3BFQG

Crystal structure of truncated fimg (fimgt) in complex with the donor strand peptide of fimf (dsf)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
132
structure length
132
Chain Sequence
b'AKPCTVSTTNATVDLGDLYSFSLMSAGAASAWHDVALELTNCPVGTSRVTASFSGAADSTGYYKNQGTAQNIQLELQDDSGNTLNTGATKTVQVDDSSQSAHFPLQVRALTVNGGATQGTIQAVISITYTYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein fimG
molecule tags Structural protein/structural protein
source organism Escherichia coli str. k12 substr.
publication title Infinite Kinetic Stability against Dissociation of Supramolecular Protein Complexes through Donor Strand Complementation
pubmed doi rcsb
total genus 24
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2007-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 3bfqG00
4AUUA 4J3OG 4X5RA 2XG4B 3MCYA 1N0LB 5AALA 4XOBA 4AVJA 5AAPA 5LNEA 4AVIA 4AUYA 4LOVA 3BFWA 1QUNB 3SQBB 4AV0A 1KIUB 4X5QA 3ZL1A 4J3OF 1ZE3H 5FLUA 4AV4A 2W07B 4AVHA 2JTYA 4XODA 5F3FA 5CGBA 5FX3A 5FWRA 2XG5B 3BWUF 4XOEA 3JWNE 3JWNH 5ABZA 5F2FA 4X5PA 3RFZA 1TR7A 2J2ZB 4XO8A 3ZPDA 4AUJA 4J3OH 4BUQA 1PDKB 4CSTA 5LNGA 4CA4A 2UY6B 3ME0B 4AV5A 1N12A 5IQNA 2JMRA 5AB1A 5JQIB 4XOCA 4X50A 4AVKA 5IQMA 4ATTA 4XOAA 2WMPB 2UY7B 5IQOA 3ZL2A 5FS5A 2VCOA 1UWFA 3BFQG 4XO9A 4CSSA 1KLFB 3JWNG
chains in the Genus database with same CATH superfamily
1BQHB 5SWSD 3M1OA 2IV8A 5C0BE 2BDNH 5C0FA 2X4QB 1U8MA 2O6CA 4NJAL 5CJXA 1UTDA 1IV8A 2XN1A 3D2UB 3LEXA 1E8WA 1IGMH 1MEXH 1SQ2N 5EOQL 5DEGA 5FW8A 4BUGA 4HIHB 4N4YB 4IIZA 2LOEA 5IJVB 5D4JA 4NQEA 4YFLF 2BO0A 5LBVA 3E1ZA 1YYML 5ACMA 4MXWL 3H56A 2XVBA 3CSYB 1VFAB 2IAMB 3VXSD 5EORH 3NK4A 1MUJB 1AOZA 3MNZA 5JHLL 4LSRL 4Q6YA 2KDYA 1C5CH 3ES6B 5KBKA 5KVDL 4JFFA 4ZXBA 2OTWA 1C5DA 1EUTA 2CDGA 4ZMNA 2HT2C 4MJIA 1FZKB 1R24B 1CXFA 4G5ZL 1ZS8A 4AH2A 3GKZA 4X98A 3OAZK 3ZXAC 1WA1X 4KXZI 1NFIB 3VDAA 1KB9J 3MI6A 4PY8J 5BW7A 4IRZH 5FO8A 5HYJE 4YFEA 4YDZA 4K7FB 5E0QA 1L0QA 1Z9SA 1PZBA 2Z35A 4HUCA 4LSSL 4K3EL 5JO5A 3Q43A 3MJ9H 3MRLA 4KUZL 5E2WL 1T03L 4P57B 4FCHA 5ABAA 4C4UA 2VDKL 1E4KA 4UBDD 2ZSVB 3VD7A 4WDIA 3D5OF 2SEBB 4K3JL 5C0GB 4PD4K 4FXLA 3IT8D 3Q01A 4DF9A 2AQPA 2QFRA 4HETA 4UIKL 3D1MC 4IRSB 4XVJH 1F3DJ 3O6KH 2J8UB 4X6DF 1HIML 2WVUA 4HAFA 2WZPD 5EF0A 2AERT 1BVKB 4JHWL 3S35H 3WNJA 2Y7QA 3MV8D 1OT4A 3QCTH 4R96A 4EI5A 5HHQA 4BCYA 3OHXC 2YIHA 1TZGL 2CLZA 1WIPA 1XH3A 3ERXA 1CICC 2EKJA 3TIEA 4P2OA 4JY6B 3HFML 3RLSA 3E8UH 2Q20A 1MCEA 4BQ6A 3AU1B 4YBQD 5F93C 3FAWA 2B1AH 3OF6D 5I30L 3UYPA 1N19A 1XH2A 2BP8A 4ELME 4YEEA 3GZPA 3SDCA 4Q2ZA 1ZHLA 1PKQB 3HAEB 1U91B 3QUHA 3PWVB 4J8RB 3GMLB 2VDRL 1B2WL 2XVKA 2X4OB 4NZTL 1XTLA 3RBSA 1D6EB 5J9PA 2CR6A 4G3YH 2NR6C 4Z0BH 1KY6A 3FW6A 1UD3A 4R5VA 2OMXB 3OKMB 1YEFH 3BX7C 3IFNL 3SB3A 1J05A 1NUDA 3TBYB 3CQPA 3FQ2A 4GPVA 3SY0B 1KCVH 3OJDB 3F7RA 2AJUL 1ZLWH 3STZA 3HZMA 1NUGA 1AD0A 4PSRA 5TE4H 2JJTC 5BS0B 3LZLA 5CILL 1H3GA 2B1OA 1GGIH 3FB8B 1JNJA 2VXVH 1OP5H 2BMKB 2EDMA 2EDYA 3UZQB 3EFFA 2APVA 3V0WH 4MB4A 2OK0L 2QDWA 3WKPA 1BEYH 1N4XL 3MUGA 2XJKA 2DWXA 3NJXA 4HGKC 2IG2L 4OCNC 1YQ2A 5C8JB 1MRCH 2ARJB 3SIKA 5HI4C 5TE6H 1S9XB 1W0YT 2XVGA 5E2WH 1R5IA 1MW3A 1PZAA 2EYRA 1F86A 1RURH 4F2MA 1WFNA 5ID1B 1EVTC 1EO8H 1HS6A 4B9PA 1DDHA 1T20A 1CZ8L 4HW6A 2H1XA 1RY7B 1UC6A 4X0KA 4X6DA 4ZD3L 1MFMA 3T77A 1RZIB 3J7HA 2BJML 1VRSA 3C6SB 4LSDA 2IFFL 4HPHA 1S4IA 5CCGE 4YUEH 2EADA 2NUPA 3B2UC 3HG1D 2H9GA 4M7ZB 3K6NA 1C5CL 3PJLA 1INQA 3FYIB 3BUIA 2ZCKL 4LP4A 5E00A 5C2BH 4OFYA 4G8AC 3WFBL 3L5WB 4LLWB 1YN6B 1R33A 1YDPA 4G6KL 3FHAA 3ARDD 5CU5A 3HUJF 5M94B 5EU3A 3ARFC 4JHWH 2QQNH 4MSWB 4HF5H 1UADC 3DVIA 2EIBA 5JDSA 2ZX6A 2VMFA 3EJZD 4LK4A 3RZCB 1KIPA 4TRPL 1D5MB 5ANMA 1XTMA 2NXYB 3DX9A 3HKFA 2HKHH 2Z91A 4YXHL 4TF4A 2CMRH 4XBPA 3CZGA 3HAEH 4KFZC 3T0WA 1S78D 1FAKT 3RPIB 2I26N 1UT9A 2NX5E 3P73A 2DQEL 4QRAA 2D03H 4LAQL 3HI1A 3P4OB 4MJ6B 4U6YA 5DMGD 1SQMA 2NUPB 4OT1H 1EZSA 1SXSA 2VR6A 3VFPA 2YEVB 2VB5A 3OX8A 4A6YB 3MX0B 1P1VA 4NQCE 4UZUA 2WWKT 2BOBB 4WV1B 4KJQC 4P46C 3EHBD 4Y9BA 5TF1H 1AVAA 2DQEH 1RP9A 3WTUA 4X6FB 3QI9B 3SE4C 5EF2A 3BXNB 3FU7B 5GQBA 4PJ5B 1IGFH 3EH3B 5B1BB 3TCLA 4BRJA 1HINH 3FU9A 4EXKA 4Z3GA 3P4MA 3FF7A 3PPEA 2ZKWA 4YDVA 3R0MA 4GRLD 3BGFB 2X9XA 4IIQA 1S7VA 5H4YA 1MF2L 1KTLA 2B14A 4ESKA 3IDIA 4HYTB 2E6PA 3B43A 1R1CA 4X7CC 3ALWA 3QA3A 4LPWA 4RX4A 2VR7A 1DJWA 1KCLA 2OR9L 3AQYA 3OKKB 1JZ6A 3K71B 4PB0L 2PETA 3HZYA 5DZNA 4MDRA 4UIMA 3A6CH 3CVIH 5CSBA 2ZKHL 3GMOB 1MLBB 2VABA 4J4PD 4XAKE 3CFQA 1KSRA 1TOXA 1TVBA 3MA9L 4HJUA 3TEYA 1BVNT 2V2XB 4EOWH 1G9NL 2GBVA 2K6WA 3LN4B 4L9LC 4OZGF 5T1JA 2IXQB 4I3SH 4ZTEA 3QSKB 1H3PL 2G30A 2EDKA 3JV4B 3GSRB 4OCWL 4XHJD 3JT0A 1RZ8B 1S2EA 4PJEE 3VXUD 3L7FA 1E4WH 3KPOB 4AQAA 3RWCA 1LO4L 1YNTB 4WAFA 4QO1A 3LDBC 4WFFE 3NESA 3N5AA 1EX0A 4FQCH 3CK0H 3QEUA 1G84A 5B1CA 5ILTL 4PR5B 3B2MA 5AVVB 4BCZA 2DQCL 3ULUH 1A6VL 4NKIH 4JVWA 2C9RA 2EEFA 3T6XA 1GIGH 3POHA 1NFDA 3LEVL 5CHNA 2R7EB 3MRDA 1OVZA 4Y4KB 2OMYA 4KXZH 1FVEB 2YJLA 3SGJC 3VFVA 2R9HD 5DUPH 3SE9H 1SN0A 4E9TA 3ILPA 1M9SA 1BFOA 2BH0A 4XP1L 3AM8A 3UPRB 3G5VB 3GHBL 3PG2A 2BVPB 3BN9C 1GZPB 1KJ2B 4A2GA 3N3EA 1HYSD 1K72A 