3BFQG

Crystal structure of truncated fimg (fimgt) in complex with the donor strand peptide of fimf (dsf)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
132
structure length
132
Chain Sequence
AKPCTVSTTNATVDLGDLYSFSLMSAGAASAWHDVALELTNCPVGTSRVTASFSGAADSTGYYKNQGTAQNIQLELQDDSGNTLNTGATKTVQVDDSSQSAHFPLQVRALTVNGGATQGTIQAVISITYTYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Infinite Kinetic Stability against Dissociation of Supramolecular Protein Complexes through Donor Strand Complementation
pubmed doi rcsb
source organism Escherichia coli str. k12 substr.
molecule tags Structural protein/structural protein
molecule keywords Protein fimG
total genus 24
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2007-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 3bfqG00
4J3OG 5JQIB 4CA4A 1TR7A 2XG4B 4AVKA 5FWRA 5ABZA 4J3OH 5F2FA 1KLFB 5FX3A 4AVHA 4AUJA 4XO8A 5F3FA 5LNEA 1QUNB 4AUUA 4AVJA 3RFZA 5FS5A 4LOVA 4XODA 3JWNG 3SQBB 3BFWA 1PDKB 3ZPDA 5AB1A 2XG5B 4AVIA 4ATTA 3JWNH 4CSSA 4CSTA 2JTYA 4AV5A 3MCYA 1N12A 4X50A 5AALA 4BUQA 3ZL2A 1KIUB 1N0LB 4AV4A 2J2ZB 3ZL1A 3JWNE 2W07B 1ZE3H 2WMPB 4AV0A 5IQMA 3ME0B 4XOAA 5CGBA 5IQNA 1UWFA 3BWUF 4J3OF 2UY6B 4X5QA 4XOBA 4AUYA 3BFQG 5IQOA 4X5PA 5AAPA 5LNGA 4XOCA 4XOEA 2UY7B 4X5RA 5FLUA 4XO9A 2VCOA 2JMRA
chains in the Genus database with same CATH superfamily
1L3NA 4PJBB 3RWCA 2R2EA 1W16A 3U6XA 2AK4B 3FTSA 4DTGL 2X6CA 3D06A 4AJVA 4Z7WF 4XWGL 1B0WA 5CJOH 1U30A 1KGCE 4XN4A 3WJLC 2YPVH 2OJ1A 1XCTA 3NJIA 2DTMH 5ILTL 3M1BA 4A2HA 4LCUB 2CCLA 3TNMB 5D6DC 3BIKB 5CIPB 3WO4C 1YJDC 1X5LA 5DK2B 5DSCB 3L4YA 1I1RA 3GLAA 4ERSL 3UYPA 5ID0B 2CDGB 3N40P 1ACZA 1ED3A 2HKFH 2D3LA 2RACA 5ETUB 3TNNB 4ZUUA 3RTQC 3AG2B 2FSDA 4XRCB 3PWUA 4K3EH 5F9OH 1BF5A 4MZIA 4MASA 2XV6B 3TPKA 3AQXA 2E0PA 2GJRA 4JMXA 4N87A 2MPVA 3P11L 4RX4D 3ZE1E 4CGUB 4FQJH 2H45A 5D6CA 4P4RA 3UAFA 4AYBA 1N5AA 3DJZA 3CD4A 4TUKH 5G55A 3QR1A 1L6XA 2JIXD 3VXNA 4OV6F 5D70H 5D2LE 2J7LA 3QZLA 1YPZA 3FXIC 1WFNA 3BVNA 4N28A 3GXNA 2PCFB 3STZA 4LLVB 2YWYA 1A9EB 1EGJL 1YN6B 3GHPA 2ZP8A 4PD4K 4DP0X 2OCJA 5CEZE 3IDIB 4FQXA 4WAFA 3VXPA 3KH4A 2V2XA 2YXVA 4F2FA 2C9QA 1MFMA 2CO4A 3FB5A 4ZSOE 3DPBA 4NQCA 2EH8L 1K4CB 3R8QA 3P9WB 3WNPA 2ZONA 5CEYA 1URIA 4PJEF 3ZIYA 4UDTB 1UZGA 1Q94B 4UMGA 5DJCB 2UZIH 5EU7E 3MRRA 3D2UD 3CSPA 1KBGL 2BVPA 2PUQT 2PPDA 3BMWA 4O02B 3ECVA 2EJ1A 3GBDA 1FO0A 3KNBB 5GHWL 1FDLH 3HG5A 1S3KH 1Y18B 4IBVA 3MGAA 4N2HA 1RUQH 4XOEA 1NCAL 2IBGA 2KDGA 5EBWA 1LNUA 3EGDA 1J0YA 3KVPA 1N3NB 4ABVA 4HC1H 4KKBC 5IQLA 1KYOJ 5EUKB 1C5CH 5TE6L 4WHTA 4XWOD 1XGQA 3RE0A 4Z8FH 4MNGB 2B77A 4WKZB 4AENA 1OZTG 4LCIH 1KXHA 4Z5RA 2J2ZB 2PKDA 3HC4L 3NCCB 3Q8FA 4NKIL 5JXEA 3U2SB 2VXTL 2VDLL 3RPIA 3BVWA 5E8EA 4MAUH 3EZJB 3V0VB 3Q5TA 1UA6H 4WGWB 1RU9L 3JVFC 4L4TA 3IJSB 4KRPB 1LILA 2BVQA 4WHCA 5BZZA 1IFHL 4M6ML 5DUPL 1D5MB 1QBLH 4OGAC 5HI5C 3W1ZA 1NCAH 4DGYL 1EHNA 2NX5A 4JFXA 3ZSTA 4CU7A 1HSAA 4ZO9A 3GMQB 4MXVF 4IGBC 5HD8D 3ARRA 2VDKH 4QRSB 5CHNB 4WCYL 9CGTA 2XXCB 2Z31B 2ATKB 1URLA 3RUGE 4FNUA 1ZHNB 2ZPKH 4EVNA 1KXQA 1OY3B 2EH8H 3B2VL 1HJCA 5DJXA 2W80C 5DUJA 2BP3A 2BVPB 4QNPE 3UTTE 3ME0A 4HWBH 4JN2A 5L9DH 4H7VA 4J7RA 3R8BB 4P04A 1NCDL 3Q3GB 3BJ91 4XI5C 2ZXGA 1HINL 5TJWK 5EBWB 1DQVA 2B59A 2MJWA 2B7DT 2IDTA 4AZUA 4KZ0A 3AITA 2BRQA 3EDKA 2WKGA 4TQEH 2FB4L 2VB5A 4BBWA 3GSXB 1XZ0A 2DWTA 2Y23A 5GRVL 5EBMA 1A1NB 3LAFA 2YWZA 5LUMA 3DYPA 4X5PA 3WUWB 2J5WA 4JFSA 4JMNA 2X9ZA 1KGIA 3NFPA 3PAYA 1DZ0A 5MEND 2BSTB 3PWUB 5IIEB 3G6DH 4XMKH 2E3VA 3ABZA 5KBNC 4NO0B 4BELD 3HAEG 3KEDA 4GUPB 1FCGA 2CNYA 3VFOB 1AD0A 15C8L 4DCQB 2P8PB 3MFFA 4LSVL 4P07A 3S34L 5L4FA 1OTTD 5I5RA 1NGWA 2AEWA 1CFSA 1LMIA 4QO1B 3MQIA 4YX2H 5JIKA 3IU4L 5B1KA 5AYUL 1OP9A 2PPCA 2J88L 2X2YA 2XVLA 3GBEA 1KBVA 4OR1A 5FWQA 3TBSB 3G6AA 1DBML 4G8EA 4XN7A 3MRMB 5CKAA 3EBGA 1RZKC 4HOMA 1WBZB 1T5KA 3S6CA 4M7LT 5CUSH 5IV2B 3BHBA 1B0RB 4GUCA 4JFEE 4NCC2 2EVIA 1JXJA 4A2LA 4HJTA 4KTDH 1DQDL 4QTFA 4HXBH 1A7NH 1CL7I 3OJDB 3TBWB 4QXUL 3K6DA 5DC4B 1BVKA 5JIPA 2FBRA 3U25A 2AK4E 3MRJB 4OF6A 4QCIA 4F92B 2XWTA 2YRLA 2XRAL 2IDCA 3UJIH 1XF5B 3T0VA 2VZTA 1UATA 2A73A 4PV9A 2Z92B 3FRPB 2UWEB 4E9YA 3TN0D 3I9GH 4AMXA 5FYJL 3QJHA 4X6DA 3CZFA 3VXQB 1BEYH 3ZDZF 4AEHH 3RL1A 2V0AA 4U1NA 5D5MB 4D0DA 3GFUA 5C09A 3BZDA 3CSBA 4BGLA 4ZZFA 2E46A 1K4DA 4DO6A 3ARXA 1BD2A 4IMKC 4G43A 1AO7A 3TURA 2Y3AA 1GGBH 4YO0B 3O9WD 5EU6E 3VFOA 1AXSA 4HZ1A 4K94C 4BK5C 3RGVA 4YHML 1H3TA 5IQ9B 4BSWA 2JE8A 3O6FA 3P4OB 4LGSB 1NM9A 1XH0A 5BZXA 4FKEA 2UXGA 4HH9A 3RZCB 3BD4A 1O5DT 1UCTA 4J3UA 3BWAA 2MWCA 2OXHA 3FQ1A 4EUPB 5E9DB 4BK4A 3PHQB 3Q48A 3IS0X 3MU3A 2B0SH 2DIAA 4KO7A 2X2UA 2DQIL 4QRSA 5DJ6A 5E8NA 2L7JA 2I27N 3UZVA 5J57B 1T0OA 4NQVB 4BA0A 2OFQA 2E59A 4N2IA 2WQUA 1ETB1 5F3BA 32C2A 3MODL 1P5UA 5CXPA 4BH7A 2NXZD 2EKJA 3QZWB 5A7BA 2DEYX 5ACZA 1TNMA 1MCLA 4X98A 4Z0XA 2DL9A 3N3EA 3Q5YA 1YEDB 4L8SA 1U8KB 4QUOA 3W3BA 5KW9H 4PCSA 1THCA 2CDFA 4QRUA 2PR4H 1LO3L 4LKXB 4LP8A 4UBDD 3APFA 3SOTA 3LIZH 3M86A 5T8IA 4LNRA 1QSED 2EC8A 3QW9A 4U1KA 1PD6A 4GBXA 1TZHA 3LH2L 1XVSA 4R2GB 1KYDA 3MCKA 4J8RB 2R4RH 4MNGE 5E6UB 4X9HA 4HHAB 4MA3A 