3BEWA

10mer crystal structure of chicken mhc class i haplotype b21
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
271
structure length
271
Chain Sequence
ELHTLRYIRTAMTDPGPGLPWFVDVGYVDGELFMHYNSTARRAVPRTEWIAANTDQQYWDRETQIVQGSEQINRENLDILRRRYNQTGGSHTVQWMSGCDILEDGTIRGYHQAAYDGRDFVAFDKGTMTLTAAVPEAVPTKRKWEEGGYAEGLKQYLEETCVEWLRRYVEYGKAELGRRERPEVRVWGKEADGILTLSCRAHGFYPRPIVVSWLKDGAVRGQDAQSGGIVPNGDGTYHTWVTIDAQPGDGDKYQCRVEHASLPQPGLYSWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I glycoprotein haplot
publication title Structures of an MHC class I molecule from b21 chickens illustrate promiscuous Peptide binding
pubmed doi rcsb
source organism Gallus gallus
molecule tags Immune system
total genus 64
structure length 271
sequence length 271
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bewA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3bewA01
1X5JA 1HKLL 2EZ0C 2AKRA 3Q6FB 1FL6A 2NY6D 4JFDA 1G7LB 4YK4B 2J4WL 1EFXB 2ADJB 5GS2H 4U6VL 3IXTB 3GBML 1IM3B 1R3LB 4OI8A 2PUQT 3KXFB 3CX5K 1DQTA 2AJVL 2YD4A 1DUZA 5CD3B 4GRWF 4H88H 3TBTB 4OZGE 2IADA 1NCNA 5CBEA 1ES0A 4GS7B 3AM8A 2OP4H 3TO4B 3RHWK 5FA3B 1XCQA 1FVDB 2X41A 3B2VH 1P4IH 4HJGA 4PJ9B 1JWMA 5F1IB 4PGDB 4YPJA 5T1KA 3M17A 4N0CA 1M6OB 4LKCB 3T04D 4X5XA 3OXSB 5AAMA 4HFUH 4RMRA 4OFKA 5I8EB 4E9LA 4JGUA 4D3CH 4J6RH 4LP5A 5B21A 3HAEA 4G6ML 4QT5B 4KI1A 2MCPH 4ZUSA 4H0GA 1PVHA 4H5SB 4M1GH 3WJLA 1ORSA 1AD9B 1BREA 1OF2B 3QDGB 2X1OA 4R96A 4KFZC 5FB8B 3DLQR 5JW5B 2E7LC 4JQVA 1GHFH 2X1QA 5F3HA 3UP1A 3HE7C 4NC2B 4LSSL 1IZJA 4FQJH 4YEEA 1JGLH 5F97E 3KPTA 4DVRH 1G7PB 4M61B 5F7NC 1U9KA 1I3GH 1FNLA 2BSRB 2VYRE 4N68A 1CGUA 3MREA 3BPOB 5DJ6A 1GYAA 3MRKA 3P0VL 5GGVY 4HC1H 4RGOH 2APBA 3S7GA 3SDDC 3OJMB 4P4KD 5C3LD 4PJDE 3TYGL 3B43A 3MACL 1S9XA 2DLFH 5GRYA 2X44D 4MQ7A 4FG6D 3FB6B 3KPNB 4PJ8B 4WI3A 5DWUL 5I1LA 4KVCL 3LCYA 2ZSVA 5E2WH 4AH2B 1BOYA 3OXRA 1T83A 4JKWA 5LAXB 3MO1A 1EEYA 3DYMA 1MJJB 4OJFL 4XNQA 5DMIL 4MS8A 4YHYB 2BY0A 1IEAA 1CIDA 2JCCB 3RBGA 1EBAA 3RWFB 5BW7C 3QAZB 2PO6A 3K46A 4DW2H 1CFTA 1JF1B 3ARBC 5BJTA 2OL3B 2NY4C 3VFSA 1Q9OB 2DJUA 4TSBL 4X6BB 3RWGA 2O5ZL 3CFDA 1N59A 4G6FB 4NFDA 3VFNB 4FQ1H 1MVUA 1AO7A 1PKOA 5AZEL 2X70B 1T1XB 1KJ3H 2ZUWA 3OJDA 5DUPH 1T80A 1VFBB 4Q97A 4ETQA 5EU3A 4JZNA 3H9HA 4WWKA 5L88L 3ULVE 5ISZE 1AHWC 4QTHA 2RR3A 2QEJA 1B0RB 2MQ3A 5IMLA 1H3UA 1ZWIB 2O5YH 5DO2C 4Z7OE 1FAIH 4S2SA 1CDJA 2QSQA 3TP4A 4ODWA 4WV1C 4WU5A 4DWHA 4U2ZA 2XWTB 2C7UB 5GPRA 3EYUL 2FIKB 1FQ9C 3UJJH 3VDAA 3L3HB 4EBQH 3ERYA 3HZMA 1JUFA 3FO9B 5ESAB 5C0RH 3TVMA 2Z91A 3T0ED 3CLFL 1N4XL 2J88H 2OL3L 2Z92A 4OFVA 5FUZL 1N0XH 2OTPA 3G6DH 5FYLE 5IVXE 3SDAA 5JUEL 2ITDB 4QRQB 2P43B 4MA8H 2VLRB 5D2LA 3PHQB 4U1JB 1OGTB 3KYOA 4M6OL 4UAOB 4UQ2A 5I1JL 3WXWL 1ADQL 4KHXL 2R4RL 5JPMB 3AXLB 1IAOA 5J3HD 3V8CA 4OCYL 4ERSH 4G6JL 5DHXB 1PX4A 2PETA 5F7YC 3SGEH 1DQDH 1S7UB 2VDOL 1A6TA 3FQRB 3U46A 3LQAL 1FE8L 2NY3D 4ZNCD 3MXVH 3FMGH 4QTIH 1J0YA 3LKSA 2E3VA 3VFRA 1CT8A 2YZ1A 1MF2H 4O4YH 2VNCA 3O2VH 1I3RA 2CDFB 4LSUL 3KDMB 1N6QL 1CDCA 1CK0H 4HAGA 5C0AA 2DIJA 4KC3B 3WJJC 1OAUH 4ZAKD 5MP6L 3DETD 2AV7B 5CHNA 4ELMA 1NDMA 2RB8A 1M71B 1MCWW 2PNDA 4D0CB 4UINL 1YEGH 5HYJA 4MDIA 1QFWL 2XN9B 3FN0H 3IYLW 5CJXA 1KIUA 2MHAB 1CL7I 5HVWA 1WWWX 3T0DA 1HYSC 3C5SA 1A7QH 1QLRA 4PJCB 3GI8L 3H3PH 3H3BC 1SJHB 4NJ9L 5E99L 4I0CC 3DRQA 1BEYH 3QB7C 2X42A 3QI9B 1NCCL 2F54D 3CPLA 1C1EH 2RGSA 4PRIE 4HW6A 2R1WB 2R29L 1QA9A 4JANB 1OSPL 2YD2A 1XGRA 4OSUL 4PY8I 2VAAA 1MI5D 5C70A 4BQ8A 4HGWB 4X80L 5KS9F 5EOQH 5DEZA 5IMMA 4KHTH 1FZKB 2VLJD 2IH1B 3G5YB 1AKJB 3MYZA 4L3EB 5I1GL 1OWRM 1ND0A 5F88B 1PEZA 2HH0H 4LCUB 4HIXL 2KDGA 4OZ4A 3DUSB 1ZLSL 1AGBA 4LIQL 4TUJB 1EFXD 2HT4D 3QUMA 2GTZB 2YUZA 4HUUB 3KXFD 1F58L 5EZJA 3QUXA 2D03H 4V1DD 1S7VA 5D8JH 1A5FL 5IFJA 1T7YA 2Y6SC 2HN7A 4UOW0 4X83A 3DGGB 4MD5B 4KH2A 5L2KB 4JDZA 5BRZE 4M7LT 4BQ6A 1F4WL 3KLHC 1LEKA 3KR3H 3F7RA 5EULV 4LF3A 4TSCH 1INQB 1TJHL 1X3DA 2AEQL 4JRXB 5D96B 4WFGD 1KB9K 4AEIL 1QSFE 3M45A 2PN5A 4U4BA 3MNWB 43CAB 1HILA 2AK4A 3QUYB 2EYRA 1K4CA 4GAFB 4F8QA 5CKGA 1U8KB 3GKWH 3EO0B 1YMHB 4GKSB 3U1SL 5JOPE 3AB0B 3GIVA 5IT2H 1L4IA 2E7LE 5L2JB 5DT1H 2OZ4L 4Q9QL 3OV6A 5F7DB 1V7ML 3U9PL 2D7TL 4APQC 4PRNB 5K9JL 1I7TA 1T6WA 5GZOD 1U58A 3GRWH 4EXKA 4Z78A 1R5VA 5ADOH 4UV7H 4JFFE 3D87B 2YPLB 1KF9B 2YRLA 3ZE1F 4OLUL 4KJYB 2BOCB 1R0AL 3P73B 3IFOB 5I1HH 3AS3A 1MUJB 3ETBF 3HC3L 4KZEH 4PJ8D 5IGXL 5ECJE 4R7DB 4OCXH 2Q86A 3EOYG 1XH3A 1FV1B 2E7HA 1RZ8B 1YNKL 3PJSB 2QQNH 3FAXA 3WLBB 4QXGL 3VRLE 4K23H 1R3HB 1Q1JL 2DQTH 4PFEA 1ZK9A 2FJFA 4L4TB 5T1DL 4QHNB 4Y5YB 5C8JB 5FYJE 2BNQB 5L8KB 1SEBB 3WNPA 3VGDA 3B9DA 4Y5XC 4I48A 3LRHA 4IJ3B 4XCCH 4PJEB 5DZOA 5CILH 5CKAA 4Z8FL 1G9NH 4K8RC 2D4FA 4XNZB 4TN9A 3HR5B 1J05A 3V6OC 1LD9B 4WEMB 5J6HB 1NBVL 4U1IA 2XNAA 4L29A 2NYYD 1NMCC 1A14H 2J8UF 3LMJL 4X4ME 5E08H 1ZKAA 1FO0L 4K7PL 4NNXB 4HH9B 1TZHA 3EYSL 1A9BB 3TJEH 4MXWL 1HDMB 3VE0B 1RK0B 2VZSA 2XWJA 2V6HA 2C1PB 2HFEB 4KPHL 3BW9B 5KOMC 3VFMB 3P40A 2VTFA 5DJ8A 3LHPL 2XY1A 3MRRA 1D5IH 3V52H 1NDGA 4NO5B 2C1OA 5C0GB 4P2RE 4MGXA 2DQDL 2EE9A 4PJHE 5ACLA 3BZEA 5HPMB 3V7AE 3PV7A 1RFDL 