3BFQG

Crystal structure of truncated fimg (fimgt) in complex with the donor strand peptide of fimf (dsf)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
132
structure length
132
Chain Sequence
AKPCTVSTTNATVDLGDLYSFSLMSAGAASAWHDVALELTNCPVGTSRVTASFSGAADSTGYYKNQGTAQNIQLELQDDSGNTLNTGATKTVQVDDSSQSAHFPLQVRALTVNGGATQGTIQAVISITYTYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein fimG
publication title Infinite Kinetic Stability against Dissociation of Supramolecular Protein Complexes through Donor Strand Complementation
pubmed doi rcsb
source organism Escherichia coli str. k12 substr.
molecule tags Structural protein/structural protein
total genus 24
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2007-11-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 3bfqG00
4AUUA 4AV4A 1QUNB 5IQNA 1KIUB 5FLUA 4XO8A 5FX3A 2XG5B 1ZE3H 4XOBA 5ABZA 3ZPDA 5FWRA 2J2ZB 4XOEA 4AVKA 4AVJA 5AALA 3RFZA 4AV0A 4X5QA 3MCYA 4XODA 5AB1A 3BWUF 4AVHA 2JTYA 5LNEA 2W07B 3ME0B 5F3FA 3SQBB 2UY6B 5AAPA 4AUYA 2JMRA 5IQOA 4CSSA 5IQMA 4XOCA 4J3OG 3ZL2A 1KLFB 1N12A 4X5RA 4CA4A 4J3OH 4BUQA 4AVIA 1TR7A 4ATTA 2VCOA 4AUJA 4J3OF 1UWFA 2XG4B 3JWNE 4X5PA 4AV5A 4XOAA 3BFWA 5LNGA 5CGBA 1PDKB 1N0LB 5FS5A 5F2FA 4CSTA 4X50A 2WMPB 4XO9A 3JWNG 5JQIB 3JWNH 4LOVA 2UY7B 3BFQG 3ZL1A
chains in the Genus database with same CATH superfamily
4A7GF 4NOFA 1NBCA 3K71B 5F7KC 3L1GA 5DO2C 1T6WA 4PV9B 1FPTH 3RFZC 2X6BA 3EJYC 1HE8A 4PJCB 2Z8VC 2Z31D 3L6FA 1QFUL 2BXZA 1UB5A 5DUPH 4U6HA 2Y69B 1NJ9B 2AEWA 2KPNA 4RCAA 1YY8B 1RJYA 3ILEA 4KJYB 2VDRH 3BPOC 4LNRA 2AQSA 2AS5M 2ADIB 2DEXX 1TJGH 3L3HA 2DIAA 4GRWB 4YFLF 2Z34A 1JUFB 1NIBA 1B3IA 4JL1A 3BKCL 4YWGH 4I18C 4UOW0 5F7LB 3L4XA 4LSSL 4MX7B 2ZUQB 3MV11 4PIBA 4AEIH 5FF6A 3ZMEA 3JV5A 2E5EA 2ERJB 3HE7B 5LGYA 1SDYA 1HH9B 4WW1A 1YSOA 5CD3B 4TTGA 3HR6A 5F3FA 4MXWL 4DTGH 1G9NL 3G08B 3UZVA 2VC2H 2AJYL 1I8MA 2WAQA 5IQ7L 3GB7A 4WKZA 3T0EC 5C2BH 4HU8A 5CEZH 4NC1C 1BFOA 4XCYA 4NIKB 4K9JA 4PHZA 5I0WA 2ED9A 2J6EL 2EDQA 4DP1X 2WCSA 3R18A 3QNXA 4KK6D 1IARB 1KGYE 2NY4D 4XGZA 5D2LF 1JNLL 5DYOA 2R1XB 1U6AL 4LCWD 3VA6A 3I6GB 4G7SB 3VQ2C 1L0XA 4HLZG 4TQEL 4UM9B 1A4AA 5JXAL 1A9BB 4N90E 2YEZB 3PP4L 3KLHD 4PIRF 1KBBA 3HMXA 5MP6H 1CBVL 3VUAA 3UACA 2B2XH 4AUJA 2GTZB 3DK2A 3BVTA 3ZDYE 1U58B 4AITA 1IIKA 2IDCA 4JZJC 4WJG3 1CLVA 3UTZB 5K93A 1T0PB 1DBBH 3W56A 1U8HA 1WBYA 2AQRA 4NZUL 2DLFL 3G5YA 1Z5YD 1DYZA 3MKGA 1KYOJ 5FYKE 1GGYA 1PG7X 1XCWA 4HPYH 3UO1H 4R26H 2X87A 2AV1B 3FUNA 1D9KD 2BPBA 5LCVL 2A73B 4DAGH 2OYMA 4Z7QF 4FL4C 5EOCH 3U7YH 5CILH 4XVTL 9CGTA 3GSOA 3MA7A 3T8MA 5EO0B 4XP6L 4LVHC 1IGJA 1N0LB 1FNGB 1YHPA 5GRUH 1FYTB 4ZW6A 2APTA 4KX8A 5E99L 3TL5A 4OGZA 1CDJA 2X70A 1N70A 1P4BL 2YKLH 3F7KA 3QH3A 2F58L 3B6SB 2G2RA 1UM6L 3F3HA 2D9CA 3C5ZD 4JFYB 4UDTA 4WK0B 5FO7B 1BF5A 3GXNA 3EO0A 1L9SA 2PETA 4LLQB 3CSGA 5EZLA 3WI9A 1BJ8A 1T7YA 2V3DA 4KXZI 5K69A 2YAQA 4HS6B 1KN4L 4X9HA 4Y2LA 1M6OB 3FCBA 3STLB 2X7LB 3RUGE 3M1CA 3W0WA 3IU3A 4OI7A 1X9UA 4KROD 2JKNA 2YD2A 4ES8A 1H3WM 3IDIB 1Y18A 3P3SA 1T83C 3IK2A 3G3LA 4XTRC 5D1ZA 1PBYA 4KQ0A 4E9TA 4OZGB 5CJXC 3WE6A 4WEBH 2VYRE 3B2XA 4A2HA 4LASL 3FBQA 3G6DL 4HT1L 4OLEA 1AE6H 2D3JA 4JFZH 1JDAA 1LMKA 4DZ8A 4HV8B 2C9RA 3D85B 3D3VE 3KGUA 1NPUA 4OF8A 1QAWA 3CX5K 5DD1L 5DJ0B 4ZMLA 5AW9B 1AHWB 1AXIB 1BECA 1KJ3L 3ZTDC 1H9DA 3S5YA 4LLAA 3P3YA 1S9YB 4KRPB 5D1XD 1A7NL 1P1ZA 1BG9A 3NA4A 1JHKL 5B1JA 4R7NA 1JGLL 3T4AB 1BBJB 4BA8A 4NENA 1F8TL 3K6OA 1GS7A 2VISB 1F6LL 5DQDL 3H2WA 4XP1L 4NNYA 2VSCA 1YLBB 4FS0A 3PWUB 3TZVC 3AW5A 3L9EA 2FX7H 1I3GL 3EGSB 1M2VA 5G4MA 3WLBA 4L9LA 4BFGA 4XPGH 3UTTE 2A9BA 2XRAH 2X4SA 4DNLA 1J05A 4NCC2 3QCUH 1HHHA 1KCLA 2CBPA 3FU8A 2DLTA 3QJHA 4KY1H 3SE6A 4LEXL 1U91B 1JWMA 1V8HA 3FO0H 3GIVB 3O3AA 2EIDA 3MC0A 5AYQA 4K8RC 1EGJA 1B9ZA 2DQGH 5I1LA 1PQZB 1WFTA 2ESVE 2NNRA 2VOTA 3TF7C 3S8GB 5I18H 3DSNA 3VGDA 5B8CC 15C8H 3HHMA 4ICXA 1NUNB 4XB3A 1W2KT 4RH4A 3OGOE 4P3CL 3T09A 1GMIA 4NBYB 2HH0L 4KH2A 1EHLH 4P2OA 4HWNA 3ILPB 3GSXA 4A66A 5C92A 1INQB 2WINA 3N44B 4PJ8A 4JO4H 3EZ8A 4P07A 1OPOA 1SOSA 4C57C 4Z3TA 1DL7L 5CIPB 3ESMA 5I30H 1FI8C 2J8OA 4BCZA 1UHVA 5E70A 5IOPB 4EOWH 5LKNA 4AK2A 4K3JH 4X8XA 2NNFA 1RVFL 3IMBA 2F5AH 4R7XA 3V8CA 4F93B 4KKQA 4AW7A 3RWIB 4NHUB 3JTSB 1YUKB 4AXWA 4PJDF 5HYJE 1ROWA 4Z7NB 2PYEE 2Z4QA 3KJ4B 3WEXA 2VDMB 1PFCA 1IEAA 3U4AA 3X1GA 1XCQA 2DTML 4OZFB 4RGOH 1RK0B 3B9KB 1KTLB 1IC5L 1ZDQA 2XWBA 1BZ9B 4F8LA 5ISZA 5EB9A 1RUKH 2DWEB 3BUPA 4N0FB 4PRID 1JS4A 3G04B 5CBAB 3HR5B 3BE1H 1OB0A 3NIDB 4PLJD 1ZE3H 3REVB 5C97A 5DHEA 1Y6MR 1I7ZA 3RVUD 2NDFA 4LLUB 1TJIH 3GPSA 1BPLB 1EA9C 3QUYD 2CKBL 3P77A 3WJLC 5ESAB 2FECI 2H3XC 1F1AA 4YDKH 5D96C 2BM3A 2GY5A 2YK1L 3P73B 4NJAL 2QADB 1AS6A 2JXMA 3HN5A 3JWOL 5AD0B 1NGWA 2CIKB 3BLPX 3BWUF 1K8IA 3UBGA 4IGBB 2JTYA 5KSBE 3UDWC 4ORGB 1ITCA 3GBNH 1FZOB 5K39A 2BFGA 2DW5A 4K73A 4FXGA 4J4PD 3Q8FA 4XNQA 2XN2A 2Y06H 2VW6A 2HFEA 1P4IL 1F6AB 2NY3D 3B9AA 3HG4A 3QDJD 5DVNA 1HOCB 1QBLH 3OKKA 5GRZA 3NJFA 1NM9A 4Z5RB 1V27A 3IGAB 5EORH 3BPCA 5L9DH 4GRMA 5EC2B 2GBTA 3GSWB 5A2KH 1HI6A 2BH0A 2NOYA 2NUTB 3MNWA 3QIWC 5IUSA 4PJHE 2P52A 3LS5H 1CG9B 1JV5A 