3BGDA

Thiopurine s-methyltransferase
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
232
structure length
232
Chain Sequence
PDAEVQKNQVLTLEDWKEKWVTRHISFHQEQGHQLLKKHLDTFLKGQSGLRVFFPLCGKAIEMKWFADRGHTVVGVEISEIGIREFFAEQNLSYTEEPLAEIAGAKVFKSSSGSISLYCCSIFDLPRANIGKFDRIWDRGALVAINPGDHDRYADIILSLLRKEFQYLVAVLSYDPTKHAGPPFYVPSAELKRLFGTKCSMQCLEEVDALEERHKAWGLDYLFEKLYLLTEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Substrate Recognition in Thiopurine S-Methyltransferase
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords Thiopurine S-methyltransferase
total genus 78
structure length 232
sequence length 232
chains with identical sequence B
ec nomenclature ec 2.1.1.67: Thiopurine S-methyltransferase.
pdb deposition date 2007-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05724 TPMT Thiopurine S-methyltransferase (TPMT)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3bgdA00
1SUSA 3WSTA 4FT4A 1G8AA 2IIPA 3OU6A 2PY6A 4DMGA 4FGZA 1WZNA 4MWZA 3NDIA 3I64A 1R8YA 2GAFA 3C3PA 4R8RA 5ICFA 5FQOA 1VQ1A 3NMUF 4V0QA 1VBFA 1AV6A 4CKBA 4YV0A 3OZRA 4MQ4A 3U81A 1MJFA 3KR2A 2BZGA 5GINE 1D2CA 1VP3A 5DTMA 3A25A 2OZVA 2PX5A 3DXXA 3HCBA 4RX1A 4DA4A 5FHRA 3T7TA 1EJ6A 1F3LA 3CBGA 1N2XA 3IV6A 3ELWA 4U7PB 2ZBQA 2PGXA 4QQNA 3FPFA 3GNLA 1WXXA 4OA5A 4E2WA 4EQZA 3HTXA 5E2AA 3V8VA 3HCEA 1RJFA 2IDJA 4YMGA 3LBYA 3P9IA 2ZBPA 2ZIFA 2F8LA 3MTEA 3NWEA 5F2OA 5BP7A 2FCAA 4RTKA 4RVGA 1AQIA 3DXZA 2NXCA 3V97A 2UYCA 2PXCA 1KPGA 3T7RA 2P7IA 5E1BA 3TR6A 3DMGA 2FRXA 9MHTA 5DX0A 1B42A 2P35A 3GRRA 2FPOA 3LL7A 4PWYA 4YUVA 4PNEA 2ZFUA 3EEYA 4DCGA 4V0RA 3AWIA 2IDKA 2OKCA 1BOOA 3M6XA 3UJ7A 4BP1A 3HVJA 4HTFB 3LCCA 5EGSA 3GJYA 3HVHA 2IH2A 3FPHA 1BKYA 2ZZKA 4DZRA 5CIYA 1RI4A 3R6TA 5HFJA 3C3YA 4RVDA 4RTSA 2BH2A 3ID6C 4GOND 1XXLA 3B3GA 3FYCA 4YV2A 5DXAA 3EEOA 3DUWA 3P2EA 1XVAA 1ZHFA 1JSZA 2PT9A 3OZTA 2CKDA 5LQJA 1JG1A 4RTMA 4PIPA 5E1OA 4YV1A 5K03A 2C7RA 2ONYA 3C6KA 4PCLA 5EEHA 1VL5A 1YFJA 1FP1D 3LDGA 3MERA 1NKVA 3DR5A 3HEMA 3PB3A 3PFHA 2NNWB 3BGIA 4FP9A 3LPMA 1G6Q1 2PSSA 1EJ0A 3OPNA 4F85A 4FR0A 2I6GA 2ZZNA 1QZZA 1SQGA 3F4KA 3EVBA 5E8JA 4E30A 4HGYA 3DTNA 8MHTA 5FHQA 5EZQA 5FWDA 3FZGA 5KS2A 2PWYA 4MTLA 1UIRA 2PV0A 3KQYA 1RJGA 3SR4A 5DM0A 3AY0A 2EJUA 4AZVA 2B25A 2ERCA 5CCBA 4PYJA 1L3BA 3DP7A 3LKDA 3M33A 1PRYA 4AZSA 1NW5A 5JR3A 4HG2A 4IWNA 3HA7A 3MGGA 3BWYA 3UJCA 2CMGA 4WVLA 3CKKA 4BP3A 4B17A 3ORHA 4R05A 2JHCA 5GM1A 2XYRA 3SSNA 3HNRA 5GP1A 5D1HA 4RTQA 1ZG3A 4JXJA 5DLYA 3P9KA 2KW5A 2AOTB 2B78A 4XUDA 3GU3A 1HMYA 5DM1A 4BY9E 3REOA 5GIPE 1XJ5A 2NXNA 2VS1A 3MTIA 2P3OA 3PVCA 4KW7A 5ERGB 2ORED 1Q0SA 4C4AA 4CTJA 3BGVA 5DSTA 1BC5A 3B3JA 1IXKA 1NT2A 3QOXA 1O54A 3KPVA 3T0IA 3DXYA 4C07A 3A7DA 3GXOA 2YUIA 5DX1A 1JR4A 2AOTA 1KPHA 4OBWA 2IBSA 4GOMD 1X1CA 1KYWA 2LD4A 2B2CA 3BT7A 2G1PA 2VP3A 2OBFA 5E9QA 3EVFA 1EIZA 3HM2A 3JWGA 4M38A 3B7PA 3CJQA 2PX4A 1WY7A 4QQKA 2YXDA 2ZVJA 3UA3A 3RIEA 1PJZA 2R3SA 3P9NA 3T7SA 4RTJA 3LKZA 3ELUA 4GF5A 3H2BA 2ONZA 3P2IA 5E1DA 2UYQA 4YUZA 2P1DA 2K4MA 1KXZA 4IKPA 2ZLBA 1YB2A 3G8AA 5HEKA 2H00A 2I62A 7MHTA 5EMKA 2ZULA 2AS0A 1X19A 5C1IA 1O9GA 3P2KA 3SSOA 3UJ8A 2YTZA 3LBFA 2AOWA 1DCTA 2AN4A 4CXMA 2GS9A 3B3FA 3GDHA 3PLAE 3LDFA 3VC1A 2HWKA 5EIFA 4HC4A 2QY6A 1I9GA 2OO3A 3TOSA 1NW7A 1ZGJA 3PX3A 2C7PA 2Z6UA 4GOOD 2DPMA 2P3LA 3BGDA 3HVIA 4C04A 4E2ZA 3E7PA 2FHPA 3ME5A 1TPYA 1Q0TA 2R6ZA 3LX6A 5EHGA 3SX0A 4PONA 5GIOE 3EVDA 5K01A 4E70A 3KPYA 3K0BA 3MCTA 1D2GA 3FPJA 1X1DA 1XDUA 1VP9A 1FPQA 4KDCA 5HZMA 3TKAA 2AOVA 3FUTA 2O07A 1I1NA 3OZSA 4GOLD 3THRA 3FTEA 5HIIA 1X1BA 5ICCA 2V74B 2VDWA 3FPEA 3FTCA 4EKGA 3B5IA 1N7JA 2QRVA 4KWCA 3G5LA 4Z2YA 3EMDA 3G2OA 4FSDA 3K6RA 5M5BA 3ER8A 2CMHA 2GPYA 3KPWA 3KQWA 4QDJA 4M37A 2Z6QA 1MHTA 3NJRA 4A6DA 3BXOA 1YZHA 4NECA 5MHTA 5FTWA 4XCXA 3KQVA 3OCJA 4PGHA 2AOUA 5DSXA 4YUXA 4U7TB 4OA8A 3ERCA 1N7IA 1WG8A 3KR1A 3NVMB 4OQEA 5DTQA 3UZUA 2ADMA 3B89A 2NP6A 2GA9A 3DMHA 2Q41A 4OQDA 1DUSA 4Y30A 5T64A 5DWQA 5CVDA 5K0CA 1BHJA 1WXWA 1JTFA 1JTEA 1SVUA 3TPZA 1KYZA 4CTKA 1KPIA 5KQSA 5BXYA 1SUIA 2FYTA 3D2LA 3FRIA 2OY0A 5KYGA 2BM8A 1YFLA 2JHPA 4ER0A 1NW8A 4EK9A 5CUQA 3PT9A 3G88A 4FS8A 3JWJA 3FRHA 5DM4A 3HCCA 3L8DA 2PX8A 1RI1A 1G60A 3G2MA 1JQDA 4LG1A 5DXJA 1R00A 5ICGA 4E31A 3JWHA 3CCFA 3R3HA 5KQRA 2ZZMA 3LDUA 5LQCA 2PWPA 2AZTA 3ELYA 1TW3A 5GM2A 3VYWA 2I7CA 1KHHA 1NW3A 3CVOA 2P7HA 3OFJA 2ZCJA 4ISCA 5EHIA 3KQOA 4PINA 5HIMA 3UWPA 1NBIA 3GO4A 4GC5A 3E23A 1RJEA 4QPPA 