2CIIB 3MGTA 3BN3B 3U4AA 4YQXL 3NCEB 2XA3A 5LBSH 5DD3H 1I8IA 1TVDA 4E41B 2IH3A 1DBJH 3TCLA 3K2MC 5E0QA 5JA8B 5DR5H 3P0YL 4NP4H 1B3JA 4Y7MA 5IFHH 2ZKHL 1RK1B 4FFVD 2LAAA 3NGBC 4QRSB 5TE6L 4CVXB 4ZFOA 3O0RL 4GKZB 1UEYA 4X4ZA 5INDB 4I4WB 5I1CH 4PY8J 2B8OT 2XWBA 3BDYL 1AD0A 1FZJB 1ETZA 2ZCKL 1NGXA 5GS0H 1RUPL 3ZKXB 3RUGF 4FQCL 1INDH 3ARPA 2BNRB 2HFFB 3D39B 1J0HA 4PGEA 5DI8B 3OR7A 3MV7A 2JE8A 4PJFE 2IMMA 2UVFA 2J1KA 4ZSOA 1IC4L 1XGTA 1LE5A 2AW2A 4XWOC 4KK6D 5I1KH 3KPQB 4NO2A 4N0YL 1P4LB 1KIPA 4DN3L 3RKDD 1YECL 4YXHL 1ZLUH 4D9QD 5LGJB 3QG7L 2VDML 3UPRB 3X14B 3G5VA 4JG1L 4PRAA 5HDQH 4Z7VF 3T0WA 3R4DA 1DBML 3BQUD 2Q3AA 2IAMC 4HWNA 4AL8L 4P0DA 1S7SB 3GSXB 1ITCA 3ARGB 1J1XH 1RZ7L 4X0KB 3BUTA 5ACZA 4EN3B 1HWGB 3MBXL 5IQ9A 3RAJL 1V3JA 3NA9H 2NY5C 1I1RA 4GXVH 2Q76A 3ULVH 4I2XA 4YHZH 1FPTL 5E8PA 1W0YT 4RISL 1YMMD 3A6OA 3P4LA 1KYOK 4NRXB 3CXDH 4PREB 4U1MB 2F5AL 3P9WB 2EEBA 5I1DB 1E4JA 4HWBH 2D9CA 1S3KL 1EIBA 1WLHA 3L3DB 1MSPA 4QRPE 3HPLB 2A6DA 5C0EB 4GKNA 3HUJE 1L9MA 2LQRA 1FRGH 1GOFA 1TQCB 1OLLA 5EBLA 3VXTB 5I8CA 5E00A 2GHWB 3LEYL 1MPAL 4YPGB 1UCBH 4FNLL 5EU6B 3CC5B 5EC1A 3WIHH 5D72H 3VFGL 4FFYL 3ULUE 3LZFL 4FTVB 3ZTJH 1E28B 1YEEH 1DEEA 3HE7A 3DBXB 2ZOKA 3VXUA 2CUMA 3KYAA 1YEFL 1ZANL 5FYLH 3LPGA 5E1HB 5SWQA 4M43H 3IDNB 1TQBB 5EU4A 5L2KD 4G9DB 4XPAH 2YD1A 4JN1H 1OGAD 4GG8A 3ME0A 4S1QL 5HHOD 4N1HB 5KG9A 5IVZA 4OD3H 3NTCH 3IETA 4W6XB 5DQJB 3L3JA 4P5TC 3T1FA 2UWEE 3STLB 4QOKB 3SPVA 3WUWB 1RHFA 2Y36H 3VA6A 4MA7H 4WI7A 1MFBH 3BP4B 2K7PA 5ADPH 5ANME 1YEDB 4D9RE 3BIBX 5J6GA 2EKSA 3L1OL 5HVFB 1CXEA 1J8HE 4X6FA 2H1PL 4HXAL 2H2PD 5B22A 1LK2A 4LLVA 1U6AH 3RBSA 3RVWC 5BW7A 3H7BA 1CD8A 1EO8L 4KTEH 3H9SA 5IBUG 5IIEA 3FOMA 4P2OC 4WY7L 1AIFB 1YEKL 5KTEL 3TPUE 3JV4A 3QXUA 1GH7A 1I75A 4GXUM 1C5DA 3LN9A 1A6WH 4UDUB 1JBJA 4QGYA 3SKNB 4IM8A 1AC6A 1JHKL 3WN5C 4JFZL 1UJTA 3A67H 3SE8L 1AHWA 5IMOA 5IESH 1MIML 2I5YL 5D6CA 5DSCB 3HZKB 3UBXI 4DEPC 3B5TA 3ARSA 4OLXL 1U3HA 1IRAY 3TCXA 1CFVL 1D6VL 4W6WB 3QO1B 2R0ZH 2APVA 2DD8H 4O5LH 2W0KA 3DX9A 1HH9B 2AK1L 2ZCLL 3B9AA 4R3SB 3JWNC 4JFEE 5I30H 4L4TD 1FFRA 1H3XA 2AQ1A 3STBA 1I8MB 5AAWA 4K3GA 5TDPA 4GLRH 4K9EC 2H3NA 4KXZI 1KBGH 3VXPB 4OGXH 1EGJA 3FKUS 3H8NA 1Z3GL 3CCHB 4MHHG 3O41B 4F9PC 4LHQB 5I74B 4HG4J 4LVNB 3VGEA 4XMLL 2QLVB 4AENA 5HVGB 1ZEAL 2DM2A 4OLVL 4XGZB 3DI2B 1A21A 4TTDC 3O2DL 4TPRL 4JO3L 2H9GA 3CZFB 1A3LH 2X4TB 1QSEA 1G1CA 6FABH 4KAQL 3VW3H 4I3RL 3MLTA 1UJ3C 5GRJH 4NM4H 3RWIB 1D5XA 5BO1H 5B38G 2H32H 2R8SL 4G8FA 3QQNA 2XXMB 5DUBA 1DLHB 4OF6A 4KUZH 4FQ2L 4L4JA 4L8SC 5KVGH 2PR4L 1MHHB 1N5YL 2ZUQB 1NCAH 3X3FL 3ZSSA 5D9SA 1K2DA 1ZLVK 3GO1H 3ELAT 3UTTE 4U1LB 3D85B 5B39A 4NUJA 3IDJB 2ZUVA 3ALXA 4FQPA 4DZ8A 2V2TB 3FZUC 1NL0H 1CR9H 3DV6A 4G9FB 4YBQD 5FV1L 1CG9A 1V8HA 4L1DA 3SY0A 4ODSL 4PB0H 3EUUA 4Z0BL 3V9FA 3UTSB 3QFJA 5IWLA 4NFBA 2BNRD 5IB3B 3PXJA 3GMRB 4CDHA 4XBEH 3KJ4C 4PG2C 5IVOA 2ZUTA 1A7OH 1BQUA 5ELIA 2B5IB 1QQDA 1GRWA 3GEWB 3MJ7B 1BIHA 4OCLC 3ARDD 3CFEA 1Q94A 4W6YB 3HI6L 3SDYL 5GGSA 2FBJH 5TFSL 4IS6B 4BQCA 3B6SB 1SY6A 3L3GB 2GCYA 3BPLC 4R90H 4X6EA 2XQYK 3OKDA 2W0PA 3L3KA 1DLFH 4D9LH 5H35A 1A8JH 5FYJH 3C5JA 5CWSA 5DJ0A 1KXVC 3GSWB 4TVPL 3QRGL 1Z9MA 5ID1A 3R0NA 5JO5A 4MCYB 3WMSA 2C26A 2BVTA 4EI5C 1Q9KB 2Q20A 4N5UA 5SWZE 3EYOB 4G8GB 1EEUA 2APTA 4YHPA 5HD8D 5BS0D 5EU7C 1ZVYA 5HDBE 4N8CH 4G8IB 4M8QB 5IB4A 4NN7C 2OP4L 3CH8A 2AXFA 1IC1A 4IIQC 2XV6B 1YNTB 5C08A 3PL6B 1B2WL 3B2VL 1IGTB 1P4IL 3KYMA 4BFIA 3DRTB 5LWYL 3KG5A 3ORJA 4Y19A 1OHQA 1X5YA 3QQ9D 3ECBB 3E6HB 3G6JE 2H6PA 4Q2ZB 5EU6D 4D3CL 3VWJD 2JCCF 3EKCA 1WAAE 1X44A 2JIXB 5EUOA 3CVHA 1EJOH 5TE7H 2MCPL 4JZJC 2YKLH 3OHXB 4P2QA 2EE6A 3OKMA 3MV9A 3T8XA 3BH9A 5EZOH 2XRAL 3BKCH 5T5FL 1PKQA 1YPZB 2R4SH 4ZPVB 3ZT7A 3KPMB 5KSAD 4KRPB 4JLRA 1U8QA 4ZS6C 5HI3C 1ODAA 3S3JA 1IEBA 1KT2A 4FQJL 1JGLL 4NZUH 2DL9A 1XGYH 3PABA 5KAQG 3FT2A 1CE6B 4KI5F 5C0IA 4HFWA 3IVKA 5AD0B 2D2OA 4N0FA 4XCEB 2CLRB 5I16B 3ZTJG 4NZDA 2DMBA 2NXYD 3X12A 5SWSB 1UB5B 4TUKL 2ICCA 2IPKA 4W4OC 5DRNB 3ZYZA 3H42L 5AWNH 2O5XH 4P5KA 2DLFL 1MCJA 2FLBT 4U1GB 3ES6A 4OFDA 5F9WB 3DMMC 4HIIA 4O51A 2K3TA 1J5OH 1D5BB 1HQRB 4JM2B 1TMCA 2XACC 3O3BB 1L0YA 5I0ZA 1X4XA 3RPKA 4QHLA 4DW2L 4ODHL 2P4AB 4AIZA 1Z0NA 2EDDA 3ZSTA 4A6YB 5FKPA 3ZL4H 4L5FH 1ZXQA 3RVXD 3V6OA 2XYCA 3SGEI 4NC0B 1FL6B 1JF6A 4JFDB 4FQHA 3GM8A 3V4UL 4YEFA 4NRZA 3EJZD 2FZ3B 4ZOEA 1ZMYA 2N1KA 3U30B 5C09A 4WHDA 1DUZB 4RFNC 1H9VA 3FONA 4PTTA 3F65A 3ARFD 4N9GA 3UJTH 3ZKND 2OXGA 1ERNA 1L8JA 2IADB 3ZE0F 5CBEB 1EAPA 1ES0B 15C8H 1ITBB 3U48A 2O5YL 3VG9B 2PXYB 1FAIL 2FECL 3MCG1 3TWCL 5D1ZD 4OZIA 1XCQB 2VDQH 5D93B 1WZKA 5D7LA 2BVYA 1NBZA 2VZVA 4I0PA 1DEDA 3W9DA 1S7QA 5T1KB 1NFKA 2WWKO 4JHBA 4DKEL 3VFOA 4X5XB 3QPXL 4X9FA 5TF1H 4WI5A 4OGZA 3VD7A 4EBQL 4F58H 4NQDE 5E8DL 3QHFH 1TJGL 1OTTC 3HAEB 2FX8H 3ULUH 2VLKA 2DQIL 5I9QC 4ZUSB 3UO1L 2J88L 1ORSB 2NTSP 4A6YL 1P1ZA 5DJCB 4PJCF 4ALAL 3MROA 3F7QA 3IB4A 4PUBH 4CBPA 5E8NA 1TLKA 4OTXH 4UNTA 2G5RA 1JZ2A 4P46C 2K1MA 2WLZA 3D3VA 3KYNA 3PGFH 1AO7E 4KJWC 3SGJC 2DQEL 2UYLA 4NOFA 5CBAA 1X4ZA 4KGLA 2GSGB 4ERSL 3TA3A 1D9KC 4NHUA 4LLMA 5LJYH 4KK9D 3CDYA 1GOHA 4FQLH 1J10A 3MXVL 