3BESR

Structure of a poxvirus ifngbp/ifng complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
250
structure length
250
Chain Sequence
TITSYKFESVNFDSKIEWTGNGLYNISLRNYGIKTWQTMYTNVPEGTYDISGFPNNDFVSFWVKFEQGDYKVDKYCTGLCIEVKIGPPTVTLTEYDDHINLYIEHPYATRGSKKIPIYKRNDMCDIYLLYTANFTFGDSEEPVIYDIDDYDCTSTGCSIDFATTEKVCVMAQGATEGLLDKITPWSSEVCLTPKKNVYTCAIRSKEDVPNFKEKMTRVIKRKFNKQSHSYLTKFLGSTSNDITTFLSMLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interferon gamma
publication title Structure and mechanism of IFN-gamma antagonism by an orthopoxvirus IFN-gamma-binding protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 55
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF07140 IFNGR1 Interferon gamma receptor (IFNGR1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3besR02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3besR01
4P23A 3UCRA 1RURL 2DBLL 1WZ1L 1HHJA 3A0OA 3SE8H 1H8SA 3TYFB 3MRLB 1E4XH 3W11D 5MI0B 1ZHLB 3QUYB 3VXPB 5AAMA 2H3NB 4RNRA 1YEHL 1QNZL 2X70A 3RY4A 3E8UH 4W4OC 3H42H 4BKLA 4B50A 3BP5B 1D6EB 1FRGL 4S10A 5IB3B 4NWTL 1EO5A 2D0HA 5GSRB 3NACL 4OZHA 5L9DH 3D85A 2R39A 3K8MA 4UBDC 1J88A 5HHQB 1QLFB 3P4OB 4U7MA 3QNZA 1GOFA 3C87A 2BJML 5A3ID 1KXVC 3EJJX 4OCYL 1IM9B 5DJYA 1XF4A 3U9PH 4KRNA 3CUPA 4LCWB 1MHHB 4PJCF 4IRZH 2NY4C 5DRXB 4ZFFA 2MCG1 3TIDB 1VKXB 4A6YH 2RHEA 2BNUB 5TDPA 4I0PD 1K6QH 4ODSH 1ONQB 2H32B 4OT1H 5JPNA 1JNLH 1HCVA 3IDGB 5BS0E 1NBVH 1CICC 3AREC 1RHHB 4I18B 4Y19D 1U6AH 3T2QA 1J11A 2AJUL 4FXKB 1DLFL 1JTTA 2NY2C 2VH5L 5EO1B 3S4SB 5IK3B 3V4VH 1P4LB 3T0AA 1J5OL 3QIUC 2XFXA 3FOMA 1P6FA 2ZSWB 4I3RL 4S1SL 4JY6A 5T3XD 1MREL 3UYPA 4AIZB 1NMAL 4HWBA 2HKFH 3Q3GA 4YEFA 3SY0B 4S1RH 5FO9A 2ICWA 4R3SA 5D72H 2NR6D 3BQUD 1VADA 4GSDL 5DS8A 2XKNA 3WMSA 2APBA 1E4WH 3BISA 4O58H 1XZ0A 1M71A 2NZ9C 1A7RL 1YMHB 4XH2A 1YJDC 3RY6A 4K71C 4PJBA 4QOKD 3AY4A 1TENA 3FB5A 4K07A 4ZFZA 3UTSB 5JXEA 2HJLA 4PS4H 3K2UH 1YNTB 2YRLA 4M93C 1QSZA 3TF7C 1MFAH 5KVDL 4YHNB 4WUUE 3WUWB 2E6JA 5HI3D 4LKXA 1KB5B 4ZYKA 3D39E 1BIIB 2C4XA 4FG6C 2FO1A 4IDLA 4QXUL 4LIQL 4WI4A 4PRPD 5HVWA 4U1LA 4PJEE 4YUEH 5KVEH 2LABA 1C5DA 1MCLA 1TJGL 1BLNB 2E8YA 2F8OA 5T1LD 5D93C 3ZSTA 1QFUL 4GBXD 4FQXD 2DRUA 4PBVC 4X4XB 1S7SB 2CMRL 3O3EA 3QUMA 3IFNH 3VD5A 3BMWA 4PJ7A 4JPVH 5DA0B 1CI5A 1C08A 2BY1A 2FNBA 3ARGC 5IQ7H 5AWNH 5SX5H 1OAUH 2ESVD 4C57C 2XTJE 5SX4I 4P57A 4JM2F 2RAMA 4F15C 4UDUA 5HDQH 2AEIT 2EH7L 1TXKA 2HRPL 4BM7A 3GSXB 5AUMB 5FO8B 3TESA 2VAAB 4NQXA 3KAAA 2XZQL 1M05B 2K7PA 2R0LL 2D4DA 4IDJL 4U33A 2B0SH 3O9WD 4JO4L 2I07A 1P7KA 3S3JA 3WFBH 3TJHC 1DDHB 2IFFH 2PXYC 1HOCA 1YEJH 2GCYA 4G9FE 4HH9A 4WY7H 5CEZE 1YJDL 3TA3B 3UPCA 3P9MB 1J05A 1DTUA 1FVEA 1ZA3A 3VH8B 5C2BH 1I7ZB 1WT5A 3FQTB 3OGCA 5I1EH 1F3JA 3EYQC 2DL9A 3JTSA 4MNGA 2OSLA 4QTIH 4WI3A 4ZUTA 4IRSA 1ORQB 3HNVL 5J06A 1A7PH 5EZOL 3RZCC 4JFQA 4NQED 1N8ZB 2OTUB 1KT2A 5GS0D 2RIKA 3H0TA 3HNTH 4I3SH 2BMKB 1GVIA 2BNQD 5GISH 5D1ZC 5EZJA 12E8H 2R4RH 3CSYA 1YNKH 1KXQE 4Y4HA 4OIIL 2XZAL 5INCB 1B4RA 4HGWB 4U0RC 3CX2A 4Y5YA 3LEXB 4G6MH 5E0QA 4CMHC 1MI5A 5DD1H 4P5MB 1JNNL 5A1AA 2EDRA 3HI5L 2ATKB 1MCPL 3RTQA 1Y6MR 1MQKH 4JREB 3RDTA 4Y2DB 4L29B 4MSWA 1Y0LB 5JHLL 4FOMA 3ILQD 4BH7A 5C8JB 2AK4B 2X44D 1W72L 1LO3H 1Z9LA 1HWGB 2WBWB 4UAOB 3P9LB 4ZTOL 4M1DH 1NH6A 1EUTA 4L4VD 1Z5LB 4G43A 5HVHB 4M1CD 1FE8H 4LCUB 2XWJA 5EBGA 4XP6L 4CJ0A 4GXUM 4IOIA 3HUJA 5EOCJ 3M17A 3P30H 1D3CA 4ONHA 3EYFA 1JGLL 5T5FL 4MWFB 4LHUB 1FGNL 1T4KA 4HKJB 4LMQI 4NHUA 4YBQD 2ICWI 5CINH 4K8RD 3S88H 4KJPD 1ZHKB 3RIFK 3SDCD 4HV8A 3BIBX 1I4FA 3MV8B 4OCNC 5C3LD 3IFOB 4PJEF 1IKFL 3HE6C 3WSQL 2F54A 4GKNA 5C07E 3T0BA 2A0LC 2HVKB 2A6KA 5E1AB 3Q0HA 3QI9B 4HFUL 1JTOA 4XCCL 3VFWA 4H20H 3ZO0A 1EAJA 1OTTD 2GY7B 2YC1B 4XI5D 1KB5H 1ETZB 1DQQA 2NXZD 2V6HA 3U7WH 2ADJB 3FONB 5C0EA 1XR9A 1KLUB 3LS5H 5F44A 3L6FB 4M7KL 4KTDH 4M48H 3TT1L 1X5YA 5C0RL 1ZLUK 3JV4B 5HYEA 3DYPA 4KK9C 1VENA 4ODWA 1NFIA 2BERA 1MCQA 1P2CA 1MWAA 4PJDE 5KANG 5HHOA 3T0XA 4GRWH 4CN1A 3DV6A 1X6NA 3Q6FA 4O4YL 1WJ3A 1AXTH 4MJ5A 5JPMA 4HIEA 3MO1A 5ACMA 5C0GA 4ZXBC 1I1AD 3ALPA 4NIKB 1VEMA 2VIRA 1NBZA 3HZMA 4JKWA 4O5LL 2FJHB 2AI0H 2Q3ZA 4XVJH 3QCTL 4GW5A 4U1SB 4TSAL 3BXNA 5K59E 1A6TB 3CZFB 5EU3A 2DWDB 4NRYA 3C5ZA 3QAZB 4KAQL 4NN7C 4PY8J 5LXGL 4HHAA 3U2SB 1U93A 2OL3B 3H3PH 3NFNA 2HMID 5ICXA 4P2RD 4LSPL 4HCRA 5FK9B 4APQC 3HZYA 3TNNB 3S37L 4NQCE 3MGTA 1CDHA 2V7NB 2NY4B 4JRXE 5DJAA 1MCFA 2EC9U 1ZSDB 3SE9L 3VA2C 3CK0L 1VCAA 5E9DA 4LLYA 5I0ZA 3TZVD 3P77B 1UWEH 1KXTB 3AREB 1ZA6B 2JJTC 4HUXA 4J3VA 3WIIH 2X4PA 3H9SD 4R0LC 1VEOA 5FEBA 4N8CH 2NY2B 2IAND 3VXUE 5IMKA 2C1PA 2GUOB 5GHWL 3QIUB 2CKBL 2R23B 1LWRA 4KI5E 1FNGA 4E0RA 2A77H 1IAOB 4LVNC 3BYTA 4OQTA 4JQXC 1IGYA 3I2CH 3TBSA 4HPOL 3PWVB 5CSZA 1F2QA 2NR6C 5E95B 2W91A 5KVFH 5I66B 2BSTA 5GGSA 1MJUL 4IRJD 2VLLB 2WANA 4H5SB 4HZLA 5JW4R 1GZPA 5DR5L 5L2KE 3WDJA 4QRUA 2DBLH 4UT7L 2X4OA 5HDOA 5E8DL 4BK5A 3HZVB 4YFLI 3F6IA 3HG1B 5AAWA 2YK1L 3WO4B 4PV9A 1A4JB 5JW3L 1TVDA 5EBWB 2GY5A 3O4LA 5IIEB 5C3TA 5HGBA 2B5IC 3S36L 1YEHH 1QNZH 1ZHBB 4J8RA 3E3QC 1HE7A 4M93B 1F11A 1DE4A 4KKAC 4R90L 1L7IL 1FRGH 1XF5B 5AYUL 4NWTH 2ZSVB 