3BESR

Structure of a poxvirus ifngbp/ifng complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
250
structure length
250
Chain Sequence
b'TITSYKFESVNFDSKIEWTGNGLYNISLRNYGIKTWQTMYTNVPEGTYDISGFPNNDFVSFWVKFEQGDYKVDKYCTGLCIEVKIGPPTVTLTEYDDHINLYIEHPYATRGSKKIPIYKRNDMCDIYLLYTANFTFGDSEEPVIYDIDDYDCTSTGCSIDFATTEKVCVMAQGATEGLLDKITPWSSEVCLTPKKNVYTCAIRSKEDVPNFKEKMTRVIKRKFNKQSHSYLTKFLGSTSNDITTFLSMLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interferon gamma
publication title Structure and mechanism of IFN-gamma antagonism by an orthopoxvirus IFN-gamma-binding protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 55
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF07140 IFNGR1 Interferon gamma receptor (IFNGR1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3besR02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3besR01
4Z95L 1B0GB 3LRSB 2HT2C 2MKWA 2G2RB 4FZ8H 1FPTL 3H9YA 3NZ8B 4GRWH 4E5XB 3TH3T 3WNLA 5DRZA 4G42B 1YQVL 3AB0C 4PJIE 1ND0B 1KENH 1UVQB 2A0LD 5L0QB 1CGVA 2DLFL 4LP4A 3L5XH 4ZAKB 1FQ9C 1BQUA 4HMCA 2G60H 4X5WB 1KCRL 2MOVA 2NY3D 4YDVA 3HI6H 3WJLA 5T3XH 3KJ6H 4WGVB 3RDTA 1OB1A 1QTYT 3HUJA 2BP3A 3OPZH 1XIWD 1A6WL 1V7MH 1BQHA 2D03L 3LB6D 4M4RA 5EB9A 4UI2A 1IC4H 4JFFA 4EXPX 4XP1L 1N4XH 5IF0A 4ODXA 4WFGE 1M05B 1YMMB 2FO4A 5FYJD 2X4TB 5TF1H 2BY2A 3LV3B 1EAJA 2VXVL 1KV3A 2E6JA 1QD0A 1PLGL 3NCYS 3VG0H 3TFKD 5ABDE 3MRKB 1XGUB 4QNPE 4ZMAT 3BKJH 5GJTL 5D7IB 1SBBA 2FECI 3IDYC 5B39G 1S5IL 2DLTA 5IGXL 4NGHL 1KCVH 2YRZA 2R56H 1KN2L 4C4KO 5KSAB 1HSAB 3IS1X 4NDMB 2NY4B 3DTXB 3SDAA 1T03H 2GT9B 1NANI 1AIFA 4K8RH 4WHDA 2W9EL 3IDNA 2YD5A 1ULVA 1PD6A 1QBAA 3BQUB 5JIPA 1IGFL 4YK4C 2CLRA 1U41A 5HHOA 4OM1L 2YPLD 4ZNEE 3BWAB 1VGEL 3GK8H 1DQJB 4GG8B 2A1WL 2BNRB 1DBAL 3ALXA 5DS8B 3KHOA 3U82B 5E2JA 4Z8FL 3RIFF 1B3JA 5GQBA 5HTSA 4TVPL 4PLNC 4NNYB 2QQKL 3T09A 2FGZA 2BRRL 4P2YA 4DVBA 1T83A 2QR0A 3RVVC 5DK3A 3PXJA 1B88A 1A9EB 1YDPA 2DQIL 4W6XB 5EC1B 5I9QB 2VSCA 1YYLL 4KMLB 4I9WD 1QACA 3Q6FB 4H8WC 4TUJA 1PKQA 2CXGA 2R4SH 5JQ6L 5CKGA 3BXNA 1W72B 1ADQL 4M1GL 1AO7A 2Q8AL 2BVOA 1C5CH 4UT6L 1C12A 1O0VA 1NCDH 3D85B 4M9OA 1R3JB 2GCYB 3IETB 4N0UB 1RZ7L 3PGFL 2XRAL 4FMKA 1U8MB 3HZMA 5C0RL 1I7ZB 4N0FA 5FHAL 5CAYB 3QHFH 1HXMA 4KMTH 3I02A 3CIQA 1HNGA 3MACL 1L7TL 1GGIL 1M7DA 4ZNCD 3AC0A 1N8ZB 1KELL 1CQYA 3UPRB 1UZ6E 3W5NA 1YC8A 3GDBA 5IMLB 4FNLH 2P24B 1D9KC 3MV8D 4X7SL 5CZXC 4K3JL 2ZWLT 5EH1A 2ITDA 4DGYL 1E4XL 2ILLA 4NYLB 5I8CA 4FHBD 5FGBC 1SJEA 3RVWD 1MHHB 2F5BH 4IHOA 2XZQL 5FUCC 5D6CA 1DCLA 3K2UL 5L0QC 3WIFA 2RIKA 4O2FA 5C3TA 1XGPB 1BHGA 3UBXB 2VR9A 4JO4H 1O7VA 1KIQA 4NBXB 3WSQH 4OCXH 2AQ1A 4HWBL 3ARRA 4I77H 5I1KL 1MI5E 1MFEH 1LK3H 1I9JL 2CK0L 4WO4B 5DJZA 4XGZA 4OCWL 5F6IC 5GGVH 2HLFC 4XMKL 5EU5A 1GGBH 3IJSB 1QSFD 3MXWH 4Y5YA 5E2UL 1HWHB 4KRPD 4XPTL 4ESKA 5C0NC 1U8NA 4MNHA 3W2DL 1BBJB 5IBLC 5FGCE 1ZXQA 3H7BB 1JP5A 1LEGB 3EGSB 3LQAL 5IUSA 5L9DL 3L95B 4WTZG 1JGLH 1YNKH 2HVJB 3U46A 3GRWH 3LQAC 1S7SA 2YUVA 2IPKB 2IPTL 3DETC 3HB3D 3OKKA 4GS7B 4M3JA 1X5LA 3HAEG 4YHML 5BS0D 3EO9H 4NKIL 2FX7L 2CUMA 2Y36H 2FECL 2EXYD 2NY4C 4MHHI 3TJEL 1E28A 1AXTH 2VDRH 2F54E 3PWLA 1JPFA 1NSNH 1DVFB 2YHGA 4XI5D 1A8JH 2VKXA 1KIRB 3DXAE 5F9WB 5FUOH 3RX8A 3GIVB 2FJFB 4R26L 3BQUC 4Y2DD 3TZVD 5EU4B 1IM9D 1XFPA 1ED3B 4IRJD 5J1SC 4MJIB 1V7NH 3OB8A 1KT2B 4NJ9H 3X14B 3O3AA 1ODAA 1ADQA 4LGRB 3CX5K 4HUXB 3RTQD 1JZ5A 1JYNA 4V2BA 2XQBH 4QRPA 4YDLC 1TCMA 1JHLH 2H9GA 3GSUB 4G3YH 4MWFB 4JFDD 1OGAE 1JPSL 5TDPA 2PYED 3PP3H 4OCMC 3QNXB 5DJ8A 4LHUB 3P9LA 5TE4L 3S5LA 3MRHB 1UM5H 4G5ZL 5TGBB 5FKPB 4WTXA 1YPZB 3TN0B 4QT5B 2XQYG 3BHBA 1MVUA 4JQXC 1W72L 1B0GA 2G2RA 4U3HA 3NZ8A 5CSZA 3MUY1 2VDKL 2I9TB 5IESH 4E5XA 5GGTL 2XXCB 4K07A 3MRJB 1ND0A 1UVQA 4P59H 1AR1D 4QRRE 2UV3A 4ZAKA 5AZEL 4P3CL 4FABL 2ZNXA 4X5WA 1MCEA 1VFMA 4PUBL 3CSGA 5E6ID 2Y6SC 4RNRB 1SJVA 3EJYD 1MRCH 4ONGL 5E2TH 5BRZB 4NQEB 1JYVA 5ITBH 2MTPA 3T4YB 4CJ0A 1JF5A 3PP4H 3QEQB 3MGTB 4HWBA 1SYVB 2QSCH 2E5EA 4M6ML 1X5ZA 3B2UD 3T2OA 5CKAA 2NCMA 1YMMA 3O6FB 2X4TA 3HMWH 1S78C 3LV3A 1UCBH 4U05A 3UTTE 5I30L 2C3XA 4BH7B 4OZHE 1B0RB 4KHXL 1KC5L 5IEKB 3ZKMD 3MRKA 1XGUA 2EH8H 3H6JA 4QRSB 1ZLVH 1CFVL 4N1CA 2VLMD 5IB2B 3IFNH 3ULUL 4H20H 2YWYA 4MA3B 3UJIH 4ZFGH 2VYRE 4ENEC 3KPRB 3FQTB 5AUMB 3NACL 3FN3A 5KSAA 2AXGB 4NDMA 1CCZA 3DTXA 2H45A 5IG7B 1LILA 4U1LB 2GT9A 2WMPA 4NRYB 3VRJB 2AJVH 3E3QE 4WO4C 3H42L 4RBPH 2EIEA 3BQUA 5K9QI 1KB5A 3K74B 1FYTB 2VDMH 4ZOBA 3BWAA 4HKBA 1DQJA 4GG8A 3WV0A 1Q8MA 2BNRA 4WFFE 1JPGB 4DVRH 1T2QL 4XPAL 5DS8A 4O51B 3ZDXE 2PKDA 5D7KD 2PR4H 1YN6B 5TE7L 4LCIH 2B0SH 4NNYA 2R2BB 4YHOL 2JE8A 3GMQB 2BY3A 3DUSB 3JTSB 3O9WB 1NCWH 1T0NB 1WZMA 4JFED 4Q6IC 3RFZC 1I1FB 3TESA 1A9EA 2LTQB 5EO1B 1RZGB 1OSPL 3D3VB 5EC1A 1P4BH 1YUHB 3FO0H 3MRFB 3IFOB 5KS9E 12E8H 4OSUL 1I9IL 2JK5B 2K9UA 1BPVA 1P84J 3Q6FA 3RGVB 5T5NG 1W72A 2EEAA 5D7LE 4JDVB 5ILTL 2OP4L 1JVKA 3CFBB 4F7PB 1BOYA 5GGTA 3D85A 3T0BA 3T0ED 1R3JA 2GCYA 3CLEL 4FN0A 4N0UA 2D0HA 1U8MA 4JM2B 3NOIA 2VLKD 1UFUA 1I7ZA 4KKNA 5AWNL 2G5RA 1FRGH 1OCWH 4I13B 1UWGL 5F7EH 3U1SL 2A6JB 4L9LB 5IW3A 3LMJH 3MLYL 2HRPH 1MUJB 4NO0B 1N8ZA 3U30B 