4RTPA 3FPGA 3G8BA 2PBFA 5DRTA 1U2ZA 2H1RA 4LWOA 4GEKA 3ER9A 5LQUA 1VE3A 5CM2Z 4KVZA 4E32A 4PYLA 5K0GA 4K6MA 1JG2A 3DLCA 5DT2A 4GBED 4POOA 2YX1A 2AVNA 3NTVA 4FZVA 3SXJA 3TRKA 3KR0A 4RTNA 4KRGA 5E9WA 5H02A 2IPXA 3BZBA 3UJBA 3E8SA 1QYRA 1R8XA 4RV9A 4RTOA 5CVUA 2O57A 3DMFA 2O0LA 1FP2A 3G89A 2ZWAA 4M7RA 3BKWA 1G55A 2IFTA 3DOUA 5GOZA 3TKYA 1INLA 3Q7EA 4ZTBA 4YUYA 2C7QA 1TW2A 2PXXA 3NWBA 5T67A 4PYOA 2HR1A 4R6WA 3G7UA 2YR0A 2Z6AA 3MHTA 3CJTA 3O7WA 5EOVA 1R18A 4QTUB 3LCUA 4C08A 1NBHA 4PYKA 3HA5A 3G5TA 2GH1A 4E2YA 2NXJA 2ZSUA 2EFJA 3A4TA 3PTAA 4M36A 2PKWA 3A26A 2HTEA 2WA2A 4OBXA 1EQAA 2UYHA 3EVGA 2EJTA 2XVMA 2NXEA 5K05A 3AXSA 4F86A 5K0JA 4PYMA 2IP2A 3X0DA 3GRUA 4YUWA 1F38A 4PYQA 1P1BA 5DX8A 5CCXA 5EG5A 2P41A 5D1NA 3TMAA 1X1AA 4RTRA 3NDJA 4PGGA 4RVHA 1YUBA 2FK8A 3AXTA 4XUEA 5F2NA 5K0EA 3KQMA 2BR3A 2GB4A 3A27A 3P71T 1ORHA 4RYLA 4DF3A 1ORIA 5T6BA 4ER5A 3KQTA 2IGTA 1JQEA 3EMBA 3TM5A 4DQ0A 1P91A 3HA3A 3IHTA 2I9KA 3LHDA 3QOWA 4A6EA 1H1DA 3M6VA 3MCZA 5DPMA 3NVKI 2WK1A 5IH3A 3LSTA 4RSRA 2FK7A 3UFBA 4XUCA 4IV8A 2OPBA 4HSGA 5P8WA 3HCFA 2YXLA 3HP7A 1IM8A 4P7GA 5F2KA 3VSEA 1YF3A 2BR5A 3R9XB 3AJDA 1KIAA 2AN5A 3I5UA 3LECA 4HH4A 2QM3A 2QE6A 5LQAA 3GRYA 5B1SA 3C6MA 5C9ZA 2P3QA 3TLJA 4QVKA 1L3IA 4RTLA 5CVEA 4KIGA 5K0FA 3BWCA 2VDVE 3P9CA 4LECA 4X63A 5K0NA 1UFKA 1JSXA 3KPUA 4HRAA 4HTFA 4EKIA 3LGAA 2HMYB 2ESRA 1NV9A 4AZWA 2JH8A 1HNNA 1AF7A 1NW6A 2EG5A 3DLIA 2PVCA 4F84A 2QYOA 2Y1WA 3RW9A 3SVZA 3VC2A 5LSAA 2P8JA 4ATNA 1M6EX 4AUKA 3DULA 4YMHA 1O9HA 4O29A 3MAGA 1DL5A 3I9FA 3O31A 3EVAA 5K8VA 1KR5A 2ZWVA 4BLUA 3S68A 4UOEA 4GQBA 3SM3A 4ER3A 3M6WA 3TQSA 2GLUA 3KKZA 3GRZA 3PX2A 2QRVB 3KQPA 2CWWA 2XBMA 3EPPA 1L3CA 4GC9A 5CVVA 1Z3CA 1NV8A 2AN3A 2OB2A 3Q87B 2DULA 3P8ZA 5FCDA 2IBTA 2B3TA 4IV0A 1SG9A 3OE4A 2AOUB 3TFWA 4ER6A 4R8SA 5U4XA 4P7FA 5G02A 2XYVA 4DM3A 1T43A 5DTRA 4FT2A 3MB5A 5LQRA 1YZ3A 2G72A 3BUSA 5EEGA 1G8SA 2VZ9A 1QAQA 3FUWA 3FTDA 4AX8A 1FJXA 3FTFA 3EGVA 3GWZA 1RJDA 3HCAA 4BLWA 4QVGA 2IH4A 3NW9A 5E2BA 3M6UA 5EKUA 5EKXA 2C7OA 3HCDA 4CWAA 1V39A 5FULA 3EGIA 3EVZA 3KQSA 2PT6A 4OX9Y 1D2HA 3FUXA 3GIWA 3I58A 3KPJA 3M4XA 4LWPA 2CL5A 5EC8A 4GUAA 4EMSA 3KR9A 5FQNA 4WXHA 5K0LA 2B9EA 3OE5A 3BWMA 5EMJA 5GWXA 1SKMA 5FADA 2PXAA 3SSMA 4QTTB 4PIMA 5E9JA 5FA5A 5K09A 2OXTA 4E33A 3GGDA 2XVAA 4FSXA 3UJ6A 2ZTHA 1L9KA 3UA4A 1ZQ9A 3MQ2A 2VDUE 2XYQA 3OU2A 5DRYA 2ZBRA 2OB1A 5FWAA 1OR8A 4CKCA 5ICEA 4RWZA 1VLMA 2PJDA 2NYUA 5E8RA 4X41A 2AOXA 3ANXA 3R0QA 5HIKA 2P40A 1JQ3A 2YQZA 5BW4A 3GRVA 3UBTA 2ZIGA 2BM9A 5EVJA 5BW5A 3IYLW 3FUVA 3KU1A 5EPEA 3UJAA 3KHKA 3G2PA 2O06A 1QAOA 2G8NA 3OFKA 5EZSA 3UJDA 3CJRA 1WS6A 3QV2A 3CGGA 5DM2A 3G2QA 1VIDA 2PX2A 1L1EA 1NE2A 1EG2A 1P39A 1VPTA 3BWBA 1XTPA 3EVEA 4H0NA 4PYNA 2OYRA 4EVIA 2WA1A 1IY9A 2BR4A 4QDKA 2ZIEA 5FUBA 1XDZA 4C05A 3SGLA 2O05A 2YVLA 1SQFA 4X61A 1Y8CA 3GCZA 3TM4A 1M6YA 4PCAA 5LR6A 2H11A 3JWIA 3PS9A 5CVJA 4P58A 4C06A 4X60A 5EQJB 1XCJA 1ZKDA 1JG4A 2HV9A 2YXEA 5E1MA 4C03A 3E05A 4HGZA 5EMLA 5C0OE 3M70A 2G71A 4X1OA 4G56A 2NP7A 4Y2HA 2EX4A 3ELDA 1QANA 3EVCA 3SMQA 4P7JA 3FYDA 3THSA 4CKEA 10MHA 4BLVA 3OU7A 3FUUA 2JG3A 3R24A 5KVAA 4R6XA 3LCVB 2IH5A 5HIJA 5K0BA 2Y1XA 3PFGA 5HILA 1R74A 2HNKA 1AQJA 1RI2A 4RVFA 2A14A 3HVKA 3BKXA 2E5WA 1M0EA 1XDSA 3CC8A 5FA8A 2JHAA 1R6AA 3A7EA 3DH0A 2UYOA 4L7VA 1UWVA 4QPNA 5LQNA 4KIFA 5EMMA 2JH9A 1RI5A 3RODA 2UZ4A 1RI3A 2ZW9A 4PYIA 3O4FA 1P1CA 4AZTA 3P97A 5JUWA 4P7KA 4KDRA 2V7EA 3EGEA 1EAMA 5CD1A 2AVDA 3C0KA 1JG3A 1XCLA 4ER7A 4E2XA 1I4WA 3UJ9A 4DKJA 1KP9A 5EIWA 1ZGAA 3KQQA 1G38A 5IKMA 2PLWA 3IEIA 4MIKA 2AR0A 4DCMA 5HOQA 5LQKA 4MHTA 1FBNA 2JJQA 1QAMA 2N47A 3I53A 2G70A
chains in the Genus database with same CATH superfamily
2G76A 5DO9A 4FT4A 1VJGA 3GC6A 3OC0A 1G7RA 2G67A 3AOGA 1G9XA 2RB4A 3AMVA 3N2IA 1T2EA 3EWSA 3WLPA 2LP4Y 1ZGHA 4L4ZA 4Q4JA 4DXAA 2G63A 4J43A 3SZLA 4B82A 4B3TB 3V6LA 4LGMA 1TX4B 3OBIA 1N77A 1VJ5A 2XNHA 2YXBA 1EFUA 3PXCX 4QXQA 2VKQA 2ZIAA 4JYZA 3LLMA 2GA8A 1AUVA 1MJFA 2YBDA 2WYHA 1I3KA 2YQ5A 1ESNA 1K27A 1EXVA 4NATA 3DXXA 2IS6A 3AJRA 5J23A 4A0GA 2D1QA 1TZMA 3HYTA 3L0DA 3KAPA 3CNLA 3HTXA 4WH0A 4WECA 3V8VA 3NHMA 3ND8A 3A6LA 3FDZA 2IYWA 3LK7A 1BWSA 5B12A 1MV5A 3CVJA 3MXOA 4F56A 3U7GA 3IPRA 3V3TA 3VBCA 5EERA 5A0TA 4UHEA 1GGFA 1EM8A 2HBZA 1YZUA 1R2QA 2IW1A 1CQZA 5IAGA 4EMBA 3DFZA 3BRCA 3PUVA 4NHOA 4WV3A 4Y3UA 3TR6A 4EMTA 3ADDA 3M5CA 1XYYA 3NBFA 2BOVA 3NKFA 4R01A 4R7TA 4W5RA 2FQ1A 4AU1A 1B42A 2XBLA 3GRRA 1Z4MA 3GGGA 