3TH3T 4PGEA 3UO1L 1GSKA 3VFNB 1JIBA 3LZQA 4ZMPA 3L3IB 4GUPA 1AE6H 4MNHB 1E3ZA 4BK8A 1HHJA 5MENE 3ETSA 4GG6A 4LK4A 4NLAA 1J9RA 3QUXB 3AS3A 4X6EB 5D7JC 1RJCA 1HKLL 2PWGA 2C9UA 3G6JA 4G8GB 4OCSL 3BGMA 2ZXAA 5C71A 3U7AA 3B2DC 4JQIH 1F02I 4XP4H 3U4BL 4ELKB 1KZQA 4PRID 5F8QC 3DO7A 1ES0B 4JM2F 3HE6B 2WCGA 1P7HL 3QG6B 3UZVB 1ACXA 2G3ZA 5I1GL 1VHPA 2WV3A 1CICB 1OWWA 3I2CL 1QFHA 2LOEA 5JO5B 1UT2A 4F57L 3SYOA 1NAMA 3IMTA 3UBGA 2VXSH 5EIIA 2DDQH 4MXWH 3FCGA 2BSRB 5FK9A 5KVGL 1F3DJ 1IEBA 3QDMA 1VKXA 2BM3A 2I26N 3QO0A 2R0ZH 5F7FA 5IW6B 3OG6B 3B7SA 3Q6GH 2FQEA 2I60L 3O41B 3TEZA 5IEHB 3HLKA 5IROC 2P43B 5I71C 1IEAB 1T6WA 3RVWD 4MA8H 4N0UA 5F6HI 1JGVL 3L3OA 4G9FA 5I6KA 3CGTA 3K6NA 1OPGH 3BDXA 4QRPA 2X88A 5L8LB 4IBUA 5DJDA 1UT1A 3OZ9H 4M6NL 4MJ4A 3L8QA 4PG9B 5FCSH 3FT2B 4ONHA 4L3EB 5DQ9B 1FHNA 2DQUH 5D7LB 2B20A 3A24A 5C7ZA 5EZOL 4GG6B 5CJ8A 1K8IA 5ENWA 1K72A 3B2MA 3HAEB 4NHUB 1PG7H 5T1KD 1GRWA 2BIOA 4PJ8A 5A6LA 5EFIA 5B8CA 1SDDA 5IUSA 4IRJA 2APBA 2X3AA 3QR0A 5FV2A 3WL9B 3ET9F 1F41A 3BGMB 2WVVB 5BOZG 1SMOA 4OQTL 1OSZB 4NN5B 2F15A 1HAWA 3IJ8A 1PX4A 1L9NA 2MOGA 1FYTB 1NUGA 5E8OA 1XB3A 4AXWA 1PAMA 1XGPB 2E9JA 1DEEB 5LGJA 3QXVA 4NOBA 1R3JA 2NY5C 3FO1A 2G2RB 3Q1EA 4XNUL 5F9AC 3KS0J 4C83A 1CS6A 1FNSH 2CRIA 3MR9B 3ZYOA 2GITA 4ZSOA 1CD9B 3K91A 4DERA 1UGNA 2RAMA 1TTAA 2XN9B 4L2YA 4Z9KB 3WKYA 5DD5H 5J1AA 3R1GL 4KI5C 1WBXB 1VGEL 1Y6KR 2CH8A 3FB6B 4FQXD 3BEWA 5CN3A 3G3LA 1RJYA 3FCBA 2MCG1 5EZIH 2ED6A 1EJOH 3CN1A 2B1HL 4I5BA 4KNTA 5TDPB 4AIEA 4ZS7H 3NH7L 2GK0A 2FIKA 2CDFB 4Y19B 3F7YA 1T7ZA 1IILE 3QR2A 4LO9A 3DHMA 4P4KD 4ENED 2CJTA 3QCVL 4LCWD 3T8MA 1QP1A 2R56L 1ORSB 1EA9C 1X6NA 2X3CA 4S1SL 1NOLA 5FA4A 4FQCL 2FJHB 3HG2A 5HHPA 2DYPB 1S7RA 3HKFA 4OUUB 1CLCA 3UTTB 3H7BB 3WFDH 1T7VA 3EGXB 2X4RA 2RCSL 4JFDE 2G5BA 2R2CA 3ARFD 3AZUA 3BP4A 3QO1B 4PRBB 1EAPA 1HH6A 1UXSB 3R0MA 4RMQA 4PJGA 5HY9B 2R27A 3S88L 3RU8H 2WIIB 1KB9J 3VWKA 1BBDH 3HRZB 1A22B 4N0FA 1XB6A 1MF2H 1U4EA 1EFXD 4XX1G 3STLB 5IMLA 2V9RA 2FUQA 2DD8L 4RISL 2WQSA 1E5AA 1D2OA 1I8MB 5TQ2H 1HE8A 1BQLH 2QPUA 1NSNL 1YMME 4TOYH 3HR5B 1MELA 1R6VA 1S7SA 3Q2WA 3Q9QA 4LHJB 5DQDH 5SWSE 1N0XL 3OR7B 1WIPA 4MNQE 4U6VH 5AW8B 4DHLA 3VFPB 3MJGX 3U4BH 4A7UA 1KPVA 2X6MA 3U0PB 4A1RA 5EN2B 5L4JA 4OJDH 5DC9B 2X6AA 3T8VA 5IESH 3MUGB 4FJZA 1BAWA 2YIHA 4H20H 5EOCL 5FO9B 1J8RA 4H2CA 2WTRA 1K9TA 1NUNB 2VUYA 3TFBA 4CJ0A 3QUYC 5EO9B 3IAGC 5HDRA 2F8VA 1BIHA 4UM9D 1SDAB 3F7RA 1I9RH 3NYKA 4Y9FA 3BZFA 5INCA 2D9QB 3UO1H 4J3BA 5EZLA 2IH3A 4ODSH 1JHTB 5FM5M 2E8ZA 2ZNWA 3FU5A 3L5HA 3UBXA 3AAZB 1NEPA 2HJKB 2XFGB 2AQPA 2EUWA 4MD0A 4JE0A 4LU5L 1GH7A 1JZFA 4HUVB 3WY4A 4A6YH 4ZDHA 3QORA 4HJJH 3DA0A 4FLRA 2BVOA 4ABUA 4N0UB 4F7TB 2PO6B 3L3HB 1MG3C 4CKVX 2IPUG 3UZQA 1HEHC 4MA1B 4RGNB 3FOLA 4RA3A 2VWEE 3P9MB 4GSQA 3W11D 4IRJC 4EXPX 5HI3D 4PWFA 5KSVB 4WK4B 4NQSA 1TFHA 3FT2A 3LEYL 4NFDA 5DQ9A 4NRZB 3DO3A 4IU2B 3O4LA 3CXFA 1SFHA 4B9IA 1YEWA 2X0WA 1IC0A 2P1YA 5DURD 2WZPA 3EJUA 1NL0H 5E2VH 5E4IA 5IJDC 3MREB 1IGMH 4UYPA 1QKZL 3SPVB 1I8AA 3PL6C 5D71H 1S9YB 1DDHB 4PRHE 3FMGH 4YFEA 3SDDC 3QUGA 2VO8A 2ED8A 5JOEA 2ZCKH 3LKOA 3FFDB 1J8HB 5FYLD 5DVOA 4XMWA 3KLDA 1D7CA 3DX7B 5IVXF 5CAYB 3OWRA 3KWVA 1HXMA 5D9SA 5EU6B 4F9PC 1T7YA 1BLNB 4LFHD 2WUBL 2AEPL 3MV8B 4KK9D 5E1GA 1E7UA 4M1GL 1PAZA 4PG2A 2ZZUT 3KWWA 3TTSA 3ZSSA 3ARDA 4PIBA 4Z7QF 3QDJA 3VXNB 4EF3A 2V5TA 3QORB 1I75A 1OTTC 5T5FL 2BCMA 3ECQA 2QADB 4TVSa 4X7FC 3PXLA 2XNAB 2W65A 5DMIH 4U3HA 3NSDA 2LQRA 1EZSA 1ZE3H 1MI5B 1EDQA 1DVFB 3ESUF 1ZLSH 2ZWSA 1QOKA 4GMTH 2Y5EA 5BUPA 3BCDA 1W72B 2Q7NA 4JRYE 3GI9L 4ZMAT 5E2WL 1AR2A 2OMYA 3MJ7B 1DBJL 2NXZB 4L37A 2OL3A 1S7WB 3IDUA 4KZDH 5IBTL 3MLVH 1FIGL 3ARBD 1JNJA 3X3FH 5EEXA 5TDNB 3CX5K 4N4YB 2EE3A 4L1DA 5JW5A 3HI6H 4P9HL 1EZVY 4B7IA 1TJIH 6FABH 2OI9B 1JVKA 2OBGA 4PJEA 1HC1A 2MRYA 4BXVA 4AW4A 1HQRA 2CHDA 2CMRH 3BC9A 3CH1A 4LLDA 3VFPA 5BRZE 3X12A 4UT6L 1JHKH 4BUHA 5GRXG 1EANA 5KS9A 5DA4A 1FLRH 1ZTXL 2V7NA 4OFVA 2E7LA 3FH8A 3I9IA 3JWDL 5SWSD 4PTTA 1C12A 4YFLI 3MV8D 1UKQA 3NSXA 3VXOA 4IRSB 5IB4B 1EDHA 4KQ4L 4UAHA 4N86A 4NI6A 5E6RB 1JP5A 3LB6D 5I1JH 2EECA 2FEDD 3E2HB 2ZX5A 2EDJA 1Q9WB 1I1AD 5IM7B 4HUVA 4M5ZL 4MHHG 4OCRH 2VDRB 2WXMA 2H32A 4YSTA 1JZHA 4R7DB 4H8HA 2AAVA 1OE1A 4HU2A 1TTFA 3JV5A 3OMIB 2H26A 4NUJB 1A7PL 3N5AA 2LGNA 5JHLA 3QHFH 4LDLB 1ZPLA 1G6RL 4LB8A 4A6YB 4IIQA 2LV4A 4J3WA 5GGVY 4Q6KA 4K71C 3SKMA 4NBXB 1L9MA 3MJ8B 3BD5A 2IWEA 4IU2A 1Q9KB 3IN0A 4XNQA 1OQXA 4DN3H 2VR8A 3BT0A 3QC5X 3O8XC 1AZVA 3KPPB 1U3NA 3AS1A 2C7UA 1QASA 2XG4A 4MCZB 3MUZ1 4M4RA 2WXIA 1MVYA 3HI5L 4FFZA 4LKXA 4BSJA 4LDEB 4IQHA 2LTQB 3AB0C 3VDBA 1ZWIA 1HCYA 5EWIH 4BWWA 3LQAH 3QIWD 4FXGA 1XF1A 5IVXA 1PZAA 4L29B 4UQCA 1A3RL 4FD0A 4I18C 1CB4A 2WBWB 1QEWB 2OPCA 4N3UA 1MCPH 5FYJD 3ZHNA 1JZ7A 1S7VB 3DHUA 2FT7A 3TH4T 5ES4B 2ZX7A 1R3KB 4M6AA 3T0EC 4JRWA 1V3LA 3VRJB 5EC2A 1A7RL 3V6ZA 3DMMC 3POHA 3WIFA 4WUUE 1YJDH 3QULB 5B38B 3BPOB 1RIHH 5CSGA 5G4MA 3TYGH 1AG6A 4WI5A 4R7VA 1MY5A 4P0DA 3WFEH 5AVYB 1QTSA 2CMRL 4UM8B 1CZ8L 1Z0NA 5ADPL 5C0CE 1NCCL 2EIKB 4BH8B 5B38G 3PWPE 1YEIL 5A2BA 5B7EA 3ZKNC 4D3CL 3CXDL 3G5ZA 2PYED 3FFCA 3IPEA 2PTTB 3P73A 4Y16C 5IMOA 2FT8A 