4ZS6C 5C86A 1CK0L 3AAZB 3UPRA 2VLJE 3EYVB 2I60H 3TN0C 5IMLA 2P24A 3QIUD 1CDYA 1D5IL 3CSYB 5C0BE 3L1OH 3LS4H 4J8RB 3M07A 4NYLA 3SCMB 3QG7H 3RA7H 3T77B 4OLWL 3H9SE 1MHHA 4GH7B 4ZOEA 1TJIL 2EDEA 2EECA 2QBWA 4NN7C 4EOWH 3RKDD 2A6IB 1XGPA 4PJDB 5E2VL 3UBXA 2VOTA 4WGWB 2O5XL 2CGRH 4Y5XC 3GIZH 5C0FB 3MRBB 5SWSE 3N9GH 5D2LB 2IF7A 2E8ZA 2MPAH 5FKAB 1HI6B 1AKJD 2QQQA 1XGYL 4WO4A 3SDXB 1U2CA 3LH2H 1R3KB 3TCXA 3IJSA 3PUCA 3IVKB 4KJYB 5JUEH 5GRJL 2EDRA 5D7JB 5HHME 1ZA3B 1BBJA 2VISB 2ZOLB 4KDTC 3VGFA 4Z7WF 3GBNH 3H7BA 1LEGA 3EGSA 3L95A 3O3UN 4L3AA 3QWQB 2HVJA 4Q6IA 1JMZA 4Q6IB 1LDPL 1VB9A 5D1ZD 5JZ7C 4OQ1A 1N64L 4JRYE 5GS0H 1DVFA 4OUOA 4LKXB 1KIRA 3GIVA 2FJFA 1U6AL 2XWTB 3QXVA 5EU4A 3SE4C 4FQCH 4KJPC 1EAPB 1ED3A 3E6HB 3TNNB 4MJIA 1GHFH 1KT2A 1DQDL 4DGVH 3X14A 2Y7QA 5HHPA 1G1YA 4KZEL 5JHLL 1JNJA 2N1KA 2VZOA 3EJJX 3MNVA 1OF2B 1QSED 3GSUA 4MWFA 5B39B 4XPGL 2LVEA 5C2BL 1NEZG 4WU5B 5BMFH 4XP5H 3WFBH 2YC1B 3QNXA 3O9WC 4LHUA 1H8NA 3MRHA 4G6JH 4N90D 5FKPA 5TGBA 1YPZA 3TN0A 1ORSA 4K7PX 1BFSA 4YBQD 4QT5A 4HBQA 3H3PH 4OUUB 4LARL 4M9PA 2GJ6E 4OF3A 1BVZA 2I9TA 4Y4FB 4MS8D 4CVXB 2JB5H 5DFVC 4XMLH 2YD9A 3MRJA 5JIHA 3GGWB 3BW9B 4RGNB 4RFOH 5FEBA 1YEGL 1QPPA 5FCUH 4P23C 4OCNC 5CGTA 1JJUA 1CFNB 4AH2A 4L4TE 1OTTC 4RNRA 1ZVYA 3FAXA 4HW6A 5E08L 2BK8A 5BRZA 3MYJB 2CKBH 3SJVD 4NQEA 4M03A 3CUPB 5C0IA 4QKXB 3OJ2C 3T4YA 4GW5B 3QEQA 1I7TB 5JMRA 3DHMA 3MGTA 1SYVA 1VCAA 3JWNC 5DEFB 4HDIB 1KTDA 3O6FA 5F6HI 2BXYA 4OLYH 2A0LC 4OD3H 4FTVD 1B0RA 4KDTA 4QGYA 3SCMC 1MVFA 2YD1A 5IEKA 4GBXD 4QRSA 3HUJF 2NY5L 2RJMA 1NKOA 5IB2A 4PRHB 3SKMB 1WK0A 1XIWC 4XVJH 5J56B 3KPRA 3FQTA 1LO0H 3BMWA 3LB6C 5AUMA 2AXGA 3OQ3B 5CP3H 1UM4L 4LAQH 4F57H 1FNAA 2X7LB 5IG7A 2IG2L 4U1LA 5GGSY 2E7BA 4B0MM 4NRYA 3VRJA 4XBEL 4JCLA 4GMTH 1FIGH 4P9ML 1FYTA 1P9MC 3VXOB 2NTFB 4PR5B 1S9WB 4K9EL 1N3NB 1JPGA 3MJ9A 3CD4A 2PTTB 2R0LH 4OLXL 4YHZL 4O51A 5E8NB 3B8SA 4U6XB 3SDDD 3U48A 1OAYL 1B2WL 4O02L 4KU1A 4QWWD 4N8PA 1YN6A 5C0GB 2R2BA 3GMQA 1LE5B 3MLTB 4IDJH 3DUSA 3H2WA 4GSDH 3O9WA 1P2CB 1T0NA 3P40A 1I1FA 1EHAA 4CAGA 1J7VR 5EO1A 1RZGA 1N0LA 3DGGB 5E9DD 3RWDB 3EFDL 5IOPB 1YUHA 3MRFA 4Y2DB 3IFOA 1IM9B 1FNFA 2ZUQB 1RZFH 3RGVA 2VZ1A 5EUKB 5D1XB 3UO1L 3RTQB 4JDVA 3TT1H 4X7DC 2DQTL 2E6QA 3H3KA 1A6VH 2I07B 3G6JB 2WWMD 3CFBA 4F7PA 2ZCLH 4FQLH 1TJGL 2CO6B 2ADFH 5C07E 2P5EE 4HIXH 1IGIH 2VTFA 3K2MC 4JM2A 1U92B 3QULB 1ERNA 4JRXB 3UTZB 2BVYA 2A6JA 1A5FL 4LAJH 4QYOA 2H32B 1MUJA 2AK4E 1UXWB 4NO0A 3VFUB 1EBPA 1NBVL 4GG6F 3AAZA 9CGTA 4ORGB 3EYVA 1FZOB 1S7WB 5EU7C 4UIKH 3CSYA 2UWEE 4H26B 3MODH 1AC0A 1OTSC 4J8RA 2F15A 5AAMA 3SCMA 4GRLD 3QQNA 5HGBB 3T77A 3EYFB 4M7JL 4JPVL 5CJQH 2FJGA 4YC2C 2R15A 4YPGB 2A6IA 3Q1SH 3GJEB 4RMWA 5HHNB 5C0FA 1FNEB 2E9BA 3MRIB 3F7QA 4YHNB 1BREA 3WCYA 1J1OH 5FKAA 1UWEL 3SDXA 4Z7OF 4KI5E 3KJ4B 4UTAL 1S8DB 1XEDA 3VFWB 1QQDB 1R3KA 1AH1A 3IVKA 2Z31B 1GAFH 4KJYA 1MJUL 5D7JA 3RVWC 3HNVL 4JY5H 4Z95H 1HH6B 2AERT 2AXHA 1ZA3A 2ZOLA 1FPTH 2VISA 4KY1L 3S37X 5FK9B 4AL8L 2P43B 1YNTA 3WDJA 1FAKT 1YQVH 3EO1B 1DSFH 1QG3A 3D9AL 3MV9B 2Q76B 5E6ZA 4GUPB 3QIBD 3B9KD 1BD2D 2VDLH 1KCRH 3I6KB 4LCCB 4G8IB 2GFBB 4HH9B 4K3EL 2PNDA 1A6WH 3P4NB 3GNML 5CLTA 4O5LH 5ERWB 2D03H 2M2DA 4LKXA 3KYAA 3MJ8A 4KRPC 1K4DB 2RBLA 2XWTA 1JHTB 3MZGB 4HPYL 1EAPA 3E6HA 3TNNA 4XP1H 4Q9RL 2WANA 4QRTB 4J23A 1KXQE 1Z6JT 1DUYB 1CVRA 1SVZA 5F9DC 2RB8A 1OF2A 3WN5B 5J6GB 3DVIA 5GXBB 3HB3C 5B39A 2ENSA 4CNIB 1RZKL 4NBYB 5GJTH 4WU5A 2EXYC 2YC1A 1S5IH 5IGXH 3T2NL 2AXFB 1KN2H 4PGEB 5F7WC 5BV7H 4U7MA 3HKFA 4OM0L 2I26N 3QZWG 4TN9A 3QXUA 4Y2DC 3I3BA 4PV9B 4OUUA 5EDXA 2ZUQC 2OJZL 4PJ8B 4PJAE 3K4ZA 4Y4FA 4CVXA 3RTQC 2W60B 2V9RA 3GGWA 4OM1H 3BW9A 5LGHH 1U3ZA 4LPUA 1VGEH 2A1WH 3QAZB 2Q8BL 5E4EB 1CFNA 4RA3A 3MYJA 2VMFA 2KKQA 4J4PD 2QQKH 3OR7B 2P42B 3CUPA 2BRRH 4GW5A 1OVZA 1I7TA 3I50H 4U6TA 4Y19D 5DD0L 5DEFA 1I9RL 4KGLA 5D70L 4HXAH 5D7SL 3PHQA 2HT3D 1Q0YL 2IFGA 5LWYL 3KHQA 5DD3L 2JELH 1AR1C 5EO0B 3KPNB 3U0PB 3GUTB 2YMXL 4BA8A 1ADQH 1VERA 4M1GH 1S7QB 1MFDL 2Q8AH 3VH8G 4PRHA 4UT6H 5F96H 3NCJL 4JFQB 3Q48A 5SWZD 3SKMA 4P2QE 3EJYC 4XNYL 1RZ7H 3PGFH 2AEPL 4PJ5E 1X6NA 2XRAH 2EC9T 5C0RH 4FFYH 1KCSH 5GHWL 3I9GH 2X7LA 3S3JA 2DBLL 3BPNC 2WWKT 1L7TH 1LNUA 2DYPB 1FO0B 3VRLE 1FNGB 1KELH 5I73B 3VXOA 2NTFA 4PR5A 2Z31C 1S9WA 5KVDL 5IMMB 1F6AB 3BPLB 1GRWA 5ISZE 4M62L 1N3NA 2PTTA 4K3JH 2J3SA 2NY7L 3VGBA 5E8NA 4U6XA 5DRNB 4HIIB 1E4XH 3HCVA 4RDQF 5BS0A 5C0GA 2GY7B 2IGFL 2XZQH 1HNFA 4R0LB 3RHWK 3K2UH 4CU8A 1CWVA 1ZHLB 1P2CA 4YO0B 2V7HB 2XZZA 1RZJL 4ONFH 3DGGA 3NIFE 4MNGA 3RWDA 3D0VB 4LCCC 5IOPA 2BNUB 4EUPG 4Y2DA 2EICA 4PJCA 1IM9A 1RZJC 3QCTL 4ERSH 1R5VB 4JDTL 4HWBH 1Y6KR 4JKLA 3WUZA 1ZTXH 2BY0A 2W0FB 5EUKA 5FHBL 3RTQA 4JKMA 1CICD 2DMBA 4HKZB 2I07A 3G6JA 5LBSL 1MCIA 4ORZC 4F7MB 4XNUH 5IJKA 5D5MB 4TOYL 4XPTH 4WUKL 2NMSA 2OL3B 3WN5C 4WTZA 1U92A 1ZLWK 2OYPA 3QULA 1F11B 2X44D 3GZKA 5EZLB 4JRXA 3MMEB 3RUGB 3KYOA 1DLHA 2H32A 1UXWA 3VFUA 1CU4H 5B21A 4YHMH 1U95B 1F3DJ 4L5FL 4ORGA 5LJYH 2FX7H 2IAMD 4DOHB 4HXBL 2F53E 5EWIL 2ZUTA 1S7WA 3K4DA 3U2SB 1ZLUK 3LDBC 5C09E 1GCFA 1QFWI 4H26A 5IHLB 4NOBA 5HGBA 3T0EC 3B9AA 3OAUH 4XNQA 2YA2A 3KPSB 4R26H 