4GUPB 4JRYD 3VDBA 3NACH 4J23A 4F3FA 3BZEA 1NJ9B 1I9JL 2OMBA 2FJFA 2APVA 4NRZA 3QIWA 2HA1A 5LWYL 5I9QC 2VXQL 4R4BB 2BJMH 3QULB 3MCLL 4ZG1A 4NKQB 4OCYH 5HYJA 2A83B 5D93B 2XA8L 3Q6GL 3T65A 5DI8A 2P7TB 3MLXL 4R8WL 5DRNB 4ZNCD 2G9HA 1F4XL 3RVTC 4R96A 3I02B 1FG9C 4OLZL 3V6OA 1MVUB 1OAZL 4U1KA 3C09C 3GIVA 4PJDF 4F15B 1ZVYA 3GBNL 3SBWC 4YFEA 5D7IA 1FH5L 4GAGL 4DK6A 1W72B 3KHQA 2AJUH 1WITA 3VXSE 1CS6A 1DLFH 2VH5H 1U8QA 3WD5L 1JPFA 4E41A 1J5OH 2YUVA 3EIFA 3EJZD 1HH6A 4U1IA 3DTXB 4I3RH 1UQSB 4S1SH 3KJ4B 1MREH 4UINL 1I85A 3N06B 1NMAH 3BZ4B 5KSBE 5K59F 5F3HA 2PXYB 3BOVA 3GSWB 1JN6A 4KXZI 1NCWL 4GW4B 4HIHA 4ZUVA 4D9RD 1EEYA 1FYTB 4ZUSA 4L3AA 4GSDH 2X1QA 4V1DA 5I17B 4XAWL 1IAII 2UWEA 4PGCA 4NQDE 4Z76B 3OKLA 2ZOKB 4AEHL 1A7RH 3DVIA 1BD2B 5C08D 3VWKC 3MJ7B 1OAQL 4Q6IA 1MJJA 2MFNA 4NGHL 2J8OA 3RZCB 1CFTB 5GQBA 4JAMB 1E4KC 1TZGL 3NTCL 4OUUA 2FGWL 3W2DH 5DZNA 4NT6B 5KVDH 1N6UA 4NNYB 1J86A 4L8SB 1ULVA 4J1UB 1S7RA 1GSMA 1JYXA 3BW9B 2IH3B 1H3GA 4U0RB 1ZS8A 2ZUTA 2DI9A 3NCYP 2LVCA 4LIQH 4QXUH 1DLHB 2F5AL 3CDGA 4QRRE 5FOBB 3QO1B 3SQOL 2YMXL 5I75B 3L3IA 1IQDB 1TJGH 2EDFA 2GJZB 2I9LB 4RMWA 2H6PA 2X89A 1CG9B 1EEZA 3TPUB 3DECA 3HI1B 4QHKJ 3INUL 3KWWA 5EU7C 3KPPB 1Q9KB 1FBIL 4GXVL 4M1CC 4YZFE 3ZTJG 3Q2CA 5DO2C 5BZDA 1NGXB 2EH7H 2HRPH 1GYAA 5ALBL 5AYQA 1D5XB 3FO2A 4KVCL 5MP6L 5DSCA 1S8DA 3GSNA 2XZQH 1HHKB 2R0LH 2Q6WB 1ZVHA 4RAVA 2GAZB 5FCSH 4IDJH 1DBML 4JO4H 4G42B 2JIXB 1T89A 3LB6D 3QQNA 2NMSA 1S5HA 4P4KD 1Q1JL 1KIQB 1XAUA 1SJVA 3TEUA 4HBQA 4ZUWB 5ETUB 1YJDH 1I3VA 2GJ6B 4M8VA 5B8CA 1NGQL 1XGYL 3VFMB 5A2LH 5FA4A 3AVEA 4P5TC 1TTFA 4D0BA 1A6ZA 3FQNA 3ARTA 3R06B 4CU6A 1IC4H 1Q9OA 3CSGA 4D8PB 2BVEA 2CQVA 3CXHJ 4KROD 1DQML 3B43A 4JJ5B 2IPTL 1MSPA 1OGAA 3LEYL 1CBVL 3HNVH 5DFTA 3FT3B 5EZOH 3NN8B 4OFIA 1BMGA 4POYA 3CFJA 1GOGA 4JFZL 1X3DA 2CKBB 2GSIB 2Z8VC 2HT3C 2VLRB 4OI9A 1WISA 1PEZA 3H3BC 4OFYD 1RJZB 5I0DA 5IJVA 4OIIH 3GM8A 2XZAH 4R4FL 4BZ2L 2VR5A 3OJDA 3SJVD 5JO5A 3V5DA 4ELKA 4UMGA 4X5XB 1JNNH 1LGVA 1QQDB 5DJXB 5DMGC 3HI5H 1I1AC 1FQ9C 4B5EA 1MCPH 3LQZA 5C0BE 5F3BB 2QSTA 5TGBA 4ZXBB 5J1AA 3BVNB 4RAHA 5JHLH 2Z8WC 4IEFB 3F7YB 1W72H 2ZJSL 4NYLB 5JHDB 4GO6B 4CAGA 4UTAL 4J3UA 5C0ND 4DGVL 4QHLA 2EKSB 5CMAA 4RIRA 4NN7B 3VWJB 3X3GL 2HLFC 3MXVL 5DA4A 1QO3B 3QDJD 4XP6H 2EIZB 4YHPB 4APQB 4RWHA 1JGLH 2VKXA 1FGNH 1Q72L 3CMGA 3VE0A 3TZVC 3L3HA 5F7LB 5C6PB 2WIIB 2BVUA 3MUGA 3MLPA 1JWUB 3S37X 1JPSL 1P4IL 4OSUL 5DJ0B 2E5EA 3DO7A 4PRHB 5C9KA 4N8VG 4H8WC 1JUFA 1OGTB 2A74B 3B6SB 3HAEA 3IXAA 1EO7A 1IKFH 4NO3B 2GSGA 3WSQH 3RUGE 3ARFD 4R0LB 5T33L 3BH9B 4WWKA 2BVPA 1CFNA 1W0WB 4PREB 1U8KA 3EOAB 3EJYD 4AYFA 5C70A 1QFPA 4HGKC 2ITDB 3NCBB 5MEPB 4HFUH 1RZ8A 5ANMA 4XCCH 4CNIB 1WCBB 1FNHA 4LVNB 4L3CA 4C59B 4YZFF 3ARDC 2DN7A 1NL0H 1HNFA 2O5ZL 2X09A 4M7KH 1UGNA 1X6LA 5DVMA 4BFIB 3TT1H 5C0RH 5I1JL 2M26A 1OLLA 1PKQE 1B0RA 1X7QB 2P24B 2LAAA 4NUGL 2L7UA 1F42A 5BRZA 4ZS6C 5MHSD 3DROA 3ZT7A 3OBAA 5C0AE 1CD9B 4YDLC 4ZUUB 4O4YH 3V95A 2B5IB 4KJQC 1EDQA 4LARL 2YN5A 3U9UB 3OGOE 1OSPL 5TDOB 2CR3A 3S36X 1FV1B 3VXRD 1J8HB 4O5LH 2BVTA 1OD9A 4MS8D 5C0CB 1KTLA 3QCTH 1RIVL 4NN6B 4I8DA 1OTUD 3D25B 1U8OB 1AKJB 1FZMB 2VZ1A 3NAAL 4KAQH 4YJZL 5EUOE 4Z78B 2Z93A 5LXGH 5ID0B 2KQNA 5FO7B 2OS7A 5I9QB 1CDIA 1QACA 4LSPH 1A1MA 4PB0L 1RZKC 4XNMA 3IYLW 4H8WL 3S37H 3ARBB 1I3UA 5IW1A 3IB4A 3SE9H 2CLZB 3CK0H 1VERA 4GG6B 2V7HA 2PYEB 2EH8H 3PUCA 1KG0B 2K7QA 4JZJC 1YECL 4M6ML 1OSZB 1S7UA 4D0CA 5HD8D 4CMMA 3UJTL 1D5MA 3ZKMC 3L3KA 5GHWH 3IRPX 2CKBH 4X98B 4H1LH 5GZOD 3DVFA 1BIHA 3PHOA 1ZT1A 4N90E 1SEBA 3L95A 4LCCA 4MQ7A 2FIKB 3Q1SL 2CXKA 4MNQD 4HPOH 4Z7WA 4CRPA 1BFOB 1PX3A 4NQVB 3TVMD 2F8VA 1MJUH 2XKSA 2YA2A 2JCCA 2QKIB 3G04B 2DKSA 1UJ3A 3BP7A 4UT7H 2H1PL 2LU7A 4MAYA 1VPOL 5E8DH 2AK1L 4XCNA 1IGIL 2YK1H 4YDVA 5JW3H 1DQTA 3F12B 5I1DA 3MRRB 4AQOA 4JY5L 5CZVL 3S36H 3K81A 4F80A 4WI7A 1Q9WB 4CDGC 2NZIA 5ERWA 1IGJA 1R5IA 1AHWA 1VFAA 2C7UA 3RUGF 4R90H 3KPRD 3SQBA 1L7IH 1GXEA 4U6XB 1UENA 2E27L 1QA9B 3BUTA 3S4SG 1U8PB 5D2LA 5AYUH 3EHBC 2QL1A 1TQCC 3KLHC 1I9JH 1RZKL 4JN1L 4Y89A 3JZ7A 2UY7A 1HHGA 2E7LA 4ZQKA 5LWYH 3REWB 3K3QA 1U8LB 2VXQH 4OAWB 4PJGE 3MCLH 3D2UA 3QA3A 3EGSB 2XA8H 3Q6GH 1WZMA 1WWBX 2YWZA 3MLXH 4R8WH 2JJWA 1F4XH 2DM7A 3LRHA 4ODUA 4OLZH 3MLYL 4HW6A 3MV7B 2PTUA 3MFFA 2YA0A 3BDXA 3VFUB 4QRSA 3GBNH 1BREA 1Z2KA 4PJAE 5AD0A 1ZANL 4R2GB 4M43L 4G3YL 3GJEB 3MJ9L 1FH5H 4GAGH 1VFBB 4C56A 4DQOL 1EZVY 1NQBA 1UH4A 3ZE0E 3OKMB 3RWCB 3WD5H 5TE7H 2WINA 1R3JA 4JDZB 5HHMD 3WUWG 1NCUA 1FNEA 3K1DA 4UINH 1KIUA 4LRIC 3FOLA 1PYWA 1BBJB 1NCWH 3MMEA 3PABB 4QCIB 3WDIA 5EUOF 3VXMB 4F2MB 3CVIL 1AO7B 2XY1A 4LEOB 1RZIB 3WKNA 4UUJA 4S1DD 4XAWH 3MLZL 4PB9L 4ESKA 4B53A 4AEHH 4JHAL 2P5WE 2XN9E 4LVEA 3VDAA 4HKZA 1JP5A 1T20A 3SGEI 4MZ2A 1OAQH 1NUGA 3EO1B 4ETYA 3QEUB 4KUCF 4U3XA 4YGAB 2EKJA 3OAUL 1A5FL 1I1FA 2DQCL 1QRNA 1BAFL 1NLBL 2AV7A 3AGVA 1EFXA 1TZGH 3NTCH 4X8JA 4Y4KC 2FGWH 1GH7A 2YEZB 5I1AA 5IBTL 3LPFA 3WNPA 4U7SA 3GB7A 5AG8A 1J0JA 2C4FU 3WIHA 4MVBD 2FBOJ 4BH8B 2PW1B 3TH2T 2R0ZL 3SQOH 4JHWL 5C6WH 2YMXH 2QTEA 1X5GA 3R0NA 5IHZA 4X8XA 2PYFA 3VI4E 4NBYB 4EDXB 5J11C 5D1QC 4OCMC 1NEZB 3VH8G 3CFKB 3INUH 