3LS4H 3O3BB 2QSCH 3HN8A 3MACL 1RPKA 2O5ZH 2VYRE 3HI1B 3P4OA 1UZGA 3BDYL 3B5TA 4QRSA 3VWJC 3QWRD 5LVEA 1XVSA 1FFQA 3UEQA 1A6AA 3ARZA 3KEHA 4X5RA 2JKJA 2QQLH 3PABB 1XB8A 1DQLL 4R0LA 1OM3L 4UV7L 2P46B 3B1UA 4XVTL 1A4BA 4K5PA 5GS2H 1KGCE 1I4FA 2H6UA 4XRCA 4HIJB 3ESPA 2WVVB 3HG3A 2XRAL 4L4VB 4DZBB 3EFDH 3NJLA 5I1LA 1IQDA 3SO5A 4ODXA 3RBGA 4POUB 1PSKL 3TA3D 5BV7L 1JG9A 4ATWA 3STZB 4OLWL 1MDTA 1T83A 3OC8A 1BG1A 1AXSA 1Q90A 1MF2H 1Z6JT 3C5ZA 1H0DA 4Z7IA 2EEDA 3KHOA 5KS9A 5SX4H 3PNWB 3X12A 5FF6A 2D0HA 1UCBH 1RZJL 3Q5OA 3ZZQA 1OZUA 1UM5H 5GGRA 4HK3J 3MBXH 1PAMA 4TUJB 4C56A 4NP9A 2BY0A 2P24B 2W38A 1FGVL 4PJAE 4QKXB 3UYPB 5I1CH 3TA3A 5IHBA 1F13A 3DWTA 2DKUA 1U9KA 1FFOA 4IJ3C 5M7QA 4KJYB 5KYYB 3IGAA 3RUGE 3CU7A 4IW4C 4FFVD 4OLEA 4KK8C 4ICWA 1U3HD 5G5DA 1JRHH 1BZ7B 4LHUA 4LSSH 3IK2A 2E9IA 4JQVC 5D70L 3RDTC 5DTFB 1DL7L 3ZDZE 4PTUA 4AQ8A 4GS7B 2P3YA 3VXRE 3KMDA 1PYWB 4NYLA 3VD3A 1UM5L 5C86A 4JPWH 1AKJA 3D6GA 5CEZE 1J1PL 3L08A 3HB3D 4X8XA 4IJ3B 4MXVE 4XNQB 4QWWD 3T3MF 4AX3A 2KZWA 4AGNA 2RFXA 1OGAB 4ALAL 4ERSH 3TO4A 4MAZA 3MRGA 3FQUA 5EU5A 2I9LA 3GUFA 2F74A 1QBMH 1NMCC 3WE1A 1UXWA 1UM4L 3L5IA 4BM7A 1S7QB 3X1BA 4G5AA 1UEYA 3QDMB 3MRLB 1DL7H 5TF1L 2HLFC 5TK2A 3DJRA 4E9SA 5BO0D 5IB2B 4G6JL 1G4MA 4NS0A 1I1FB 3DBSA 4FXGB 4HJ0D 2F8IA 5D7IF 3T3PE 3CAFA 3TESA 1LHZA 3RWJA 1SF5A 5EOQH 4J28A 2DQUH 3RTQD 3BP4B 2EVHA 2BW4A 2HLFD 3BVWA 1JGLH 1XGYL 2R9HC 2WLMA 4Z7VE 5E99L 3PWPA 3TEUA 1H6TA 2XKNB 1OTTC 3JTTA 5A3IC 1CGWA 1I8UA 1YEGL 5IESH 3ZGHA 4UT9H 4K94H 3KE0A 1YEEH 3MV8E 3RPIA 2NYYD 4G6FB 4ZFZA 4R4BB 5HYJB 4YXLH 3P0VL 4IKIA 2JF1A 4BK5C 1J0KA 3QUKA 2J6EH 3K2KA 3T08A 3MROB 4YQXL 3D0VA 4KTEL 5C3LD 3IDUA 1ASPA 4V1DD 1ZLVH 3RAJL 5FW7A 3FUDA 3PIQB 2WQRA 3BW9B 3VDBA 1CBVH 3WGUB 2Q5BA 4X5PA 4FS0A 4JBSA 1RIUH 3I9PA 4HXBL 4I77L 2UZIL 4H4NA 4K3DL 1NPNA 2IALA 3HB3B 2C8NA 2VIRA 2PTUA 4B9IA 2MQCA 3T4AB 3QZWB 1CDYA 1LWJA 3JT2A 4HXAH 2GQHA 5I1AA 4YXKH 1BMWA 2BNQA 1YEJL 5FECB 2VJ0A 3CFBA 5CEYA 5CCKH 5DRZA 3WFHA 5EU7C 4F7CA 4MWFB 4OI7A 4Z7WE 4Z7OB 2GK0B 1VENA 3QIUA 4RETB 3B7YA 3CFTA 3CZFA 1ZS8B 3BPNB 4XVTH 3QJOA 2OP4L 3WKNA 1C5DB 1JDCA 2CDGB 2E7DA 3DRQB 3NZ8A 4XNMA 1UWEH 2H7WA 2YGOA 2AEOA 3LQAC 3FU7A 1P4LA 2NDGA 4LP5A 4Q8BA 4Z7WA 3FTGB 5IKCB 3GHBH 2OCJA 3MLUH 3NQKA 3DMMB 4NKDA 4GH7B 4GRWF 3S3PA 4TKWA 1YECL 2DM4A 3UGXA 3VFGH 1Z32X 4L1DA 4N8VG 4OM1H 5D2LE 4Q4EA 5ICXB 3QJTB 1Q72L 1I8MB 4AVHA 1OF2A 3IJ8A 4HUKB 3QZNA 1WA2X 4E42A 5D6CB 3CN1A 3GTTA 5D4QA 2PO6A 2F54E 2P8LB 1GR7A 2CH8A 2NCEA 4OSUH 4W9IC 3KPSA 3ISRA 2PCPB 2VDRH 4AEEA 4HUWA 4AEFA 2FX7L 4D7BA 4KOCA 2NMSA 5EBLB 1G7LB 2P5WD 2WSPA 2WZ0A 1RLWA 2NLJA 1F45A 3ECWA 5FUOL 1UT2A 1HNFA 1YSOA 5F7HA 3HI6H 1E28B 4JDVB 1G9NH 3QXDB 4JG9A 5T3ZE 1AHWA 1IC4H 3FBKA 1QPKA 4YDMA 3N85L 2ZX5A 3QFJD 4LO9A 1U8OB 3M45A 1IFHH 4PJGE 4G1EB 4YHLL 2IQ9L 5F3BB 1IJ9A 1BFSA 3QUML 1AGFA 1R34A 4A38A 3PJSA 2UWEE 5DJYA 2O1AA 2AJVL 4GJTB 1O9VA 3ZZSA 4I2XA 4EI5B 3MRCB 3OPZH 4QD2E 5K9JL 1J1XH 5DLLA 3EH1A 4UDTA 4X8CA 1R3KB 4ACPA 1RIUL 4H8UA 4I77H 3T9WA 1F42A 2VRQA 2YA2A 1GS8A 1L9TA 3UTSE 1HJCA 1TQSA 5D2LB 2WN2A 1MY5A 4ECNA 1MEXL 3FUNA 4PWJA 4EDXA 5DRNA 3QUMH 1H0DB 3P0VH 4N8PA 4BFIB 3SQOL 5GS1B 1CD9B 3WY1A 2CG9X 3VD9A 1UEMA 2CHDA 5F7UA 1BQ5A 1JGVH 1VEMA 3LKNB 1P7QB 3O3EA 4DKTA 1B6DA 3FN0L 4FHJA 3GWJA 3QULA 3OWRA 4OCYL 2DBLL 4DO4A 1QACA 5I24A 1MCOH 4ZUSA 4BH7B 3KYMA 2F61A 2J73A 1WFMA 5I8EB 1Q9LB 1QEWA 3VYPA 3TJHC 5DURD 5L2KA 3BCFA 3VI3E 2I07A 3QH3B 1KB5L 3PWLA 4F7TA 1Q9WA 1DCEA 4JCMA 1EJ8A 4AM0B 3SKUD 1CMOA 2VLKB 5K9OA 4HZ1A 4Z5RB 3ASOB 3DRTA 3O2WL 5HVGB 3C60D 3VMOA 4H0HB 3QUXA 4OQTH 5D7LA 4NNPL 5E1AB 1O7VA 4L3AA 1GJUA 1Z0NA 3C2AL 2B0SH 4PJ8C 4B3VA 5EIQA 5G4MA 4EI5D 2EICA 3QUYC 3BHBB 2HKFL 5M95B 2DIBA 4NJAH 4QNPE 1OGAD 5LAPA 1BP3B 1HH9B 2Q8BL 3HMWL 4M7LL 1MG3C 1CK0H 1UUNA 2D3LA 1WUZA 1OQOA 1BVOA 3MLUL 3CFUA 3DSFH 4XVUC 3SDXA 1XF4B 3EBHA 2X41A 2PWGA 4FFTA 2FO8A 2X3BA 5AOIA 4HOMA 1T89A 4UNIA 5ESAA 4G42B 1L6PA 2B5IC 1P7KB 4X8GA 2EVIA 4BD4A 4LLMA 4XN1A 1YAIA 4UQ2A 5JPNB 2L0DA 1MCFA 5D5MA 1CK0L 1IARB 5J12B 3Q3GA 3IRCA 4RDBA 4WU5B 2AC0A 2DV6A 2F5BH 4UB0H 4HU8A 2OTUA 4QJ3B 2VDMB 3B9KA 5HYSG 4XCYB 1G1KA 3VXOB 1F1AA 4QHMB 5GGVY 2AAAA 4XB3A 3OHXB 1F1DA 3KAAA 1QTYT 3BGMA 5ADOH 3VXSA 4Q97A 3M07A 4N8CL 2XFXA 2XPZA 1BPVA 1YQVH 1TCRB 3MV8B 1PX3A 4DP5X 2X2UA 1WWBX 1BZEA 4U2YA 4DQAA 3MJ9A 4M62L 2ADJA 1I1AB 1LNUB 2OCFD 1Y1DA 1YJDL 3L3KB 3HC0B 4WI0A 3M1CA 3JVGC 1B0WA 2H3NB 3VGAC 1TQWA 2W8CA 3IE9A 1QLEH 5IK3B 1Q1JL 5JR1H 5KVEL 3EGXA 2JELL 2CUIA 3HIZA 5FF6B 3UTTE 2HG0A 3L9EA 1WTLA 4PVBA 5D7SH 1VA9A 2AANA 2HFGL 3KGRA 3RNKA 3WAKA 3QZLA 5C0FB 1I7RB 2ZG2A 5FB8B 3ZTNH 3FT2A 4YSQA 5F21B 5FUZH 1QBML 3NACL 5IBLC 3HMWH 1TO4A 3BKMH 2NQDA 1T0MB 4XPGH 1IIIA 1IKOP 2JSFA 3UZVA 15C8H 4I0KA 1LJMA 4PJ8B 2XIIA 3KPQA 1ADWA 1EHAA 2LFEA 1NMBL 4NQCA 1N3NB 1RZ7H 2HRPH 5IEHA 2JCWA 2O72A 2EXWC 2WUCH 5B3JE 1G0DA 2BZ7A 3MRFB 2N0MA 3BD4A 3QHZH 4WU7A 4JFHE 4DUWA 1MCOL 3T6WA 2ZQKA 3ULVC 1M7UA 4YHIA 3K6DA 3GS0A 4U3SA 4GO8A 5E1HB 5DUML 3AREC 4ZFGL 5E00B 3DI3B 4LP8A 5FYJE 2WXLA 1OK0A 3TH4T 5HGBB 3GSWA 4M6AA 2OV0A 4I48A 4XC1L 4LRNL 3WUWA 2B1HH 1X9UA 3CZJA 