2O5XH 4GAYA 4FJ6A 3TA4D 3QUZD 4NO0D 3R0MA 3WMPA 2W92A 3LNFA 4MQ7B 1WYJA 1RK1B 2XKNA 3HG3A 2R8SL 2CM6A 2VDPB 1BJ1J 3EFOB 5F93C 1OL0A 1YEHH 4P4KA 2XN0A 2H8PB 3P9LB 4Q89A 3KD4A 5CKAA 4AKOA 1CF8H 1YYCA 2VLRD 3WDIA 5KJ4A 2BSBA 1AH1A 3AAZA 2WUCL 1JF5A 5A2IH 1XL4A 3ISYA 3T6WA 1JK9A 1L3WA 3F01A 3K46A 4G6AD 1MI5E 4HJ1A 4JM2A 1ETA1 4KFZC 3IRZA 2Q2EB 1GGUA 3BAWA 2R0LL 4ELKB 2BRRL 4A63A 3KNBA 3V0DA 2WQVA 3QPKA 4PCSA 1OGAD 4MWFA 3EYUH 1C5CH 1A4JA 3D7PA 4L8SB 3A22A 4XVJH 1KCRH 1ZD6A 4F7PB 4MA3B 4NUQA 3MLPA 2Z0UA 4KO5A 5ADOH 1CXHA 1XR8B 3U0TA 1FCCA 1HDMB 2G5UA 1YMHB 5JHDE 2J6EA 5AW6B 2O6PA 4L5FH 1T04B 4QXUH 4MFHA 5JZ7D 1NEZG 1UB6B 4Q58C 1KACB 4LSPL 2EVJA 2H9GB 2WNKA 1EH9A 2UWEB 4N1EA 5E5UB 1U95B 4NFDA 4N8VB 4X9IA 1GZHC 4RAVB 2F8OA 2QHLA 5DHVH 4IOSA 1XF2B 2R2BA 1G9MC 5F1OB 2XG4A 4Y4FD 1TIUA 2DBLL 4HUUB 2JLLA 5KYXB 4NOBA 3KLAA 1DN0A 2TSBA 5ACLA 4MHHG 3N9GL 3NQKA 4S11A 3BMWA 5ICYB 2YOCA 3BDYH 1JAEA 1ZLUH 1DQIA 1B4LA 3X1BA 2EEFA 1WRFA 4GQ9L 5DMIH 4H25B 5TPWH 2CJUH 5SWZB 3V6ZA 5LCVA 1B0RB 1R46A 4PJ6A 5B22A 3OKYA 4OLXL 4RWYL 4BKLB 3CPLB 3FH8A 3H0TB 2VN5A 2JELL 4FHJA 5I1DA 2Q0ZX 3FQ1A 4DP8X 2NQCA 3MJ9H 1IC0A 3HFML 1YMMD 5AW0B 3BPNC 2XBZA 3BI9X 3OR6B 4WUKL 4PJBA 2R2HA 4ODXB 4JFHD 4DHLA 3ULUE 5I1JH 1BVLA 5DMGD 1JPTH 2ZOLA 4I4WB 3RIKA 1OCWH 4LLVB 5LXGH 4XVSL 3FH5A 3UYPA 3ZDXB 2X2JA 4Z18A 3VU2A 3GD1C 2I9TB 3WYRA 2LFGA 3ZE1F 4J3OD 1WZMA 2VZOA 2AJSH 3EHBB 4JRXB 4OFYD 3BP4B 3CZKA 3GSVA 1KCVH 1KBKA 4A7UA 2E4TA 2NCEA 3N1FC 2HAZA 1W72B 3UEZA 1LILA 1C08B 5HYEA 4WEMB 4J27A 5ETUB 1N2RA 5EIIA 4Z78A 4K3EL 4GSQA 1UGKA 5DZLA 5K9QI 4NDMB 2FIKA 4I0PB 5KYYB 2HPOA 2YXFA 1DBJL 5E8NA 3LH8A 2YQ2A 1MG2C 5IQ9B 2Y2YA 1BQSA 2EABA 3QPXH 1XBRA 1MFUA 4D0DA 2AK4D 2IV8A 2V33A 4EN3B 4Q9BA 3CCHA 2ZP8A 4PBVC 4Z76A 4ZFFA 3AS0A 5CEXA 4HIXL 4QXVA 1T0OA 2HVKA 4A55A 1A7BA 2WIIA 2E8ZA 3PGFL 4AW4A 1HHKA 3SIKA 5AVVB 1NCCL 4OLWL 2OCFD 5DTFB 3QWOA 1Z66A 2BCKB 4LSVL 4F58H 2W91A 1PY4A 2GJZA 3GHBL 5DRXB 5TF1H 5I6OA 3I75A 5FGCB 1KENL 4GSDH 3WENA 1DQQB 1KTBA 3NGBC 5IB3A 4ZUVA 4TOYH 2JJUA 4GG6E 4B27A 2B0SH 3CN1A 3QHFL 4EDWL 1U3HB 1U33A 4CU7A 4HUVB 1TQBB 4OJCA 1SDAB 2RJMA 3QP3A 1A9VA 3WDHA 3FCSB 4P9HC 3LEVL 3MNDA 4YZWA 1HEZB 3CSBA 4AEHL 4R5TA 2PUQT 4PJEF 4YDMA 3P3TA 4NRYB 4IRJA 4IRSB 1LTXA 4QAMB 2OXHB 3G6JE 3MCLH 4LPXA 2Z35B 3LVEA 3AS2A 2IDFA 4TUJA 2J2ZB 2VERA 4Z7WE 4ONGL 3GM8A 5DZ9A 3FT0A 4WF7A 5CD5D 4PB0L 3UX9B 3TWYA 4Z95H 3N55A 5HYQB 2EVIA 3E6FA 4GINA 4IM8A 4Y9CA 5IV2A 1PZSA 1JP5A 1Q72L 3SPVA 4Y0GA 3B7TA 2EH7L 3HG1A 3ZL4H 4UIKL 2F8XC 4HFUH 4OD2A 4W9DC 4G6JH 5F6IB 5HJ3A 2FBJL 2HT4C 1DVFB 3KAAA 5K9QG 1OE3A 2CRZA 3B3BA 1M53A 3T71A 1J5HA 5E2WH 1TO4A 2VLJA 4U7SA 3MRLB 1KGXA 3O8XC 4R3SA 5EU7C 5C08D 3GXTA 2UZPA 1AZVA 1FVEA 4UWQB 3C6LA 4JJHA 2OPCA 3P9WB 2VDRB 2X6AA 1S3RA 2X10A 4ZW7A 1V55B 1S5IH 4QLRA 1MRDL 3H54A 4XCFH 1VFUA 4PG2C 4LSUL 1OAYL 1GGBH 2EDNA 1AHMA 3QUKA 2E6QA 3G5WA 5AVZB 2XPGA 3P0GB 4DEPB 3K8LA 5FUZH 3HMWH 4QRQA 1U9KA 3V95A 4KVCH 1A7PH 3FU5A 1DJHA 2NX5E 3ECVA 4FXKC 3I50L 3G5XB 1VERA 3LZPA 3U6RB 2DQCL 4ZMNA 2YC1A 2VC2B 3IMSA 4EIGB 4MAZA 2BSTA 3K6IA 5K9OA 3DOHA 2J88L 1WUZA 2EDFA 2Z31C 3IAGC 4XBMA 4LU5L 4Y1AA 3KDPB 3T3ME 3NJGA 5DDHB 2A9CA 3QHZL 4AH2A 2WKOA 3H9SB 1S7UB 5IWLA 5IB2B 2CCVA 4YBHA 3ARSA 2YMXL 1HQ4B 1TU2B 2E47A 3VXMB 3VI4F 2QR0B 4ZMOA 5GSVB 4B41A 5FM5M 1HKFA 1WA2X 1X7SA 3MMEB 3HS0C 3VRJB 5DK2A 2ZOOA 3MUGA 4B95C 2D03L 5CU9A 5BZWA 4Y9EA 1LEIA 4W9LC 1EUTA 3BD5A 4NPYB 3VTTA 3BDXA 4HUNB 1ZIAA 4R96A 5DWPA 2NY2D 1AGEA 1VGKA 4AM0A 2CO3A 4HKBA 5TJWK 1KCKA 1I8IB 4F9LC 4ZUSA 1A7OL 3U0WL 2BIOA 3S5LA 1S7TB 4R4FH 3CSPA 3DMMA 4JJ5A 1SY6L 3CVIH 5E6IA 3US1A 4KK6C 2NY4C 2FRGP 3D39A 4L4VA 5I2IB 3HN8A 2WAHA 3I9AA 1FN4A 2MTAA 2QL1A 1BQHB 2EKJA 2VDNH 3B2VL 5C9JB 5D7HA 2X2IA 4N8CL 4Z7VB 3BGFC 3KLHC 2ZE0A 3AXLA 2J56A 3L3DA 4X6BA 1JL8A 3A24A 4JO5A 4X80H 2OZNA 3CSTA 2FHCA 3U4EB 3IB4A 1ZLUK 2F74A 5GRWA 3T9WA 4Y2OA 5EBLA 1NFAA 3DROA 2H6OA 3WIFB 3IFOA 1Q9OB 4FADA 4KPHH 1T20B 4L3EE 3L1OH 2A6KB 1F5WA 1VPOL 1D9KC 3MBWB 4OD1H 3RTQD 4X7TB 1KB9K 3A47A 3A6BL 2FSEB 4I5BA 5HYSB 3LN5B 5EMYA 2YD1A 4MCYB 1DJGA 2X09A 2CH8A 1JPSL 3SPCA 4YJZL 3TM6A 4IDJL 5LAPA 3DSFH 4DSYA 3SKOA 1DSYA 2X6VA 5DD0H 4EKJA 2E7LA 2YPKB 3EG9B 3OKEA 4NQDA 2G60H 1L0PA 5DEGA 1MZZA 3C5ZC 2DD8H 1EJOH 1MWAH 4JN2B 3LXUX 1DR9A 4GRWE 3VFWB 4R5XA 2BW4A 2OJZL 4R83A 5AW4B 2QQNL 2WM0A 3N5AA 1M7DB 4QIRA 3IS1X 4XP4H 4G8EB 3CFJA 3I02A 3PFUA 5DZAA 3SN6N 2IPTL 1ZSHA 3OLGA 2O5ZH 4MZIA 3EJRA 4NN6C 4R6UA 3LIZA 4RGND 3RVTD 4FA7B 2H2PD 2W9DH 3MA9H 1P4LB 1DZ0A 4PVBA 1RZKH 4QCIA 4PGDA 2JCCE 4L37B 3SDDB 3T04D 1C7SA 1IB5A 1S4IA 1X5GA 1ZT1A 1CGUA 2VABB 1VSCA 3IJHB 2VRAA 1J8HB 1N6UA 5EUOF 4L48A 3J07A 4CU8A 5E94A 2BK8A 2XTSA 2WB1A 4U1GC 5EG6C 4R97B 1J1PH 4CNIB 3KM2A 2X4QB 4P23A 4JCMA 3E8VA 5D1XC 3GBLA 4UQCA 4KDVA 3S7GA 4BH7A 1RD6A 4G1EB 3ZYOA 2AEOA 5AOIA 4DEWA 5HXMA 1B0IA 3OF6D 3BKYL 2EYRA 1U4FA 1S2EA 3UTSB 1H3TA 4KUZH 5D7KD 4GEIA 1ZVNA 2GSIA 4QT5A 5I5MA 3BIKA 4UQDA 1HESA 3CFNA 1VACA 2ADJA 4YDJB 1XR9A 2BVPA 3HHSB 5DS1A 2VXQL 2WTOA 2SEBA 4Q7DA 2VIRB 1U8IB 4FHBD 3QFJA 2EYSB 1G7JB 3WNJA 3LIUA 4W68A 2IGFL 3DHUA 1OD9A 3QS2A 