4XPFH 4CVUA 3SPVB 3H9ZA 2NYYD 2H8PB 1NANH 3KYNB 2DQDH 3QXDB 2RFXB 2V2XA 4HS6B 4YPGA 4ALAH 5KOMC 3ZE0F 2V5MA 3GJEA 5CILL 5E4EC 3BESR 1DBML 5HHNA 4S1RH 5ICYB 4MQXD 1FNEA 2XT1B 5JHDD 1NEZB 5FOJA 4YHNA 1JFQL 4YDJB 1F42A 5L7XH 2WLYA 1RK0B 4U33A 5ICZB 1S8DA 5TE4H 5BXFB 5GJSL 3VFWA 1PEWA 3B5TA 1QQDA 3BKMH 3T08A 3ARQA 2B4CL 3ARZA 2Z31A 2D7QA 2EC8A 3SO3B 4GBXB 4G9FE 1Q72L 1HH6A 2Y9RT 3KYKL 1NGQL 4LIQL 4IMLB 5FK9A 1V05A 1OP9A 2AV7B 2B39A 3RKDC 2P8LB 2QL1A 1UQSB 3MCLL 4XX1E 4IRZL 2Q76A 4GUPA 5MI0C 2J8UE 4P3CH 5HYSA 2OQJB 3TC9A 3KLHD 3S6CA 4YHLL 5DA4A 5DVLA 1YEIH 4PUBH 5IROC 5JR1L 5DZLA 3V95A 3I6KA 4LCCA 2FBJH 3JUYA 4NIKB 4WRLA 5MEND 3R06B 4G8IA 2GFBA 4HH9A 1FO0L 5I15H 3P4NA 4C83B 1P84K 8FABB 5ERWA 2VAAB 3O3EB 4OD1H 3PE9A 4KDWA 1A7RL 1K4DA 2J6EL 1JHTA 3SBWA 2CPCA 4D8PB 4M6MH 2NNAB 4V1DE 4QRTA 1PG7X 3BPLC 4CGTA 1DZBA 4GXUM 5I30H 1DUYA 2P46B 4YUEL 1A6AB 4NKDB 3WN5A 5J6GA 2FATL 3L3IB 1KC5H 1WCBA 5DZNA 3MRMB 3MA9L 5F7HA 4JFEA 2H2PD 4LSRL 1CFVH 4CNIA 3EOTL 5D1ZC 4XAWL 3O2DL 5C0CE 3ULUH 1LQSR 1WAAE 3GSOB 4EQ3A 1ZLSH 3VXMD 2AXFA 4PGEA 2R8SL 1RIVL 4HK3J 4I2XE 5F3HB 3IXAB 4PV9A 2J8HA 3DO7B 1T1YB 4L4VE 4NZUH 1I8KB 2D7MA 5F72S 1DEEB 2W60A 1SY6L 2PTUA 2OL3L 2P8PB 1QNZL 1FVEA 5E7FA 1JZ2A 1T2QH 4XPAH 2VZSA 5EA0L 2MNUA 1RJLB 5FCSH 3UZVB 4LLQB 1BVLB 1YPZF 3QP3A 1T2XA 4UU9B 4DK3A 4YHOH 3OR7A 5DYOB 4YBQC 1H5BB 1J0ZA 3EFFB 3SHSA 2JJVA 2Q7NA 1F3JB 2V9TA 4O9HL 1RHFA 4MS8C 4PRNB 5F93C 2OM5A 4OSUH 3T2QA 5EO0A 5BV7C 3DX6B 1GXEA 5E95B 3KPNA 1A7OL 3GUTA 2FLRT 2O93L 5ILTH 2OP4H 1MOEA 3IKKA 4E9LA 2GJZA 4JFQA 3QHZL 2DLHA 1GZQB 5GPRA 1TETL 4V2CB 3QYCA 2VERN 4BM7A 3CLEH 1S7UB 2NR6D 2C26A 1ETZB 2BHYA 1SJHB 5AWNH 2D7PA 4NQDD 2HFGL 1NL0H 3U1SH 2ZNWA 2DYPA 1JK8B 4NZTL 4XCYB 4KKLD 4RIRB 1FNGA 5HGDB 3WL9B 1CK0H 2G9HB 4LDOB 3HC4L 5IMMA 4Q74A 4OZIF 1F6AA 3KPMB 4LK4A 2CDGB 4NM4H 3SO3C 4GBXC 3LVEA 5GRYA 2IQ9L 3CFDB 2UZIL 2F19H 3QIBB 4HIIA 3TO4B 3B9KB 5K9KB 3OJVC 1PYWB 4EN3D 2NPLX 2W0LA 4M48H 3WLWD 3U9PL 2CMRH 1ZT4A 3LQZB 4D9QD 4R0LA 4TSAH 3V6ZB 1FZJB 1ZHLA 4YO0A 4CU7A 2V7HA 5E2VH 1MH5B 3O2DA 3LCYA 1JE6A 4R97B 2BNUA 3QRGL 1R5VA 4IOFD 2EDFA 4LCWD 3DVGB 3RWJA 2W0FA 1IC5L 4LSQL 4ZSOE 5C08E 2PN5A 1XGYH 3QWRD 4G6KL 1H8SA 5DJXB 3SDDC 4HKZA 3UMTA 4F7MA 5D5MA 4QWWC 2L7UA 4WV1B 5GRJH 3IB4A 5E56A 5DJYB 2XTJB 2XA8H 2OL3A 3BI9X 5LCVL 3O6MH 4LCYA 1F11A 2R69L 3N1FC 5EZLA 3MMEA 3QJFB 3RUGA 2J8OA 3P0GB 5DF0A 1KF9B 4OCSL 4PRID 3LIZL 3VFGH 3BKYL 2L7JA 1U95A 1JTOA 4DCQB 4P2OD 1LDPH 3FFCE 2EYTB 3QSKB 1AY1L 4WHCA 1EGJL 3U2SA 1IEAB 2XTLA 2BNQB 3V79C 2EEDA 4HKXB 1NC2D 1N64H 5E70A 4ELMB 5HI4D 3SGJA 3KPSA 1FL5B 1U6AH 2VL5B 2EO9A 3QUKB 3SPVA 2H8PA 4PJ7B 4G43A 3KYNA 1DQDH 3QXDA 4HS6A 2A2QT 2RFXA 1YYMH 5CMAB 4KZEH 5JHLH 1JRHI 2C4XA 4H1LG 1SEQL 2BJML 5ICYA 3INUL 3QXAB 1NEZA 2ZJSH 3DUHA 4Y19B 4KPHL 3QQ9D 1NAML 1NDMB 4XPGH 1A7NL 5C2BH 4YDJA 2NXYD 4M6OL 4WEBH 1DQLH 1FJ1B 1RK0A 3QZWB 5ICZA 4L3EE 5BXFA 3HE7B 4WUUD 2BVEA 4GRLC 4PJBE 4GBXA 2ICES 3BGFC 3UTPE 4Y4HD 3IU4L 4LARH 4IMLA 2Y07L 2AV7A 4JHAL 3KAAA 2P8LA 4FRWA 4N5UA 1UQSA 3RWGB 4JGMA 1G7LB 3P9MB 5TF0A 1K85A 2OQJA 2YKLL 5F21B 3HS0B 1YEGH 4UT9L 4E42B 3R1GL 4Y0GA 2ADIB 1QO3B 3R06A 2DAVA 5E08H 4E0RB 4TSCL 4C83A 4D2NA 4XP9H 4N1HB 1CLZL 2ICEB 3WNPA 8FABA 2VAAA 3O3EA 3X3FL 5CEYA 3W0WD 4Z77A 1FP5A 2LABA 4IMKC 1D5ZB 2C3WA 3OAZH 4MVBD 1F4WL 5JO5A 1IGJB 5I8KH 3RWCB 1A6AA 2FLBT 3QIBC 4NKDA 3L3IA 3B9KC 1J8KA 3VH8B 2VN7A 3B9VA 3TWCL 3GJFK 2FL5B 4H88L 1T7WA 1WCQA 5JORB 4YBLC 2VABB 1HK6A 1J8HD 3GSOA 1A3LL 1WISA 1H15B 2XN9D 3H0TB 3KLAB 4LLVB 4HUVB 3I3EA 5F3HA 4E41E 3T1WA 3IXAA 3BPCB 3DO7A 5IT2H 1T1YA 1I8KA 1EGJA 3LKOB 4XBEH 2IANE 1KULA 1DEEA 4P9MH 3S37H 2PO6D 3RI5K 1KTRL 4MB5A 4K2UH 2P8PA 1OGTB 4Z0XB 2VZVA 4ISVB 3NCFB 3MUGB 5K9OA 3MX0A 3O4LD 1OAKH 2B20A 2WQ8A 4FQ2H 1S9YB 4WJ5B 4JG0H 2P49B 3QUZD 1LD9B 25C8H 4LLQA 3ZMRA 1BVLA 4K7FB 1KPRB 1JZ3A 4UU9A 4P2RE 1UJTA 5DYOA 3BAEL 1H5BA 5IHUL 3EFFA 4EUPB 4NC1E 4BQCA 1P7QB 1GVIA 2BSRB 4GRLA 3EFDH 4K94L 2DQGL 1XF1A 5TH2B 4PRNA 2BFVL 3GI8H 1RUKL 3TBWB 3DX6A 5DTFB 4KK9D 2OXHA 1OQOA 3UO1H 4MD4B 3V5HB 3UJTL 2DQTH 4PJ9D 2CH8A 5LAXB 5J3HD 4QXWA 7FABH 3C87A 3F7YB 3NPSC 3CXHJ 1GPOL 1GZQA 1TJGH 3KXFD 4HZLA 4J4PC 2GEEA 3C60D 1S7UA 1MWAH 1ETZA 1SJHA 1M71B 5FAAA 3AS2A 2YD6A 4FOMA 2HT3C 1JK8A 4QEGA 4G8EB 4XCYA 3OB0K 4RIRA 5E8EB 3WL9A 1EH9A 1RJZB 3HE7C 4IMKA 1W2KT 4JR9L 5ANME 5DD6B 1KJMB 5C0AD 3KPMA 2CDGA 4LEXH 2Z91B 3SKOB 4RMRA 2MKLC 2LFGA 3CFDA 1MCFA 4R2GB 3QIBA 1DFBL 3B9KA 5TDOB 4LRNH 5K9KA 2DQJL 1PYWA 3OKOB 1BD2A 1IJ9A 3K3QA 4NO2B 5JIIA 3P30L 5HVGB 3LQZA 2IBGA 3GMPB 2EYRA 1A6UL 3F62A 3V6ZA 1FZJA 4LVOB 4UUJB 4ZFOB 5CSBA 3VXSE 4PB0L 1MH5A 4HULB 3S97C 1DR9A 4LSPH 2VITB 4S1SL 2VXQL 1CVSC 5K33A 1ZHKB 3FFDB 2ZCKL 2PCPB 4Q9BA 3JWDH 4LPXA 3C8DA 3L3OB 5LQBL 1EO7A 3CH8A 1UWEH 2DJUA 3O11A 3U4BH 5I66B 1CDIA 2YUZA 2BVUA 5DJXA 4JCMA 2CRZA 1MJUH 4WV1A 3PV7A 3NCEB 4CU6A 1CDBA 5DJYA 3HG1E 3G08B 4YXKL 1F4YL 3NIGF 4KY1H 5HVWA 2IC2A 3O6LL 1MCPL 4HEME 4MNQE 3RP1A 3VXMB 5A16B 4PJCF 4P3WA 4GT7A 4PJXE 5FYLE 4WFGD 4DCQA 3HPLB 3B9EA 3BZDA 4Z7WE 3TV3H 2EYTA 3NFSH 2YK1H 4FG6D 5FYKL 3ZKND 1U93B 2P4AB 3CFCH 