3SDXB 2N4IA 3NCEB 4OGAD 4BSVA 5C0DB 4Y16A 2IH1B 2IADB 1LO2L 4LLUB 3TIEA 2VZ3A 4HAGA 4GXVH 3T77A 2OR9L 5IBLC 4ZFOA 4Z77B 2EYRB 2M2DA 5L6YL 4G9DB 3V0WL 2P5EB 5ALBH 3NIGF 1RUKH 4JFFA 4KVCH 5MP6H 5SWZA 3ZE2E 2R1WB 4PRIB 4HS3A 1TNMA 4PJ8A 2F5BL 4OKDA 3D0LA 1EJOL 1DBMH 1DBJL 4U1JB 3MV9E 3TBWB 5HYQA 4PG9A 3MUZ1 1MHEA 3E6HA 3GMRB 4NFDA 2CLVB 4YEEA 4PJIA 5MENB 2C3XA 3EFFA 4H88L 1NGQH 2DYPA 4NPYB 1XGYH 1H3VA 5JQHC 4WO4C 4M3JA 4X4YB 2YWYA 3PWUA 2VLJD 4CW1B 1DL7L 4E42A 5D7LB 5FB8A 2GITB 2BHZA 1U91A 4WW2C 3EBAA 1A7NL 1MCHA 1KENL 3RNQA 4OLYL 4Z7UB 4XGZA 2VDML 1DQMH 1YUHA 4JQIL 1TVBA 1TZHB 2IPTH 4D0DB 4JGJA 5F9OL 3SDAA 2X7LA 1FZOB 4ZSOA 3LEYH 3ARDB 3MLSL 1CBVH 1I7TB 4XHJD 2OTWA 3VFPA 4PJAF 3BESR 2ARJA 2D31A 2YPLB 4JFZH 2OMNA 5E5UB 4Z0XB 3T8XB 2BVOA 1KJVB 4AT6B 2DQIH 4MJ6B 5CJBA 5KANI 3MRQB 2A6JB 4FQ2L 3ZE0F 4PLKC 1K8DA 3SKOA 4OV5A 4RQQB 1RZ7L 1WBXA 4BZ2H 3RWFB 3RWJB 3TN0B 3K8KA 5GGUA 3VG0L 5DYOB 3G6DH 4YK4C 4P46D 2DAVA 3MGOA 5DRWA 4YDLB 2VZUA 1FNSL 4HFWA 4ZOEA 1UWXH 5EU4B 1A9BA 4NO0B 1ZLWH 3RIFF 2Q20A 1QBAA 1JWSA 1KBGL 1N59B 1BFTA 2BSSB 4YXKH 1H0DB 2LTQB 4PJ5E 3VFSA 2Z31D 3O11A 3SDYL 4JPIA 5DTFB 2ZJSH 4ETQB 4WV1B 1FFOB 3QSKB 1WZLA 5FYLD 4UTAH 1HXYB 2R1XA 3DMMA 1VGKA 4DGVH 1OAXL 4ORGA 2H2SD 2BXYA 4WVRA 3VWJD 3PDGA 3X3GH 4DUVA 5GGQL 3U36B 4E5XA 2P48B 3MXVH 1G7JA 2MQ0A 1S7WB 4GQ9L 3RWHB 4BZYA 5I76B 4U1HA 1Q94A 1CQKA 3HPLB 4K3DL 4F7EA 4OB5L 1LEKA 1Q72H 5HGAB 1EIBA 5DF0A 1U92A 2VC2H 4NFBA 1TVHA 2FHBA 5IB2A 4HK3J 1KEML 4MJIA 1JPSH 4OSUH 3DJ9A 4HLJA 5EFIA 2DKMA 5IB5B 5HD8C 1HEZA 4OIBA 4RMQA 2Z4QB 1EGJL 4HIIA 1FC2D 4XT1C 4Z7VA 1N0LA 5JXEC 5HGHA 5T33H 1OB1A 4C83A 1NCTA 3VI4F 1D9KA 3S7GA 1QBLL 4IHOB 1CFQB 3KPSA 3LAFA 3P2TA 1JMZA 2DD8L 5IMLA 3RNKA 3RVXC 1X9QA 2A2QT 2VUYA 3OXRA 1IGTA 3ZKND 4BSWB 3BKYL 1ED3A 4H26B 3RI5K 5FUZL 4IMLA 1NSNL 4QTHA 2O5ZH 3HB3D 4QHMA 3ZE2F 5I1JH 5DJZB 3C2AL 5HPOA 4NHCL 4NUGH 3DV4A 5ISZE 1TDQA 3V4UL 3ULUE 4XNQB 5DEFB 2IQAB 4YO0B 3TO2A 3SKJL 3O2DL 2PO6C 5E1HB 1F45A 5DEGA 5C09E 1G7QB 4LARH 4NZDA 3HHRB 1M7DA 3NA4A 4J4PC 3QISA 1IMHC 5H35A 5INDB 1OP5H 4PIRF 3IGAB 2V9RA 3A67L 3AM8C 1ITCA 1NCNA 3V79C 1DUYB 1TQCB 3QWRD 3D6GA 1RIVH 3STBA 5IESL 5IB1A 4ELMA 5JIPA 3L3DA 4DKFL 1RK0A 3RJQB 1T04A 3NAAH 3QNXB 5IWLA 4ODXA 4MAUL 2ADGB 3BFOA 2H8PB 3QIBA 3U0TB 4NZRL 4PY7B 4PB0H 1CXKA 5C1MB 3MBED 4PR5A 5GXBB 4QRPE 2G5BA 3ARBD 1KACB 3LD8C 5IVNA 4H8WH 3W5NA 3KPTA 4WHTB 5EZLB 4ZODA 5CCKL 4A6YA 3RGVC 3O2VL 4X6DE 2ENSA 3HNSL 5J6HB 3S6CA 2B1AL 4YIQB 5F96L 3TFKD 1R5WB 5BS0D 3W0WA 1FGVL 5I71B 1T21B 4M6MH 4W68A 5F1IA 1JZ7A 5DHYA 5T1KA 4LFHD 4O9HL 3RPKA 3UJTH 1XR8B 3VD4A 1T5WB 2DQFA 4UQ3B 1JZ4A 3UTTA 5F7KC 2Q7YB 1OAYL 1FL3B 4Y4HC 5FYJL 5JW4N 4K7FA 5F1OB 3Q1SH 3RX8A 3MBXL 4LF3A 1AXSA 2APXA 1R3IL 1HHIA 4EN3A 4ONFH 1ERNA 1I1RA 5EIIB 4N8VA 4YXLL 4LSUL 4EVNA 3GSOA 1UYWL 4F7MB 1EEQA 5SWSA 2FIRT 3ZYJA 5CJ8A 1A2YB 1T1WA 2H1PH 1VPOH 3SDDC 4KDVA 3QDMA 1MCNA 2AK1H 4ZPTB 1IGIH 3U4EB 3C9NB 3IETA 3OKNA 3FO9A 4XRCA 4XCYA 1QR1A 2EDEA 3CIQA 4JY5H 3VD7A 4XTRD 4Q6YA 5CZVH 2FATL 2KZ1B 1KPRB 3D0VB 3FRUB 4JFDE 1Z3GL 5TDNB 1QSFB 4KTYA 3ZDZE 4Y4KB 4Q97A 2OK0L 5J4MA 1YMMA 1HINL 3DHMA 4J12A 1IFHH 2UVEA 4WUUD 2E27H 4MVBC 4WU5B 2XPGA 5KS9A 5ILTL 2NPLX 2LAGB 3JTTB 1RZKH 4JN1H 1ZT7A 4Y5VB 2VQUA 1IGCL 2X1PA 3BIKB 3MPCA 1PEWA 4MB4A 5M94B 4MCZA 2NW2A 4OF0A 5CGMA 1CVSC 5J11B 3MODL 5LG1A 2R2HA 1VGEL 5D1QB 5DMIL 5E8NA 4HMDA 4KGJA 4QRQB 2XTJD 3MV7D 1JJUA 3MLYH 4LLVB 2CH8A 4BSJA 4D9QD 2WNGA 1T1XA 5HHVL 4P2QE 5GS2H 3ULUF 1U8MA 4HWNA 5A16B 1YY8A 1ZANH 2EEBA 1SVCP 3I75B 4M43H 4G3YH 4WFHE 3TCLA 3MJ9H 4LCYA 1N6VA 2Y5TB 3ULSB 1J9CT 4DQOH 1EH9A 2MTPA 1WFTA 2DLEA 5E2WL 1JPTL 3T0EB 1CVRA 3BIAX 5E6IA 4OFPA 4XCEA 2OQJA 4P23B 4KJYA 4FQLL 4JFEE 2BNRA 3V9FA 3UYRL 4WTWA 4L3EE 4J2XA 5CEZD 4G9FD 5DZLA 5GRVK 3EUUA 2HH0L 2P4AB 4MB3A 2X4UA 3MRLA 3LQMA 1MJ7L 2FWOA 3CVIH 1ZHLA 1E4XI 2OJZL 3OAZH 4RNRB 4WO4B 3O3BB 4KC3B 5CKAA 1F4WL 2V5YA 4Z0BH 3O4OB 3MLZH 4PB9H 2IBZY 4GMSH 1N5AB 2B20A 5D1XC 4JHAH 3BP5A 1D6EA 3EOBA 1F6LL 3MLWL 4X6DF 1RK1A 5D6DA 4OZHB 3C60D 1KJ3L 1HSAB 1NC2A 4HLZH 4TTGA 5FDWA 4IOFC 4M61A 3OAUH 1A5FH 2DQCH 4ZOBA 2ZP0T 1DZBA 1BAFH 1NLBH 3K46A 5AZEL 1YNLH 4FABL 2C3GA 5IBTH 3EDFA 1V7NL 1DP0A 1IARB 3CU1A 1XF4B 3EDDA 1U58B 3CXHK 3CUPB 4DCQB 4ZFFB 1MHHA 5T1DL 1XF3A 4YK4B 3TIDA 4Y0GA 3WHE0 1VKXA 2RB8A 3CVHL 3HR6A 2R2EA 2DTML 3QDGB 2R0ZH 4N9GB 4JHWH 5I1KL 3BP6B 5JPNB 2Z31C 3RVUC 5KSAC 4QGYA 1RHHA 1G6RL 1H5BA 1P5VA 5IG7A 4FXKA 2XQBL 2H2SC 3K8LA 1LO2H 3GMOA 5EO1A 1Z9MA 3S4SA 1P4LA 1NCDL 2XFXB 3FOMB 1MY7A 2ZSWA 3O8XC 4JY6B 3DURA 4Q0XL 5EC1A 2P5ED 2A73A 4AIZA 2VB5A 2VLMD 3V0WH 1MNUL 3AS2A 3Q3GB 2UZYB 3FL7A 4PG2C 2SEBA 5FM5O 1AE6L 4U1NB 5IB4A 1HN1A 5EA0L 5FO9B 2ICWB 3ZDZF 4R3SB 3DXAA 3MNWA 4H1LG 4D2NA 2F5BH 4F8QA 1VADB 3V2AR 4W6WB 5DS8B 1SM3L 1EJOH 2XKNB 5DFVC 2GT9A 4M8QA 1DBJH 3BSZL 3QUXC 1XZ0B 3QFJE 1M71B 4GW1B 4X6FB 5CJQL 4XH2B 3PP4L 3LKRB 1YQVL 5D2NE 2W0FA 2L0DA 4PJBB 4H88H 3FB5B 2NX5A 5C07D 2QQQA 3EOYG 3UTSA 1DL7H 3BUYB 4WHCA 5EBLA 1N6QL 1AY1L 4FTVA 3D69B 4M7JL 1A7NH 2X9XA 1KENH 3CH1B 3U30C 4YDJA 4OLYH 5GS3A 3ULVC 2VDMH 4JQIH 3UZEA 4LKXB 4ZYKB 4K7PL 