 2Z95A 3PI6A 5D2CA 2Y8EA 4XWWA 4XPIA 1JIJA 2O3UA 2MYPA 2AZMA 2IUEA 3BVPA 4CXMA 3C1AA 3NM5A 2JGMA 3DDOA 3AVWA 4IZ6A 1HT0A 2H3HA 4LPSA 4X9XA 2P4UA 3F49S 2W2VA 1BS1A 4FINA 1VBKA 4PANA 4WECA 1JT2A 1J1IA 3F3KA 3JASA 5BWCA 3DEKA 4UHCA 1ZUIA 4HXYA 4RQUA 5E4TA 1HSZA 5I7FA 4HVLA 1ZW6A 3BX1A 2YDYA 4V1CA 5AW2A 1XP5A 1ML3A 3GH1A 4FGSA 3AVQA 2ORWA 4Z4EA 3PRYA 4C0BA 1UEJA 5C8YA 3FJ1A 4OCZA 4Y6QA 3H1BA 4G8DA 1CUGA 5CXSA 4A5OA 1M74A 3KPWA 1GGFA 1U0GA 2XUIA 2H5EA 3TB4A 4GWLA 1BFUA 1E2MA 1LF0A 2D3TA 1DZ3A 1EFRA 3E22B 1E8NA 5TQJA 1VI6A 1J20A 3GR6A 4MV5A 5F3DA 3BCHA 3ZGOA 5K3SA 3JZFA 2L82A 4LA4A 3LX5A 2RIRA 2JG3A 1DBPA 4LXXA 4N7BA 5JS1A 3FR7A 2HF9A 1ZH0A 2RKWA 2PGIA 3KKMA 3OESA 2Q2NA 4Q4HA 2P27A 1S2LA 1F51E 2P4SA 1FJ2A 1U5AA 5JSKA 4B82A 4TT8A 4DCPA 1WUJS 3LQ4A 2AN9A 3GRUA 3RT7A 5HM6A 2WTBA 1ND5A 1UZLA 4RVSA 2Q8PA 1UPFA 1AUVA 4FDLA 3R0QA 1J2UA 1NL3A 5ALZA 4DTIA 3N8HA 2EARA 2CDAA 2I1VB 3LXXA 3OAAA 4IO1A 4O02B 2R4UA 2AC4A 3PKIA 2EFEB 2QTTA 1RBMA 2PGOA 1ZVKA 3L4EA 3PFGA 4G0VA 4AU1A 2YV1A 1ZOIA 1TA4A 2AX3A 2Y67A 3G2IA 5JSZA 3KQQA 4MW1A 3REQB 2DBRA 2PO5A 2RGWA 4JBLA 4QATA 2XCQA 5DB4A 3V1TC 2XW6A 1YQDA 3DBHB 5DHTA 2G3YA 4AS1A 3AFIA 2O23A 5BN4B 2P3OA 3O3CA 1L3IA 2VSNA 3C45A 3KR9A 4MUNA 4QRIA 2PWBA 5CJJA 3T7CA 2EXXA 3Q88A 1OB2A 2CNKA 2F1RA 1BS9A 3D7SA 3R3VA 4MVYA 4ZZ3A 5IT0A 3JQGB 1KRXA 5AVQA 1DE0A 1RTKA 2AC2A 3MUFA 3TLKA 4PQEA 3FN4A 4R1UA 2AOTB 2V6JA 3OPNA 1QKIA 4FLEA 4U7FA 4IHJF 5JVDB 3IAXA 4RGVA 2R7LA 4RW0A 4DZZA 5AJTA 5JCPA 3BGOS 3TXAA 5KS2A 2Q4BA 3FVWA 4GQBA 2O9JA 5FKJA 3P9NA 2EJBA 1TM3E 3KP1A 1NNUA 4TS4A 2WUDA 3TFQA 4K81B 4KVFA 2QAJA 3DHNA 1NASA 5THKA 2O57A 4HYTA 4TYNA 1W7AA 3HM9A 4MKFA 3VYSB 5IJ9B 3LPNA 2ORYA 4OYLA 4OUDA 1OVMA 2ZUVA 3NBXX 2PIDA 3DBIA 1E5XA 3R5SA 1XTZA 4P3PA 3I3OA 3D6UA 3B5IA 2HM7A 4O0LA 3U2QA 1ZN2A 1GZHB 3NWJA 4FS8A 3TNJA 3FCXA 1FA9A 4LBZA 1SK9A 3ZQKA 3DV2A 3ECSA 3G49A 4C6TB 2TYSB 2H1VA 2O7NA 2GPWA 4GSLA 1EWRA 4IGEA 1DGQA 3PX2A 1Q57A 1U04A 1BKDR 1N8KA 4HOYA 3IC5A 2FZ5A 5ALOA 5L40A 3L4JA 1LDGA 2NVUB 2UVPB 4MVCA 1GPJA 1SKUA 1H93A 3MMZA 4LZJA 3CUYA 3D2CA 3HNOA 4LHZA 1J8VA 4LSMA 4X6XA 4NE9A 1SKYE 1Y4DE 1ZXXA 4IAOA 3OZ7A 4BMOB 1RRMA 2FFBA 5FO0A 2ZXFA 2V9CA 2RB4A 4BKQA 3KQNA 2QLTA 5JCOA 1X2BA 3STHA 1NNSA 3L6UA 3P32A 4M0MA 3RHSA 2A1IA 4YAGA 1FLNA 4FBMA 4M0KA 3SEQA 4MUMA 1T5TA 3RC1A 3CO0S 5BR1A 5CFPA 2X14A 1AOXA 2ASEA 3Q3EA 2MTBA 2AFIA 1NVWQ 1E7SA 1E59A 4XYMA 3OIDA 5HK9A 1NAIA 1BMDA 1B14A 1NJ2A 4YMUA 1BN7A 3DHWC 4GE0A 1B42A 2H31A 2GFHA 2Z08A 2I2DA 4I55F 4L4YA 3NCHA 1GTJ1 5B2ZA 2R0QC 2E5LB 1QF6A 3IP6A 1ZGHA 4NYIR 4TV8A 1CDEA 2IU0A 2MINB 4S24A 5HK8A 1VJTA 2HQBA 4XDZA 2BEWA 1NZJA 1TADA 2XB8A 4YP9A 1SD1A 2QP3A 2BMDA 3AINA 4JUAA 5DYGA 1MNQA 3K0FB 2XGSA 4NI5A 4PAQA 4ZD6A 3VR2D 1P7VA