1XSJA 3CFUA 5DJ8B 3PHQA 4X99B 1KTKE 4ZXBB 5KUMA 4PV9A 4U4BA 3OAUL 4H0IA 5EO1B 2OI9B 4JFDD 1RURL 4YXHH 4KJWD 2O61B 3OD3A 4PJCA 3CD4A 4YLQT 4BFJA 3CX5J 3MGOA 3AB0B 2FWOA 1PJWA 1NEPA 1N68A 2EDTA 1W8EA 2NSQA 3QJFA 4Z7UB 2A9NH 2X40A 1BVKB 3QEGL 1PYWA 2GUOB 4BZYA 1AYOA 1E4KC 5GGUB 3TYGL 1U93B 4N2HA 2VDLH 5AOMA 2GFBA 5E5MB 1FL6B 4ANVA 1NFDA 2D7PA 5JYMA 1BSIA 5E4OA 1JF6A 2FX8L 3GSUA 4MX7A 1N7ML 1HTYA 3HE7A 3QDMB 5CD3A 4OZGE 5F9JA 1C5DB 4ZQKA 2OX5A 3KCPB 3AXIA 4P46B 2BIMA 4HK3J 4PP1D 3L9BA 2DQJL 4AVIA 2WHVA 3MKKA 5HGAA 1HEJC 3AU0A 1COBA 2NY0D 2R69A 3UTQA 5BRZB 5IROA 2XY2A 1UWFA 2C3VA 5MENB 3NSXA 1OOAA 4JDZA 4MJ5B 1SM3H 1T89A 3AACA 3N1MC 3ARED 4NN7B 4F37K 2VW7A 5AYUL 4JKPH 3QG7L 1MEXH 2AJ3B 3P3RA 3I6GA 4H2AA 4QRPD 1CD8A 4UM9A 3PJSA 1A4BA 5I8KH 2BLFA 3H3BC 2EIKB 3LKSB 1PZ5B 4UQBA 1FFQA 4ZOAA 2YEZA 3RGVB 5KWYC 1SXCA 2ZD0A 1B0WA 4XCNB 2IVFC 1OSYA 1O7SA 3KPTA 1ZXKA 3EOAA 3KPNB 1AO7D 4HWBA 3EGDB 4NO5B 4PLJC 5E9DD 1JBJA 2VXSL 3N0PB 3P4MA 4PSPA 3RVUC 5JIPA 4JFXA 3RIAF 3QUYC 4FHKA 1K8DB 4OUUB 4A2LA 4KHXH 3V0AC 3WXWL 1JTPA 4H8HA 5JR1H 1QATA 2F8VA 2CDEA 2AV1A 2VAJA 4BWWA 4LCIL 4W81A 4EBQL 5F72S 1PPIA 2HCZX 4F7KA 3JUYA 2EDWA 3ATFA 2EE0A 3CX2A 1FNGA 3VGAC 2QVIA 1CE6A 4LIQL 2IV9A 4J4PC 1QSVA 5TK2A 3DPDA 1ED3B 3QUHA 3PWPB 3CZFB 4OQ1A 2UX6A 2HX7A 1IBHA 2NY3C 5E8PB 3TN0A 1ZWIA 1CQYA 3LRLA 5MERB 3FB6B 3ZU8A 3CMOH 3ARQA 1CLOL 5FKPA 1ZT4A 2VKWA 1XGRB 4C83B 3QYCA 1IGCL 4GSXA 4M5YH 2R23B 4JPWL 4FQQA 1W72L 3QUZC 1XZ0A 3GMRB 3BH8A 4FQXB 4OZHB 3C09C 4NKOB 3DI2B 4LT7A 1FFOB 4OVUA 3L5WA 5DEJA 3TTYA 4HXAL 3TTSA 1N19A 3FQUB 1CXKA 4Z7NE 1L7TL 1TZAA 3O6MH 5F9OH 1QRNB 5B21A 4P2CG 2VH5H 3BSGA 4P9MH 2W60B 3K5RA 4G6AC 5DHVB 4DETA 4LLDA 3ZIMA 4X6CA 2HLAB 3C5SA 4JQIL 5KVGH 1A2YB 3BKMH 3IDGB 2KQMA 3V9EA 2OZ4L 1YPZF 3HKFA 1CK0H 5JW4Q 1BBJA 1NBVH 4RSYA 3NIDE 2QSCH 1RPUA 5E03A 1H0DB 5DJ2B 5KW9L 1JE6A 1RZ7L 2Z1KA 4J3OF 3GS4A 1AJ7L 3QUXB 5F3BA 5IZ7A 5IJKC 2N1KA 5DO8A 1SY6A 1KPRB 4PAZA 2K0RA 2IANA 4A37A 4JRWA 1ZT7B 3CDGB 5I5RA 1X5HA 4JFPA 4NKMA 2HFGH 3T08A 1U91A 4BGLA 4DESA 4OT1L 2I5YH 5ITBH 4WUUA 4IOIB 3GIVA 2OMUA 3ULSA 1NIFA 3RLSA 2QGEA 3WU1A 2Q8BH 1KC5H 2AERT 4H5SB 4FTVA 5AVQB 5CEYA 3C2AH 1FNAA 4ZUTB 4ACPA 1KBGL 1AZCA 2W65B 4XWOD 4M8QB 1JGEA 3FULA 2PXYB 3VH8G 1H6FA 3UZQB 5FYLE 1J9SA 2B8OT 4EI5A 5EC1B 2LAGB 2N3JA 3MVSA 4JKNA 3SDXF 2FX9L 2CJSA 3X12A 4D7PA 3H55A 4P4RB 5ECGA 3ULVD 4UYQA 4FX5A 4ZAKA 2QDWA 4WI4A 4YHLH 4ZD3L 1E5CA 4WV1A 3ESPA 1UT2A 3DXAB 3TASA 3MRDB 2ED8A 1Y0LA 4Z0XB 1DP0A 1X7QB 2VL5B 2XZCH 4XAKE 1L6ZA 1SLVA 2XFXB 3KM1A 5AAMA 1HC1A 4G80A 2BNQD 1JWUB 4AMXA 4TUOB 3ARFD 5DUPL 1J5DA 4J3OC 1FC2D 3TS8A 3SKMB 2JKLA 2LLGA 1FFPB 3GMLB 5DJZA 3IKCA 1YJDH 1A3RH 1E9PA 1KXQE 1TJGL 4MAUL 3Q06A 4A2FA 4PP2A 3TC9A 1G4MA 5T3ZL 3B9KA 3C75A 4YWGL 1GR7A 4NRXB 1E6OH 4AEIL 1UXWB 2QBWA 1ZLEA 4JGUA 3VFPB 1UH4A 1IGIH 2X1OA 5D1QB 4DTGL 2OK0H 2IPKA 4X2UA 5CLXA 3HAEG 5IWLC 4G9FA 4IMKC 4NFCA 5C2BL 3R4RA 5CEZL 2P5WB 4ZFZA 7TAAA 4XOCA 1IO4C 4ZPTB 5ITFA 2UWEE 4ZDHA 4Y4HA 3TEUA 1KNOA 3JBG7 4ABVA 1FNFA 5D5MA 1KCBA 2VLMD 4XH2B 3K6FA 4C56B 5KVFE 3HJEA 3PAZA 4B9PA 5MP6L 4P3WA 5DURB 1BW8A 2V7HA 3E1ZA 2A9AA 4PTTB 4PRHA 4U6XB 4JQVA 5LBSH 1DBBL 2WXNA 4C8XA 2VQ1B 3SDAB 3C08H 2YGVA 2ZX6A 2NMSA 3ECQA 1GOHA 1TFHA 4R26L 4OVVA 2EADA 4YHKH 4LIQE 1CG9A 3U7YL 4JVPA 1RUMH 2ROXA 4HYTB 3DX8B 5LG6A 5CJ5A 4P57A 5B7FA 4XMUA 3ZDXE 3FOLA 2XXGA 4KAQH 4H8PA 3DGGB 1I75A 35C8H 2H8PA 3DTXA 4JRXE 5CD5C 5IMLA 3RL2B 5FO8B 4RISH 4MJ6B 4U6TA 2FL5B 1AOHA 3E2HC 3VXUA 1XF3A 2PO6B 2Q86A 1HEHC 4MCZA 2WTRB 3E38A 2BMKB 3CXHK 2BP5M 4BYHA 5JPNB 2CCLA 1FVDB 2OMWB 1JMXA 2GBUA 2HB0A 2KI6A 3P54A 3BUBA 4TUUA 4QTHA 1GKEA 1MFMA 3QQ4B 1NDMB 1IT9H 4L8SA 4DVRL 5JTWA 1TZHA 3UTPD 5C3LD 4ZMQA 3AS1A 1EAJA 2EKSB 2FCBA 2DBJA 2MJWA 4WEBL 4HJJH 4BCYA 5ID0B 3KBEA 1XH3B 4JFZL 4U1MB 2CGZA 5J8OA 2V5SA 3OMZA 2IH1B 4HPHA 1H15B 1V10A 2CWRA 4NRZB 4CADB 5C0BB 4ZMZA 1UH3A 4PRAA 5E6SB 2IH3A 1TOXA 3IXAB 1TTGA 1MRCH 3VI3F 4FFYL 5FGCE 1NANI 3E9TA 5KSAA 4H8WH 2NSMA 4GAGH 2WLLB 1ACXA 2VW4A 5HDLA 5KYXA 5ICYA 1A1NA 3MI6A 4LAJH 1J8RA 3I6KA 4BSVB 1HK6A 1NAKH 3NZHH 4HETA 3QYNA 2ZAIA 4M62H 4YHZH 5E8EB 2YPLA 3A67H 5GS0H 5SWZA 5BJTB 3SQRA 2XWTA 4ZK8A 2FX7L 3QWRA 4MMZB 2QVFB 1QP1A 2WXFA 1FZMB 4P2QB 4XPGL 1PNCA 3IDNA 2XRAL 5DJ6B 4K5LA 4OV5A 4LVNC 3ESUF 1IGFH 3LSOA 4PEEA 1JGDB 5EULV 7PAZA 5GS2D 4TRPH 3CC5B 1QFWH 2PPEA 1SUHA 2P24B 2K6WA 3FO0L 3VD0A 2FBRA 1A1OB 4WGWB 4JPKL 2NZ1A 3ARUA 5IFAH 4ANWA 2JIXD 2ZG2A 3L3OB 5EIVA 1MW2A 3MRNA 2DQGL 5DC4B 5SWSB 3S37X 3V0FA 4PJ5D 2ZXDA 1JHLL 5KBKA 5I18L 4IIQA 15C8L 4OFPA 2P49B 4PRNB 3SE9L 4POYA 1FYHB 2FEEI 2F54B 4LMQE 1HNYA 2HKFL 1EHLL 1EV2E 3AQZA 4W1TA 3EJUA 4XB7A 4XNUH 1HX0A 3SGJC 2NY2C 1D7FA 2WZPA 5SX5K 4NQVB 2OMYB 2VRKA 1PZ3A 3G5VB 4I3SH 1Q0XL 1EZUA 1GZPB 5B38G 5I30L 2PTTB 3T1WA 1IM9A 1ID5I 2MNUA 1PKQE 5I76A 3JWNG 2F5AL 5D4JA 5L8JB 3L45A 2G3XA 3T0WA 1H9VA 3FNKA 4QRUB 3W39A 5C3IA 2NDGA 3D25B 1MWAB 2K6YA 4FA8A 5IBUG 4KITB 1QNZL 3ZQ9A 3EFFB 4LCUA 2X4PB 4QAWA 1A6WH 5C09E 4YGVB 3CHQA 3ZDZB 2OZ4A 5DU7A 5DMYA 1XGQB 4HGKC 2FBOJ 4GRLD 4LHJB 1Z7JA 2YMTA 4YDVA 5C8JB 1TQTA 5DTFA 1N3NA 2H0FA 2A4ZA 