5KSBB 3FMGL 4QTIL 4WO4B 4N0UE 4O2CA 1S9XB 4YFEA 4MQ7B 3S36L 1U8PA 1WV7T 4R4ND 1CK0L 1MCNA 3RL2A 3QQ3A 3ESVF 5I1LB 2ZSVB 3G5XB 3OXRB 3MO1B 1EEYB 5GS2D 1OAUL 2CKBB 5C0CA 2CLZA 4OGAC 4XNQB 4KV5F 1OT1A 3RA7L 4KTDH 3UTOA 1VGKA 2IAMA 5F8QC 4PJXE 3DVGB 3LEVH 2PO6B 4K2UL 1JRHH 1CFTB 4HEME 5DVMA 5BJTB 3RGVA 3TBYA 1NC4A 3VFSB 4NQEE 4M1DH 2FX9H 3RWGB 3ZE2E 1A7QL 3UTSD 3SJVE 3CFDB 3QXDA 4I3SL 1N59B 2F19H 2NY6C 1UXSA 2ZOLA 1MVUB 2CK0H 4MXQD 1PDKA 4HDIA 2DQUH 2FNBA 2EKJA 4FQXC 4PS4H 3GBNH 5I76A 5DC4B 2VOTA 4Z18A 5HGAA 3SDXA 1MRFH 3WHE1 4ETQB 1CDGA 4JZNB 5EU3B 4JJHA 5AG8A 3H9HB 4S1SH 2DF3A 1FLRH 1LO4H 4QTHB 1CVSC 4GMSH 1AC0A 5IMLB 2BVOA 5IW1A 4PRHD 1LDPH 4ODWB 4WU5B 5IEKB 4J3XA 5C0AE 4UQ3A 4KKLC 1FC2D 4HWUA 2CKBL 2I26N 3HMXA 3LKPB 5E9DA 4S0TD 3HZMB 5JR1L 1JUFB 2IBZX 1UZ6E 4L9LC 3VXRA 3PHOA 2Z91B 5D8JL 2CDGA 2WIMA 4G8GD 2C3XA 4QRRD 2Z92B 3HFMH 3SDAB 1QSZA 2RIKA 5MEND 3BZ4A 3R0MA 3PWUA 5D2LB 2QQLH 3CFCH 4OIAA 3HNTH 2P48B 4HPOH 3KYOB 4Y88A 1MCBA 4DVBA 4TRPH 2X9YA 3DSNA 4XTRC 4LSPL 3QIWA 1VKXB 1PLGH 4MLSA 4H1LA 1A1OA 3DO7B 1IAOB 1I9EA 3PF2A 3BO8A 3FFCD 2JIXD 3U46B 1A6TB 5HBBA 1K8DA 1ED3A 3AMLA 5IVNA 3EFFA 1A2YA 3VFRB 5C07A 4YZFF 1IGCL 4ZODA 5B8CC 4FG6C 1I3RB 4P2OA 3MV01 4PJEF 5CCKH 3GKWL 3CSBA 1IGJA 5I1EH 4LLDA 5IT2L 5GZNC 3S98A 4D8PA 4ELMB 1BZ7A 1NDMB 5DT1L 3N9GL 3WN5A 3H6JA 3SKOA 5GS3A 1U3YA 5EOCH 3BX7C 3KGRA 4E0RA 3V7AG 3LN4A 3MRGA 1EERB 2GJ6E 4Z7QF 4DN4H 5DEFB 5B38B 5DXWA 3C5SB 1UH2A 5TDOB 1QLRB 3O8XC 1XFPA 4XNXH 3DRQB 3W0WE 2C5DC 5I1HL 2AJSH 2Y07H 1QBML 3CPLB 4OCXL 2OS7A 4KUCF 4B50A 4Z7NF 1QA9B 3W9EB 5D7SH 1XGRB 4JO2H 4MJIE 2V5YA 1I1AC 4KKAD 4L1HA 3WO3B 2QQNL 3O6KH 2R56L 3O4LD 1OCWH 4ODVH 1BJMA 4K23L 2DQTL 1TFHA 4C56E 3MJ8A 4MAYD 1GGTA 1FVCA 1OY3B 4KJQD 1AGBB 2VR9A 3ZKSD 5FGRA 2FGZA 4K71B 3QUMB 4PJ7F 4HX1B 4XHJD 4I5BA 1KCUL 3IDYB 1RU9H 1EMTH 1FYTE 3X3GH 3QUXB 3EYVA 3OJ2C 3QWOB 2VITA 1S7VB 4J23A 1RIVH 2K7QA 3T0EC 1T22A 4LOUD 2DJ4A 1IQDA 5F9JA 4KKCD 1BX2A 2IQ9L 3MRDB 2PXYD 2CDEA 4HCRH 4JDZB 2RBLA 1QNZL 3OL2A 5DRZA 2G75A 4LGRB 4N0CD 2Q6WB 1R3JA 3V52L 1QVOA 1OTUD 2PW2A 3VI3E 1GGYA 2EDQA 4H20H 5CINL 1A47A 4BH7B 2R2EA 3LH2H 1BFSA 1HINH 2KQNA 2NY3C 4P59L 1HILB 4EVNA 4QCIA 2GK0A 1U8OA 2AK4B 5GGVH 2EYRB 4Y16D 4CU8A 1DBJL 2HYMA 5GS1C 4EZMA 1IEHA 4N1EA 4NO3A 1RUKH 3QDHA 3QWRD 5IFHL 1JPST 4KK8C 3GIVB 3OSKA 1G6RA 1FBIL 2R23A 2HRLA 4ZAKC 4GMTH 1QTYT 2H41A 2WWKT 1T0MA 4ONFH 3H2WA 3E0GA 4WFEE 4XNYL 1JNHA 3KS0H 1I7TB 4PG2A 3QDMD 4Z78B 1R5VB 3DXAD 4WO4D 1ZHNA 35C8L 1AP2A 1CE1L 4IRZH 5FUCC 5GS0L 1ZGLA 3EHBD 3HC0A 1D6EA 4XPHH 2R1XB 3E8UH 1KEGH 2L0DA 5LGHH 5TH2A 1KJ2A 1CN4A 4HAFA 1J86A 2Q86B 3QNZA 2I07A 1XH3B 3O11B 4XC1H 3V5DA 3TN0D 1QR4A 5I1KL 1MCHA 1TZIA 5H2BB 1RPQA 4HWEH 2HJFA 4JRWA 5I0DA 2F53E 3KLSA 4AQOA 1EHAA 1NLBH 3MLSH 5K9QI 1JNJA 1KELH 2FJFB 1RJCA 1W8NA 1PY9A 2AJUH 1JVKA 4HPYL 3PWPD 1T0NA 3DURA 1UKSA 3FQWB 4F80A 4EI5A 2EDBA 5J4MA 4NM8L 4XP1L 2VQUA 4N8VA 2GY7B 1J1XL 4JKPH 5DD1H 3RY5A 1J05B 2WLYA 1UYWH 5DFVD 2WV3A 3NA9L 4Q6IC 4U1IB 5DHYA 4M62L 5KOVC 2XNAB 3ROLA 4L29B 2IAND 1T6VN 4P9MH 1A1NA 3ULVL 4YHZL 3VGAC 1FYHB 2ATPA 5K59E 1DJSA 2CMRH 4PGBA 1TZHB 3DV4A 5A43C 3QUKB 1YEJL 3PUCA 2XWJB 3PXHA 3NA4A 2X9WA 3GIZH 2BK8A 5DJ8B 4I0KA 2IALA 5INCA 3MRRB 1NDGB 5KS9A 3IJHA 1CZ8H 2C1OB 3BYTA 2NY1D 2Y1VA 1QEWA 4XBGB 4LBEB 3RWHA 1UCBL 1QYGL 1RJYB 1HEZA 2W60A 1NSNL 4DKDC 3L5IA 3MGTB 4PBWD 4UTAH 3O6LH 1I8IB 3EOBA 4OD2A 4U7KA 1DP0A 4RGNE 4Y4FA 3GMMA 3TCLB 1QOKA 2XG5A 1MREH 4H0IA 3HNVL 3I6GA 3QDJE 5DLMH 5KVEL 3IJSA 2OYPA 4OD3L 4G7YL 4B0MM 1A64A 2JB6A 3MLZL 5D7KE 2VDKL 4ZFOB 3J8F7 5KJRH 3N0PB 1U8JA 5DJ2A 4OQ1A 2Y36L 2XWBB 4GLRI 4HULB 4JB9H 4K3JL 1MFBL 1ETZB 4KTYA 5ADPL 1CLOH 8FABA 4YXLL 3DMMA 1KLGB 4GRMB 1Q0YL 3NN8A 1KOAA 3DNKA 4BFBD 3IDGB 1UZ8A 3C8KA 4EEEA 4PGEB 4OZHA 4EJ1C 5BOZG 1QR1A 1JGVL 3O3AA 3OR7B 3MV7B 4OFYD 1UVQB 3U79A 1ZHKB 1XGTB 1P9MA 3CD4A 1QRNA 1FGVL 2C3VA 4PJGA 4ZSOB 1LE5B 2BVEA 3LD8C 3EDFA 3D6GA 4NO2B 1RZIA 2ICWB 4GKOA 4LQFH 4F3FB 4OFIA 1KIPB 4H26A 1KPUA 4KKBD 3SO3B 3E2HC 1G7IA 3GSNA 2FR4A 1EH9A 3G5VB 2Z93A 1RUAH 4URTB 3A67L 2AXGA 4Z7WF 4ZFOL 5I71C 1Y0LA 4M7KH 3QHZH 5ACZB 1IGYA 3MNZA 5IB2A 5IQ9B 1RAMA 3LIZH 5JTWA 2MKWA 2NYYC 5D5ME 2JJTC 4O5LL 4UMGA 4I2XB 3TT1H 1MLCA 1T1ZA 1CQYA 2IBGA 4Z7UA 2B4CC 1TPXC 4JFYA 2BVUA 1CLYH 4DCQA 1TIUA 4PJIF 3GMNB 3HRPA 4WI4A 3RU8L 2A6DB 3MRLA 1H3VA 4GKNB 2C3WA 3BEWB 3VWKA 1RMFL 3P30L 5E00B 4R8WL 4WHCA 3WIFA 1NFDA 5EC1B 3CDFA 4P46A 1MNUH 4OV5A 1DEEB 3HE7B 1MFDL 3O3EA 3MV11 5CJBA 3SGJA 3E3QE 5F72S 2OI9C 1FLTX 1LQSR 2VXUH 1NANH 5GS0D 4GG8B 2DMKA 1ZLWK 2YHGA 3T0AA 1E27A 5KG9B 1D9KA 3T77A 3IETB 4JQIL 4KMTH 3L3JB 2J8UA 3T1FB 3SDDB 3SPVB 3VGFA 1A3LL 5E6ID 2R2BA 3JWDH 1HHHB 2DL2A 4XZUA 4NM4L 5BO1L 4FP8H 4AM0A 4GG6B 5KW9H 4CMMB 2Y23A 2EKSB 4Y2DA 5E2UH 5GQBA 5JZ7C 4KUZL 5DJDB 4X6FB 1H5BC 5F9DC 2GK2A 1LK2B 4LLVB 3KHQA 1ZSDA 5IV2B 1G84A 2OR9L 3H7BB 1R5IA 3T0VA 5EO9A 3PDOA 1AH1A 3ARBB 3H9SB 4KK6C 1JHLL 2NY4B 3AUVA 3MBED 5IIEB 3WS6C 2D7NA 3IFPA 3QBTB 1CBVL 4WFHE 1NL0L 1CR9L 3RKDC 2A0LD 3ZLQC 2B20A 2DQJH 3JV4B 2Z0BA 3ULVD 2MKLC 3MODH 5ISZD 3IFLL 3TIEA 3BQUC 2MOVA 4NN6C 5DC0A 