1KXQA 3SJVE 4L8DA 1XDTT 4LSVH 3VFSA 3TEXA 3L3IA 5BV7B 2YUVA 2FGZA 3T6ZA 5LBSA 5AVSB 1N7MH 4PJIB 3UTOA 4BBWA 5CHNB 1P9MC 3LH2L 1OTTD 1MCLA 1OV8A 4GP5B 3RE0A 4RWHA 4EBQH 5JHDD 2NUTA 1M2VA 3UL4A 5IBTL 1JN6B 3GM8A 2JK5A 1IC7L 3I50H 1ZD6A 3SGDH 4Q9CA 3Q44A 5DR5L 1UZ6E 1UA6L 3DLQR 2CKBA 5LGHL 4LSRH 4BFEA 2R2EB 1GYVA 2BXYA 4I0PC 4KHXH 2DM3A 3FUKA 4U1HB 5E9DD 1MFNA 1F4WH 4BINA 2GSIA 2IH1A 4P5TA 5EU6D 1JXJA 3JWNC 4I48B 2AHIA 3UXFA 1N7ML 3PHAA 4NCDA 1DBBL 5K69A 1PFCA 3MRRB 2R1XB 4I9XA 3NJKA 4PGBA 1NM9A 2IFGA 4NGHL 2DJSA 1IB5A 1LD9A 5DS8B 4I5BB 4CADB 1WBYB 1UKQA 3HI6L 4KROC 4YE0A 5B3JF 3DHUA 1TZHA 2ZF8A 4ZJ9A 4O2EA 3BW9A 1BQSA 3II1A 1KIPB 2A4ZA 4MAUL 5EC1A 2J6WA 3TPUB 1N8ZB 2DKSA 3ABMB 1N59B 2XSKA 4JPKL 4D94A 5I1KL 5D72L 5GSRB 1RUQH 4L0YA 2EE9A 3QQ9D 3OHMB 1HILA 2CDEA 1S9KC 5GRZA 4XBEL 1GOFA 3DTXB 4MHHI 1QZ1A 3IDMA 3MJ7B 4KROB 1SOSA 4JM4H 4R4FH 4AQOA 1QTSA 2YUZA 1P4BH 3QJFB 1PLGH 3KS0H 2IGLA 4IGBD 5AW4B 4LVHB 4HLJA 3WIFA 4DKEH 4R97C 4KZCA 5C0AB 3ISWA 4PY7A 2XNAA 4L5FH 4CKQA 1GGIL 2OR7A 1IFGA 1A7OL 4HK0A 1WC7B 5C7XL 4N24A 1UXMA 2AGJH 3CK0L 4DW2H 1L9SA 3ZE0F 2FTAA 4D7PA 3NJNA 1U8LB 3B9AA 3CXHJ 3W81A 3MRHB 3BPOB 4R2GB 3EDEA 5PAZA 2FAUA 1ZV9A 2JIXB 3SE4A 2JJSC 3SE6A 2ESVD 4DP6X 1UKSA 3ZIYA 4P9HH 4LVNC 5JOPD 3O2VL 4JG0L 2PN5A 3ARFB 3HZKA 2OYPA 5JDSB 2BS9A 4A7VA 1DFBL 1MIEL 3I75A 3V4UL 4DNLA 4O2CB 2R1WA 5CLXA 2AGJL 4MJ5A 4EN3B 2FL5A 5LGJB 3LZQA 3DX6B 4HGWA 3LEVH 4YMPA 4S11A 4ELMA 3UPRA 3GLZA 1ASQA 4I9WD 1QUNB 3QPXL 1PS3A 1J12A 1S7UB 2H9GB 4R6UA 4TSBL 5B39A 1CF8H 1UHVA 2QVFB 1RKRA 1LO5B 4BFNA 4ZI8A 4CVXA 4I3RH 3MRHA 2XG5A 4MGXA 2Z31C 4M1DL 2DLTA 2OSXA 5IHHA 3SHSA 4CUCA 2AV1A 2V6HA 5CS7A 2ZCLH 5D2NB 4LPYA 1FRGH 7FABH 1MCNA 1P4UA 4GINA 3ETBJ 4PV1C 2Y1YA 2MOGA 3EBAA 1O6VA 1SY6L 4QWWC 2FWSA 3TV3L 3AB0C 3IF1A 4FXKB 2VDOH 5DVKA 2CD0A 1JK9A 1KB9K 2FLBT 4V11A 2J88H 4NAJA 2AK4B 3BYYA 3GGWB 4ZTOH 3CVHA 1NGPL 4Q58C 3N1GC 1PKQE 2AABH 1NCIA 1JFQH 5FYJL 1L9PA 4CVZA 4ELMB 3GKWH 3CG8A 3H54A 5D5MF 4IBVA 3DVGA 2X6AA 3LD8B 5DS8A 5B1KA 2R8SL 4IJTA 3SOTA 4LIQL 2OCCB 4JHBA 2UUDK 2DTML 2NNFA 5GGSB 4XPTL 5C0EA 1SVCP 5AKSA 1VADA 1NCGA 2ZT9C 4Q6KA 5E1AA 1EJ6A 4OV5B 1F6LL 2CO6B 2I27N 4JDZA 1QSFE 4NNYB 4HKJA 3QFGA 3X14A 2EVJA 1KGUA 1G7MB 1YG9A 2NDFA 2QTVA 3GIVA 5HHPB 4NI3A 4RFNC 1KBVA 1R9FA 1QW8A 4OQTL 2ZOOA 5AL0A 2K78A 1BZDA 3ORJA 4KRPB 4BKLB 1Q9LA 1JV5B 1BQKA 2DQTH 2NXYC 4OAWA 5D4HA 4Q9RL 3D07A 1NBZB 1FVCB 1T22B 1EV2E 2J5LB 2A9BA 5D70H 4ZUUB 2VJXA 2VMCA 5I8KH 5K9JH 4FFYH 2QSQA 1JRHL 2W81C 2PW2A 3PCYA 4C4BA 3D30A 2FWOA 4ZW6A 1XGRB 2BIHA 2HVJB 3GSXB 3V5DA 4QT5A 4W6XB 5C0AA 4WV1A 3DX8A 2ZJSL 1M05A 3EDFA 2R1YB 2Y5TB 4MCZB 1Z9MA 1BX2B 1F4YH 3HG4A 1I8LC 4P9HL 3GSWB 2A38A 4XMTA 2EAEA 2JLLA 3BQUC 3BUYB 1JYXA 4RMQA 3VRLF 3R4RA 2DM2A 2COQA 5D1ZI 4KI1A 1RZJH 5E5LA 4OGYH 1KTKE 4KMQA 1NM4A 1HESA 4KJQD 2QZ5A 4EZKA 1F8TH 2ITEA 4WK0B 2Z65C 2J12B 1IKFL 1CT8B 4FMFA 5IMMB 2PCXA 3VM7A 4JFZL 1BD2E 2KI6A 4UCFA 2OSWA 2EILB 1C5BL 4BUHA 4HA1A 4ZPVA 1U92B 1S78C 2WXOA 3FFCD 4XXDA 4R3SB 2WLHA 3PDGA 1XO8A 4ZXBD 4KZEH 1EXUB 1AGDA 1HDMA 3NACH 3L1GA 4U7MA 1JHLH 2IMNA 2H0JA 5K59F 1ZE3H 3TZVA 1FGNL 5T1LA 4ZW3A 2NW3B 1R3JA 4UQ3B 3W2DL 4LNRB 1A4AA 2C7UA 1A14H 1KG0B 4LBEA 4HDIA 5EEWA 3H9SE 4IU2B 4FQXB 1E4WL 3DJTA 4GG8B 1YEHL 4KVNL 3QIWB 4NAQA 1PW3A 2OJZL 4HS6B 2WMPB 3TN0A 5KBDA 3QB7C 5D55A 1QHOA 3IU3A 1RJYA 4WFHD 4FNQA 4AW7A 2AKRA 4AQEA 4Z9KB 4KVPA 1S7WB 4FXGC 4P23B 4OKVB 3VG0L 5BRZD 3LS5H 2EDBA 5D1XA 5FFOA 3PGDB 1T1XA 4A63A 5TGBA 3VMPA 2UY6A 1ACYL 4GRWE 1EFXB 3NJJA 1JF1A 3T1FA 4G8FA 4JM2A 1B90A 3TBWB 5IJBC 3KJ4B 1I53A 2I7OA 3D39B 2EEBA 1AGBB 2G5BA 5DF0A 2DWEB 1BQUA 2A6DB 4PREB 4G8IB 3PFQA 3AUVA 5IK3A 3EH4B 2UXVA 1JNNL 3WNKA 2GJZB 2HUHA 2FH8A 4PLJC 1LNUA 4HEMA 5GS1C 4PJ9A 3SE9L 4BZ2H 2BPBA 1JNLL 1RHHB 2EO1A 5FK9B 4NWUH 5FKPA 4PJBA 3LVTA 1DEEA 1SY6A 4AIEA 1RK0A 2H26A 2X4PA 5BZWB 4MMYA 5CM1A 3WY4A 3S5LG 1KCBA 1YMMA 3EADA 3VXNB 4BIKA 4XOEA 1U3HB 3O0RL 4I9WE 4UAOC 3ZTJH 3K80A 3GSVB 3S96B 4K23L 3IDYB 4J7RA 3VNZA 4B27A 1BYOA 2BP8B 4AKOA 2G75B 2G5RA 4FA7B 1X4ZA 4HV8A 1TZGH 2FJGB 3IGKA 1AGDB 1HDMB 5D71H 4CDGC 3U46A 1G9HA 2YD0A 1BXXA 3CTTA 1T89C 2VDML 2X42A 3L48A 1JGUL 1TQCB 1GCFA 4QXWA 1S7RB 4O02B 1SHSA 1OWRM 1V3MA 1T2JA 2EXSA 4UOZA 2CIKA 3ELQA 3T6VA 2X1OA 4PWKA 5BUAA 3DMMA 5BZDA 1TJIH 1B0RB 4ORZC 2ARJA 5DHYA 3IJYA 2VDKH 3ARDC 5AVWB 5KSUA 5C08E 1AJ7H 1GXEA 1I9RL 3FFCA 3I6LE 2YMXH 3APMA 4KTDL 4N2DA 3KLHC 1GGTA 1OZTG 4PJBF 5I26A 3BAXA 4WHCA 5C0BD 3TZVC 3GSNL 5EIIB 1GAFH 5IG7B 1DQVA 4PJGA 2J72A 4M43L 4ZAKA 1BEXA 4J3WA 4S1RL 5IFHL 3EYSH 2A73B 3GSUA 3L2NA 1WZ1L 3EO1A 3QHZL 4L4VD 1KXHA 2BRRH 2APSA 2G60L 3OJDA 3QCUH 4JKKA 3UAJD 4FJYA 5C0CA 3FRPG 4FADA 3U36B 3CSBA 5BMFL 4IOSD 4HX1A 5EU6E 1I9RH 3ARGB 2D3JA 4P4RA 2YQ2A 1AO7E 1GYCA 3O0LA 2AI0H 3BEWA 3L45A 1TT6A 1G7PA 1AQKH 1GH7A 2WXGA 4XODA 5DHYB 1GHFH 4QJ5B 4HKJB 4ZUTA 3KPSE 1MRFH 4AXWB 3ZDZF 4P2QD 2AS5M 2BSSA 1BJ8A 2WCSA 1TUPA 2R39A 3QWNA 3PUCA 4I3RL 3RHWF 2EKSB 5H35A 4JZOA 2BJMH 1R5VB 4NWTL 3GLEA 3UDWA 4WWPA 3QPXH 1FV1A 5EMYA 4LCUB 4HIQA 4HJJH 5E5RB 5J1SC 4QMEA 4MXQC 4UWQB 2IC2A 4KJYA 1JV2A 3QWOB 3Q5TA 2QMJA 