3BESR

Structure of a poxvirus ifngbp/ifng complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
250
structure length
250
Chain Sequence
TITSYKFESVNFDSKIEWTGNGLYNISLRNYGIKTWQTMYTNVPEGTYDISGFPNNDFVSFWVKFEQGDYKVDKYCTGLCIEVKIGPPTVTLTEYDDHINLYIEHPYATRGSKKIPIYKRNDMCDIYLLYTANFTFGDSEEPVIYDIDDYDCTSTGCSIDFATTEKVCVMAQGATEGLLDKITPWSSEVCLTPKKNVYTCAIRSKEDVPNFKEKMTRVIKRKFNKQSHSYLTKFLGSTSNDITTFLSMLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of IFN-gamma antagonism by an orthopoxvirus IFN-gamma-binding protein.
pubmed doi rcsb
molecule keywords Interferon gamma
source organism Homo sapiens
molecule tags Immune system
total genus 55
structure length 250
sequence length 250
ec nomenclature
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF07140 IFNGR1 Interferon gamma receptor (IFNGR1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3besR02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3besR01
3QEQE 4OGXH 1YEJL 4Y0GA 4GXUM 1U8JB 3MJ7A 4TSCL 2VITA 1KN2L 4G6AC 5TDPA 4PJAB 4JZOB 1UADC 4CUCA 5DD1H 4PRPE 4QHUB 1UH3A 2FECL 3RZCA 1N2RA 5T5FL 3QXWA 1TENA 4EOWL 1JZ2A 5DJXA 1Z9LA 4EI5C 3QBTB 4TYUA 3X13A 3G6JB 2PXYC 2FX8H 4OD2A 2IAMC 4WEUD 3AM8A 4KUCF 3CFBA 2YPLE 2F19L 3L3IA 4KGJA 4YBQC 4PJHE 5K9QG 3CFKB 4HQQL 2IH1A 1AIFB 1GIGL 1BX2A 5FYLH 5C6WH 4GRMB 3RTQA 1XR8A 3QDGD 3MRLA 4POZD 3LV3A 4WUKL 1NBZA 2DWDB 2FJFA 1AKJD 3BKJL 4NIKB 1YQVH 1WGOA 4PJDF 5E6ZA 5JIIA 4JFDE 4YHML 1IJ9A 3P0YH 5F70A 3MCLL 5DTFA 4JRXD 1LO4L 1KCVL 3D39E 4OZFG 3K80A 1S9KC 2N4IA 2QQLH 2BRRH 4RFOH 2KL6A 4C56B 2P8MB 5C0CA 4U1HB 2EDBA 4NJAL 4GRWB 4H5SB 5GRUH 1OTSC 2APBA 3HRZA 3PHQB 5FYJE 3BW9B 2DQGL 2R1WA 4YC2B 4ODXA 1RJZB 3MLUH 2P5ED 2LTQB 2J5LC 1QBMH 2C7UB 1QBBA 3VD7A 1YNLH 3BD5A 4PP1D 4PRDB 1FE8H 5DGQA 5E56A 3VXMB 5GISL 2I25N 2DIAA 2FGWL 5FHAH 4UTAH 1FNFA 4MSWB 1PY9A 3ILQD 1WBXA 3GSNH 1MQKL 4LNRB 1F42A 3JTTA 3GMNB 1IM3A 3WFEH 5AD0B 1QLFB 3D3VB 1E6JH 4MMZC 5L7XL 5IVXF 4NQUA 4RFEA 3DHJA 5T3ZL 3C6LB 1G6RA 3AU1A 3RIFF 5I6XB 4M61A 3L7FB 3HAEA 4HK3N 1UG9A 1PDKA 4GQPH 3DPBA 2JLLA 5JUEL 3UC0H 4GAFB 3V0VB 3O6KL 2PR4L 3FQTB 5ESAA 1E4WL 4OUUA 2LU4A 3V5DA 1O7SA 2GJZA 5FYLD 1TJHL 2EO1A 2CDEB 4IIQC 5I0DA 4TPRH 4ERSL 2DYPA 1FVCB 2E27L 1P6AB 4TULL 5BRZD 5JIPA 1S5IL 1G7MB 2ARJQ 3EDDA 4M7KH 2VQTA 4LRNL 3FFDB 4X6DF 1EEQA 1TZGH 1CGUA 2P48B 1KJ2B 4TUKL 2IG2H 2OYPA 4Y5VC 1BVZA 3L5XL 2Q1EA 4U4BA 4BM7A 1BPVA 1OY3B 1ONQA 5HY9B 1C5BL 2X42A 1VGKA 1VACA 3GSVA 3W2DL 5A40E 3DVGB 4YIQB 1V5JA 2XNAA 1A6UL 4ETQA 1PYWA 4WW1A 3C5ZA 1S7QB 3MSPA 3SE9H 1OW0C 2Q20A 4PJ5D 2WBJC 4LLYA 3HPLA 1S7WB 5I1GH 1QFWM 1FNHA 1T22B 3TZVC 3HMWL 4ZQKA 1NBYA 1P4LB 1H0DB 3UJTH 4ZUUB 1CF8H 4H25A 5F7HA 1L0YA 3V8CA 2DQCL 5DC4B 1QUNA 2XA8H 3F6IA 2IQAA 4MXQD 3LKOB 2B4CL 5D7JA 2WLZA 1MELA 3OX8B 4NDMA 2ZSVB 5CEXA 2HG5B 1I75A 1JF5A 5HHNA 1NMCC 5J1TC 1JWMA 2N7BA 3EDEA 5ICZB 5BW7A 4HBCH 4HHAB 5FCUH 1EZVY 4UUJB 1JGLH 5IW6A 4I0CC 1IGFL 3D0VB 3QUMB 5C0BA 4QF1B 1U41A 4OFVA 3OJVC 4HZAA 1DQQA 5EZJB 5HD8D 5FA3B 3BT2L 3IS1X 2BSTA 4Q9BA 1RZJL 4POUB 5D1XB 1F90L 3TBYA 4EIGB 2W9EH 2NX5B 1EA9C 4P57B 3BEVB 4PRHB 4JY5H 3WHXB 1E28A 4WY7H 1ZA6B 1IAII 5MEPB 4OF3A 4GKNA 5FKPB 1IC1A 4P46B 4J2XA 4HFUH 2FEDD 3MGAA 4OCWH 2EDXA 1IAKB 2AABL 1FSKC 3MNZB 4X7CC 4WI5A 3D87B 2Y25A 3O41B 3P9LA 5AWNH 1T7XA 3T8XA 4QHLA 1K8DA 2NZ9D 2XY1A 1HKLH 3LSOA 2OCFD 4LCCA 1XGUB 1XF5B 1H3PL 3BPLC 1HZHH 1EVUA 2RGSA 4NKMA 1J8KA 2CSPA 1BWMA 3OPZH 4OLWL 5INCA 3PP3H 4R26H 5T5NF 5DT1L 3UTQA 2EC9U 1H3XA 5B38G 3OKMB 2O5XH 2Y6SC 4YHPB 3TV3H 5BS0A 2UWEB 1CT8B 2GTZA 3MA7A 2EKJA 5LQBH 2C1OB 2UV3A 2GYSA 2HMIC 1D9KD 12E8H 5TE6H 3BRFA 2CQVA 3RKPA 3O6LH 4OIBA 3MCG1 1CGXA 1UEYA 4P3DB 4PTTB 4NCDA 5SV4A 1VEMA 4JFEB 4FTVB 5C0BE 4XBPA 4NO0B 5LGJA 4LLQA 1U92A 3DVNA 4U31A 1NJ9A 3RDTD 5HXMA 2XT1B 1AE6H 5CZVL 3BYYA 3C09B 4FFWC 3VWKB 4OZ4A 2YN5A 1S78C 5M94B 5T3XD 3FB8B 3H7LA 1Z9MA 5D2NA 2HVJA 5EO9B 3LS5L 1M6OB 3VH8G 1YJDH 1A3LL 3GB7B 4ORZC 5C0RH 3V6ZB 1Q72H 3MV11 1WAAF 4RGNE 4KMQA 4NZUH 3WFZA 3IU4L 3U7AA 3TBSB 2AW2A 1QD0A 2VL5A 4XXDB 4BH8A 5DI8B 2AEPL 1Q9WA 2AERT 2DTSA 4XB8A 4Q6IC 2YD6A 1SYVB 4YFLI 5DJAB 1BD2D 4EZMA 1I9JL 3P73A 1BHGA 5JPNB 1ACZA 2VABB 4K94L 5FM4A 5TPWH 3BP6B 4HK0B 2EYTA 2IADB 4KI5D 1LO0L 5C7XH 1F4YL 2QSCH 1UA6L 2NY6B 3G6AA 3MLTB 4N1CA 4NUGL 4DFIA 4Z76A 5CUSL 3IDGA 4IS6B 2DKUA 3TJHC 3X3GL 2Q76A 4RIRA 5BS0E 3T3PE 1AGDA 4NM4L 2EH7H 3SKNA 2YMXL 4F9LC 1OP9A 3UTPE 5HYQB 4JANB 3Q6GH 5L8JB 2NY7H 1CGSL 2PTTB 4C55A 4L4TD 3UTSB 32C2B 2NLJB 4X6FB 4ODSL 2COQA 1EXUB 1D5MB 3Q6FB 5EUOF 3FN3A 4BSWA 1MCCA 5C08D 3U46B 4PRIB 2BJMH 2VUYA 1CVSC 4Z7WB 3G04A 4JFYB 4F2MB 2EZ0C 1REIA 4H8WL 4NQEA 5FYJU 5CD3B 1Z0MA 4N1EA 1MCSA 1CICA 3VG0L 1KTDA 4OFPA 5ETUA 5DMIH 4F57H 4O51A 1IAMA 4BFGA 5MEQB 2JJVA 3ALWA 4G8FA 3K4ZA 4JG0H 1JUFB 4WVRA 5AZ2L 4ESKA 1IT9L 2XKNA 3EKCA 4OCXL 2OZ4H 5SX5K 2CO7B 3BAEL 3LKPA 3QEUB 2H1PL 2CXKA 2N1KA 2ORBL 3RVUD 5JOFB 4GBXB 3T4AB 4HIIA 1AI1L 1JTOA 4KK8C 3WD5H 4L8SB 1BP3B 1NKRA 3C9NA 4ELKB 4HKJB 3MV9B 3OHXA 4GSDL 1FAIL 5HHOB 4P59H 3WV0A 3W5MA 5CLTA 1LK2B 2P24A 4K7PL 1PQZA 3PXJA 1CXHA 4NYLA 2Y06H 4XNZB 2FX9L 4ONHA 5IUSA 4NSKA 1BBDL 