4PB0L 3HS0A 3Q0HA 4JFXB 4JZOA 4XBEL 1AHWB 3OB0H 5IMOB 5FYJU 5D6CB 3BKMH 5D71L 4HSQA 5F7KC 1U3HB 5JHDE 3VD4A 4WV1B 3RUGA 3DX9B 5C0ND 2FBJL 1YPZF 1X6NA 3O4OB 2LFGA 5JOEA 4ZYKA 1JYXA 4R90L 3A0OA 3ARUA 4LARH 5FYLD 1DLFL 4D9LL 3VXME 5MHSE 1J1OH 2HMID 1OQOA 2RCSH 4OGYH 2R1YA 5TDPB 1X5HA 3BIKA 1JPFA 1LK3H 1UWXK 2H3NB 4LCWE 1MCCA 2F15A 1G9MC 3QO0A 4JPVL 3E1F1 3V0WL 2E7BA 2XQBH 25C8L 3FB8A 3MA9L 4Z7VA 3S35L 3QXVA 1FORL 1XF2A 1KG0A 3EIFA 4Q0XL 2ZNWA 1HHJA 4ZXBD 1IGMH 4AENB 2VR5A 4NSKA 3QFJE 1FJ1A 1FZMA 3GSOA 3V6FB 5C2BH 4QXUL 5D6DC 3D48R 2DBJA 3S34L 2CGRL 4JM2F 5FDWA 2DTMH 1I7RB 2H9GB 2BDNL 2VXQH 4WU7A 2DDQH 1CLZH 4XVTH 1QSEB 3QCUH 3SCMD 2VIRB 3D18A 2JJWA 5B8CA 3NPZB 2CR6A 2FCBA 1D5XB 1BBDH 3KPPA 3OAYK 1YEIH 5BMFL 5DUBB 3B5HA 3INUL 1LO2H 4X9BA 2R4SL 5I8OH 3NH7H 5FOJA 2H2PC 3IJYA 3W2DH 3GK8L 1FN4B 1FNGA 2OJZL 2IJ0C 2IQAA 5B3JF 4C54A 5D9SB 4PGZA 1EGJL 1K2DB 2PKDA 5F96L 4NZUL 2PW1A 2B2XL 4Y5VC 3I2CH 5B39B 1ZHBA 4NUJB 5JXEC 4GW5A 4PRID 5I1IL 1KN4H 4LKXA 4JGJA 1CFBA 4DZ8B 3DV6B 5MERA 1IKNC 4LSTH 3MRQA 4HLZG 3MLPA 5IHUH 1Q9LB 2CUIA 2ERJC 3SY0B 3BI9X 4YGAB 4WTZA 3B9KD 5F89A 1UM6H 4UIMA 2DBLH 4MSWA 1MCOL 1VDGA 2VDLL 1P5UA 4O58H 4QRPB 5JHLL 1KCSH 1U8HA 5JQ6L 1QQDB 3ZZ1A 3LRSB 3CFEB 1MFEL 1Q94B 2P7TA 4NNYB 3BEVA 3RIFK 2EZ0D 4HZLB 5GGSB 2VSDA 4XPGH 4QRTA 4X6EB 4X7DC 3OKDB 1EUUA 1SBSL 5H35B 1JWSA 1R6VA 4U6HA 1GXEA 3T0EA 5CWSB 5DJ0B 1UKTA 4QY8A 4WJ5A 3MRPA 5C7XL 2HJLA 2PYFA 1DQJA 2W9LA 5BRZD 1JL8A 5ID1B 5JO5B 2YBRA 1QLFB 5E5RB 3GNMH 1UKQA 3JV6B 1VFUA 1FNHA 2QADC 4DGVH 4YHPB 3FQTA 1QSFD 5KSBF 2NZ9C 4BJLA 4WEUD 2D31A 4G3YH 4RMQA 4IDJH 5DHVA 1K9TA 1U8MA 4M5YH 2AXFB 1LHZA 5C08B 2VDQL 4U6TA 4BFIB 4NZRL 1J8HB 1JRHI 4Y19B 2EDHA 1KENH 3EJYD 2H6PB 5TF1L 3BRFA 5C0BE 5JOPD 4F58L 3IF1A 2P5EE 3QHFL 2EE2A 5EUOB 3SE3C 3VI4E 5GS1A 3SN6N 2UY6A 4P2QB 3N1FC 4G43A 3OKMB 3T8XB 5IW3A 1CF8L 4ZAKA 3TPUB 5JLZA 1U8QB 1CXFA 3IU3A 2I25N 5CJOL 4IOIA 4JFFD 2QQQA 1F13A 1WBYB 4APQB 4Y4KD 3DHMA 1KT2B 4ZUWA 3PABB 3SDDD 3FT2B 4RMSA 3AS1A 5C0IB 3QEQE 4HFWB 3IVKB 1CDUA 4N0FB 1ZAGA 3OR6B 4TSAH 1RV6X 4RX4D 1L7IL 2IGFL 2AJXL 2F54A 3X12B 3U6RA 4FQLL 4I77H 3VFVA 3OPZL 4P5KB 4XAKE 3ES6B 3NIGE 3MCKA 4W4NA 4OCSH 1HWHB 4ODTL 4XVJL 4OV6F 3RTQD 1DZBA 1IFHH 5KSVB 1VPOL 1LO3L 3ARBD 4HIIB 2VLJA 4O51B 2YEZA 3ARDC 1TMCB 2BJMH 1NKRA 3U7YH 3FO0H 3Q6FA 4MX7A 1XF4B 4MVBC 5T33L 4Y5XB 1EFXA 2XT1B 3LS4L 2C3GA 3Q1SH 4HT1L 4PDCE 3IXTA 2SEBA 4WCYH 5D2LF 4AIZB 4DAGH 2AI0H 2EDYA 5FKPB 2COQA 5CD3A 4M1DL 2FX9L 5AEAA 4V1DA 1FHGA 1UM4L 2Y72A 3I6KA 1NAKH 2F19L 1RURH 4Q9CA 4FQHB 4Q6IA 1B4JL 2E7MA 1T03L 3QNXA 5JNYA 2CK0L 4I13B 1ACYH 1NMCB 3C60D 4YLQT 4L4VE 2DQUL 3R06A 1EHNA 2ZUUA 5DO2D 1HOCA 4LSDA 3GBNL 5C09B 4M1CD 1MRFL 3FONB 4PTTB 2EICA 5CZVH 4N9GB 1HNGA 4P2RD 4PGDA 4NHUE 1LO4L 4ZNEA 1M6OA 3V5HA 1EHLL 1EAPB 1CDHA 1JI1A 1JPGA 2O26U 4Q74A 1RUML 1GC1C 1QKZH 4NUGH 4JEGB 4OZIB 3TO2A 1AGDA 3B9EA 5CSZA 5D7LB 4TULH 2PTVA 1NBZB 4I0PB 3W9DB 4H5SA 1S7QB 3QQ9C 1GIGH 4WW2F 1AD9A 5F9OL 3VFOB 1VGEH 1F6LL 2HP4A 4ELMF 3VWJC 1MJUH 2DOCA 1DN0A 3OG6B 3RZCC 4IMLB 2VLKB 1Q72H 3MYJB 3QWQB 1N64H 3GFUA 2ESVE 2HKHL 3HFML 3CFIC 1P1ZB 4OZGF 3KJ6H 3MROB 5KSAC 3NGBB 4ELKA 3QA3B 2QQLL 3CFCL 3QYCA 4V2CB 4HPOL 4F7EA 2BSRA 4RAVB 4YGVB 3UC0H 1NCDL 2VQTA 3D3VB 3KYNB 4TRPL 4OZFA 4RRPG 1H0DB 2P44B 1FSKC 3MLRH 1PLGL 2UYLB 3UTPE 2QTEA 1P7QD 4YHMH 5IR1A 3KYKL 1A1MA 2NXYC 4PJ8A 4LLMB 3DX7A 4D94A 4ZD3H 1AY1L 2M1KA 1BIIA 2W9DL 2NY2C 5EC2A 2JCCA 2WMPA 3UDWC 3RL2B 3QQ3B 2GI7A 2FEEL 2DYPB 4MNQE 5I1EL 4LLWB 3ZYIA 3E2HA 5IK3A 3PWJA 3D25A 2CLZB 5C0CB 1U8LA 1VGKB 4J3VA 2IAMB 2YMXH 3WFCL 1GGCH 4IHOA 4DN4L 3TBYB 1ZTXH 3D9AH 2XZAL 4M7LL 5JMOC 3RVXC 1T1YA 1UXWB 1XGQA 1M05B 3QXDB 5DDHB 4XNXL 5KVFH 2X1PA 4PJDF 4BK4A 5A2FA 2DQGH 2JJTA 4QRPD 3EJZC 2Y07L 4HDIB 4Q9RL 4O2FB 1ZWIA 5I76B 1I3VA 2B0SH 2Q8BL 3SDXB 4RAHA 5D7SL 3T3PE 3ARFC 4JO2L 1T7WA 1MIEH 3PDDA 3ZKNC 4UB0H 4Q6YA 1Z9LA 3O6KL 3ULUD 1A7NH 4ODVL 2Q3ZA 3L3HA 4MB4A 2BVOB 5IW1B 3FO9A 2PYEE 5D1ZC 1MCPH 3MLYH 1BBJB 1D7FA 1NC2D 5JOFA 2Y6SD 3D2UD 4FFZH 5KZCB 2APXA 1LO0L 4WHYG 4QRQA 3PHQA 5E9DB 2OI9A 2FH6A 4ZS7H 3VXRB 3PHOB 2UZYB 2CDGB 1ZOXA 4F7TB 3C08L 2WUBH 3IDIA 2ZPKL 1QZ1A 1NCWH 1W0WA 1KFAL 3H0TA 3T0XA 3ULVF 2WNGA 3QZWG 4N5ED 3BZ4B 4P5TB 1B90A 3PWUB 2NY5L 3VFUA 4D9RD 5IB5A 2DWEA 4DVBB 5F93C 3CAFA 1J8HD 1QBLH 3Q6GL 3WFBL 4K94C 1KCLA 2YA2A 5JW3L 5EWIL 4G5ZH 4H1LB 4ZOCA 2YRPA 3HC4L 3HG1E 4KDWA 5KAQF 1BJ1J 5L9DL 1T1WB 3RZWA 3BO8B 5FGCB 1JGUH 4H20L 1H5BA 5EBMA 4RMTA 1DL7L 1K8DB 1HINL 2MQ0A 3EFFB 5GGVL 5JDSB 4LAJH 4UT7H 4C83A 4KQ4L 5C07B 1M71A 5CGYC 4D0BB 2VZOA 1KPRA 4P2OB 4R4NC 4YO0A 3BPCB 2JJSC 4APQD 1TETH 1P84K 1RUKL 1V7NL 3RFZC 3DYOA 4LLDB 4X6DA 5DVLA 1LDSA 4LLQA 4D8PB 1BZ7B 3PWNA 3BQUA 3WN5B 3SKOB 5DMJB 1GPOH 3BP7A 4JN2A 4G80A 4E0RB 4XPBL 3LN4B 3MRGB 3REWA 4OM1L 5J1TC 4DEPB 3UMTA 3J7HA 4M3KB 5DD5H 4JFED 4HZAA 3NAAH 4YDKL 1OAZL 3QXAA 4HGWA 2JB5L 4MXQC 5EOCJ 5LGHL 2AAVA 2Q8AL 1OSZA 1YMMA 4LPWA 1QRKA 2IH1A 3G5YA 2OQJA 4NQCE 3TV3L 5EZIH 5HJ3A 1ZT4A 4JPKL 3BKYH 4NQTA 1UADC 2GTZA 4NN5B 5I19H 2YPVL 3MLSL 2I27N 2P8LA 3MJ8B 2AJUL 1FVCB 2OZ4A 4HG4K 5ID0A 2EDWA 4PJBA 