3EH2A 3ZR5A 5I8OL 1UD6A 4CVZA 3RTQC 1HHGA 1RUKL 2ZSWA 2N1TE 2YGQA 3SOBH 3VFTB 1T21B 5CEZE 3BE1L 2ZKWA 4QLWA 3V52H 3SE4C 5ERWB 4HG4J 3BRGC 2R29A 3BH4A 3EGXA 5FWQA 1YDPA 4Y88A 1QWNA 2ALWA 1TJIL 2KH2B 4KO9A 4KV5E 4QY8B 5J9PA 5J1SC 1A6PA 5HGDA 2NY1D 3J7HA 3LQAL 4J12A 1E5YA 4YDKL 5I16A 4XMPH 5I19H 1N59A 1PG7W 2ADGB 3H9SE 4PJIA 4C4BA 1EHXA 1EEZA 3FBKA 2EUWA 1VRSA 1WF5A 4HIJA 2PYFB 4K15A 3P0YH 3OZ9H 2R1WA 4N2LA 1IGMH 1OGTA 1KTDB 1GZQB 1RHHB 1T1ZB 2AV7A 3FT2A 2L4OA 3VFGL 3VXME 1GA2A 3HNVH 3L48A 1I7TB 2YQ3A 2VDKL 4QDGA 1ZVSB 5D7IA 5KSVA 3CFIC 3ZZSA 1N0XH 3I3EA 4HHWA 2QDVA 5HDWA 2OJEB 3KPQB 4RGNC 2P7TB 2XTJB 4WFGE 1A22B 1HHJA 2H2PC 1U3ZA 2JMRA 3BEVA 4XP9H 2CHXA 2Y06L 4YK4B 5DA4A 1JGVH 1INEL 3IWUA 4QXTB 2EDEA 5JW3H 2E76C 2IAMB 4KKLD 5EORL 3NACH 4JK0D 2TSAA 32C2A 2VMCA 4PJFF 3ARDC 4L8CA 1RIVH 3T65A 3LS5L 2PTUA 5D71H 4N3UA 3OWRA 5E1HB 4Z7VE 4TUKH 1TQVA 3MSPA 4MXQD 1PLAA 3RNQB 5DWUH 3PIQB 2AXHA 1CLZH 1HSBA 2ZG1A 4Y5VB 1CF8L 3WN5B 5D9SB 2GAZA 1OTUD 3OB8A 1IL1A 3BYTA 5D6DC 1XDTT 3S98A 2B9AA 2VDLB 4N90D 2JJTA 5DRWB 5HYFA 5L7XL 2DQHH 5MEOB 1XXDC 4M1GH 4LHUD 2XSKA 1AYRA 1FRGH 2YGPA 4RZKA 2ZOWA 2OA9A 3ZYZA 1LWRA 1YY9D 2YA0A 2CDFA 1C5CL 4X6FA 4UTCA 1MUJB 4XVJL 1KCRL 4ZSOB 2COQA 3OKMA 5FYKD 3OMNB 1P6AB 5ADOL 2DLEA 3IVKA 2CO4A 5TFSL 2IADB 2O6FA 3MV9A 5JLZA 3MLRL 4KJWC 5H35A 2HVJA 2F7PA 2I85A 1M71A 4QXUL 4JQXA 3VXRB 1PLBA 1ZMYA 4H88L 4NQUA 5DSCB 1KPUA 2Z7UA 3RKDD 3SJVB 4ZNEE 3N91A 5GZND 3OKDB 4OZ4A 3RFZA 4RMTA 3OSKA 4GKZA 4QHNB 4B9GA 1HQ4A 3PQYA 1TU2A 3QXDB 5AB0A 4PJGA 3DDFA 3O2VH 2P8PA 5CF3A 3L08A 4HSCX 4L4TB 3S4SB 3TYFB 5DI8A 1RLWA 4APQA 3CVDA 2ZP0T 3IWVA 1AGDB 4BBWA 2ITCB 3DHJA 4OB5H 1FZJB 3RWFB 5F89A 4G42B 5DMIL 4PP1C 2CJUL 3FQNA 4HQQH 5AALA 3CZNA 1J8HE 2IWGA 4P99A 2NY0C 1N8ZA 2QMKA 3ZYIA 4Q4IA 3BMVA 5HHNB 3TBTB 2G4EA 3MJ9L 2JLPA 4OF5A 5JUEH 3AREC 2WXGA 4RQQA 5I2IA 1ODAA 2AJZA 1UFUA 1ZLDA 4O4YH 1K2DB 1YYLH 3NZ8B 5AVYB 3D3VD 5I6XB 5E4IA 4GKNB 1OCWL 3NFPA 5LXGL 2B59B 1V5JA 1G7IA 1QASA 1MXGA 4NKIH 3CLWA 9PCYA 4AJWA 1R5VB 2NT0A 1KTRL 1FG2B 1U8LA 4QRTB 3IFPB 3K1KC 4M03A 1JTOA 1ZK9A 3WKQA 1EEYA 3U4EA 1RZPA 4Y19B 4Y4KB 5FGBC 5KTEL 2QV2A 1CPUA 2ZQKA 3JZYA 1K3IA 1SEBA 4PJXA 4AQ1C 3FUJA 2NCMA 1R34A 3V2AR 1MF2H 1O6SA 2VQTA 3BQUB 3UTTD 3BZ4A 4TSAH 1XGZA 2FWUA 5DRNA 2WXLA 5EOQH 3NJLA 4WWKA 2VZTA 4UUJB 3RYMA 1OLZA 1NGZA 4GBXB 5KEZA 5C86A 5T1MA 4M7LT 4BA0A 2O5NA 3QPXL 4TQ8A 4IHOA 1CD1A 3RPBA 3QJSB 1A1MB 5LNGA 3ZO9A 4Z7UE 4Z77B 1AD9B 3HBPA 3H7BA 4FFZA 4IMLA 2ESVD 4JY4B 4E41A 3B9EA 5F6HI 3O3EA 1SXAA 4FFYA 4RMVA 4YAQA 1Z9SA 3L4YA 3NYKA 5FUOH 5G5DA 3V79C 2WLIA 4EXKA 3NAAL 1GC1C 3LMJH 3KCWA 4U6YB 3OX8A 4YFDB 1M1XB 5BZZA 4GSDL 4ZFOA 3KZ8A 4J2XA 3QR2A 4TF4A 5I1EH 1HZHH 4HJ0C 1P4LA 2V5YA 2B0SL 3OR7B 5AW7B 3S96A 2OMTB 3HPLB 4YSAA 1B9KA 1NCBH 4AIZB 3BSZH 5BRZE 2EINB 1AR1B 2EO1A 4X8CA 3A0OA 1E27B 1RZGB 1T1YA 1XCTA 5MENE 3EZJB 2C7UA 5CZVL 5DD5L 5TQ2H 3WMQA 4Y89A 3EO1B 4Z0BH 1OSPH 3QA3B 3ULVF 2DQDH 5AB9A 5HYJD 3MCLL 5AVXB 2UZYB 1IGTB 5CHNA 3TJHD 1FAIH 2AZUA 1OSZA 5FWRA 3DX7A 2BY0A 3ETSA 1ASOA 1MHEA 3GMNA 3M7FB 3FMGH 3U46A 1QSEA 4YHNA 1Y7VA 2NY6D 4YSPA 3UTSA 2F5BL 3RWHA 4GSRA 1PMYA 3DVNA 1E8ZA 4QWWD 3T8XB 1YC8A 5I5JA 4L1BA 3KWVA 1QOKA 2DDQH 3DO7B 4U0RC 1E90A 3ZL4L 2IXQA 3MV7A 3Q2LA 4G6JL 2WIMA 2VIRA 3PL6D 4D8PB 3BCFA 3MROA 2EUXA 4HJIA 5E2WL 2LGNA 1ECZA 1W16A 4WEUD 1UXLA 3DJ9A 5C1MB 4Z1PA 1ZRUA 4YE4H 5HI3D 5JNYA 4ZXBA 3VFRB 3E6HA 5F44A 2P47B 2GJ6B 3PWPE 3H3PH 4KU1A 5CM1A 1R3LA 4XWOC 4XCFL 4NWTH 4UNIA 3SZKC 1QR4A 1BZ8A 5EN3A 5C07A 4ZUWB 1GGBL 1VFMA 3PE9A 1E8XA 5FUZL 3HMWL 4A6YH 4KVCL 1A7PL 3TA3B 3AQYA 4P5KB 1YEFH 3L7EA 3KH3A 5IB1B 3ULVC 3JV6B 3B5GA 4OZHE 5KYWB 5HVHB 4L5FE 1WDAA 2XNAA 2BNUB 5BOZG 3ZX1A 5I15L 4KNSA 3QDMA 4KK9D 3EJQA 3BZFB 3QIUB 2OULB 3SGKC 2MH4A 2HXAA 3AG4B 3ARFC 1GPOL 1QRNE 4PFEA 4WIQA 4JO2H 5DLML 2XUWA 5HHPB 1G7MA 5KSAC 1R5IA 4MJ5A 4LDOB 1MLCA 4F7CB 5HGBB 3U4BH 3DV4B 3KMDA 4ZQTA 3FB8B 1T22A 1QR1B 4LKCB 4HKZB 3ALXA 1TZIA 3DX3A 3AM8A 3FCTA 3F6IA 5I75B 2EACA 3BUYA 5T1KD 5IVZA 1DLFL 1WPCA 3KPNA 2G75B 5ICXA 3INUH 4WY7H 3TLRA 2COVD 1ZTXH 1TQCB 3F8UB 5I6PA 1TQSA 3CBRA 3V4PH 3LXBA 3RX9A 1E30A 4WO0A 4KVPA 2P44B 3CSFA 3PPSA 3VXSA 3EH4B 2K7QA 3ML8A 4R4FL 4M3KB 5JHDD 1RIHL 1UT1A 1QO3B 3CVIL 3ARGD 3QO1B 5B1AB 5F3HB 4U1HA 1CVRA 2CLZA 5IK3A 1NGQH 4AT6B 4HBCH 1GCYA 3U7WL 1FO0L 2QKIC 2VDNL 4JZNA 1WK0A 4GYBA 2R51A 3VNZA 4KQ4H 3CZUB 5LQBL 2PPDA 5CLWA 4B9KC 3GO1H 2V5TA 5BNXD 2PYEA 3D30A 1WIUA 1JD9A 2A74C 1SYSA 1CFVH 1G0XA 4LEEA 4NYLB 3UGUA 1AI1H 2CO1A 5HHMD 1IAOA 4PJAB 2HA1A 4ALAH 1HXMB 1E2ZA 1N9PA 2CO6B 3HE6B 4KPHL 5ENWB 3Q1EA 4C83A 4DGVH 4OD1L 1M05A 2EIBA 1LNUB 3DXAE 3UADA 1YNTF 1NPNA 1U8MA 2B4CH 3RDTA 1CXIA 2B08A 3DX4A 5EOTB 1KXTB 4YDLC 4LMQI 3S2CA 4J3UA 3W9EB 1JCVA 1NDGA 2IWEA 4UQ3A 3VG9C 3W57A 1H3XA 3NCJH 3M8OH 1V7NH 1EO7A 3DSFL 1U8QA 2HJFB 1CS6A 4RFNB 5DD0L 3ULUD 5JPMB 4POZD 1M4KA 4JS7A 5C7ZA 3Q6FB 2WCGA 1ND0B 3TO4D 1T66C 3IGLA 2X1QA 2DD8L 3BVNA 3LD8C 1MWAL 1UA7A 5FGRA 1DVXA 1NGXB 1F4WH 3WEBA 4CDGC 4ETQA 5B7MA 2EVFA 1LP9A 1ORSB 1MRFH 3I6LE 4X7DC 4A1RA 1LO5A 3GJEA 4JPIA 4GMSH 5FUCE 4AYFB 5E9NA 2FATH 2IOIA 5D4IA 