1BQUA 3K0WA 3TO2A 4YDLC 2NY4C 3QUYA 2ATKB 1I9RH 4KWUA 2EDEA 1AGBA 1QP1A 3EO0B 5CILH 5HHMD 4M03A 4PY7B 4MLIA 4XHQA 2ZCKH 5EDXA 2AEIT 4LLUA 5BVJB 4X4MA 2VUOA 5TDNA 3N85H 3PWPB 3RWDB 1VFAB 5AYUL 4N8VG 4YE4L 3OAUL 5I9QC 3ESVF 3KYMA 3S9DB 3OG6B 3GNMH 5AEAA 4P4KB 3J8F7 3MO1A 1WC7A 1AO7D 4MD0A 2E6QA 1L6ZA 2YS4A 3O3BA 2ADJB 3ZE0F 2XZAL 5HYIA 4FQIH 1F11A 4Z7VB 3MV8A 4Q7DA 3QA3B 3S8WA 4PGDA 1SMOA 3VFWB 3WFBH 3LS4H 1NFIA 1JWSA 4Y19A 1CFNB 4WU7A 4RBPK 4HJGB 5EBGA 1IGIH 2XZQH 2HLFC 3DBXB 2IC2A 5HHQB 1INDH 1NBVH 3EOAA 5DHVH 1FL6A 5E1HB 2NY5L 4GG6A 3MLPA 3CLFH 4Z0BH 2V17H 2R4RL 1VFBB 3BPNB 3KPMA 5TGBB 4MAYA 4P5KB 5GS0L 2HJLB 4G6MH 2H32A 3VU2A 3IDIB 2ENYA 1V7MH 4MGXA 5GGSY 1FO0H 4MWFA 1VCAA 1MCWM 1S9VA 1YMMA 4O5LH 3JWDH 3MX0A 4XXCC 1FZOA 3VFUB 1OAQH 3R06A 4D8PA 3O9WA 4X4ME 3GJFB 4LBEB 4XBEH 3SCMA 2LE9A 3OXRB 3L1OH 1MWAB 3PWNA 5E24E 4URTB 3IVKB 3C2SA 1YY8B 3LN5B 4IHOA 5I1HH 4K3JL 3G5ZB 3QG7H 3TWCH 4XGZB 2WIIA 1UM5L 2I60L 3KHOA 3LHPL 3ZHLA 2M26A 4N0RA 1EJ6A 3PQYD 3QIBB 4NBYB 1TJGL 4E0RA 2CLVB 4N0YL 2LAGB 4D9RE 5CLWA 3KWWA 1MAMH 1FZJB 3CFIC 5HVGB 2JJTA 3CX2A 2C3VA 4QRSA 1AR1D 4LOUD 3MV8E 4RSVA 1FGNH 2AXHA 4KHTH 3RUGB 1A3RH 1QFPA 4TUJA 3SPVB 2I24N 1VKXB 1G7LA 3QFJD 2PTVA 4Y19E 3CXDL 5LVEA 5K9KA 4U1JB 4WV1A 4M93B 1RUMH 4GXUN 4G9DB 2VDNH 3CH1A 1MFEL 3FO9A 1MJ8L 5DS8B 2O93L 4MJ6B 4U1KA 1W72H 5A2JH 4GG6E 5DFTA 2X4NB 1QHPA 2CPCA 2FSEA 1JE6A 4XB7A 4DZBB 1L7IH 4NO2B 4HKBB 4OCNC 3X17A 3VXNA 2BMKB 1AD0A 2GT9B 1M1SA 3I02B 3ZMRA 5HVWA 2DICA 2EDDA 2YKLL 5GRJH 4HWEL 4LCWD 3JWNC 3IU3A 4NQCB 1HIML 3QXDA 3S4SG 5BV7B 1YMME 4LCCC 3VW3H 1OGTA 2OR9H 5FM5O 1GGTA 2V5MA 4NN7C 4YDKH 2Q86B 4KROD 1EBPA 1ZHKA 3BZFA 1G7QB 1WBYB 5GZOC 1H5BB 2DQUL 5I1LB 5EU4A 3HZMA 3E2HC 4KK9C 4ODVL 3VFPA 4J1UB 1S8DB 2EIZA 4XCNB 1XR9A 4AQ1B 2EH8L 1A6AB 1D5BA 3IDUA 1A4KB 4XX1E 1HYSC 5T3ZE 1ZANL 3BWUC 1MH5A 2IWGA 3NFNA 4H26A 4MJ2A 5D1ZA 2UZIH 3V5HA 3V4PL 3OXSA 3TN0B 3MRPA 2NNAB 1DVFC 1A22B 4PJ9B 2FNBA 5HHXH 1QACA 4I3SH 1F6FB 3G6DH 4I3GA 4PJXA 2ITDB 2O61B 1ZLSL 1A7OH 2VSDA 2IQ9H 5FA4A 4XVSH 1P7KB 2DBLH 1OB1B 4YHZH 1DBJH 4RA0C 5D1QD 1T7VA 3WDIA 3S5LA 5I1AA 3LPWA 1HEZA 3PWLA 4X7EC 4R4FL 3HE6A 4O4YH 4OLYL 5ALBL 5JW3H 4NQXA 3KGRA 1S7XA 3KLHC 5BQ7A 3M1BA 2JELH 1XFPA 1H8NA 3O11A 3QNYB 5E2WH 1DQMH 1A1NA 1DEDA 4Q9CA 4M00A 4AIXA 3ARWA 1KIPA 3WO3B 2GUOA 3LMJL 4GAGH 4YJZL 5TQ0L 2G5RA 1LK3L 2DQEL 3ZKXC 3E8UL 1RURL 3GI9H 5C9JB 1B0GB 3TIEB 2BNQA 3H7BA 5MP6H 3NIFE 1I7UA 3EYUL 4YHOH 1GGCH 3JTSA 4GRLA 4F15C 3DROB 1JNNL 4APQC 3VD9A 4NKIH 3RU8L 4DW2H 1ZT7A 1JPFA 1QSEA 4IM8A 1U8PA 4WI9A 3SO3C 2MCG1 3B9VA 5C07B 2VLKA 4P4RA 2DWEB 4MXQC 1RZIB 3PF2A 1T7YA 4JPKH 2R2EB 2HRPH 5CBAB 3HCVA 4HCRL 2Q7YA 1K4CB 1MJ7H 4G6FD 3PJSB 4IRJD 5DJ0B 2RBLA 3S35X 2ZUWA 4PLJD 1KBGH 3SDXB 4PJXE 4LU5H 1ZT1A 3FL7A 3LKQA 5T1DH 1P5UA 3TCLB 2R1YB 3D2UA 4X6CB 2ADIB 3MRGA 4QXGH 4OI9A 4PRBB 4UIKL 4NZDA 2VYRE 1CLYL 2IGFH 2F54B 3MLVL 1D6EA 2IPKB 3Q5TA 4P23A 4ZUSB 3K4AA 2IPUG 2WUBH 3RWGB 4KDVA 3RVWC 1FV1B 1BFOB 4G7VH 2OR7A 4WI7A 4OZHA 1H15A 3RWFB 4BQBA 4P2OC 4S11A 1JHTA 4YFLF 4G6JH 2EIBA 3QG6A 1UZ6E 1CGTA 3ARRA 2YBRA 3LN4A 4XP1H 5J8OA 1QBAA 4UV7H 4HAGA 4U2ZA 2LFGA 3WLBB 1MCFA 2JE8A 3EO9L 3MV7A 4PJCB 2XZCH 4LAQL 4O58L 3KPTA 2DQDH 2OJZH 2HYMA 1B9ZA 3FO1A 3IDXL 4GXVH 4JFOA 5F21B 4M1CC 5KJRH 1VDGA 2NZ9C 3LPFA 1X5JA 1AGEB 2W9LA 3G5YB 2B0SH 2FL5A 3EYSL 5F1NA 5K93A 4OZGB 3VWJC 5EZIH 3NCBB 5DHYA 5ITFA 4D9QD 4JPIB 3P4NA 2BDNH 2VLKE 3DUUA 5CJXA 3V2AR 2AP2A 1UQSB 1TVDA 3REVA 4S2SB 3QCVL 2FGZA 4Y2DC 3GHBL 1KN4L 3PP4L 2XWTB 4M9OA 5D7SL 5H2BA 2P5WD 4L4VA 2H3NA 1A7QH 5GRYA 4YQXL 4ZFOL 1D9KC 4G9FB 1N4XH 3LEXA 5GSRB 3MBEC 4F9PA 2XN9B 1NEUA 1PY4A 1TETH 2AJZA 1CE1L 4FMFA 1Q9OB 4OF5A 5JHLH 4L9DA 1CGYA 5A2KH 1F58H 4HS3B 4JZOA 4H1LG 2R0ZH 1JGDB 2R4SH 4JJ5A 2BSSA 1EAPA 2WSKA 3D48R 4X99A 5C6TL 4OZHE 1EBAA 4LHUD 4X7TA 4PB9H 1JJUA 5EOCL 3IDJA 1J1XL 1KCSL 2FJGB 2QBWA 3TBVB 3P0VL 1CGWA 5E00B 3OV6A 3K8KA 3MFGB 4I13B 3WEXA 5C71A 2HFFB 4DEPC 5T1LD 3O8XB 3ZDXE 3CK0H 3QCTH 4JDTL 4PB0L 3MXVH 2HVKA 4JO2H 5I18L 1I3GL 2HFGL 1CR9L 2NXYD 1UYWL 3LRHA 3MV01 5SWSA 5CEZH 3BDXA 1UACH 1RIHH 3P4OB 3SCMC 4JFXB 4U6YA 4X0KB 4YPJA 2AJUL 1WCQA 3LQAL 1NUDA 4QRPA 4TNWK 4CU7A 4NBXB 4G6KL 3QUKA 4FFZL 1CFSB 4ZOCA 2BFVL 1V3MA 1ND0B 1I1AA 3FB5B 1RK0B 4MJIB 3RZCD 1NSNH 1J1OH 1G6RH 1RJCA 3QO1A 2P8MA 1NCAH 4U1HA 3CDCA 4N0CC 4H5SA 4ZFGH 3HAEH 4P2RB 3SGKA 4UNUA 4ALAL 1RJZA 2FB4L 5F71A 4XP9H 4NZTH 3K2UH 1K8IA 1KPUB 4X9FA 1KB5L 4I18A 3QQ4B 4DAGH 1MFBH 3RTQD 5GGSA 4YDIH 4L3CB 3VRLF 1MIEL 2X1QA 1ED3B 4MSWA 4C57C 2EDHA 4LNRA 3DX6A 4M6ML 2WIMA 3GMNA 5D6CB 2AXFB 3RVUC 5AD0A 3BPCA 4R9HA 1WZ1H 1QRKA 5CZKA 4XPFH 1B0RB 4D3CH 1C1EH 2YRZA 5HDLA 1QPXA 2VDRL 1EFXA 2UYLA 1A02N 2EECA 1MRFL 2NYYD 1A1MB 4U05A 3VRIB 3CFCL 3CSGA 4BUGA 5C0DB 1NLDH 2X10A 1YJDC 4M48L 4TSAH 3O3EB 5DJ8B 1MRDH 5C0CD 2P8PA 4YGAB 1ITCA 5SWSE 4OV6F 4CDHA 3WN5C 3STZB 4XPTL 4QXTA 3JZ7A 2EICA 3QZWA 2OL3H 1KJVB 2VE6B 2WW8A 1J0YA 4K3DH 1D5IL 5HYJE 1C5CL 4XRCB 3F5WA 3E3QE 5CEZD 1I9IH 5JW5B 4MQ7B 1OP3H 1OLLA 3FONB 4JB9L 4OKDA 2R8SL 3I9GH 4LCYB 4OLEA 3KPSA 3I50L 1KOAA 2BC4A 4K9EL 2F74B 3ZKNC 1LDPL 5IJVA 4HIEA 