3ZDFA 3SS7X 1SWWA 3G85A 3AZOA 1KSGA 5A2GA 4DHWA 4LYDA 3LKVA 2H2GA 3OHSX 1TEXA 3IPCA 2B69A 2B1GA 4UKDA 4XQ0A 1LK5A 3RYHA 2QORA 1Z13A 4ZQIA 3S2FA 5BNWA 1JXOA 4TMYA 2L18A 2JFHA 1M7HA 2R6HA 2WZDA 1IBRA 3OOSA 4UU8A 4EFLA 2OCYC 2X0NA 2J3MA 4IXNA 5HGJA 2A9VA 4L4UA 1JPUA 2F3UA 4HXFB 2YJTD 4DV4B 3KWJA 3PA8A 3HU3A 1Z4OA 1VCIA 4MEBA 1ONBA 1YNSA 2P6PA 3PITA 4QGBA 2VJMB 1RDFA 2I76A 2WM9B 3GGCA 3JRNA 1LVUA 3QBJA 4U0JA 1R5BA 4U63A 4FIZA 3E9RA 2C8JA 4KJXA 1I2ZA 1J24A 1U3GA 4RLQA 1IN5A 4ZGGA 2BZ1A 4CR7A 4MYRA 4LNUB 1NKVA 2P1RA 4L7QA 5K3FB 5K8IA 3BBPA 3C4QA 4P54A 5AIBA 2PU7A 2GHIA 3H99A 1W5SA 4MCHA 2PSSA 2UAGA 1EJ0A 2C97A 3K30A 1SRQA 3L01A 1I2CA 1W35A 2DBVO 1ODFA 5DI9A 2AD5A 3UJHA 5SICE 4F92B 1JQKA 2BFDA 4QFDA 1SK8A 2OBLA 2QGFA 3AF3A 5F12A 5B53A 4BQSA 4PG6A 3PLNA 1WDWB 4BKPA 1FA9A 5EVCA 3QEBZ 3F7MA 1XAGA 4GNKA 2W9XA 3U3MA 1PBNA 2IU4A 1EFHA 1UZAA 1PI3A 1NW5A 4KO8A 5JR3A 2ZI4A 3A31A 1R6BX 3Q2OA 2G77B 4WESA 4WOBA 3SSAA 3EH1A 5JZSA 3A1VA 2DQSA 1KU6A 2A4MA 4MIEA 2E4ZA 3PHLA 4MRPA 3Q3VA 2WDPA 4D0LB 3JVVA 3WJ7A 3JQPA 5EJ8A 4K8RB 4DV5B 4JLNA 5J2UB 2YJ3A 3CLUD 4JBNA 1V16B 4HSEA 1D8TA 2AOTB 3H16A 1GDHA 3GU3A 1ULUA 5ALDA 1K92A 2Q7OE 5BN5A 3QZUA 5H9VA 1ZLXA 2IHUA 4C0BA 5CCDA 4DMRA 3GLFB 5LMNB 5GIPE 1MXFA 2AV6A 1O3YA 3HL0A 3I3OA 3CNQS 3QVKA 1P9WA 2YNMD 1RCFA 2ZETA 3D54D 3DZDA 3ZD9A 1AGRA 1EUZA 2YDYA 3DXYA 4N8EA 4TXHA 4XWTA 4JT4A 4EVRA 5L40A 2YV2A 1JDTA 1TLFA 5EJAA 1DCMA 2TECE 5ALTA 1MT3A 1RHUA 3OE1A 4GOMD 5TPZD 3UTCA 3VTAA 4EATA 2CCGA 4Q1VA 2Z2IA 1A72A 3IS3A 4US0R 3ZIAD 3WIEA 3PQ4A 1EIZA 4MP6A 3H9EO 3NEYA 4DS3A 2H16A 3C6BA 1F8YA 2HIMA 2CDBA 1PJZA 1PL0A 5K45A 2DT5A 1B1CA 3A6HA 5ED0A 4YASA 3BJMA 2K7FA 4U1RA 3P2IA 1JIVA 2ZUFA 3Q15C 1TKAA 4IIDA 2FEAA 4UMFA 5FD8A 5HF9A 3ZPXA 5KQMA 5JVDA 1IB6A 1KJWA 1EH5A 2GD6A 2VWGA 2WV7A 1VCMA 3N7AA 4B4DA 8GPBA 3N2GB 4QG7A 3K6SB 1KBQA 1SFRA 2EF0A 2XWBF 3A9VA 4IDDA 3W06A 5F21A 1I9GA 3FGZA 2XGSA 4JITA 4JENA 1ZUNB 4KVAA 2FWJA 1CP3A 3AEUB 1O8BA 3S0JA 3WKBA 2WKSA 3HGTA 4U2GA 4FOPA 2IE0A 4JBGA 4MIYA 2CVHA 1SQ0A 2XOKA 4P98A 5FOSA 1NDQA 2OT3B 3AONB 1KIFA 3LNTA 3T4EA 5JOQA 3ZNPA 1F4VA 3GRFA 3H3JA 2QRNA 4GYKA 2XOEA 3FPJA 3ZE7A 1RBMA 4DUGD 4N65A 1D7AA 1XVLA 2HC9A 2G9NA 2O07A 3QLUA 5JCXA 2VSQA 4GSKA 4JI3B 5L7WA 4KLAA 1KQ3A 2O5EA 4X71A 4UMDA 1N2CA 4OK6A 5E4TA 4QYMA 2PLAA 4LYYA 3KYIB 5SYAA 5JQGF 1KARA 1U99A 3PC8A 2QTZA 2CMHA 1BXZA 1VSUA 1AIPA 4B3DA 4G9EA 4ZMSA 1NUSA 2FEPA 4IJQA 1HSOA 2DB3A 3UQYS 2FPRA 1PLJA 4S3MA 2AXEA 1L8XA 1W36B 1X7WB 1JHXA 1PGNA 1SVSA 3G7NA 3GLRA 1E4EA 1ZIXA 3IAM6 4J3FA 2QQ0A 2JGNA 4CE6A 4A15A 4QUKA 3BZUA 1TVEA 4ZXFA 4E11A 4KAXA 1WV1A 3OOHA 3STWA 5FBLB 3V9PA 3ANMA 4AECA 3RTEA 1P9LA 3ZU4A 1CVLA 2MJLA 3HZOA 4PQGA 4DIDA 1LV8A 2ORWA 3L0ZA 2HXYA 3PUIA 5CHYA 2QDXA 2G3YA 5KYVA 4HDMB 3ZWVA 4DMHA 1PT8A 2GCIA 1A27A 4GKBA 4HAVA 1I7QB 2H18A 2CV1A 1Q3HA 3RT7A 2J9YB 3PPVA 1WPGA 3DAOA 3RS5A 4XEHA 4MVJD 1BN7A 4XJSA 3OTWA 2Q3CA 4A0HA 1P81A 3NC0C 3O8OB 4LC1A 4PG7A 4Z2AA 3GBSA 4GR4A 4IGAA 2Q29A 4JCCA 2Z04A 5ALSA 3LDUA 3Q3CA 1FMLA 3T3PB 5H4HA 3ELYA 2VYFA 5GM2A 3V8MA 5BNTA 3L3BA 4M9ZA 3SYLA 1JZSA 4CODB 3T5DA 4Q1AA 1CU1A 2AKYA 3JQAB 1T26A 4TYMA 2Z9DA 2R8OA 2RGEA 2RK4A 3S2YA 1F12A 2AA3A 1OAAA 2R1TA 5CM2Z 5CFZA 5CXUA 1M5TA 3UN1A 1UT6A 2HHAA 3TDMA 3UIEA 2WG1A 5K0GA 2UU9B 4GRDA 7MDHA 3U0VA 4P36A 1L8AA 1QUEA 1W36D 1IEWA 1L7RA 2JHGA 2GWHA 3KR0A 3TAHA 1HDOA 4GLLA 5F23A 4JUDX 2QNRA 4HYQA 5E6UB 4KPEC 1GWNA 2P69A 4RV9A 4KUGA 1YD7A 3BS4A 3IHLA 2AI2A 5TNXA 2J5BA 1QE0A 3K92A 1DRUA 3Q7EA 1MCZA 4UCWA 5FWYB 1OLUA 1M73E 3H8SA 5F35A 1TUEA 4WE3A 1G291 2R8PA 3L43A 3PDJA 4WCFC 2WAOA 1ONNA 2YZMA 5F1KA 4YGXB 3T3GA 2FPGA 2PX6A 1I0ZA 6REQA 1OTYA 4XAQA 3G5TA 2YJZA 2IPOA 3A4TA 4INJA 3CVWA 3ABIA 3LHSA 3B6IA 3KT6A 3PDWA 2HTEA 3DL0A 3CVVA 4KACA 1C9NA 1H69A 1UINA 3ECAA 1RC0A 4PC2A 3ZWXA 3NTQA 1EFVB 1YVUA 3R3UA 2HNAA 3BXZA 2YJ4A 3QMPA 4OAQA 1G17A 2O3QA 2GLXA 3TRDA 2WU8A 3VSBA 3EN0A 2MSCB 1B0UA 1LVGA 1Q84A 1EE2A 1F38A 1RMQA 2FEWB 2Z2JA 2ZJ3A 3BDVA 1YA4A 3GRPA 4NZYA 3O8QA 2Q2VA 3WBFA 3NDBB 1PR9A 4CJXA 1QHGA 1ID1A 3NDJA 2ISCA 3TGWA 4XGRA 3OZIA 4XUEA 3WGVA 4U6QA 1RQNA 2Y4OA 1ORHA 1B43A 1JFVA 1SCUB 2P0AA 3IJEB 3PNBA 2JFYA 3R1IA 3BRWA 2YFQA 4ND6A 5TQ0A 2Q5FA 1WZEA 5CLQA 4ER5A 2VQFB 1IZ0A 4R31A 1IWOA 2G1AA 3HKDB 2KI5A 1MEOA 3DMNA 1NXWA 5GOTA 2LBPA 4N7JA 3RC2A 3HKCA 3A9WA 1ISIA 3JZDA 1E2EA 1HI9A 3LSTA 3RANA 3WNCA 4DFDA 1OFUA 1UMCB 4BS9A 2VRCA 1QTNA 1RYNA 1R6TA 4Y9RA 2X2EA 4AI6A 