3CDCA 3PQYE 4I5BB 1MCRA 4MD5A 2YSSA 4JKPL 4NKIL 5DD1L 4NWUH 5EBWA 5L2KA 3EYVB 4XMPH 4YHKL 1UYWL 2VITB 3NACH 3AMKA 1T22B 2XI9A 1OGAA 5HHOA 2OK0L 5F9JB 3DGCR 1A6VL 4P9ML 4Q58C 3O2WH 1SJVA 1INQA 5D6DA 3EO1A 1P4BH 4WW1A 2AP2A 2VN7A 2CDEB 2HT2C 1BQSA 1AQKH 1FP5A 5DRZB 2G75B 3MQIA 4N0UB 3AY4C 2MFNA 1R3JB 1U92A 1TDQA 4PGJA 1BGXH 2PW2B 3MLXH 3U0TA 1QFUL 3WKMH 4L8SB 1U8KA 3UTTD 5IQ7H 5IFAH 4DK6A 3N1PC 4LLAA 2R2EB 4K9EL 4EVNB 3ZO0A 4NCC2 2GK0B 1U8OB 4HKJA 5J12C 4Y5VA 1IM9D 4RWYH 4HLJA 3MLVH 5F7DA 2BRQA 4JRYE 1E4WH 5DLML 4NO3B 5LCVH 3SJVB 1G6RB 2R23B 4MNHA 3L95A 3X11B 5BCAA 4LU5L 5HI4C 1FO0A 3LKOA 5BV7H 5F7HA 4KJYA 4CU7A 4GAJL 3P73A 5CEZL 1T0MB 1MUJA 1FIEA 1JNHB 4LGSB 3N1MC 3U4EB 3KJ4B 3CMOH 1CLOL 1RHHB 1ZHNB 2VABA 4PG9A 3VXSE 1AP2B 4NCC1 1K4DA 1BVKA 4XWOD 3MUHL 2FD6L 4UV4L 1D6EB 5SX5K 1FFOB 2OR8A 2ID5A 3PNWA 1NBQA 2DYPD 2DKMA 1MJ7L 3K8MA 3NABH 3C2AL 2I07B 2YXMA 3BPLB 3V5DB 4HUMB 4L4TA 4QHNA 5HY9A 1XF3B 2P46B 5C8JA 2F58H 4B5EA 1TZIB 2HJFB 2AVGA 2BZDA 2Y7QA 4PJEA 5F1NA 1NGPH 5CAYB 1CFSA 1ZT7A 4MAYC 4GSDH 1F90L 2WUCL 3OAZK 1T0NB 4KJQC 3C6LC 8CGTA 4EI5B 5FUOL 1S9VA 4RWHA 1G6RL 1JMXA 5A2KH 4WEBH 5EU5A 4N8VB 4FMKA 4EKXA 4M7KL 3QHZL 1HXMA 1HDMA 1RK0A 4NN7B 4LOUC 3G5ZA 2N7AA 4IIQB 5DHYB 4KKCC 3ROLB 4O9HH 4GG6F 1A1NB 4GFTB 4Y4HD 5J13C 4UDTA 4PGBB 1F11A 3VRLF 3HHRB 1CLYL 1RQ5A 4BZ1L 4EUPG 1PG7H 3SQOH 5HPMA 4OCWH 4P3CH 5INCB 2IALB 4JZJB 5IBTL 1OTUC 3IJHB 2NNAA 4KDVA 1KCVH 2IG2H 1QEWB 4U1KB 2A6IB 2AGJH 4POYA 4ZFZB 5CFHA 4IOFD 3MJ6A 1HEZB 2W60B 4GW4A 3T4YA 4D0DA 3K4AA 5DK3A 4TVSa 1G9MH 4MXVF 3S5LA 1NGZA 4Y16C 4PJ7A 4P5TD 5FYKL 3EOBB 4CVXA 4GKZA 3BSZL 4WUUE 4Y4FB 1CU4H 2VXUL 3GMMB 4I4WA 3WFEH 1SJXA 4OQTH 3G6AA 5J9PB 4F15C 4ORZC 3I6GB 4HUKB 1FZJA 1JNNL 2P1YA 3DVIA 5I73C 4U1SA 2JB6B 4XP6H 5DD0H 2OTUB 5SV3A 1F45A 3JTSA 2FO1A 4AEFA 3CNKA 2MCG1 3MJ9H 3OZ9L 3EGSB 2BNRA 5DJ2B 3ZE1E 3GMQA 5DI8A 2O93L 5CIPA 3A6CH 3DUUB 4FP8L 4OB5L 5LQBH 2ORBH 3DMMB 2ZCHL 1CFNA 3UXFA 3ARDA 4X4XA 1OP3H 2FLRT 3OF6D 3SGKC 5K9KB 3EAKA 3SO5A 2KL6A 3C8KB 4HQQH 4OZHB 3O3AB 5LGJA 1X5FA 4AK1A 1C08A 3HMXH 3TN0C 1QRNB 4PJGB 2Z8VC 4Z95L 4RAUA 1RIUL 1DQLH 2VLLA 3RY4A 2LE9A 1CICD 4XPFH 4H26B 1S7SA 3GSXA 1A6AA 1KPUB 5CEXB 2DQJL 4WI8A 2Q1EA 3GSVA 4X0KA 3GSNB 1G7IB 4LCYB 1NMAH 2EIZB 2FR4B 3MODL 2ENYA 5GRVK 2VDPH 3QULA 1O7SA 1YQ2A 1UACH 2Z93B 4RFNB 2EXWD 1J0ZA 2AXGB 5BS0A 1FFNA 4CW1A 2G9HA 4U1MA 3ZTNL 43C9B 4UILH 5DFVC 4PJFF 1IGYB 3MNZB 5I1DA 5IB2B 4JFQA 3I3BA 5C0EA 1B9ZA 4GAYA 1NJ9A 4NQDD 1D3CA 4WUKH 5HHXL 1OARL 1MLCB 5KN5B 3VXTA 3V4PH 1T1ZB 2BSSA 3T65B 2RFXA 4GRLD 4Z7UB 2NCMA 1FG9C 4JFYB 5EU6A 3TM6A 4LARL 1DCLA 2EDFA 3VWJA 3M1BA 5ICZA 4LVOC 1GGUA 3MRLB 3MA7B 4GAGH 3KPSE 1H8NA 1J1OL 2HKFH 2RCSL 4OGYL 4FHBD 5I9QB 4OFPA 3VU2A 2NY1C 3HMWH 5DUMH 3TT3H 2DMCA 1EEZB 1HIML 3IDNA 4G59A 2FL5A 1KEML 5E03A 3WIFB 1GGIH 5KSAA 1NFDB 2XQBL 3MZTA 4P46B 5JIPA 3GSNL 3L5HA 4OV5B 4ZFGL 3O3EB 4M6NH 5C9KA 5DQJA 5T3XE 1JGDA 4E5XA 1E6OL 2AABH 3STLA 4GQ9H 4PP8C 3ALPA 3ZHLA 2J6EL 1Q0XL 4GS7C 3BOVA 5EUKB 4FQQB 1OOAA 2FH8A 3RDTD 4FZ8H 1E27B 1D9KB 1MWAB 2ZG1A 3FFDA 3KNBA 5C2BL 1YEDA 3T77B 3S9DB 1UM5H 3L5XH 1I7ZB 2H26A 4DOHE 4XVTL 1HCVA 3QCUL 2R2BB 1CI5A 4G6KH 4XRCB 4XZUB 3ULUF 1BBDL 4PJAE 3ZT6A 4AM0B 5E4EC 3WLWD 3HI1A 3DECA 5J0BA 5D2NC 1DUYA 1LO2L 4ODUB 5I8OL 3VD3A 3TYFA 4NQED 3FZUD 3W2DL 5F21B 1ZSDB 3SJVD 2P5WB 1R5IB 5EO9B 3PDOB 1T0PB 3SKNA 5E94A 4PLKD 4P23D 1G9NC 2HA1A 4QO1A 2UWEF 3BMWA 4Z7VE 3BP6A 2DQHL 2NY6B 3L7EA 4J8RA 4KKBC 4GW1A 4LSTL 3F7PC 3RY6C 2UV3A 5DSCA 3RX7A 1IGIL 3BPOC 3O2DA 1MRDL 5TE4H 2GUOA 3TIEB 4FQXB 1Z5LA 2H45A 3MV8E 1MWAL 3ARFA 3HKFA 3ARRA 4JO1H 4JZOB 4HJJH 1C7SA 2DBLL 2XPGA 1IQWH 1XZ0A 5MEPA 1KN2L 1RZKC 5HTSA 4ZUUA 5HHME 1EFQA 2BRRH 5EUOF 5D1ZA 4ZO9A 3UBXA 3T2NH 4R0LA 3MXWH 3RUGB 2X2YA 3LS5H 5ALCL 4XPGL 3FJTA 4ZYKB 2B7DT 4XWGL 4JPIA 5HHQA 5DK2B 1RZJH 3DOSA 2BERA 2R0WH 3MX0A 4YXKH 4L9LB 2YD9A 2IFGA 4HK0A 1N0LA 1OP5K 2R1YB 2NTFA 5E2VH 5IMKA 1JPFB 1I8LC 2GKIA 2HFGL 2JLLA 2GY5A 4QEGA 4MD0B 1MY7A 1TJIH 4JPWH 3GNML 2FATH 4PJ5E 1KTKE 4L9DA 3MOBL 1XF2B 3F58H 1HHJB 3U7WL 1CXKA 1K6QH 4Z7WA 4XP4H 2R69H 2N56A 3GUTB 3CSGA 1TITA 4M5YL 1FJ1B 3GSOB 5FK9A 5CMAB 3BWUC 4C55A 3NVQA 1T7XA 4MMXC 4LP4A 2B1HL 4WU7B 4PBVC 5E6IC 3BZDA 4HH8A 4ZS6D 3D18B 4PJIA 5B8CB 5HI3D 5C3TA 3KPPB 5DA0B 5BXFB 3UEZA 4U1LA 3NIDF 2G5BA 1OAYH 2GJ6D 4CRPA 1CIUA 3IJYB 5ILTL 5EPMB 4PRDA 1O7VA 3PIQB 4XXCA 1FNGB 2P45B 2IQAB 2HG5B 3W0WD 3D0LB 1CDIA 2PW1B 3U4BL 3MRFA 1T20A 2XXCB 1HCFX 1I1YA 4GW5B 4XAWH 3UTSA 3O8XB 5DURD 4LKXB 1O5DT 2A0LC 2E9IA 3VXQB 5MERB 1REIA 4S10A 4MXQA 4MJID 3GJFH 3MRQB 5TF0A 3ULVC 5FKAA 2J7LA 4K3DH 4OZIF 5DFWH 4J3UA 5F89B 3GJEA 1I1AB 4C56D 4UIMB 1IVLA 4C57C 2YUVA 4OCSL 2UZIH 2V7HA 3B3IA 4I9WE 3UZVB 4PRHA 4IEFB 3U7YL 3GI9H 3FO0L 3ARVA 3Q5OA 4JG0H 1FYTD 3MNVA 4X6CA 4EOWH 4DGYL 3UYRH 2AI0L 1B6DA 1GAFL 2H2SD 5DJYA 1A6ZA 1JWSB 4RSVA 1H8OA 1P5VA 4U6HB 2J5LC 1NAKL 4G8GA 4NBYB 3T0EB 4QRRA 3MRPB 2ADIA 2PYFB 3KVQA 1DQJB 2QKIA 2YBRB 1ACYL 5MENA 4OLYH 5EA0H 5GISH 5IUSA 2NX5E 5EDXA 1N8ZA 3MCLH 3FQTB 4XHQA 3QIUD 1QPPA 5F44A 4ZXBC 2D31B 3AY4A 4NJAL 3E6HA 4L8CA 5DHVB 1KTDA 3BYYA 