4HBQA 3VXSB 3ARED 5HY9A 1SM3H 1YYLL 1UJ3B 2MSPA 1M7IB 4ELMF 5EBMB 3ZE1F 2NY1C 1S7QA 3QUXA 3ECBA 5A2IH 2YUXA 3P9MA 1LD9A 1CG9B 3MRFB 4IRZH 4Q0XH 4R3SA 3B6SB 5KS9F 4EN3C 1SMAA 4OZIF 2AXJA 4QHNB 2GAZA 2G9HA 1S7WA 4LPUA 5FUCE 1R5IA 3KS0J 5AZEH 4UTBH 1YEDA 4M6AA 1T22A 2DLGA 1HDMA 1I8IA 3OAZH 4QNPE 3HI5H 1H0DA 2AQ3A 1ZLWK 3T1FB 3IJYB 4ZUUA 1BJ1J 4LLWA 4NQDB 4RRPG 1JYNA 4ZXBC 1QFWI 4S1DD 1GGUA 4QLRA 4LLDA 5HYSA 4CVXB 4TTGA 1QFWH 1IGCL 1KTRL 2DKMA 4MDIB 1JTTA 3LKOA 1MHPH 4HIXL 2ZSVA 4I9WD 1EERB 5KBNC 5B39B 3R0NA 3UTTA 3C60B 1T7ZA 1OP5H 3NCEB 3QO0A 3HG1A 3CXHK 2PTUA 1J18A 1A7BA 4WNQB 4HS6B 2A6DB 1XZ0A 2H6PB 4TSBL 3QDHA 1I4FB 5ESQB 3FAXA 5EUKA 2F58H 3MMEA 5F1IB 5KOMC 4GRLC 3C5ZD 4TOYH 3QUMA 4UU9A 4ZFZA 1IAOB 4XNUL 3BEWA 2EYSA 4JRXB 1QR4A 4NT6A 2KQMA 2VDPH 1R3JA 3I2CH 2GSIB 1KCRL 4ZUTA 4FABL 1CDJA 4CADB 4JGUA 5D1XA 4YEFA 3BEVA 5I1IH 3RHWF 3BSZL 4JDZB 3SJVE 5AUMA 3QDJA 2HN7B 4FZEH 3PWUB 4IRSA 1T66C 1WZLA 1YNTA 2UZYB 5MEPA 1BM3H 2A6JA 3SE4C 4XMLL 5D2LA 5D7JD 2VWEE 1UKTA 2EXYC 5EO1A 3TA3C 3L3HA 1DBKL 3O41A 4JREB 5J0BA 2DOCA 2GJJA 3VXTA 4AM0A 2VC2L 4HUKB 1ZOXA 1JI1A 4UINL 2WK2A 2R39A 2G5BB 3BISA 1I7ZB 1MHEA 1FFOA 3DYOA 4L4JA 4R7NA 3DWTA 1S3KL 1ZT4B 2DJUA 4DUVA 4M4RA 2W60B 3UTTE 4YHPA 1CT8A 1KENH 4XCCH 4U1NA 3HG1E 3KYNB 1XF2B 2A77H 1SYSB 2AGJL 4XC3L 4XAKE 1I7TB 5E8OA 5IMLA 1PG7H 1DQJB 1T0NA 3C2AL 5D7KE 2XRAL 1KT2B 4RGND 4JFEA 4HJJL 4FTVA 2GTWB 2M2DA 1T89A 3F7RA 2CDFA 1X5AA 1QKZL 4J3WA 4JLRB 5KVEH 3HZYB 5E5MA 1T6VN 5DD6A 4OQTL 2FATL 4NNXB 5CKGA 2ESVA 1B6DA 5GRVL 3GGWA 2VDQH 1RFDL 2DRUA 3MFFA 4Y5YB 3VWKA 3JWDC 1MF2H 4Z95H 5MEOB 2F53A 1OARH 3P4LA 3QDJE 4WWKB 4XCYA 1OTTD 4ZTPH 4AEHH 5DDHA 3GB7A 3GSXB 5D70L 4ZD3L 4S1RH 1AGFB 4YHYB 3TEUA 5D2LE 4ONGL 1A14H 1S7RA 5F7DB 3FN0L 5DI8A 2YD2A 1N6UA 3GO1H 5BS0D 2HKHL 3D0LB 1MNUL 1NGYB 2BVQB 4PJ5B 2V2TB 4HWBH 5KVFH 4HCRA 4G8GA 3VGAB 4FQ1L 2JK5B 2VABA 4MB4A 2VXVL 3ARFA 4GAYA 4JG1L 4OGYL 1ZSDA 2IPUK 1PSKL 3SOBH 3OKKA 1DLFL 4IS6A 3B8YA 5DQDL 3BP4A 1SJXA 2VLRB 1WFOA 1UC6A 1G9MC 1S9WB 4Z7OF 2QHRH 2VXSL 2ARJB 3O4OC 4PS4L 4P3CH 4EI6B 5HGBB 1XGPB 2XY2A 5EU3B 1D5MA 5LAXB 1MCLA 1MFAH 5E7FA 4Z7WA 3HI6H 1IEAA 4BZ2H 5I1CH 4JFYA 4BKLB 4WFFE 3VXUA 2D7QA 1I3RA 3GMRA 4NC2B 4ZAKD 4E41B 1IGML 3W5NA 3BRDA 5FGSA 5D72L 3W9DB 4KRMB 2ESVE 1JUFA 1KJMA 4UDUB 2X4UB 2HTKC 3RPKA 2F53E 3MYJB 4M6OL 3E3QC 5JZ7D 3VFVB 5JOFA 3QDAA 4X4ZA 4UB0H 4XX1G 3T4AA 5EWIL 1OSZA 1AQDB 3RWIB 4NZJA 1IEHA 4X7SH 4L8SA 2E6JA 1XGRA 2A0LD 3IDMB 3MNWB 1YYML 4ELKA 1NMAL 1A47A 3MV9A 4HS8L 4KKBC 4YGVA 1RD6A 2GITB 4GUPB 2ZPKH 2X4QA 4NKDA 2FO1A 4G8GE 4RAUA 2XPGA 4B53A 1BEYH 3MGTB 1CD8A 4OZFB 4HH8A 1JF1A 1N26A 4WUUE 4A6YB 5CSGA 5SWQB 5C0GA 4ZFOA 1IC4L 3SKOA 3V8OA 1FRGL 1U8NA 4NQED 5IBUG 4MX7B 4UQ2A 4PY7A 2J2ZA 2YRPA 2A6IB 4XBGA 2NCMA 1CICD 3MLWH 5E03A 2FIKB 1CYGA 3DX8A 3G9VA 4AT6A 1GZPB 2XQBL 4Z18A 2VDML 4LQ1A 4RDQF 1X7QA 2NY5C 4CNIB 4PIRF 1A0QL 1A6TB 3HE7A 5C0AB 1FNEB 1KCVH 3TT3H 1OPGH 1G7PA 3OJ2C 4PJIB 4P4KA 1SBSH 3FZUC 4UILH 4ZSOE 1YEGL 5GGUA 5GS0C 1VPOL 2R23B 3VXUE 4U6VL 4MHHI 1DSFL 1YUHA 4F33B 3DTXB 3TIDB 4HPOH 4JO3L 2Z31A 2WWKO 5FM8A 1JZ3A 2ED8A 4OSUH 1CFNA 2NTFB 4HJGA 3DRQB 5CFHA 1S7TB 4PGBA 4ONFH 1AY1H 3DBXA 2YD8A 4JHAL 3MGOB 5C70A 4Y16C 4PG9B 2N56A 4L29A 3QWQB 2ZG1A 1VFBA 2DLFL 5L7XH 2ENSA 3QUXC 5IFHH 5LWYL 3O0RH 5HGDA 4P5KA 3LKRA 1TQCB 5HI4C 5CJQH 1T03H 4AL8L 5BMFH 2W0LA 1JIBA 3IDIA 3QQNA 3L3KA 1RZFH 4AEIH 4ISVB 5DRZB 1DDHB 5E9DB 5IHUL 3S5LG 5EG6C 3TFKD 3E1F1 5SV3A 2PR4H 3OQ3B 3O2VH 3RGVB 4M7ZB 1KTKE 1FG2B 1KB5A 3GMOB 4KK5C 4MAUL 3MV8D 4DN4L 4TQEL 4JHWL 1MWAA 1ACYH 4MA1C 4EVNB 1BFTA 3KPLA 1XIWB 3LN5A 1PKQA 1VSCA 3EOTH 4M43H 3HS0B 1QA9A 4L4TB 4Y19D 3T09A 4N0FB 3FQWB 1YN7A 1UFUA 3WJLA 2D03H 2H9GB 3MRIB 3RL2A 4YUEH 2CH8A 1ORQB 3CVHH 4XMKH 3GIZH 2E6PA 3PGCB 2A74B 4LP5A 2YXMA 4UT9L 4FQXA 1B2WL 1FZJA 1YN6A 4PRNA 1EGJL 2NXZD 3GSRB 2YN3A 3QQ3B 1C5BH 3W2DH 1U8HA 2Z8WC 2GCYA 2XTJC 2CLZB 5F9WB 3SO5A 25C8L 1KXTB 2B2XH 4WW2A 3CDGA 3FQRA 1SJVA 5HDQH 5HDOA 4Y4KA 3OKDA 1HI6A 5C2UB 1BOGB 3HB3D 5DURD 4QRUA 5DS8A 1ZXQA 1MY5A 3SY0A 5IHZA 1XCQB 4PJBA 1K4DB 3O9WD 1KIRA 4V1DB 3VCLB 4IRSC 5E7BA 3NH7L 4NO2A 2WWMC 3RGHA 2BMKA 3QXUA 3SQOH 4ENED 4F37K 1DL7H 1KB9J 4PGCB 2L7UA 3ARGD 3U0WH 3BKYL 4FQJL 2OSLB 5F9OL 4LPYA 4K8RL 4KRLB 3GSWB 4ZTOL 1P53A 1XCTB 4LSQH 1T1XA 2Q86A 1UVQB 1KCUL 1DUYA 5JHDD 3KLDA 2R9HC 3HZVB 1Y6NR 5AYQA 4G5ZH 4LLVA 1S9YB 2DM3A 5IMKA 4HFWB 1UM4L 4LVOB 1IGFH 3IDYB 1PKQE 1JPGB 2RHEA 3HKFA 2DMKA 4J1UA 1LEKA 3UJIH 2EE3A 1FNSH 3NGBC 5H94B 3GJEB 1IFHL 2NYYC 3KPPB 4HXAL 4WO4B 5BO1H 1G0YR 5HBBA 1AXSB 5CEYB 1AO7B 1Q38A 4I5BA 2DQTH 4MA7L 3SE8H 2HH0L 3MLRH 1IC5H 5B38B 5CJBA 2V2WB 4PJ9A 4X6EA 5E2UH 3PWVB 1G7IA 1PW3A 5L2KD 1NCCH 2NW2B 4BQ8A 1U95A 1P7KA 4MQXD 1OB1A 1U58A 4XP6L 4XWGH 1F4HA 5I8KH 5M95B 3RVXC 5E08L 3MLSL 4PJBE 2YD9A 5DUML 4S1QH 4KJQD 4KMTH 5IQ7H 2GFBB 1NL0L 2W38A 1A6WL 1HINH 3ZSTA 1DBML 4N8CL 5EIIA 4Y4FA 3BOVA 5EIQA 2Y7QB 3WSQL 5GIRB 4WTXA 3WKML 3VRJB 3CCHA 4YEEA 2R1XB 3QI9A 4DN3H 2VLJB 3MUHL 3G08B 4DKEH 2ZUYA 1UB6A 1KULA 4I4WA 3V7MA 3DO7B 3GHEL 2CUIA 1FZKA 2ICWJ 2JCCB 2NY0C 1I1FA 5TF0A 5D1ZD 3VH8B 5T33L 