4TNVK 3G6JF 5T33L 4PJEF 1IEAA 2Z4QB 2BNQA 4HKXA 4NFDA 3LEVL 4HWZB 5GISH 3K0WA 1BOGB 5I75C 4ELMA 3HTLX 2QADD 1FL5A 1TZGH 2Q1EA 2VL5A 3MGAA 3QUKA 4HPYH 4PJ7A 4Q9RH 3EYSL 4LHQB 3OKDB 5CMAA 3BH8B 3MLUL 4OZFG 2CQVA 3VXRB 1NUNB 1BFOB 3QXAA 4WWKB 5ESVB 4UQ3B 4Y19A 5DT1H 4LRIC 1NDMA 1GOHA 4OF0A 2IAMC 1RZKH 5EZIH 5F7MC 2UUDK 1FJ1A 4EQ2A 3GHEH 3VI3F 3HE7A 2HJKB 5F7DB 3FCTA 1CG9B 3C08L 4W81A 4OM0H 4Q9CA 3MLPA 3NCYP 2YOCA 2NYYC 3FN0L 2ARJQ 2VWEC 2OJZH 1RHHB 4WCYL 1D5XB 5IK3B 3RWGA 4MQXC 1G7LA 3P9MA 2D4FA 4S0TD 3RKPA 3FN9A 3GMNB 4U3CA 1MAKA 4G6ML 3HS0A 1A1MB 4E42A 5I1JL 4B5EA 2Q8BH 1FVCB 5E8OB 2Z93B 4R4FL 3HAEH 1QO3A 1IILE 3HZYB 4E0RA 1JMXA 4FXKB 2ICEA 4IIQB 3S34H 2O5ZH 3BP4B 4C56E 4ZXBD 1BZQK 5DD0H 5E00B 1D5ZA 1I9RH 1IKFL 5D70H 5LWYH 5IHBA 2IJ0C 2X4UB 2PW1B 2EDHA 1T04B 4P57B 3X3GL 3UPCA 1XT5A 3CVHB 3VH8A 2YMXH 5IMKB 5CBAB 3KLHC 4ZFOL 4FFZL 5JORA 1MFDH 2VABA 2D0FA 4PD4K 4XNYH 3D87B 4HC1L 1H15A 4BFBD 3VGAB 2DQEH 5I19L 3BVNB 3KLAA 2OTPA 4LLVA 4HUVA 4XXCC 2O61B 1NFDF 5DUPL 3G5VB 2BSTB 3HUJE 2DQFB 3BPCA 4D94A 1I3GH 2DBLH 3NCMA 3LKOA 2I5YH 2C1PB 4IDLA 4WI2A 4JZJC 1J10A 1A7BA 2A73B 2HG5B 1INEL 1QYGL 1EMTL 2CR3A 4JFFE 1OGTA 4Z0XA 3VG9C 4ISVA 3MUGA 2H2PC 4KMQA 5HYQB 5J89A 1S9YA 4WJ5A 5IKCB 1LD9A 4ONHA 4ETQB 1MI5D 3L3JB 4LRIA 1H8OA 1B4JL 1P53A 4G6FD 1KPRA 3VI4E 4RISL 4AEHH 3NIDE 2QQNL 4EUPA 1F5WA 3NCBB 2D9CA 1I9EA 2BSRA 1WIPA 1UGNA 1AGEB 5TH2A 3SDCD 1DBKL 1PG7H 4NZJA 5DTFA 2MCPL 5FHBH 4MD4A 3V5HA 3T4AB 5E5MB 1KACB 4XMPH 1IC7L 4NCDA 5LAXA 5HHOE 1IL1B 3F7YA 3V52L 3V7AG 15C8L 2D7TL 3CAFA 2EDBA 4TOYH 5KZCD 4WUKH 1NAKL 5JW4Q 5E24E 5DVMA 2NXYB 4LFHG 4YFEA 3MLZH 4N9OB 4WWKC 3EOYG 3TVMD 3DXAD 1M71A 4FQ1L 3U4EB 4Y16D 2PXYB 4G8EA 5E8EA 4AIOA 5B8CC 1RJZA 1EJ6A 4L5FH 5DD6A 1KJMA 1RZIA 3GJFB 4HXBH 1I1CA 3T3MF 2Z91A 3SKOA 5K93A 2MQ3A 1OGAD 3B8YA 4NKOB 1YEJH 5DJDA 3OKOA 1E27B 1PKQE 4NO2A 1AJ7L 2JCCB 3GMPA 1NC4B 3OAYH 1V3MA 2NR6C 2VQTA 4H1LB 3ZTJG 1HSBB 4UUJA 1AO7E 4ZFOA 3LRHA 3IFLL 5CILH 2D2OA 1DBMH 2VITA 4QHUB 4GRMB 4WW1B 4X6EB 4JO3H 4KGJA 4ODTL 4XXCA 2LAGB 4YWGH 3FFDA 1ZHKA 1TTUA 4U1JB 2PCPA 3ALWA 4KKLC 4HC1A 1JFQH 3L3OA 4U0QB 1QVOB 2BHZA 4QRRD 4JZJA 1IE5A 2Q86B 5I66A 5GJSH 3UTOA 2E7MA 5SV4A 5T1KB 2B4CH 5AG8A 4EN3C 3FAWA 3CVHL 3WLWC 2VDNH 1Q72H 4NHCL 3G08A 1NGQH 5MEOB 2VE6B 3ARYA 3VXMA 2F74B 4P5TD 4DFHA 3U0WH 4HCRA 3MCLH 2XN9B 4HV8B 5ICXB 4LQ1A 1N26A 1OARL 4NM8L 4IOFC 3S36L 3WMSA 1MQKH 4YHLH 3VXNB 5DWUH 3UTTD 3HPLA 3HRZB 1NUFA 1U93A 3UTQB 2DQHL 2PO6B 1FO0H 1IZKA 2Z4QA 3T0DA 4U3XA 5D5MF 3DARA 1M4KA 4XVTH 4HHAB 1C5BH 4HWZA 5ACMA 5GZND 1BOGA 1UJ3B 5D2NC 1H3GA 1A7RH 3QG6B 2X1QA 2J6EH 2CDEB 1UM6L 3TBSB 3F58L 3HC3L 1QBLL 3RUGF 2B8OT 3OKDA 1WFUA 3BH8A 4LVHB 5KTEL 5CCKL 4YFLI 4I0PB 2ZCHL 4YUEH 3VXRA 4UTBL 1BFOA 3ZHKA 2FATH 4WWKA 5ESVA 4UQ3A 4X5XB 1JPTH 1IEBB 3MV7D 1XGQB 1F97A 3RJQB 2Q20A 4KROD 4LSRH 3EOTH 3O2DH 3GSNB 4JVWA 4LLMB 4OCYH 4WFFD 4TVPE 3RZCD 2HJKA 4XCFH 5F7DA 1CG9A 3ARBD 3SQBA 2R8SH 4D9RD 5J11C 1LVEA 1RIVH 1JPST 4ZFZB 4XB8A 5DEGB 5FUZH 1CFQB 5ACLA 3MBEB 2IBZX 4A2MA 1MCWM 1RHHA 2AQ2A 3DECA 1W0WB 3KXFB 1HE7A 1BJ8A 2IBZY 4XXDB 3C60B 5IK3A 1F02I 1SY6H 5F70A 3PV6B 4Y88A 3GMNA 1QNZH 4OLZL 2BX5A 3QQ9C 1G9EA 1A1MA 3HFML 1N5YL 2V2TB 2EKSB 4GQPH 5DK0B 3FRUB 3U7YH 3ZT7A 4BZ1H 3IRZA 4J3VA 5E8OA 2HTKD 2Z93A 2NXYC 2MQ0A 3QUMB 1RK1B 3CJJA 5L6YL 3HZYA 4QRPE 3BP5A 3ZKXB 1Y0LB 5F7UA 5D7LD 3L3HB 4KZDL 4FXKA 1TXKA 3NFPB 3U4AA 4IIQA 5C0AB 3QJHB 3AM8C 2OCFD 3BP4A 3TCLB 1RV6X 5LG1A 1UENA 1G9NL 4Y4HC 4X6DF 5E00A 4JGJA 5E8DL 4LPTA 1MREL 3P0VL 1X5KA 3ULVL 2O5YH 1LGVA 1PAMA 3QDGB 4CJ1A 1T04A 4P57A 4KRLB 3CVHA 5IMKA 1A14L 1P4LB 5CBAA 3JVGA 3AS3A 1QFWH 5FUCE 5HJ3B 1OQXA 2VH5H 1IGCL 1DLFL 1TETH 5K59E 5C0BD 3OR6B 4LCWA 1LE9B 3BVNA 4BK5A 3LPGA 3BZ4B 2BSTA 4OGXH 2DQFA 2B1AH 1F45A 4D0BB 3H9SD 2RQ8A 4MVBC 3S36X 1YY8B 2C1PA 4ZG1A 5D2NA 1HYRC 2A73A 4NZTH 2WAHA 5EBWB 2HG5A 4ZO7A 3DYOA 3HC4H 3S9DB 1WZ1L 1AE6H 3QDAA 2DMKA 2ITCB 5F1IB 2XNAB 1FL6B 5SWSD 1YMME 2IQ9H 5HYQA 2UZIH 5BZWB 2DLGA 4OF5A 1FNSL 5I6XB 3V8OA 1ITBB 4GW4A 3L3JA 1T20B 1INQB 4DQOL 3U9PH 5IFJA 2Q7YB 3TIEB 1VHPA 5D7IE 1HKFA 4X9IA 5HHMD 2MMXA 3ZL4H 3EDEA 1ZS8B 5EUOF 1INDL 3OZ9L 1IAMA 3SN6N 2PO6C 5AZ2L 5DDHB 3FOLB 1X5IA 1ZWIB 1IC5H 4LSQH 2C3VB 3MRLB 3OGOE 4P9HL 4G6KH 1D6VL 5E5MA 5I8OL 3H9HB 4YNYB 3QUZC 1OAXL 5J4MA 1IL1A 4NC2B 1I7UB 2EZ0D 4LVHC 2BNRE 3LN4B 2IADB 4I0PC 1CL7I 3PWUB 1D6EB 5CZKA 5LCVH 4RGOH 1C1EH 3FQXB 3GSNL 4WUUA 5LVEA 3AM8A 3U4EA 5DJ0B 3HA0A 1W8OA 5AYUL 4G7VL 4OCSH 1G6VK 2PXYA 4YGVB 1CF8H 3EDDA 3BJ91 4KK9C 3GJFA 1CDJA 3E2HC 5IFAL 3CLFL 1I8LC 2FX8L 4UV4L 4MZ2A 3ZHDA 4TNWF 5J3HC 5EBGA 1IAIM 1MEXH 1PX3A 4NKOA 4CN4A 3RWHB 3VA6A 3TPUB 1E27A 4D0CA 1P6FA 2F5AH 3LKPB 1C5DB 3C60C 2JCCA 1NC4A 4R4BB 4OZFB 2WBJD 4H1LA 1G7IB 1HSBA 1TQCC 2HFFB 5C6WH 1SEQH 2BJMH 4QHUA 4GRMA 4WW1A 3INUH 4N0UE 4X6EA 2CIIB 5CUSL 5DMKB 1YMHB 4JFYB 4U1JA 3DVNB 3PIQB 5HY9B 1TNMA 1NAMH 3ZKXC 1A7NH 3O8XB 2W1NA 3KS0H 1QVOA 3D0LB 5DFTA 1HHJA 1R3IH 1QRKA 2Q86A 4PTUA 5ADOL 3ROOB 2PUQT 5HHXL 5T1KA 2X6MA 5DC9B 4L4TD 1J9CT 2QJDA 2ORBH 1X9QA 1HHIB 3IU4H 2HKFL 3LEYL 5MEOA 2VE6A 5D1QD 4JHAH 2F74A 2CRYA 2XN9A 