1W2GA 4HRVA 5EJFA 4IILA 3WLAA 2K2QB 4DMCA 5ULLA 2XB9A 3G2JA 1B3RA 4P38A 4Z53A 4E03A 3F78A 2VJAA 1AS2A 4EGFA 4CT0A 4X64B 4U7JA 3GJ4A 3OZ7A 2WQZA 4H7JA 4Q05A 4MUXA 4P9NA 4ZD6A 4AVYA 3PEYA 1HFEL 1DXQA 3QJ5A 1L3IA 3UOWA 3AINA 3RYHB 2B4AA 4RKWA 5DASA 2AW3A 2V8BA 4RU1A 2AUMA 2P4QA 3R5JA 5K0ZA 1MOQA 2SKCA 1X1QA 3FUCA 4P22A 5KJFA 2ZM6B 1HG1A 1ZXBA 4PLFA 1WJGA 4RHEA 3ZD6A 2B8NA 3KZOA 2Y99A 1OYWA 2NYRA 5H0IA 2VSXA 1ISPA 2GCNA 5BSMA 4DLVA 3ZOKA 1JIQA 5I8WA 3OSZA 4KR2A 4MV4A 3EVAA 3T34A 2VATA 3UM9A 2OC9A 4F4JA 2QJOA 3W34A 2DP4E 1B0AA 2X13A 2A78A 2XTJA 2CFOA 3U3DA 1VSQA 2QUBA 1RVV1 3NPAA 2RBGA 1GPBA 3KQPA 1NOIA 3NHSA 1E89A 1I0IA 4NP6A 4BVHA 5GZ1A 1GAEO 3VRHA 4JL5A 3SF8B 2WUDA 2NU8A 2UZ1B 4LWZA 1FVHA 1KO8A 2C2XA 2RI6A 3BMXA 3NHWA 4Y9DA 4JLBA 2BDUA 2ZJ1A 3HGQA 1JPJA 2MSKA 4P7FA 1HLGA 4FDTA 4G1FA 1V4NA 2Q6KA 3HUDA 1ZI9A 1E6CA 2QUAA 3H9JA 2LNDA 2ZJZA 1HT3A 2OHGA 3KOUA 1WCIB 3JZFA 1AQYA 4DA6A 3ILHA 2E85A 1N5JA 3P2JA 4UFPA 4BJ1A 3CPSA 2ZVPX 3F9CA 2R2GA 3B36A 3PNLA 4MTCA 1LNQA 1E2LA 5C31A 3R74A 4ZCQA 1W2WB 2VYND 3K0FB 3UOAB 5I48A 3FFWA 5KSYA 4WNAA 4ILEA 1X2EA 2C96A 1LZKA 1WXDA 1YQGA 1C7IA 2Q4EA 4WESB 1D2HA 3BMOB 4X5OA 4XH9B 4ZOQI 2OMKA 4BCCA 3K73O 3GMIA 1VDZA 3IAEA 5FQNA 2ZXEA 1NXVA 1JA1A 2B9EA 5KYTA 3AG6A 1C1DA 1NT4A 4RE6A 1IY2A 2VJNA 2H1VA 3CRVA 3ZU5A 2GCEA 1VGRA 4GXTA 2C94A 4WXMA 2EJBA 4CUKA 3ORSA 4YXFA 1E9VA 1FQWA 1L9KA 1QVVA 5EYPB 3TOXA 4Z4QA 2ZIWB 2BSQA 1G18A 4YDQA 5A5VA 3E7FA 4NCBA 1E79D 1NBAA 4L15A 5JRDS 2X2PA 3HCNA 4WBSA 3KT8A 2I67A 4JKIA 2PUCA 3KTAB 2NUAA 2J46A 3K8OE 5FNVF 3M81A 2ZOSA 2OOSA 1GDDA 1I5RA 5I4IA 3K6JA 1LWOA 1W36C 2E87A 1JDNA 4ZV9A 3KHKA 5BV1A 2RE8A 4LOLA 4KXWA 3AG5A 1P2FA 4FGJA 1E60A 1CF2O 3EC2A 3C97A 4FMCF 4YDRA 4BQFA 1BMFA 1MNAA 3IJRA 3OZCA 2GNAA 3PPXA 2CNDA 2HK9A 4RZ2A 1P39A 3LDAA 1FUUA 2QNBA 2FWNA 4NFHA 2RB5A 3TSOA 3VR3D 1EESA 4IXTA 3K9GA 3IT2A 4W7SA 3EGXB 2W6IA 1HZZA 1TO1E 1UKAA 1YQQA 1U2TA 3CE6A 3P52A 1JFTA 5AOBA 5I9NA 1DXOA 1NI3A 2QN2A 3DNPA 4BC1A 3PS9A 4HWGA 1GTSA 2ZB3A 4C03A 1RPJA 1DEXA 1V1MA 3UAWA 4HNRA 3V1MA 1SOUA 3U5ZB 4NFYA 2CV2A 5U4QA 4GKAA 4HUQA 4JVSB 1AY0A 4Y2HA 2DJ5A 2GT1A 1M2OA 1ICEA 3CT6A 3GAZA 1DX4A 3RV3A 3WKAA 1P3DA 2JLAA 4QU0A 1PGJA 2CXXA 1CQIB 5ELXA 1HDCA 3THYB 4MWGA 3ADBA 1CD5A 4RL6A 4G86A 4L4SA 2PUJA 1OXUA 4Z1MA 1YRHA 4YCAA 1H85A 3DV9A 4RVFA 4XPIA 4KQMA 5CYOA 1U28A 1XDSA 3ACCA 2JHAA 2UZ4A 2XHZA 3OZVA 4Q7MB 4I50F 4YHHB 1PNRA 1DAPA 5JUWA 2QTRA 2XVYA 1OA1A 2FMFA 2D2VA 3R6WA 1BH2A 4Y0AA 3RTGA 4DJEC 3M7IA 4K6HA 2V7VA 3PR2B 2AJ8A 4B6JA 2BEUA 3FCCA 3QX7A 1UMCA 3HV2A 4RZUA 3T61A 4KMOA 2IV3A 1M2NA 3IP3A 3M9XA 3H1TA 2HN9A 4M1TA 1DBIA 4YMIA 1QAMA 5KO2A 4ALLA 1JBEA 2CXOA 3FZQA 4IDHA 4JXXA 5AOCA 2RGGA 3OT4A 3IBFA 5FNVB 4GKVA 5EJGA 5ALHA 3TW0A 2PUAA 3B6KA 3E03A 4Y6GB 2GD0A 5CJ2A 2VWQA 2GAFA 3VKFA 1HNXB 4OLHA 1QHFA 2ZYIA 1M7GA 3IT3A 2IYQA 3ZEAA 3H5OA 3L07A 4NQZA 3BICA 4E7OA 1KI9A 3GEBA 3I83A 5AW1A 3KD3A 4G24A 5FHRA 4ZAXA 4PG8A 2VYVA 3OIUA 3JQ7B 7AT1A 2ZBQA 3L02A 2C95A 1DJQA 3H6HA 4PX3A 2GBGA 4I5EA 5F98A 2F9FA 3VSCA 5BSHA 3FCEA 1CEYA 5TARA 3HJGA 3LBYA 5LQMA 4YRDA 3CWZA 3TTUA 2DH5A 5I47A 1FUIA 1FTYA 3QQPA 1ZUNA 3ZTYA 5AO9A 4DABA 5LZ9A 3UMVA 2ZE5A 5KKCA 3T52A 2Z2ZA 3FBTA 3VR4A 1NU6A 3CU5A 1PR2A 4XUGB 4IEIA 5B37A 1P1HA 4LRWA 2C0PA 3OY2A 4BO5A 1KDRA 1PK7A 1UMBB 4YUVA 3I62A 2UUAB 1PNQA 4KQ2A 4NDZA 8AT1A 3PSAA 5CH5A 4KQIA 3AETB 4KTTE 1G5HA 5ALKA 4ZKEA 5JS8A 3UJ7A 1JDJA 2OCBA 3BIOA 2YVAA 3H2KA 3L8MA 3D8RA 1N8NA 4FYYA 2PDAA 5CFQA 1M6VB 4IJKA 1JEAA 5AJVB 1QTRA 4RVDA 3DOIA 2A35A 4GI7A 1IQ0A 2GK7A 4MIOA 4RY9A 5C8YA 4R8LA 1CUHA 2KYRA 3HP1A 2R6GA 3O94A 1C1DB 3WFJA 4PN7A 4PIPA 1ENZA 1PZEA 3NBMA 2H9AA 1AXGA 3HUUA 2VCHA 3LIPA 2A84A 1CS0A 4LOHA 1DIGA 4UDNA 5WRFA 3ZNOA 2BKEA 3ORFA 4JQSA 4WTOA 1PZGA 3L1VA 4DPKA 2YYAA 3QLTA 2AJBA 2XOXA 3B12A 3NATA 3DCNA 4NEGA 1F8FA 1IM5A 2VP0A 1JZQA 4R7GA 4FWTA 4JBXA 4O3MA 2XUJA 2VSFA 4TL8A 5DLQC 1IMJA 1WVMA 3S2SA 4B45A 1P3Y1 1QZZA 3O4JA 1QF6A 3CIFA 2JC3A 4JLPA 4M8IA 2HV8A 4MYSA 1IIBA 1Z0DA 1BSVA 4WFKA 1J49A 3TJMA 3DR3A 3VOTA 1PVOA 5KSPA 3JD4A 1H93A 4LE0A 3ZK9A 4W5HA 4DCOA 3GLQA 3MS4A 4UQPA 1QRUA 1W581 1DKOA 2REOA 4C43A 4COKA 2VBGA 3KTDA 5GZ3A 3D4IA 2WJVA 3A06A 4R05A 2WZCA 2XMBA 3VNVA 5T3UA 2EV9A 5KTTA 2XT0A 2QLBA 4D56A 4D3YA 2QHXA 2V55B 4OSEA 4PNHA 1T8SA 4H59A 1UBCA 4Y1GA 5BNFA 5SZJA 3REOA 2VS1A 1R1DA 1NMSA 2B94A 2E55A 4X1YA 3VNRA 1XD8A 3NHJA 3I05A 1FEZA 3BSWA 3OFSA 1BC5A 4OI2A 4Q9LA 1XIVA 