1RIVH 3V4UL 4U1MA 1GZQA 1J11A 3H3PL 4NWUH 4PBXA 4TTDD 3BUYA 3CX5K 3RWEA 1T21A 3FQUB 4MNHB 2EDLA 3ULVL 3BXNB 1PEZA 2AK1H 2MNUA 3HUJA 2K7QA 4R4BB 4PJEB 3NCYP 4Z7UA 2PO6D 2VQUA 3R8BB 2AV7B 2FWOA 5ID1B 3VA2C 15C8L 4DGVL 1B0WA 2VH5H 3MRJA 5A16B 4C58B 3PIQB 3S36L 1GL4B 3PQYB 2O5YH 5HVHC 1JZ5A 1FL5A 4X98B 3IF1A 3HE6D 1C7TA 4YHIB 2F5AH 5DJ0A 3PJSA 2FZ3B 4X5WB 2X40A 2R0LL 1P84K 1CU4H 3ZYJA 1HWHB 2BCKA 2YSSB 4DVRH 3CSYA 4P5TA 1X5XA 3F7VA 1WCBA 3VFSB 5I74C 1N5AA 3H9SE 4M8QB 2F8OA 4NN5C 1Y0LB 4QRRD 3RNKB 5I8OL 2FX7L 4F8QA 4HKXB 1K2DB 2XTLA 1R5WA 2BNQD 3CLEL 2PYED 3FT3A 5EOQL 3LZFL 5HDBE 4X7DC 1LO2L 3AY4A 3D9AH 2H2PD 2MPAH 5DHVB 1CL7L 4YAQB 2IEPA 2L7JA 4KKCD 1QSED 1UB5B 3E6HB 3X11B 3W11C 3MJ9L 2Z93A 4N90E 3MRBB 3A6BL 1WEJL 5F8QC 3SDCD 2BOCB 3ULUL 2IANB 1XGTA 1IVLA 4UI2A 4L9LC 3CMOL 3CXHJ 1HHHB 3HI1B 3PL6C 3RL1A 4OLXH 1JZ7A 3HUJE 1BZ7B 2O5ZH 5HYEA 5KZCB 4E5XA 3KXFE 4Z7UE 1NMBL 4G43B 1Q0XL 4ZNEA 2ZUQC 4BFEA 2BVOA 3KYKH 4LL9A 2D2OA 1R0AH 4X8JB 4DKDC 4G8EB 4C4KT 2OQJB 5E2TH 5JIHA 4QT5A 5AZ2H 5D7IF 4JPIA 4OCYL 1K9TA 1DZBA 1YY9D 1UQSA 4P23D 3U1SH 3GIVB 4J4PA 4D0BA 3Q5OA 1TNMA 1D7FA 2ORBH 5IMMB 2PW2B 1M71B 3SGJC 4ZS6D 4YR6B 2J8UA 4G8IA 5C1MB 3LDBC 1KIQA 3IFLH 4G9FA 1R3IH 5M7QA 4N8VB 3ZZ1A 1TPXC 2WINB 1HHKA 3GMPB 1NCNA 3LQZA 2AK4B 4RGMC 5DC9B 2R2BB 3MCKB 3BO8A 1Q9OA 4MNGE 4DFHA 4LLMA 3KLAB 5GJSH 2RCSL 5CMAA 5I16B 3MV7D 3IGAB 5TDOA 5DD0H 4K3EH 3O81A 3EGSB 1QSVA 2NW3A 5KSBB 4OLZH 1VFMA 4L3EA 3SKMA 2C5DC 3RY4A 2FHFA 4LCIL 1RK1A 6CGTA 1HNFA 2OTWB 1ZMYA 4GRWH 4MXWL 2HFFA 3A67L 3UBXA 3CZFA 1N3NA 2CMRL 2X4RA 4MJ4A 3TCXA 4Z7QE 3NVQA 1AHWB 4MA3B 3TYGL 5BZDB 3EYFB 3NN8B 4L4VD 4XNYH 5J57B 4MD5B 4XP4H 5I1EL 5ADPL 1GPOL 2VIRA 1KEGH 1QNZL 1F4WH 2HLAB 2ICWB 3UP1A 2VISB 1GH7A 1KLGA 3DI3B 5HYSG 1HSAA 3H9HB 4X9IA 3WXWL 3MLXL 4HUWB 4PJ7E 3UEZA 4I48B 5IIEB 3TNNB 3CFDA 3WL9B 3UTOA 3TZVB 3FB5A 2J8UE 2YA1A 4HWNA 3SE3A 1YEFH 3BDYH 3CDYA 4QY8A 4QOKB 5ELIA 4N8PA 4WCYL 4DTGL 2PF6A 5A3ID 3FHQA 4ZUWB 5I19H 4WW2C 4I0PB 1G6VK 4Q97A 4RA3A 1C16A 1NMCB 3IJSB 1CK0L 4HT1L 1UZ8B 3QEGL 4L3CA 4KDWA 4LDOB 4P2QB 3VE0A 5F9JB 4L3EE 1ZK9A 1F4AA 3FCTB 1UWEL 2CIKA 3B5GA 4X4XA 3V5KB 2AXFA 3P30L 5TQ2L 5EZOL 4LVNB 3PV6A 2QSQA 5KVDH 2W0KA 4YHKH 3U7WH 5E4EB 2W9DL 1I3VA 1MCOH 4NNPH 2AJ3B 4U1LA 1OAKH 4QRPD 3CPLB 5D93B 5F3BB 4PJ7F 1NCUA 1MCRA 3HMXH 5IF0B 1KPRB 3QIWA 3RVVC 1I1AD 2CD0A 2O26U 5DJ8A 4C56D 3U82B 1G9EA 4P0DA 3ARDA 3EBAA 3FRPG 4J6RL 5DJ6B 1KFAH 1U8QA 1GC1H 3SKJL 3RWJB 1MCEA 5CKAA 4M02A 1U3YA 1JYWA 1LE9B 1KJVA 3HNTL 2QADC 5F96H 3BQUA 3QEQB 4XRCA 1KLFA 3NAAH 4NKQB 2D9QB 3S4SB 1T1ZA 3I6KB 1WQVT 1T6WA 3VXMD 4KJPD 3B9KB 4MQ7A 3Q3GA 1W0VA 3FONA 3CXDH 3O3AA 1MFDL 5B8CA 1J0ZA 2CR6A 1BGXL 3BPLB 4U7MA 4PRPB 3QUZA 4FQLL 3FJTA 5DFVD 5INDA 1K3IA 3KPRA 3LAFA 1UXWA 4QTIL 4JFZL 4NZRH 1U3HC 1QFUL 1LP9F 2IH3B 4Q9QH 1PD6A 4JHZA 4LSVL 3C6LD 5HGGS 5F93C 2YPLB 1INQB 3LRGA 4D0DA 5T1KA 5EOTB 5CSBA 4PJHB 4ZO8A 3MZGB 1W0YT 2Z4QB 3CAFA 2J7LA 5I1DA 3WO4C 4QHNA 1EGJA 4JZJB 1HILB 1S7VB 1A7RH 1E6OH 4RWYH 4YWGL 3QUMH 4OV5B 4LDEB 1CFTB 1XMWA 2ZJSL 4RX4A 3IJYA 4NQDA 1MJUL 5IMOB 1PKOA 1P4BH 3FOLB 3U36B 4KGLA 1HK6A 2QTEA 4JFDB 2E7HA 3LEVH 5ADOH 4MDIA 5F89B 1QZ1A 1OSPH 5IV2A 1S9XB 1DQLL 1J86A 3CU7A 1F4XL 5B39A 1IRAY 3T08A 3D39B 2Y36H 5DWUH 3KPSD 4PUBL 4QXUH 1QG3A 3VG9C 1NC2A 5D71L 1AGCB 4HS6A 2NXYB 4A2LA 1JF6A 2A6DA 4RMWA 1MPAH 2RFXB 5F3HA 2H8PB 1TLKA 3S3JA 5FAAA 3BESR 3HNVL 4WFHE 5F7FA 2Z35A 2ZCHH 2B8OT 1YECL 4J12A 5MHSD 2NMSA 2X9XA 5LGHH 3MJ6A 5TDPB 4LF3B 4GAJL 5GGRA 4LPTA 3UPAA 3SDDC 4WRLA 5KG9A 4UOJA 3P11L 4JY6A 3QPQD 1N2RB 3MRMA 2FBOJ 4CBPA 4PFEA 4F58H 3DGCR 1U3ZA 5FYKH 3V6FA 5K59F 2HN7A 3X13B 5ISZA 3MQIA 4OD2B 1P7QA 3CFBB 3D25A 5KSAC 1JHKH 3WJJC 3MRCB 3LVEA 3ZT6A 1X5IA 2IH1B 1BX2B 5JOPD 3RTQB 1NDGA 1XR8B 3A6CL 3MRLB 1TJIL 3LV3B 2FJFB 2GQHA 3LMJH 3DUHA 2QQNH 3UDWA 5TQ0H 4FZ8H 5E6IA 1KUMA 3C5SA 3NBNA 4OGAD 5I17A 3BP5B 1CE6A 3AY4C 5GS2H 2P47B 3NIGF 3O4LE 4H0GA 3PGFL 5AG9A 5I8CB 3F6LA 3WUZA 4YXHL 1H9VA 5LXGL 5EU5A 5D1XD 4ETYA 3VDAA 1DQJA 3ARGC 1ZGLP 1N6QL 5IVNA 4KTDL 1GCFA 2R1WB 4ODXB 4OIAA 4P46D 1CI5A 2GTWA 2VXTL 1ZEAL 2NY3C 4R97C 2OM5A 2KDGA 3ZYZA 4KKLD 3RPIA 2I07A 4DGYL 4PJFA 4PD4K 3FHAA 1L9MA 1OVZA 4YHLL 4JHBA 1WBXB 4J4PC 5JTWA 4PJAE 1HXMA 4ODTL 2APVA 5ISZE 1IM3B 5IR1A 3GSXA 3C8HA 1NLBL 1FPTH 1JRHI 1OD7A 2J6EH 5HTSA 5I8EA 1JRHH 3BKMH 4RFEB 4XVUC 3VFGH 2KZ1B 3AU1B 2EDYA 4U1GC 4M61B 1BAFH 1JI2A 1UCBH 4I3RL 1NEZG 3HAEB 2AJVH 2APWA 2H41A 5FYKD 1NGQH 2V2TA 5FB8A 2A73A 3VMOA 4OM0L 1H3WM 1TITA 3I6LD 4HV8A 4G3YH 5ESAB 1P4IL 2VZTA 4H20L 4OUUB 3SDAA 4NC1C 2GJZB 2HJFB 1CLCA 2E7MA 4JFED 3HN3A 4FTVD 2A6KA 1DFBL 4NQTA 3MODL 2DYPB 4NO0D 2E7BA 1Z0NA 1GAFH 1P1ZA 4JQVA 2VLRA 1BJ8A 2MCPH 5KW9H 5EZLA 3P77A 4ZOAA 1XGYL 2VB5A 4CN4A 1YEHL 4KZEH 3I3BA 1I8MA 2ESVD 5I1JH 4R96A 3VWKD 1MLBA 3MRDA 2JB5H 4H1LB 4MJ5A 5GS2D 4HSQA 1EMTL 1A1OA 3UX9B 4XMPL 1SY6L 2CKBL 1ONQB 3MACH 2AEQL 1VGKB 1E0OB 1VACB 3GSVB 4PJAF 4JQIH 4WTWA 4M8VA 1BF8A 2XNAB 2SEBA 3O6FA 1PYWB 3RHWK 1LO3H 5HVFB 4WW1B 3C5ZB 4YX2L 4E41A 7FABL 3KR3L 4HPYL 2VRAA 4NKOA 3WLWC 5BV7L 5J6HA 3HPLB 3L5WA 3UJJH 3ULVE 3G6JF 3IRPX 3WS3B 4ZQKB 