5ALBH 4HV8A 1LO2L 5D71L 3U6RB 4HBCH 5ICXA 4X6BA 3MCKB 3VXNA 4UZGA 3R1GH 1K3ZA 1KCLA 3HRZA 1LEIB 3ULUE 1EX0A 3UTQA 2XWBB 1WGOA 2PO6A 4UDUB 1EFXB 1KXVC 3E8UL 4TSCH 2C5DC 1SMAA 1RMFH 3QQ4B 4QHKI 1U0QA 2CDEA 2VL4A 4CMHB 3TO2B 2EDOA 1T4KB 4GFTB 1F4WH 4G6FB 5B38G 4PRDB 4I0PA 5C3LD 5I6XC 4X8JB 1YEEH 4X5XA 5DJCB 1IEBA 4YXLL 4M93B 2GI7A 2GW5A 32C2A 1XGQA 3TWCH 2P45B 3HE6D 2HTLD 3BYYA 1LP9F 4FG6C 3ZKNC 4LLMA 1A3LH 4XBPB 2FYYB 4A6YH 4ELMF 5D93C 4H0IA 4NUGH 2DLIA 5BO1L 4ZFZA 5DEGA 1KLUB 2AJ3B 5DI8B 1OOAA 2N56A 1CFQA 1A22B 3MBEA 1GGCL 1W0WA 3KXFA 1BQLL 3DX7B 4XXDA 3C60A 5DUML 3PV6A 4MJIE 2HLAB 4ODUA 3C5ZB 2V2TA 2EKSA 4M6AA 3FRUA 4Y1AB 3RGHA 4G80B 1HQRB 3ORJA 3QUMA 1CZ8L 4XNXL 4B50A 1RK1A 2KPNA 4PREB 3DVFA 1YEKL 3PWPD 1Y0LA 1P5VA 3L3HA 3NFPA 1CL7L 3RHWF 5C0AA 3QJHA 2YRLA 3EYUH 3TCLA 1UCTA 4OZGA 3FONB 5IHUH 3V6BR 1PJ9A 2C4FU 3BDYH 5C07D 3VXUD 3F7RA 2J88H 2DQGH 4MQSB 4RQQB 2BFVH 3QDGA 1RUKH 2QEJA 1U3JA 1P4LA 2AK4D 1H3VA 3IXTA 1WWBX 3UJTH 4Y8DC 4MJ2A 4G6AD 1W8NA 4I18C 5IWLC 1DQTA 5ECJE 5HJ3A 5BQ7B 4GKSB 5I1IH 4GAJH 3OR6A 3S98A 1LE9A 4AMKL 5DLML 5EU3B 5KVEL 4ZXBC 4J3SA 3BZ4A 1EVTC 4OF7A 4BUHA 4D0BA 1JRHH 5BRZE 3RNKB 4XCCL 4NQEE 3C6SB 3LZFL 3CVIL 5EBWA 3QEQE 5IB1A 3N85L 4JR9H 3REVB 1PVHA 1UWXK 4JFPB 2ITCA 4P5TB 5INDB 5F1IA 2XNAA 1FL6A 4Y5VB 5BZWA 1DFBH 1CS6A 1JYWA 4HQQH 1G6RL 1T20A 4MXVF 4HJ0D 4KI5D 1INQA 1ZGLP 3SGKA 5GS2D 1QSVA 3L3DB 3P30H 4LP5A 3X11B 2Q7YA 3TIEA 4YZFF 4X0KA 5EULV 2YBRA 4S1SH 2VXQH 3KPRE 1ZS8A 1L9NA 4ODWB 4CW1B 3V4PL 1DBJL 1OD7A 3QUXD 3VWJD 3EHBD 5DDHA 3AUVA 3FOLA 4JPWL 3R8QA 1ZWIA 2C3VA 3MRLA 1G9MC 5BOPA 1FGNL 1X7QB 4G8GB 3T65B 4PGCB 4YNYA 4NWTL 4HG4K 2E9WA 4FP8H 1FYTE 4DW2H 1A0QL 3TP4A 3MV7B 3ARED 3C09C 4KK8D 3LN4A 1FN4B 5F9JB 3GBML 1D6EA 4YXKH 3BPOC 1NQBA 5EFIB 3EDFA 4AENB 2V5TA 4QHNB 3FQXA 3ZSSA 5J1TC 1MCPH 4M93C 4GLRI 3QO1B 3ARBB 2WZPD 4WHYH 5DJ0A 5IBUG 1F6LL 5KW9L 1XF3B 1QRND 2IH3B 5DRWA 4YGVA 3RAJL 4P4KB 1PX4A 3D3VE 1YEHL 3L9RB 2WBWB 2JJTA 2LAAA 3EJZD 2NX5B 1G7HB 3LEVH 4ZTOH 2VDOH 3GKWL 3RWHA 3TPUA 1MCJA 1CGSH 1OAQL 5JXED 3LKPA 1EV2E 4MAYB 1C5DA 4U1MB 4FFWC 5E2WL 1JTPA 4R4BA 4OZFA 1G7IA 1U3YA 3T0WA 2R9HD 3EYSH 4HD9A 4XC1H 3TVMC 2DI8A 4NN5B 1FORL 1X6LA 3C6LD 4P3DA 1BFVL 4ZS7H 5GGVY 1TZIB 1RU9L 5L8KB 1KEGL 4NZRH 1MCCA 1MJ7H 2HFFA 2PTVA 1BJ1H 4QHMB 4XB7A 4Y16C 4ZUTB 5DMKA 1YMHA 4JFYA 4NUJB 3UEZA 3DVNA 3PIQA 5I0ZA 2Y06L 3O8XA 4KRMB 3D0LA 3VWKD 4HLZH 4J2XA 3CFIC 4UDTB 5TQ2L 4NQXB 3S8WA 5KSUB 2R0WH 4RDQG 3GM8A 1NLDL 2P1YA 2VLRD 1KGCE 3PQYB 4LVNB 1U3HB 3UYRL 35C8L 4WI7A 1HHIA 3FN0H 5JLZB 2HT4D 2LU3A 4HLJA 2ICWI 2IEPA 4JHWL 4WCYH 2HVKB 5FGSA 4HUMB 3G9AB 1X4ZA 3WLBB 3U6RA 3MCKA 4G6MH 3WD5H 4R90L 5I1JH 3MV11 4PJDE 1GOFA 2EDKA 1LEIA 4R4FH 2BSSB 3ARFB 1ZHBB 2XWBA 4UDUA 1EFXA 4QGTA 3NTCL 5AYQA 5J06A 5D2LE 3VW3L 1P1ZA 4HWEL 2ED7A 3QQ4A 4P2QD 5FYJE 3SDXE 4R96B 4JY6B 4DGIL 4EI5B 5DSCB 1RVFL 4P5TC 1YC7A 4PRDA 5DC0A 1EO8L 2X89A 3F5WB 4DFIA 3X3GH 4X8JA 1TNNA 3WFZA 4YBHA 5DJCA 5JDSB 1TVDA 1G1CA 4MDJB 5HHMB 2OR7A 1MFAL 1UXSB 3PJSB 2BC4B 3LPWA 5IQ9B 2DQUL 5HYJE 5ISZD 4XBPA 3DUUB 1CN4A 2EIBA 4HC1H 5ALCL 5GZNC 4HWUA 5I19H 1OP3K 5DUPH 1KLUA 5DI8A 1FE8L 4MD5B 3R4DA 4QRQB 3DX7A 1AFVL 2CJUL 2V5SA 3WO4C 3E3QC 4OQTA 4J7RA 1MELA 3C5ZA 4YXHH 2W91A 4KROC 4G80A 1HQRA 1ZAGA 2BHUA 3Q2CA 3RBGA 4PREA 2XKUA 1B4JH 3CFJB 3RZCC 1T7XA 3ARBC 4JG1H 4RISH 5GRVK 3FONA 1S7XB 1II4E 3RRQA 5GRXG 4K23L 3TLRA 5D6DC 1CD9B 4I9WE 1TJHL 3F6LA 3VRIB 4RQQA 3FHQA 4RAVB 3WIHL 3OG4B 1DBKH 5EU7E 1J0IA 1P4IL 3N1MC 1N6QH 2MCPH 1E6OL 4UINL 5IQ7L 2ZUVA 2ESVB 4AG4H 2HTKC 4M7LL 1S7VB 1A4JB 1IC7H 5IIEB 1FH5L 1JWUB 3V52H 2F53D 5BQ7A 4RGNE 4GKSA 4NN5C 3TBYB 3VD5A 1NAKH 3VGEA 5B22A 1D5BB 5EU3A 2NLJB 3NABH 1TIUA 2EIZB 1LO3L 3RNKA 4KUCD 4DKEL 3C6SA 1PBYA 2HH0L 2X9XA 1DDHB 1JGVL 3WKML 2HWZH 4U6VL 3OV6A 1FFQA 5CS7A 3REVA 4HK0B 5D1QB 4JFPA 4P5TA 5INDA 2WQRA 4OI7A 5T3ZL 1Q9OB 3MOAL 4CN1A 3DYMA 3VE0B 3DHJA 3MSPA 1CGTA 3GSXB 4HJGB 1AJ7H 3X11A 3L3DA 4OLVL 3ARUA 3REWB 4PRHE 3UXFA 4G9FD 2JJSC 4CDHA 4XVUC 4ODWA 4CW1A 2A77L 3QH3B 5TFSH 1IFHH 1QSZA 3RVTD 1EUUA 2DD8H 1A7PL 2HMID 4Z7UB 1X7QA 4G8GA 4MYWB 3TM6A 4XWGL 3T65A 4OGYL 2X1PA 4TPRL 3MV7A 4RCAA 2ATPB 4HAGA 1RULL 3HE6B 1CLYL 4P99A 1FN4A 4NHCH 2NY2D 5F9JA 3N0PB 2FGWL 5EFIA 1B9ZA 4AENA 2WUCL 4TRPL 4WU7B 2OK0H 3ARBA 1TLKA 3T1FB 4U2ZA 1NLBL 3C9NB 3SGDI 1XF3A 3B5HA 1J5OL 1OARH 2IH3A 4NM8H 3FKUS 4R7DB 3S36H 4X4YB 5DHVB 4LSVL 5D6DA 5CJXA 3NIGE 2R0KL 4X6FB 4LPVA 3OJDB 4QOKB 3IAGC 1MQ8A 1V3LA 1X5HA 3RQ3A 2NY0D 2NX5A 1G7HA 2Z8SA 1MY5A 3CFKB 4L8CB 3WIHA 5C0CD 2EDWA 2WSKA 2EZ0C 4RZCB 4MAYA 5B38B 3DV4B 1UM6H 4U1MA 1XR9B 1X5GA 5DHXB 3QNYB 4NN6B 3HC3H 3G6JE 4GG6B 3PWPB 4NO5B 5BW7C 1TZIA 2VDPL 5CCKH 3AB0B 5KTEH 3MGOA 4QHMA 2ZCHH 1EXUB 1PG7W 4L4VD 4ZUTA 4NUJA 4NOFA 1TITA 1OD9A 3VXUB 3GM0A 4JRXE 2Z9TA 3FRPG 4N0FB 4NQXA 5KSUA 5C6TH 3I02B 5C70A 2JCCF 1M7DB 2XG5A 1RUPL 3QEHB 4PRPB 3D39B 4LSDA 2WBJC 3ZDYF 5JLZA 2BERA 2FZ3B 3VI3E 1UACL 5C0BA 4Z7VF 2HVKA 3RI5F 3B2VL 3WLBA 3V2AR 4OLZH 1G7MB 5F89B 1N5YH 1BJMA 1LK2B 1IAOB 1XF5B 3AU1B 3CMGA 2QQLL 2BSSA 3ARFA 3IDYB 1ZHBA 5L6YH 4AEIL 5IV2B 5F1KC 4KZDH 2J5LC 1V3JA 