5JO5A 1RH8A 1VADA 2EYSA 3VCLA 1ZDQA 3ALWA 3Q3GA 5JPNB 2OS7A 5JR1L 1NINA 4NQCE 4O51B 5DRXB 1WK0A 4G9DB 2HRGA 2XYBA 1FC2D 4P2QD 5E2WH 5JHDA 3U83A 1CF8L 2ZXEB 1ZOXA 3ZQWA 1BJ1J 1O9WA 3JUYA 1UM4L 4M48L 3BW9A 1BMZA 1OK0A 2G2PA 3P4OA 3PQYE 2QVKA 2YAHA 1C16B 1OP5K 3ZIMA 3TM6A 4CU8A 3NCFB 4JHUA 5LBSL 2PTUA 1FG2B 5EBMB 1C9SA 5DR5L 3BH9A 1O75A 2UWEA 3KYAA 4J3OC 4NQDB 5D2LB 1FSKC 4UF7C 1BYNA 2GSMB 1VEMA 4IK7A 1PZ5A 4PJ8D 2K8MA 1HHGB 3N2JA 4OD3L 5BXFA 3UAJD 2OW7A 2V9TA 1TO5A 2JJSA 1T0MA 5DJDB 1QSFB 5KVFE 2ZWZA 3OBAA 2EDQA 2JCCA 1R24A 1J0HA 1BQKA 2WOBA 3NIDB 1VIWA 4HW6A 4NHUA 4QHLB 4UMSA 3VG9B 2X6VA 1IL1B 1CFTA 3ZE0F 3UPRA 1P5VB 4NRYA 5C3LD 2DYPD 4X8JB 5EUOA 3BRDA 1N0LB 2FQFA 2BCKB 1SFDA 1A02N 2YZ1A 4I89A 1UD4A 2YSTA 3G6AB 4HUNB 4OF3A 5KWYC 1UXMA 3MACH 3GF8A 3ZHKA 1BZ9A 1QPPA 3PWLB 4DN4H 1TQVA 5DJYA 1XGPA 4MAYA 1XF2B 5LGHL 4R96A 4JW3A 1R0AL 3BHBB 5C3TA 1KGXA 1DQMH 3QUXC 1MFDH 2VKWA 5BZWA 3WFCL 4OJFL 2WGXA 3HLAB 4Y1AE 5F1IA 2J8UF 2RBLA 1SJVA 5D96B 3QRGH 2DTML 4H88L 3PGFL 4M8QA 1O7SA 2V8LA 3HI1B 5L88L 1FNSL 4KY1H 1MFAH 1J0KA 5FEBA 4ENZA 4PWJA 3SYCA 4OSUL 3QZWA 4DQOH 2XJKA 4A7VA 1ZXQA 4XNZC 2NNFA 4TSCL 3AREB 1G7HA 3BSZL 4I48B 2JELL 5AAWA 1L7TL 4M29A 1RURL 2J8UA 1P69B 4XVUC 2CE6A 3M7FB 3QK0A 2EEXA 2YOAA 2CBPA 4N2LA 5I1IL 1H9VA 2BFGA 1N10A 3KDMB 1K2DA 3QE5A 2Y2YA 1JNHA 3UPAA 4H1LA 4AGOA 4YHKH 4MQ7B 1AGCA 4ORZC 2AKRA 3P4MA 3IE9A 4K2UH 3RUGB 3NA4A 3C6LB 4GBXC 4BZYA 3DX8B 4GW4A 2X4UB 3AACA 5GS1C 3TF4A 2AJ3B 5E00A 1VEPA 4TVUA 3STLA 1ZTXE 3WIAA 5CCKH 5IMLB 3MRPA 4Y4KB 5B38A 2H1PL 1ZK9A 5KBKA 1BFOB 1LO2H 2BJML 5AB9A 3FRPG 2P5WD 2EDYA 5KTEH 1QTPA 2Y36L 4WI7A 5AKVA 5JW4M 3TEWA 3OGOE 1N0XH 3NQKA 4GH7B 3UC0H 4DGWC 3A6BH 2HLAA 4OF8A 2W9EH 3RFRA 3HC3H 4PMEA 2NY2C 1AXTL 3W2DL 1S4IA 1G7JA 2BMKA 5TE4L 1I7TB 2F8IA 3QPKA 1H15A 3AU0A 1OAYH 5EO9A 3BAJA 3G6JF 5C0IA 5JPNA 1IAIH 1MZZA 1ZLWK 3L4CA 4MWFB 5C0BA 1L0PA 3HVNA 4GQRA 2BWIA 2P8MA 3A23A 4OZIB 3D69B 4GRMB 1MVFA 4QRUB 4P9HH 4PY7B 4PMFA 4L8SB 4K3DH 4C54A 4LLWB 4D9RE 4LNRB 4ORGB 4U1KB 1JPTH 2R56H 4LCWA 4FFZL 2ZUQB 3P2TA 3PU7A 1TKWA 4KTGA 2I25N 4ADIA 3WEOA 2ZKMX 3X14B 3IKCB 4YS4A 2H6UA 1TVHA 4K7PH 3IJYB 5D7LE 1CFNA 1H5BB 1OE3A 1X7SA 1F45A 3E38A 4XVTH 1UQSB 4PW3A 3V6OA 2DQJL 1XIWA 3OMAB 3K81A 3K3QA 2WLYA 3R1GH 3IJHA 2ROXA 3M17B 2AJ3A 3GSQA 5E00B 1YEHH 4I0PC 4W9GC 1ND0B 1BQUA 2ZCHL 1OM3H 3ZKSD 4Y5VB 4F2ME 1F4HA 3OJMB 3GZOA 1OF2A 2ZX9A 3WUWG 3VGAC 1PZDA 1M71B 3HJEA 2VDQB 4YGAB 2E74C 2HVBA 3KD4A 2Z9TA 2VDOH 3E6FB 2H6PB 2QSVA 5E56A 4I2XE 3IJ7A 2ZOWA 3ULUH 4LSQL 2IQAB 4OTXH 1IM9B 3FAXA 3L3OC 3NVQA 5F7EH 3T0EB 5B21A 3MLWH 2A6DA 3HAEH 5G4OA 5TE4H 2AEPH 3MZTA 1OXYA 6PAZA 1EFQA 1HHIB 1D9KD 2IAMB 3C2AH 1UXWA 1NCOA 2EXYC 4RSYA 5DD0H 1UZ8A 5GJTL 4PPTA 3W9EB 2C9XA 5L88H 2NW2A 1HIML 1QTYT 3KLAA 4KTEH 1FYHB 4Y5XB 5CCGE 3CN3A 1KTRL 4MDIA 2EE9A 1BBJB 2DQUL 4WSKA 3VWKB 5JUEH 5GIRB 4N2AA 5J0BA 4YGVA 3DDGA 3L5XL 2VN4A 5JUEL 1IO4C 3SN6N 1SXSA 3RZWA 2GK0B 4RWYL 3C60B 2WNKA 4Y88A 3FQUB 3GMNB 3QORD 1MJJA 1HEJC 1GC1H 1JGVH 5JQIB 2DWXA 3QDGB 3ZO9A 3B8YA 4LCWE 1CBVL 3LN4A 4XPHH 3THMH 1SLVA 5JOFA 4OFDA 4H4NA 1MJ7H 1U8PB 2J8HA 3CC5A 4Y9BA 3FK3A 1FVDA 4X7TA 2K7QA 2WINB 1BPVA 2PW2A 2FWLB 4G8FA 2VXSL 2IFGA 2KZ1B 4QTHB 4TLTA 4L48A 4FE9A 5G2NA 2BVUA 3LH8A 1MNNA 5DVKA 1BGXL 4PJ8B 2XZZA 2YBRA 4TVPE 2Q2EB 4FFYH 1CXIA 4IGBA 1TQCC 2AGJL 1O5PA 1I9EA 2V3EA 4N6QA 2JF1A 1BLIA 1FAKT 5JNYB 1MFCL 1DCEA 3KJ4B 4FXGC 3T9WA 4YUEL 5C0FA 4YXKL 5CJXA 3DSNA 3ZR5A 1RK1A 5K9JH 2EICA 5MP6L 3B9EA 4E41A 4MMZA 1SMAA 2AQNA 5HVGB 5IESL 4MNQB 2DI9A 4G6ML 4FF9A 4GKLA 4FFZH 3VFMA 1ZVNA 4Y7OC 2BWDA 4K23L 1AACA 1JF1A 1TZAA 4YVUA 1OANA 4UILH 3DBXA 4PS4L 3TJHC 1JOIA 4J3XA 3VYPA 5C0GA 3ARWA 4Q6IA 4D7BA 2NPLX 4KUCD 3EYFB 2Z64C 3IFOA 1OCCB 3OAZH 5AYTA 2AJZA 4FXKA 3TFKD 2FJGA 3ZVVA 3IXTB 1MJJB 2PWEA 1MF2L 2I24N 1XGYL 2VQ1B 5JHLH 2YMOA 5I15L 4TUJB 4P2RB 1VJSA 3NP3A 3Q2CA 2IPKB 4PJAE 4PB9H 1JUFB 2W9EL 1F4AA 3DIFA 4G8GE 4HOZA 2ICEA 4QHNA 5CJQL 1D9KC 4UM9B 5K59E 1I3GH 3ZGHA 4N0UE 5FKAA 1RK7A 2R59A 1E2ZA 1AZCA 2H32H 2N3JA 3CHSA 6TAAA 3TV8A 4DQAA 5CWSA 2PW2B 2IC2A 3C5JA 2F1BA 1ZEAH 5DJ8A 1PIGA 3L4XA 1HTYA 5C0JB 2EIEA 5ABZA 1IBFA 4V1DE 1KYUA 2NXZC 2XV3A 3D3VB 4XP1L 1NIAA 2X7LB 3SGJC 4PD4J 4A63A 3ZDYF 5DYFA 4AJ0A 4KKCD 4PLKC 4LBAA 1T21B 1T4KA 2HTLD 4XPTL 2UY7A 2BERA 1IGFL 2W65B 2BDNH 1W91A 3ABKB 1CLVA 5CJBA 5CLYA 8FABB 1P6AB 3Q8BA 4N22A 1F4XH 1ZHLB 4JQIA 4OKDA 1UB6A 4MYPA 5HJ3A 2VRQA 3T6XA 2LU5A 1V3MA 4KAQH 1JF1B 2DQGH 5FC9A 1I8LC 1QEWA 3CZSA 3F5WB 4LEBA 5CLZA 2FNBA 4HS8H 4QY8B 1FFPA 2DQEH 4L1SA 4ZPTA 2BVQB 1JYVA 3WEXB 5D7KE 2IH1A 1NC2D 5KOVC 1KTKE 2CO6B 4UIKH 4TNVK 1DBAH 1OGAE 2ZOTA 2NLJA 2W07B 3UERA 4ELME 4P4KB 1LNUB 3DC0A 3H3PL 5AOKA 4OZHE 4F7TA 1INEL 2CIKA 4OCRL 4NN6B 4LSTL 1M56B 1KCKA 4ZDHB 1FNGB 1XGQB 4AYMC 4O58L 4LCCA 3VE0B 4BH8A 5KOMC 4PJAA 4WHYH 4P5SA 3KPSE 2LLLA 3D50A 5E6SB 5KAQG 4L18A 1ERNA 1A3RH 2G9HB 2J5LB 2ARJA 1RJLA 4TKWA 4IRZH 2EYSB 2VW4A 4EUPG 1RZKL 4CADB 1RI8A 2HKHH 2IALB 3SE6A 4HIHA 4GIAA 4N8UA 1E6OH 1U2HA 3G5VA 2A6KA 5DZJA 4O02A 3NK4A 2FZ3B 3MREA 2BLFA 5I75B 2PCPA 4PP1D 3VM5A 3AG4B 1UJ3B 2I60H 4Y2DD 1AKJB 4O9HL 1J8KA 