4R96B 4WUUD 5DLML 5KYYA 5MHSE 1DJZA 4QYOA 5E6IB 3LRSA 2IFFH 3B3IA 1LK2A 2CBOA 4YC2B 4HJSA 4K5LA 3U48A 4BWUA 1BD2B 4FEIA 5JIMA 1LK3L 1S7RA 1MRCL 1TCMA 3MNDA 3WEXB 1G1CA 2EO7A 1LMIA 2Y9RT 3DRTB 4XCEA 1OPOA 2X1QA 1UH4A 3IU4L 3IEAA 3VGDA 4KI5D 3GDCA 3K6IA 2HN7B 2I9LB 5KVDE 2PPFA 2EUVA 3S2CA 3LH9A 1QI5A 3VH8G 3H0TB 4M7LH 1M6UA 1S9WA 4TSAL 3HPJB 4TL4A 3SDAA 3VW3H 4WEEA 1ETJA 2EIEA 5JO5B 2CJ3A 4U6XA 3TJEH 5IVZB 3ROLA 3UBXA 3HUJB 3MBEB 2X09A 3DK2A 3D4GA 3FUHA 3N41B 4NQXA 1Q4NX 5E9NA 2WN3A 4FQIH 3WHXA 4P2RB 4LPTA 1NCJA 5AAMC 4C57C 5C9JB 1OSZB 5SWQB 3NPSB 4G43A 3L1FA 4AK1A 5ENWA 5DO8A 3K3QA 2N7AA 3GZKA 4J2QA 4JZJA 3W0WB 1V55B 3WY3A 4DUVA 2XN9B 3BVXA 1XF3B 1ZHKB 2AJZA 4LKXB 2PWHA 1KFAL 4O5LH 1JHKL 1IBDA 3MLZL 4AGQA 4HT1L 3Q1SH 3QXVA 4N6RB 4KPHH 4PRPE 2WBJB 5PCYA 1EAPB 1J0IA 1LEKA 2IWKA 2IMMA 1BLNA 3PJSB 2J8HA 5CP3A 5DJYB 3WD5H 2IGFH 1AOHA 4FP8H 4ENEC 1BF2A 5TGBB 2X89A 1Z1WA 5TDOB 3RGVB 1KCRL 5LGYA 5IW3A 1F11B 4Y5XA 1F58H 3FZUD 4X80L 5DS2A 2A99A 2R0ZL 3KL3A 1KACB 4K5MA 2YUWA 4PAZA 5HDQL 1L6ZA 5I5JA 1YEDB 4LSTH 5TE7L 3SPIA 2VIRB 1E5CA 2J1XA 2NY3B 3MYZA 1DP0A 4Z3TA 1T5XB 2WINB 5DRZB 2Q7NA 1FORL 4F7CB 1R3HA 5EC2A 4R4FL 5GSRA 5IIEB 4AEIL 3I84A 2ICWB 4IBTA 2ICWI 3UG4A 2B08A 3GSNB 1J48A 2XZQH 1M4KA 3GMNA 3O3AB 4FCAA 4I85A 4KTEH 1U3ZA 2V9QA 1RK0B 1S9VA 2X4PB 3MROA 4P2QA 3RDTD 3F7KA 4Y19D 5IQOA 2AQQA 2A4EA 3Q6FB 1Y18A 5D1ZB 1SOXA 4ELKA 5AUMA 4B9GA 1KCKA 1M56B 1HHJA 2GC7C 4HOXA 3X13B 1IC4L 2BX5A 1U30A 4NQVA 2GEQA 3WDHA 3FSOA 3LNDA 2PWFA 2FQEA 2DQUL 3CDCA 3HBPA 4L3CA 4YR6B 5A2JH 3D39A 2L7QA 1KYDA 4AGMA 4KX8A 5AKRA 3TTSA 2V7HA 5IFAL 3B4NA 5IVXA 5GGUB 3FTWA 4HBCL 5DT1H 1NFDB 5FYLD 1HKLL 4AWJC 3ZMNA 1IU1A 1HEZA 4UF7C 2E86A 4X6BB 2EABA 2PP9A 2QDVA 3FRUB 4QRPA 1HEZB 4NZFA 3K2IA 3MGOA 4WGWB 1AZUA 4L8CB 1M05B 1TSRA 2RFXB 3BKCH 2V0AA 4KDWA 1EJOH 4QAWA 5CZRA 1P6FA 3RWCB 2QELA 1T3FA 3ZR6A 2K1MA 3X3FL 2ZKMX 4ZMVA 3VFSB 1NCBL 1YYMH 3QW9A 2C3GA 3ZRCC 1CICB 1FDLH 4DN4H 1I3GL 4K8RD 3GD1C 4KNSA 4PJHA 2G2RB 2ZPKL 3LKQA 3NFSL 1U3JA 2DQFB 1WBXA 4CNIB 1AGCB 2VXSH 2BWDA 4LEOB 3WXWL 4IHBA 3LMJH 3CFCH 3OR7B 2Z31D 1HE8A 1LEIB 4UINH 5CEZH 1R3LA 2DM7A 3EYOA 3MA7A 5ANME 5EEUA 2Y06L 4R90H 3QFDB 5CLTA 1XD0A 3RTQC 3RZCA 1W8OA 2FJHA 4NHCH 1QBLL 4EKXA 1W15A 4UDUA 2VLRD 1ZXKA 1E2ZA 4UQ9A 4LCWD 4BDVB 1UCBL 4TRPH 2YMTA 4WWNA 1P5UB 3RWFA 4C8XA 5BQ7A 3ZE0B 4DEUA 4IS6A 1BZ9B 4OR1A 1MOEA 1QSED 1MWAA 4XOAA 2ZOKB 3VXSE 4YJZL 3N1PC 1Q72H 4TLTA 4B5EA 5JIPA 1G7HB 1P6AB 1NKRA 1PIFA 2P49B 4OM1L 5F88B 3RJDA 1WV7T 1DQQB 4FC3E 4Y4FA 1EAQA 1OE2A 1J5OL 4NQCD 3QBTB 1MZZA 4Y5XC 1QKZH 5FHBH 3SN6N 2APWA 1JHTA 5FA4B 1D5XA 4MJ2A 5I1LB 5JYLA 3CFKB 4YFDB 1OP3H 3CSFA 1FP5A 1NBZA 1I4FB 3LKRA 3AMKA 5D7JB 3L3KA 4HGMA 3SYAA 1ULVA 1YN7A 5KVGH 3V79C 2GBAA 4MAYD 2WB1A 3FB5B 5EA0H 4KK8D 1RIHH 1G5AA 3QORB 4GIOA 3SSGA 1B2WH 1KGJA 1H5BC 1B3JA 1E2WA 2GY5A 4F80A 2E9WA 3IE4A 3OL2A 4JDZB 3FU5A 3Q8FA 5J11B 3GMQA 1Q94B 5LN8A 5E8NA 1ETB1 1F6AB 4OZIB 4WV1C 4JPSA 1HQRB 2ROYA 5JW4M 2F6AA 3LSOA 5DJ8B 5T8IA 1U3YA 3SKJH 3FB8A 3QAZB 5E8NB 4IK7A 5C0JA 5KJ7E 2GIXA 3UPCA 4FI8A 4NUPA 2NY0D 3ZKQD 2VLRB 4JFSA 4XO8A 3ZTDC 3C5XA 5FO9A 4HMCA 1A66A 4IBUA 4MZ2A 2F1AA 1QFUH 3GPEA 4KX9A 5TE4L 1YN7B 1ADQH 4PRDB 4XGZA 4NBXB 4ELMF 4NLHA 2ZWZA 3NRQA 4QHUA 5LAXB 1KDIA 1FHGA 1CFTA 4QRPE 1P7KA 5BV7C 3WTWA 4UQEA 3O6FA 1TFHA 2HUEA 1CLCA 3IMRA 4WSGA 1EEQA 2XZZA 3QORC 4MD4B 5AVUB 2V17L 3R7QA 4JO4L 3LNFA 1HE7A 3UMNA 3QJQB 5FYKU 2R7EA 3MRDB 2DJUA 4KK5D 5ISZA 3UABA 1HCZA 1W72H 1WF5A 3FQTB 2WZ5A 2NY4B 3PDOA 2X87A 4K2UL 1S7UA 5I1GH 3IXTA 1SXAA 1BZ9A 4XT1C 3KYNB 3D85B 5DD6B 2LLLA 3QEHA 3HR5B 4U0QB 2JQMA 4OCSL 1AGCA 4U6TA 5JIQA 3FN0H 1M71A 4IRZL 3CLFH 5B8CA 4M7JH 4PJHB 5JOFA 1I1CA 1I9IH 3D69B 3GDBA 3IKKA 1XL4A 4OJDH 4CRPA 3VFWA 3L95B 5HDOA 1XB3A 3GRWH 3X3FH 4Y1AA 3BP5A 3T4YB 3CXDL 1J5HA 2X89D 5GRVL 2NY4C 1T1WA 4BGLA 8FABA 2VN5A 1OPGL 2R2EA 3IFOA 4J27A 1NEPA 1E3FA 1PFOA 3BLBA 1MRFL 4UYQA 3F85A 5IBTH 2JK5B 3NSYA 1O9ZA 5FYKE 4OQTA 2WXRA 1BVLA 3OM3B 1B6UA 1FSKB 1HINL 2XWCA 4K3JH 2ZG1A 4N3UA 1ZLDA 1SJMA 2P52A 2F8OA 3GSUB 4ZO7A 2OZNA 1NCOA 4TNVK 2AV7B 3O6LH 3UX9B 3P69A 3GKWL 5L9DH 3O8XB 3C60A 1Z9OA 3K8KA 1VB9A 5A2IH 4IRJB 1EHKB 2F58L 3OAYK 4PCSA 1DQLH 1UQSA 4HBQA 2EDXA 3D18A 5EA0L 4UV4H 4M5SA 4OD2A 3VUAA 3HMXA 1A2YA 5LG1A 1XGZA 5A2CA 2HKHL 2D03L 2AK4D 2ZYRA 4C55A 2XTJE 4IU3B 1L7IL 1KUMA 3MUJA 2YAEA 2WW8A 3QHTC 5DHDA 3AFLA 1BWMA 2H1PH 1T0PB 4OIIL 5C07A 1N59A 4DCQA 4E9LA 1J5OH 5DZJA 4UDTB 3V4VA 5JUEL 2N4IA 5CLWA 3WO3B 2Q76A 2YPLD 3U2JA 3GIZH 4XMKL 1IQWH 2FX7H 4TPRL 3V6BR 4R0LC 1EDQA 5I8OH 3GHEL 2X38A 3AS1A 2ZICA 4TVPD 1CDHA 1MFEL 2BXZA 2FECL 3NN8B 4LSTL 4AZ8A 3EYQC 5FUZL 2XWJB 2XQYK 4G7QB 2M8XA 4YWGH 3CPUA 2R0ZH 1VACB 5AZEH 4LT7A 4OJAA 1MVUA 4AYEC 4BELD 1HHGB 3VQ1C 2LLNA 2YAFA 2CRIA 3WMSA 3FSZA 1HQ4A 2R29A 2BY2A 4G7SB 5AEAA 3EOAB 3LB6C 4OF8A 2NYKA 1LEKB 3DV6B 1K8IA 2XI9A 4ZT1A 2P80A 5BVPL 3FUJA 3FO0L 1MQ8A 2CO7B 3IDYC 1A6WL 1HN1A 1K4DB 3QQ4B 1YJDH 1AFVL 4L1LA 4PJBE 4CSTA 5KVFH 3NSCA 3G6JE 4EOWL 2P48B 1N26A 3ZO9A 4IQHA 4ZPTB 1P6WA 3V0WL 3G5YB 5T1MB 4M5YH 1X5XA 4N2FA 5B4MD 4I1NB 1CD8A 3B37A 1YUHB 3P3TA 4BQBA 