5I1CH 4XP4L 1T7XA 2WBJB 2J5LB 2O5ZL 4TNFA 3AC0A 2W9DL 3MA9L 4NQCE 1ZGLP 1RZKL 1NC4B 4JZOB 1UEMA 3WS3B 2NT1A 3MRPA 3KE0A 5HY9B 1ZTMA 4QHMB 3VSVA 2P5WE 2W94A 3NQIA 1ZHBA 2E9WA 3QUXA 4OZIA 2WMPB 4X6DA 1FH5L 4NC2B 1J0JA 1J1PL 4PLNC 4N0UB 3TFKD 5BMFH 4CVWA 1V3JA 4ERSH 5F7UA 2JFCA 1T4WA 1DHKA 4N20A 1JZ6A 3ARTA 3QXWA 3DV6B 4CC0A 2KLTA 1I4FB 2CO7A 4OIFA 4L3CA 2H0JA 1L9OA 1DJWA 3QZWB 4Y2DD 3RWCB 3ARBD 1ROCA 3LZFH 4O2CB 1URZA 5F7MC 3I3DA 4E9SA 3BWAA 3CTTA 4QRRA 4Y1AD 3A21A 1XF5A 3AABA 2GT9B 2C1OA 3RA7H 2VWEE 3MRDA 1I8KA 2IDUA 4HUXA 3QXAA 3PV6B 1ACZA 2XFXA 3GLDA 3Q8CA 3BP5B 3QEUA 2DLHA 5GRXG 5HHQA 4WWOA 1C12A 1T3FA 3DJSA 1IKFH 2Q9OA 3LZQA 1MQ8A 3MTXA 2A9NL 5TDPA 2FUTA 2Y5EA 2BO0A 2YSSB 2VDLL 2YD7A 4KRLB 3KPRA 3VMNA 1ZHLB 5AB2A 2R4RL 1KIPB 5BO0D 3D0LB 1EEUA 1G94A 4Y16B 5FM4A 4P5MB 4UYPA 3MBED 2XZQL 5D72H 1Z9LA 4HW6A 3TIEA 1KB5A 2X1WL 3DMMD 3SDCB 2PLTA 2KDYA 3BX7C 3D39D 2YOAA 4DP0X 2LVCA 5I1KH 4LL1A 3O4OB 3CBJB 4R5VA 4LESA 5K59E 1GXEA 4N2GA 2OMZB 2OCJA 3GMMB 3MGAA 2P80A 5LB1A 4KXBA 4PI0A 5C0BE 3O4LB 4MZRA 3VWKA 1SM3L 4N5ED 4D0BA 3S5ZA 1S9WB 4Z3FA 5BOPA 4HCFA 4JKPL 4GRLC 3VH8A 1MEXL 1Z9MA 2V8LA 4FULA 4ZNCD 3RPIA 3EXJA 2ZKHH 5I8KL 5IG7B 1DE4B 1UCBH 2WQAA 1ZVYA 1KEGH 2E27H 1UKSA 5CLZA 5DVMA 1AY1L 4C56A 2BVOB 4TQIA 2YGNA 4FMKA 5GZOD 2F9BT 4Q9RH 1WLHA 3FTGB 1LE5B 1AQDA 2Y22A 2Z91A 4HMDA 3UAFA 4AQ8A 4KI5D 5JXEA 3VW3H 4LKXB 4P2QE 2CUHA 2DI8A 4PRDB 1C8QA 3HNSH 2NY1C 4G8GB 5IVXB 3IGUA 1P5UA 4KHXL 1NINA 2KT6A 2HUEA 3D08A 1M2OA 2IMMA 3D4CA 5JR1L 3FTYA 2KYIA 3ZDYF 2GITB 5BO1H 4NAQA 1AMXA 2H26A 5SWSE 4CUCA 4OKVB 4K5MA 1P2CB 2B1HH 3P4NB 5GGSA 1BZEA 1YQVH 1BQHG 2NPLX 3IE4A 3V0HA 4OCRL 4ODHH 3MBXH 5EU6A 3OJDB 3RJQB 5EBWA 4P2RA 2RB8A 2J43A 4MJ6A 2W0LA 2VLKA 3CMOL 1HHIA 3LPWA 3CG8A 5EUKB 4KKLC 5FO9B 1EEQA 5DJAB 2BMKA 3V0VA 3V6OA 1PZCA 4H4NA 5I73C 3X11B 3HAEA 4KGLA 4M5YL 5CP7B 5TH2A 3O3DB 5JHLA 1I1RA 3NFNA 3MYZA 3QUMH 1ADQL 3MYJA 1PDKA 4H20H 4ZX3A 5I8CB 1LLAA 2YQBA 1G9EA 3T6QC 5FA3B 2VDOH 3U9UB 2EKSA 5C0JB 4E9WA 4MXQC 1EFQA 2X3CA 3H6JA 5HYSG 1I3RA 3MO1A 2VQUA 3RWDB 1SN0A 4OJAA 3WFEH 5EZOL 1NC2B 2J72A 3KR3H 1OTUC 3O6ML 3RUGF 1MJ8H 2WVVB 1JXDA 2VH5L 4XXWC 4P9ML 2Z92A 2BSEA 5I71B 3VXTA 3PRZA 4G7RB 5KVGL 5I8EA 1HFUA 1E50A 1N12A 3FQ2A 3FN9A 3IXAA 5TQ0H 4U0QB 5KG9B 1YY9C 1LE9B 1HH6A 5EU3B 2ICEC 1NBVL 3F7YA 2PN5A 5D7JD 1KJMB 2Z65C 2QSCL 5GGVL 4RAUB 3OJ2C 1OCZB 2ENJA 2PWFA 4BSVA 5FDYA 3GLEA 2H3NA 5H37H 2KL6A 2VXTL 3CDZB 4L3FA 3QAZC 1MZYA 2X4RB 2A4CA 1XL6A 3FCGA 3VXOB 1DFXA 3BDBA 1LEKA 2W9LA 4W9EC 5GISH 2QPEB 1E9QB 4JRYA 3RKDC 2FO4B 3V0JA 4PVLA 2WOBA 5GZNC 2J6WA 1FO0A 3VU1A 2I5YL 5ITBL 5KS9A 2XFGB 2J8UB 4N2DA 1EAPB 1AIFB 1G1YA 2JK5B 2WV3A 4XN2A 1V3MA 5FM5O 3ZT5A 1HOEA 1EWHA 1BLIA 2XTJE 4MNHB 1KC5L 1JDCA 4HAKA 4EKXA 1IAKA 3C2AL 3G5ZA 5DQ9A 4QYOA 3CVBA 4X4YB 1S7RA 1GGCH 4PRNA 1SGKA 1MJUL 1TTCA 2VM9A 2XJLA 3HE7D 3HZMA 2CBQA 3WNMA 4TULH 3QEQB 4AJYV 1UQSB 3VWJA 3ARZA 4MA8L 3I9GH 5GSRA 3FW6A 5FO2A 3SCMA 1JPEA 2NX5A 4YH6A 1LVEA 1HL5A 1LK3L 2O6EA 2OMYA 3G5VA 4I2XA 3ESOA 4E36A 4J8QA 4YHLL 1VEMA 1GZPA 2QFRA 3V0WH 4HD5A 3ZGIA 5JA9A 2KBGA 4A04A 2XZCL 3TEYA 1Y07A 4X4XB 5I66B 4UM9D 1MWAA 1IBZA 1A0QH 4RLDA 4GS7C 1A6AA 3X13B 1ZK5A 2GABA 3MGTB 2EICA 3WTTA 1K72A 1VAHA 4PWFA 1YJDL 1A3RL 4YGVA 1XGUB 2VJ0A 4G1MA 4GT0A 2YQGA 3QW9A 2W95A 3DURB 3FT3A 4CMMA 1P6WA 2Z1PA 4K7FA 2O30A 4NQQA 3K4ZA 4PMEA 2F53A 1P7QB 5DR5L 1BHGA 4V11A 1IGIL 5M95B 4YFLI 4IRZA 4MJ2A 5IHZB 2FUQA 2OK0L 4G71B 5AFAA 3SQOH 3P9MB 1PCXA 3GIZH 3VXRE 1X5KA 2ZOTA 5FDWA 3SJVE 1FYTD 2PCFA 1WBXA 4JAMB 4PN6A 3IDYB 2BNRB 1NBYB 3C12A 3QDGB 1MLBB 4F20A 2GCYB 3D05A 2AJXH 3H42L 1W9XA 2YBRA 5FECB 3WY2A 4R0LC 4ZYKB 4G8AC 1JYXA 2AQ1A 2ZOKA 4L4TE 3VRIB 1CICA 3BO8A 1KYDA 5D93C 1NFIB 1I7TA 3EYOA 4U1LB 1DQDH 2MSPA 3MRGA 3OGCA 4WGKA 1RZQA 5GHWH 4JCWA 4DFHA 3FN3A 2O6DA 4X4KA 1EBAA 4HX1A 3BVDB 5B38A 4B5EA 3X17A 5KSBF 5LBSL 4QXTA 5INDB 4BHUI 4PS3A 1DDTA 1PIFA 5J12C 1N26A 3C08L 3FB5B 4XNMA 5DFWH 3QI9A 2XVLA 1AC0A 1CU4H 3B83A 3BC9A 3WFHB 3IDXH 3LX9A 1DUZB 3LKPA 3HMXH 2PPCA 2H47C 4YHKL 4BZ1H 5FC9A 3N2JA 5L0QC 3D85D 1RUML 4G8IA 5E8DL 3NEOA 1WAAA 5J57B 1NCTA 1NMAL 2EIJB 5F9WC 4CILA 3TJHC 3AFLA 4PLOB 3LKRB 4KAQL 2YUWA 3O41B 3IJYA 3RNQA 4KRPD 2R0ZH 2X4NB 35C8L 1EJ6A 2Q3XA 4JFFA 4PJHF 5EEWA 5D9SA 2NY6C 2AMUA 5E00B 4XNXH 4LOVA 4P5TA 1I9JL 4A6YB 4Y19E 1WCBB 3FHQA 2ARJQ 4QWWC 4G7VH 3VFMA 5TDOA 5MEOA 1EAQA 5DS8B 3CQPA 2VITB 5IB4A 2QQKH 4ONOA 4U1KA 2E7CA 2CE6A 4CC4C 4LCWE 1KGCE 2WXMA 1OARH 4WENB 3RWEB 2AFNA 3PL6C 3SYCA 1XIWA 4LE8A 4Y5XB 2YD3A 3NPSB 1KYUA 1P5VB 1QD0A 3FO1A 3GJFK 5L4MA 2B1AH 1BWMA 4UQ2A 5HI3C 5C0IB 3FF8A 3VXQA 3NABL 3ZPDA 2IFFL 4HJJL 1IIIA 4HS3B 5KVMC 1LEGA 1WHPA 4U7KA 4MNGA 2A6IA 3KXFB 3QQ3B 3W2DL 5C0CB 3W1ZA 4YQXH 5KJRH 3NTCH 1QYGH 2ZNWA 2CUIA 4E0RB 4P2AA 1MOEA 4X98A 4QHLA 3V4VL 4QF1A 4LCCA 1BEXA 3K0YA 2Q1EA 4H8WL 1D7BA 5CGTA 1JXJA 4GAGL 3GEFA 1MPAL 3KS0J 1Q94A 5JDSA 4OY9A 3V4PB 1NAKL 3NZHL 4KK9C 2DYRB 4M62L 2YAFA 4YHZL 2I7OA 3A67L 5GS0L 2OQJB 3VDBA 4C55A 5B1BB 2RTTA 2K8MA 4Q0XH 1IGFL 3FHAA 4KK5D 4OAWB 4PY7A 1NIDA 3PGCA 5G55A 5I24A 3ZHKA 1LO4L 4TRPL 4PRPA 1QFWL 4JREB 4F2ME 4X5XA 