1KXTA 2VLKB 3JVGC 1WBYA 5C0AE 4ZXBD 1HL5A 3OSKA 4YHNB 4KZEL 1S9YA 1YEGL 1ZHLA 1G43A 4XVSH 3VWKD 2GY5A 4JE4B 4M8VA 5F9WC 5CZVL 4N5EC 3QNXA 1OAKH 2NQDA 3QQDA 4KZCA 5EF3A 1LK3L 2A4ZA 3TWCH 2FHCA 1FFPB 1AD9A 3SDXE 1SN0A 4XRCA 4DVBA 2ODIA 2OXGA 2HPOA 3UTZB 4I13B 1M05A 2DS4A 4N2GA 4XNQB 1CFSB 1RHHB 2YGPA 1NFIA 2A83B 2ZXDA 5T1LB 3HE7D 5GS0L 4J4PC 4PLKD 2WANA 4G1EA 2P80D 4LEEA 5FGRA 4OM0L 1J48A 1ETZA 5JXEC 1ANUA 1JTTA 3JWNC 4DZ8A 4CC0A 3QZPA 4Q0XH 2D7NA 3UTPD 1HU8A 5D1ZA 3HZVB 3F6LA 3VVVA 3UG4A 2WLIB 2VYRE 1MUJA 3KPLB 2I9LA 3NFPB 4NO2A 1NCHA 5EOCJ 1TZOA 1NCCH 3TWCL 2Y07H 4ESKA 4R84A 1O9VA 4A6YA 2WLHA 4JPSA 1JZGA 3HI1A 1OGAD 5FLVA 1T1YB 4QT5B 5I8KH 1E43A 1ZGLA 1B0IA 1PCSA 2ZXWB 1RIHL 2PO6C 3WE6A 5L9DL 3T3PF 3BVVA 2ODHA 2SEBA 3IFNH 2VQUA 2EXSA 5EC1B 1CG9B 4TSCH 5IJVB 1I1FA 2JTYA 3HB3D 5DD3L 5J11B 1PVHA 1YY9C 1N12A 4LRNH 3QFJA 4GB9A 3AT8A 4PJXF 1PEZA 4JCWA 7PAZA 4FG4A 5H37A 3LS5L 4XOBA 2AS5M 1SQ2N 1AD9B 1HQRB 5AOZA 1JNHB 2K9FB 3BKJH 1P4UA 3ZRSA 1BD2B 2CRYA 1ZSDA 3NMEA 4F7PB 5KYYA 2V9QA 5F9DC 3RUGA 4KU1A 5DUML 1OARL 4Q9RL 4PJXA 3AU1A 4C56E 2NXYB 2FNWA 3ECBA 3BW9B 4NO3A 5T5FH 1FC1A 1ZRUA 1CVRA 3QJXA 1YAZA 2F1AA 1SLWA 4W9IC 4UIKL 2VT0A 3BGFC 1N5YH 1XF3B 3NZ8A 3QVAA 4Y4KD 2GBVA 1MCBA 1Q0XL 3INUL 3U1PA 3EXLA 4JFXB 2VOTA 4B9KC 2CJUH 2F68X 2DM2A 4KGLA 3VFRA 3QJUB 2IFFL 4HG4J 2VDNH 4TUOB 2BS8A 3T3PE 3SKOB 3SBPA 2VXVL 3KXFE 3UG3A 1TUPA 1BV8A 4PJ7A 4RFNB 4AVKA 1J9QA 1ZY9A 4JKWA 2VLRE 5JW4Q 3EYSL 4KITB 1B0RA 3V9CA 3LRGA 2J57A 3LS4L 2WWNA 2VW7A 3NDZE 4L5FE 3PJLA 3VCLB 1WT5C 3BVTA 4Q4EA 1GKEA 3O2VH 2SEBB 5FUCC 3HKZA 2E9WA 2D0GA 3MLPA 5HGDB 5EOQH 1QKZH 5SWQB 2WJ5A 3AXLB 2JNZA 2GI0A 4PCTA 5EZPA 3OVUB 3LS5H 3MKGA 1AYOA 3BH9B 4OQ1A 1QBBA 2WO2B 5BVJA 3MRNB 4L8CA 2GYSA 1KPRB 1GVIA 5LNEA 2G30A 5C09E 2HLFC 1FLRL 3TS8A 1T2QL 3WIHL 1QSFE 1HS6A 2VAAB 3QIUA 1O6VA 2IOIA 4LHQB 5CZVH 1KG0A 3EIFA 1E42A 1EMTL 3POCA 3T04D 5GISL 1MW3A 4WLCA 4X4MA 1G7LB 1CFVH 1CTNA 5IIEA 3GJEB 4AQAA 4MRCA 2ZX8A 3RWHB 4K3JH 2ROYA 4U1MB 4NJAL 4K8RH 2VN6A 4GKNB 4JAMA 3LB6C 1QD0A 3LRKA 4PEEA 2Y25A 1HESA 2FATL 5DTFA 5FIEA 3TV3H 3EUUA 5I8OL 3MV9E 2HKFL 2CIIA 3RY4A 5TTRA 1E7VA 4QEGA 1IGJA 1IM9A 4M00A 1COBA 1JXKA 3VXTB 4JY6B 3RDTA 4Z3GA 3KWUA 3FFCB 4BDVB 1DN0B 4EZKA 5K1JA 2NUPB 1HNFA 1T0PB 1INDL 1G9MC 3LOWA 3N0PB 4O51A 3QDJE 1QFWM 2XN9D 1VZIA 3O4OC 4HIEB 3B5TA 4OLVH 4XTRC 3IVKB 5GZND 4XWGH 1CE1H 1YECL 3OKOB 4HEPG 1AR1D 2NNXA 5CLTA 4KHXH 3HG0A 2NY1B 4KXCA 3FSAA 1PZ3A 4F1SA 1OCRB 2WC7A 1I1FB 3EYUL 3NZSA 1G7MB 1C16A 4U1SB 4J2QA 4KKBD 2WQ8A 1ZJBA 2YFOA 3CZKA 3FRPA 2BK8A 4AKPA 2WTOA 2ATPB 5K9OB 5D4IA 5DEFA 5I73C 5E24E 1P6FA 4PGJA 5I1LB 4ZTEA 2VMFA 1YLBB 4XCEA 4FYQA 4C56D 1RUAH 3IAPA 2FK9A 5MENB 2EINB 1UWEH 2IDUA 1W2KT 3P0GB 3TBYB 2XA8H 1CDJA 5IBLC 2ED9A 1AH1A 5AZ2H 5E51A 2FYYA 2WBJC 3DX8A 4R83A 3C75A 4I2XA 3OM3B 4TULH 4ETYA 3TBTB 3HG1B 4G8IB 4JO2H 5CU5A 1W9XA 1U3HC 1P1VA 4KQ4H 1A0QL 3VXTA 1H3PL 3DVFA 4JO4L 3SOBH 1QBML 4WUUA 4XC3L 5LQBH 3GXIA 1XTMA 2NR6C 2Z7UA 4XAWL 2YRBA 4HSAC 4W9ZA 4FTDA 1T5WA 3CLFL 1S9WA 4WU5B 1CYXA 2ED7A 3AG1B 3O6KH 1TXKA 1A4JA 5HDBF 5A2CA 5JDSB 4XXCA 3OG4B 1QFPA 2ITEA 5E8NB 4BCYA 3MBEB 3U4EB 3VDCA 1WZAA 4UTAA 1PIFA 5HHNB 4NUGH 3A4AA 1VFBA 4S0TD 5J13C 1MCRA 2QZQA 3EOTH 3SCMD 1KN4H 3ELAT 2L7EA 4HCIA 2XLLA 3BEWB 2YN5A 4P57A 4UOQA 1CR9H 2GHWB 4XCCH 1NUFA 4QYOA 4ODSL 2R51A 5SWQA 2UXVA 4DO4A 3ERXA 2DWDB 2O6EA 4BV1A 1WICA 3AREA 1OWRM 4MMXB 2JSFA 1A7BA 1GZPA 4HK0B 3UTSB 4XCNA 4FFWC 4QRPE 5D55A 3O2DH 3QXDB 1QWUA 3WS3A 4K3GA 2XPZA 4OI8A 5JZ7D 4JHBA 1JGEA 1MRDH 3KDMA 5FECA 3APCA 4OT1H 2Q7YA 3PJNA 3WTTA 2W0FB 5DZNA 1E9QA 4GOSA 3ULSB 3QUKA 2CR6A 2NZIA 3PWJB 3NFNB 3HAEA 1OT1A 3K5SA 3AUWB 4PJ5E 5B39B 2VM9A 4FQ1L 1KJVB 1DO6A 2XQBH 3BZ4A 1WAAA 1T1ZA 2VERA 3S0PA 3NA9H 4GP4B 1S8DA 1P2CA 3HE6A 4Y4HB 3DMMB 3QSKB 1I7RB 2ENPA 4CSPA 2YXWA 2G2RA 2K0RA 4BQ9A 1K3ZA 2JCCE 1MW1A 4PR5B 3FONB 5MERA 1N9PA 3C8KB 5IQOA 4RMUA 4PS4H 5FDWA 2QVFB 4PI2A 4LIQH 1FHGA 5I1KH 4QTHA 2BJMH 3HMXL 3L5XH 2F74B 1MAML 2GBAA 2JKXA 4YGVB 3VGEA 9PCYA 4Q7DA 3O11B 1PY9A 3MV7E 4KDVA 2D2OA 4LXFA 2B0SL 5AZUA 1S9XB 3RWEB 5GS2H 3GJFA 1SZNA 2PXYD 4YXKH 5K1NA 1E5BA 2XY1A 3DSFH 3FQTB 3RLSA 1IGCH 1VZGA 2ATPA 1LK2B 3HZ3A 3QZMA 4C4KO 1TMQA 5FECB 2OCFD 2WWKT 5SWZA 5E9AA 3T2PA 3U0PA 3MLWL 5E2JA 2OYPA 5B3NA 4NCC1 3LH2H 1I3UA 1QBAA 4Y2DA 4XB3A 5F7NC 4NRZA 2JK5B 2Y5TB 4W93A 1U8MA 3PWJA 4UV7L 1AQDB 3PXHA 3WDHA 2Y1AA 4S2SB 3WLBA 4UQ3B 2BFVL 4XO3A 1NKOA 1T20A 1W8OA 2Q1EA 3NCYS 4EEEA 2VZUA 4TF4A 4TQ8A 4ZFFA 1JD7A 2HTKC 3K8KA 4QRPD 2B1AL 2YMXL 3E9UA 1KGYE 2YD8A 3PDOB 1JPFA 4YHNA 4DKEH 1IGCL 4Y5YB 2YMXH 2B1AH 3CNKA 1KCRH 1DQJA 1TJGL 3GSNA 4KRPC 2DAVA 1RIUL 4RWYH 4L1TA 1S5HB 3OXSB 1WG3A 1JG9A 3SE4A 4AEEA 2ALWA 1NCWL 1RMFL 4QRFA 4PJDA 1OSEA 3GMRA 1IKOP 5FW6A 1UM6L 3IEAA 4WTWA 3R7QA 3HMXH 3W0WD 5LGHH 4C56B 1RZ7L 3BE1L 2SODB 4JG0L 4F7MB 4H8VA 3IDXH 4H1LH 4JN2B 3WI9A 3DX9B 3QUML 3BPLB 4K0OA 4MJIE 3Q6FB 3ABMB 2X89A 1MH5A 3HZKA 4AGQA 3ZL4L 1MVUA 4X9YA 1BZEA 5TQ2L 1M2OA 1SF3A 3B9KD 1XV8A 4IMKA 3UXFA 5KVGH 4GS7C 4LHUB 4RISH 3DSFL 2D9CA 2ZUXA 3KLSA 1UFUA 3SPVA 1A9EA 1JD9A 2NR6D 4OFQA 3SO5A 3ZZQA 2BRRH 