4OIFA 2DLGA 3EFFB 3VFPB 5GS0L 1OL0A 3FT0A 1FCGA 4NKIL 4UT6A 1CE1H 2DQGH 32C2B 3MRMB 4HJGB 4YGVA 5T1KB 2VO5A 5HGBA 1HL4A 4G8GB 4UQDA 1NL0L 2BNUB 5C0CD 1HI6B 1AZZC 3ULUE 3WHE0 4RDQG 3MO1A 2LU5A 5D1XE 1FZMB 5IT2H 4Y19B 1CF1A 5DUBA 2XX1A 1SLXA 4TSAH 5DK3A 5AWNL 3CCHA 1OM9A 1WZAA 4IEFB 4PGDA 4WTZG 2Z6FA 4KWUA 2FB4H 4M4RB 3MYJB 4NO5B 5DFTA 1J8HA 1KXTA 2JH2A 2V3EA 3GBNL 4MD5B 2UZYA 1U58B 1NINA 3HG5A 4BE5A 1U8NB 1EJFA 4NRZB 3EYUH 5CMAB 3TYFB 4NZJA 1ZHLB 5EZLA 4EI5C 2VH5L 1CS6A 4LHUG 3F6IA 4RRPG 3MFFA 4UT6L 3FSVA 3BDXA 3EOBA 3NZSA 3HZMB 3NSFA 1XF1A 3LQMA 1OTSC 2DYPA 2I60L 1U8CA 4DGIL 2VSKB 1Q0XH 3VFUB 2L7EA 3ZT6A 4Z7VA 3CPLA 3RVXD 5AFAA 2LVCA 2QV2A 3QWOA 3S97C 4L1SA 2GCYB 2JKNA 1WYJA 2N56A 2IADB 3VRIA 1HIMH 1MFBL 1JPST 1YPZB 5FM4A 2QPFA 1BD2A 4J3OC 3WEMA 2GUOA 4AT6A 1ANUA 4OGXH 4QXTA 3FJTA 4GY4A 1JXFA 1QI4A 2ZF9A 3AU1A 1PZUB 3SJVD 2WNXA 1JV2B 4CU6A 2WQWA 2W9EL 3QNZB 1IM3B 5C8JA 2UZPA 1NEUA 4P59H 1NGZA 3WG7B 3TBVB 3L81A 1ZLSH 4JFYA 1JTPA 4KJPD 2KHAA 1CVSC 5HGAB 3BOVA 1XZ0A 3VD2A 5CGTA 5E6IC 3FB7B 4RA3A 1YNTF 5KUMA 1TTGA 5FYKD 5KYUA 2J43A 4QRRD 3ROOB 3HPJA 4N0UE 3NUKA 5F3FA 1ACZA 4FFWC 1ORSB 1ZJAA 1NCTA 2BC4A 4LGRB 5JIIA 4KTDH 1BV8A 2GJ6D 3DO7A 4QXUL 5A43C 1KB5A 5I74C 1U8KA 1CFQA 1M7DB 1B0RA 1X7QB 1FE8L 2C1OB 5ESAB 4KGLA 2R83A 4PP2B 3FSWA 4ERSL 2FRGP 2XG4B 3WFZA 4BHUA 1W6WA 2N0KA 1NPJA 1IIKA 2CKNA 3EO9L 4WJ5B 1F56A 4P9MH 4KAQH 4AV4A 3WLBA 1MFUA 4C83B 2HFGH 4MVBD 5DJAA 3K1DA 2AEIT 4JFFB 2CLZB 4OZHE 5BPPA 2GFBA 4Z0BL 1JWUB 4NXSA 4M61B 1EO8L 5EZPA 2A77H 1ILSA 3WO4B 2WKOF 3ZE1B 3P9WB 4AMWA 5CR8A 3DIFA 1F3JB 5IM7A 1Y0LA 2YK1H 5DGQA 4C56B 1A4JB 4F8TA 3TVMD 4Z7NE 1M7DA 4FZ8H 1G7PB 2Y7LA 2Y6SD 4XI5D 3UEZA 2AV1B 4EIBA 3ABKB 4GO9A 5CGYC 2BOCA 3AREB 4OY9A 5ADOL 5G2NA 5CAYB 4P3DB 5F3BA 1UWXH 4PBDA 2H45A 2R0WH 2YSTA 4P5RA 5T1KD 3IMBA 3Q6GL 1DQKA 3G9AB 35C8H 4B53A 3DX7A 3P11L 3BVNA 2CWRA 4WFFD 4U1LA 2CIIB 2LAGB 4QKTA 2VR5A 1S7XB 2A0LC 1Z0MA 2ERJC 4ODXB 3RL1A 3SE8L 2HLAA 5GGVL 3AS2A 3K6OA 4EAEA 1XZ0B 3RJOA 3ZX1A 3L3HA 4L29A 3VQMA 3VX1A 3BZ4A 1ZY9A 4WHTA 2AJXL 3C5ZD 1CLYL 1SJHB 3L7EB 4W68A 3O4OC 4DSYA 2OKMA 2WZ6A 3KLHD 3L13A 1TNNA 2DLIA 1SNRA 2XETA 5HVFB 2NY1C 3N1FC 3BGAA 2IO5A 2X4RB 1A3ZA 5DI8B 4OFQA 3X17A 2JKIS 3MJ9L 5JNYB 4L3EE 1LO3L 2EH8L 3CLEL 3RQ3A 4TNEA 5I71C 1RH8A 3T04D 4NBZB 2HAZA 2NZ9D 5EOCH 1P4IL 3TVMA 1E9QB 3LEYH 2DEXX 2XA8H 5I15L 1FVEA 4DP0X 4C47A 1A7NH 1BXUA 3FOLA 5F7EL 2FJGA 4KNTA 1FPTH 2QR0A 5AOMA 5FX3A 5KVDH 3WIIL 1JUFB 4G6AD 2Z0BA 5L2KD 3WFCL 1TF4A 4TQEL 1J10A 4M8QB 1LQBC 1JPGB 5DJCA 1A1OA 1LDPH 4TPRH 2AXFA 1FPTL 3EOTL 4NUMA 2X05A 1Z7JA 2MKWA 5LNGA 1G0YR 2JJSA 1KG0A 2P8PB 4FYTA 5E8PB 4OQ1A 5HHMB 1TNMA 1IKFH 4U1IA 3JV4A 5F7WC 3BUDA 4DKDC 2WP3T 1GW0A 3G6JB 4N0FA 3ZL1A 3U1SH 4AEHH 4XMWA 1FZMA 4BZ1L 2IALB 2YPVL 1HFUA 2XIBA 4I5BA 3QVAA 4P23D 5GSVB 3ZDXF 3GLAA 4M6MH 4CADA 1FZJB 4F8OA 4X9FA 1M7IB 5J1AA 4ZO9A 5IP4A 1F4YL 2NZ1A 4WW1B 3JWDC 1DVUA 2CJTA 2UZYB 5ETUB 3T0EE 2OQJB 2F15A 4ZMXA 3GXIA 5HD8C 3SPJA 1OP4A 2TAAA 4BV1A 1HHIB 1O5PA 2DKMA 1MH5A 3FULA 4RAHA 1S5IH 3VWJA 1IAOA 4ZUVA 2VE6A 5AAPA 4G6JH 3HNTL 3QZMA 4MS8D 3TIDA 2OR9H 1V27A 4IRSC 4GQ9H 5SV4A 3TPKA 2FSEB 3MNWA 4JRXE 5IHZB 1ID5I 1ZEAH 3QEQA 5I18L 5IGXL 4J4PA 4PJFA 3OXRB 3CVHH 3K1KC 5I0ZA 3EZJB 3GMRB 2IAND 1JCKA 1VGKA 3QI9A 5AOJA 5CD5C 1PG7W 1ZGLP 2FSDA 5JPMB 1BF5A 3L3JB 4OFVA 1JGEA 3SJVA 2ESVA 3QHFL 2VM9A 3ABZA 4WWID 2F53D 5IFJB 2WANA 3EJPA 2PABA 1KTCA 5I1AB 3DX7B 3VJ6A 3RX8A 2P7TA 2KT6A 3IN2A 5A16B 4L3FA 1AY1H 3THML 5ALCH 5E70A 5TQ2L 1XX9C 4W1TA 2CGRL 3T1WA 1FFNB 5IJCC 2HH0H 3FCSB 3NABL 1F00I 1W72L 4HWZA 4GUPA 1ZWIB 1XGQA 4IDJH 4ONGL 5J3HC 4HIIA 3OAUH 1DUZA 5DRXB 5F0MB 4HK3N 1URZA 1INDH 2ZAIA 3DHPA 1JGIA 4N0CD 1KYUA 1X5FA 4PGZA 4XP6H 4R4ND 3MRNA 4NKOB 5C7ZA 2ZCLL 4GKLA 4G8GD 3PNWA 4UYPA 5HYJD 1INQB 2D7TH 5HHOD 4HJEA 3KYAA 3MLSL 3QNYA 1FNFA 1N8OE 2FX9H 6FABL 1OGAE 2YWYA 3VH8A 5JXEC 4K8RL 4DAGL 3MLVH 1OGSA 3V4VB 4N25A 3WFBH 5F1SA 4M1CD 3D0AA 3DBXB 4NUQA 2ZUYA 4MD4A 4FZEH 3EOYG 2FWOB 5DJ2B 2VDPH 5ECGA 2PO6D 3DGGB 3KLLA 4WY7L 3ULAB 1MHHB 1O5DT 1N6QL 4NCC1 3JUYA 1HH6A 2XZCH 2WXIA 1HU8A 5A2BA 5CBAB 4YL4A 3X11B 3HG1A 3NSDA 2Z7WA 3H9SA 4M1GL 2F53A 4P5TD 4WI2A 5E8EA 5JIHA 2FJFA 4I4WB 1MWAL 3O11B 3PNRB 2WAQA 1R3IH 5GRVK 2A6KA 1JPTL 1OHQA 4WTWA 2AV7A 4NM4L 2IH8A 3QI9D 4NQQA 3OLDA 1GA2A 3Q8BA 2IANA 4ACTA 1KGYE 1TVDA 2WOYA 2BIPA 4PI2A 3T2OA 4NNXB 4RLDA 1CDJA 3RIKA 4W6WB 3KEDA 4GKSA 2VOTA 2HFFB 1VFOA 3AC0A 4DEPC 1MJUH 1FI8C 2DAVA 4LLDB 4X8JA 2PF6A 4ELDA 8FABB 3NK3A 3H9YA 4XHJC 1QFOA 3G5WA 3QG7L 4G9FB 1KTDB 4IRJC 1PU0A 1A6VH 3Q9PA 3A47A 3UJJH 1JZIA 2DD8L 3O3UN 3HMXL 3PWPD 2WO4A 4JFTA 1NDMA 2BLFA 4ZX4A 4DVRL 1R0AL 1BIIB 3RTQA 3UTQA 1EEYA 1RUQL 1COBA 2R51A 4HMDA 1S5IL 5MEND 3QJUB 2KKQA 4ONFH 3BUTA 2BM3A 3CBRA 2BZCA 1XZWA 1G7QB 2F1EA 2N3JA 5F7AA 4WK4B 3O6ML 4OV6F 3U4EB 4CDHA 1CTOA 4Y7MA 4PRNA 4YSPA 5MP6H 3V8CA 1BIHA 2B3RA 5CGMA 3Q2LA 4U1NB 3EDDA 5MEQB 3EDJA 3BT2H 2YSSB 3QIWC 4DPAX 2IWFA 1KIQB 5GRYA 2CDFA 4DUXA 4C54A 3OF6A 3QFJB 3HZKB 1QR1A 1QFUL 1RCYA 1UD4A 1V7ML 1TQVA 2OMTA 5MEPA 4RMUA 4X42A 2ZYIA 4H8PA 2C9PA 2V2WA 1KJVA 5LDSA 4DN3H 3UAFA 