5F9OH 4CN6A 5DJ8B 1KB5A 1CE6B 4U7KA 3MLSH 2GJJA 3QIWC 1R3KA 4M9OA 1CN4A 2UYLA 1VFUA 1AC0A 3PP3H 5EU6B 1C5DB 3RA7L 2GTZA 3GMLA 4JM2C 3RVWC 4FQ2H 3IDXL 4LU5L 3QZWG 1ZWIA 3O3EB 3QUMB 1S7SA 1RZ7H 3QUZA 3TN0D 4PJ7B 3WFZA 3B9KA 5I1IL 1C08B 4PJHE 3VG0H 5FYLL 5L88L 2CRYA 1NFKA 4P57B 2PO6B 3KXFA 1IAMA 4JM4L 4UDUB 4WFEE 1NMBL 1JHLL 1I8LA 1KBGH 3IJYA 3GSXA 5JDSA 5AUMA 3SDYH 4NQXB 4WU7A 2VAAA 4J7RA 1M05A 2I07B 1P7KB 1OAXH 3VRJA 4UIKL 3R1GH 5GGQH 3MBEC 3C6LC 1FG2A 3KPMB 3WDHA 1HOCB 2EDQA 2GCYB 4RSVA 4GQ9H 4MB5A 4QXWA 2M8XA 3WJJA 1YEKH 1J05B 2PW2A 3P9MA 1IEAA 4HMEA 5DQ9A 4K3DH 3LD8B 1ZA3B 3GFUA 2E7CA 4OB5H 4JRXD 3I3EA 3RGVB 3OGCB 3FQTA 1LHZA 2J5LC 1G0DA 1F3JB 5B38G 3GI8L 3JTSB 1KEMH 2HT2D 1OVZA 1HYSC 2OSLB 3PQYA 3EO0A 4IRSB 4NDMA 5JQ6L 1EGJH 3G6JA 3RWGA 1MFBH 1ORQA 5J0BA 1XIWA 2JLLA 3PXJA 3VXUD 1KT2B 1F3DH 1QBLH 2OTUA 3WKMH 1IRAY 3H0TB 1U8IA 4F37K 2DD8H 4F9PA 3CSYB 5IT2L 4Y4HB 2LE9A 3BPCB 43CAB 1PG7L 3CSPA 3BKYH 4Y5YB 3VXTA 1I8IA 5FUZH 1MI5B 1YN7B 4PJXA 1NSNH 1HILB 4P5MA 4XNZC 2NXYD 4ZO8A 4HULB 1U2CA 2ATKA 1A0QL 3RTQB 4L9DA 3C2AH 2QHRH 1TJIL 2JCCF 3G9AB 4NHCH 2JJSC 3FO1A 4Y19E 4H0GA 5C8JA 3BDBA 2AK4A 4OFVA 4G8GA 1A1NA 3V4UH 4MQXC 4OZIE 3O2DH 4OCSL 4RGNB 4BQBA 5HXMA 2EDTA 1Z5LA 2WBJC 4G43B 3GMNA 3BH8A 2UUDH 2AJXL 2C1OA 5T3XE 5JW4Q 1K4CB 1T83A 4Q9CA 2XWJB 4LCUA 2ZPKL 3A67H 3M17B 3F7VB 3EYFB 3QXDA 1T4KB 1G0YR 4MWFA 4HKJA 4X99A 5IESH 2VDRL 4DKFH 4DGYL 4OUOA 1ZHKA 4G6AD 1I4FB 4X5LA 4MAUH 2FO4A 4JKKA 3PWPA 4NZRH 4MNHA 3IFOA 3VDCA 1DN0A 4HPYL 4QOKE 4OBSA 3WN5A 4ZAKA 5CCKH 4AY0A 2A6KB 1Z0NA 4I13B 4XVUD 4LPCA 3QEQE 4NZUL 3PDOA 4PJHF 5F96H 4DN4H 3VFWB 3SGKC 1G6RB 3GHEL 1FGVH 3WUZA 1DVFC 2YC1A 5HHXL 3DVNA 1CGTA 1J1PL 3UTZA 1DQQB 4AG4H 4O9HH 2DL2A 3O3AA 5C0EB 4K94C 1FFQA 3L6FA 3NIDE 2FHCA 1OAYH 2DDQL 5FYJH 2IG2L 2QLVB 1S3KH 3MBXH 5IUSA 2QQNL 4OTXL 1R3IH 5HHOB 5FYJU 5J13C 3FQRA 3Q6FB 3AAZB 2ESVE 4YXLH 3CLEL 4MJ5B 3QCUL 4HIEB 5ADPL 1UYWH 4HJ0C 4NQDD 5JTWA 1O0VA 5LGHL 3E1F1 1T03L 3MO1B 2Z8RA 5C0GB 3C60C 1TITA 1KTRL 1UB5A 4DOHB 1NBZB 3HZMB 1LK2A 2E7HA 4EDWL 5ICZB 2FJHA 2VDKL 5E4IA 4GW5B 3WNKA 1A6TA 3CZFA 4NRYB 2FATH 3C5ZB 1CDBA 3MRHA 1MLCA 5IROC 3T1WA 2X4QA 1Z3GH 2OK0H 1I3RB 1U93B 4OZFB 5F9JB 3U2SA 1JZ6A 1HINH 3NFNB 2WK2A 4FQQB 5ICXB 3VGEA 3HZYB 2HTLD 5FK9A 1JFQL 2Y4SA 5ILTH 3VW3L 3HKFA 3MGTB 3TNNA 2V7NA 5DJAB 2ARJQ 1N26A 1JZ2A 5K93A 1IGCH 1ZSDA 3WFDL 1EAPA 3QEHA 2VQ1A 2AGJL 4YE4L 5KSAB 2CUHA 4Q2ZA 1XMWA 3MODH 3AREA 1CICA 1ZA6A 1VGEH 2X4PB 5DMIH 1C7TA 2Q8BL 5IGXL 5IMKB 4NQEE 2F53D 5D7JC 4E0RB 1FNGB 3QIUA 5CJOL 4K94L 5FHBL 5HHVH 1SJHA 5CEZL 1JGUL 2W92A 2BNQE 2ICES 3OXSB 4N0RA 4OZIF 3TBSB 4N0YL 5CSZB 4S2SA 5GJTH 1MIML 3T0ED 2BSTB 5GGSB 5I66A 5E2WH 1JPTH 1CGYA 2VLLA 1LNUA 3R8BB 3FQXA 3HMXL 3GRWA 4JO2H 3GSRA 1UA6L 4HWEH 3Q5TA 3ES6A 1ZLSL 3I50H 4FQLH 1CWVA 1U3ZA 3GSUA 4JY4A 2X4OB 1VESA 3UYRH 5B3JE 2MCPL 5AZ2L 4M5ZL 3HG1A 5H94A 2HH0H 1AQKL 1A4JA 3NABL 3D3VA 2OJZH 5HGBB 4PJIF 2DBJA 4J8RB 4L4VE 1F4WH 4WI6A 4TQEH 5F1KC 4L5FL 1DE4B 3HS0B 1TPXB 5IV2A 5JXAL 1DJSA 1XT5A 3U30B 2VL5A 3MLWH 1FC1A 2QSCL 2ZSVA 3D85D 4F3FB 3BZEB 5J89A 1KJ3H 1NJ9A 2FJFB 1MY5A 1YC7A 5F72S 3QIWB 5EN2A 3GSQB 3T0DA 1NFDA 4YGVA 1YY9C 2WWMC 4K7PX 5AZEH 1IZJA 2P8PA 4FABH 3T65B 1CU4L 1V7NH 5DI8B 2DLHA 2R56L 2YD7A 3VFTB 2P7TA 4HUNB 3U46B 4BA8A 3LEVL 4R96B 4X4ME 3I02A 5T1DH 4YFDB 4EBQL 5LCVL 1ZT4A 5TH2A 3ARGA 4Y4FD 1M6OA 3CVHH 4U1KB 2DTMH 3SGDH 1W8NA 1A6PA 5A2IH 5I1KH 4YHYC 5BVJB 5GGSY 3V6ZA 3AMLA 5F9WC 5D7IB 4JPWL 3H7LA 5D71L 1G6RH 2EDHA 4FQPA 1W72A 3WHXA 1KUMA 2XQBH 1IEBB 3IT8D 5J57B 5B21A 4XWGL 1JPFB 2O5XL 1NCDH 2E9WA 3FQWA 1HH6B 5GRUL 3MUJA 3DTXA 1KN4L 1UQSA 4Q0XH 1P7QD 1T66D 1J10A 1MNUH 3QDAA 5FYKD 5F3HB 3C6LB 3U6RB 1JN6B 2PXYA 1AE6H 4HIHB 3GSWA 4OLWL 4ZUVB 1L4IA 1EEYB 1TCMA 1BFVL 2Z92A 5EA0H 5K9OB 4V1DB 2EDBA 4YDKL 2BY3A 4OGZA 2HKHL 1QHOA 2UWEB 3BSZH 4PGCB 1Y18A 3WBDA 3OKLB 2J5LB 5I8EA 1MAML 1AGBA 5CJQH 3PP4H 1TCRB 4K23L 1YQVH 4UI2A 3S8WA 3MJ7A 2H2PD 4JHZA 4KI5C 1AP2A 2YBRB 2KH2B 4JAMA 4OUUB 1N6QH 3BKCL 1AY1H 2Q87A 1T3FB 5D7KE 4M7JH 3IDYC 1BX2B 3L5IA 4D94A 5E24E 4OZFH 4NNYA 3WFHB 3BPLC 5D1ZA 1UG9A 4P2RE 4J1UA 2L7JA 2D3VA 3BT2L 4HCRH 2EO9A 4K7PH 2NXYC 4R26L 3VFOA 3CDGB 4P59L 1HI6B 4MMXC 5FOBA 1PG7X 3L3IB 4XNZB 3RA7H 1IQDA 2I9LA 2H6PB 2EE6A 1EEZB 3IDXH 4N8PA 4LU5H 1YDPB 2FEDC 1UEYA 3TPUA 4LQFL 3HI1A 4JG0L 4OM0L 1HKLL 3QXAA 5I1IH 1MFCH 2APTA 5MEOB 2YD3A 3H9SE 3KPPA 1Q9KA 5L88H 3FRPG 2IANE 1QLRB 4YC2C 1WAAA 5F93C 4JM4H 1NGYA 1NGXA 1NMBH 1JHLH 2VXUL 1FLTX 1UB6A 4P2OD 3FO2B 3FO0L 5DSCB 2XNAA 2MWCA 1S8DB 3PF2A 3GSNB 1KCRL 2GAZA 5FCUL 4PGBA 4RBPH 2JIXA 5FUCE 4UIKH 1S5HB 2X4SA 1ZAGA 1D7FA 4ZUWA 3S5LG 3O3UN 4Y1AA 5EIQA 1BF2A 5KAQG 5B8CB 1MRFL 1URLA 5IW3A 2ICWJ 3LKNA 3QQ3B 3HE6A 1PQZB 2OR7A 1YEEL 1UT9A 3EDJA 1PW3A 4HX1A 5LVEA 1Q9OB 3GI8H 1UXSA 4N0CD 2ICEB 3EYSL 4JJ5A 4IRSD 3ULVH 1OGAB 2E9JA 4U6TA 5JQ6H 1DVFB 3TBTA 5DZOA 5E2TL 5SV4A 3NN8A 3TO4C 2Y07L 2CKBA 2IFGA 5F9DC 4H1LA 2VLRA 2NLJA 5JIKA 4HLZG 3FFCA 1KB9J 5IT2H 5IJVB 4B7LA 3LN4A 5CBEA 1B6UA 1PG7H 3OJDB 4LCWE 1EVTC 4ELKB 5J13B 4MGXA 4X5XA 1BGXL 1KLFA 5DJXA 3RTQD 2GYSA 1A0QH 2AVGA 4I1NB 