4JRLA 1BZDA 3U79A 1AG0A 5CJBA 3MRRB 5HGGS 2VLLA 5IFAL 3Q43A 3MRFB 2B59A 2V2TA 1OKEA 3B9KD 5DHYA 3T1FA 4XZUB 3HZYB 3ZT6A 5CSGA 1I9RH 3GMPB 3SOTA 1F2XK 1ZGLA 1JPFB 4HULB 4I48A 2I27N 2A9MH 4XNUL 5C0FB 1ADQA 2YZ1A 3QJVB 4IU2A 3Q8EA 4V1DA 5EZJB 3NJHA 4FI6A 5E24E 1EGJH 2G9HA 5CSBA 3HI1B 4OU3A 1ITBB 2XI9A 3ARGC 4HWZB 3SKJH 2V3FA 2QADD 4AL8H 2XN9B 3KG5A 4EI0A 1S5HB 3T2OA 3ZDWA 4IGBD 2GJ6E 1L5GA 4LOEA 3QC5X 3T2PA 5BS0A 1I85A 1D5IH 4JUSA 3RZWA 3ZK0A 1A6WL 1TMQA 1BD2B 4WNJA 3MOAH 4S0SD 1X9QA 4BINA 3O9WA 4ZMAT 2JB5L 2KC0A 4AQEB 3FU7B 4K7PH 5TDNB 2IPUK 4X9GA 1CT8B 3AG3B 3V6FA 2ZIDA 1F3JB 4NQEA 3SOBL 1W80A 1TEFA 4K5PA 4A7SA 3O45B 2OMXB 1E4XI 1T0MA 4J6IA 3C60B 3DRQA 5JHMA 1WZKA 1SJVA 2YA2A 3VJ6A 3FO2A 2A83A 3QSKB 5K9KB 1QBAA 3IGKA 4KUCD 3ULUC 4POZC 3PFQA 4XMPL 5I19L 3TO4C 1X5JA 3OHXA 4KX9A 2VQ4A 4BFKA 3EF7A 4UOQA 2CJ3A 4HA1A 3OZ9L 4H13C 1CIDA 2LU5A 4N8UA 5DZJA 2AQ2A 2YAOA 1KPVB 5A7BA 2WLYA 2P8LB 3U6XS 1U8PB 1M3JA 3TZVB 1N0XL 2WKOF 3MRQB 3CK0L 5A6MA 4NP4H 4NN5C 5KAQF 1S9XA 3EOBB 3NK4A 4XP9L 4CN4A 3PWLB 4JY5H 2QJDA 5J6HA 1JGVL 1QPXA 3O2WH 3Q5OA 3WBDA 1O7DE 1SOKA 3G6JF 4ELMB 5JW3L 4ZW3A 5LAXA 4O2FB 4YR6B 1D5BB 3Q1SH 5JOFA 3AGWA 3KPSB 4Z7WF 4TVPH 2M2DA 1RIVL 3U6XA 5ELIA 3TFKC 2QVMA 5D7LA 4PS7A 3EJSA 4N9OB 3O6FA 1CUOA 1HXYB 1J0YA 1KGWA 4PRIE 4XI5D 3K72A 3ZBMA 3VFRA 2N7SA 4JDEB 5DWUL 4J2QA 1P6FA 3P2BA 3BP6A 5DK3A 1VKXB 3KPMB 5JMOC 4FLQA 4Y2DC 1CE1H 2KZBA 3BH9A 4PCTA 5C7XH 5JW5B 2V2XA 1JV2B 2DQHL 3ARBC 5GJSH 4PJAE 3QIBB 5AZ2L 2O5YL 1RPQA 2W07A 3NBNA 1FF5A 1RFDH 2NR6D 2BFVH 3HI5H 3SQBA 3UJTL 1FRGL 3RBSA 5SWZD 3C87A 4P5KA 3B4NA 1AQHA 4Y5YC 4YUEL 4IU3B 5KYWA 2PWGA 2ATKB 1P7KA 4FQ1H 2RGSA 4M00A 3WJJA 2XYBA 3N3EA 4MB4A 1G7HB 1TKWB 2WGXA 2KS0A 4XC3L 4LSSH 1S7QA 1KXVA 3QDAA 4KI5F 2DH3A 2HRGA 2PP9A 1CL7H 3L4UA 2VSKB 1R3KB 4UZSA 5DXWA 4MD0B 4MXWH 1G9NH 4ODTH 4L23A 1OM3H 3EHBD 1E67A 4JRXD 5IQ7H 1OB1A 3MREB 3ET9F 5HGBA 3ZKNC 3RZCA 4MRBA 1OP3H 1PCSA 5IIEA 5IFJB 1ZSDB 2VRQA 4KC3B 2J6EH 4HKZA 1IEHA 3CPUA 4HIEA 2C1PB 3MBEC 3Q9QA 1PJ9A 1HWWA 5D2NB 3TCLA 4OB5L 2XIIA 1O7VA 1G0DA 3HG2A 3KYAA 5CGYD 4K9EC 5JXAH 1TDQA 4I0PD 3KEDA 4HQQL 1Q38A 4XODA 1IM3A 3AMKA 2Y3AA 1Z3GH 5HHOB 4DH2A 2AQTA 4GW4A 1EJ8A 3WSQH 2W8CA 1YEEL 4M7KL 4N0UE 5DJDB 4KZEH 4UIMB 4AE1A 4N5EC 4E5XA 5JUEL 4EN3D 3SE3A 4JLRB 4PJ7A 1NMCC 4U2YA 4DP7X 3OTTA 4O4YL 2YRBA 3W5MA 1WQVT 1I7RB 3DIVA 4L8BB 2NY7L 3TNMB 4GFTB 3TH2T 4NKIL 2BVUA 4OKDA 1I1FB 3GXIA 3ZL2A 5GZOC 2BERA 4XVTH 2FDBP 1KXQA 3ATAA 4XP6H 2I07A 1G0YR 3GXUB 3LRSA 3CZLA 5KVEH 1XF4A 2JKXA 2X89A 3HUJA 3QUMB 5A2JH 4LLYA 1U3HD 3AQXA 5GGRA 4BH8B 4MQSB 4YSCA 2VDOB 4M7ZC 1MF2L 5GS1C 4GT7A 4TL5A 2GTQA 5IKCB 1H5BB 4TSAL 1Q9LA 1BX2B 4W9JC 5HHXH 1ZXQA 5EOQL 1TTAA 3V7AG 1DJYA 3UBHA 3VSTA 3B7SA 4IRSD 4IJ3B 1BIIA 2X4OB 2D9QB 3KYNB 2J4WL 1H6EA 3ZKSD 1ND0A 5D6CB 5MEQA 2ZWNA 5C0DA 4PGCA 4M4RB 3V4VA 1ORSA 4PJCF 4XPHL 1LJMA 3V5DB 1NWPA 3S8FB 4LASH 4HT1H 1I1YB 2DYPB 3LMJL 5IM7A 2ZX9A 1AOZA 4JFHE 3JV4A 1AZUA 2BSRA 2DWYA 5C6TL 3LQMA 1K85A 3LS4L 4U3CA 3MX0A 3KYKH 3QDHA 1HZHL 5I1EL 1RZIA 3GM0A 1DVFD 4GRWF 1OWWA 3AZUA 1GOGA 3C9NA 3MZTA 3ZSSA 3KYOA 2XZAL 4MNQB 4U3SB 4CVXB 3H1ZA 1V54B 2XWJB 5AG8A 1NCBL 1CJYA 1F8TH 3BSZL 2V6HA 5DQDH 2JCWA 2NNAA 3O4LE 3OKLB 4A7TA 3WO3B 5TQ2L 5HVFB 1VESA 1PAZA 4Z0BL 3SPHA 1OSPL 3NRPA 4HEME 3V9FA 3TVMA 1SJHB 4UAOC 3A23A 2DQDL 4FKEA 4XBPA 4K94H 1FAIL 5I23A 5DK0A 4Q6IC 2P8MA 2ICWI 1G7LB 3A6CH 3CZGA 4FLRA 4LF3B 5F9JB 1ZA3B 5D7JC 1JPGB 4LEXH 3M17A 2PPFA 2KHAA 5F7NC 4H0GA 3SY0A 3BHBA 3D48R 1EQWA 2RHEA 3DX6B 4OLVH 4G8GE 4I1RA 2OCCB 5IVXE 4UOZA 5CEZD 1YEDA 3I6SA 1H6UA 1D5ZB 3CFBB 2DDQL 3PP3K 1NAMA 4RMUA 3LN4B 1A3QA 2W1NA 3KWTA 5I28A 3QCTH 4PJ9A 3STBA 1YNTB 3VMPA 3NIFB 3H9SD 4WQOA 4YE4L 4Z3EA 4RSVA 3BWSA 1QWHA 3FUHA 5HP5A 3B9VA 2AKRA 1KYAA 2PABA 2Q87A 4CGTA 1BM3H 2ZG3A 3H3PL 3VXMD 2YWZA 5FPIA 1ZANH 1PY0A 4WHDA 2LABA 3ALWA 4NWTL 4LPTA 4BUQA 2ZUQC 2A77H 5L2JA 1RVFH 2V9RA 3HOGA 2ERJC 3X2QB 2ODIA 1U3NA 4WFGD 4YSTA 3UO8B 3L6FB 1UB5B 2YD6A 2EECA 3SPJA 3LPOA 4U6HB 2YSSA 2WKGA 3H53A 3MLUH 2FR4A 3RNKB 1YEFL 2Y07H 1CDCA 1BQLL 1RJYB 2WTPA 5T1LA 4LNRB 2NZ9D 2J57A 3TJPA 3CZSA 2NXZB 1JZEA 4J3BA 1OALA 4AI7A 3L3HB 5CP3A 3APCA 5IHHA 3GGWB 2A6JA 2M1KA 1YEJH 4ZMWA 1DZBA 2A99A 4I89A 1UUSA 3KLSA 3MRJA 4B6ZA 1Z5LA 1W8NA 5FF6B 2Y6SD 3ES6A 3VMOA 4OD3H 4WW1B 2PWDA 3SBWC 1F4XL 5DRZA 4CGUB 1FHNA 2G0LA 3LV3A 3UZVB 3H4FA 4OZGF 1I8MB 2ED7A 3H8NA 4N0RA 3GB7B 4WKZB 3NGBB 3U4BL 1BFOB 4XCYB 2B7DT 5JMRA 4E9VA 1M3IA 4BK4A 4UDUA 3QZOA 4NZTL 2GI7A 3QNXB 3U25A 5DYOB 2EQDA 4XGZB 3U83A 5AAWA 3QWQB 1W6LA 2EC9U 3OLEA 3INUL 5C0ND 1BLNA 1S7WA 4WY7L 4LKXA 4MS6A 1ZTXL 3QJTB 2BOBA 1ZLWH 5IUCA 2Y24A 4LPCA 1MAKA 3O3UN 2DMHA 2QELA 5F71A 2J25A 2GC4C 1YVLA 3ZY7A 1FP5A 2H6UA 1SOXA 1WFJA 2GI0A 2J8UE 3HRPA 4JKLA 5HHVH 4YPJA 3HB3B 2YD9A 1U8HB 1WBYB 1NGQL 3DO3A 3MNVA 4GKLA 4HBCL 4L18A 2X0VA 3G5YB 1X9RA 2XV6B 4TNWK 2BSDA 1OT1A 2VUOA 5A16A 2H1XA 3MLVH 1OP3K 2HKHH 3D33A 3GO1L 4YBLB 1I1AC 2BWDA 4J3WA 2EEXA 3GSOB 3MA7B 1QHPA 1Z0NA 1QFOA 1UZ8A 4D9RE 1IGJB 3RKPA 4JB9H 2DJ4A 2R1YB 2X70B 1AI1L 4HZAA 4MCNA 4BELD 4KTYA 3QH3B 3SDDD 2G2RB 3L7FA 3SPIA 3HRZA 1PF3A 