4UBDC 5HGHA 3RWCA 2J4WH 3U48A 2NY6D 1R6VA 3C6SB 4H0HB 3SE3C 3S3SA 5CSZA 5B4MC 1Z9SA 4OB5L 1BQHG 2FBJL 1V3KA 4IDLA 1DBBL 2IQAB 3ARTA 1F13A 5D7JB 4NDMB 1OAZH 5L88L 5CEXB 5ANMA 3L95A 4NHCH 5HHNB 2AXGA 2OLDA 4NJ9H 1JWMB 4KKAC 4XNQA 3UTSD 1CZ8L 2CK0H 4TUOA 2V9RA 4PRID 5KOVC 4U6TA 1DR9A 3V95A 3KJ4C 4HGMA 4FQCL 1MY7A 3ZE2E 1AP2A 3STBA 2FH6A 1JGVH 5I18H 2NY2C 1WT5C 3PV7A 5DQJB 3CX5J 5C0BB 2HP4A 2YD5A 4NN6C 1DQQB 4XH2A 6FABH 2FD6H 2AJUH 5IVZA 4H0IA 1H3GA 4XVTL 2BSTB 4YK4C 4ZOBA 4HGWA 1A6TA 4GBXD 3TBYB 3Q1SH 4G6KH 1KPVA 2P8LB 5C9KA 4PJIA 2A38A 4HUVA 3NCFB 1E28B 1N7ML 2Z92A 1ZGLA 3ZYOA 3NIDE 3LH2L 1RUAL 2R23A 4GKNB 4RGNB 4I77L 1ULVA 3ULUE 1U8KA 3MV9D 3OB0H 4QHMB 2CGRH 4U0RC 5HHOD 4UV4L 4LRIC 1I1YA 3P9LB 1P84J 3LKSA 1C12A 4BYHA 3T8XB 2FB4H 4QHLB 4LIQL 1DQDH 1WSST 3LSOB 4LCCB 2BXZA 1RI8A 1T83A 3GJFH 1CLOL 2NTFA 4NN7B 4NKMB 5IB5A 1RMFH 3QUZC 1MWAH 1OQXA 5INCB 2KBGA 4LGPB 3QNXA 3UTQB 4PG9A 1FJ1A 4D9LH 1MI5A 5ANME 3T0EA 4NM8H 3PWPD 5BS0B 4R0LA 2GTZB 3MA7B 4JM2A 4KTEL 1E27B 2F5BL 3CMGA 4CKVX 4DWHA 3BN9D 4M62L 2AJXH 2XI9A 1Q0YH 4P4KD 5K33A 1N64L 1DDHA 5E9DA 1I85C 3GSOB 1CIUA 2HT3C 5TFSH 4LSUL 2JB6A 5LKNA 5FGRA 1RULH 3RGVA 5LGJB 5F1OB 4LLQB 2BVPB 4FN0A 1U92B 3B4NA 3HC4H 4HLJA 4FQQA 3ISWA 4O2CA 1D5IH 3ILPA 4OZ4B 4W4OC 4EVNA 2Z31D 4C59B 1XIWA 4X80H 2GJ6A 5D2NB 2HVJB 1OAUH 1GGBH 4JB9H 3TGXA 3N1PC 2XWBA 3PGCA 4FQHA 2VL5B 4Y4HA 4BH8B 2NX5E 2XKUA 3NABH 1Q9WB 3JVGC 4RISL 3QQ3A 4PRHE 5IQ9A 4K8RC 2JF1A 5KTEL 2FCBA 5J6GA 4J7RA 3WFDH 3F65A 4K2UL 1A6VL 1NCDH 2A1WL 4KVNH 2EYTB 3V7AG 4N5UA 3HTLX 1Y6MR 3G6AB 1AJ7H 1MIML 4XAWL 4IOSD 1KTLA 1FCGA 4X4YA 3QFDB 3BH9A 2X89D 4OD1H 5DJZA 1FDLL 1K4DA 3IFOB 3UZVB 4JZNA 1MI5E 2Q76B 2Q8AL 1OGAA 1BQLH 4RIRB 3T0EE 3GZKA 1AGDB 4ZUVA 5HHPB 1FFRA 4HAFA 1RUKL 3SKNB 4Y1AA 5D5MA 4G42A 1J5OL 3SDYL 5F7UA 3MXWL 5E8EA 4RFNC 1EZVX 1LDSA 4NHUB 5JLZA 4BSWB 2P42B 4MB5A 3G04B 2B1HL 3QIBD 4CMMA 1JFQL 2F15A 1JPSL 4FQXD 5E6IC 4OF7A 4K23L 3ZHKA 5ITBH 1KTDB 5KN5A 5CHNA 4O51B 4R7DA 1SEQH 1KGCE 5BZWA 1OM3L 4G8FB 1H3VA 1S5HA 5K9JH 1NGPL 2NTSP 2XKNB 2PKDA 2GJ6E 4O9HL 5DLMH 1N5YL 3LKPB 3T4YA 4Y4KD 4L3AA 4HIIB 3GJEA 4JVPA 4L5FH 5LBSH 2AVGA 5SWZA 2FJHA 3KPPA 4OLVH 1AXSA 3QIUA 2VKXA 4GMTH 3C9NB 4QGYA 3TC9A 1UM6L 3OHXB 2D4DA 4Z6AT 4JPWL 4HUUA 3UO1L 2XWJA 3DUSA 3E6FB 2P24B 1FIGL 1FIEA 2C3XA 1PQZB 2VQ1A 3TO4A 3UTZA 4NYLB 4NQCD 4K3HA 4WU5A 4ONHB 3TO2B 4KV5F 3QUYB 5GRXG 5C09A 3VXRA 3IXAA 1OAXL 4Z8FH 4JKWA 1AGBB 2UWEF 1SBBA 1OGAE 1A8JH 4LLUB 1ADQL 2FO4A 3DXAE 4JO4L 1UJTA 4Y1AE 5D5ME 5TDNB 2CRZA 4XZUB 2K3TA 2R1XA 3NA9H 4X9BA 3G08A 3KVQA 4HH9B 2V9TA 5C0JB 4OD3H 3QHZL 5GGVL 1RJLA 2JCCA 2V5TA 4OM1L 4JRYA 4JO1H 3C6LC 5I6XC 3W0WA 5B21A 1FVDA 3OJDA 3SDAC 3TN0D 3MO1B 3OR6A 1AQKL 4MD0B 1RIUH 1NAML 4M1GL 3O3BB 3RAJH 3MOAH 4QWWC 1JYXA 4HK3J 2GK2A 1QSZA 4PJ9D 4HULB 3MV8B 1L4IA 3BXNA 4OCMC 3TVMC 4PGDB 4BUHA 4R4BA 3OL2A 5H35A 5GZNC 3U7YH 1NFIB 3RKDD 4OF8A 4AIZA 1IGJA 2VDOL 2QQKL 1JWSB 4RNRA 4Y19B 4WU7B 1NCBH 4HX1A 3UBXG 1FYTA 1UKQA 4R4NC 5SWZE 3PNWA 3PIQA 4CW1A 1Z3GL 1NFDA 1RZKL 3F58H 1FL6B 3R1GH 4Y4FD 4GG6B 1A7NL 3KJ6H 4YHIA 4EI5A 3TT1H 1RHFA 3KPMB 1IZJA 2PXYA 3QI9D 1P9MA 2IAMA 3KG5A 3EO1A 4IOFD 4MAYB 2CUHA 1MCPL 3ULUC 4KY1L 4FG6C 2H32B 5LGKA 5DFWH 3S34H 1F02I 4MWFB 1E4JA 3VXRE 3HHRB 3EJYD 1S9VB 1YMMB 4M8QA 5DURB 1Y0LA 3RIAK 3M17A 1FZOB 4F7CA 4HKXA 3I85A 3R06B 4D8PB 4NPYA 4TRPH 5JQHC 3O9WB 4KVCH 4M5YH 5GS1C 2DN7A 3C08L 3WUWA 4LSSH 1F3JA 4BH7A 3SCMB 3GRWL 1I8LC 5JW4N 3GI8H 3PWNB 3OTTA 4M7LH 1WVZA 3W39A 4IHOB 4PGJA 4JRYE 3E6HA 1MEXH 2HJKA 3W0WE 1OP5K 3L3GA 2WIIB 4OLUH 5HI3D 2DQIH 1LHZA 3NACL 2ZCLL 4XC1L 2WBWB 1U42A 4E0RB 4HUMB 1QBLL 2YOCA 4M7JL 3GBNL 4QRSB 3EOBA 5D8JL 4BZ1H 4DUWA 5J1SC 2YA2A 4TUJB 4NWTH 1T5XB 5I75C 4OBSA 5KAQF 1DEEB 1FFNA 3UYPA 1G7LB 5AG8A 4YDVA 1E4XL 5IBTH 1CDYA 4ZS7L 1FYTE 2B5IB 5K9KB 1CVRA 4F80A 4MB3A 3CH1B 4WDIB 3EFDH 1NFDE 3FO9B 5JR1L 2F54D 1WWAX 4U1KB 1EHLH 4E42A 1RZ7H 5IMMA 5IBUB 4K71C 3GMQA 1JP5A 2R56L 2FSEB 2OP4L 2VXQH 1EV2E 1A5FH 4F3FA 2Y1VA 3VXNB 1G1YA 4H88L 1AD0B 3P2TA 4LSTH 1FORH 5E2VH 5E8DH 5HGAB 3LIZL 1YMHA 5B3JE 3B9AA 1NCTA 5DUPH 3IU3B 1SY6A 3QWOA 1NUFA 4ZPTB 2FEEI 1EJOL 1D3CA 3QXDB 4P46C 4XPAL 3UAJD 5JQ6L 5ACLA 2R2BA 5EORL 4NNYA 2VZVA 2DL2A 4M1DL 4LSRL 3S97C 5FKAA 1FBIL 5JXAH 1ZHKB 3BZFB 3IGAA 3K1KC 2XYCA 3FMGH 4GOSA 2ZSWA 1QEWB 4PG2A 4DVBA 3PABA 1KNOA 3BIAX 4DGIH 5EIVA 5EU4B 3HZMB 4IIQA 1IKFH 2ZKHL 3UCRA 3T0EC 1T1WA 3KLSA 3VFPB 1XR9B 1A21A 1U91A 3ZSSA 1D5BB 4TNVK 3ZTJG 3NPSB 2EO9A 2VXUH 1NFKA 3S88L 2X7LA 4JFFA 4H26B 5D1ZB 3V5HB 4Z7VF 1YPZA 3HC3L 3OXSB 3QULA 1WWWX 2DD8H 3ET9F 3T2PA 3IXTB 4PJGA 3VD4A 3UYRL 3IDNA 1KC5H 4Y5VA 5EU6E 2FIRT 4NGHL 3AXLA 5BZDA 2XACC 3NN8A 3U0PA 3QP3A 2R69H 2LU7A 4G9FD 3WXVH 2DBJA 4PJXB 2NY1B 1BZQK 3L3OB 2XN9D 3H9HA 5FA4B 5C86A 1OW0A 2WBJA 4OGXL 4I48A 3MUY1 3TNNA 3EW3B 2VMFA 4PD4J 2GY5A 3S5LB 5I1AB 1YEIH 3PWLB 1U0QA 2HKFH 5DD1L 3MOQA 3RY5A 4ORGA 4IDJH 1QQDA 4QOKA 4Y4HC 4NQXB 2HT2D 3N1FC 3M1BB 4WFEE 3O11B 2A2QT 1HE7A 2FX8L 4ODHH 1A1NB 5FO8B 3ES6B 3ZO0A 4LMQI 4MVBD 1KIPB 2GUOB 4LASH 3NCYS 4LCUA 5FYLL 2XXMB 4P2QA 2OS7A 5FGBC 1GRWA 2DQHH 4JDVA 1I7UB 5F88B 3V5KA 