3VSTA 5DMGC 3X11A 1H6FA 3CHPA 1JN6A 1A3LL 2Y3AA 3W1ZA 2D0FA 3RIAK 3CHSA 2N59A 2WZPA 1ORQA 1H5BA 4JFEA 1JPFB 3H3PH 1SYVB 5L7XL 4K0OA 3IFLH 1Z9SB 1YLBB 3P30L 2RH0A 3S5YA 3TO2B 5FYLH 1CGSH 5FO7B 3VCLA 1K2DB 3D33A 4ANUA 4GW1A 3I6LD 3QYMA 2ZAGA 1A7PL 3LHPH 1KLFA 1K4CA 3AABA 1PIGA 5C6TH 4HAKA 5DVNA 4AKPA 4J2XA 1E9PA 1NCAH 3CDGA 3QQ4A 5DA4A 1AZVA 2VLLA 3CIAA 3P73B 3UTPE 3D08A 4LHUD 4D0BA 1PDKA 3V6ZA 3DGGA 4UQIM 2ZOLA 4OGZA 3B2UD 1EGJA 1IAIL 4MRCA 4PJCF 4K7PX 3ARSA 3LIZH 3CQFA 1PX4A 4L8SB 1SUHA 1I1RA 3Q06A 3ZLQC 1OE1A 3K6SA 2WQXA 2OMUB 4ES9A 2B9AA 1UM6H 3LZFL 3ML9A 3RRQA 4OZFH 1MIML 3SE8H 4IBYA 1EXHA 4GG6B 2ZCKH 5C2BL 4ZZKA 3G6JA 5D1ZD 3MUUA 5FV1L 1IC5H 4J8QA 5AB2A 1N64L 1KCRH 1ZAGA 2K3TA 1AHWB 2Q1EA 2PXYB 3PV6B 5IFJA 1AKPA 4ZOBA 2HSIA 2WQAA 3C5JB 4XMZA 4M1CC 3SGDI 2ATAA 5HD8D 5D9SB 3L1OH 3FCUB 1MCPL 3M7FB 4YK4C 4DCQB 5CEZD 2WYZA 1O75A 4JM2F 4O4YL 3V0FA 1X5AA 2NXZB 4UINL 2A6JA 4UNVA 5CEZL 4B41A 5JQIB 4QTIH 1A64A 3VXPA 3MLZH 2BIOA 1T5KA 3U9UA 2NX5B 2P7TB 5A16A 4HZLB 1U8QA 3O6LL 3TIDB 2XWXA 2GBUA 3MVSA 1T0NB 4XP5H 5D7LD 2P8LA 3D06A 5BOPA 4JQXA 2IG2H 5DK2B 4Z23A 1JTTA 1GOHA 3GZOA 4Y8AA 6PAZA 4M5TA 4ODVH 5F6HJ 4GW4A 1B2YA 3CUPA 3RWIB 4B7IA 3OHXA 4LEBA 2V5MA 4XC3H 5ANHA 4W9LC 5JW4R 3TEWA 3FOMB 2OTPA 5DCCA 4G7VL 3U79A 4QHKJ 5I6XC 4GAJH 3T2NL 1G7IA 5DD0L 1S3KH 3F05A 5CKGA 3GMPA 1P5VB 1T6BX 5DDHB 3VNYA 3P0YH 5I66B 4FKHA 1R75A 1QRNE 4FMVA 3D8MA 4EIZC 4GIAA 1N5AB 1QZNA 5MP6L 5FGSA 5MENA 3JYCA 4OJEH 4JVUA 5T1DL 5CBEB 3QUYA 3RWHA 5JIKA 2W80C 5CEYB 3TS8A 2D8KA 3NAAH 3O4LB 4JUSA 1MCWM 1IEAB 4RX4D 4XAWH 4LCWB 2IPKB 1N70A 3ZSSA 3AT8A 2G3NA 2KUTA 4O00A 3SDDA 3UOAB 5B1AB 2D2OA 2NYZA 4NZ8A 1T1YA 3JTSB 2XHNA 2L7UA 3PLYA 4OUUA 5FKAA 1HH9A 3FUIA 3SDCB 4OCRL 3NTCH 4H44C 5LAXA 5J13B 4NKMA 2FR4A 2QVMA 5KANI 1DBAL 2WQ8A 4JKNA 5I19H 3LV3B 3CHOA 1F97A 1MHPH 2ADJB 2X7LA 2XTLA 2DJMA 3NJFA 5HJ3B 3TFBA 2EIZB 4X9IA 1Q0YH 3W9DA 2HPTA 4S2SB 4H88L 3V10A 2QEJA 1XSJA 3A24A 1GGCH 4JE4B 5C0GA 3WNOA 2G2NA 1XCWA 5INDB 3INUH 4XWOC 5KJRH 5IB5B 2B5IB 4KRPD 4QRPD 1AQMA 2PTTB 5E08L 3GK8L 4ETQB 4OZGE 5I0YA 1NC2A 2OYMA 4L4JA 2Y5EA 2A1WH 4QRQA 4Y89A 4UQBA 4YHKH 2OTUB 4RA0C 3ZDYB 2H0PA 2XBTA 4ZS7L 4AMKL 4ZUTB 4ONHA 2NPLX 4PRPA 4NQUA 3UTTB 2F19L 4FFZH 2NQ3A 2DJ4A 3GNML 3QXAA 4QJ4B 3QCVL 2WOBA 3ILDA 1QEWB 1KXVC 1MI5B 4JRYB 5ACZB 4FQIL 3EJZC 2FX8H 5D7JA 1G7JB 7PAZA 5HPMA 1TZAA 1U8IB 4M8UA 3V4LA 2FEDC 2WBJC 4WUKL 1OSPH 3SQBB 1MJUL 4Q2ZB 2LHAA 3IJEB 2FYYA 5H2BB 1S7XA 2JKXA 3IN0A 4MA1C 2D7MA 5AB9A 1F2QA 4JFVA 4HWEL 5TQ0L 1C8PA 1DSFL 1TITA 1VFBB 3BDBA 4P4KC 1F02I 3I02A 1R3KA 3I6KA 1JPSL 5FDWA 4ETQA 2XBDA 2AQNA 4NC1C 4RESB 4Z78A 2CR3A 3T65B 4EDWL 1N12A 3FDWA 4XNYH 4JQIH 1GY2A 2D3NA 1D7DA 4AI7A 2P5WB 2C9UA 4L8BA 1AHWC 5FGRA 4PP1D 1SMOA 2VW6A 4KMTH 5D2LA 4ZXBC 5DA0B 4OFYD 3FKUS 3UTZA 2XACC 4YFLI 5BOZG 1JVLA 5KJ4A 3BPNC 2BWQA 5A2LH 4A7UA 3FQXB 3D85D 4O2FA 2IQAA 5CJOH 2K7PA 3WFDL 4Y5VB 3S98A 2ZOTA 2X3AA 3Q2WA 1Y6NR 2OL3L 1AZBA 2VERA 3WGVB 1RJCA 3O3DA 3SGEI 2ETWA 2ED9A 2LVEA 4JRLA 4APXB 2PYEA 4FMKA 1ZK5A 2PR9A 2YLKA 3SDYH 1M7XA 2QKIA 1X6NA 1DZBA 3BQUD 43C9A 1OGTB 3MPCA 4ZQKA 3FC8A 4MA1B 4HZAA 4HH9A 3NPSC 1SFDA 3FH8A 5HI5D 2IPKA 4HCFA 5C07D 3NJVA 1IL1B 4F3FB 4TOYH 4ZAKB 1ZCRA 5GGTA 1T3FB 1FLTX 1G1YA 5SX5H 1XCQB 2QADC 5L8JB 1U8HA 1EO7A 5AZUA 4QHLB 5F72S 4RGNB 1HSBA 3KXFA 4PJFF 1VEOA 3KPRD 4YDIL 3GMRA 1CDBA 2G3MA 1AZRA 3QZBA 2WZAA 4U05A 3MYJA 4NO5A 1FJ1A 3TV8A 1NAKL 1E43A 1OOAA 4G6ML 1KLGB 3DECA 2JB6B 2VMDA 4KU1A 4Z7QE 1BQRA 3DPDA 3FTVA 1A8ZA 4M43H 5IFHH 4P2OD 4JHAL 3NVQA 1W8EA 1HXMA 2DQDH 3VVVA 3M88A 3DDFA 3VG0H 3N9GH 2Y72A 5KBNC 2E4FA 1JGVL 3VI4E 4FG6C 3LOWA 4OBRA 4XCNA 5I5RA 3H9ZA 4X7EC 1QI3A 4NQVB 4PJCE 1GZPA 3CDFA 4FTDA 4HG4K 3T0AA 2WBXA 4KVNH 3WNLA 2Z8WC 3FO1A 3CFBB 4TTDC 4JN2A 4ZSOB 2EIDA 2I85A 4CMMA 5B7EA 2Y2TA 4Y1AD 2UY7B 4UMGA 1MREH 1S9VB 3MTRA 4P2QB 2AZAA 2WXFA 2P44B 3QO0A 3GO1L 3ZDXB 4L0ZA 1F41A 3JV5A 2XJLA 1TPXB 3V4PL 4R7LA 3WEOA 1U3HA 1DQIA 3PIQA 2OJEA 3T0DA 4H1LB 5JIDA 3QDGA 1YVLA 1NDGB 2J2ZB 3UBXI 4NPYB 1RU9H 2VDLH 3BSZL 5IQ7H 1DVSA 2DDQL 4N8UA 4DGIH 1KWKA 3LKSB 3IB4A 2EH8H 4QOKB 1CURA 1B0GA 1MW1A 2IWEA 3O6FD 1NH6A 3V6OC 1KDJA 3NCMA 5DJXB 4KK5C 5DMKB 4W9GC 4YAQB 4H26B 1FH5L 4RMVA 3UAAA 3V5HB 3AGVA 4M9PA 4GW4B 4TUKH 1FG2A 1MFDH 4Q89A 2YD9A 5GZOA 5IREA 4KO9A 2B3IA 3TM6A 3BLKA 4I2XE 5CO1A 2JB6A 4NC2B 3TFKD 3BIAX 4JFQB 3TJHD 1J5IA 2ORBH 4U1JA 5D7EA 5AYTA 4UZSA 4J1UA 4XC3L 1QEXA 1CQYA 5FGBC 5TF0A 5SWSE 4Y19E 1QNZL 1T0OA 2D9QB 1CFVL 4AKQA 1HXYA 1J1PH 3DX2A 2F18A 1JWSB 4PWHA 3PGDA 4ZPTA 4PJCA 1A1MB 3OZLA 4KTGA 3REWB 5J7CC 2APBA 4IGBC 1QW9A 4M5ZH 4DK6A 5BXFA 4L3EA 4FQHA 4RAUB 2NX5A 4H8WC 5A6MA 4ZMZA 3WL9B 4PJAB 3W9EA 2EH7H 1DUYA 3KBFA 3MRGB 2VLJD 3MC0A 3SPCA 3VGHA 5L88L 1OAYH 1AR1D 4R9HA 4G83A 3PF2A 5TJWK 1C12A 4DOHB 5C0DB 3RY6C 4NI6A 4A2LA 1XGPA 1O6SA 5IF0B 4XNUH 4U3CA 3DSNA 1K9TA 5AKTA 2JVUA 2PPEA 4YZFF 3H1ZA 1MJ7L 4GUOA 3V8OA 5ICZA 3KXFE 3TA3B 1YEJH 1EFQA 3NJHA 1WWCA 1X5MA 5IR1B 5EU3B 3B56A 2O4EA 1UB5B 3DJSA 2LU4A 2YPKB 4OD1H 2VXQH 2ICEB 5EBWB 4LCCC 3GZQA 1NLBH 1OT1A 1QRKA 4M1DH 4QRUA 4Y4HB 1TKWB 3VD1A 2HWZH 4S1SH 2VGLM 3NG5A 