3LQZB 2WP3T 3RDTD 1TJIH 2HFGH 5TGBB 4ZXBA 5TF1L 5EORL 1JF5A 4NYLA 4CADA 4G6JL 4OCWL 4RGND 4QHLB 3M07A 2DLGA 4RIRB 4KDTC 3MR9B 2AJXH 4LLWA 4JHBA 1VA9A 1CD1A 5J56B 1R3LB 4FQ1L 2ZPKH 4ERSL 2QQLL 4D9RE 2NY6D 4APQA 1A7BA 3QZWA 1BQHG 4C4KO 3L3HB 3MRNA 1BP3B 2VAJA 2VDRH 4DGYH 4M6NL 2WIIA 1JWUA 5J9PA 3DO7B 3GSVA 4PRHA 1JUFB 5C08E 1UWGL 3HAEB 1OGTA 3IXAB 2F54D 2GSGB 4NO3A 4HPYH 4CBPA 4TOYL 2BVPB 1CFNB 1EUUA 5DURD 1C16A 3H6JA 1D5BB 4NZUH 3FAWA 2F15A 1RZ8B 5F6IC 5ANMB 1SYVB 3GHEH 1WCBA 1KIRB 3SDAC 4L3CB 4PYGA 4JQXA 4QKXB 5HHXH 3P0VL 1J1PH 5TFSL 3BQUA 3KYNB 4NKMA 1IAIM 2NQCA 2COQA 2HRLA 3DSFL 3VFGL 1JGVL 1HSBA 4BFIA 2MKLC 1A6AA 5BJTA 2DDQH 4AJ0A 2IG2H 2P24A 2IPUK 1MJ8L 5BRZB 2DTSA 3OX8A 3DRQA 3DROB 5B38A 5J1SC 5HHOD 2QQNH 4OTXH 1QFWM 2QQKL 1A6WL 3CLEH 5KTEL 4YQXL 5ADPH 4TYUA 5LGHH 1T03H 1S7XA 3U9UA 4FFWD 1PLGL 4GG8B 5TDOA 1L0YA 3OR7A 4EDWH 1J8HA 3DX7A 2VDKH 1KTLB 2H41A 5C0CA 3ECBB 4YX2H 3D25A 4PRPA 1U8OA 1AKJA 3C5ZD 1FZMA 5EUKB 2DMCA 2G5RA 2NY0D 2Z93B 4G7YL 5T1LA 1UZ6F 4FQXA 3HTLX 1IKNC 1RMFL 1A1MB 3JV6A 1GGTA 1U3YA 1JFQH 3VW3H 3HE7D 3AC0A 2A6IB 2GHWB 2A6DB 4RMRA 5E9DD 3WFDH 2V7HB 2HLAA 2AGJH 3CDFA 5CBAB 4YE4H 4NUJA 1AFVL 2JB6A 3SBWA 5F9WB 1OSZA 1RZGA 4D0CB 4WUKL 1RU9L 4CMMB 2Q8BH 1CXIA 5IGXH 3O9WA 1D9KC 1D5MB 3IKKA 2V2TA 2AEQL 1NCCL 1TETL 4U6YA 5B39A 1C12A 4K94H 2NCMA 5CJOH 2C3WA 4Q9RL 3PIQB 5FHBH 1MH5B 5CEZH 1JGUH 1ZT1B 1SEBB 1G1YA 4MQ7B 3R0MA 3N0PB 4N0YH 2FIKA 2J6EL 4NQCB 4Z7WB 4MD4B 4FFVC 2AJZA 3BPOC 4AENA 2QSQA 1MIMH 4NQVA 5J1TC 5DGQA 3C8HA 5ICYB 1CDCA 3HMXH 4NC0B 2BK8A 3OZ9L 4GKSA 1A1OA 1UA6H 2X42A 1UJ3B 1ZGLB 1ZLSH 3BP7B 1LEGB 1DEDA 4LAJH 4MAYB 5DJCB 1HHHB 5MERB 3LN9A 4G5ZL 3BKJL 4XCNB 3V52L 5GGVY 2VWEE 5AZ2H 4YDVB 4HEPG 1AQKH 3VWKA 5I1DB 3NABH 3O4LD 4W6YB 4XXDB 3F12A 1CZ8L 3MRRA 5CZKA 4KGLA 2P42B 5BVPL 1IGJB 1R5IB 3T09A 1AHWB 4YHML 5CILL 1AI1L 2HAZA 3QNYA 3LSOB 5JXAH 1BOYA 3GGWA 4U6XA 5D2LB 4CJ1A 1CLZL 2BDNL 3QDJE 2HT4D 1EXUA 2WUCL 3ARYA 3PHSA 1Y6KR 1HHGB 2CXGA 3O0RL 5IWLC 4ZQKB 1RZJC 3REWA 5HYJD 3QA3B 3D2UB 3MV8E 4OAWA 1BJ1H 3EGSA 3RAJL 3K4DA 1CU4H 3V8CA 4MA3A 2R56H 2BY0A 1RJYA 4X9IA 3LEVH 2UV3A 2X2YA 3HAEH 4AH2B 2D7PA 4LEXL 2FHFA 5LCVH 3O41A 4U05A 4ODUB 3OR6A 5ITFB 3MFFB 2CKNA 4HIJA 4P2OC 4YC2B 3VFUA 5AD0B 4OF6A 4BFEA 4JPWH 4PJ5D 5D71H 3GJEA 4C56B 3RX7A 4E41D 4XWGH 1WUNT 3RWCA 3B9AA 1R3JB 2O5XH 5GRUH 3W39B 1KN4H 3QQ9C 5F1NA 4G7VL 3H2WA 2IGFL 4W81A 3FOLB 1PYWB 3MMEB 4OLWH 5MHSE 1BFVH 3VXMA 4F2MA 4YDIH 1KN2L 4V1DD 1AO7A 4G8FA 4YDKH 1RZIA 4UUJB 2HKHH 4P5TA 5KSVB 3OB0H 2ZZUT 4EEEA 1MAMH 2GK0B 4K23H 3VXSB 3ESVF 4HKZB 1T20B 3T3PE 3HLAA 3QP3A 3EO1A 5EULV 5IW6A 1I1FB 4PP1D 1QRNB 2AV7B 1EFXB 4X8JB 5E2VL 1PVHA 3BKCH 3FB6A 5KSBB 2XI9A 1FJ1B 4HG4J 3JUYA 5I1AB 4XAKD 4PBXA 1RZJL 3ZHKA 3MROA 3GB7B 3L5XL 1RVFL 2VZTA 2EEAA 5DHXB 1U8NA 3BT2H 4FA8A 3PWLA 3ISWA 4R26H 1PD6A 4BH8A 2XT1B 4ZNEA 4P59H 2J4WL 3QUKA 3DGGA 3DIFA 5CGTA 1E0OB 3H3KA 5D96B 4XP9L 2ZG2A 2X89D 1I1AA 2AKRA 2PYFB 2EE9A 2VE6A 5CD3A 2BRRL 4QF1B 4LQFH 4NRXB 3NMEA 4JG0H 4OM0H 1HKLH 4OGYL 3SCMC 1UH3A 1NAML 3DBXA 5C0DA 4Y16B 3SDXA 3ULUD 4OIAA 3TIEB 2C5DC 3WS3B 3T77B 5C09D 4YNYB 3UTPE 4ZFOB 4Z77A 2VXUH 3U83A 4JFFB 5F7MC 4BZ1L 5ESQB 3FO0H 5SWZB 2V9QA 1QZ1A 2AS5M 2NY3C 1MHCB 4HS3B 5F9AC 1KCRH 3TCXA 3K4AA 4QRRB 3D0LB 2Y25A 5FCUH 1MCRA 3VCLA 4LDOB 4Z8FL 3TZVA 3UYOD 1DR9A 3WV0A 4PG9B 3TBWA 1MHEB 4F37F 4OZGA 2RQ8A 3EFFB 2YD8A 4KRPC 5MENA 3NA9L 3UJJL 4QRPD 1FIGL 1MRFH 2DYPB 1ND0A 2Y6SD 2R0KL 3IF1B 3PWUB 4E42B 5FB8B 1YEEH 1U91B 5D7LA 2GITA 4QWWD 1LP9A 2NTFB 4KZDL 3RNQB 5KZCB 1YUHB 4Z7UA 1TVBB 3EYSH 2WQ8A 3SDAB 2X7LB 4ZSOB 4U1GB 3CD4A 2OTWB 3ARDA 3VFPB 4XB8A 3T3ME 5E2TH 4F7PA 3CFDB 4LDEB 1WFOA 2D31B 3UDWA 1JZ5A 1CLCA 2Y07H 2VERN 2WSKA 3SPVA 1Q0YL 1BVLA 1QVOA 3RWEB 2ZUUA 4D9LL 3ZKXC 1K8DB 3LKSA 4OV5B 5GGUB 4WW1B 2CD0A 5DYOA 4TUJA 3ZTNL 3MGOB 3BAEL 5DRWB 4CVUA 3MLTB 3AB0B 1B3JA 4XPHL 3V7AE 1A9BB 1BGXH 5EU4A 1P84J 1JWSB 5I6XC 1S9XA 3VFSB 1MCCA 3WIFB 2GW5A 4JRYA 3O11B 3QG6B 5TF1H 4JPIB 5EORH 5DTFA 5IVXA 1FFOA 3IKCA 4G6JH 2R1XB 2ARWA 4OCWH 1VGKB 4MQSB 4ZFGL 4ORGB 1TZIA 1FZJA 3T3PF 3V0VA 1F97A 4F58L 4MHHG 1G7JB 1S7WA 5DJ6A 3HE7C 4FQ1H 3RP1A 4ERSH 3GK8H 4U1HB 5CSGA 1Q94B 2QQLH 5I76A 4F7EB 1FYTE 4HDIB 2KL6A 3SKUD 2FX7L 2EO1A 1UKQA 1K3ZA 1WICA 5C0BB 5B4MD 1HQ4B 1LO5A 4M02A 3FFDA 4M6NH 4WHDA 3RWIA 3FRPA 4FZ8L 5EFIB 1BD2E 1OPGL 1RZFL 5IHLB 5IB5A 4JZJA 5IMOA 1UWGH 3BKML 3MRGB 4NFCA 4Z7VB 4GAYA 1ADQL 4YXHH 5L8JB 1ORSA 2Y23A 4YBLB 4C83B 5E7FA 4WWKD 2LFGA 1Z6JT 1D9KB 4TOYH 3G5XA 3T2NL 3H9YA 2AXGA 5GRXG 3TWCL 1JK8B 4KKCD 2KQMA 3KPSB 1H15A 4N5ED 4P2QD 4AIXA 1CGUA 5IMLB 1GGCL 4WEUD 3OXRB 3MJ9A 1IGTB 4XBGB 2IEPA 3WNLA 3WNMA 1CFSB 2FSEA 3P0VH 4BSWA 1ED3B 5TFSH 3BPOB 3QO0A 4H26A 4RFNB 4IMKC 3S5LA 4IMLB 4OZFG 3DSFH 4QHMB 4DAGL 3VFGH 4LP5A 3O3DA 1PZ5B 3IDNB 4L3ED 1J18A 2XQYG 4ZS7L 5CJXA 1IC7L 3OJ2C 5C6TL 1XGPB 1T0PB 1MJ8H 3RUGB 2E8ZA 1QFWL 2MQ3A 2QQKH 5DEFA 1T5XB 1A6WH 2IQAA 3RHWF 3L5WB 4YO0A 1TTGA 4NM4L 5DEGB 5KTEH 1LEIA 4POZD 4YQXH 4JDTL 1G7QA 1U9KA 5JMRA 3MRKB 3D18B 5H35B 15C8L 2HT4C 4KWUA 3UJIL 3ZT6A 3UEZA 5K9KB 1UXWA 4LLQA 5IB1B 4ELMB 4YHLL 5T3ZD 