3DX6A 3I75B 1OB1A 4LEXL 3U0PA 3FFCA 1OWWA 2J8HA 5GIRA 3T3MF 2JIXA 4DGIH 1MI5E 3R8BB 9CGTA 2A9NL 1A7PL 3JWOC 4NC1C 4TUOA 3IAQA 2NY3B 1IBGL 4P48A 2L4OA 4I18C 1YPZA 1BJ8A 3EDDA 2VQ1A 3SCMC 1MJUL 3IF1B 1AXIB 4IBLT 4P46D 2X89A 1Q72L 4ISVB 5GS1B 2CSPA 1N64L 4KJWD 3SGDI 1K8IA 1I9JL 1QSVA 3KXFE 4WFED 1A9EA 4ZAKB 3KJ6L 3T4AA 5JLZB 3KPRE 3IU3B 1OAKH 4IOIB 4XCEA 2CLRA 4NNPH 5I16A 3UC0L 5E6YA 3OKLA 4EUPB 4M48H 1FFQA 1FNSL 4ZUWB 5BVPH 3SDXF 1ZA3B 3O81A 5DRNA 4JDTH 2OBGA 3G6JF 1LGVA 2BHUA 4YHML 3WHXA 1GSMA 1L9NA 4G7VH 1E6JH 1EVUA 1F3DJ 2LVEA 2F54B 1L0XA 1WITA 4HMDA 3U6RB 4H8WC 3VFVB 1KB9J 2NY0C 1HQRA 1N2RA 2EYTA 4HEPG 2F53D 4MWFA 4UIKH 3IU4H 4OGAD 3MCKB 4Z5RA 5D2NE 3EOTH 3MGAA 2P5WD 5E56A 3BD3A 3QDGE 3O4LA 4MNGA 4XBPB 2APWA 2VLJB 4NRYA 2QQKH 2YEZB 3KLAB 2FX7L 4JVUA 2FYYA 4MAYA 3HNSH 4MX7B 2JTDA 4PBXA 1RY7B 2VWEE 2YMXL 3F7YA 2APFA 4IOSD 1K3ZA 4NT6B 1GGCL 2FZ3A 2SEBB 5I18H 2AERT 5L0QC 4FQXD 1ZTXL 4JHAL 4V1DB 4Y89A 3I6KB 5KVFL 4Q6IB 3QNXB 5JNYB 4YWGH 2DQGL 1BVLB 2VC2L 3VGAB 3R06B 2PXYA 4HF5H 1HOCB 5EN2A 1DN2A 5DS8B 3I6LE 1SHMA 1MIEL 2ADGA 3P11L 3S5LG 3V5HB 4KKLD 3B8SA 5IJVB 1A7NL 1PSKL 1JPGB 2W59A 4KU1A 4P57A 1MCPL 4RBPH 1JFMA 4KVNL 2ILLA 1AGDB 5CSZB 3TO2B 3F8UB 4LSQH 3OWEA 5GRZA 4RGND 2FWOA 4GO6B 1EZVY 4FFZL 3EJYC 5DJCA 1FH5L 3QDJD 1WC7A 1PJ9A 2R0LL 4Y16A 3BAEL 5GJTH 1DN0B 2EDOA 4QWWC 4ZS7L 3RWCB 2BVQA 5D7KD 1KSRA 3FL7A 1NAMH 2JELH 3RL1A 1AJ7H 2X09A 2DWDB 4NZTL 4XTRD 1UWGH 3QWRA 3EZ8A 3HCVA 2CXGA 1AXTL 2Z31D 2WANA 5T3XH 4S1RL 5HI5C 3GHEL 2GSGA 4ELKB 1IAIL 2DQFB 4LPVA 4KI5E 4F7EB 2FGWH 4Q7DA 4S0UC 1JN6A 4ODXB 4OZFB 4U31A 1G0XA 4Y4KC 1QBLL 3QDMA 5KSBA 3DXAA 4WO4A 1XIWD 3BGFC 1UGNA 1IE5A 4MJ6A 1OAQH 1C5BH 1CGYA 4U49A 5FHBH 3SGKA 5IR1B 1A1MB 1B0WA 3QUZD 3DX7B 1XCTA 3G5XA 4PP1C 4E42A 3BIAX 5GZND 1F4XL 2CKBA 1RULH 1BIIB 2NR6C 3TN0A 3MLUL 3QFDA 1OAXH 3LD8B 3FB5A 5EC2B 1MJ8L 4PYHA 3DVGA 3RI5F 3RTQC 3BHBA 5DQDH 2YN5A 5B4MD 2VLRE 3E2HB 5IK3B 3PWJB 2X9XA 3S96B 3V0AC 3D25B 3QCVL 3RPIB 4BZYA 1S9WA 3O8XD 2YD8A 1U8LB 3O6FC 3PWPA 2DN7A 1ZLUK 3S88L 2V2WA 3DIFA 3DSFH 4IHOB 5I6XC 5I71B 5JQHC 1BFOB 3I50H 1T1YB 1XGQB 2QR0B 4DKFL 1BAFH 1GGBL 1CDYA 5DD5L 1FFPA 1I1AD 2IANA 1C5CH 5BZWB 3C60C 2A9ML 3CK0H 3TZVD 2A73B 2YOCA 2BFVL 1YEHL 4LRNH 4M1CC 1TPXB 1I85C 3BESR 5IEKA 3U9UA 1IC7H 1YA5A 5C0BB 3AREC 1VEMA 5C1MB 3BKYL 4PJXF 4LIQE 3BVNB 1OP5H 3LKPA 4MJ2A 3UROR 1LP9B 4L8BA 1HHIA 2EH8H 4QGTA 4HBCH 1CGWA 3MRIA 1JPSL 3ZE2F 5JOFB 3BUYA 1K3IA 3W82A 2XN9E 4YE4H 3CLEL 3F12A 4D9QE 2MJWA 4TOYH 4PJCE 2OI9B 4OM0L 4XMPL 3NACL 2HLAA 5HGDA 4GXUN 1VKXA 1INEH 3BT2H 3IDIB 3TLRA 1W0WB 3H0TB 2CKNA 3O2WL 3STZB 3DO7A 5IKCB 1P4BL 4RA3A 4F57H 32C2A 3VFUB 4FRWA 2ARWA 4RFEB 4UZGA 5IB5B 4HIEA 2DWEB 4XNUH 3UYPA 1AQKL 1XR9A 3TF7A 4YHNB 1BOGA 1KYOJ 3NZHH 2B4CL 1WWCA 4L3EE 2A1WH 3PWVB 1MEXL 4ORGA 3MLXL 3LOWA 3WCYA 1H5BB 5EBMB 3IKCA 4NC1E 4CN1A 5IQ7L 4FMFA 1UZ6F 4AT6B 2VXVH 4JY5L 5K9OB 2HVJA 5IM7B 4WW2A 4KK8D 4OFYA 2JK5B 4WFHD 3MLWL 1Y18B 4C83B 4RWYL 1KPRB 4KV5E 2VE6B 4YO0B 5C9JA 1E4WL 2AQ2A 4LQ1A 3K2UH 5FV2A 3CVIH 4Y8AA 1XF5A 5DEFA 3RY6A 5B38A 1NLDH 4X6DB 2EE3A 4LLQB 5TDOA 4HGKC 4P49A 4TNWK 3RNKA 4OZGA 3UBXG 3PWNB 5L2KE 4FZEH 3BQUB 4NN6B 4R9HA 3FT4A 3BP7B 4JN2B 1IAKA 1DQMH 1X5AA 5JHDD 4G80B 5CGTA 1YYLH 4EI6A 3IDXH 3REWB 4AMKL 1T5WB 4LVHC 3W9EA 4JRXE 2BSTA 4BKLA 3SE9L 1A7RH 1AGCB 1JTTA 3V6ZA 4OCRH 1MAML 1F97A 1F6AB 4M5ZH 2GEEA 3QXAB 2CD0A 2ADFH 2NW2B 4NBZB 3VXMD 1KPVA 4HHAA 4JM4H 1OSZB 1YMMB 1OPGH 5MHSD 2OQJB 1ZHLA 2AJYH 2YWYA 3WL9B 3IGAB 2F58L 4XC3H 4LCWD 5HJ3B 5MEOB 1ZT4B 1R24A 3OAUL 3ULUC 4HX1A 1BZQK 1MFAL 1NGPL 2WBWB 1QLEH 1I8LA 3LKNA 4U6VH 2P8LB 3QWOA 1KTLA 2Z8WC 3TH4T 2AJVH 1TTUA 1MQKH 5ID0B 4PJBB 5F7UA 5HHPA 3MRDA 2YSSB 3L6FB 2YPLE 2GJZA 1IC5H 5EBWB 1PG7W 3TBWB 3LPWA 1NQBA 1OGAB 5HHOB 2E8YA 1KACB 2CRYA 2Q6WA 4PJDA 4N5EC 3WSQL 2ITCA 3EO1B 3JUYA 1VFMA 4WW1B 1CL7L 1CYGA 4X98B 1BF8A 2X4QB 5IF0B 2HWZL 4ONGH 1FNEB 5E6IA 1J8KA 3JTCA 4OZHF 4BH7A 3SQOL 2W1NA 1FL5A 4OCWL 1U92B 4PJGF 2GITA 4MA3A 4K3EL 2AEPH 4IMKA 1JZ4A 1KCVL 2IG2L 4L4TE 2ED7A 3U0TB 2BNQE 2M8XA 3WD5L 5E2JA 2KZWA 1WT5C 4PJEE 4OAWA 4L3CA 3IDMA 1G9ML 5F7MC 4YC2C 4HKJB 4LSSH 2P24A 4BM7A 4PR5A 4Y5VB 4HV8A 2JJVA 1UA6L 3MBEA 4G8EB 2FEDD 2Z35A 3WNLA 4X7EC 4KMQA 5DZNA 2DAVA 4MB5A 4LAQL 4MNHB 4XVUD 5ISZA 5DD0L 3L95B 2ERJB 1A3RH 3P0VH 5FF6A 1FO0B 3LKOB 1NGQL 2KPNA 3T09A 3VI3F 5JXAL 5SV4A 2R1XA 3HLAB 4HWBA 4ZO6A 1T7ZA 4Z7UF 5D7IE 4X5LA 3KWWA 2VABB 1BD2E 3O11A 4PG9B 4RMWA 5LQBL 2G2RB 4KVCH 3FRPG 1K4DB 3K1DA 5IHZA 1BVKB 5H2BA 4EDXA 1S9KC 4XT1C 1UQSA 1T66C 5ICXA 3WIHA 3D5OF 3PNWB 5DMIH 2XKUA 2PF6A 1I8KA 2CRMA 4LHUG 2ED9A 4WIQA 4E41E 1NFDF 1YJDC 2F5BL 5HY9B 5IVXA 1A0QL 5FIEA 1MAJA 3FQWA 1DQLL 3NCJH 4X4YB 4TSBH 4XPFL 2Y7QB 3BGAA 5F1NB 2VXSL 4MAUL 1SQ2N 1CFSB 5FGSA 1ZT7B 4KZDH 2VDPL 3NOIA 5HHVH 5T1MA 4ENED 1UACL 2FSEA 2QADB 1S9VB 1S78D 3OQ3B 1DTUA 1GZQA 5EU5B 1HHKA 4ZXBA 1R3KB 3QUKA 4WWID 1GZPB 1HXMB 1DBKL 2UVEA 2X4PB 3BKJH 3P0GB 3RKPA 3G5ZB 1JI2A 1BZ9B 3D39E 2DQCL 5C0BD 1JZ5A 1RZKH 3WUZA 2P5ED 4UDTB 4JO4L 3NIFF 3RX8A 3V4PL 4XBGA 1F11B 2A38A 2I9LB 3OKOA 4I18A 4LBEA 3EYUH 3S97C 1RJYA 3V2AR 