2OR9L 3OMZA 4UILL 5MP6H 4MB4A 2R2CA 3ZE1F 2YUXA 1EDQA 4L8SB 3VJ6B 3OGCB 3K81A 1MHPL 4R96A 4JY6A 5DSCA 5D1QC 5E8DH 4MCZB 1BQSA 3ULVH 5EOCJ 4YK4B 3F5WA 3OKYA 5DUBB 3VD3A 3ZO0A 1DN2A 4RMQA 4H1LH 1A14H 1S3KL 4OCRL 1KLFA 3ZE2F 5JOEA 4MDJA 4FQJL 4PY8J 4M43L 4QHLB 1UXSA 3PJSA 4U4BA 5IQ9A 3MV9E 1VFOA 5J12C 5A2LH 1IGCH 1OW0C 2GIYA 3DUUA 1UZ8B 2VIRB 1P7KB 5H37G 2OI9C 1S7SB 1LWRA 1JTTA 4QRQA 5HDQL 2P5WB 4HZAA 3PABB 1S5HB 3HPJB 3LRGA 1NBQA 1KB9J 1GGUA 1WZ1H 1A47A 5BW7A 1KEMH 3HE6C 2HTLC 5TPWH 3WFCL 1FNSH 1QRNB 5C08D 4PY7B 4OKDA 3CFJA 3QNZB 4OTXL 1AQDB 5CZVL 4JPIB 4RGMB 2AJSL 1U8PA 3V4UL 1I85A 1BEYL 3AMKA 1QFUH 4B7IA 1N7MH 1S7XA 4PBXA 3V4VH 1YJDL 2X4OB 2ZSWB 1I1YB 1E6JL 1QLRB 3VRIA 5JTWA 5DJ8B 4RAVA 4XC3H 1INDH 2YN5A 3OZ9H 5AZ2H 1J1XH 3U36B 4WVRA 5F7FA 2XG4A 4LL9A 3SE3C 1K6QL 3DWTA 1OY3B 1YEFL 1D9KB 3C6LB 4JN2B 4P9HH 2ESVA 5HDBF 3TYFB 3LKRB 4MXWL 1D6VH 5I8OH 4XP6H 3UAJC 3B3IB 1S7VA 1A4JA 5IIEA 5CSZB 1JWUA 1OAXH 3FFCD 4NN6C 5AEAA 1GC1C 3TBYA 4PS4L 5DK2B 1IT9H 4OZGF 3FTGB 3K8KA 3H8NA 1D5BA 1ZVHA 5IBUB 5DD1L 2NLJA 1SMOA 2D31B 3GSNH 2EIZA 5I1GL 2VLRB 2MHAB 2DTML 2VN4A 1U8OB 3O6KL 1ITCA 4G7VH 4N0CD 4UOW0 5AYUH 2ZUWA 3KG5A 1DDHA 1AQKL 1WVZA 4LQFH 4ONOA 4HK0A 4N5ED 5D1QA 4TNVF 5IFAH 1WZKA 1J12A 5F6IB 3CLFH 4G6AC 2FX8H 4UV4H 1Q9OA 1VEMA 4ZODA 5J9PB 2V2WB 4JVUA 1HINL 3UYOD 4JVPA 3CXDL 3VE0A 1H3XA 3MV01 3GSXA 4HJGA 2C3GA 3RVUD 2IFFH 2B1HH 1A1NA 1ONQB 3T3ME 4N68A 4O4YL 3REWA 4LIQE 3EZJB 5T1DL 4KV5F 1OW0A 3AS0A 3PP3K 2E7CA 5TQ0L 3UTPD 3V0WL 5FECB 1UKTA 2MJWA 5C6PB 3QH3A 4Q2ZB 2X4RA 4NBZB 1Z0NA 3JV0A 2X9WA 5DMIL 3ARDD 5ADPL 1U36A 5BVJB 4Z78B 4Z7UA 3ETBF 5CJOL 5ADOH 4L8SC 1YQ2A 2ED9A 5HHXH 3GSQB 4HJ0C 4KI5C 2ATPA 1IQDB 3HE6A 1ROWA 3L7EA 1OM3H 1KB5B 4XHQA 1NPUA 4HKBB 2HKFH 3LEYH 4UNVA 1RPQA 1M1SA 1WEJL 5EC2B 4WU7A 4TYUA 5ENWB 3W9DB 4D9LL 3MO1B 1CD1B 4LSSL 4HAFA 4JN1L 3T1FA 4YDLB 2ZUSA 3C9NA 5D71H 4MJ6B 3L3GB 1HKLH 3QUXC 4R7DA 3VWJC 3EHBC 1HIML 3NN8B 4X4YA 5DHVA 3R0NA 1CXFA 4QY8B 4X6FA 4HGKC 1BP3B 3OJDA 4QOKA 4F9PC 3E8UH 2QSTA 5HSFA 1BGXL 3LN5B 4FS0A 3CFKA 4L8CA 4JM4L 4P5KB 4H8WL 2B7DT 3AREC 2VXTL 4KK8C 3S35L 2R29L 2LE9A 5CBEB 4NQCB 4RZCA 5B38A 3DV4A 3RJDA 3O4OB 1XR9A 3QNYA 3JV5A 3MRNB 4FZEL 1G7PB 1ZLVK 4GG6A 3PWPA 4NO5A 2KUTA 4XP4L 5D5ME 2R1XB 4K3DL 1EXUA 1FNHA 1NGPL 4H0HB 4LU5L 4RX4A 4BK4A 4N0YL 4EZMA 4YXLH 2IAND 1EEYB 5C07A 3VXUA 4RMTA 2UZXB 4RGMC 3S3PA 3RUGE 4LDEB 1OAZL 3D69B 5HHQB 5FB8B 2FSEB 3GMRA 1A7QL 3DLQR 3EJZC 3AY4C 4RBPK 5EPMB 4HMEA 5BO1H 4DOHE 2J4WH 4LEOB 3QCUH 1BIHA 3PWVB 3QEHA 3TH2T 4PRPA 3D39A 1KJ2B 1SVCP 1WQVT 4P2RD 5H94B 1GGCH 3RX7A 2FZ3A 4DKDC 3C6LC 1BQLH 3A6CL 1MPAL 3UBXI 3KPSE 1N6VA 2PETA 6CGTA 5DUMH 5I1EL 2OJEB 1G7MA 4BKLB 5F89A 4YE4H 5CEZL 4MXQD 3G5ZB 2DM2A 2ERJB 1LK2A 3VXQB 1IAOA 1XF5A 2NY1D 4J3WA 3AU1A 3VWKC 2Q6WB 4IRSD 1YEKH 4GRWB 1A2YB 5IV2A 3T0XA 1NMCB 1CL7H 3SO5A 1J05A 4ODSH 5CJBA 4L8SA 3VJ6A 3OGCA 4X9BA 1XCQB 3B9DA 2JIXD 1UYWH 2SEBB 4MCZA 1GIGH 4RWYL 1QKZL 1QLEH 2W92A 5AAWA 4F9LC 5I1LB 5DUBA 4GAYB 3TJHD 3BRDA 4LLUB 3MLSH 3M8OH 2KQNA 1L7IL 4QHLA 2APVA 2WV3A 3OF6A 1FBIH 1C08B 2DIBA 4LKCB 1QUNA 4ODVL 1UZ8A 2VIRA 3UP1A 1P7KA 4AMKH 2G75B 4F9PA 2FHBA 1HZHH 5CJ5A 4XCCH 3X12B 2P5WA 4CMMB 1FG2B 1WBYB 1YECL 3CVIH 2NY2B 3LZFH 3PABA 3VXSD 1S5HA 3HPJA 1KB5L 3SQOL 4DTGL 1OLLA 1RJCA 2AK1H 4KAQH 2H3NB 4BSJA 1D5MB 2BRQA 2EDYA 2XKSA 1K8IB 3JWOC 3KGRA 4JREC 3S35X 3ME0A 4R8WL 1DQQB 5IB3B 1QRNA 2Y7QB 4PY7A 1G6RH 4QTIH 5HHPB 5FO8B 2IBBA 1G0XA 3QNZA 5IR1B 1MIML 1AQDA 3MNVB 4JPIA 5GS0D 4OGAD 3Q5OA 2NY0B 1OWWA 5I17B 2X4OA 5GS1C 4JO2L 1Z3GL 2ZSWA 1I1YA 2MQCA 5C0CB 1QLRA 4NJAL 1DBJH 4MNQD 1RURL 3U36A 3Q5YA 3M45A 4JPWH 1DL7L 4NWUL 1ORSB 1D9KA 3C6LA 4JN2A 5FYLD 3TYFA 1FGNH 1MNUL 3LKRA 3V6OC 4M7KH 3B3IA 3O4OC 4NWTH 1O5DT 4J1UB 1NCAL 2AJYL 5FGBA 3CU1A 5DK2A 4S1DD 3WO3B 5KOVC 2APFA 4X7EC 3FTGA 3GBMH 2VC2L 3QDJD 4NN7B 4JB9H 2D31A 2YR3A 1BBDL 5F44A 2WUBL 2ADJB 1BZ7B 3GMLB 4Y5XB 3TA3D 2VLRA 4AH2B 1ACZA 2MHAA 5HYSG 5KW9H 1U8OA 3DMMB 1U58B 3RAJH 1RIUL 1KJ2L 5H2BB 1E4KC 5C0IB 4UT7H 4TQEH 5EOTB 4F2MB 4HF5L 4F9LA 1T66D 1VENA 3EYOB 1FGVL 1L4IA 5J9PA 2V2WA 3GKWH 1KTDB 3PF2A 4B53A 1OAQH 4H5SB 1ONQA 1O7SA 5SV3A 4G7YL 3MLRH 1JCKA 5DR5H 5JW3H 4FZ8L 2KDGA 1FORH 1BFVH 4H0GA 5GRUL 1RU9H 4OZIB 2ERJC 5FECA 1UKSA 1UEYA 3JUZA 3I84A 3ZDZE 4Q2ZA 3O3DB 1XGTB 2Y06H 1NMCC 1XH3B 1D7FA 1WUNT 3K4AA 4NQVB 5T3XL 3CMOL 5BVJA 4Z78A 1BAFL 5IBTH 1ZA6B 4N8VG 4HIHB 1NLDH 4JKPL 3G5XB 4KKCD 3GSQA 5I74C 4D3CL 2UY7A 2FWOB 3FQWB 4I0CC 4OZHF 2VJXA 1IQDA 2ATKB 4ZO6A 1HCFX 1WBZA 4CUCA 2G5BB 4MLSA 1XF4B 4C56D 5EC2A 2N7BA 5ENWA 1Z5LB 3W9DA 3MO1A 3I6LD 1CD1A 5TF1L 1LO5B 1WWWX 3TNMB 3P0YH 4MJ6A 3L3GA 3G5YB 3VD7A 3RVTC 5DVNA 4R90H 1HYSD 3NN8A 1FC2D 3G04A 3BKJL 4POYA 4QY8A 4LLDA 2HMIC 4OAWB 3MOQA 4J3TA 3BD5A 1K8DA 2F58L 2R56L 1CE1L 3LN5A 3VW3H 4JJHA 4P5KA 4HWEH 2J7LA 4N9GB 1J0YA 5CBEA 3V6OA 4NQCA 4JQXA 2NY2C 4DGIH 3MRNA 4JFXB 1G7PA 4K8RL 1RVFH 3ZTJH 2R1XA 1AHWC 4Z7NF 4K8RC 2XTJE 3GSWB 1SHMA 4GJTB 5KVFL 1EEYA 2DQCH 4P23B 1X5JA 4M4PA 4JFFD 5HHQA 3D69A 2DQUH 5FB8A 2FSEA 3MRGB 3NZHL 3MOBL 1G7QB 2NY0C 5L2KE 1FC1A 2DI7A 5EPMA 4QYOB 4LEOA 3PWVA 