3JTSB 4GRLB 1RUQH 3S35H 1YQVL 5DYOA 1NCWH 1JPFB 3FFCE 4Y5XC 1QSEB 1T4KA 1U8PB 2X70B 3JWOH 4JFFE 4GS7C 2AJ3A 3WIHH 4ZMAT 1YPZE 3RUGF 1NC4A 2CIIA 2VLKB 4PJGE 4P4RB 3P0YL 1X5HA 3V0WH 1KPRA 3RJDA 4FA8A 3HCVB 4HJ0D 2JKXA 2Q7YB 2QQLL 2BRRL 4RFOL 4LQFH 2YK1L 5DJ2A 3X12A 1M7XA 5DJ6A 4P2RD 5GRUL 4BK5A 4X5XA 1AH1A 2HT4D 3D2UB 1R3KB 1EX0A 5FUOH 2BXYA 2ICES 3MC0A 1GGYA 4JCLA 3MRGB 4HG4K 4KQ4H 1QBML 3S4SA 2W07A 3P0GB 5FK9A 1YNLL 1FE8L 3FT4A 1D6EB 4P23B 4PJ8A 1X5KA 4MYWB 5FHAL 1A6PA 4HD9A 3ARBC 1A9EA 3AGVA 4UTAL 5BCAA 1RU9L 4NQVA 4IMLB 3GKWH 2AJYH 3GSNL 2EDTA 3ZHDA 4OZHB 1H15B 3G9AB 1MCIA 3ZKQD 5EC2A 3BIKB 2I9LB 35C8H 3STLA 3WFEL 3DLQR 4B50A 1E6JL 1JHTB 2DQJH 1F3RB 5L6YH 1INQA 1AXTL 3LN4B 2OI9B 2YBRB 5EB9A 1X3DA 2DMCA 4FHBD 4PJHA 2BNRA 5FHBH 2ZG2A 3RX7A 1C7SA 1JGUH 3MV7B 1O0VA 4LEXH 5L0QB 1ZLVH 1OTUD 3ARDD 4LIQE 4JFOB 3FO1B 4OV5A 4KJWC 3UC0L 3S37H 3EHBD 1JNJA 4LDLB 2FL5B 1KCUH 2VDLH 3AB0B 5IMOA 3FOLA 1N0XL 2Z8VC 5DHYB 3BQUD 3EYVB 5ITFB 1QLEH 4WHYH 4TPRL 4QYOA 3P4NB 3P4MA 3DUUB 4FFYH 5IEKA 3REVB 1U93A 3CD4A 4LFHG 1YA5A 3OGCB 4PJDE 3ARQA 4M7KL 5H2BB 3WCYA 5B3NA 1TZGL 4L4VB 3KPRD 2H3NB 5C07E 2IG2L 3VXSD 5DK0A 2H8PA 3M8OH 2ADGB 3LEXB 4YZFF 1ZTXH 2MFNA 5L9DH 3EIFA 2A9NH 5GGTL 5GRVK 3ESUF 4Q6IA 2AJZB 5T1KD 3T77A 4LF3A 3SE9L 4X6DA 3SHSA 1TTGA 1TTUA 5EO0B 4JJ5B 2G75A 2BSSB 1EAPB 4X99B 5E08H 3KPQA 5I1GL 2K9UA 5JNYA 2MMXA 4X7TB 3QPXH 5D6DC 3B2VH 3RWHB 4NQDD 3IDJB 1J0KA 2ZUTA 3UJTL 2E7CA 1LGVA 1P9MC 4MS8C 3WSQH 1CF8L 4DZ8B 3PDGA 1BVLB 3WEXB 4F9LA 3MRCA 2BNRE 2AI0L 5DJCA 2XA8L 3O4OB 3C60D 2LVCA 1HNGA 2JIXA 2H2SD 1F97A 2HVKB 5IJKC 1FLRH 1NC2D 2ADFH 3D69A 4Q2ZB 5IVXE 4R2GB 5SWSB 3VI4F 2VN4A 3H3BC 5HPOA 4HBCL 3BP5A 4U6YB 4N5EC 2V6HA 5FCUL 1JGLL 2KPNA 4OFIA 3ZDYF 1X5GA 4QRPB 4HLZG 3NFSL 5I8CA 1HSBB 2FLRT 3QUKB 3SDXF 3BX7C 1ADQA 4OZGE 1I1AB 3QO1B 1SJEA 3BD3A 4X6CF 4LEOA 5F1KC 4P9MH 1YEEL 2W9EL 5ISZD 3BJLA 1TVHA 4JR9H 2PCPA 4JY5L 1Z2KA 4WY7L 4KQ3H 3AS2A 2R0LH 4OCRH 4HFUL 5KSVA 1K8IB 4X6DE 4FXKA 1NAMA 3C87A 4I18B 4F7MA 3GSQA 3NZ8A 5GGSB 2IJ0C 3KDMB 4JPVL 4P49A 2OBGA 3CNKA 1GSMA 3HNSH 4KRPD 2RR3A 4KDTA 1CFVH 3Q2CA 1HKLL 3KS0H 3DX6B 3BPCB 1HZHL 3F12B 4HC1H 4G7YH 2R2CA 4KK6C 3OPZL 1Q1JH 1EFXB 2UYLB 2YC1A 4R26L 1BJ1H 4PJCF 1V3JA 5IWLC 2EC9T 5JPMA 3U4EA 2YWYA 3O45A 2UUDK 4Q58C 4NRXA 3TV3L 3IT8D 1J0IA 2IMNA 5LQBL 2P8PB 4YBLC 4CMHB 4OZGF 4MDJA 5K9QI 2CUMA 1T04A 12E8L 5TE6L 2HJFA 4PG2C 2Y07H 5BV7C 4QXTB 3QZWB 3O6LL 4JFHD 3F7YA 3EUUA 4YO0A 5H37G 2CR3A 3K1DA 1PBYA 4EUPA 4J3UA 3IKCA 2VN7A 3F5WB 4NC0B 2Y5EA 3JV6A 1H5BC 3W9EA 1AE6L 4H1LA 3KPSB 2BC4B 3GRWA 4ZODA 5MENA 4I2XA 2X9WA 2CK2A 4WWKD 5IJVB 3QDMA 4HIEB 5HJ3A 1L6XA 4Y16B 1YJDL 2I5YH 5IEHA 1INEH 5C0RL 4OZFH 1Q72L 3O2DH 3O6MH 5MI0C 5I1KH 3VMPA 4A6YH 4NZUL 2LV4A 3QUXB 2IFFH 3ECBB 3P9MB 3VGFA 1LD9B 3RI5K 4R3SB 5J7CC 2DI8A 3TJEH 1J9CT 1I8KA 4W70A 43C9A 2GAZB 2G9HB 1JYVA 3QSKB 1R5IB 1YEDB 5F7EL 4JAMA 3FO2A 3WS3A 1HDMB 1I8IB 5HYFA 4XNXH 1J05B 1CBVL 4XXCA 5TPWL 1WAAA 5E99H 5C7XL 3C6SA 4J3XA 4LLWB 1T0MB 4XCFH 3NZHH 4LLDB 2YPVH 5HYSB 2VLRD 4Z78A 2QHLA 5D7LE 3UTTB 1FNGA 1VGEH 4O00A 2CJUH 3QO0B 1CDBA 1JHLH 2EH7L 3O2WH 3HG1B 3Q6GL 5BVPH 2NY7L 4JVUA 1XZ0B 3H42H 3BH8A 5CINH 5EUKB 3MMEB 2BJML 1A2YA 3O6FD 3QDGA 4UU9B 5DQJA 3IAPA 4E41D 3CFEA 5T3XH 4ZFZB 4YFDB 3ULSA 2BY2A 3BEWB 2EYSB 3WDHA 4D0CB 4WFGE 4NT6B 4NOFA 5DMIL 4F57L 1R3JB 4ZUTB 4S1SH 5MENE 4JG0L 3RVTD 4I2XE 4XTRC 1IM9B 1TIUA 5EUOA 1FH5H 3QDME 2OZ4L 1CDHA 4ZOEA 2P8LA 5AUMB 3QDJB 1N6VA 3MLZH 2ZOKA 4IRSB 1YNTB 2A6JB 3WD5L 1IAIH 2EDJA 4P9HH 5D2LB 1RHHA 4JGMA 4YXKH 5C0FA 4QHMA 5EO1B 2X09A 2BK8A 3L3HB 3DMMC 3VXTB 1S7UA 5DC0A 4PJ8C 4AM0B 1FQ9C 5CAYB 1WAAE 4OI8A 5C0ND 2Y06L 3I3EA 2XV6B 5JOEA 1MHEB 4QTHA 5DVNA 1FFOB 3VGHA 4R7NB 5EOCJ 3FQXA 4TVPH 3CC5A 5CILL 2ZCKL 1TZIA 2F9BT 3HFMH 4KAQH 43CAA 2RJMA 1LEGB 3NFPB 4U1NB 3N85L 1E27A 3TLRA 1X5ZA 2QLVB 4UDTB 3NGBB 5C0AD 1A3QA 2DM7A 1WIUA 4WI3A 4J8RA 5E8OB 5IMLB 1K6QH 1T0NB 4JKMA 3DURA 1J87A 1MCDA 2P46B 3GSOA 5C6PB 3GNML 3BE1H 3QDGE 1DVFA 1LILA 4QO1A 5D96C 4KJYA 3WFHA 3MREA 2CDFB 4J6RH 2B1AH 3QCUH 2BVPA 5E5MB 4BA8A 2ERJC 3VXPA 3QQ9C 4RWHA 5DD6B 3Q48A 2ESVB 2VR4A 3GGWB 3MFFB 5DJYA 5EUOE 1JV5A 3HA0A 3FRUB 3WFBL 4EXKA 3LS4L 2F53B 4JRXE 1UH2A 4XCYB 5DDHB 3BKCH 5ALCH 1FVEA 3MLYH 2P43B 1IGIL 2XZQL 3BZDA 1X5FA 4RRPA 1DE4B 1S7RB 1NBVL 1QFUH 1IBGH 2C4FU 1NANI 1YNKL 3T0AA 1G9NH 3CLFL 4Z0BL 1NANH 3U4BH 2P5EE 2V17L 4G8GB 1QRNA 4XCEA 5DMGD 4G6ML 3CZJA 5EPMB 5ABDE 3O3UN 3ARFB 1Y6KR 4LSPH 1V7ML 4GAYB 5E9DD 1FO0L 2BSRA 3DETC 1ZSDB 2Y72A 4EDWH 5ID0B 3OKKB 1E4KC 3GBLA 1TNNA 3QFDA 4O5LL 1Z6JT 3JWDL 3IFOA 1O7VA 5CGTA 3RGVD 3BP4B 1F6AB 1TVBA 4JKPH 2VAJA 5DRXA 1OAQL 5HHPA 3VDBA 4APQA 3MZTA 3V4VH 3AFLA 1N8ZB 1JNLL 3EDJA 4XBEL 1TCMA 5GRZA 3MRNA 1TZHB 4WI6A 1XIWD 3L1OL 3EYQC 4TVPD 3EJZD 4NHUA 3GSNA 5CP3H 2Y23A 5I1HL 4JN2B 3T3MF 4BSVA 5IK3B 3QG7L 1IEAB 3TWCL 2BVUA 3ALXA 4ZSOB 3GBMH 2XFXA 1TMCB 3VXUB 1I3RB 1PAMA 4FXGA 1VERA 3GMRB 3BGMB 3O8XC 3WUWG 4LAJH 1MAML 4PLKD 5FYLE 3FKUS 4OCSH 1FGNL 4KHTL 1KJMB 1A3RL 2EE6A 5I74B 5BRZE 1Q9KA 3DO3A 1G9ML 1I1RA 1OSZB 3H3KA 5IW1A 1FL3A 3H8NA 1RUML 3ZE0E 2VDNL 1RV6X 4HGKC 