2IOQA 2X1VA 1FBTA 2XMRA 2C92A 2FG6C 4URVR 1B8NA 4PIVA 3WZMA 5H4GA 1XTBA 3GJZA 4R2HA 1V5GA 1Z7EA 1Z88A 2JBAB 2YZGA 4IICA 1FJHA 2FPPA 4MVJF 4OBWA 3Q8KA 3LOUA 2H57A 4JSTA 4R1LA 4O2RA 2D2EA 2IRWA 3TDKA 1PV1A 2A0FA 2AJLI 2BF7A 2NU7B 1PDVA 3R76A 4W4TA 2W8BB 2WOJA 5C51B 1V48A 3D5TA 4QGFA 4LK2A 4QC2A 2OLJA 4KQFA 5B1YA 2CT8A 1GZ6A 1TQ6A 2XLBA 1CUJA 2IYVA 4Q9NA 1IN6A 2XDQB 3MYYA 3T7SA 1FLDA 1CUFA 4MVCA 2J9XB 3JZIA 2DHCA 1CSEE 3GCGA 3DOHA 4CM8A 4IKPA 2YWXA 5L45A 4Q3BA 2PMEA 2PEZA 4IS3A 1GGHA 1L1QA 3PQ2A 3OLZA 1TA9A 5L3ZA 1BCRB 3G9XA 2GS9A 3ET4A 2ECQA 4D6XA 3Q2KA 1XPJA 3WQSB 4HWKA 4CXMA 2YWBA 5K5EA 2IITA 2QLNA 5C46F 2YN2A 4N12A 3P2MA 2HNBA 2Z6UA 4JVMA 1V3TA 5AM1A 1QDUA 1QE3A 2BDTA 3B51X 4Q12A 1N57A 3E9NA 4YFYA 4OY3A 1BCSA 1R0ZA 3FMGA 4TRJA 4RF3A 2OV8A 4EG5A 1Z8HA 1ZOLA 3L6RA 2X3UA 4E70A 1Y6FA 2EW8A 3D5QA 3N6XA 4MVJG 4FKZA 1M72A 1X1DA 2Q3FA 1U9ZA 1V3VA 1QGUA 2JLYA 2FSUA 4NHEA 4CDGA 1ZW1A 1Y5RA 4FFNA 1QS0B 5C35A 3FTCA 2IU3A 4QECA 1D0VA 3C98A 4LHXA 1XJQA 2GBPA 4B3CA 3FAZA 2DTEA 1P0FA 4ZCLA 1GRVA 2FX5A 3SXPA 4BN5A 2EFCB 4IVPA 2XECA 4LC0A 3GWGA 1Q50A 1Z16A 1AHHA 1P7WA 3ETDA 2GILA 3CZMA 4WFJA 1YZHA 5F77A 1CS4C 4YAEA 2W58A 5SY6A 4B6OA 1G3MA 2CFCA 1WHTA 2FZ5A 1L7XA 2JW5A 1TQ8A 2PUVA 3UZUA 2R5WA 1FUKA 5KHAA 3T1QA 2PMKA 2YJGA 1MG5A 2ZTMA 4DG8A 4QPZA 2QU8A 1QRSA 2J67A 2IDZA 5BVHA 5K0CA 1LPNA 3MWYW 621PA 2VJCA 1SVUA 1Q1AA 1MAUA 1XQXA 3GARA 4AKEA 1ZJ6A 1UDWA 4EW1A 2EYQA 4KWEA 1ZH8A 4PQFA 4TRNA 3OJOA 2EIXA 2P79A 5CUQA 5EIBC 4D9HA 5CB4F 4BBPA 2AJDA 3LP5A 4RF5A 1E2KA 4BUJA 3EMKA 4JZYA 3TB4A 4ZI7B 2NACA 1YTUA 1X14A 3UHJA 1G3QA 2NU6A 3TIIA 1RKXA 2QG4A 1Y4UA 2WIAA 3G2MA 4JC0A 3F73A 3S1AA 3H1EA 1ZBDA 2ZT7A 4F5WA 1RXWA 2ZZMA 5B4VA 3K35A 2OG2A 2PWPA 1NF3A 4XYBA 2I7CA 1WCWA 5I6DA 3I34X 2E18A 2W70A 5KHOC 1SVOA 2GN9A 4XGIA 2GYUA 1KK2A 1ZJJA 1DV1A 3N58A 4B4VA 2PBFA 2GXQA 3ZU2A 1ZVKA 3PQDA 4C9BA 1DOHA 4LWOA 4FHDA 1NVDA 1K9SA 4LRUA 3NDPA 1NC3A 2Q1YA 4IJ5A 5C4GB 3I30X 3PNMA 2DHEA 4W82A 5LKRA 1ZAKA 2A33A 3B1XA 3EC1A 3K2EA 3TNYA 1FDWA 4YRBA 2GYYA 3KLMX 4OHCA 4AXXA 3NNSA 3EGXA 3JS5A 4UBLA 2ZI6A 4ENUA 5MN5A 4FINA 3DNFA 2DFDA 5DNDA 1DRWA 4LRYA 1A9TA 3T15A 4ICIA 4MOWA 2AG0A 4Y8VA 3NUQA 4NK4A 1J8FA 1NYTA 2CWDA 2PUWA 3HLKA 4BFWA 2JFQA 1W49A 4HH3C 4J2TA 4MRNA 3BXEA 4A6PA 2HUPA 4CM1A 2MDTA 3N2KA 4YJHA 2J0UB 3KV1A 1KR2A 1DEKA 1OE0A 3LQ2A 5F7XA 4LJ4A 1I33A 4FN5A 3NORA 1MU0A 1OXSC 1XHEA 3GQBA 2MU1A 1SRRA 4JN6B 3F8WA 3LCUA 2H7CA 3KLOA 4C08A 4WKNA 3H0EA 3KSRA 1QP4A 1PWEA 3R4CA 2MSEB 1IULA 3EHDA 3KB1A 3DD1A 1JJAA 3H7AA 3HB4X 1E61A 3PKZA 5YASA 5B55A 2DFKB 1CR0A 3O47A 1UBEA 2QM0A 3E8MA 1EEHA 5K3FA 5KNDA 2WTUA 1X13A 2WAXA 3OIWA 4HDQB 2ACVA 4K9OA 3URKA 2ONCA 2BBTA 1X38A 5DULA 3A9CA 3LXUX 4DMMA 3ZWQA 4I4IA 3PXUA 1W1IA 4FDVA 4YJGA 3IL2A 3TXXA 2N46A 3FOAA 4DDTA 4U7WA 2WD7B 1SBQA 4C7VA 3LPAA 4LXIA 3QKSA 1UEXC 2E21A 1LBHA 3Q0EA 3GK3A 2MSLA 5D1NA 3PI6A 4UQOA 2YHSA 5HKLA 5A6SB 4S04A 2XA1A 1QF9A 1NRXA 4HNGA 1GUDA 3HB1A 3BJEA 5FA6A 5HQJA 1P73A 1LSSA 1XD2B 3IOYA 3JAKB 4YJDA 4EZEA 3EPLA 3H5AA 5DN6D 5JY1A 5GONF 1D5CA 4DQ0A 2X4GA 4RPKA 4CL3A 5A1TA 4WNCA 3GLVA 5KPJA 5AP9A 4RSRA 2JL1A 2XAAA 4HWPA 3HEBA 4JJZA 5P8WA 3ZLTA 2J4DA 2ORIA 2ZCUA 4P7GA 1CY7A 1VE5A 2ODWA 4YB8A 3U44B 4EIWA 2C9YA 1NUUA 1FXWF 1VFPA 3WDLA 4EX6A 5DLDA 2O9JA 3CUSA 4I14A 3W9SA 1SKBA 1XRPA 3AETA 1XVVA 4RTLA 4P8RA 4KSYA 3CRMA 3L0CA 4XYEA 1I7DA 1CRQA 1M2GA 3LNCA 2P1ZA 3OCVA 3W6ZA 4EJ0A 1LB1B 3VV2A 1PNVA 1AF7A 1IOWA 1FP4A 1YDEA 4N4AA 2AFHB 3SVZA 3GLIA 1IDN1 2O2XA 2P8JA 1M6EX 3NQ41 2QJFA 1IG0A 2YN0A 1T36A 4M6WA 4QO7A 1RRKA 4EJFA 4AY2A 1Z4LA 4DDVA 3VHQA 5TF4A 1A5BB 1KVRA 4TLLB 2QRUA 3F67A 3ZW9A 4D9MA 2JZCA 1F48A 1L5OA 4MPTA 4QBKA 1MQ8B 3HN2A 1C3VA 4LJ7A 3EPPA 5CP8A 1L3CA 4HXEB 4KLZA 4QQRA 4BVGA 1G21E 4B76A 1SB8A 3RC8A 3STUA 4ZI2A 2C1XA 1M0WA 3H2IA 5ENDA 2FMIA 5FCDA 5FJJA 3ISTA 3ISVA 4C4YA 2VPXA 4O4LA 1PX0A 1MRSA 1JF8A 1ZH0A 2FSSA 3I92A 2QTWB 1ABBA 4RACA 4FE7A 3MB5A 5JASA 1MIOB 3EPRA 2NAPA 2ODQA 3NH6A 4GM0A 3NM5A 3IV9A 1FJXA 1VL0A 3R6LA 5AW2A 4KV7A 2QQFA 3D8HA 3QWFA 4MRAA 1SXPA 3EZFA 5EKXA 1EGVB 2B4YA 2H59A 4LIPD 1OIXA 5KTYA 3ZJ4A 2Z98A 2W90A 2Z8YM 5HK8A 3KSBC 3FSJX 3JSAA 4Q3DA 4YJFB 3A4NA 3TLYA 2JGDB 3R09A 1QV7A 3K09A 4OI4A 4RZHA 3ESRA 4S1NA 1B76A 1GNVA 2NSYA 1T1RA 3QWIA 4PIMA 2DGDA 5E9JA 4AJOA 1JA0A 4PN3A 5C8VA 5B2ZA 1VKRA 3CWCA 3BWXA 3EFEA 3DE7X 2V7QA 4GLOA 3WSWA 2WHYA 4KP7A 3EYWA 4A1FA 1NI4B 2I99A 1VIVA 1ZH4A 4RESA 4Z9YA 5D5HA 4LI0A 