2W07A 4NRXB 1KJ2A 4K71C 1FE8H 4PB9H 3ISWA 2BNQE 5H94A 5FOBB 4M1DL 3O0RL 1WJ3A 4DJMA 4L3CB 4ELME 1AFVH 2CJUH 1F6FB 1UB6A 4JO1L 2OJEA 3QXWA 4PJ7E 5TDNB 2ZUUA 4DKFH 4BKLA 2NY3B 1BECA 3G5ZA 3E0GA 5EZJB 3VXQA 4HFUL 2Q6WA 2FJGB 1JNHB 1XIWB 1C5CL 2BVQB 5DJAB 1A2YA 2DLEA 4Y19E 4DEPC 1MRDH 2DDQH 4ZYKB 3D1MC 4JAMB 2H6PB 5CIPB 5HHOD 3DMMC 3T04D 3Q6GL 4GLRH 1XCQA 4PGBB 4K23H 4MX7B 3WXWH 2XZCL 3ESVF 1TJHH 1BLNB 2SEBA 4OF6A 2X41A 3WIHH 3ARGD 5I1LA 1PSKH 3GI9H 4RWHA 1AXSA 4GAYA 1JWSB 1NKRA 4LLUA 3QDMD 1UG9A 1E6OH 4UINH 5IQ7H 4DZ8B 5E94B 4FNLL 4GXVL 4W70A 3BKCH 4M7LH 1FH5H 3NCCB 5FF6B 3WHE0 5FYJU 1C08A 4LKCA 1YNTB 4NT6A 3ARDB 3NH7L 1KJ3L 1PZUB 1ZHNB 1H3UA 2G75A 4BSVB 1AC6A 4PRBB 1LO3H 4JO4L 1J1PL 4JJ5B 4DKEH 3BFOA 3X12A 2HH0H 4CMMA 1AO7D 1FG2A 3KVQA 4JQVC 1WBYA 3WSQL 1JGVH 2YPLB 4OCXL 4KFZC 2VXSH 4YQXL 2H3NA 1D5MA 3MJ8B 4MLIA 4PJFB 1K8IA 2I24N 3MJ9L 5T3ZH 3PL6D 4KC3B 3DI2B 3MOAH 1QPXA 3W9EB 1DQQA 5IMOB 5IB3A 1WWCA 3U7AA 3OWEA 5MHSE 1WITA 5FO8A 3A6OA 5IR1A 1MF2H 3T0VA 5I1HL 4OLVH 3EW3B 5FYLH 5EO9B 5I17A 3EZ8A 4YX2L 3MA7B 2X70B 5C0CA 4JKWA 2AV1B 3D25B 1JGLL 1CGYA 4MXVE 4TTDD 2A77H 3QPQC 1FZMB 3P4LA 2EDLA 4HK3N 5ID0B 3JSSA 3TGXA 4YZFE 3MCG1 4GKZB 1A7PH 5FYKE 2X5PA 1R24B 1J0HA 1EJOL 4XCEB 1T1WB 4MD0B 1AXTL 1ORQB 2VDRL 1XCTB 4J1UA 4TPRH 1NSNL 5IM7B 3G6DH 1RULH 1CLYH 2ENYA 4NQTA 3T0AA 5CGMA 1MLCA 3UCRA 4YC2B 4NJ9L 4C54A 3D2UD 2WUCH 4XHJD 2ADJA 4JE4B 2GUOB 1BZ7A 3GMLA 4Y5XA 3MRRB 1NLBH 3DMMA 4NHUB 5J1AB 2MWCA 3RPIB 1CIDA 1U58A 4KWUA 1HXYB 5H2BA 4P48A 2R0KH 3WEXB 3MV8B 5EOTA 1QLFB 3B6SB 5KBNC 4F2MA 3EYOA 1KBGL 3MQIA 3PHQB 3FB8B 4LPWA 1Z9LA 4H5SA 2E7LC 2AAVA 5J13C 3IYLW 4TVPD 5TJWK 2NY1B 3B83A 3RVVD 1XGRB 5F9OH 1V8HA 4KVNH 3EO0B 4W6WB 3RX5A 2NY3C 1Q0XH 2VDPH 4OZIA 2HJLA 1T89C 3S7GA 5SX5H 1BF2A 4B41A 1AGDB 4N0CC 3FRPA 3O3DA 1XGTA 4X7FC 3BP6B 3FT4B 2XKNB 1XH3A 5GSRB 1W0YT 4N5EC 4AQOA 4NQVA 1GJIA 1Q1JL 1B6DA 3ARXA 4JQVA 4I4WB 5FYJL 3JTTB 4BQ6A 1RZ8B 1ZA6A 5H35B 1MRCL 3GO1L 3EYQD 4HIHA 3OX8B 1QSFB 5C8JB 2A9NH 3G5XA 1KB9K 4DUXA 2FWOA 1LNUB 3FQWA 4KRPB 5ITBL 2ATKA 1RUPH 4ZTPH 4F7EB 2AW2A 1N6UA 4HJJL 3RVUC 4LDLB 3SE4A 4HSQA 1T6WA 2G5BA 1XF4A 4JFHE 3TFKC 1UACH 2OS7A 5EIIB 1Z5LA 1LO5A 3TNMA 4OV5B 3VFTA 5BVPL 3G5YA 4KUZH 3HCVB 2VO5A 5J57B 1ZT1B 2YWZA 5BS0B 5DURD 4P0DA 2EH8L 4Z7UF 1LO4L 3ARDC 5CHNB 4OAWA 4M8VA 3R8BB 4H20L 4YH6A 1KCKA 5IW6B 4MNGB 5F7YC 4ZO8A 3NBNA 4N9GA 3GRWA 3STLB 4PJCB 3TZVB 4ZAKD 3DOSA 2EIDA 5KSVB 4IRJB 2FRGP 4P5MB 1MHPH 4JFXA 1JI2A 2RAMA 4GMSL 2AJVL 3Q3GA 4HUWB 1CXEA 2ZSVB 3GSWA 4PJEB 2Y25A 1S3KH 4JFDB 3WNOA 1TVBA 4OCRH 3MBXH 4P23A 1MCDA 2P47B 3VXME 2PYEB 4FQJH 3KR3H 4YJZL 2DF3A 4M43H 5L8JB 4PP2B 3LOWA 2COQA 1N0XL 5TE6H 3MRGA 4YLQT 2DL2A 1G7QA 5HYIA 2PR4L 1YMMD 3KYOB 4KK6D 5C0ND 4LCIL 2B0SL 1DLHB 3L6FB 4NRXA 3SKNA 3I2CL 4U7SA 2CXKA 1KTLB 4B7LA 5FOBA 3RU8H 4UNUA 1P4BL 2AEIT 4L3CA 2E7LA 4CBPA 12E8L 3QDJB 1XF2B 5TDNA 1W0VB 2XICA 4XNQB 5KSAD 1KN4H 2NY4D 5E6IB 3SE8L 1AP2B 5EZJA 1T89A 4UOJA 1PFCA 1JNHA 3VXRE 1XIWA 2BVQA 2V2XB 5DJAA 1X5YA 1ZGLB 2EE3A 3BQUD 4ZYKA 2FR4B 5C2UB 4JAMA 4OIAA 2H6PA 2AJSH 5CIPA 3V4UH 1VADA 2AGJL 4L4JA 3UJJL 4PGBA 1YJDH 5IFHH 4M61B 4MX7A 1FRGL 2XY2A 3BPNB 5F7EL 1BLNA 4Z7QE 3IDXH 3SGDH 1YNLL 2HRPL 3F8UB 3W82A 2P48B 1P9MA 4F37K 2CKBB 2APWA 3MXVL 1JWSA 1K6QH 1K3IA 4DZ8A 5E94A 4MXQC 5I71B 2R2HB 2NY1C 3L1OL 2X42A 1OLZA 5FF6A 4IRSC 3BH9B 1KNOB 4PS4H 5JXAL 3ARDA 3RA7L 2DLFH 5DFWH 1ZHNA 5HYSB 3HRPA 4BSVA 3WNMA 3FT2B 5JW4N 3LY6A 3OKMB 3NMEA 4KI5F 5I1GH 4PRBA 3CK0L 2CGRL 4JJ5A 1RY7B 4ELKB 4M1CD 3BEVB 4HMDA 4F8TA 4PP1D 2YPLA 1AQKH 4PFEA 4TNWK 5EOQL 3TJHC 3J8F7 5IVOA 2VKWA 4PJFA 3IU3B 1NFDB 1QR1A 3LH2L 5IMOA 3W9EA 5FIEA 5B3JE 5HBBA 4NSKB 3VFSB 2VXVH 5ID1B 1AGFB 1IC1A 1PLGH 5JPNB 4O4YH 1WCBB 5T1DH 5EO9A 4JFEB 2YD8A 5BZDB 1MCRA 2XWJB 1S78D 4I1NB 3MA7A 4YEFA 1NJ9B 2X70A 4XH2B 3VFVB 1ZVSB 2AV1A 3JBG7 2VZ3A 3D25A 1I1AD 2FEDD 3MROB 1FZMA 4NGHH 5FO9B 5ID0A 5DMIH 4N8VB 1FG9C 1Q38A 4GKZA 4XI5C 5ADPH 2I25N 1H3WM 3TZVC 1R24A 1MAML 3HI5L 3LDBB 1JL8A 3DRTB 4IRJC 4XCEA 1T1WA 4MD0A 3ZT6A 1ORQA 1XCTA 2LVCA 2W9EH 5IM7A 3T0EB 3ULUD 1IGFH 5IJVB 5GS0C 2VLKB 4ZO9A 4OGAC 1GHFL 1S9KC 1FVEB 4DGVL 1WEJH 1DBAH 1AD9B 1CIUA 4WO4D 4D9LH 2GUOA 3MRRA 2QHRL 2XFXB 4Z8FH 4MHHG 4NHUA 5J1AA 3RPIA 4TVPH 1E0OB 1MCKA 3BUYB 1EIBA 1HXYA 4I3RL 5DGRA 3WBDA 5EBMB 3WEXA 3MV8A 3QIUB 1QLFA 1HDMB 5BMFL 3B6SA 3WFBL 3WUWG 2DQIH 1BGXH 1RQ5A 3MNZB 3FB8A 4JM4H 3KPPB 4H8WH 4R3SB 2VXTH 3S35H 4S1DC 1YYLH 1I4FB 2WWKO 1XGRA 1T3FB 4IOIB 4FZEH 5E03A 3EO0A 5JQ6H 4K3DH 4WW2B 2JB5L 5E6IC 1JHKL 3TA3C 5J7CC 5MI0B 1NGPH 4LU5H 43C9B 2IQAB 1AGDA 3K80A 1I75A 2GJZB 4RFOL 1DVFD 3BP6A 3FT4A 1NEUA 2XKNA 5GSRA 1AKJB 3LPFA 4MJID 5FHAH 4I4WA 3JTTA 1RZ8A 1A7QH 1T66C 5H35A 3B2UC 3MACH 3OX8A 1QSFA 5C8JA 3QDMB 2CKBL 1GGIH 5A1AA 4F7EA 4MA8L 4OLUL 3UTSD 2CLZA 1OTUD 3RL2B 3ZKMC 4X7SH 2MFNA 3A6CH 4EJ1C 5EIIA 3ULVE 3RZWA 5I71C 4R6UA 4LHUD 4DGYH 1X4YA 4YIQB 4OV5A 2JCCE 5I1EH 2OXGA 1ZT1A 4Q58C 5IVZB 5D1ZB 1ZT4B 5CHNA 3STZB 2EDNA 3IF1A 5IW6A 2UVFA 3FB6B 4XVJL 3VRLF 4KKCC 2YEZB 3STLA 3TZVA 3PL6B 5KSVA 4IRJA 4F57L 1R5WB 3C5JB 4P5MA 1OWRM 1JUFA 3RWJB 5I1KH 1CI5A 