4ZTOL 2H8PB 3SCMA 5A1AA 4MD4A 1SYSA 1LQVA 5TQ0H 4GAGL 3L5JA 5T1LB 4OLZH 1N4XH 2NNAB 2OL3H 3HMWL 5FUZH 3TT3L 5JUEH 1GGIL 1QUNA 2PCPA 1BQHG 4GW4B 3T4YB 1FNAA 1NCTA 4D0DB 3QEQD 4M6OH 4DUXA 5I1JH 1KIRA 3WXWH 3S5LB 1NGZB 4PJ7B 1ADQH 2WM0A 3RQ3A 5K59F 2R4RH 5ENWA 4PRIA 3BRDA 3G6AB 4G6JH 4YR6A 1VEPA 1NUFA 1ZA6B 4I3GA 4U1SB 2VDOH 2KKQA 3EO9H 1QFHA 4XAKD 1KLGA 3LQAH 4GRMA 2XZZA 2WBJD 1TCMA 2DI7A 5JZ7D 3JTSB 2CUHA 2Y06L 3O9WC 3MSPA 1LE9A 3IDGA 3B9KA 3DX8A 3GMQB 2GT9B 2N4IA 4NQCB 4G6KL 5CIPB 3FOLA 3F7VA 4LSUH 3TJHD 4PV8A 1UVQA 2UY7A 1ZHKA 4RGMC 4J2XA 1CFNB 3K3QA 3ARDB 4X4XB 4N90E 3C09C 2ICWA 4FTVE 5MP6H 4ONHA 4F3FA 2EH7H 4KROD 3C8DA 4MYWB 4WDIA 1C08B 1R3IL 1KULA 2IPTL 4GUPB 2X10A 4RAUB 2VLLB 4L4VD 4HWZB 3TFKD 3GI8H 4NJ9H 5E99H 1A6AB 1LILA 1MHEA 3QPQD 5BRZA 3GSVB 3GSUA 3V6BR 4QOKE 5SX4H 3BGMB 3QULB 1WZMA 2K9UA 4KJPC 5BS0B 1WFNA 1FFNB 1QSFA 4CW1B 4ZUVB 2G9HB 1OD9A 1IQWL 4X80H 5EH1A 4FA8A 3RX5A 4LL9A 5FOBA 3GMNA 4JFQB 2BRRL 5I1GH 3BEWA 3MXWL 4KK5D 4GAYB 3TNMA 1NJ9B 4YIQA 4Y4HC 3TC9A 4HIXH 1ZLSH 2BSSB 4LIQH 2RFXB 1XAUA 5AYUL 1MHPL 1DVFC 2BC4A 3VWJB 3M1BB 2E7LA 5ICZB 3WS3A 3RZCB 1N7ML 1A5FH 3CDGB 3EYQD 3LSOA 3THML 2FL5B 5KSAB 4JPWL 1MCKA 4IOFC 1Y6MR 3UTPD 4P9HC 3U30C 4JFFA 1FIGH 3F58L 2HLFD 4Y4KA 4ZQKA 5D5MF 1JGDB 1FSKB 4E5XB 1F4WH 5HXMA 4JR9H 3SDDA 3DROA 4UNUA 1UT9A 5CS7A 1TJHH 5DTFA 4KQ3L 1HHHA 4XXDB 4RX4A 1AE6L 4AEIH 3KNBB 3FFDB 2NXYB 4GG6A 3VJ6A 1Q8MA 1SEQL 2W0FA 3U82B 4B53A 4CMMA 5DJDA 1GC1L 3W11C 5BVJA 1RZFL 2H26B 1HSAA 4MNQD 3S3SA 3VGGA 5C0JB 3AS2A 3JWOH 2NY2B 2D4DA 1S5HA 4DQOL 5IV2A 4LSVL 4PRPE 1R5WB 4NGHL 3RTQA 3HPJA 1BFVL 3A6BH 3HI1B 3MRJA 3ARBA 3U1SH 3MGOA 1DUYB 5JXED 2CLVA 1OAYL 1BQLH 2XY2A 3TYFB 1JPTL 2OZ4H 4JQVC 4XB8A 2GW5A 5D1XD 1V7MH 3U9PH 2WINA 5E94B 3SE4C 5K9JH 1J87A 4RNRA 4X4MA 1WFUA 1CICC 4U3HA 4JFXA 1B0GA 3BP6B 1W72B 4C4KO 3DJ9A 3L7EB 4HIHA 4J8RB 4GW1B 1QO3B 4OLUH 5I15H 4NWTL 1IL1A 4PD4K 2OX5A 3C60A 2GUOB 3Q3GB 3UYOD 3O3UN 4JFOA 1WJ3A 1Z5LB 4LASH 1S7TA 4QXTB 2EXWC 1I85A 1OL0A 4WV1A 3ARFB 1O0VA 4P2RA 2RAMA 2PYED 2XPGB 4H8WH 2UZIL 1XZ0B 4PJHA 5MEPB 4QXGH 1JWUA 3FQNB 3ULSA 4ZUUB 4M7JL 2VSCA 5T5NG 3FTGA 1T83C 5D1ZB 3WNMA 3GI9L 4B7IA 1A6UH 3UBXB 4R0LB 2V5TA 4OIIH 2ZJSH 5GRWA 3BJLA 4MS8C 4EOWL 3MPCA 4GRLC 5L8LB 3TIDA 4TVPE 2DLHA 3UYRL 4JPIB 5HHQB 3ZDYF 1G0YR 5EBGA 4Z8FH 1JK8A 2QADD 1MRCL 4BSJA 1X5LA 4HK0B 4G9FE 2NTFB 12E8H 5IMKB 1NBVH 2NZ9D 4YUEL 2I60H 5L6YH 2VH5L 2D7QA 3LMJH 5ACMA 4OLYL 1W72L 2DLGA 4K7PH 1MCDA 3HG1D 4MXWH 3V6FA 4ZO8A 1KB5B 4KPHH 1S7RB 4WWKC 1G7JA 2HVKA 5D4QA 4Y0GA 4Z7WB 4FN0A 1I7RA 5EIQA 4NIKB 5C6TL 1P7QA 2LTQC 1YYMH 2VIRA 4PJFA 3NFSH 4R4FH 7FABL 5EORL 3RDTC 5FK9B 4U0RC 3UJIH 1WWBX 3SKMB 4I1NB 5T1LD 1L6XA 3S4SG 2DS4A 2GTWA 1RFDH 3MRBA 5FHAL 4CVZA 5FAAA 3WJJA 4PJIB 1E4KC 1FN4A 2LV4A 5I8KH 3TVMC 5CSBA 3WLWC 3P0YH 5HDOA 2ZKHH 2CRIA 4OD1L 4NBXB 5GGQL 2G5BB 3I9GH 5TE6H 4JDVB 3GM0A 4PRDB 3O0RH 4G8GE 4NNPL 1V5JA 3BN9C 2NXZC 4FXKA 4M48L 1CGSH 1RIHL 3WFDL 5HPOA 1Q9LA 3VMPA 4PLKC 3L5WA 5BVPL 1LEGA 4P23C 3MRFB 5D1QD 2ZCKH 1T20B 3B5GA 3VH8A 1I1YB 3O45A 2HFTA 1KB5L 3WIIL 4NQCD 4JCMA 3OKKA 4K94L 1RUPH 5HYEA 4QRPA 1E6JL 4HUXB 5FKAB 3LB6D 4PTUA 1TZGL 2F8VA 3LRSA 3VFTB 3LQZA 4NNYA 4UIKL 1M7IB 3IU4L 1IC4H 2IPUK 4HZLA 3GJEB 3CU1A 4MVBD 3NCBB 1OM3H 3R1GL 4N0YH 3UAJD 2EDTA 1J7VR 4DN3H 1FZOA 3CXHK 4YXHH 2V7HB 3B3IB 4PRHB 2NW3B 3PQYD 1NFIA 2B39A 3HNSL 5GRVL 2L7UA 1HQ4B 1NC2A 4JG1H 3MNVB 4X6CB 3VFWA 3D2UA 4Z77A 1I1FB 3MRNA 3N50A 1QLFA 3QSKB 1MCFA 5I18L 5GRUH 3T2PA 3JV6A 5DJYB 1A6ZB 5JW4M 1ZGLP 2UWEA 4NQXB 2X1WL 5FCUH 3MBXH 4YNYA 4H88L 4QRRB 5AG9A 2ADIB 2R39A 4G6AD 5E8EB 2QKIB 3RIFF 5SWSE 5LKNA 1BMGA 2W38A 5IEHA 1KC5H 4N5EA 4JKLA 5MENB 1FPTH 5CLWA 3B4NA 3QEGH 1BECA 2V5MA 4LHUB 5ANMA 4RISH 3RWEA 2F5AH 3SKJH 3MMEA 1J8HA 1N8ZB 3S37H 3JWDC 4KY1H 2EDKA 5EO0A 5F7LB 4HFUL 4L8CB 1KTDB 3DX6B 1OB1B 3U0PB 4J6RL 3FFCB 5ERWB 5GIRB 3LEYH 1MPAH 3RZCD 3Q48A 4LSQL 2WAHA 4M1GL 1JF5A 1NMBH 1WT5A 4IRSD 4TUOB 5EG6C 2XICA 3LZFH 4A2MA 4JRYD 1AGEA 3TPUA 2VQ1B 5CP3H 3LDBC 1ZANH 5J12B 2V9RA 3EYFA 1GHFL 5GJTL 4JFDE 2X40A 1QP1A 4ZO7A 1WBYA 2JELL 4APQA 4S1QH 1K8IB 5HDLA 1T5XA 5T3XL 4DVRL 1A9EB 4XH2B 5F1OB 3T4AB 3MRCA 1BWWA 2Y9RT 5GGRA 1I3GL 2DI9A 3OR6A 3VXSD 4Y1AB 3WHE0 3OKLB 5GGSY 2Q7NA 3FO2A 5MEQA 4HC1L 4RGOL 4UUJA 1OAQL 3D0VA 3K74B 5DQ9A 3L1OH 3WHXB 2NY2D 4JFEA 4LVEA 4HMEA 5FHBL 4B41A 2EXYC 2H1PH 3GGWA 4HXAH 4U3CA 5FEBA 5KSVA 1J88A 5E2WL 1LP9F 3QISA 1N2RB 1RULL 2EYTB 4MWFB 5K9QG 4NO0D 5JPNA 5TDNA 1EO8H 5D7JD 1KJVA 1G0DA 1XF4A 4GJTB 4Y5XA 1AGFB 4Z5RB 4WY7H 2Y4SA 2E8ZA 3O4LB 1YEKH 4MNGB 3HA0A 4LNRA 5HGBA 4NRYB 1PQZB 2FYYB 4RFOH 1FC1A 4MAYB 3C6LB 3ESUF 4FQ1L 3F7YB 4JFZH 4XX1E 3DSFL 3SE8H 2OMNA 4JGMA 1KJ3L 1U93B 2H2SC 5DUPL 1MIMH 2I5YH 1JIBA 1G7MA 5HHNB 2QL1A 2QHRH 2F9BT 1XEDA 3RWJA 4U1HB 1CFVH 3NIGF 5KSBE 4O02H 5J13B 1RJLA 5EN2B 3W39A 3QH3A 2VJXA 1IC7L 1GL4B 2ADGB 2VKXA 3QIUC 4N9OB 2E6PA 3QNYA 3UJJL 4J3WA 1QACA 1QPXA 4P57B 5C0RL 3RJDA 5M94B 4IMLA 2EH8L 3UTTA 1Z3GH 3MYJA 4WUUD 2FWOB 2WZPD 1N0XL 3G6DL 4X6DF 1ACZA 2OCFD 3N06B 1WC7B 4MA8L 4Y16B 3QA3A 2XKNB 1IM9A 3OKNB 4XMLH 4RAVA 4YGVA 2BVQB 5DYOB 