1XGRB 5CZXD 3A0OA 4V1DD 2AKRA 5F7MC 4RMVA 3LQMA 1W72L 3QR2A 1OGAD 2MTPA 4KMLB 4YGVB 3VXQA 4NOBA 2X4QB 4NKDB 4P2OA 1KV3A 4RAUB 1QRNE 3WS6C 2XPGB 4DKFH 1L7IL 3E6FA 3K2MC 5DEGA 1JF1B 1G0DA 2A83A 5C0GB 5GRJL 2RAMA 4ZFOB 1DANT 3G5XA 3SKOB 5IB2A 3QH3A 4KDTC 5DD3H 1U8NB 5GGTA 1OWRM 1NPUA 1J10A 3VW3L 4UQ2B 2OR9L 2VR5A 3BZEA 4XBGB 4Q9RH 3GMMA 4YDKL 2YPKB 2DLHA 2X4PA 1H3UA 4PLNC 3DX8B 1WFTA 2K7PA 4XZUA 1DN2A 3SKUD 1JNHA 4AT6B 3VWJA 1RZKC 4HH9A 1X7QB 5C0JA 4ZG1A 3PGFH 3HE7B 2VDKH 5C2BH 4WENB 1G7PB 4Y2DA 5GGUB 4WO4D 4OFYD 5IB4A 2UZIL 1YUHB 4K7PY 1A9BA 1TCRA 3LDBB 4YXLH 5EN2A 1D9KA 4F7EB 3K8MA 3N1GC 5GJTH 5GGQH 3MBEA 5DVMA 3KYOB 3OF6A 2HWZH 4I3SL 1YDPB 4Z7NF 3KYAA 1PLGH 2Z31B 3TO4D 2HTLD 3MOBH 2IQ9L 5C09D 4XVSL 4X9HA 2DBLL 1ZKAA 2P7TA 4PGBB 4YHZL 3RDTA 1DBJL 5JXED 4HUNB 3VXOB 1MCNA 1QYGH 4ZPVB 5TE7H 1QHOA 1UXSB 4ODTH 3NA4A 4L29B 4LPCA 4W68A 1FFPA 3WHE1 3B2UC 3AVEA 3FO0H 3HC0A 3PDOB 4O4YL 2J1KA 2VLJD 5HGDB 3LKRB 1G1CA 5L8KB 5JW3L 1DJSA 4MNQA 1UJ3C 4ODWA 2JELL 1HXYA 3V79C 3L3KB 1IGTA 4Q6YA 4N9OB 2DIJA 5E2WL 1DQML 3BIBX 1LO5B 2ITCA 3QHFH 1BD2A 2DKSA 4DQOH 1D6VH 3ZKMD 3DI2B 1FC1A 4GAGL 3QB7C 1FNLA 2FHCA 4BQ9A 1KB5B 3T2QA 3GI9L 2L4OA 3IRZA 1HWGB 1NUGA 3IKKA 3S96A 5MP6L 1FGVH 3KPLB 3MNVA 4YHOL 1GGCL 1PKQB 3UPRA 4G6AD 1QA9B 1Q94A 2EDRA 5TF1H 4NKIL 1T80A 4DW2L 1YN7B 1FYTD 1FP5A 1A6ZB 1J8HA 3RL2B 5E2JA 3DARA 4WJ5A 4L8CA 4FQXB 1YN6B 4PRNB 2C26A 4XMPH 4XPGH 3DGGA 4MZ3A 3N9GH 1I7RA 3WDJA 2HRPL 4POZC 3TESA 1ZVSA 1U8HB 1MJ7L 2J88H 5C08A 2IAMD 2GCYB 1T5XA 1DEEA 1KBGL 4WW2B 4YBQD 2UVFA 3CDGB 3FQRB 5T1DL 4HPYH 2EIEA 4HMCA 1OQOA 4Y4KB 1PG7W 3IAQA 3OKDB 1HI6B 4WDIA 5I15L 4QRUB 4Y8AA 4QXGL 1ZLUK 3SY0B 5IHZB 4PJBB 4Z5RA 3DX7B 3EOYG 4QEGA 1KIRB 1IGYA 2APXA 4IMKA 3MRHA 2WUBL 4JKKA 5FCSH 4S0TD 1T5WA 3VFOA 4G7VL 1RPQA 5HGAA 4MNQE 5JDSA 3D6GA 4KPHL 3FB7A 4ZPTA 1LE5A 4PGZA 4G6JL 2BSED 3G5VA 1CXFA 2ICWI 1BD2E 1AFVH 3BWAA 4PP1C 3RY6C 2G2RA 1X4ZA 2IAND 3BMVA 4XP1L 1T1XB 4W6XB 1OTSD 4JM4H 4V2BA 3H9ZA 4JREC 1DUYB 4UV7L 2R29H 4AY0A 1QEWA 3WN5A 2XZCL 5C3LD 3ILQC 2DQDL 2OJZL 4LLVB 4MD4B 5IMKB 5KZCD 2QADB 4GQ9L 5KJRL 3R4DA 3NCJH 1U36A 1N0LA 3ZT7A 4WEBH 2B0SL 1LEKB 1V05A 4QRQA 1J8HE 1LMKA 2IPTH 4GFTB 1JPTH 5EZIL 3U9PH 1MVUA 4LKCB 3BRGC 2BDNL 3H6JA 3VFRB 3IXTA 4I5BB 1XH3B 2VR9A 2EXWD 5HHVH 5CCKH 1BZ9A 1L7TH 5C08E 1XAUA 1MREH 4GW5A 1RZGA 1IQWH 3LH2H 4X6EB 1A7QL 4EXPX 1G7IB 4TVSa 3L3OA 3KNBB 1N4XL 1G7JA 1U95B 3LEYH 1JZ6A 4GW1A 1U58B 4HWUA 2AK4D 4EN3A 4XT1C 3JUYA 1TETL 4X6BA 1KCKA 5JHLL 2RIKA 2WUCH 4PGEA 4OCLC 1F58L 5EIIB 4Y4FB 4FMKA 1FFQA 3W81A 2R0ZL 2R4SL 4GO6B 3BUTA 1CXKA 2MQ3A 3CCHB 4KI5F 4NO5A 4ZXBA 3QI9B 4A2MA 1F8TH 3GUTA 1UB6B 4PB9L 2OZ4A 4I4WB 1OCWH 4PY8J 5IB1A 1SJHA 2QJDA 1FZKB 1O5DT 5FO8A 5IB3A 1I1FB 3ES6A 1MLCA 1PZ5A 5FECA 2P49B 1MHHA 1EO7A 4JGJA 1J0JA 3T2NH 4U1MB 3VG9B 1GZQB 4XP5H 1Q9LB 5IFAH 1KEMH 2BNUB 3BUYB 4UIMA 3RWEB 2IBBA 1T21B 3CK0L 3QCTL 3MXVL 3VGAC 5F88A 3X14A 4JO2L 1CXEA 1JWUA 3HUJB 5HHME 5GPRA 3VD5A 1A4JA 4Z7UB 5CEZL 3T1WA 1UACL 1RIHL 2FWOB 5DGRA 4KXZI 2X70A 4WTZG 1B4JL 2D9CA 3CSBA 4N0UA 3MRJB 4KXZH 1A7PL 2X4OA 3TZVD 3GSUA 1FL5B 3DNKA 3IF1B 2FRGP 4QOKD 1NSNL 1J1OL 1G6RL 5E1AA 2AQ1A 1NCAL 4ZFGL 4BQCA 1YEKH 3R0MA 2BCKB 4KUZH 3SE4A 3CSYB 1R3KA 2E9WA 3CFJB 4P5TB 3F7VB 3TA3A 1WCBB 4I0PD 5C0EA 1WWBX 1N5AB 4K2UH 4XP9L 3OKLB 4NZTL 3K2UL 2IBZY 4ZNCD 4MNGB 3F7PC 3FAWA 1U8MB 4DAGL 1MFBL 3QFJA 1F00I 4P2QD 1R5WB 4YDIL 3V6BR 5KVGH 5HD8C 3FT3B 4IMLA 4PRAA 4CN1A 5F9AC 3WHE0 1G7HA 4JRWA 2GY7B 5IG7B 3BIKA 1HQ4A 2I9LA 4PREA 4M6NH 2Y9RT 1WZ1L 4XPFL 1IMHC 3ARXA 4D3CL 1C1EL 2Z93B 1J5OH 5CD5D 3MXWH 2FEDC 4NCC2 4OT1H 5FDWA 1CFQA 1XGTB 3GM0A 4FOMA 5GHWH 1ODAA 2DLEA 5FYJH 4KZDH 4LCWA 1GHFH 1NLDL 4TSAL 3RL1B 4Q74A 1MRDL 4E5XB 4IOIA 3ALPA 5C0NC 2BVOB 1KYOK 5F7YC 3EYVA 1FO0A 3QEQD 4N0UE 2OL3L 4QT5B 4PJ7B 4K3DL 4B5EA 1NGPH 2GSGA 3B9KD 8FABA 2OTUB 1WBZA 4UT6H 4D0BB 1I9IL 3NTCH 2D7TH 3OGCA 4L1DA 3S37X 1F2QA 4PRPD 2C1PB 2J8UB 4G8IB 1KIQB 5T5NG 5KVMC 1EUUA 2RB8A 5DK2A 4GKZA 4U1GB 2ADGA 2X1XR 1EIBA 3QAZB 3V52L 3ZTNH 1RUPH 4E9LA 2Y6SD 5JMOC 1SM3L 2VZUA 4EUPG 3X3FH 1HHKB 3OAYH 1OAYH 2YPLD 3LQZB 1CQKA 3UZEA 2Q8BL 3BO8B 4LVHB 4AMKH 2BNRD 4LLMB 5J56B 3F8UB 5CBEA 5ICYA 2HMID 5CMAB 1U9KA 3QFJE 4IRZL 4Q0XL 1X6NA 5EO0A 3RDTC 3JUZA 5TDOB 5AZEL 1BVKA 4UTBL 1RVFH 2NW3B 5D1QA 4MQSB 2JCCF 4L3EB 3SKMB 1JGEA 3HI5L 3RWHA 5D4QA 3AMKA 4ELMA 1CLZH 1HHIB 1RK1B 4JFDD 4DZ8A 3WNLA 1BVLA 1CDGA 4U7SA 5JMRA 3INUH 3VRLE 5KS9A 1QFWL 3UBXB 1S78D 2VSCA 3CZFB 1JVKA 1MRCH 1MHPL 1GGIL 1W72A 4LCWE 1N3NB 3D39D 2X4RB 3DRTA 1WJ3A 2WBKA 4PJEF 3N0PB 1UENA 4P9HC 5KANG 4Q2ZA 2VIRB 1U8IA 4KI5C 3KHQA 5FYJD 1KLGB 1HSAB 5KSUA 1BIHA 2UVEA 2F58L 2EE2A 5IHLB 5IM7B 3BFOA 4TOYL 5HYJA 4UMGA 3THMH 1C8PA 3CFDB 2IMMA 3L3DA 2HA1A 1HSBA 4L1HA 1M4KA 2VDPL 3I2CL 1WF5A 4WHDA 1V7NH 4QY8B 4AEFA 3IJHA 4QCIA 3JXAA 3D5OF 2MHAA 5I1IL 4XPHH 4OJFH 4FZEL 4JQXC 1BM3L 1C16B 1L0XA 1MFCH 1YQ2A 3EJJX 3MRKB 3TPUA 5IT2H 4LK4A 2R0KH 3KDMA 3OSKA 3S36X 3BJ91 3VE0B 2ICEB 3EAKA 3ZL4H 3MROA 2EZ0D 2CIKB 2NY2B 4IMKC 4X4XB 1SVCP 5E95B 4ELME 2DI7A 3PV6B 3ZE1E 3F12A 3QXTA 3U4AA 3NCMA 4H1LH 4Z77B 2E9JA 4Z9KB 4EIZC 5KS9E 