3A9RA 5BQ5A 1A69A 2RKWA 3ITNA 3K31A 5CT8A 3H97A 2QXYA 3BXGA 4JB0A 4Z4CA 2AUTA 1MN6A 2F8MA 2JJ2D 3DFIA 1ZUHA 3EUWA 4LK3A 2P40A 3G0CA 4RH0A 4REQA 4U39A 4Q9KA 4EHDA 3I61A 4UASA 2ZK7A 4X20B 3FUVA 3A04A 3CW8X 5ALPA 3UJAA 2AG8A 1PQUA 1ZXXA 1ISHA 3LY5A 2OSBA 3SYMA 4DYHA 3MLAA 3IX7A 2AQ8A 3NTXA 3TINA 5TDHA 2D2IA 4BU1A 5HWSA 5DM2A 3G2QA 3N87A 3P2OA 3N3BC 4C1NA 3X1DA 4FPXA 2JGRA 4FE4A 3VZQA 2BRUC 3DKRA 1Q0ZA 5H1YA 1ILWA 3VR1A 3AJ9A 4IEEA 2ZR7A 1DEAA 2ZIEA 3PKJA 5DTEA 4CMCA 2FXIA 2G6TA 4G23A 4BC0A 1G42A 1ZOIA 1JYSA 4CIVA 4DLTA 3AF5A 2EXXA 1M76A 4PRKA 1Q6YA 3IP1A 3KD2A 3P0RA 1HE8B 3NOOA 2QD1A 5H3LA 3VJKA 1EJBA 4X60A 3ZDRA 4CKWA 5JS6A 2NZJA 5IS2A 2HV9A 4HTAA 2D74A 1WMAA 4JYMA 4R3NA 3H1BA 1MX5A 4LHZA 3HLYA 3BD8A 4U9IS 3O21A 1Q5PA 1WSDA 1JKXA 1XWWA 1YULA 2QTBA 4MUBA 5ILQA 4BGVA 4P7JA 1I6KA 1YVRA 3L93A 3BDAA 1Y6QA 3OU7A 4OJNA 3PEEA 2XT9A 4BVJA 3F71A 4AF7A 1JHRA 4PFQA 2O0JA 1JYEA 1WQ4A 2I2BA 4HDNB 3L6CA 2M6RA 3O8NA 1U9CA 4GSLA 5IARA 5CLGA 4QJ4A 4M7OA 1AQJA 2XBUA 4G4SO 3OQ1A 2REQB 4MI1A 3ZD7A 3ESBA 1VL6A 5FOXA 5LQNA 5LD2C 2JH9A 5T4HA 3JQFC 5TVGA 3BTSA 3OJLA 3ZIUA 4E7PA 1S7CA 3CLTC 4LOKA 1UBHS 2LW7A 1FTGA 1JR3D 1SG0A 3O4FA 3P97A 4HEA6 4C0KA 5IVKA 4MI6A 1FFGA 5L3SA 1V8DA 2A5FA 1IBLB 1WDLA 4LTMA 1WVIA 4PZUA 2WWWA 5EXTA 2AYYA 4HN2A 3ZIDA 2Q62A 5K4HA 1S8NA 3HWX1 2W2KA 4PF1A 4ZZ3A 1Y4SA 5DHFA 3UEOA 4RQTA 1T2NA 2XRFA 2CNKA 3CEAA 4OQNA 3WSTA 2Y3IA 1F0KA 2TSYB 1G8AA 5BSKA 3KKNA 3F6YA 4MMYB 4PCVA 3NBXX 3T5AA 3OHPA 2RHOA 3GOQA 4G2NA 4KXQA 5HF8A 5AVKA 5JQWA 1NR5A 4GMFA 4NENB 3OZUA 1PT9A 4RIGA 3K9CA 3E3MA 1D3AA 4BQEA 3T5CA 1Z26A 4AS1A 4MQ4A 4N0PA 5EE5B 3L8GA 1E3WA 1LPAB 2H7XA 3G02A 3I0ZA 3HRHA 2D3WA 3KVOA 3UAGA 5EFOA 1LU9A 1UP7A 2VYVD 1YZYA 2BZGA 2ZE8A 1KHTA 2Y0EA 4RZSA 5BURA 5C8ZA 2VTBB 1NXOA 4DY4A 1T35A 2QR5A 3RABA 5JCOA 5TMBA 1UPXA 1CJCA 2PGXA 1O7JA 1P7CA 2WIKA 2NUPB 3KKEA 4N54A 4E12A 2KBFA 3AIIA 3WHIA 5BP7A 1TT5A 1Q77A 4CCYB 2PCJA 4D82A 4PZAA 3BERA 3KXKA 5AVVA 16PKA 3FFBA 1XPUA 2DERA 4WI1A 1O57A 2I6UA 2B1RA 3PUXA 1A1SA 3CYFA 2ZKLA 4KQ6A 3B1VA 2C1ZA 3DAGA 1ZISA 4OHOA 4EGSA 4D25A 1E1CA 3E4CA 4O1MA 1K5DA 3R7WA 2HQRA 4QHYA 4JNKA 2Q28A 4JJGA 3OPQA 4PTZA 3RSSA 4PNEA 1KEPA 5JTTA 3RBZA 3CNNA 3LUBA 4U0KA 1N4DA 4CMEC 3IDAA 2IL1A 5J47A 1IJFA 3HDJA 4EYKA 2WWRA 3C1TA 1J7JA 1TJYA 2XVXA 3GJ3A 1PJ8A 2H29A 2HLNA 1PFUA 3MT0A 3K9HA 2P9EA 1AZTA 1TMKA 2EFEB 4IGKA 4KU4A 4HX5A 2COUA 3D6FA 3E27A 3MRXA 2H17A 4HP8A 4Z9XA 2F4VB 2W8ZA 1VG9B 4TTVA 1THGA 1FFYA 1MH1A 1G8GA 3CEMA 1LLQA 3BMNB 1UODA 4MQUA 3WO1A 3QQ5A 3GHHA 1ZL2A 2WIBA 3C6KA 2WJGA 2Y4NA 2XKJE 4UVEA 5H80A 3H2SA 2WD9A 2YWRA 3LDGA 4PG5A 4TKUB 1M8PA 2W42A 2V9ZA 4CL8A 3EY4A 3CFYA 3SHWA 3X43A 1P0IA 3NHAA 2Z6QA 3VUFA 4US1R 3FCYA 2IUTA 4U8GA 1EXWA 2GGSA 3PL5A 4JMLA 3CEPB 2VAPA 2I22A 4PSUA 3WZLA 1FXSA 2VRBA 1GZSA 2J0SA 4HYTA 1EMDA 2ZAGA 3KAJA 4WY5A 2M1XA 2XZPA 3WWOA 3HKEB 3KQYA 2IU0A 2VQEB 1BXGA 2G82A 1XELA 1RFGE 1J0EA 1KJIA 3LTEA 4JLAA 2WJ6A 3LQ4A 4PYJA 3S8EA 2NAFA 2QLTA 1U4NA 4LHVA 1E18A 4NC9A 1FLNA 3I32A 4FR2A 3IODA 1WABA 1US8B 3ZY3A 1L2TA 3ZXUB 3GFOA 3A0RB 3IGFA 4UC0A 1RYYA 1XCMA 1LX7A 2D62A 1RPAA 2W2VA 2BE9A 5FTKA 3RYIB 3SSNA 1WXEA 4JXJA 1AT1A 3FDJA 4J0KA 5JSUA 3Q72A 2PRIA 5GJBA 2HU2A 2R1TB 3E9EA 1E3LA 1AXEA 4JSRA 5DCUA 4F45A 1F7VA 3IO5A 1XZLA 4TS4A 5DSTA 1GRQA 1Y8RB 4DM7A 4YV0A 2C4VA 3DMTA 3B3JA 5DM70 3D1LA 1JDZA 1HOTA 3TWOA 1XQWA 3F6RA 1Z12A 4II3A 3TYXA 4EZIA 2Y2UA 2NYVA 2BC9A 1OXVA 1N7GA 1QCCA 4YALA 1GQYA 1GV0A 2HDNB 1SU4A 3KZNA 3RSZA 2AL7A 4D4MA 1CQPA 4GPZA 3OZAA 4QXPA 4BMYA 1N1GA 1DAKA 2OBFA 3HP4A 3VI3B 2BMWA 1BW9B 1NLFA 1YC5A 1LPSA 1LS6A 3LV8A 3N6RA 4UFNA 4UM7A 2YWJA 3AUAA 3QKTA 1M33A 3RIEA 5KTNA 4QNMA 1RU3A 3GPDG 1IY8A 2C31A 3CE9A 2N1BA 4FWIB 5F51A 3RQIA 4BVBA 4CMGA 2ZYRA 3UMJA 1GFZA 3RVMA 2OHFA 1J2EA 1T6NA 1KO7A 2QTCA 5AXDA 4TL7A 1SAYA 3DDWA 3RRMA 5L3SB 3IDQA 2YUTA 2AN4A 3MRSA 1JMYA 5M04A 1AHPA 4ALNA 1YE5A 2WG2A 2QAGC 3DZIA 2Y67A 3KJGA 3MMXA 4ML3A 4GPAA 4J76A 5EIFA 4GGOA 5F7OA 3GUUA 3OIDA 1GR1A 1TFRA 5COBA 3SNHA 3L40A 2NQ2C 4QOHA 3KXIA 3UK7A 1RWPA 4B44A 4F5EA 1BFUA 1F9EA 2R1VA 1GN8A 1SU8A 3GD5A 1GQFA 1OFIA 2DLCX 2Q49A 2VK8A 3EF1A 5CM9C 1A82A 2H4ZA 2IY9A 5F3WB 4XB1A 1IZZA 3C74A 4KDCA 4EB6B 1IN4A 3TKAA 3VJMA 2KE5A 1RZVA 4W5TA 1IC6A 5G1PA 2V74B 3EFBA 4EYSA 3ADCA 1UKEA 3MRVA 4BLRA 2PX0A 4D4JA 3W5DA 2GPNA 4XZ3A 4MWSA 2AI1A 1CVIA 2F3SA 3UKJA 1ZK1A 4HCJA 1HRDA 2VC2B 4A73A 3GI1A 2YL2A 4MQ5A 1NX9A 1XMPA 1ZM2A 4HLQB 2ERXA 