3X3GL 4WI8A 4Z3JA 4AIZB 3P1VA 5D1XE 1B2WH 3IU4H 3HBZA 3GBNL 5FGSA 4PN6A 4ISVA 5C0BD 3GD1C 1JV2A 1D2PA 5IOPB 3FUKA 1IZJA 3QEQD 3TBCA 3B9KB 1XB8A 4PU2A 2PLTA 1FNEA 4TNWK 1JNNL 3C6SB 1FVDB 3IETB 3DVGB 3N91A 4DVRH 2NY5H 4K71B 3GMMA 4PRBA 1WEJH 3TPUA 2CPCA 1XEUA 5D2NE 2GK2A 1G0XA 1QO3A 2FYVA 3QQ9C 4HGMA 1CDYA 4KK5D 3MLTA 2ZYHA 5ANMB 4IBTA 1HKFA 3T1FA 3B83A 1RIVL 2NQCA 2R4RL 5D7IE 1J8HA 3W38A 2V37A 4HWEH 3MUY1 4HBQA 1XD1A 1GMEA 3L81A 3MCYA 2J71A 4QF1B 1KIUB 3RJDA 3E1ZA 1MZYA 1HXYA 3ZZSA 3ZT7A 2H3KA 2FL5A 3MLYL 2O4EA 4HWBL 2QGBA 4K5NA 2DB8A 4NO5A 1BFVH 4KXAA 4E9XA 3LZOA 4GQPH 3BSZH 3PNRB 1OAYL 1PD1A 2OL3B 4MDJA 4FZ8L 4OGXL 4RAHA 4DP7X 3RWDB 5BS0D 2Q8AL 4NGHH 4ZO6A 2ZXQA 2R7EB 1YJDL 3AWFA 4M61B 3P4LA 5I1EL 3AVEA 1X4XA 3ZE1F 4Z6AT 4F20A 1QLEB 4F9PA 4NP4H 3F65A 2X2JA 1II4E 2K1MA 3FTWA 5F9JB 3ARUA 1KEGH 5C0EA 1UWXK 3VXUD 2WXNA 4OUOA 1BVNT 5TF1H 2QFPA 2V7NB 2DQIH 1UJ3C 4F8PA 1OPGL 2D03H 5GS3A 4V11A 2Z4QB 5I1HL 5DFAA 1F6AB 1YDPB 2VWEC 4N8CL 4HVBA 2Y1VA 3TO2B 2BNRB 2K70A 3VFVB 1IVLA 4LQFL 4R26H 3L5IA 2AMGA 5D7JD 1DLFL 4KVCL 4P4KC 4B9PA 3BUPA 3RNKA 3ARGD 1Z3RA 3N04A 4JY4B 2H2PC 5TH2B 4QHKI 1CUOA 4WK0B 1H3PH 3SOBL 1A0QH 3B2UD 5I16B 1TYJA 2AP2A 3PWVB 2BC4B 3FH7A 3PHAA 4U0RC 1XH3B 2CZNA 2GCYB 3X1GA 1PD0A 3G5XA 1MFBL 5DFTA 3KYKL 4X7SL 3B2VH 1A66A 3O3BA 3RG1C 3G9VA 1T83A 3US0A 2YA1A 1IBBA 2UYLA 2EDXA 1OAZH 3KPQB 4QAMB 2HKAA 4DQOL 4HS6B 4LLMA 5F2FA 4BHUA 1MOEA 4ZYKB 4HETA 1YNLH 3EO0B 2YQBA 4A67A 5DRWA 3QJSB 3QNZB 1C5DB 2JB5H 2O5XL 3FO2A 4FYRA 5FPIA 2Q20A 3RVVC 2BIHA 1GYAA 1KIQB 2FX9L 1DUYA 2D3NA 1XHHA 3B7YA 1MRCH 4L4JA 4A2GA 5IJVA 5LXGL 2E7LC 3KDPB 1JAEA 2FEEI 3KPSD 1ESOA 1YNTB 4OF5A 4DN4L 5L6YH 1P0SE 5JPMC 5T1KB 1MXDA 4POUB 3FF8A 4WHDA 4B97A 2WNWA 1HEZA 2GIYA 5FOBA 4J4PA 4NZJA 4D3CH 5TFSL 3WN5B 1QRNE 1DJGA 3V6FA 4X7EC 4FFTA 4JZOB 1ZTXH 5J3HC 5CINL 7CGTA 5ITFB 2F5AL 3DGGA 3KPRB 1S7XB 4XCYA 3ZOAA 3MRIA 4TVPL 5ALCL 3T4AB 4G6AD 3VI3A 5BS0E 1TT6A 1JZDC 1V3JA 5CP7A 4BFGA 4DW2L 4N8VA 1CLZL 5AW0B 2F54A 2P5PA 1G7PB 1YNTF 3CDFA 4R3SA 4BFOA 1J05A 4RGNC 2PR4L 3DXAB 3RNKB 5EC2B 3F00A 3GHBH 1ZV5A 2AXFA 2XWBA 3MX0B 3UOAB 2AC0A 4J3VA 4XB7A 5TDNA 3H2QA 3RUGF 4EZJA 4GI9A 4IS6A 1E27B 2DJ4A 2X2IA 4RQQA 4ANVA 1KY7A 1GGYA 5CBAA 4GXVL 1XH3A 1E5UI 1BP3B 4BKLA 1D5XA 3KL0A 2FATH 5HI3C 4HZLA 2UYLB 4HGKC 2FECI 3D39B 4X9IA 3ULVH 2EIMB 2IMMA 3GJFK 5EWIL 4O4YL 2P28B 1ETJA 3NGBB 4LEXH 1WGOA 3MXWL 4GIPD 2J1YA 4AV0A 2XZAL 1F42A 3OLDA 5CGBA 1IL1A 5JR1H 4BFRA 1R3KA 3BJLA 2GY7B 3KR3L 5BV7L 1U95A 1HINH 1WZLA 4P46B 2R7EA 2WSKA 2XPYA 3OQRA 3UTPE 1ORQB 5SWSA 4E42A 5FS5A 2NTFB 5E6IB 4KJWD 2F0CA 4ZX6A 3A67H 1XX9C 3QHFL 3TEUA 3L3OB 4W6WB 3IDIA 3QHTC 4GSXA 4JO5A 3VUAA 1BJ1H 4H40A 1H0DB 4NWTH 4O00A 3VSVA 1U8CB 3MRHA 3U0TA 2VDKL 3CBRA 3RI5F 5DEJA 1ET5A 2NT1A 4AE0A 3O2WL 4X9BA 1FPTH 1YEKH 3VXMD 5H37H 4IEFB 4EMZA 3F12B 5DUMH 3KPMB 2XWJA 4FQLL 2YPLD 4YHZL 2VN7A 4P2OB 2D3JA 2RMNA 5KSAD 2IGFH 5H4YA 4XO8A 2R0WL 3ZDYE 1GS6X 1ZT1B 1U8LA 1H5BC 4DPCX 2CJUL 4E9SA 3QDGE 1KXVC 2EDRA 1GZHA 4JFTA 2JCCF 1FF5A 2WZ5A 3PABA 5F71A 3CQFA 1KLGB 3KCWA 4JRYD 4LOFA 4UNIA 2WMPB 2VERN 5CLWA 2IBZY 3F7VB 5D1QD 1JZIA 4ZW8A 3WY1A 1A1OA 1YQ2A 4HWZA 4QRBA 1HK6A 3LKRB 3LSOA 3Q0HA 4XOCA 3G5WA 1RZIB 2IF7A 1S7QB 4LEXL 2XZQL 3TYFB 1HHJB 2QZ5A 1HHKA 4XHQA 4Y2OB 1S9KC 1FL5A 2WO4A 4YXHL 4JAMB 1VZHA 3GMPB 2J8UE 3C5XA 3FT3A 1QQDA 4M5YL 5EA0H 5GHWH 4KZDL 2R0WH 1EXUB 3NIDE 2KQNA 2O5YH 3OKEA 4YDZA 5IHLB 5K9QI 2A7BA 3BP6A 4NYLB 2J8UB 4M56A 4N26A 4PRIA 2NUTA 3O0RL 5T1KA 4Y4HC 3D3VD 4DIXA 3DLQR 5TK4A 2VRAA 5D7JB 1U8CA 3MRHB 2ATKA 4WUKH 4IRJD 3U0TB 4HP5A 3GIZL 4M7LH 3UGEA 2ADJA 1WZKA 1K6QL 1ETA1 3VGAB 3T2OA 3WNLA 4D8PA 2YA0A 4M5TA 3NSFA 2CO3A 4I0PB 5E08H 5I1AB 1IEBB 3MNWB 1XD0A 1NMBH 4YPGA 4OCLC 2IANB 4PI0A 2FYYB 3L1OL 4PRAA 5T3XH 2EADA 3WKML 5B3SB 2X53A 3L1OH 1QEXA 1G94A 5CM1A 4ACPA 2F7QA 3MJWA 5EUOE 3UPCA 4KKPA 3T6QC 5I30L 5LXGH 5HYJD 3H2PA 5F9OL 3X14A 4NRXB 5C6WH 1VCBC 5EO0B 4HLZG 4G11A 1IT9H 43CAA 1CL7L 2FGZA 5AB2A 2VISB 4HDIA 3WCYA 1TVDA 4B9ZA 2CBOA 2X40A 1PQZB 1RFDL 2R0LL 4N1EA 2Y1ZA 5IBTH 4LLYB 5C97A 1Z32X 4NO0A 2Z1PA 5GGTH 1QSFA 4FYSA 1G6VK 1E0OB 5MEOB 5E2VL 1QQDB 5C0BB 3PPEA 4OLEA 2VXQL 2Y1YA 3WFHB 1CFQB 3QPXL 4RMBA 4HZAA 2YRPA 5HPMB 1EJOL 3ISWA 5AG9A 4GRWF 2LLGA 4GRLB 4Y4KC 4L0PB 5DUPH 1G0YR 1BQHA 2HTKD 4S10A 2NZ9C 3KYOA 2A4EA 2QKIA 1Q9LA 3FUFA 1D5BA 5DMIL 4RGOL 3C6LC 4GBXB 1T1WB 2WVUA 4M1DH 3FS9A 1LWRA 3GDBA 3OJ2C 2UX6A 3JT0A 5IT2H 3EH5B 1EHLH 4NT6B 1GTNA 1KYOK 1I3VA 2XCMC 3FOLB 4C83B 4JDVA 4Y1TA 2UZYA 1OP5H 4WEBH 3EYQC 3HUJA 4GAAA 4HHAA 3ILQD 3VH8A 2B9BA 3K71B 1FL6A 3MBWB 3S5YA 3VNYA 3MV7A 2W0FA 1SGKA 4PJ7E 1OGAB 5IQ7L 4TLUA 2QQKL 3O4LB 3V4VL 2WXGA 1A4BA 4U6HA 2IGFL 4O02H 1XT5A 4NQQA 4PGZA 3QEQB 4EKJA 2F08A 4YHZH 1G7MA 1UHVA 1IFRA 4FG6C 4XN5A 1S3KL 1H3WM 2CWRA 4IRZA 2WN2A 3LPOA 5DJ0B 4MMXA 4KMQA 3OMNB 1EEZB 3T2NH 4QIRA 3LN4B 4CBZA 4LMQE 2MQGA 4XPTH 4CBPA 5F7HA 5G5DB 4IHOB 2I07B 2V9UA 3IWUA 2XOTA 4RFEB 3C08H 5T1LD 3TNNA 3DMMA 4F80A 1OCZB 5HDWA 2HT3D 3AREC 4LARL 1JPGB 4U6VL 4ODTH 4X6CB 2XQYK 2XN2A 3DV4A 3HG3A 2JMRA 4AK1A 3C8KA 2VC2B 4HS8L 2F53A 5JW3H 2AZAA 5FXCH 3LEYH 