4EZKA 4DGVL 3H9YA 5BW7C 4UDTB 1OW0A 3QQDB 3APNA 1J8HD 3EO0B 2JJSA 4YN3A 2L0DA 4O51A 2J1WA 1AIZA 2F2HA 2LTQB 5EZLB 4QRBA 1AHWC 5LGHH 2R0LH 3N44F 3CIQA 2VERN 4WDIA 1N5AA 3NCJL 3M8OL 1V7NL 3RTLA 4ZO7A 3MUY1 3W0WB 3IU3B 3MFGB 4W9KC 3T4AC 4ATTA 3AWEA 3FQXA 1Y18B 3EH1A 1TTFA 4NWUL 2V4LA 4DP6X 1F4WL 1W0VA 5D1ZB 3SEPA 1U3JA 3CN0A 1L6PA 1MRFL 3UTSD 3WE6B 2E0PA 4HCGA 4S10A 4GMSL 1FVCA 4NNXA 5SWQA 3ARPA 3B3IA 2FATL 3RI5F 1USQA 1A6VL 3DRTA 2CNZA 1U8OA 3EAKA 4RX4A 4XBGA 4HBQA 4DZ8B 4Z7NF 4PR5A 2ADFL 3VYNA 1QI4A 1FNLA 4N2BA 3T3PB 3WFDH 1P1ZB 4Z6AT 2IQAA 2FT8A 3INOA 3ZE0F 4JFOA 4ANKA 2YAPA 1TVHA 4ANUA 4E42A 1HJCA 2DRUA 1H8NA 1TZ8A 4NENB 1XQ4A 2X4RA 4ZXBD 4BKSC 2BNRE 2DBLH 3JQOB 2Y1AA 3QDGE 4LLMB 1UWXK 4J23A 2E6JA 2IOOA 3NIDF 4WTWA 1J1XH 4X42A 1N18A 4UT7H 3LIZH 4ILDA 2K4WA 4WW2A 3CXFA 1GTFA 2L8AA 5BMFL 2AQQA 2ZUXA 2O26U 1M2VB 3WLBB 3B7YA 4N3TA 4L9LB 1T5WA 4TKWA 1EAPA 1DEEA 3WIHA 2X4SB 3H6AA 1J05B 2V5RA 1HHHB 2R0WH 3QJHB 5L2KA 1ES0A 1R9FA 1JWMB 1CZ8H 4WUKH 1D5MA 1DJXA 3QNZA 3O3AB 1SFDA 5J1TC 3QDMD 1VDGA 5SV3A 4XVSH 5I1LB 1CXEA 3LZFL 1S7SA 4G9DA 2CBTA 4P46D 1O0VA 4XMTA 3ALPA 3DSNB 5DC9B 5ANME 2CGRH 3BUQA 3EUDA 2O1AA 3OAZK 4KK5C 4YXKH 3RIAK 5EEXA 4BUHA 4J6RH 4NHCH 1Q1PA 5BRZD 5MEND 1WD9A 4P2OB 3KJ4C 3GSXB 2Y5TA 3EBHA 2WINB 3MXWH 4NNPH 4PJ8B 3X3FL 4TYUA 2JKRM 3OPUA 4LGSB 2G3MA 1H3UA 3VSUA 3LCYA 4N5UA 1OCRB 4OLZL 1FGNL 5GXBB 2H6PA 1YN7A 3RFRA 3RGVD 4JL2A 1NCOA 4KUCF 4L1DA 3FOMA 3FT1A 4PGJA 3ARWA 3Q5YA 2JV6A 5TTRA 3BP7A 2OSWA 1WZLA 4O2EA 2C5DC 1CWVA 1M57B 3U2JA 1NIAA 5F88A 4AXWB 2IH8A 4FQCL 2BP3A 1HCVA 3PWVA 2Z4QB 1DVSA 1L0QA 4I87A 1PX3A 4HIXH 5E2JA 1KBWA 1U3YA 5D72L 1IEAB 3WEXB 3F5WA 3HIZA 3PGFH 2QADC 1KXVC 5C0AA 3ZT7A 1OZTG 5IHZA 1NA8A 2XPYA 4IGBC 5H94A 5I1KL 2XWBB 2A7BA 3FSVA 1J0ZA 5ISZB 1S46A 1RLBA 2FQDA 3ESVF 4F15B 1IU1A 1KENH 3GRGA 3KXFE 4NI6A 4JFEA 5IY5B 5C0CE 5BPPA 1I7ZB 1ETZA 1UATA 3PWPD 3QHFH 4NN6B 4ZMVA 2D2CC 3P77B 1CQKA 3AXHA 4L9DA 2ZKHL 1UCBL 1LO0L 1B4JH 1KEGL 4HS8H 5I0YA 1CCZA 1F45A 2JXMB 5ICUA 1NGWB 2R69H 3WXVH 1K8IB 2UWEF 5GJTH 3QORA 4Q9RL 3P2DA 1UKQA 4FQLH 2C9XA 3VW3L 5K39B 2CHWA 4FQXD 4LP8A 4U1JA 3HNSL 2R39A 4FXGB 1Z9OA 1NOLA 1L4IA 2ZF9A 4NCC1 3FO9A 4YBQD 2Y7QA 4XNQB 1T1WA 2X6CA 4NM8H 1GW0A 3UZEC 5INCA 2X05A 1J48A 2HFEB 1JZDC 4HOWA 2XVGA 3OKKB 1QRND 2ZSVA 4OIIL 7FABH 1WVZA 3BPCB 4OCXH 4WI9A 1A8JH 3Q8AA 2FHBA 3QVAA 4GRMB 4HWBH 1HI6B 4C4KO 4LAQL 1R3JA 5HD8D 2Y0SA 4UIKH 3MNWB 4G6MH 5SX4H 3NPZB 6PAZA 4GAYB 1JV5B 3VD7A 2LAAA 1S8DA 1YQVL 2X4NA 3WG7B 3MBXL 5BVJA 3X1FA 2XKNB 4AYMC 2Y1VA 1FLTX 4P4KB 1IAMA 2BC4A 5DZPA 3ZDXF 3AT9A 1F18A 5CCHE 3QARA 2D31A 3QUXD 1MRDH 3AAZB 3K6SA 2I60H 4N2FA 4LSUH 2APFA 1OAYH 2LFEA 3M1BA 1JK9B 3QUML 4JM2B 1X9LA 3L3KA 4H20L 3MPCA 4UI2A 5H2BA 3LPPA 2W80C 2XN9E 4NLHA 1J5OH 5MI0C 2RIKA 3PNWB 2VDOL 3DA0A 3KNBB 3KLLA 3F7LA 3PAYA 5BXFA 4XI5C 4MWFB 1XGYL 4GAAA 2J1YA 1A4JB 1PD0A 5EPMA 5IMKB 3WFEL 2DQCH 3TFBA 3KR3L 4GSUA 1ZJAA 1BD2E 1HL8A 4XRCA 1MJ8L 2P1YA 3UROR 4B7IA 3ZN6A 1CLCA 3QQ3A 1O5DT 2YEVB 4I18A 3U0TB 1QLFA 4E0RA 2PXYD 4BK8A 4AENA 5LBGA 2NR6C 4KZCA 2Y7NA 3MN8A 5E2UL 4KRMB 3PWNA 3GRWL 3HC4H 3QHZH 4ODUA 4YC2B 2A9DA 4HLZH 3T0EA 3QG6A 1TQWA 3ZJAA 4GQQA 3QCVH 3DXAD 4MQTB 2OR8A 2R2BB 5I5IA 2XG4B 2WGNB 3CHOA 3QO0A 1YG9A 3KLAB 1DN0B 5GISL 4KI1A 4A7GA 2E9GA 1U8KA 4N9GA 2ZP9A 1JZFA 5EF3A 3V6ZB 3EHBC 3BN9D 2AAVA 1XMWA 1SYVA 2H0EA 2MPVA 3AQDA 1P9MC 4LSTH 3F6JA 4TQPA 3SGDI 1MHCA 2P45B 1GOFA 2FEDD 1OTSD 1QA9A 5CMAA 5I1DB 3I6LD 2DKMA 4CBZA 4JZJA 3U1PA 4DUVA 3NSDA 3CN2A 1FORL 4PJBB 1UXSA 1GGCL 2R2HB 1QEWA 2UXGA 2YD5A 1FNHA 1BVLB 4ELME 3IMRA 3AT8A 2ZOLB 2Y7MA 5CGYC 5D7IF 4I0PC 4TULL 4N8CH 3UYPB 4E2OA 3K8KA 1G5AA 5D1QD 3KPSE 5C0FA 1PD6A 2ZCHL 2P5WD 3DKHA 4GQRA 3V0WL 3GSVB 3HI1A 4NAMA 4EN3C 4PBXA 1WO2A 2WBXA 4QRSA 1JI2A 3S88H 2FWSA 1ET5A 1I82A 3MRMA 2AABH 3NSJA 1S5HA 1N2RB 1NCJA 4Z78B 3FONA 3E9UA 1NOAA 3GS7A 4HMEA 1PVHA 1A0QL 2MNJB 4BZ2L 1XF1A 2FIKB 4C56D 2TAAA 4KXCA 5D2LA 3TEXA 5DURD 1EANA 2WLZA 3N06B 4IDJH 4M43H 2ETWA 3QQNA 2OSLA 3GXMA 5T5FA 5DFAA 3SKUD 3UBXI 5CN3A 1U3HC 3C09B 1TQBC 5T33H 4C4UA 4D0DB 5IJBC 4J5VA 3NCCB 1T83A 2JKJA 2P5EA 3CCHB 5FFOA 3SDAD 2ZXAA 3L95A 1AXSA 3WDJA 4Z76B 1CT8A 3QJQB 1OQXA 4ZFFB 5CEXB 2HVKB 4XCCH 5CJXA 2CG9X 2WIIB 3WO4C 2OMXA 1HHKB 3PDDA 3QWOB 3R19A 1EXHA 1KBVA 2GJZB 2QTEA 3SQOL 4U1NA 3ZKXB 3GIZL 3I75B 2GBAA 5I26A 4IBSA 2G5RA 5F1KC 4KZDH 5IB3B 1ZPLA 4J3OG 4ZUVB 4ZZKA 1NCDH 2AJXL 2Z7YA 2DIJA 3BT0A 1IE4A 1GC1H 2PO6D 3IDJA 4KV5F 1QBMH 1JNHA 2E9BA 3NP4A 1OWRM 3TZVA 3I2CH 5D2NE 1IC1A 5KYUA 3MRQA 4P3DA 5GHWL 3CFDA 1J9QA 1DVFC 3NCBB 3UYOD 1FV1A 4IRJB 4WJ5A 3S48A 1UT9A 1X5YA 4FQHA 1X5ZA 5HHOE 4TUJB 3BOVA 4WWNA 1CU4L 2NYKA 3IDXL 3VD9A 4KXZH 2MOGA 1K4DA 4P5SA 1HQRA 3HMXL 4BZ1L 4IK6A 4TS6A 3LKQA 5ALCH 3SPVB 1U0QA 3HG1B 5B8CA 2BSED 2RCSH 5C0BD 4DEPC 3P11L 3JZ7A 4OD2B 2YLHA 2NTSP 2MCPH 2OL3H 5HJ3B 1OQOA 1VFBA 2R0ZL 2M26A 2VLJB 1PEWA 4R3SB 2UUDK 4QOKB 1VKXA 4XNXL 1TG8A 3WUWG 2P4AB 3UBXG 1NFKA 1FVEB 4G7VL 2FZ3A 3OAUH 1XGTA 3QEHA 4M56A 4Z7VF 3C6LB 5D4HA 1BV8A 4NUMA 3T4YA 2B20A 2QQQA 3GLAA 1Q9WA 5K1VA 1OARL 4P2QD 2HFFA 3S36X 1I1CA 2VN4A 3DLQR 3MAWA 3QUKB 