2OXEA 4Z4FA 1TO2E 3CRZA 4V39A 3QXGA 1DDGA 2PGDA 1RYFA 3H19A 4UBMA 2H9IA 4UAJA 5ANRB 4F4UA 3J81k 3NVMB 4OQEA 5AVWA 2F55A 1PGPA 2AE2A 3UXYA 3ZXYA 2PQ2A 4J3JA 1X80A 3P0EA 4CR8A 1VCNA 3F0TA 3N86A 4MH0R 5T64A 1XDWA 1Y81A 3K2QA 3KKQA 3QYPA 4BJ5A 3O8OA 4R1MA 1JTFA 1RMTA 1KYZA 2QU7A 3KUKA 3KCNA 3LUHA 4GPIB 4PVDA 1JQLB 4QU5A 3S5JA 2NG1A 3TBFA 3ZY2A 1BDBA 5KYGA 1M1YA 3B38A 3OIGA 5HMLA 1WZCA 2C58A 4HJRA 3MSCA 1POWA 5GONA 3AVYA 4B85A 1M2WA 4IZIA 4M4SA 5DN6A 3F6PA 1W4BA 5AK4A 3IURA 2XQKA 5K2OA 5AVXA 5HRAA 1EJ2A 1KJ8A 2Y1EA 1AKVA 1CJKC 2WYOA 3PE6A 4HFMA 4J0JA 2JGLA 2FJPA 3N8GA 4UEWA 3UUFA 3WYCA 4YCNA 3IE0A 4RPCA 4BXOA 1J1ZA 3RK0A 3R3HA 5ICGA 2C5HA 1OPXA 2IEAA 1EZ4A 2R1UA 5G53C 1AKQA 2I80A 3OOJA 3V4OA 2RCNA 1HSZA 1KHHA 5JNUA 5F9HA 4G89A 4YP7A 4PLHA 1UPUA 4A2CA 1MFZA 4KE9A 1Z2NX 2BONA 4RFVA 3ZTWA 2FA9A 5JZVA 4GC5A 3GO4A 1QH9A 5KNDD 4ENRA 1ZVJA 2Z3WA 3FDFA 5DRTA 1R88A 1U2ZA 2YY7A 1EFTA 1U0BB 1CJUC 4ID9A 3K0FA 5IP5A 4ZI5A 2G25A 3FYSA 2HZBA 3P9QA 4P84A 1ADJA 4XVUA 1JQBA 5TMEA 1UK9A 2J5RA 3WMRA 5F9FA 3S27A 4BVKA 3PWTA 4N7RA 2ZRFA 4BYGA 3TG2A 3HADA 3KYJB 1ZNZA 3A1TA 4BLQA 2PS9A 4EHNA 1IN1A 5GQSA 4C0AC 2MMGA 1KI8A 4R1NA 1UPBA 2ZPTX 3ZGNA 1L4FA 4ARAA 3AGQA 2PXXA 5C8XA 4DBVO 3ZLJA 3ECCA 1FB5A 3VPSA 4DCTA 4GEGA 2Z1NA 4MHSA 4RAQA 2A57A 1FRVA 2Y1LA 1EVZA 1NJFA 1JVSA 2QTTA 1ZD2P 1LRKA 1SC1A 3DDNA 4GQIA 3CH5A 4UDYX 4BASA 4IOMA 2P9JA 4LYGA 5EHXA 5DGCA 2PNJA 1JH9A 1E94E 3MYRA 5E95A 5J5VA 2EWVA 4MGHA 3K70B 1MC4A 2XVMA 3PUYA 3F6CA 1V45E 1EP9A 2ZSEA 1BGWA 4MI3A 3MT7A 4TYYA 1P62B 4ZVSA 3R3SA 4KAFA 2DTXA 1Z2DA 2EWWA 2LVBA 2YS7A 3DBLA 4FJ2A 2FDXA 5AW3A 1KI3A 1LCIA 5ITZA 4C7OB 1W30A 2WUFA 3O1JC 3U60B 1XZNA 4XKJA 3DONA 2HQBA 4PGGA 2XD9A 5HG0A 1C3OA 1L4HA 3RVRA 3A27A 1MOPA 3EQ6A 1TK3A 4HBZA 5CNMA 1E9CA 2BFBB 3F1KA 1BVRA 3IDSA 4LJ5A 1X8LA 2X58A 3COWA 2UKDA 3ZE0B 1DLIA 1GKUB 5JMOA 1PLLA 1SHZA 4P3YA 4D9NA 2WK1A 3L8FA 5CT5A 4Z3KA 5JAUA 5IH3A 3IEMA 4J0QA 2O2HA 2PM8A 4PXSA 3F6BX 4JYPA 2GLTA 2VPPA 4FILA 2JS7A 4XWYA 2GJAA 3P0FA 4DJFC 4BO1A 3BX1A 4FW9A 3UHOA 3KDSE 3ZS9A 4KIWA 1K8RA 3ED1A 2Z5FA 3ZBQA 1KY5A 4KVGA 3I5UA 3WRVA 4N5MA 2A9OA 4TV9A 2VBCA 3VFDA 3IBSA 2V6JA 2GRUA 1R6DA 4P5PA 1G3RA 3CX3A 5ADWA 1KZGB 1DC3A 1OWMA 1H6AA 1NWCA 1P45A 3MUEA 4KOEC 4YRIA 3O91A 4TQGA 2GVZC 4IRUB 5AVRA 2X7XA 1JH8A 5KKAA 2UZ1A 4MWCA 3QF4A 3FWHA 4NU8X 4TVBA 3W8FA 1DL5A 1O4VA 1YT5A 3HDVA 3WLKX 1DWPA 3EDQA 4EITA 2UXDB 4DUGA 1P7YA 2GLUA 3R8CA 3PHHA 5EKDA 5BN4B 1HLPA 5AJHA 3ZY4A 2G88A 3IERA 1EK5A 1GZHB 4NFLA 4TVOA 3IB3A 1S2NA 5H70A 1Y9ZA 2D0PB 3BWVA 5K3DA 1K89A 1MO2A 1MTOA 5U4XA 4JROA 4OSOA 1KWGA 4BB6A 5FPHA 4O02B 1OV6A 4ZOEA 4BN4A 2VQDA 1UMBA 2CHVA 4I4CA 4NU6A 1Y6ZA 1C14A 3WGIA 1XL1A 1H66A 3EXAA 4ROSA 5CDUA 4J75A 2J0VA 2CW5A 4LHSA 4V1CI 1E64A 3RS4A 4AX8A 5D2CA 1HL7A 3HXKA 2QT0A 3NTUA 2V54A 2HBQA 4FI3F 4R1PA 1VPLA 1KF0A 1CJVC 4X93A 4XLLA 3DHYA 1AHNA 3MJRA 3RWBA 4MQBA 4WEOA 1YTLA 1XE3A 1TF7A 1IUPA 3GGJA 3DAPA 3H18A 3FUXA 3LXMA 4OKNA 5D3MA 3M4XA 4EP1A 1M67A 2CL5A 2GO1A 1TADA 2B82A 2H52A 1MB9A 4TV9F 3IAS1 4Y6SA 5HDBB 3TW8A 3PEVA 3O2JA 1CETA 4EMSA 5CA1A 3CZ9A 3TI9A 1V6CA 4Q24A 4G81A 3ETJA 4NXMB 1XQ9A 4IJVA 1CUYA 1GRNA 3DBHB 5DM60 1ZIYA 5IK2A 1P8JA 3EDMA 3UA4A 4AJ2A 3AVWA 1M54A 2Q6IA 2YRWA 1Z0AA 3D0QA 2FUCA 3DF9A 3WZ2A 4F2GA 4B2IA 4RJJA 2YWDA 4ZYWA 2YIDA 3AEZA 2CF6A 2G4LA 3I45A 3PXEA 2PJDA 3C3KA 3OJCA 1YHNA 3OX1A 4QOJA 1PJRA 5FJIA 1PJBA 2XQGA 4D9FA 1NXXA 3FNGA 4BNLA 2QK4A 2Z9CA 1ZKMA 1EUCA 1WXGA 3Q9SA 3QU7A 3VDMA 1U8XX 2VK4A 2PS0A 2V1XA 1N2GA 3LA6A 5BWNA 3MWJA 1OGYA 2FF5A 2VJDA 2EDCA 2O06A 2WMNB 1U0SY 3NBKA 4OFXA 3UXMA 5KC9A 1N2HA 3IKTA 4XGKA 2BGLA 1ISSA 2GD2A 1EDBA 1GGNA 3CZAA 2QXUA 1JEQB 3SFVA 5LMZA 4PANA 1GA6A 3L92A 4WJZA 4FMBB 1BZYA 2R7KA 3DCYA 2PMBA 3TLGA 1IY9A 1M3SA 1MVOA 1PT7A 3MF4A 2I6QA 5FUBA 3SBOA 2W48A 3FJ1A 4OP3A 3WGTA 4KUEA 1GM5A 1CS0B 3LX4A 2VDLB 1UFRA 4YLGA 2ACKA 5D7BA 4P58A 1W5FA 3D2AA 1OXBB 2QSZA 5GVSA 1EK2A 1RWNA 4TN5A 1XA4A 4B71A 3WHLA 3KSAC 4Z3OA 1V11A 2QV7A 4IFBA 2NZ8A 4UHJA 3Q7IA 3SOPA 2GCOB 2J3DA 3GMDA 4NNOA 3JQ9C 3V9AA 2QW1A 2VDKB 1HXHA 5AI4A 4X6XA 4RDXA 3L7AA 2ZYAA 1ZSNA 1BDHA 2FOIA 1H42A 3PXGA 3M3PA 4BNDB 1GU1A 4CDRA 2ZJOA 3CEHA 2E5FA 4AS3A 3U31A 1CQXA 4M0FA 4Y6QA 3Q7SA 5HIJA 5K0BA 1CQJB 3U3OA 4Q4LA 3Q11A 4JYBA 1J8DA 4IQ0A 1HA3A 4J7CA 3TTSA 1C3JA 1ZA2A 2VJYA 3WAGA 3U56A 3VO8A 4DBLE 3QMMA 2ADOA 4D4KA 3MAAC 4UM8B 2CXSA 5A03A 3JR7A 2R87A 2PMDA 4BO9A 1JX6A 3U40A 1YDWA 4WPGA 5EXSA 