2A74A 4HIJB 3RGVB 4YDIL 4HKBA 3CSFA 1E5CA 3BPCB 3QIUD 4OZHF 4QLRA 2ICES 3D9AH 2XXFA 3HR5A 1DVFD 3K72B 2EUVA 2HSIA 1I1AC 4XPGH 2D8KA 3TP4A 3TONA 1IB5A 2RCSH 4CN4A 3ZE2B 1DLHB 4KRPD 4O4YH 4FEIA 4JDTL 3WFDL 2WBJB 3LNIA 4B9GA 4ZMYA 2APWA 3EBHA 1DUZA 1GS7A 3MBEA 5HDQH 3U4EA 2DMBA 3VWJA 4B27A 4HKXA 3DJ9A 2P8LB 4OCYH 4A7QA 5KSBA 1SN5A 1KN2H 5ISZB 3GC3A 4GQ9H 3D12B 1J7VR 3QUYA 3KJ6L 2CRZA 1F2QA 2BHZA 2EEAA 1FSKB 3QWRA 4NQUA 4G80A 5FYLH 4EDWL 4ZTOL 7PCYA 4MDJB 1PLGH 1R5IB 1X5XA 2UY6A 2I5YH 1J9CT 3EOAA 1YHPA 1YC8A 3LQMA 1FV1B 4UOZA 1A3ZA 3R4DA 2Q87A 1DQIA 1R3LB 1A65A 4JZJB 2C3HA 3ROOB 1UZ6F 3QUZD 1H8OA 4HK0A 3X3GH 2BRRL 2GB2A 5G4NA 5J6SA 5K33A 3FBQA 4N20A 1RK0B 1FGVH 1QX1A 5ECJE 3GSNB 1L9PA 3GXDA 2IDSA 4GEIA 4GQZA 1ACYH 1NBQA 4P49A 4HWUA 1PF3A 4EUPH 1ODAA 2HG0A 4Y2DB 1KIPA 3IDXL 1IC7H 3LEXB 3OX8B 4UV4H 2A74B 5IFJA 3ESNA 5AENA 2VR9A 4GRWB 1UM6H 3FB6A 3CU7A 2MCPL 5DMGC 4BE5A 5KJRH 2Y7QA 2YLKA 3K72A 3CZGA 5LAXA 1B6DA 1ZDSA 4MTMA 1XCTB 4HUWA 1MLCB 2K6YA 3BQUB 5EZOH 5L2KB 1CK0L 4JY5H 4LSDA 1RZQA 5GGSB 1E4XH 5ANHA 4IGBB 3SDDD 2GJZB 3BT2H 4W9KC 2D0HA 1GYCA 3UMNA 1JYNA 1F86A 4GEJA 1J8HD 1L3WA 3FQXA 3K1DA 4YAQB 3HN8A 4CVZA 3E6HA 3BPOC 1DBBH 4CW1A 3DX6B 3ISRA 4JL1A 4N68A 1J5CA 1KPUA 1U8JA 2CO6A 2P7TA 2DLHA 4Y5XA 3QI9C 5IQNA 2R0ZL 2VRKA 4JFYA 4PJFA 1PGRB 1TOXA 3T0AA 3VD0A 4RZCB 4HJUA 5DVLA 1VESA 3QPQC 4Z7UB 1LLAA 5IEHA 2WZ0A 3UACA 2R8SH 2ZSWA 4HLZH 2B8OT 1EAOA 3EYQD 1CLYH 3VFGH 5IW1B 1DBBL 2WP3O 4QHNB 2YEQA 2JK5A 4LIQL 3R19A 3LTVA 4UINH 4AEHL 5EU5A 3KPRA 4ODVH 3REVA 1ZVYA 4XMXA 4EOWL 4M8UA 2WW8A 3S5ZA 4R3SB 3PP3H 1AQHA 4KMTH 1JFQL 3DX1A 4N0YH 3N85L 5H37G 1QO3B 3WGVB 4O2FA 4BFBD 4NQDE 1JERA 3S5LG 3SYPA 4U1GB 5D4JA 5TE7H 1X5JA 5CILL 1RP8A 3VD2A 2NY4D 5KYXA 2XSKA 3KYNB 4RBPH 5E95B 2DLFL 4AL8L 5IY5B 1A8ZA 5ICUA 1UWFA 1AR1B 4XO4A 4WHTB 4AT6B 3KLQA 1QHPA 1G6RB 3CK0L 4UQIM 4NERA 4WIQA 3NZUA 1FJ1A 1SHSA 4J39A 2X4NA 3OKNA 4HAGA 5CZXC 2AF2A 3FTVA 5DMYA 4P99A 2FR4A 3MKKA 3QFDB 4XVTL 4PJFB 1YMMD 5TK2A 4MRBA 2WXRA 3V0VA 3D0VB 2YUVA 2OK0H 2X4OA 3DUUA 4LHUA 3VXOB 3MOBH 3MRJA 1JFQH 3FJTA 3UYOD 2XJLA 2XWTB 2QBWA 4HGWA 4H8PA 2Q8BL 3BWUC 1JWSB 4TQPA 3I9PA 4ADGA 2ZAIA 1IGIL 3TWYA 3IE4A 3LKOB 4DK6A 1WFOA 4NQXA 3C60D 1HOCB 3WOVA 5DJ2B 2YPLA 3FUHA 5KVDH 2Y5QA 4FQPA 2NY1D 1HYRC 1U3ZA 1CLYL 3W57A 2E6PA 5GZOA 3WV0A 3REVB 3MRBB 4FKHA 5JA9A 5J12C 1BAGA 3KHQA 3H6AA 4UQDA 3S36X 1OAUH 3D5OF 2LVCA 3FUJA 4TMPA 5D7LD 4EN3B 3W2DH 4YBLC 4OJYA 5DHVA 4N2NA 4RNRA 4J5VA 3KYMB 4TQEL 2CLZA 5SWZD 5EHFA 3KAAA 1NDGA 2N7SA 2PYEA 3FFCD 3QORC 3BWAB 2R69L 1AIFA 3CFDA 3OXRB 5J12B 1C08A 5KTEL 1CDGA 4NQDD 5I0WA 4PY8J 3NT0A 5FYKH 5HYJA 2P5ED 4KOBA 3B8SA 1BCIA 1R33A 2NY6C 2PCFA 1RURH 1AVAA 4JDZA 4ZOCA 3WEMA 4WUKL 5I26A 5CILH 3SDXA 4YN3A 1GXEA 4PJDF 4JKPH 1WVZA 2AQ3A 1FFTB 1XQ4A 4X99A 3WUWA 3JV4A 3PAZA 2ZSVA 2VDQH 2UUDK 4K4KA 4P2QE 5F89B 1C7SA 4R5TA 3AM8A 4CW1B 1UWEL 3DYMA 3L9RA 1VAHA 4CNIA 4ZQKB 1KLUA 2FQGA 3D2UA 3TYFA 1LE9A 4C4BA 2K3TA 3MODH 2AI0H 3GXPA 1SYVB 4ODVL 3AY2A 1CICD 1Q9OB 4K8RC 3ZTCC 2F5BL 3JQOB 1IFHH 1WF5A 2DJMA 3W0WA 2G5UA 5A16B 3EDFA 4HK3J 4RWHA 5EN3A 2NUTB 2OSXA 3EYUH 1R5WA 4PRIB 2YK1H 2CUHA 3KXFA 2ETWA 4RIRB 5I17A 1MCWW 4XPAH 5I1DB 2I9LB 1Y0LB 4P06A 3EKCA 1DBMH 4A7GA 1ITCA 3DUSA 4BK5A 2ZE0A 4HSCX 1EAJA 4LLQB 4LDOB 2Y06H 4UT6A 2D3VA 1DTUA 1MCWM 1GGBL 4Z7VB 1WISA 2B1OA 2G4EA 2F54B 3TBWA 8CGTA 4JO8A 5DO2C 1I53A 3CE1A 15C8H 4M3KB 5I19L 2HT2D 4OZFB 4Y8DC 3MRCA 4TULL 1F11B 2I9TA 3IK2A 2ZXCA 3LPPA 3D0LB 5E6IA 4RRPM 1S46A 2J3SA 5FW8A 1HL4A 4GW5A 5MEPB 3FB8B 3OKMB 1G6RA 1I8KA 3PV6B 4XN2A 4C55A 4PJXE 4ZMWA 4CA4A 2X4NB 3OKNB 4FQHB 4KK8D 2BP0B 1C5DA 3BIBX 3FO2B 4BKTC 3KGUA 1CURA 1DQDH 5I18L 1OHZA 4PJXB 1WH0A 1AR1C 1CXEA 3D9AL 3PE9A 1IC7L 5CZRA 1CO1A 4KJQC 1FYTE 1JPEA 5I18H 1RAMA 3WMSA 1JCKA 1H6TA 2DJSA 4XP5H 3BDYH 2C3GA 3ULAB 1GY1A 5E23A 5F7AA 1ECZA 2Z91B 3MLUL 1CZ8H 1GKOA 1DN0A 3F83A 4LE8A 2J88H 3NIGF 3KEHA 3KLLA 3GSWA 2V2XB 3IJ9A 3FB5B 1T04A 5A43C 1J88A 1H0DA 3UC2A 4WV1A 4JM2B 4NN5C 1JZ2A 4LPYA 3VH8B 4NP9A 1M7XA 1HL8A 2F7RA 2XIIA 1TNNA 2OAAA 5CSBA 1P7KA 1NDMB 4RX4A 3VI3B 3L3KA 1ZGLP 3V4PL 4QDGA 4L37B 4X50A 5BQDA 2BNRD 4NC1C 3KYMA 4N0CD 1AOHA 3KPTA 3SDAB 3ZE1B 5HVWA 4NC2B 1YPZF 3VI3E 1KTCA 3AUVA 2JB6A 1LL1A 5FO7B 3SSGA 3QWQB 2YUZA 2CO1A 4G7SB 3S5LA 1KMGA 4NBYB 3GM0A 5AVRB 3FB8A 1MHCB 3NQIA 4G70B 4IHOA 5G5DA 2ZG3A 1A2YA 4OW6A 5D7EA 2PF6A 5D7JA 3O6KL 1GJIA 3AC0A 3ARQA 3RTQD 3QIUB 3S8FB 4Q9RH 4XPFH 1LWHA 3U2SA 3IRCA 1MCPL 1BVLB 3WJMB 3BSGA 3KVDD 4MA3B 1HE7A 4XAKE 4NHCH 3FB7B 1LO0H 1NEZB 4GAYA 3IJSA 1WBXA 1JHLL 4Z3IA 5HHVH 3NOIA 2C3VB 1FL5B 1MCOH 3VWJD 3WTXA 5AZEH 1FUNA 4X9FA 4K7PX 3CFQA 4HF5H 2CHXA 5F1SA 4U1JB 3W5MA 2JJTA 1OT4A 4Y5YC 4N3TA 2HXAA 1WD8A 2BNQE 3MGTB 3QCUH 4POZC 5AZEL 2EXTA 3H4FA 4JKPL 2CDEA 3TIEA 4AITA 4ZRGA 2BIPA 3LS4H 4E41D 12E8L 3EFOA 5SX5K 2WN3A 1I7ZB 1Z5HA 2ZNXA 4M7KL 2CLRB 2BZ7A 5DJXB 5JORB 4DAGH 2IJ0C 4FMFA 3L3KB 1AO7D 2C9RA 4LPWA 3BAIA 3QARA 4N8VG 5IQ7H 4AMKH 3EO1A 1G6RH 4UT7H 1TTBA 4RGND 2XTJE 4MAUL 5DZPA 2VR4A 4J4PD 2J1KA 5CJ5A 1CDHA 1FV1A 4LQFH 4PRNA 4QWWC 2BNRE 1WLHA 5D72L 1Q0YL 5DHXB 3KR3H 3MRCB 2E5EA 2EXWD 