1RK0B 1T04B 4G7YH 4ODXB 3RVVD 4AL8L 4RX4D 1K5NA 1U8JA 1RMFH 2H8PA 1Q38A 1ES0B 2GJ6E 1T0NB 2G5BB 1J1OL 1QSEA 2VLJE 3AU1A 3A6CL 4EOWL 3Q5OA 1UVQA 1PG7W 1AFVH 2OXHA 1HQRA 3U4AA 3P0YL 3OWEA 1ZEAL 1T2XA 4M00A 5DHYB 5T1KB 1VDGA 1RU9H 1GGYA 4JKMA 4KKBD 2FECI 1XR8A 2AEQH 1NCCH 1TETH 2DQFB 3RKDC 3RX5A 3UTTB 4PJCE 4HS8L 4NCDA 1BQHA 1NMCC 4Q9RH 2Q7YA 1SYSB 3PP3K 1DSFL 4K7FB 4LRIA 1QBML 5LBSL 3SE4C 4LF3B 3DETC 3HA0A 3LKOA 2R15A 5JIHA 4EN3B 4GOSA 1YPZA 1EHLL 3IVKB 4N8VB 4UZGA 5CGYD 1A3RL 4JN2A 3JVGA 5HI5D 4EVNB 3OZ9H 3GSOB 3VU2A 5SWSB 4F7MA 1T1WB 4KK6C 2VDQH 4G5ZH 1DBAL 3BKJH 3MRIA 2RCSL 1YEGL 3V52H 3EYVA 4BQ8A 3IETB 1GAFL 5H2BA 3OKNB 4PP1C 5JHDE 3LVEA 4XRCB 4XCYB 2YPVL 3O6KL 1CZ8H 1QR1B 2VDPH 1F4YH 3DX9A 2XRAL 2UZXB 1KPRA 3D0VA 3U4BL 5TDNA 2ZUWA 1QSFA 4OFYA 4YHMH 4Y4KA 5CILH 1YMMB 1AI1H 1ACZA 1T2QL 2XPGB 3E2HC 1CLZH 5KS9B 3SJVA 1J0KA 2H9GA 3RL2B 1ZT7B 2WUCH 4WTZG 3ESUF 3FZUC 3O0RH 4JKLA 3BIKA 3VG9B 4MCZB 3EZJB 2GTWA 2NW2B 4K55A 3RAJH 2WW8A 5D1QA 2CDEA 1MEXL 5HI4C 1MQ8A 4GRLC 4JFHD 1I9EA 4QRQA 1A8JH 4LLVA 1D5ZA 1F13A 1T1XB 5I1CL 2B1HH 1G1CA 1U8MB 1YY8B 5A16A 4JVPA 3I75A 4C56D 3PXHA 4V2BA 1JGEA 4PBWD 2Y5TA 1JWMA 1WAAF 1J12A 3HCVA 4X80L 2NY3B 1JGDA 1JYVA 1AD9B 5E6IB 4PJFA 2VTFA 4PJGB 2OQJB 6FABH 3BX7C 3QPQC 1A9EA 2BNRB 3GI9L 4G7VH 3CLFL 2IGFH 4KRPB 2X4UB 1AR2A 3ARFA 2FWOB 4F7CB 1KN2H 4WO4A 3O3BA 1ZGLP 3CFEA 4WW2A 1I9RL 4Q58C 1JNHB 2Z0BA 2O5YL 1N5AA 2E9IA 5DMKA 4PTTA 2LVEA 3EOBB 5CHNA 4TTDD 3BEVA 1RK1B 1EGJA 1JPGA 4KHTL 1NC2B 3O6FC 4RAUA 1HSAA 5FDWB 1CGSL 4M61B 1FCCA 1QRND 3UPRB 5E2VH 3LY6A 4NP4L 1RZJH 3CCHB 5KOMC 1LE5A 2MPAL 3BD3A 3KPNB 3L5XH 3ZKXB 1RVFH 5HBBA 3VGDA 5FGCB 3ULUL 1U58A 3FN0L 1XF3B 3PE9A 4DCQA 3BPNC 5ENWA 4UNTA 4L4TA 1JZ3A 2J4WH 2R2EB 4GG6E 3QDGA 4XP9H 3IAPA 1F8TL 4N9GA 2P5WB 4I0KA 2VLKA 4PLJC 3BP6A 5E94B 2PYEE 4EI5C 4F9LC 4QXGL 8CGTA 3VXRA 5TF0A 1H5BB 2BRRH 5IG7B 5C0IA 4OGYH 1KB9K 1NAMH 2X5PA 3GMOB 4WIQA 3LMJL 1H3TA 1WV7T 3O2DA 2Z91A 3MA9L 5GZNC 4OQ1A 4LP4A 2WM0A 3DURB 3MX0A 5EC1B 2A73B 4DEPC 5DK0B 5EG6C 2SEBB 4BZ1H 5TPWL 5IB4B 4U1NA 1IILE 3GJFB 4PJ8D 1ZXQA 3DXAB 3MNWB 2FZ3A 1NEUA 1HKFA 5B4MC 1Q9LA 4WDIA 2GT9B 4M8QB 4TVPD 2KKQA 4Z8FH 4GAJL 4XC3L 4GW1A 4R4NC 4X6FA 4JDVB 4WHYH 4OD3L 4F57L 1N0XL 2N7AA 3LKRA 2W0FB 1R3HA 3NA9H 1I8MA 3B9VA 3UJJH 4X6CA 1FIGH 3MLRL 2CIIA 2NX5B 2DQTL 4DWHA 2AV1B 3K1KC 5EBLB 1H8NA 3BUYA 3QEQD 4FTVB 3D69A 2FH8A 3H9HA 3FAXA 4JFOB 3CH1A 4KZDH 4YDJB 5ID1B 4MNQA 2D7TL 3IXTB 4ACPA 1GCFA 3IDIB 3C5JA 4YLQT 2QADC 2QHLA 3S9DB 5DJ8A 1CE6A 1HWHB 1P5UA 1R3KB 3WL9A 2UYLB 1P1ZB 1S7QA 3MV9B 5EU6A 1Q0YH 5E2JA 2GTZB 3GMLB 1I1YB 1PGRB 4D9LH 1MRCL 4B7IA 4G8EB 1ZWIB 4XNUL 3QUZB 3B9KB 1BQLL 1NBQA 3RU8L 4GRWB 4O00A 3ZTNH 3BAEH 1KTDB 3MV7E 3KXFB 3SOBL 4XPHH 2PO6A 3QJHB 2GFBA 3HFML 4XX1E 4D9QE 3KPRA 3HAEG 3IJYB 3KGRA 5JDSB 1SVZA 4J4PA 3ZYZA 3I9GL 4ENED 4WU7B 1C5BL 1DEEB 3AM8A 5FF6B 5J6GA 3DMMD 5D5MA 4ZFGH 3LDBC 3GRWL 3VRJB 1EBAA 4F58H 1FG2B 2IAMC 3KPMA 3I6GA 2J8UE 4ZPVA 1EFQA 1OT1A 2PW2B 1IEAB 5C0JB 1QPPA 5DQ9B 4WNQA 1XGQA 1Q8MA 3A6OA 2FX7H 3CU7A 1G0XA 2HJFB 2C3VB 4MCYB 3RGVA 4U6VL 1L9NA 4Z5RA 5IHUL 4MJID 2GQHA 1J0ZA 4FZ8H 1G9EA 3QPXL 4X9GA 4N68A 1RZFH 3S98A 3PQYB 3EO0B 4NDMB 1F2XK 9CGTA 3BKMH 3G6JB 1KOAA 3LRSA 4OF7A 2C9AA 3RWGB 4GG6F 1A7OL 1ADQH 1XIWB 4XP4L 4JCLA 4KH2A 4X83A 5E8OA 3T2NH 1I8KB 4LK4A 3ME0A 1U8IB 3TWCH 4YHKL 3MRMB 1NMCB 5E03A 5T1MB 1GGCH 2XWBA 1I7RA 3BPCA 2HYMA 4NC2B 43CAA 2CO6B 4UQ2A 3TLRA 3VXTB 1BOGA 1I8IB 2NY1D 3SO5A 4PJXB 1YN7A 1U3JA 4DAGH 1HILA 5D2NC 4PLOB 2Q8AL 4PD4J 4ZS7H 1IC7H 5C6TH 1GZQB 4EIZC 3FO1B 4GT7A 5I8CB 3SDDA 4G8GB 4KUZL 1QFWH 3GEWB 1A1NB 4PP2A 3KLDA 3U7AA 3LKPA 4NM4H 3GMNB 4JDTH 3BH8B 3IRZA 2C1OB 2O26U 1II4E 1K4CA 2P5EE 3DYOA 3F58L 4M7LT 2VLME 15C8H 4UTBL 3BMVA 4PRIE 1ZLUH 1BF8A 3QXDB 3F7VA 1IVLA 2W07A 3GJFH 5EO0A 3G5ZB 4X99B 2J88L 4J3XA 2A9ML 4YHLH 4M03A 5I74C 3U79A 2FO4B 5CS7A 3QIBD 5CJ5A 4AL8H 1ZVSA 4BFBD 4AEIL 3PWPB 4MNHB 3ILPA 1NDGA 5D9SB 1J1OH 1DN0B 4XBEL 2JTDA 4ODBD 5KOVC 3WN5B 4ZAKB 5BV7C 1E27A 3CVHA 4MX7B 4RGMB 3PL6C 1E6JL 5FECB 1FNFA 2DQUL 3QG7L 5FDYA 3PDOB 3A6CH 4EOWH 3W0WD 1G6RA 3P0YH 1FO0L 1ZEAH 2P8MB 5T1KD 4JRWA 3DVNB 3ZE1F 2EDYA 3UTZB 4HQQL 4I5BA 1V3KA 3O3AB 2YPLE 3DVGB 3NVQA 1EV2E 4HS8H 4NWUL 5IJKA 1DSFH 3L3GA 3W11C 4LHJB 4W6XB 5LBSH 1QBMH 4G6FB 4FQHB 4OV6F 1OQOA 4BK4A 5HPMB 3UBXA 1J1XL 3FQRB 1KCSL 1Z0MA 1U3HD 1EHLH 2FLRT 2I26N 3AAZA 4X4ZA 1A3RH 4M4RA 2J8UF 1OQXA 4JQVC 4N0UE 1XGRA 2QEJA 3QDMD 1UB5B 1CXEA 1DBAH 5D1XA 2RCSH 1YEGH 6CGTA 1LK2B 4PJ9D 3B4NA 5FGSA 2YXMA 5ICZA 1GAFH 3SKNB 3QHFH 4FP8L 4NOFA 4I2XE 2YPVH 3O6KH 3FTGA 4EQ3A 5AG9A 5A3IC 5IFAL 2XRAH 3MRHB 1MLCB 2X4QB 3B5GA 4P2CG 5D7KD 3U4BH 2ERJC 5LGKA 1NKRA 1I3RA 4KJWD 4OZFA 5F9JA 3X14A 4WEMB 1T2QH 4FQQA 4Y2OA 3ZKQD 3TV3L 4M62L 2EDXA 2IMNA 4P46A 4I0PC 4B41A 3DRTB 3BZFB 2V2XB 1EAPB 4MXVE 5L7XL 5BV7L 3QEHB 1HCFX 2VQ1B 2Y06L 3CC5A 2ZWLT 4X7FC 4XMPL 2CRZA 3UMTA 1QLEL 4EI5B 3ZL4L 2Z31A 4Q2ZB 5KSAA 4HG4K 2NW3A 1CICB 2AXHA 3C6SA 3SHSA 1MEXH 2HP4A 4YR6A 4JFDB 2EXWD 4EIGB 2VDNL 5I1CH 1SJHB 3O8XA 3KG5A 1GGBL 3OXSA 4MXWL 4S2SB 1DQDL 4PG2A 5IEHA 3BQUC 3MXWL 4KKNA 4X80H 