5CZXC 1OHQA 4U1LB 2YWZA 4OZIE 2E7LC 4NP4H 4NFBA 1R5VA 4TN9A 2C3WA 4O02H 1N59A 3QIWB 3L9RA 1SQ2N 1KENL 1W8OA 4XCCL 1WUNT 3PHOB 3ARDB 4KK8D 2A77L 4XVJH 1HOCA 1U8QB 1IEBA 1PG7L 4HXBH 5TE4H 3ARVA 3VFMA 3QXAA 1ETZB 4RGOH 4U0RB 3BQUB 1T1ZB 5FM5M 5IKCA 1C5DA 5KVEL 1HH9A 3Q3GB 1W0VB 3FB6A 4EBQH 3D18A 4EEEA 3O3AB 5DMKA 5B8CB 4U1SB 1KF9B 2NY4D 1V8HA 4TNWF 4LVOC 3IDYC 3QUZB 2VDQL 4HF5H 4J3TA 2X4TA 5INDB 1MF2L 3KPNA 3KPRB 1UXWB 2GEEA 4Z95L 4X9GA 3VI3F 1OARL 4Y16A 4ZTPL 3SJVA 4AEHL 4DCQB 4S1RL 3U2SB 1MCBA 4XNMB 1AD9A 3QWRA 4D0DB 2P5WA 5T1KB 1CXIA 1A14L 5IESH 5CJ5A 5KSBF 3QEHB 3GO1L 5I1DB 4HWBL 2KH2B 1R3LA 5LJYH 5EORH 4ZO7A 4RAVB 1J05A 3WFCH 1T0MA 4GMSH 2DYPD 2DL9A 3RX8A 3SOBL 5JXEC 2VAAB 4WHTA 1VEPA 1B3JA 5J9PA 5IV2B 5B22A 4LHUA 4R90H 3OWEA 5DD5H 3H2WA 3I6GA 5LCVH 5GQBA 3WIIH 3TH2T 1IILE 2QHRL 5MEND 1IQDA 2HLFD 4P3CL 2BVTA 1NC2B 3QDMD 4ZO6A 7CGTA 5F3HB 3UYRH 4UNTA 4HUXA 5DJDA 5T1LA 2Z35B 1MFAL 5DRNB 2YXFA 3HI6L 3WIFA 4BZ2L 5I1CL 4GJTB 5ILTH 3WBDA 2V7NA 2ZP0T 4OFDA 3HPJA 5F9DC 5GGRB 4D0CA 1KG0A 5E94A 3WE6A 5KG9B 4JY6B 3MRMB 1IM9A 4AG4H 4D9QE 3OZ9H 4UT7H 4F7TB 1C08A 4CU6A 2A9MH 3V6OE 4O2FA 4P2CG 3ROOA 4M5ZH 3V6FB 4UB0L 1F3DJ 3B9DA 5ISZB 1GXEA 4G80A 3BHBB 1P7QB 2D7MA 3D25B 2IBGA 4X7SL 2VO5A 2P5WE 2Y5TB 5JW4Q 3KAAA 4NO3A 2X6MA 2CDGA 5FUZH 2WV3A 4XPBH 4RFNB 3RIFK 1AR1C 4LOUC 1PX3A 5I30H 2ZPKL 1NDGB 1UWGH 5I0ZA 1Y18A 1BEYL 4KRPB 4FQ2H 3FRPA 5E6IB 5SX4I 3PDDA 5JA9A 1IC7H 3C5SB 5SX4H 1HN1A 5I17B 1CE6B 2R0WH 3IFNH 2X9YA 5C0BD 1KELH 2W91A 3MLWL 2PN5A 4NFCA 1LEGA 3NFPA 2VL4A 1BFVH 4CN6A 2AQ2A 1P2CA 4UDTA 5EU5B 5IROC 4KHXH 1S7SA 2YEZB 2AJSH 3TT3L 1WZKA 1OPGL 2CLRA 1SBSL 2YK1H 4UILL 2XTJE 4Z7OE 1HCVA 1UWXH 4QRTB 4KROC 3RPIB 3IFPA 2I07B 1XEDA 4PJFB 2EEBA 2XQYG 2R2HA 5DMJB 1X5YA 2X44D 1L9NA 5D9SA 3FRUA 2EEDA 4HPOL 3PXHA 4Z0XA 1HXMB 2OR8A 2X1OA 2ID5A 5IR1B 4OSUL 2H26A 4PJHF 4M3JA 5I8EB 1MHCB 5GZOD 1RU9H 4OI7A 4ONFL 1AY1L 1U8LA 1DE4A 4KK9D 5IP4A 1NAKH 2OK0H 1K5NB 2EXWC 4POYA 2X4SA 3JSSA 3AREA 5FB8B 4PV9A 4OIIH 3UTPD 2A73B 5IFHL 1HYSD 3O0RL 1AXTH 3QNZA 1T03L 5EPMA 4HV8B 5CJQL 5DO2D 2DM2A 5BMFL 4WUUA 3SDAB 3U30B 2FR4A 1DVFD 1RZFL 4AEIL 2VLME 5ID0A 1EO8H 1KCLA 5D1QC 2X41A 2A6KB 2F8VA 1DBAL 4OTXH 1P1ZB 3TVMB 1F6AA 1X5LA 3O2VL 5EZLB 3P77B 1HH6A 3GMLB 4U7KA 1XGQA 1I8MB 1N0XH 1N8ZA 3GK8L 4R96B 1MLBB 3MRDB 1TZHA 3L3JA 1BBJA 4MJ5B 3MA9H 1GYAA 1ACYL 4B41A 1A1OB 3MUGB 2WAHA 3EOTL 5CJOH 4M43L 3RA7H 4JN2A 3B9EA 5IK3A 4DK6A 5MERA 2D03L 3EYOA 3LD8C 1WFUA 2DDQH 4YUEL 4ZSOA 3MBXH 3O6FB 2SEBB 3CVHL 5C0CE 4XMKL 3GIZL 3BGMA 3KLHD 1AHWC 4NKOB 1KXVC 5J6HB 3VGDA 1QRND 1YEJH 1OF2A 3L5WB 5GGTH 4PTUA 4TSCH 3A6OA 1KN2H 2B2XL 2PW1B 3D85B 5HGHB 2C3GA 3RWCB 5HDQL 5CEZE 5I76A 2FECI 3ETBF 2LU3A 5CSZB 5GS1B 5T5FH 2OL3A 4MCYB 4EOWH 1YC7A 1CDUA 4NCC1 1NH6A 5HSFA 2JJWA 4APQD 5GSVA 5ANMB 4IRJC 1W2KT 2DLTA 3L95B 1OT1A 5JO5B 5HPMA 2AXGB 2F19H 2YRLA 4PLJC 5FGCE 4XNQB 3DOSA 2AI0H 4TUOB 3SQOL 1DL7L 4HQQH 1GIGH 3U0WL 4L9LA 4I0PC 4WUKH 5C0IB 1AP2B 2OXHA 3PL6A 2HFEB 3BKJH 4LSQL 4MLSA 5I75B 2YPKA 2RQ8A 3BD4A 4HZLA 4XH2B 3I75B 5BOPA 3CUPA 4YHMH 4G5ZL 5IVZB 3P40A 1R3HB 3MCLH 4HGWB 4LVNC 3NFSH 1LO4H 1KPVB 5E4EC 4I9WE 3UJIL 4HUVB 3SGJA 2Z92B 4K71B 1ZGLB 1FNSL 1T20B 5D93C 3RVWD 2WZPD 5CD5C 3KPOA 4NJAH 2H32H 2YUZA 5BO1L 1U8KB 1YEEH 4F7EA 4P2OD 2DQTL 2DQGH 3SE8L 3MLRL 1I1YB 1NEZA 1IC5L 3LKSB 1C12B 1FCCA 3KYOA 3CU1A 1JN6A 1YDPA 3DV4A 3OKEA 5E2UL 3VMNA 5GISH 1NCCL 2EDFA 2FGWH 4KU1A 3QUYD 5IB5B 5EBWA 2YUVA 1BLNA 4JPVH 4XWGL 5I8KL 4N1HB 3VXOA 3B5TA 1MQKH 3QNXB 4M1CD 3V6OC 4ZPVA 3B9KC 4S1QL 1FJ1B 1UXSA 4KMTL 5IQ7L 2CRMA 1HINL 5DSCA 1MI5B 4I8DA 3T0EB 4R0LB 5F7LB 3W82A 3PDOA 4JM2B 3VWJD 4X83A 5T3ZH 4LKXB 4DN3L 4DKEL 5ERWB 2E8YA 3MRQA 2Z8RA 2MWCA 5ACMA 4Y2DD 5DRWA 1RJYA 3LN9A 1LO5A 4WEMB 1ZLVK 2JB6B 5JUEH 5F6HJ 3O6KH 1E4WH 4D9RD 1RIVL 3HLAB 1TJHH 4JZJC 4NWUL 4W4NA 3MBED 4FQQB 3OF6D 4O2CB 4ERSH 4BSJA 3ILPB 2AK1L 1CD0A 2E27H 1KYOJ 4TULH 1IL1A 5I73B 2GJ6B 1S5IH 5DEZA 2OJEB 4DKAA 1A6ZA 4UQ3A 4LRNH 2UZXB 4JY4A 4O2EA 2XWBB 1MJJA 2VH5L 4GW4A 4RMSA 4TUKH 1UEMA 5E8NA 5IGXL 4FQHB 3L5XH 4Y4HB 1BQHA 2O5YL 5IQ9B 2F5AL 1ZA3A 4MAYD 5J6GB 1A6UH 4JN1L 3L7EB 2NXYC 2CKNA 1CU4L 4MNQD 5CP7A 5IOPA 4ZAKA 4DVRL 3ROLB 1YMMD 1KTLB 5F7EH 3T0BA 4X4YB 3BH9B 4CRPA 5LG1A 5I71C 3HMWH 1JCKA 5DJZB 3DX7A 1DP0A 4JZNB 1OGAB 4ZUVB 5J13B 3SCMD 3RZCC 3TH4T 3DXAB 4Y1AB 5D5MB 4G42B 5ECJE 4Y5XB 2DQCH 5E8EB 4GS7B 3D9AL 2B4CH 3RBGA 2MPAL 1IKNA 2BOBA 5JLZB 1PZUB 3AM8C 1J8HD 4AH2A 3U0TB 5T3ZD 4CMMB 4N0CD 3RTQC 2XKSA 5KN5B 4OF6A 5CHNB 1BREA 1HQRA 4R7DB 5BZWB 4MD4A 4OLXL 1S5HB 2UY7A 4NRYA 4HWBA 1CTOA 1T1YA 2O5ZL 4ZFFA 4R8WL 3T4YB 5J11C 3KYKL 1RQ5A 1R0AL 4OFKA 1J1PL 4LKCA 5E2TL 3BT2H 5SWZB 2FJHB 3ARBB 3QJHB 3VFRA 1RZJH 1URLA 3QIUB 1F90H 1XH3A 3U1SL 5D2NE 3NPZB 5H8DA 3C5JA 1U3HA 3TBTA 2X5PA 2WLYA 3L6FA 4HUUB 1LWRA 4FQPA 2XWJB 3AAZA 3CSPA 3DUSB 5E5UB 5E6YA 5HI5D 3IFLL 5DQ9A 5GGRY 2AS5M 2AABH 2VQ1B 3KNBA 4QKXB 3TO4B 1R3IL 3UTZB 5FF6A 4WU5B 2I26N 3PHSA 5D7IA 5C09B 3VXRB 3IXAB 2OXGA 3QJFA 1IZKA 3H9SA 3T3PF 4XHJD 2IALA 1Z5LA 1H3PH 1ZHBA 5GJSL 2FO4B 4RZCA 1OWWA 4OLWH 5DD0L 4K3EL 5DT1H 4OLZL 1X4YA 2J12B 1JTPA 3AREC