2ZKHL 5GRWA 3IAQA 1I9JH 2CK0H 4HUWA 1CBVL 4RWYH 1QKZH 1Q9WB 2ZSVA 4OCWH 1FIGL 1REIA 3O3BB 3BSZL 4XMKH 4PJEA 1QSEB 5BRZD 1EEUA 5E2UH 4JFDA 4NQED 1HYSC 2PYEA 5HVHB 4PP2A 3W2DH 2XN9E 4LCYB 3NIFF 1MIEL 2GYSA 1RSFA 2OTUB 4MNQA 4RA0C 3RY5A 3LQAH 4ODVH 3O6FD 5L9DH 2RHEA 5F7LB 4DK6A 4PD4J 1QA9A 1C7TA 3L6FA 3ZE2E 1U91B 4GSDL 5K9QG 2IPTH 4NKIH 3IJHB 1KTLA 3OHXB 4UV7L 4OIIL 5E99L 3TJEH 5K9JL 5DJ2B 5I0DA 1YECH 4W4NA 3QDJA 5BV7B 5HYFA 1KB5H 2AKRB 1XF2A 2J2ZA 1WIOA 1FSKC 1RIHL 1W0VA 3KPRD 4XNZC 2WP3T 1GGTA 1KPUB 5E6IA 2DB8A 1AP2A 5HI5D 5JA8B 4MA1C 4G43B 4R8WH 2GTWB 3PDOB 2ZCLL 3Q0HA 4WFHD 1MIMH 1ZGLA 3SJVB 1KPVB 2RCSL 2FR4A 4HIXL 2JJWA 5JOPE 1FYTD 1EK3A 3MFFB 2Y5TB 4M61A 1JPSH 1T7VA 2EDJA 1TDQA 5FGRA 3QIUC 1Q94B 1F8TL 4NJAH 1RURH 4FTVB 5F1NB 3GMMB 2CKBA 4G5ZH 2E6PA 3CDFA 3MRQB 3V5DB 2FEEL 1DL7H 4NWUH 4KUCF 2WLZA 5HI3D 1MNUH 1NBZB 4UIKL 1TQBC 1W72H 2R2HA 3D48R 4XCNB 4GRWF 3QI9D 1NCAH 2VDKH 4OD2B 3D3VD 1MCNA 4X6DB 3BH9A 1KNOA 5GGTH 1T0PB 4WW2C 3NAAL 5AZEH 4FABH 3ZTNL 3ILPB 3FT2A 3RGVD 2X10A 2H1PL 2WUBH 3OKMA 3QQ3B 4TUKL 5C0AE 4ELKA 4MSWB 3BEVA 4ONGH 3ARGC 3MRPB 3VXPB 1NMAL 4JHBA 3MR9B 1J1OL 5CP3A 5CEYB 1IMHC 3CSBA 2X05A 3IU3A 4PLJD 4JM2D 4Z77B 4HF5H 1T83C 3SDDB 1NFDA 2CDFB 4XVSL 1FGVH 3QDGE 1A6PA 5JO5B 4NSKA 3VFSA 5DURB 2J8UF 5CGYD 5CWSB 4NO0D 3ZKQD 4G7YH 5ID1A 1AGFA 1OT2A 5JPNA 5CSGA 4KHXH 5IVXB 1KGCD 5GRUH 3EBAA 5BZDA 2XWJA 5E9DB 5MEQB 1NJ9A 1DSFL 1HN1A 4QXUL 4XH2A 3VFVA 1ZVSA 1MFBL 4KXZI 4X4XB 2YRPA 3CDGB 3MROA 3SCMD 5FO9A 2VDLL 4RAUB 5GGQL 3NACH 4N8VA 3CMOH 4KV5E 1BAFH 1IAII 4IM8A 3DRTA 3BZFB 3PL6C 3V0AC 3MRDA 4ZOAA 2Y5EA 4W6YB 4O5LL 4JKPH 4D3CH 4N0RA 5HPMB 4EDWL 3T0EA 1CFTB 2CD0A 3BIKB 3H42H 2V5YA 4X80L 5EUOB 5IJVA 2VLKA 4HH8A 5JW4R 5EOCL 5K9OB 1AD9A 1WAAF 3D5OF 4M8QB 5HVHC 3MFGB 4N8CL 2XFXA 3FMGL 4TTDC 3GSVB 3LHPL 3BUYA 2VLLB 5TE7H 3DGCR 4C57C 5D7JD 5EBMA 3QIUA 1HDMA 2X4NB 3OAZK 1T7YA 1OSPH 2F58H 1CE1H 4GRLB 3MNZA 5BV7L 3KPPA 4R3SA 5HYJD 5INCA 1WBXB 3GSRB 4MJ5B 3BGFB 1I4FA 1I9IH 2V9QA 2GITB 2OMNA 1WIUA 2H41A 1T3FA 4IOIA 1M6OB 4PJHB 4XHJC 4WW2A 1JIBA 1ZK9A 43C9A 2IQAA 3BOVA 5LGHL 2C4FT 3STBA 3WFDL 2QTEA 5ETUB 5KVFH 3DRQB 4Y5YC 4HZLB 1DBBL 5IROA 4ZPVB 1AKJA 4L8DB 2GSIB 4ZFFB 2X1XR 3NZHH 3KS0J 3MOBH 2B5IC 3ARGA 3SEPA 4C4KT 1UWGH 3QDMA 3MLYH 3HHRB 4I3GA 1GZPB 3I50L 3MYZA 4U1SB 5KSBB 3UYPA 3RL2A 2ZG3A 4HXAL 4M1DH 3O0RH 5C7XL 1D5IH 2CK2A 2V7NB 5L2JB 4YIQA 1X5AA 1KFAL 2JELL 4JO1H 4JZNA 3WNNA 1BD2B 1NCTA 1PZ5B 4OLWH 5IVZA 3QDHA 5D1ZA 2A74B 4HFUH 4YBLB 2EYRB 3X17A 1TJIH 3STZA 1OTSD 1BWMA 5F96L 4EVNB 1HOCB 1DQML 4TVSa 3FB6A 2O5XH 3EYQC 4Y4FD 5CD3B 1TPXB 2YEZA 3Q6GH 2P44B 4FFYL 4RGND 1KCSL 3PL6A 2YXFA 3DO3A 1R5WA 5KANG 3C5JA 3I9GL 3ZHLA 3O11B 5GGUB 2XZCH 4EI6B 2YD2A 2ZOKB 1Q9WA 3DV6A 3O3BA 3W5MA 1L0QA 1QSEA 4EBQL 1QZ1A 2E9JA 1OP5H 1OAUL 4GXVH 1EHNA 1I1AB 4BELD 2OTUA 5I1AA 5DD5L 1L0YA 3BE1L 3VA2C 1QFHA 3NH7H 1KJ3H 3RNQB 1AI1L 1EEZB 1MHCB 1U91A 4ZAKC 2YPKB 2DWEB 3QFJE 4NNXB 3IJHA 1FYHB 2WIMA 3OHXA 4ONFL 1QBML 1J1PH 4S2SB 3FO2B 5DJ2A 4PRHD 1LP9B 4ERSL 1ZMYA 2AKRA 2WWMC 4YQXH 5DZOA 2L0DA 4XZUB 1ZTXL 3PNWB 2NZ9D 5I18L 3D2UA 4ZUWB 1IAIL 1KPUA 3MJ9H 3BDXA 3DI3B 2NW3B 5CP7A 2GTWA 3NPSB 3PDOA 4XNUL 1L6ZA 1HHGB 3SJVA 1KPVA 5I1HH 4UAOB 4KK6C 4JQIL 3CSPA 3ZSTA 3MFFA 3ZYJA 3UROR 2Y5TA 2B2XL 1QP1A 4YX2H 1JGEB 1U8IB 3VCLB 1Q94A 3F7VB 3VFMB 1KJVB 4FTVA 5F1NA 3GMMA 5BCAA 1CU4L 3FCTB 2K3TA 3MRQA 3V5DA 1PQZA 5KSAC 1NBZA 1EJOH 3KWWA 4XCNA 5HDLA 2W0KA 5SWZB 2IPUG 4KKAD 4OD2A 4X6DA 5EU6E 1FFPB 4CDGC 3OAUL 4XPFL 1DANU 3KPOB 4M7LT 4Y1AE 3ILPA 2DICA 4LGSB 2UZYB 3QIWD 2DQDL 2Z92B 4JZOB 4ALAL 5D1XD 1PDKA 2FH8A 3K1KC 3O81A 5H37H 4WEUD 3QQ3A 2VXUL 4S1RL 2Q87A 3FOMB 4MSWA 5HHVL 1H0DB 3MRPA 2HYMA 3WUWB 4PJBF 3UZEA 3VXPA 3MR9A 4MB3A 3UTSB 5IVNA 2A6KB 3IFPB 5L7XL 3SDDA 4OV6F 1KBGH 2CDFA 3QT2A 4JRXD 4AIXA 3BKML 4U6HB 5I9QC 4QO1A 2WNGA 2X4PB 3V7AE 5CWSA 3VMNA 5T1LD 4KK5D 3LRSA 4FQHB 4POZD 5IVXA 4Y4KD 2NY5H 5E9DA 3TF7C 4G42A 5MEQA 4TULL 4M1CC 4X4XA 3O2VL 3CDGA 5CIPH 4PP1C 4RAUA 1MCQA 4PJFF 1YEIL 3TT3L 1Z9OA 1TPXC 3QRFM 1CICB 1UM4H 1Q1JH 2FBJL 5FYJH 3PXHA 3BZFA 2IG2H 4HIEB 5I15L 3GO1H 1IKNC 4KTYA 5KN5B 1GSMA 2FX9L 4QLRA 5I75B 5HPMA 4OJFL 1S7RB 1CFTA 3BIKA 4OD1L 4HJJH 5EUOA 2E9IA 3DYPA 3T8XB 3F6IA 4K3HA 4DN3L 4K9EH 1M05A 4OLXH 4YHZH 1FDLL 2XZAL 1QEWB 4M8QA 1QR4A 1OAYH 1B2WH 5FYKU 4O02H 4ONHB 5BVPH 5F1SA 1I1AC 3MUZ1 2FEDC 1HHHB 4L29B 5DMYA 3GSVA 1JZ4A 2Z31D 2OMBA 1M7XA 2VLLA 2IAMB 2IPUK 1LO4H 2VQ1B 5D7IA 2X4NA 1VEOA 1ZLSL 5GGSB 3GHBL 1XMWA 2AEWA 3ULUC 3MV9D 1HSAA 1WBXA 3GSRA 4MJ5A 2EE9A 1IZJA 2GITA 4G8GE 2QSVA 1M6OA 4KQ4L 4NZUL 4XNMB 4GMSH 4HX1B 4PJHA 1I3RB 3MV7E 5JHDB 3NA9L 2H2SD 1BJ1J 5ETUA 1IGML 3DRQA 2VDQL 1RAMA 5C92A 1T80A 4UAOC 4CL7A 4ZPVA 3K1DA 4ODHL 4L8DA 4D9RE 2GSIA 4ZFFA 1N0XH 5F9AC 2XQYK 4K55A 2OZ4L 4WIQA 3K8LA 4Z7NE 4OF8A 1A5FH 4F15B 3OKEB 3A6BL 1GZPA 5LKNA 4U1SA 3I2CH 1A6ZB 3RVXD 1NBVH 3QI9B 4OFVA 5KSBA 3ARTA 4GS7C 1RZIB 2NX5E 3MLVL 2V7NA 5L2JA 4TUOB 5DJDB 2IALB 1DVFC 3MNWB 1PZ5A 5F9WC 2EE6A 3MJGX 3SE8H 2A74A 4M7JH 4WI3A 1SEBB 4JPVH 5MENB 1VKXB 4EDXB 1WFTA 4PJ8D 4EVNA 3W39B 4PTTB 1KCUL 1HOCA 5MERB 3IETA