2VLME 4U31A 2BS8A 2XPGB 3QEGH 3TIDA 2B1AL 1FCGA 2KZ1B 2KZWA 4KKAD 4QRQB 3AG1B 3BGMA 3CDFA 1TKWA 2LOEA 3UPAA 1AXTH 2WSDA 3L5JA 1MW0A 4FNRA 4WI2A 1E2VA 2YC1B 4TLUA 1IQWH 2NRDA 2NNCA 5J1AA 5SWSD 3L16A 3ATDA 1VCAA 4YQXL 3F7VA 3NTCL 5K9OB 1QYGL 4WU5A 2H7WA 3FFCA 3A4AA 3LEYH 2DQJH 2F54D 2RR3A 3MREA 2MKLC 1IV8A 2YGOA 2WK2A 2R2EA 2DQEH 4AH2B 4BSJA 1P7HL 2NZ9C 2CRMA 2GC7C 3DYMA 3WJLA 2O4EA 3GKZA 4M61A 3MJ6A 2X28A 2BJMH 4MNQE 1EO8H 1H8SA 3IM1A 1XAKA 3NVQA 3D2UA 1KV7A 1AKJA 3PF2A 1GYCA 3GJFA 2BVTA 2ZAHA 2Y6SC 1BQKA 4X4ME 1Q0EA 5DK2B 4Q0XL 3UDWA 3MUGB 2DAVA 5JHAA 2DQUL 3DGDA 5BZWB 1JG9A 1LEIB 1WJ3A 1MIML 3FU3A 4ABUA 4R96B 2ZXGA 4F7MA 1AGEB 1VGKB 4MD5A 4AM0B 5M7QA 4HKBB 1N8OE 1MREH 4HAGA 4WNSA 4ZUSB 1G6RH 1PX4A 3S5LB 4QHPA 4JJ5B 4PJDA 3I9IA 1OVZA 2XHNA 5E6IB 4L4VB 3VACA 4EBQH 1I9RL 2YPVA 1FN4B 3QFDA 4M6NH 5ESVA 4JVWA 4Q9QH 3EXLA 3QIWA 1ZKAA 5EN2A 5C0NC 1QSFB 3KW8A 1YC7A 3AXLB 2NW3A 2AEPH 3L3DB 4X6BB 1OAXL 3BW9A 1CR9H 1EGJL 1G7PA 4HHAA 5J11B 1Q9KA 2CXKA 3TNNA 1RP8A 2F74B 3RVVD 3II3A 4Y2OB 5EBLB 3DROB 3DX9B 2HT2D 3HG0A 3SKJL 4EUPA 1T1XA 3CLFH 1LK2A 4AL8L 4U4IA 1KXHA 3HZVB 3RBGA 4CJ1A 1IGCH 1BQRA 3ZE2B 3W38A 4LCYB 2PKDA 1DQJA 4KOBA 3DJTA 1M7IA 4HUMB 4I5BB 1D5IL 4WHYH 1IGYA 3L9RA 4K3DH 4MAYA 3LXCA 3FUIA 4LDLB 2XTJD 5EU5B 4TNGA 2YD8A 3RVXD 2XX0A 2W0PA 3GRWA 5E5LA 4FLSA 4HXAH 3SKOB 3SDDC 4KXAA 3OKEB 4NQDB 4K7PL 3MUUA 5DEGB 3P30H 2FGWL 2IAMD 2HG5A 3CUPA 5AZEH 1QZNA 4O02H 4Z7UF 2IBZY 1WAEA 4FNTA 3GI9L 1G87A 4WWPA 5HDOA 2FIRT 1AGCA 1F1DA 3A6OA 4R97C 1CDIA 1S7XB 2OZ4H 4KJPD 1HYSD 4UOJA 3UEQA 3CFJB 3I02B 3ILDA 4MJIA 3MLZL 5AW3B 1G1KA 1QACA 3WKMH 3PABA 3VFVA 1GZHA 1T4KA 2AJUL 2R4SH 2YHGA 4LSRH 3ZHLA 4QCIB 4TQHA 4PGDB 1EZVY 1PTZA 3PJLA 4YE0A 2IBBA 1ZT1B 3M1OA 3WIIH 2R29H 1KIQB 4QPEA 5JHBA 4NP4L 1RULL 4N2MA 1OZUA 4TVUA 4P23B 2FB4L 2J44A 4ZMTA 4OT1H 2MQCA 4JY5L 4CMHC 4BH7B 1RL1A 2UX7A 3JT0A 3O2WL 3DX6A 3Q3GA 4Y8AA 2DI9A 4OI8A 4PVNA 1AS8A 4WVRA 4FYRA 4O58H 4PREA 2HTLD 2OI9C 3CXDH 1DQML 2EYRB 2NTFA 3OMIB 4TVPL 5F0JB 1SDDA 1YUHA 3VXRD 3AB0C 5B1CA 5AVUB 2GSIB 5CJQH 5E8OA 3BIKB 4FEIA 1F3DJ 1OCCB 3SJVD 4ZG1A 1V7ML 1VACB 3D12B 1OV8A 4AMWA 2ADJB 4EEEA 1XR9B 2BVPB 3ECUA 1DDHA 4OSUL 5I82A 1ILUA 2GJPA 2SEBB 5EBMA 4BZ2A 3H9ZA 3QFJB 4MJJA 4AV5A 2EE3A 5BVPH 4ZD3H 3QZNA 4L4TD 4OLYH 2YJQA 4BD4A 5IEKA 5KVDH 1ZE3C 3ROLA 1CE1L 1TVDA 1AD0A 3PHQB 5C7XL 3MV8A 1KIRA 4L0PB 2XXFA 5GJSL 3OPZL 3HG5A 4PU2A 4I1PA 2JI3A 4JGNA 2XZZA 1RFDL 1E40A 2BFVL 3HI5L 1N67A 4P46C 4CL7A 3MGOB 2WUBH 2XACC 3W3BA 5EWIL 5FV2A 3VE0A 4LARH 3ZZQA 2FWOB 3RNKA 1NGPH 3QJFB 2WN3A 3FAWA 1UTDA 5CCGE 1PYWB 4FQ1L 5FCUH 4MAUH 2CA4A 2E74C 1MFBH 2GFBB 4HU2A 4NN7C 3GGWA 5T3ZH 3W0WE 1NFDB 1NWOA 3GSUB 7PCYA 3GZPA 4OZHF 3RGVC 1CL7L 1MFEL 2UXVA 3B43A 3G6AA 3N41B 3QJUB 4FE9A 4ZQKB 2D73A 2OX5B 4ODTL 5DFVD 1OM3L 4QNPE 2XJKA 1A5FL 3KLQA 2DJMA 1RJZA 5HGAB 4I9WE 1U2CA 4ES9A 1F4AA 3UTQB 4Y19D 4Y4KD 2DB8A 4DIXA 2C3VB 3PU7A 4WO4C 1KTJA 4JDZB 4RIRA 4FG4A 1VADA 3T3PE 1NICA 1KGCD 2Y36H 2C3WA 2YFNA 1IZJA 3BQUD 3PJSB 3RX8A 4G6FB 3CQQA 5AB1A 2MNWA 3TX4A 4GBXD 3TPKA 4TL4A 1Z3GL 4BZ1A 3KDMA 4CAGA 3WSQL 3EOAB 4KZEL 3P4MB 5E1QA 1UM4H 4FTDA 4JFXB 1BAWA 4X9YA 3AGVA 2CLVA 4NAJA 3KEHA 4XNZB 3VFUA 1D5RA 2XV2A 3F6LA 4IOFC 2YAEA 3LRHA 2ITEA 2CDEB 5LBVA 2BIHA 4HGWA 5IR1A 3S35X 1N6VA 3R7QA 2ENYA 3ARDB 3M6DA 2VZUA 2CLRB 2V8MA 4FQXC 1CE6B 1PG7L 1NOFA 5E9AA 5KVEL 2R1YA 5B39G 1SJEA 4YBQC 3O8XA 3ZKMD 2TRYA 5GGTL 4GJTB 5IVOA 1AR1D 4P59H 2I32A 3TN0B 2EXSA 3NEEA 1ZWIB 3QQDA 4LXFA 1BVZA 4HJSA 5FKPB 2B39A 2F61A 3K7UA 5EEUA 2J1KA 4XX1E 1ZT4B 2E7BA 1BVNP 3LQZA 3O11A 5HHXL 3NCFB 3TGXA 4PG2A 4KKRA 5HD8C 3OG4B 1I53A 2AEQH 4NGHH 4FQQB 4NFBA 1EFXA 4PWKA 1FIGH 1XZ0B 4DVRH 3BH8B 4UB0H 3U1SH 3SGEI 4PJEA 1L6XA 3S8WA 4JKKA 3L5WB 1BQ5A 3RVWD 3AY4C 2EIEA 2UY6A 5J6SA 2EIMB 4FXKA 2EVGA 4DZBA 1U21A 2UVEA 4M02A 1UVQA 4LQ1A 5F96H 2YXVA 1YEKH 4YHYB 3CH1A 1BMZA 2D3LA 4LLDB 2Z31A 4X6CB 1RUAH 3C5SB 3KYKL 4HK0A 4HWUA 3D07A 3WHXA 2CCWA 5CWSA 3P2TA 1T6VN 5LGJA 4FFZH 1UURA 2C8NA 4YDNA 1MCKA 2W0FB 4FFYH 5EU4B 5FLUA 1MCBA 4ICWA 4LLMA 4EVNA 5E4EC 2GJ6D 4GXVL 5TE4L 3DVFA 3HZKA 2KKQA 2PXYC 2ZYIA 5BUPA 5F3BB 2CAKA 2YN5A 2P43B 3HS0A 2ZUYA 1LDSA 4K94L 2IANB 1AG6A 1L9QA 3A6CL 4UTBA 1A7QH 4JFPB 4NKMB 4TSCH 3TA3D 2XV3A 1R3IL 1O9WA 1IEBA 4NT6A 3KWWA 4WUUB 5AWNH 4FYTA 4TVPE 2OMUB 3ULSB 4F9LA 4OLVL 4JPKH 3W82A 4N24A 1OGSA 4F1ZA 1ZS8A 4FTVB 2EILB 5CEYB 4ZT1A 4UTAL 3QIUD 1JHLH 5FW7A 3T2NL 1VJSA 1JGEB 4BGDA 3U9WA 3B2UD 3SE9H 3QCTL 5CCKL 4U3HA 4EI5B 3BN9C 2HKFH 1PLCA 3RHWF 4FNPA 5KBPA 2EXYD 3X12B 2FEDC 1OTSC 3DK0A 1WGVA 4ZAKB 4F5CA 5IJDC 1Q0XH 5BZDA 4WV1B 3QPQD 1BM3L 2NLJA 3ZZ1A 5FUCC 3N42B 4CDHA 1DO6A 1ZANL 4DPRA 1Y0LB 2A77L 3WUZA 3SDYL 4M8VA 1CTNA 1D9KA 3CNKA 1XVSA 4G80B 4K7PY 3AADB 2ZWSA 1UD4A 4EAEA 3VI4A 5AVTB 2QGDA 3EKCA 3MLUL 2Y07L 1QNZH 4L0YA 5DJZB 3IKCB 2Q6WA 1E9PB 3WTYA 1WP6A 2X0UA 1SJMA 1ILSA 2V37A 4PP2B 1UUNA 3JXAA 4U3XA 4Y9BA 3C5ZA 1YEJL 4WI6A 4YSQA 3ZE0B 5I8OH 1QW8A 2BX5A 2WJ7A 3KVQA 2Z6FA 1R24A 4OD3L 3RJOA 3B37A 4RFOL 5HI5D 4AGMA 1YECH 4UM8A 5EO9A 1VFAA 2IPKB 2HN7A 2BIIA 3VFOA 4G9FB 4ZI8A 1CLYH 3LQAH 2I9LA 2PMZA 1D5XA 5AKVA