1J11A 3HRZA 2EO9A 1H0DA 4F15B 3PP3H 1ZEAH 1EXUB 1WF5A 3RL1B 1XMWA 1INEL 3HCVB 4B7LA 5I73B 5IOPA 3LPFA 4TPRH 4J7RA 3RI5K 4JO3H 5E70A 4R4BA 2NQCA 3S3PA 5F7EH 3P4NA 1DBBH 1JN6B 1DQDL 1UEMA 3QDMB 3NZHL 3P9LA 3DXAB 2R8SH 2A1WL 4MJ6B 3WFZA 1MF2L 4O4YL 5CGYD 3O2VL 5ESVA 1TCRA 4FQ2H 4U6YA 5KSUA 1H3GA 2CR3A 2A6JA 1HYRC 4BZ2H 2HTKD 1SBBA 2PR4H 3NCFB 2DYPA 1XCTB 1N5YH 2YRZA 1NCBH 3LKQA 2A74A 4E42B 4LLWA 3X3FH 3L7FA 3QRFM 3PGCA 3TN0B 3QFDB 4PLJC 3IS1X 4PJBF 3FB5B 2AS5M 4M8VA 5KBNC 4O2EA 1YEGL 3ARTA 4U0QB 5TJWK 3BHBB 1PAMA 3FN0L 1CS6A 1NLDL 2C3HA 5D2LE 3W81A 3TBSB 1UXWA 5CUSH 1M05A 1BLNB 1S9WB 3H3PL 4FZEL 3PWPB 5DDHA 4ODSH 4QNPF 1BEYL 1DQML 2V2WB 2Y5EA 3DIFB 3ZDZF 1C1EL 3RVTD 1YYLL 3MFFB 4FFWC 2QHLA 4O2FA 4YDLC 4M6MH 1A7RL 4X99A 1NUNB 5IBUB 3SDCD 3G6JA 1FFPB 2FBOJ 1LMKA 4M5ZL 2OSLA 1C8PA 1VENA 2IANB 1KV3A 3HI6H 5EOQL 4Y4HA 1TTFA 3SDYH 3UTZA 4KHTL 1F4HA 3KPSD 1C12A 3WKNA 1T21A 5AZ2H 5F7FA 1BBJA 2C9AA 2HH0L 3U9UB 2NMSA 4LVOB 4JCLA 1ROWA 5E4IA 5H8DA 1YJDH 1T89C 2NY7H 1QLEL 3SO3C 2NY1B 1ONQB 4TVPH 4ELME 3QRGH 4L8BB 5T3XD 2D03L 1HHIB 3MRIB 4RGNC 4OUUA 4F7TA 3MOQA 1MQKL 2KH2B 3BUYB 5HYJE 3KPRB 3F12B 3PP4H 1J0IA 4P5TA 1I7UA 1BJ1H 2EC9U 4LHUD 1GJIA 2CQVA 1IC5L 2HT2D 2KUTA 4OI9A 1UWEH 2HLAB 5HGDB 1DDHB 1G6VK 3T3PF 3KR3L 1F02I 2Z31C 1B2WH 3GKZA 4TSCL 3I02B 4ZMAT 5LWYH 5DVOA 5A2IH 32C2B 1T1WA 3ZYJA 4U7SA 4WI2A 1CD9B 4HIEB 4JQXC 4ONGL 3N85H 2GFBB 1XR9B 3HE6D 1BOGB 2IMNA 1XIWC 1BVZA 5E4EB 4JY6A 2AEPL 5JDSA 4ORGB 2YC1A 5D2NB 3O6MH 2XRAH 4D0BA 5T5FH 3IKCB 3CFKA 3OF6A 1JZ7A 2X89D 3ARQA 1F42A 3BPCA 3QUZC 2XKSA 2HVJB 2FIRT 4WW2B 1S8DB 4YBLC 4AQ1B 1WZ1H 4F9LC 3SE4A 4HMCA 5HI4D 2GQHA 2ED8A 1CICA 4Y1AD 5C9JB 3T08A 3MV8D 1I4FA 2EDLA 5B4MC 3GRWL 1XF5B 5ADOL 4UV7L 4NKQB 2MNUA 3S4SB 3RNKB 5HYIA 3QEUB 3QEHB 4OZGB 1A3RL 3FT4B 4EXPX 4TUKH 2BCKB 3CIQA 1IAKB 5HHMD 3H42H 4KZEL 4JHWH 3B9VA 4KRNA 4EI6B 1WBZA 2VLME 3QJFA 1EX0A 4PB9H 2BSTB 4BKLB 4BH8A 3V6ZB 1OD7A 3OB0K 2ZUXA 2BXYA 2AJZA 5CSGA 3QG6A 5F71A 3FAWA 4NQDA 1B4RA 3TZVC 1KPVB 3HZVA 4HHAB 3UPCA 2V5RA 2AK4E 2EYSA 1EVTC 1E4XH 4GRLA 1MQ8A 1ZHLB 4ODHH 5TPWH 1LVEA 3BZFA 3NCJL 4HKXA 3C6LD 1R24B 1P2CA 2E6JA 4P4RA 4XCCL 4F9PA 3VG0H 2YPKA 2FO4B 4PJ5D 5CILL 1KLUA 1G9NL 4J3SA 3LKNB 3V4UH 4KZDL 4RA0C 3E3QC 4NKMB 1KTLB 5HHVL 2DICA 3EJJX 1IMHC 1A14L 1YDPA 5E08L 5HHPB 3TJEL 2GJZB 2VL5A 5JA9A 3BKJL 4LSRH 1U3HC 4UT9H 3RDTA 4N0UA 1VSCA 4WGWB 3W5NA 1UJ3A 3TWCH 4PJDB 1NUDA 2GIYA 1HI6A 1RZKL 1D5IL 2ITCB 1QFWI 4IRJD 2VMFA 4DKEH 1FVEA 3O4OC 4NQSA 4L8SA 3QPXH 5E6IB 3WUWG 4ZDHA 1E4KA 1FL5B 5E8DH 5TQ0L 4U3XA 1TJGH 2FJGB 2DQIH 4OLZL 4WNQA 2GITB 4MA3B 4PJXA 5LBSL 5DD3L 3UO1H 2AV1A 2E7CA 5SX4I 3VH8G 4QHMA 1KJMA 4A6YH 1N3NB 3MRHB 5GGTH 3AU1A 4GBXD 4ALAH 3AFLA 3U36A 5DR5L 4NP4L 5F3BA 4NQEA 1WZLA 4OAWB 3SJVA 4L3CB 3IDMB 4UT6H 3X11A 2P24B 1BM3H 4PR5B 2VDNH 1U0QA 2DQEH 4P23A 4HV8B 4P9HH 4HKZA 3MBEB 4PP2B 2Z35B 3R8QA 1KLFA 5I1CL 1YZZA 5CP7A 3U4EA 4LLUA 3AVEA 3QJHA 1J12A 1RHHA 3QIBD 5ISZB 3EO9L 3DI3B 2J8OA 3LN5B 5K33A 5FF6B 4ZFFA 3V4VH 4X7SH 1FFOA 1VFOA 1INDL 2Q7YA 4I9WD 1TXKA 3S36H 3KWWB 4PGCA 1NEUA 2AEIT 1FL3A 1XF3A 3FN9A 5FM5O 4MA1B 5IHZB 4EDXB 3MJGX 3HAEH 1UQSB 5EB9A 5F8RC 3WDHA 5ICXB 2EH7L 4XP9H 1DQQB 5ESQA 3RA7H 4XNMA 1A6PA 1I8KB 2FJHA 4V2BA 4XCFH 3WXVH 4K2UH 3PGDA 5DC9B 5IVXB 5HDQL 3K7UA 3C5ZD 5F6HI 4LPCA 3RVVD 2J5LB 3F6IA 1WSST 3P4OA 4I3SH 2AJ3A 2NX5D 4K55A 3U83A 5H94B 3BXNA 5T1MB 4IIQA 2FSEB 5F9AC 1RD6A 4GXVL 1VERA 3P2TA 1X7QB 5IWLC 1X6LA 1GZQB 1HHKB 4ZTPH 4ZXBB 1U95A 3CXDL 1WBXA 2X6MA 1PG7X 4HWBL 3VRIB 1DSFH 4S11A 1WTLA 2CO6B 2ZSWA 4JZJA 3MV7E 1FRGL 3M8OH 4ZSOE 3OKOB 4I18B 3U2SA 4U1KA 2A6IA 2CKBH 3WIHL 4ZFZA 5D72L 3SCMB 4MD4B 1SYSB 3JTTA 1F6FB 1FG2A 3OX8A 1YEEL 5JR1H 5EO1A 3KPRD 5JMRA 1MCQA 1YN7A 5FYLL 3MRMA 1G7HB 4EDWH 2GAZA 2YS4A 4M43L 5HYFA 3G04A 3TNNA 2GJ6A 2PCPB 4XPAL 5J9PA 3TO4D 4JN1L 1FIGL 4YFDB 3VD9A 5ICYA 3NTCL 3W0WA 4PJ9D 1KIRB 2F74A 2OTUA 4LSPH 1HXYB 1FCCA 2ICEA 4JR9L 2E9WA 4XCYA 5ENWB 2FEDC 4W4OA 4PRIB 1CD0A 3EGSA 4MA7L 1WTGT 3K80A 4I2XE 3FQXA 4M02A 4YR6B 5E5UB 3DUUA 1T2QH 4MJIA 4XVUC 4WHTB 4DUVA 1WCQA 3QDGD 2NY0B 1LE9B 5K9KA 3B9KB 3DX8B 3JWOL 1U6AL 1IGCH 4C56A 3FOLB 3F7VB 4RRPA 1P7KA 3SKUD 4PV8B 4JFHE 3A6BL 4KTEL 4PY7B 4LLYB 5C0DB 2WP3O 1BQLL 4ONHB 1KCRH 1FYTA 3VXUE 3N9GH 5CEXA 1N6VA 1FCGA 1PBYA 1PZ5A 2OMBA 3KPLA 4LCYA 4WDIB 2EIZA 3TH2T 1A6WL 1H3TA 3GMPA 5L0QB 2ARJA 4J3TA 1WEJH 2J6EA 3CFBA 3RJQB 5GSVA 4J1UA 5IESL 1MHEB 5I15L 3Q5YA 5BRZB 3I6LD 43C9A 3GSUB 1QBMH 1QBBA 1XGPA 2PTTB 4ENEC 4LASL 5FO7A 4AIOA 1S78C 2R0ZL 2DD8L 4XI5C 5HYQA 1QSFB 5KN5A 4GG6E 3QIUA 4H8WL 1WFOA 2NZIA 2VISA 3T65A 5DJXA 2H32B 2NPLX 5FOBB 5DD6B 5I30L 1UH3A 1AXSB 2R56H 4BSVB 5C86A 1JGEA 3MA7A 1A6UL 2CJUH 3TNMB 4OIIL 4YIQB 2ZJSL 5I66A 4G6FD 2IPUG 3FQUA 5EOTA 5E1AB 1EEZA 2E27H 3H9SE 1KBGL 4OGXL 1F2QA 3GMLB 2BC4B 4XCNA 1KCUH 1MELA 3WS3B 1M7DA 12E8L 4KI5D 2MMXA 3LSOB 4MXVE 2I60L 1BFTA 5L6YL 1J9CT 3NPSC 5EUKA 2IQ9H 4HK3J 4FQQA 5LGKA 5BV7C 1RUQH 4JFFB 2XG4A 5HVHC 1JE6A 1MWAA 1AI1H 1QNZH 4ZQKB 4Y4KB 2VAJA 5LG1A 1U41A 3DWTA 3VDCA 2Z4QA 1LO5A 1I7ZA 1AR1C 3BGFB 3DROB 5GSRA 5D7IB 1YYML 3ARZA 3NFSL 6FABL