4ZMOA 3FQRA 1XAUA 3BN9D 5EIVA 2O6CA 2D7PA 3GZPA 4L8SC 1CBJA 4M1DL 1EO8H 1C5CL 1FZKB 2VDML 3BKCL 3BZ5A 3K8MA 1ZHKB 5TE6H 1KCVL 1K6QH 3L3JA 2ZKWA 3UCRA 4PJBE 4MMZB 3OAWA 1RZIA 2VAAA 2Q7YB 3IKCA 2ORBH 3KWTA 5C0CD 2WO3B 4X0KB 3MUGA 5EF0A 1WHPA 1J87A 1RUPL 2AMUA 1DL7H 1GOGA 2VR5A 4BFEA 4ODUB 1DBJH 1QYGH 5FGBA 5B1JA 3QC6X 2YN3A 2H0FA 1ZVHA 5F3BB 1FNLA 4X83A 3MOBL 4P8QA 3PGCA 2HT2C 4YXHH 2J6WA 2N4IA 2ZYRA 2E9BA 2HJKA 3GXFA 4NJAH 2F7PA 3RFZB 1OP3K 1TDQA 5CMAA 1BQSA 3K4DA 3H1ZA 4NKDB 3BDYL 4JB9H 4XP5L 5ALBH 1F6LL 1N6QH 1BZ7A 3HE6C 3BIAX 4Y5VC 1PY0A 3CK0H 3P4NB 3L3DB 4YZFE 2VR7A 3RGVC 1IUZA 4RSVA 3FQXB 4MCYA 1UXWB 5BVPH 3FUMA 1YN7A 5TFSH 5C1MB 2X9WA 3ARFB 3WJJA 1FP5A 5TF0A 1AGFA 4TQIA 3N42B 4MNQD 3D39E 3SYAA 1FVEB 1HWGB 4S1QH 1MHHA 3H42L 2NW2B 2WY3B 5DRZA 3VTAA 3N85H 2RJMA 5B22A 4JPVL 5GS1B 1ZT7A 3GS4A 4QXGH 4YJZL 2OV0A 3C2SA 1A6AB 3OL2A 3NSYA 3W9DA 4PLNC 1QNIA 4WFFD 4ZTPL 4J12A 1ID2A 2VSMB 3UCQA 4I4WB 1NPNA 3NDYE 3LVEA 3TBVA 1IKNC 3C60A 1E4WL 2Z31D 3MTRA 2EDDA 4HU8A 5KSAA 3CZEA 4XAKD 1C8QA 5F44A 1MN4A 2AV1A 2C8NA 4OUUA 3DO4A 3UTTA 4YNYA 4YDVB 4X7SH 4P9HC 3NSJA 4JM0A 1AO7B 2P4AB 4JR9H 4NHCL 2N01B 1MAJA 2ZICA 4OLUL 1DQLL 1CE6A 2KT6A 4AGPA 1I8IB 1W0VA 4PJCB 4MJ6B 1DQTA 4PRPB 5E70A 1ZANH 3RZCC 2EXWC 1Q9LB 2EABA 2DQDL 2N7BA 3DOHA 3FAWA 4LCWB 4X6CF 1L6PA 3SDDA 1CIDA 3TF7C 4MVBD 1WWCA 4Z78B 1JWUA 1T1ZB 4HUCA 5DJ6B 4WQOA 1AHWC 5E99L 3U0WL 3ARBB 4TSAH 5KVGE 4CUCA 3NTCL 1M1SA 4JG9A 1ZEAL 3PNWB 1E30A 1A6VH 3MXVH 2QV4A 5DYOA 5GS1A 1XAKA 3MV7B 1DYZA 1FPTL 4IRSD 3ZJAA 3GHBL 4TV3A 4WEUD 3IFNL 5I1EH 2WVVA 5CN2A 2FH6A 1EBPA 3FN9A 4U1IA 3TL5A 1LE5A 4IU3A 5L2JA 3AMLA 1T1XA 1AHMA 2X41A 3STBA 1LM8V 3KXFD 2HT4C 5E4OA 5E9DE 5HDBB 3UTSA 3V5DB 5AAMA 1UD2A 3CFIC 1Q4NX 3BRGC 3C5JB 4X0NA 2DM4A 5D7KD 1LEKA 4X0KA 3HC2A 2VAJA 5C6PB 2X7LA 4PIRF 3DRTB 4B7LA 4I85A 1U9KA 4QGTA 3MA9L 4WFFE 3EHBB 3WTUA 3LRLA 1S2EA 5D1XD 2H3NA 5FYLL 2N1TE 5DZ9A 4Z7UA 5T3ZH 5DK3A 2O93L 2BOLA 4QKTA 1RUMH 2NY4C 3ZL2A 3KL5A 5FA4B 5KN5A 3ZDXB 4TOYL 4ENEC 3QCVH 1KJVA 1XXFC 2XX1A 5GGVH 2X4SB 2XU9A 4GXUM 5FM8A 3FOMB 1ZKAA 1JNNH 5EULV 2WXJA 3S88H 1PEWA 1UASA 4HCRA 5EU6A 5EBGA 4HKJB 3WGUB 3MAWA 4YWGL 2AK1L 1QFWH 3HEIB 4ICXA 4UZUA 4L3AA 4B6ZA 3OR6B 1YMMA 1GS8A 3DRQA 2ICWJ 3UP1A 3BLPX 3K4ZA 3RA7L 1WIOA 4DGVL 4UAOC 4F5CE 4KNSA 3X1EA 2XTJB 4ANWA 4S1SH 2W60B 3NGBC 1F18A 1D6EB 5DZVA 1AOZA 4Z0BH 3NH7H 3ZHFA 1TKWB 3ZX1A 4MAZA 4JFEA 3FT1A 1BAFL 4BUGA 4F27A 4PJAB 3T77A 4AJYV 1H5BA 1E3XA 3QQNA 1NBVL 2ZUTA 4QRAA 4UOW0 1VGKA 3MRGA 4ZX4A 3LHAA 3KG5A 3P3RA 3WLWD 3LY6A 4KQ0A 5D1ZD 1GL4B 3ZUNC 2HFEA 1AS8A 3AAZA 1D5MA 2Q8AH 2CGYA 3NK3A 4WO4D 4XMLL 3IBOA 2FCBA 4XXCC 5B1BB 5HSFA 4RRPG 5LAXB 3JV0A 1F11A 5D7IB 1RZJC 2CBQA 3PWNA 1MFBH 3ZE0B 4E9QA 1FYTA 3UYPB 1QR1B 4ZXBA 4HEME 3KYNA 4KJYB 1KENH 3GZQA 4K9EC 4JZNA 4CMHC 1EDYA 1IJ9A 5T33L 2AITA 4HWEL 5EEWA 1JYXA 5C0AD 1GPOL 3N06B 4OD2A 4XPHL 1EGJA 1HXYB 4WEEA 1CGUA 1V54B 2XKNB 3EH4B 4OIBA 5GZNC 4BFIA 2WNGA 3Q1SH 1ZA6B 1D6VH 4Q4IA 1PKOA 1P1ZB 3CPLB 4K9JA 4WJ5B 4EDXB 5IHWA 1Y18A 2AJXH 2R9HC 4OZGA 4HWNA 1ETZB 1MIEH 4PBWD 4W4OC 2HG5B 1JPTL 3T3MB 3CFDB 2ZSWB 3S3SA 3GHEH 1F2XK 4NCDA 3EYVB 5BUAA 4O2EA 4HJSA 5KBLA 2F8XC 5I28A 4APQD 1C5BH 4MNGA 2IBBA 3SDXB 1U92B 1BM7A 5CJQH 5KANI 2XBTA 3NCYP 4IHBA 2DMGA 1J12A 4JO1H 4RGMB 3FRUA 4TNEA 4WWKD 4AY0A 4H0HB 3VXSA 1NCBL 2IANE 2OI9C 3MRBA 4GI8A 5HXMA 1OGTA 3C9NB 4AQAB 1E9OA 1SUHA 3K7UA 4AG4H 2ZTBA 3B7RL 1F00I 1VERA 1UG9A 3LIZA 3QJFB 4LSPL 3ZUCA 2NLJB 4TYUA 5CD3A 3A4FA 4L3CA 4XZUA 3IPBA 2IDQA 4AJWA 4FTVB 3E2HC 1G9EA 3D25A 4LSUH 1OM3L 3HZYA 4BIKA 1M6OA 1X4ZA 3WXVL 5I16A 2CIIB 2DLFH 2F58L 2RQEA 4AL8H 2OTUB 4UU9B 1XF2A 4JDZB 2GAZA 4UQ2B 1TMCB 4BRJA 1DZBA 5GGUB 1AQ8A 3LD8B 1G1YA 2V33A 1RIUH 4MZ2A 3J2PA 3Q2LA 2WYTA 2X42A 2BVTA 3KJ6H 2Z1KA 4LBEA 4OLZH 2AJYH 2FGWL 1DSYA 5FO9A 2FR4B 1TF4A 2FEEL 3P0VL 3VG0H 3M1OA 3AXIA 5CP7B 4JPQA 3AT9A 3EH2A 1W72A 4M5YH 1U95B 5AAMC 3ZDXF 5INCB 4IDJL 1MY7A 4P46A 4DVRL 2XG5A 4YSPA 4DP6X 1AXIB 3LXAA 4JVPA 2A0LD 1JTOA 2E86A 5DD6B 1QRKA 5IVZB 2ZCZA 3MJ6A 3LN5B 3VU2A 4XPGL 4NM8L 2OL3L 1LEGB 25C8L 1L0YA 4L4VB 1L7TH 4NS0A 1YNTA 1QZ1A 2OJZH 1UD5A 1ZANL 4W1TA 3I6KB 5FYKU 4EQ2A 2H2SC 2WQVA 3NAAL 2E6JA 2KLTA 4HZLB 2FE0A 4NQXB 3ZDZE 3CU1A 1AXTH 5BS0A 3V6FB 1YQVH 2CO2A 3LPFA 1CDUA 1EJFA 1MG2C 4J3TA 4ABWA 1AGCB 3HB3B 3OHXC 5KSVA 5MHSE 5CWSB 3QNYA 4YHMH 3PGFH 3GSUB 3T4AA 3ZKMD 4R90H 3RHWK 4XXWA 5IMMA 4G8AC 4YC2B 4GW4B 1KB5B 4HSQA 4MD5A 3ZLQC 1MNUL 4Z95L 4ZFOB 4JO2L 1J18A 2QHRH 1VPOH 1KCSH 2MQCA 1A5FH 2WLLB 1C08B 2A6JA 2QADC 4G72B 5C0CA 1I1AA 2FEDC 4MAYC 1NAML 1OAQL 4MLIA 1CDIA 1Q9WA 1AGBB 1NC4B 5D2LA 4JY5L 5L2KD 2IFFH 1MCIA 3AG3B 4OFPA 4XE5B 5LWYL 3VW3L 1WCBA 4RMRA 3N9GH 2Q3XA 4G71B 3T0XA 4FQHA 3ME0B 4H0IA 3UZEC 2QPFA 1JXGA 3L54A 4R2GD 3D69A 2HX8A 2UWEE 4G1MB 1ZT1A 2AJSH 3I9GL 2BCKA 1V5JA 1WQVT 2ZWNA 1P9MA 1ZLDA 3NCMA 1FGVL 3S3CB 2ZJSL 2HTLC 4FXGB 3L3GB 4JPWH 5IP4A 3HE6D 5DJYB 1JNLH 3DGCR 2XIBA 3VGFA 4PJDE 2TRHA 2ZWYA 4FCHA 1MCKA 4G59C 4PGCA 1UT9A 1HZLA 4MDRA 1QLEH 1OE2A 4HXBL 3E80A 4A2MA 4Z7VA 1RFDH 1WHOA 3MNWA 1JF6A 4MJIA 1M7IB 4H44C 3ATAA 5DRZB 2PW1A 3D48R 1TVBB 4BQCA 