3DI3B 5HYSB 5E6ID 1LNUB 3FQXB 1OF2A 1AIFB 3G9VA 3GSRB 1WFUA 3ES6B 3G5YA 4U1MB 1RURH 1WZ1H 3GSUB 3QUXA 4JY4B 3GI9H 3CLFH 1F90L 1BBDL 1QG3A 4FS0A 5H94B 2HN7A 5TQ2L 4K71B 4TUKL 3QUYD 3D3VB 4NNXB 2APFA 2UY6A 5EH1A 3NH7L 4KK8D 3DX6A 2CK0L 1G84A 1BVKA 1I9RH 1V3LA 3HS0A 3W5MA 2UZIL 2O5YH 5HI3C 5IV2B 2VL5B 4YHOL 3BDYL 4U2YA 4MD0A 2E6PA 1NC2D 1G6VK 5ADOL 2QADB 4KHTH 3WXWL 3U0WL 2VOTA 1CGSH 2XIDA 5FHAL 1UACL 2EDWA 4Z7UF 5EN2B 5GIRA 4GBXC 1NFDB 3GSQA 4YGVB 4FQXC 3PJSA 4NP4H 1IM9D 2P8PB 4RZCB 2XG5A 4JM2A 2MPAH 5CLWA 4JLRA 3VFTA 3ZYOA 3U46A 3VGHA 2AW2A 4LCWD 3ULUH 3FN0H 1DBKL 5TH2B 1ZT4B 3VI3E 3ARGB 3QXTA 3NFSL 1B9ZA 2W0PA 1M6OB 1NCBL 2XG4A 4U3HA 5T3XL 4PV8A 1F8TH 3G5VA 3SGDI 4ENEC 5BVJA 3V6ZB 4QXGH 1QTYT 1LE9B 5JDJA 1YEFL 3S34L 3O9WC 5I2IA 3WHXB 5HSFA 1OWWA 1IEBA 4MHHI 2HFTA 3MA9H 2DIJA 3FQWB 5BOZG 4OD2A 3LDBB 3REVB 2P49B 4WTZA 4PGZA 4Z18A 3X17A 1KELL 1P84K 2IAMB 3C6LA 3MBEA 1ZTXL 4Q74A 5TPWH 3U6RA 4X6EB 2V9TA 2Z92B 4DW2L 3GUTA 3JWOC 3IJHA 3QXVA 4F33B 5K9OA 2DI8A 5D70L 2OZ4L 4GAJH 2Y36L 1Y18B 4XC3H 1OP9A 1F00I 5I8EB 5BS0A 1AGBB 1U2HA 4ODTL 4OD3H 5E5MA 4F57H 1N0XH 1TCRA 1GJIA 4MXVF 4D3CL 4KTEL 1MCBA 2NX5D 3MLRH 3UTSD 1AP2B 2YBRA 5GS0C 3GMQA 3GMMB 4LPUA 1T3FA 1KCVL 5IBUB 1BX2A 3C8KA 4JEGB 3HZKB 2D7TH 5D1ZB 3J7HA 3WFHA 1NC4B 1XCQA 3OSKA 4JO3L 4A2MA 3VJ6B 3D48R 3W9EA 3VFOB 4CMHB 1A64A 1HI6A 3FT2B 3CJJA 2NY5C 3VGFA 1QFUH 4RMSA 5EOCL 2HTKD 3ILQC 1MRCH 4G8IA 3DPBA 3QUZD 1YDPA 2BC4B 2FLBT 5CP3H 4XNUH 1AXIB 2CMRH 2JJSA 3QXAB 1G7IA 1OY3B 1BQLH 1SY6L 4S0SD 5MEOA 3RU8H 1KLGA 3RFZC 3SOBH 2F53E 1QLRA 2W1NA 5F97E 3UO1L 1NGYB 3HFMH 1BWMA 2WBJA 1UB6B 2VN4A 2W38A 4WUUA 4GRMA 3IAQA 3OHXA 2XNAB 2ZUYA 1SMOA 3D39A 4HKXB 3I9GH 4O2EB 4YBQC 1VSCA 1C5BH 4K8RC 3LQAC 3T0EE 4KJPC 3JWOL 4PYHA 4U49A 1OL0A 3SDCC 4PJEA 5E00A 2DJUA 4PGBB 4EI6A 3ARWA 3TH3T 3GRWH 2KUTA 2YOCA 3IDJA 5CSBA 4EUPB 2ZCLL 1CE1L 2X4SB 4DK3A 3WLWD 4PJHB 4Y1AB 2ADFL 5IVZA 3TA3D 1I3GL 2G75A 1NUFA 3LKNB 3HE6B 3QQ3A 4TNVK 4HD9A 1PQZA 5BV7B 1AR1D 1WSST 4U6VH 5GS0L 4HX1B 5IHUH 1P69B 1YEIL 1OTTC 5F8QC 2YRPA 1UXSB 3QPXH 3VI3F 4XI5C 2LQRA 2Q86A 2ICEA 1E6OL 3SGKA 4OZHE 1FAKT 2NXZC 1XIWD 3F62A 3TBTB 1DVFA 1A7OH 4XP4H 3BP4B 4DKDC 2VISA 1JV5A 1RUAL 4H1LB 4TSBL 2NLJB 1Z9SA 3VRIB 4YHKH 4G9FA 1FLRL 3FT4A 3FFCB 2NY5L 4WI5A 3LN4B 5CBEB 4I9WD 4LVOC 1BM3L 4MLSA 1X4XA 3HMXA 3HR5A 3KYKL 2YRZA 3VXOB 5CLTA 3DWTA 4Y7MA 5FM5M 4PJ9C 2Q8AH 4Y2DD 1CDJA 4Y5XA 5L9DL 3C60A 2AK4D 4G8GD 1M7IA 1S78D 4CU8A 1C5CL 4KUZH 3MJGX 4CADB 2OCFD 4ZTOH 4K8RL 3LQAL 4P2YA 2HMIC 2MMXA 5IROA 4LLWB 3MR9A 1CD1B 2ERJB 2Y9RT 3F58H 1R3LA 5FYKE 5L2JB 2PTTA 1FNAA 4LMQE 4UTBH 5IHBA 2VR9A 3OAYK 4LHUD 3QZWB 1X5ZA 4HIXL 4ODSL 5T5FH 3BN3B 3T4YA 5DJDA 2J88H 4I0PB 4OT1L 2A9MH 4XNYL 5J3HD 3MRNB 1JNLL 1KC5L 2W9EL 3KPLA 3MV8D 1NLDL 3PV7A 2B7DT 5J9PB 8FABB 3OB0K 3GSVB 4JO1L 3X13A 4PJBE 1KCLA 2DMBA 2X40A 4RA0C 4XBEH 2EXWC 2XICA 3CX5J 4WHYG 1E6JH 1AGEA 3L3JA 4NSKA 3WEXA 2M1KA 2DQUH 1C16B 3QG7H 5D7JA 3QI9D 4H0IA 1D5BA 3WJLA 3I6LD 1SYVA 4YWGL 2VXTL 3NCMA 5KJRL 1KIRA 1FO0H 4IRJC 4NBZB 3BQUB 4NKMB 3KYNA 4HQQH 1EX0A 3UDWC 3MA7A 2CPCA 5FUCC 1HSBB 4MJ4A 4NWUH 1A6AB 5BJTB 1CDYA 3KPQB 3IU4L 3QUYC 4O2CA 5GRWA 5I8KL 4Z7NE 3OX8B 3DRQB 4QOKB 2YR3A 4PJ7E 5B38B 5C07A 5DT1L 32C2B 4P3DB 1J1XH 1KCSH 4C58B 3MUY1 3NPZB 4DZBA 1S7XB 3EYOB 3UTQB 4GG8A 1HXMA 2ZKHL 1S9KC 3OR7B 3QQ4A 2FB4L 3DX7B 4K2UL 1OD7A 2V5RA 4FP8H 5DRZA 1CXLA 4O2FA 4UU9B 3ECBA 4TSAH 4PRPB 4UBDD 1IC1A 5IFAH 5EUKA 4MYWB 5F88A 5T1LB 5EBMA 4OZHF 4GBXB 4FQXB 4IIQA 2D2OA 3WE6B 4EUPH 3ARVA 1CGXA 3JV6B 1KEGL 5DK3A 3TV3H 4PJDA 3DOSA 5DD6B 1SJEA 4M62H 4HT1L 1BVZA 1BJMA 2QR0A 3CH8A 2ESVB 2NY4D 1MAKA 25C8L 2A6IA 3P4MA 4PTUB 2A6DA 5DEZA 5L7XH 3JSSA 3WS6C 5BV7H 4I18C 2HLAB 2Y06H 3C09B 4NUJB 5CBAA 2JB6B 4MNGE 4XMPH 1QLEH 3HMWL 3ARED 4LPYA 2DF3A 2RGSA 2W9LA 1RZGB 4OZ4A 5F7EL 5CAYB 1T80A 1U8HB 4XPAL 2E6QA 2NY2D 3EJZC 3O9WB 2V2TB 4TUOA 3QIUD 3LPGA 3X11A 3UTPD 1SHMA 4U6YB 3JUZA 5B39B 1C12B 1YEJL 3NOIA 3C5SB 3PIQA 1K9TA 1MH5A 2IALB 1IGFL 4RMUA 1GGBH 3RPIA 4MXWH 1DQDH 4NQCA 4NZTL 2MSPA 2AJZB 3MXWH 2DKUA 4MD4A 4AENB 4JRXA 4QNPE 4WEBL 3JV0A 2J2ZA 1MI5E 5DR5H 5ICYA 4GKSB 4JR9L 1A1OB 2XACC 1T1YA 3AFLA 5CJXC 1ZGLA 1LEGA 5M7QA 2NZ9D 5DJCA 1HHHA 1MCSA 5MERA 1F90H 3HG1D 1BBDH 1KCKA 3VWKB 5TQ2H 4TUKH 5FUOL 2D7QA 4XXDA 4ZO9A 4K3HA 3VXUA 1K4DA 3NIGE 3NH7H 4RGNE 1OWRM 2CK0H 4PJBF 1QRKA 3MYJB 3QNYB 2UZIH 4E9LA 3T1FA 3GGWB 3LSOA 3O45B 3HUJE 4YHOH 2P45B 3WXWH 1EXUB 4QO1A 4WI8A 3U0WH 5FHAH 4CU7A 1UACH 3U0PA 5L2KA 5GRVL 2LV4A 3W81A 4MDJB 3EDKA 5C9JA 1LDPL 5GGTL 4MA3B 1RJYB 4ONGL 5JW5A 1EK3A 3THML 5DLML 2F54E 1YC8A 4AH2A 1DBKH 3ARGD 4CDHA 4L4VB 3O41B 3NFSH 1NCBH 2V5MA 3OR6B 4Z7NF 1OAZH 5ITFA 1OHQA 4HIJB 4PJ7F 5DQDL 5T3XH 3TNMA 1CIDA 4QEGA 5DWUL 1YEFH 3S34H 4QXTA 3ROLA 2HFEB 1MCOL 1PKOA 3LB6C 4P4KC 3GKZA 1PAMA 5F1NB 3TJHD 1QYGL 5E7BA 3W39A 3WLWC 2HFFB 2PXYD 1XEDA 2VRAA 1ZTXH 4DW2H 5HHOE 1FYTD 4G8FB 4P9ML 3JVGC 3R8QA 4P5TB 5D70H 2OZ4H 4KROC 5KSVA 2Y36H 2FL5B 3EYQD 1BD2D 1N2RA 4ODTH 2Q3AA 3M1BB 2GK0A 3VXSA 4D3CH 4KTEH 3HLAB 2IC2A 2NXZB 3CPLA 4NN5C 4FN0A 2NTSP 4NGHH 3S35L 3CSBA 5IW6B 3RZCD 1DCLA 3F8UB 