5E5MA 2VN4A 5I6OA 3R06B 3RFZC 2BVQB 3SKNB 1A0QL 2YOAA 3LAFA 2YPVA 1TPXC 3I02B 5K1JA 4JG5A 4QRRA 2HJKA 4I88A 1NAML 4H1LH 1UVQB 2GPZA 4XB7A 5F89A 3RVWD 3HCVA 5GGQH 4RAVA 2MRYA 1IAKB 4PJ9D 4WW2A 1CFTB 1IAII 4YPGB 3QRFM 3PWJA 4W81A 2ZKYA 3X3GL 3IJHB 4GLRH 3DARA 4X4YB 2K45A 3B8SA 4F7PA 4UV7H 4QTFA 5JPMC 2CHNA 1QBLH 4UT9A 5C6PB 1NCNA 2NNAA 5FO7A 5LXVA 3E9TA 1RURL 5B7FA 2N1KA 4JANA 2O6PA 2YRLA 3QYCA 4RBPH 2EUZA 3PXLA 4IM8A 1MPAL 3TBTA 5C0NC 3MKKA 1FC1A 4HPOH 1FDLL 4AY0A 1N18A 4MDIB 4X4ZA 1CDUA 3MLRL 2WPGA 5CSGA 5I19L 1OSPL 4MD0A 1QASA 3CZKA 1CUOA 1P84K 5E6YA 1T1WB 1RUAH 1PAZA 3C87A 3RWEA 1FG9C 5H37H 3D39D 5IV2B 4PJEB 5E9DB 3K8LA 2Y4SA 2JCCE 5T1LD 5CBAA 3DDGA 5HHOB 2W60B 3Q2CA 4ANXA 4WUUB 4BFKA 4LCWE 2J5LC 3HR5A 3CXFA 3EUUA 3OAZH 4OB5L 1FZOA 1QSEE 3KPOA 2WLNA 3O6MH 1RZGB 3C6EA 3CHRA 4JPVL 1QWHA 4U0RC 5IOPB 3B2VH 2WGNB 4PJHE 2IDFA 1ZSDB 2GT9A 4A7TA 4Y7OC 3AG2B 4WNQB 3U2IA 3H7BA 5DD1H 1UENA 1WLHA 4AGPA 2G9HB 3CDYA 2A83A 1PCSA 1NMCB 1Z2KA 2ZSWA 4MMXC 4CILA 2ODIA 2D4DA 1XF2B 2R4SH 1A9EA 3ESNA 4MA7L 4HULB 3I75B 4MASA 3L3DA 2H8PB 3UJJL 5DRWA 5FCSH 3GMQB 2DPKA 1RZFH 3QG7H 3HLAA 3RGHA 2H26B 5BZWA 4NOFA 4DP9X 4NEHB 4XNXL 1X5GA 1R6VA 1NIBA 3EJJX 1WBYA 2V2XA 2PYFB 3QWQB 4JM2C 4QRSB 5CR1A 3APDA 3LZNA 2GIMA 3D9AH 4N0YH 5EBMB 3ZU8A 3US1A 1U8LA 2ENJA 4L18A 3AROA 4M5YL 5BCAA 2WXQA 5KS9F 4GNKB 2MKLC 4LCCA 1PG7X 2H2SD 3LS5L 2FWUA 3HEIB 4NCC2 1AFVH 3EDKA 4KKBD 4LLQB 1K5NB 3V7AG 2EYSB 2LAAA 3RVWC 1QLRA 3A4EA 4C59B 4N2GA 1KBGL 5C0RL 1OQXA 1AXTH 4J3XA 2NQCA 5FPIA 1K4DA 3RA7H 3CZLA 3RGVD 5LQBL 3MLPA 4APQD 4PM1A 2Z31B 1IAKA 4WW2B 4WRLA 2EDQA 1UB6B 4HWBL 5JHMA 3LJ3A 1FO0B 4J3BA 1Z9NA 2NTFA 3D7PA 4RNRB 3EOAA 2QSVA 3MOBH 5GS3A 5JLZA 2Q2EB 4AZUA 2WQSA 1DDTA 1ROWA 1GS7A 3MLVL 1CU4L 4F1ZA 4F5CE 1HWWA 5JHLH 2E76C 4JR9L 3TNMB 3H9HB 2ITCB 4HHAB 4BFBD 1CFSA 1KYOJ 1WFOA 2H6PA 1VHPA 4I1PA 1HHJB 3BWAB 3G04A 3T3ME 3WMQA 4JB9H 2AQ3A 3F7YA 5EG6C 2VRAA 4APQA 1M2OA 4MZ3A 6FABH 5KN5A 4K71C 3DROB 1JF6A 1WBXB 2V7NA 3BWAA 3NFNA 3D34A 4TLUA 4TUOB 3QNFA 4OKDA 5EIIG 1MCIA 4ABWA 1SBBA 1CLOH 3BWUC 3K2UL 5HDBB 4RZCA 2PXYC 1R46A 4GKZB 3CX5K 3QFDA 1T66C 3IRPX 3NRPA 5C07E 1R3HB 1H15B 3MLYL 3U9WA 2DMBA 3BO8B 1YA5A 3O41A 4A7GA 1CLOL 3S7GA 3RVUD 3ME0A 1KCSL 2ZPKH 5CNHA 4A7GF 4L37B 3TCLB 4OD2B 1KFGA 1YRKA 3GRWA 4HCIA 3L4TA 3CDZA 1QFHA 3QUGA 5FC9A 4PJIA 1YQVL 4X4XB 1K6QH 4FNSA 5DC9B 2E27H 3L3IB 3VB8A 2K0RA 1V8HA 1S5HA 1RULL 2BSEA 3K74B 4GEIA 4M6NH 5HSFA 4KQ3L 1X5ZA 1W0VA 5GGTL 2E8ZA 1C1EL 2HJLB 1E4KC 2X6BA 4CBPA 2HG5A 2CK2A 5ICYB 1PZCA 2LABA 5IUSA 4WI6A 2Z91B 2D2CC 4E9RA 2VN7A 1J9CT 1HHIA 4GMSH 4CU8A 3H42L 3BMVA 4NO0B 1N68A 1SJHA 2OX5B 3K72B 3KXFB 4MSWA 3SEPA 5C0EB 4NOBA 3WLWD 3G6DL 2KPWA 4AJVA 1FH5H 1ZJBA 1KJMA 1ZA3A 2H5UA 5F6IB 5A6IA 4P3CH 2EH7L 2YPVH 3K81A 4MJ4A 4N2NA 3L54A 5DJ6B 1NFDF 3U1SL 4M3HA 1LEIA 2NXZD 2WWMD 3L6FA 3H2PA 2RQ8A 3H9HA 4BK4A 4KMTL 4NPYA 2LFGA 5DVMA 4X4KA 3B34A 2NXZC 2WWMC 2YHGA 3HFMH 3K5SA 2XZQL 5JA9A 1G9MH 2WBKA 1F6FB 5EC2B 3H7LA 4APXA 3UZVB 5FXCH 1AQDB 4JGNA 1DVFC 1TTRA 4UU9B 3PHQB 2DQIL 1VZGA 3DX4A 4S1DD 1FC2D 4G1MA 3SDCC 4DKAA 1DANT 3OGCA 3CFJB 3OZ9H 2QFPA 5F7FA 5INCB 2KC0A 4CGUB 4WI0B 4XVUD 2X2JA 2H3XC 2YFOA 3HZVB 5L2KE 2QR0B 3KJ4C 1NBQA 3QNXA 4QXUH 5E9DA 3LH8A 2GSGA 2JI3A 4JG1L 1QFPA 4WCYL 1DVXA 4YL9A 3U30C 5B39B 5J06A 2DQIH 3V0HA 4GFTB 5FWRA 3MUGB 5E5UB 2N7SA 3L7EA 3G5ZB 3NAAL 4NQSA 2X9ZA 4PJ8D 3VA6A 3UZQA 5E2VL 4LLYA 4JRXD 3KDPB 4AMKH 2I5YH 3QS3A 4P57A 1M1XB 5K9QI 5SWSB 3BZFB 3GSQB 4YNYB 4ZFQA 2F7PA 1YHPA 3RWDA 4MDJA 3V0IA 1N5YH 3FQNB 1OY3B 4Z5RA 1TCRA 3N9GL 3VYOA 5HDWA 1KNOA 3BVNB 1L0YA 4TSCH 2NY6B 2H6OA 4CN1A 4UQ2B 1SM3H 3NOIA 2X4OA 2X2HA 3IDXH 4GAGL 4AGOA 5E2TL 2OSYA 1BYPA 1QBBA 3MLRH 2ZSWB 4UM8B 1JNLH 2FX9L 3HCVB 4Y1TA 5F9JB 3ATAA 5FO8B 3MNVB 3V5KA 1C1EH 3DUSB 3QUMB 5LGKA 2B4CC 3S0PA 2ARJQ 3NH7L 1P2CA 4XPHL 4IHOA 1EMTL 2K70A 5FWQA 1WO2A 3B8YA 5DQJB 2Y7MA 4AL8H 1ODAA 3TN0D 1ZPLA 3N40F 3OSVA 1BMGA 2NX5D 4H8VA 4KV5F 2EKSA 5KSBE 1ZGLB 3ARBC 1HSAA 4ZX6A 4JL2A 1H3XA 3VI4B 3TZVD 4IRSA 4FL4C 3FQRA 3CFEA 2KL6A 2ATKA 3A67H 4Q9QH 3PHOB 3TT3H 5EFIA 5EH1A 2D31A 3BH9B 3HS0B 5ITBH 3AXHA 1TU2B 3DVFA 2VT0A 1MIMH 1WG3A 3G6JF 2BSTB 1LD9B 3E7JA 2BZDA 4QOKA 5HY9B 2HKAA 3MDJA 1IM9B 4N5EC 5FDWB 3E6FB 3EUDA 4S1QH 4UM9B 3L6FB 2BSSB 4JQIL 4YBHA 4G7VH 4R5XA 4FG0A 3SPHA 3F04A 3O4LA 3IJSA 1ADQA 4JANB 3MRBA 1U8KB 5DJCB 3PWUA 2A0LD 4GAAA 2MHAB 3IPBA 3V0EA 1I7ZA 1BREA 1DANU 3MU3A 4XMKH 3ZJAA 1MQKH 1OP5K 2Y07L 3IS0X 3VTAA 2KDGA 2NUTB 1SHXA 4QR7A 5E6RB 3ZYJA 1ECZA 5EPMB 5HYQA 5FK9A 5FKPB 1XL6A 2UX7A 4QTIL 3DIVA 3SCMD 4I7ZC 4PTTA 3U0TB 1PPIA 1OAJA 32C2A 1BOYA 1TG8A 1U21A 4HAGA 4OZHA 5EEVA 4PV8A 1IMHC 3MRCA 5DWUH 3RX5A 5KEZA 5HHME 3DTUB 3EH2A 4J6RH 3NSXA 1IBZA 4PB9L 5T3XE 2ZJSH 3GEWB 2XWTB 4B9JA 1YNKL 4JFXB 4A04A 2QKSA 3MGAA 4H0GA 5FO2A 3NA9H 4HCGA 5DD3H 2DMHA 4ZTPH 3VFRB 2NXYD 5D7LE 4L37A 4WEBH 1F3DH 1O7DC 1QSZA 4IK6A 1OOWA 2CBQA 2CO4A 3ELAT 4JKWA 3FO9B 1ZTXH 1QA9A 2E7CA 2R2BB 4BEIA 3OPZL 3VXQB 4BH8A 4ZMPA 4FNPA 3OG4B 1J9TA 4DN3L 1YC7A 1E4XH 5D7IB 5LG6A 1CBVL 1EBPA 2XVLA 2AQRA 5CP3H 1YEDA 2PP7A 4Z7VB 1JSYA 1JWMB 2BNQB 2V8LA 2ZKXA 