3NFNA 4MA1C 3EF4A 3ZY7A 4XMKL 4BD4A 2EO7A 3N50A 4XCCL 4NENB 3FTYA 2DPKA 3FT3B 2PP9A 5IK3B 4EI5C 4CGTA 1C1EH 3WXWH 4XCFL 3FC8A 2EIZB 4FXKC 4FTVA 3ZTJG 4L4TE 4XMPH 1YUHA 3SE3C 3ETBF 3LHPL 4ZOAA 1LP9A 4DESA 5DI8A 3QZOA 4EIZC 5D93B 3EBIA 2V5YA 1ODUA 3K0WA 3L7EB 4W9JC 4KK6D 4XAWH 4YDVA 1HOEA 1QSVA 2Z93B 4NQVA 3TVMB 1P7BA 4ODWA 3G5ZB 2BZDA 3P73B 1JZEA 5AOLA 4DKTA 5IMOB 1XTLA 2R39A 5ICZB 1ZS2A 5JW3L 5DHVH 2H1PH 1IFGA 5IB4A 4KKLD 5F3FA 4DPRA 1LP9F 2KBGA 5DRXA 5ACLA 1JVOA 2BXZA 2H41A 3MV9B 3EUDA 3O6FB 1KNOB 4PTUA 5AOMA 2APVA 3B7TA 4IMLA 2GPZA 4XH2A 4AM0A 2GTWB 5JHDE 5T5NG 2OXHB 1FE8H 3TBTA 3S35L 3FSOA 5HTSA 2FDBP 3IPFA 4WUUD 1TQCB 2GFBB 4AQOA 1BQRA 3D85D 1L9QA 1X5YA 3UADA 4DNLA 3HUJE 1M6UA 2A9MH 2CKBH 1WP6A 3AXHA 5FKPB 2ADJB 3IDYC 1VFBB 4JVWA 5F88A 2VXUL 1DVZA 1W6WA 2Z0UA 3ILEA 4D0DB 3CC1A 1U8MB 5A2JH 4PAZA 3ZRFC 1XR9B 5HPOA 2NY3B 1Q9KA 4MNHA 4JNXA 5EEZA 3LD8C 4HUKB 4JFFB 3PFUA 3WIIL 4EAEA 5GJSH 1EEZA 3F01A 4U1LB 5DGRA 1LP9B 4Z8FL 2PMZA 4PY7A 5K69A 4HQQH 2H0JA 2X10A 5JHBA 1FO0H 1TSRA 1KUMA 3EJQA 3CDGA 1ZK5A 2DLEA 3I75B 1MFDL 2YHGA 1YYLH 1LP9E 3QEUB 3WFCH 2EYRA 3L1EA 4D0BA 4J1UA 3RWFA 5C07A 4PRIE 5E7BA 1A1OB 3SGEH 4M93C 2ARJQ 3I50H 4WW2B 4F7MA 1Y7VA 1KBGH 3CFEA 2DY2A 3MUHL 4KJPD 4NKIH 4ATWA 1DBAL 1SJHA 2CHWA 2PO6D 3HZKB 3MLXH 4YVNA 5KUKA 4EIGB 4RGMC 4EZMA 1U2YA 4R4ND 4PP1C 1DJZA 3CFNA 1WA2X 1BG1A 2DQTL 3KGSA 4ZMXA 2EUXA 2AQTA 1A47A 4Z7WA 4ILDA 4I0KA 4LP4A 4OLXL 3Q8AA 3P77A 3K4AA 3ZZ1A 5FKPA 1CN4A 5L0QC 4UIMA 2D4DA 1JFHA 2HX7A 5DURB 1AZNA 1F1AA 3V8OA 3CVDA 5PAZA 3GLZA 3PG2A 4NZTL 2GG1A 4HC1A 1NANH 4K9EL 4HJ1A 3UYRL 5T3XL 3L4UA 3MCKB 1PG7W 4MQ7A 3ZR6A 5BW7A 1CE1L 1YECH 3B2PA 3F7PC 3T3MF 3EOAB 3W0WE 4POYA 1KJMB 4N2BA 2WXLA 3EO1B 1CXFA 3C6LA 1XBDA 5AW4B 5FGCE 4NENA 3WL9A 1K85A 1A6AA 2KL6A 2W60A 3O4LE 2G0LA 1SXZA 4KKAC 1U8QA 4M6OL 5CSZA 2HMIC 3RIAK 2N0MA 1F8TL 3EF7A 4J1UB 3RWFB 5SWZB 3WD5H 2VDKB 1YYMH 3CXDH 4X6CE 5JQ6L 1MRFL 2P5WE 1R3JB 1U0QA 2KHAA 1NGYB 3E9TA 3V2AR 4FQJL 4YEFA 1TQSA 3U9PH 2TAAA 2Q7AA 3FU3A 3QA3B 4R7XA 1KV7A 4N5UA 2YSSB 4X7TB 2JKLA 4HEPA 1ZA3B 5LVEA 4JFPB 1TJXA 4KKRA 2DI8A 1J86A 1MLCA 3BQUA 3LNHA 4JDEB 1A3LH 1P5VA 3DWTA 4NRYB 4OH2A 5EIQA 1CMOA 1W0VB 4PJCA 4E9LA 2YK1L 3QUMH 1JRHL 3WDIA 1DEDA 3QDMB 1VKXB 3X3FL 1SVCP 1FWXA 2C34A 4R5VA 4ERSH 3UBHA 5E8OB 3GDCA 5J6GB 4N24A 5ECGA 1I3RB 1J1OL 2H6OA 3V0IA 4L5FH 5LKNA 1IEAA 1OALA 4Q74A 3K8LA 2WZPD 2OMZA 1TJGH 1IBGH 1F4YH 2MFNA 5IHHA 4YUEH 1LHZA 1ZIBA 2XVKA 4Z77B 4JJOA 2EH7L 2X1XR 3D4CA 4NPYA 4KHTL 4X8XA 3IVKA 1ZVSA 3CHPA 4FS0A 5I73B 3DX9A 3AADB 5BJTA 3IJHB 4PM1A 2WM0A 1U8NB 2VDNB 3H3PH 3Q6FA 4BE6A 4H5SA 1AFVH 3P0YL 5FAAA 1OCWL 2YOCA 3WS6C 4G5AA 3ZDWA 5HDOA 1I8MA 5IB5A 2X4PA 4DZBA 1SOQA 1W72L 1QFWI 4HS3A 4JG1H 5DQJB 4BZ2H 2NR6A 4XNXH 4HJJL 3EYVA 3IMBA 3GIVB 1XO8A 3E6FA 1NEZG 5IHUH 2DQEL 1N2RA 1YRKA 3X1FA 4DOHE 1HXMB 5D9SB 4P2OD 1AI1H 2IQ9H 3QWOB 3BN3B 4ZS6D 5KSAB 2ZOOA 3DV6B 3JTSA 3UEZA 3CZNA 1HCFX 3CN4A 1X9RA 4MDIB 3HOGA 2YKLH 2WB7A 3V4VA 4ZYKA 2FO4B 3SE8L 4F37F 4IBWA 1U6AH 4A7TA 3FSZA 5GS0H 3K2KA 4YSEA 2QR0A 3CSYA 4OJAA 2C5DC 1DE4B 3IGAB 1ILUA 5AQ0A 2YAQA 4F15B 3FT4A 1WS7A 2IAAC 2G3MA 4LPCA 3LKPB 1IGIH 4Q2ZA 4KJWC 2WYHA 1LK2A 3C2AL 4LNVA 3VXPB 4GQQA 3H3KA 4GXVH 2CCWA 5D1ZB 2HB0A 4P46D 1YN6A 4ONOA 1PFOA 4BQ8A 5FO2A 4S0SD 4OTXL 5F7EL 3WAKA 3RU8L 1ML0A 2KH2B 3L1GA 5I8CA 3MLYH 4M93B 3WHXB 1I85C 5FHAL 3TX4A 1UACH 1N59B 3V6OE 4PRDB 2AERT 1JV5B 1X9QA 3LRSA 2KDYA 2NXYC 3GSNH 1W0WA 4IDJH 4BSVA 3GRWH 4GRMA 1J1XH 4X6BA 1D3CA 4IU3B 4HX1B 1E27A 2P24A 1U8QB 2VMDA 4FI8A 3R7RA 4TVPD 5DJ2A 3BVDB 5INDA 2YRZA 4M3HA 2LTQC 3BAXA 3QIBC 4PWKA 1FCCA 2B1HH 5D5ME 4JLRB 4H20L 1EH9A 3ILPB 1LD9B 3ZKXB 4ZFZB 4O58H 2DH3A 2VQTA 3O8XB 5DJAB 5K9KA 3L95A 3V4VB 4FI6A 1ZJAA 1P4LB 3JBG7 2WAHA 4UINL 2DLTA 3MRGB 4BFIB 5DFVC 2CLZB 2Y7OA 5JPNC 1IGYA 3ZKMC 4OGYH 4MD5B 3WNOA 1QPXA 2DWEB 4NNPH 4OZHA 3G5VB 4CKQA 4N6RA 3APMA 2KQMA 3ARDB 2NY7L 3MLSL 4Y16B 2VR3A 2ESVB 4MBRA 4YHPA 1OF2B 2DD8H 1MHPL 3B1TA 1DBKH 1U58A 1B2WL 3TFKC 2D31A 4HFWB 4AQEA 1CD1B 1Q72H 1UJ3A 2IG2H 4P48A 4P3DB 4ZXBB 2NTSP 1U92A 5IJBC 4FFWD 4P2RA 5AW3B 1MFUA 2DYSB 4EVNB 1MJ7L 3SBWA 4O2CA 3OKYA 3V7AE 4ZQTA 1IIIA 2E56A 2V5SA 5F1KC 2UZPA 5KVDE 3CXHJ 2XPGB 4GO9A 1CBVH 4HT1H 4MJHA 4F9LC 1MLBB 4UT9H 3VFTB 2O26U 3DX3A 1NCWH 1RMFH 2FTAA 3HPJA 5AVVB 4KVPA 3D0VA 4P4RB 3PHOB 4YHOH 3IFPA 4TPRH 1P1ZA 4OLYH 4XN1A 2FWOA 4LKCA 4YDKH 1UC6A 3NJNA 3O11A 1T21A 1MFVA 1T4KB 3SQBA 5ABDE 2E7DA 4I18A 1PMYA 5DS1A 5E5MA 2P5EB 4GAJH 2NYYC 1KEGL 3KPSA 2E7BA 5IJCC 1HEZB 5J6HB 4WENB 1HOCA 1YA5A 1SQMA 3ES6B 4CVUA 3W11C 2BSTA 1XCXA 2FBJH 4RRPA 3WSQH 4PJ9B 4IYKA 5FUCE 5AW2B 4FZ8H 5FYKE 1GJWA 1WS8A 3H85A 5AVTB 3VX1A 5EDXA 3T4AC 1PZCA 4G5ZH 2IWFA 1S7WA 1JSYA 4KHXL 4L9LC 5AG8A 4S1RH 5GRJH 4NNPL 2C9SA 2GBUA 3WN5C 5LB1A 2J6EH 4Z7UF 4F1ZA 5CBAB 3UROR 3MRFA 5KJ7E 4F7CB 5DD6A 4O2FB 1PG7L 4U3XA 3L48A 4PREA 3H9HB 1X44A 2IPUK 3N6YA 5LBVA 3QFJB 1WYJA 4ODXA 2OTUA 4UU9A 3DVIA 1EEQA 4ZUSB 1FL3A 2D73A 2VABB 1CGTA 5K9JL 1M9WA 1ZHNA 4FL4B 5DMKB 3ARTA 2Z4QA 2R2HB 3CVIL 1D5IL 3EOBB 1JDCA 1SBSL 5I76B 3O9WB 4RDBA 1V10A 3QEHB 4Y1AA 2H47C 5F9WB 3RA7H 1BGXH