3T2OA 1LVEA 2OP4L 3TO4A 1AGFA 3FB6B 5KSBA 3QH3A 1FJ1A 1KCVH 1N3NA 3D87B 1WBYB 1MHPL 3MROB 2BHYA 4QY8A 4JO3H 1BZ9A 1U8NB 3B2VL 4XPFL 3PWLB 3N1MC 4EXKA 3FHAA 3QFDA 5EC2A 3QUKB 3DGGB 2F5AH 3DIFB 4JREC 5E9DE 4NQDA 4CGTA 2VWEC 2BXZA 3GM0A 1I1AB 4Z95L 2VITA 2AKRB 2RR3A 2AJYL 4QNPF 5EOCH 3VMOA 4PRAB 2VE6B 4R6UA 5CD3B 4UAOC 4QF1A 4NRXA 4UILL 4KMLB 3DBXB 4OFKA 5C0NC 1QFOA 5DUML 1SY6H 4YFLF 3TYGL 4GQPH 3WS3A 4N1HB 5DC0A 5MEQA 1FBIH 3K0WA 3ABZA 4FRWA 4YNYA 3UO1H 3MNVA 2W0KA 1PJ9A 3K74B 3RY5A 4P2RB 3MGAA 4KDTA 4KY1L 1D5IL 1S7VB 5ESQA 4PD4K 5FXCH 1MHCA 4NJAL 1PFCA 4QRRA 3JWOH 1LILA 4O51A 4KRMB 3VCLB 3CFBB 3HUJF 3MNZA 5EB9A 2JIXD 3ALXA 3TZVB 1SMAA 5DHVH 2ZCLH 5E2UL 1CE1H 3DSNA 1Q1JH 4OZGB 3GMPA 1V7ML 3LPWA 2GJ6D 3ARFC 3H9SB 2ADFH 4TSCL 3OMZA 1I3GH 1KSRA 1ND0B 5F8RC 3O4LE 1PY9A 3EJYC 2A0LD 3IF1A 3EW3B 1LP9B 5GS0H 1B2WL 4GLRH 1YEIH 2NTFA 3KPOA 3E0GA 2CO7B 1KV3A 2P8LA 3ULVE 4TNWK 1RPQA 1E6OH 3DUUB 4C55A 2WAHA 5KVGL 4IRJB 5GGRA 4UOW0 4F7PB 3CFDA 5KBNC 3EAKA 3SPVB 1RUAH 2VLRD 4TSBH 1BVLB 1QVOB 2DIAA 5HYJE 4KK9D 1T1ZA 1NDMA 3RWEA 3FFCD 1FLRH 4HUWB 3PGCA 3LKSB 2NY5H 2J6EA 4HC1L 4R4FH 3SE3A 1N5YL 1GIGL 2FEEL 4TUJB 4WW1A 1ZLVH 1BM3H 3V6OE 1RI8A 3KYKH 3JXAA 3MLTA 3S3PA 2Y7QB 4X9BA 1S9XB 4XC1L 2NNAA 5D7IE 4ZXBD 4MS8C 4JRYB 3WIFA 1OTUC 3QG6A 1T22A 5CP7A 5JHDD 1C5CH 5IVXB 3QAZC 3IKCB 4P9HC 4E41E 4K8RH 4KV5E 3LQAH 1TZIB 1FZJB 3V0VB 4Z9KB 1A14L 5DJ6B 1IKNA 1GHFL 4JVUA 4APQD 2FJGB 3HC0A 4X0KA 4JANB 1X4ZA 4HDIA 4HIXH 4Y4FA 4V1DE 4XNYH 2PKDA 2UWEE 5GS1C 5JUEL 4HUKB 1KC5H 5C0BA 4Z7OE 1LO5B 2W9EH 3DHJA 3FFDB 3RWIB 1NLDH 1HQ4A 4LSTL 1P4IH 3GHBL 4PRHD 4JO1H 4X6BB 4JZJB 5IMOB 2AEWA 5JOFB 2VDLL 3MRGA 4GAYB 1JE6A 4G80B 4A2LA 1ORSB 5F6HJ 1ITBB 5GZOC 3G5XB 4J3SA 5CFHA 2GEEA 1PX4A 1I7UA 2YPKB 2D03L 2AXGB 1P7QA 4LGRB 1H15B 1JK8A 4XAKE 3LH2L 1B6DA 4YWGH 2D4FA 3TVMC 2VXTH 2FSEB 4IM8A 3RIAF 4XBGA 4HBCL 5KJRH 1CFSA 3LV3A 7CGTA 3QO0B 2FYYB 5D8JL 3S5LB 5E8PA 4KDWA 3ZSSA 3O3DB 2OYPA 3WO4C 1PZ5A 3IDNA 1FFPA 3OG4B 5C08B 3IU4H 3RKPA 5I8KH 1XGPA 1X44A 3P4NA 5CWSB 3RUGA 5DT1H 5JA9A 4XB7A 4KPHL 2DQDL 5JZ7D 4QYOA 3J8F7 1T5XA 1T7WA 4P9HL 3W2DL 3L5WA 1J8KA 1LEIB 3UC0L 5I30L 2VJXA 4V2CB 5I15L 2OL3L 3MRKA 1OSPH 4KKAD 3D18A 3ORJA 5F7YC 1MCWW 1J8HD 2ZKHH 2VL4A 1MAJA 1UEMA 2FB4H 3QDHA 5C0CD 4ZOAA 4K2UH 1UXWB 5K9KA 4LLQB 1AKJD 2C3HA 1XCTB 3VA6A 3FB7A 4MD5B 3U7YL 3ULVF 5I1LA 5HYIA 1PKQA 1K5NB 2KBGA 1U8JB 2IPKB 4HUMB 5HYSG 3MACL 1KEGH 2MHAA 5EOTA 1ES0A 5C0AA 3RVTD 1QSEB 1T0NA 4HT1H 4AM0B 35C8L 2WWKT 1QEWA 4OLUL 25C8H 2A9NL 4ZMAT 1FNLA 3AU1B 3CGTA 3NZHL 4GKZA 2HJKA 2PYED 3ET9F 1UVQB 2KZWA 3K2MC 4K3EL 4P2OA 1RAMA 1HQRB 3HMWH 2AXFA 1YECH 4XHQA 1OGAE 4KU1A 5F7EH 1NAMA 2CLRA 4XPAH 3BN9D 3G08A 3MCG1 3KJ4C 5D7IF 3I84A 4EZMA 5EUOA 1H8OA 3W9DA 1BQHB 5C92A 3BGMA 4P4KB 4L8BA 1SYSA 1IGFH 1ZHNA 4KV5F 1G7PA 1CL7L 2HVJB 4NZTH 3EKCA 3LKOB 5BXFA 1YPZB 4S1DC 4WEBH 4WCYL 5DMJB 3IVKA 4JN2B 1IC4L 1S9YA 4JR9H 1MRDL 5SX5K 3U48A 1EBPA 4KROB 2YKLL 3C08L 3B3IA 4MJ2A 3ZMRA 2P46B 3MRIB 3EYVB 3VWKD 2UWEF 5H2BB 4PRNA 4Z7OF 5FUOH 4RDQG 3TBYA 4NN5B 3DX9B 5K9QG 5ECJE 4L8SC 5FOJA 1F4HA 5I16B 4P99A 3N1QC 4GJTB 1EHXA 4LGPB 4NQTA 3S35X 4F8TA 2YD1A 4AZ8A 2NYYD 2VN7A 3SJVB 4JGMA 1CD0A 2H9GB 1TTUA 2Z8SA 3RL2A 5I75C 1BQUA 1ACYL 1PSKL 3MFGB 4TPRL 1EJ6A 5FV2A 2X1WL 2VYRE 1OM3L 2H32H 3FKUS 2IBBA 1AGCA 3H7BA 5KSUB 5DVOA 2CIKA 2EDDA 1RUML 2GTWB 4S1QL 1LDPH 4BUHA 1WWWX 5GGTH 2EDOA 4OGAC 4ONGH 4W4NA 2CDEB 3THMH 5IR1B 5DLMH 4XXCC 1E4JA 3SCMA 2XKUA 3KS0H 1EMTL 2DLTA 2BVQA 4OF8A 3K7UA 1D5ZB 2EIBA 3IFPB 5DO2D 5DQDH 3S97C 3HI6L 5IEKA 3W82A 4R2GD 5ANME 5DVNA 3QDJB 4LBEA 3WXVL 5I19L 2WQRA 1JGEB 4LSRL 1JWMB 5DWUH 3HCVB 2A1WL 2VZSA 4X7SL 1JGDB 4PJFB 5IBUG 1AD9A 1MCOH 1JRHL 5FGBC 4PJGA 1A9EB 5IJKC 1QYGH 4JFPA 1C8PA 5BRZE 2EE3A 3MREB 3ZHDA 1LQSR 3VXMD 3ARFB 4ZO7A 5CEYA 1YYML 1AO7D 4F7CA 5I8OL 1ODAA 4P9MH 2OJEA 4P5TD 4ONOA 2EYTA 5CD5D 3NZ8B 3CFEB 2JJUA 4PJAA 1FFNB 4WW2B 1MCIA 1JNHA 5DMKB 4PTTB 5CHNB 1CK0L 1NL0L 3BEVB 4XHJC 1JPGB 1HZHL 1T7YA 1ADQA 4RAUB 3M45A 1B4JL 4FMKA 3S35H 2GKIA 4XBPA 3UPRA 2OP4H 3GJFK 1G9MC 5T3ZE 4P5KA 2HT3D 3BRGC 3OQ3B 3L1OL 3CCHA 1LE5B 4OLEA 1MHPH 3V6BR 3KPNA 1H3UA 4H0HB 4P46C 3B2VH 3NPSC 4XPFH 4X7TB 4UT6L 1O5DT 5ENWB 3KLAA 1JHKL 4DZ8A 3MZTA 4L4TB 4EUPG 5TJWK 5A40E 5DMGD 4RFEB 3QJFA 2VLKB 4U6HA 3D9AL 2P5WA 2XN9A 4Z95H 5E94A 2AJYH 4RCAA 3VXRB 5KG9B 2BSRA 4L1DA 4LOUD 5C0IB 4UILH 2BZDA 2YD4A 3LN5B 1WC7A 3N50A 5DC9B 5DUMH 3VWJC 1XFPA 3TYGH 2Z91B 4TNVF 5E6YA 2OR9H 2Z35A 5L6YH 2HLFD 3BRDA 4M6OL 4KY1H 1D5IH 5DK0A 3KVQA 4Z7WE 5DK2A 4LL9A 4PRID 5EZIL 3HE7A 4UDTA 3GJFA 2FZ3B 4HUVA 4NJAH 1G7HA 3MOQA 1ZOXA 2JCCE 1Q9LB 4WDIB 4L4JA 4FXGA 5I18L 2EH8L 5GS1B 4NOBA 1F3RB 5E2UH 4DUXA 4JDVA 5JOPD 5MEND 3ARQA 3AS3A 1R3HB 1DUZA 1V7MH 2WV3A 1KIPB 1I8MB 4KKLD 4TSCH 4X6CB 2CIIB 4YHIB 1CFVL 2PN5A 4NKDA 1CIUA 2DMKA 2AV1A 5D7LD 3MOBL 2UVFA 1EA9C 2EYSA 3H9HB 5IQ9A 5HY9B 3EO9L 1G9ML 1B2WH 4JFOA 2PF6A 3AMKA 4MNQB 3ZKNC 5ID1A 5K9JL 3C5JB 5D2LE 3IXTA 3OF6D 3IDIA 4N5UA 5KVGH 3TVMB 3VXQA 3ARDD 4NNPL 2DM4A 3HB3C 3WL9B 2YPLD 1S7QB 1GL4B 1P1ZA 3MV9A 4IMKA 4FZEL 3CX5K 2EIEA 2AQ2A 4BYHA 1I1YA 2ZG3A