1ESOA 3CFDB 4M7JL 4OLYL 2VQ4A 4PJBB 5KVEH 4FTVD 3IRZA 1RMFH 4A2DA 4U1SA 5DHXB 1NA8A 1JI2A 3ULSA 1YUKB 5IJKA 3MRMA 1U2CA 2B8OT 5E99H 1GJWA 2VH5H 4JFFE 2E7BA 1AXIB 1ZE3C 4Y2DC 2ADYA 2R59A 5CD3A 3RFZB 4AOFA 1Q9OB 1X4YA 1SY6H 2V3FA 2Y1AA 3TV3H 5J56B 4X7TB 2Y1ZA 5IVOA 4K9EL 1V7NH 3FUMA 2X44D 3FU6A 1SJVA 1E3ZA 2CAKA 1KPRA 1CDCA 2GITB 1U93A 1Q1PA 2Z4QA 5K5YA 3GXTA 2WXNA 5LO7A 2CR0A 5DD5H 2A74C 3HUJA 2CRYA 2DS4A 4HIPA 4KQ3H 4Z6AT 3KLAB 3U4KA 3TP4A 1JPTH 3RVTC 4GRMB 4CAGA 5L4IA 2PTVA 4XPFH 4ODVL 1H5BB 4ODHL 4HALA 5AW0B 4TNVF 4KKLD 3QJZA 5DHVB 1MVUB 1BMZA 4QI3A 2Q6WA 5EEXA 4UQAA 2ARWA 5EBMA 3GXDA 4A6YH 3B9DA 1QFWI 5AG9A 3PPSA 4WHYG 3TO4B 2DF3A 2VZ1A 2IOMA 1FNEA 2XICA 4FQXA 2DI8A 3O3DB 4GG8A 1ED3B 3O4LE 1L7TH 4FQJH 2N7BA 3T4YA 3T6QC 4ODWB 5E0FA 3FO9A 4Y5VA 2VNCA 5IB4A 3QFJA 2DMCA 2JI1A 3D69A 4YGAB 1LK2B 3W2DH 2C3VB 3AADB 3C6LC 3HMXH 3WJJA 1NJ9A 1BM3H 3QDHA 2W1NA 3UBHA 1NIDA 4J3SA 3ZDYE 2EUWA 3NN8A 2A83B 1PL3A 5E1QA 4DKFH 1WAAF 2P5WA 4IOSA 3S48A 3ZUCA 5IROA 3VVWA 1IM3D 2EIZA 2C4XA 4CVUA 4PV8B 4EZMA 1AQKL 4UTAL 4PD4J 1FZOB 3MRKB 1ICTA 1FVDA 2VXTH 2YO3A 3ATBA 3ZE2B 3MREB 3ABGA 5JUEH 2WTRA 5E8DL 2Q3AA 4JM0A 2E4TA 1UJ3B 2CGRH 4PLKD 1NC2D 3KLQA 1OAYL 1T1YB 5D2NA 3KWWA 4GW5B 4TNWK 2HMID 1BJ1H 1KLGA 1UXWB 5IESL 1AY1L 3GJFK 5CN1A 3E3QE 4N2MA 4IDJL 1JS4A 1NEZA 3MRQB 4O02H 4KC3B 3GSNH 2QQLL 4U1MA 5IW1A 2JJWA 3IFOB 3GIVB 43CAB 4KXCA 5CIPA 2WNWA 3SQOH 2EVGA 2CHZA 4NO3A 5K39B 4Z0XB 2OR8A 4H40A 5EIIA 4LLVB 1EERB 4HIJA 3IKCA 3JTBA 1E7UA 2QT6A 4BSVB 2EXTA 5JHDA 3S37X 5L7XH 4K94C 3J8F7 2DIJA 3LKPA 3S37L 3DX0A 5CN3A 1YY9D 3IDNA 4HS3B 4EDXB 5I71B 3RL2B 2QTEA 3BRDA 3L3OB 1EJOL 1SDDA 1M53A 1ZLUK 4P0DA 5HJGA 4A2FA 4JDEA 2XWRA 5D1QB 5DR5H 2BNQD 3HPLA 3SDDD 1ZKAA 1R4XA 1VADB 1BBDL 5BUGA 2K8MA 1CIUA 1HYSC 2CIKB 3DNKA 1TDQA 3CLFL 4KI5E 1KJ2L 3LXCA 2DWDB 3EW3B 4NN5B 3ULUD 1ZGLA 2WNGA 5GGRB 1EAOA 1JHTB 2EQDA 3PHQA 3ZTJG 1IGTB 1L7TL 2ODHA 4TTGA 3ASWA 4QY8A 2G5UA 2NY5H 2RALA 1F90L 3BAJA 4LSUH 4MQSB 2YQ3A 3PP3K 5KJRL 4H7VA 3BGFC 2IH9A 4OGAD 2GVYA 3MLTB 5F9OL 1X6LA 4YSDA 3FT9A 3TCTA 1PQZA 1UYWL 1A7RL 4GS7C 3IBOA 5KS9B 2F7OA 1UD8A 1GC1C 1Q0EA 2NY3C 2ZG3A 1NUNB 4NM8L 1HHGA 3B6SA 1E8ZA 5GRUH 2X4NA 2D7PA 3OZKA 5DK0B 2W0KA 3RJQB 5D71L 2XU9A 1J88A 2ZX7A 1CIDA 4XN9A 1JNHB 2BRQA 3BZFA 3GSQA 3HNTH 1CCZA 5TE7H 3LNGA 5BRQA 3FRPA 1OF2B 2GJPA 1IGFL 3DXAD 2ICCA 3MN8A 4XP5L 3TO4D 3VRJB 5EUKB 5TPWH 4PVNA 4GSQA 3G5YA 5F44A 4L3ED 3VFNB 1FHNA 2F53B 3FB5A 4K4KA 1GZQA 4HCRA 3OXRA 2BOLA 3CNKA 3MODL 4GMSL 3KWWB 1A6ZB 1BAWA 1MCPH 4GW5A 4KKRA 5ELIA 4BZ1A 1A9VA 1CXLA 3CZFB 4TNWF 1EWHA 1ETZA 2GTQA 2WTRB 1OCCB 5GPRA 4URTB 5FKAB 5C09A 4GG6E 1UT1A 3QIWA 1XAKA 2L8AA 4HJ1A 4PY7B 3VXRB 4L3CB 4YR6A 4JW3A 3C09C 2RB8A 4KDVA 1DVQA 1DR9A 2UZIH 5E5MB 5AW9B 2KLRA 5I73C 3M17A 2JJVA 1FZJA 1C16A 1JZ3A 4QPEA 1FAIL 4UB0L 2CDEB 2BS71 4EZJA 2FIKB 4M48H 1WRFA 1CG9A 3KNBB 3BRFA 2NY0C 2R1XA 2X10A 1MLBA 2VABB 5EO0A 2Z3FA 3HLAB 4YUEL 4ZUWA 4ETYA 4NX0A 1ERNA 4OM0H 1OB1B 2PCFB 5DMIH 2R0WL 3DURB 3U6XS 4MMXA 4HUUA 3GQFA 4ZD3H 5EUOB 5TH2B 4GQZA 4U3HA 2AW2A 1W9XA 2WBJD 1XGTA 1EA9C 4G9DB 3QDGD 1S7VB 1WCBA 3CN4A 3FTUA 4ABQA 2Q6WB 4BWWA 4DGVL 3CFCL 4EUPA 4MA8L 1DZ0A 1WAAE 1I3GH 4LOFA 2CLVA 4PIRF 3GB7A 4BGDA 3BPOC 3OKKA 1DJHA 2N01B 2W9DH 4R2GC 3BP4A 1QD0A 2EYSA 3AVEA 3LZFH 4GW1B 1WAPA 4MS8C 4EUPG 3TVMB 1BW8A 4CC1A 5DC4B 3GFUA 3BAWA 3BP7A 2J20A 2YGNA 3LNEA 3TNNB 5C3TA 1DVFB 2GHWB 4ODSL 1IGJA 1T5WB 3UH8A 1XIWA 1SM3L 1SGKA 3VMNA 5J12C 3F00A 2ICWJ 4FQ1L 2FGWH 4EBQL 3BZEB 2A6IB 2J4WH 1YY8A 4M8VA 5DEJA 5DEFB 3GNMH 4HKZB 4NRYA 5IBUG 3WENA 3OKNA 1QLEB 2X9WA 4YHIB 3QQ3A 2H47C 2BS8A 5ES4B 5AZ2H 4HUVB 4IMLA 2OXGA 2FX8L 3LPOA 4KVCL 4Y1AE 3N0PB 3L4ZA 1EGJH 2JKLA 5GGSA 4PUBL 1W2KT 1TYEB 2R0LL 4FNUA 4UTBH 1MW0A 1CPUA 4PW3A 1CI5A 2V7NB 3NFNB 2ZP0T 3RU8L 2GJ6A 4MB5A 5I8KL 3INUL 2OS7A 1I1YA 2C9XA 4U1LB 4YVNA 5DC0A 3V55A 3MBXL 2JJTA 4WEMB 3FQTA 4Y2DD 4NRXA 3HR6A 4BFGA 1U2HA 2KLTA 3F62A 2VDRB 1RZIA 1USZA 2A9CA 1OCRB 5F1IA 4F8QA 5IB3A 2ZOUA 2HPOA 2O5YL 4PJXF 5EN3A 3AQZA 4ONOA 1DJSA 1I75A 4YHPA 5AAMA 4N2KA 3D51A 4XNZC 4ZMAT 2HJKB 25C8L 5I6KA 5H94B 4JHUA 1JZ8A 4UOQA 4JZJC 3M7OA 1ITCA 1DVFD 1CICD 2GC4C 1Y07A 3HI5L 4RWYH 3ISYA 4LLUB 3F6JA 4LKCA 4YHYB 4OIBA 3KPLB 1SDDB 3OQRA 3WD5L 5IWLA 1HZLA 3EYFA 1OAXL 3EYSL 3FH7A 4DP7X 2WKLA 1SYSA 1TVHA 4M56A 1JPFA 4XCNB 1HK6A 4F7MA 3B9EA 1RIHL 1R5IB 3GBNH 2BNRA 3QR0A 4UUJB 4ODUA 2ADGA 3F7PC 5F97E 4F57H 5I0VA 2FBOJ 2IH3B 3HAEG 2VLKA 2H3KA 4GRWH 3UMTA 3SYOA 4BSJA 4MXQD 2OMTB 3SY0A 4KOBA 2BP3A 3LS4L 4HC1L 3DV4A 4ZZFA 1A7OH 3HG1B 4AYSA 5FS5A 2G0LA 1MLCA 4FQ1H 4PJIE 1ZVHA 1CE1L 2DQGL 3PWUB 1YJDC 4JFUA 1U8HB 4UOJA 2KH2B 3O3BA 4M7KH 2IDTA 4PFEA 2B7DT 3ZE0E 4EI0A 3MREA 3QJHB 5KOMC 1J8HD 2BSRA 3WNMA 3S88H 1P7QA 3O3EB 4LDCA 4WEUD 5CJQH 1DFBH 2IPTH 5GRJL 5IOPA 3O8XC 3MV9B 5DD3L 1U93B 4YDLB 3ARTA 4JFOB 1LO4H 5EOCJ 4QY8B 3K4AA 3OAUL 3T0EC 1N10A 2XDHA 3ARDA 4PJDE 3FCBA 1AE6L 1UWFA 4NHCL 3WEXA 5AKVA 4RGMB 5LDUA 1JK8A 4P46A 1MH5B 2CHXA 4FD0A 4ZMLA 5DRXA 2BP0A 1N9PA 4K15A 3A67L 5T5FA 4NUJB 3E80A 1WHPA 5ALCL 4PJEA 3QUXB 2VRKA 1D5ZB 4WKZA 1JWUA 4N5ED 1OF0A 3ZGIA 4ZS6D 4WLCA