3WFIA 1CR4A 1Q2UA 2PAAA 3FF1A 4KDRA 4BNGA 2XZLA 1G4HA 5CT9A 1D2RA 2WFMA 3VR6H 4LC9A 3UJNA 3TTTA 2C54A 3GEPA 1E4YA 1G5QA 2CYAA 3QBDA 4GPTA 4KPUA 3EWNA 2B7LA 4U4AA 5HMMA 3IEUA 1T8TA 2FZEA 1I2AA 4E08A 2CFRA 4EF4A 3T5PA 4U6SA 5HUJA 1W9HA 4I9GA 5E1BA 2G70A 4K9MA 3T1YB 1YRWA 1BWQA 3FR7A 5BR8B 3ETEA 2W8BA 2O7RA 3TFOA 3JXEA 2PBRA 4F46A 3V7NA 5GPBA 4MLZA 2ATEA 2AFIB 2XH8A 4PLVA 3OY7A 3NDIA 4ENWA 1UWCA 3RVDA 1X2BA 2DWCA 2NXWA 5DISB 3S2GA 3BHMA 3WHKA 3ZE6A 2A3RA 3OZRA 1QS0A 2I7VA 4X95A 4CKEB 2JGIA 3N05A 3OOEA 4GVXA 3KSUA 1A7AA 2XPCA 5T4FA 4PSKA 2BGRA 4UARA 2E4XA 5GINE 4WD3A 2OZVA 3UY4A 3BG5A 3T7TA 2EDAA 2P9GA 5EE0A 3O9MA 4TVKA 3E5MA 3EW9A 5AMXA 3M3DA 1GVNB 1YL6A 5LOVF 5KEIA 2IQIA 4RJIA 4PSVA 5DTJA 2F17A 3GNTA 1JL3A 1S4MA 4LRQA 3E53A 4YAUA 3M5PA 5JRJA 1UEIA 1H5NA 1VXOA 2NO9A 3BHNA 5IDXA 1Y8ZA 4JR1A 1PDWA 4EEKA 5LXTA 4Y7CA 4ARZA 1ZMTA 3TRHA 1LK7A 4WA8A 2NX2A 4AK9A 3FGPA 1OTHA 1UAYA 4XWGA 1RCUA 3IOCA 4A8JA 5KYXA 1E0DA 1JXAA 1F0YA 3CUTA 4OLBA 5GONB 1US8A 3ZHXA 3DEAA 1E69A 4TMZA 2OQRA 5KCMA 4ENPA 2PGLA 3C3CA 2JNWA 1T2DA 5C8YB 1C7ZA 3WLEA 3KBBA 2J4CA 1BVHA 1PZXA 2R2AA 2WTEA 4BXOB 4K3VA 3GLFA 2GQ0A 4YAKA 1RI4A 1Y9DA 3BIWA 1IWPB 1WMEA 1BFDA 4HNAB 5HFJA 2G1KA 4CQLA 1CZHA 1E1LA 1YB1A 4E0BA 1G59A 3OZGA 5BWBA 1E8DA 5BV0A 2DFVA 1S5PA 2B35A 3P2EA 4IGIA 3MJEA 5DU2A 4N47A 2R7MA 4ND8B 1G9SA 3PHJA 1P4GA 1Z62A 3QUSA 4MITA 2ONYA 3K0SA 1VZ3A 2YY6A 4W8HA 5HF6A 3ENZA 2PFKA 3R3XA 3RG8A 1XLTC 4GT1A 4RHYA 1JAZA 4L8WB 4RAOA 1SHLA 4PFJA 4ZCSA 5LOVB 3BVPA 4V2IA 5MGBA 3EBPA 4KBFA 4YACA 3DM9B 3FPKA 1SQGA 4DLPA 4DWJA 2YMLA 4HGYA 3DBLB 4N5NA 1E6KA 2BTQB 1SIBE 2I0FA 2Y93A 1G2IA 2ZSIA 4L73A 1C2TA 3W6NA 4E5VA 4EGAA 2XKKA 2F2TA 1Z45A 3C7CB 3DAHA 3M4NA 2IX3A 3D0KA 4BNZA 1XGKA 4TLAA 3TSAA 1F14A 4NMMA 4IMJB 3ZDXB 1N3YA 3T1OA 1H2AS 1HH4A 4NJEB 4XM2A 2I4OA 3PQ7A 1P5RA 4NESA 4PFKA 4BO6A 1YRLA 3M6FA 1QCZA 2OCDA 4P4SB 3W90A 3R5HA 1YKFA 1IQRA 3DAFA 4K46A 4BYMA 1QX4A 1LDEA 4EMUA 3W9YA 4Y98A 1L5MA 3O1LA 1ML3A 3PVSA 4DLZA 4F4CA 3QPUA 2QRHA 4MYHA 4H0CA 2OQIA 4FYXA 3V1KA 2P9HA 1QH1A 2IHYA 4LCJA 1E9AA 3C5HA 3DV0B 4BWGA 5KU7A 4ZDKA 4CQNA 1UC9A 2QN3A 4Z8XA 2W6PA 3SS9X 4UJ3A 2QD3A 4IS2A 3QOXA 3H11A 1ZSVA 3GGSA 3OQ6A 3T0IA 1K06A 3CX6A 5K7SA 2FQQA 2FP3A 4TWZA 1YC2A 5J58A 1SBIA 1GUYA 1QB7A 3IXMA 4J1TA 5A6SA 1SQ6A 2XGOA 3FCAA 3H8WA 3PUZA 3TTYA 3SZ3A 2OLEA 1ZD4A 3NH9A 3ABSB 1ULSA 5E9QA 2R4UA 3V2GA 5GZ6A 3U3JA 1ETUA 2IHBA 1CNEA 2DBRA 1GTL1 1X7WA 2C00A 4LVCA 3QSYA 4KE6A 3BEDA 3SHOA 2O48X 4HLUC 1EBUA 3TRJA 1CC1S 1PUXA 3CSSA 3GHYA 1L4UA 4MDHA 4D7AA 5BV2P 1E2PA 1S3SA 3U7FB 4PVCA 2JIPA 5I7RA 2YN4A 4B7CA 3G8CA 5EJ7A 1WV0A 4UPEA 1UOPA 2D1FA 2RHCA 2ZI7A 4EABA 1OZAA 3MM4A 1XTTA 4ZCRA 3B3FA 4ZEMA 2PKQP 2HWKA 3QBTA 4D99A 4RJ2A 5A4MS 2WYIA 1KOLA 3I1JA 2VDQB 3TOSA 5BOSB 3M4JA 3MQFA 3PX3A 4FNMA 2C7PA 1RWBA 1GDTA 1Q6ZA 4KYIB 1FX0B 1CUZA 1SCJA 2VNIA 3CZQA 4GI1A 4MQ6A 4NMHA 4RDHA 5SYMA 2PNFA 4Q1DA 4E2ZA 4EW2A 4OH7A 3O0TA 3K5PA 4DDKA 1NNSA 2BZ0A 3MCTA 1E1QD 2YYYA 3JYQA 4DA8A 1R37A 3TKLA 4GOLD 1R5JA 3F3SA 4QZVA 5IYZA 3KLBA 4Q6BA 3WB0A 3B3QA 3AR6A 3FPEA 2ODBA 1L1FA 1N7JA 1FK8A 2K7ZA 2HPVA 4PZEA 1LLCA 2QAGB 3G2OA 1TJ3A 1TZ2A 4XQ9A 4L5IA 5BW8A 4XWOA 2VJPA 2IYUA 4PLWA 3RGGA 1DAHA 2JGJA 2GUGA 1G0NA 3IELA 3NYIA 5MHTA 2IEGA 3VAZA 3L0PA 3IUPA 4TV8A 3C3BA 5DJ5A 3V48A 1NULA 2IEYA 1SXJE 4C3UA 2ATCA 3GB9A 4MSUA 5KYYB 4JBHA 4C4ZA 4HDSB 3CTMA 1MP0A 1ZEJA 4H7EA 1AZSC 1RBYA 4UEOA 4XVQA 5DE3A 3VC7A 5KJCA 1XFAA 2WU3A 2X2FA 3UWOA 5JSFA 1JNYA 4AS2A 5BN1A 4D45A 4FUQA 2FYTA 1T36B 4JUFA 1YDGA 1T0HB 3WGOA 3SY8A 3FPBA 5AI9A 4NICA 5EWJA 2AKEA 3HO1A 1PHPA 2VJBA 4AYTA 3TZ6A 2WAAA 3QE4A 4PAQA 3M3HA 2CCKA 1A0OA 2BBSA 3S2ZA 2FH5B 4PBSA 4M1KA 2L2QA 3GFGA 3HCCA 2JAQA 4C0HA 1GYRA 2Q1XA 3AUXA 4W5QA 4B40A 4EB8A 3RYTC 2P4EA 3R0JA 3TEJA 5KQRA 3IIEA 3CLTD 2J9RA 3I9KA 1SU6A 1KERA 4MV7A 1V11B 1EGQA 1XFDA 1NW3A 1G5TA 3L79A 1ORRA 2P7HA 4GDMA 4N5DA 3RIGA 1RRVA 3NALA 1YDMA 3EDCA 3Q5GA 3Q9NA 4NS1A 1Z2OX 3ZV3A 1N6LA 4TZTA 1RP7A 4YMWA 2ROQA 1AO3A 2ENUA 2B0CA 3LGXA 3FGNA 1PS8A 4KB5A 4R5HA 1OIWA 1ONSA 4D8VA 5AVTA 1NNEA 3Q6NA 4PZLA 1B8VA 1TJPB 3IQWA 3E9ZA 2W4IA 3FFXA 2GEKA 2JAXA 3IP7A 2IQ5A 3Q8XB 4PHHA 4WNAB 3V8NA 3ZCVA 1OFGA 3E9DA 4NX2A 5BVGA 1UWKA 1JZTA 2WAMA 5FR2A 4GG1A 1A9YA 5A0VA 1KIMA 2HX1A 4CM8B 1II0A 5DTIA 4E4RA 3HCRA 4IVNA 4CCSA 4LKRA 4B6QA 2FRVA 2NADA 4EBFA 4TSFD 4DSTA 2CNNA 4FN4A 3C1OA 2H4YA 4Q9JA 2ZU6A 4ZV4A 2ZUVA 3LYAA 5T67A 5F52A 3L6BA 3W6PA 1OXKB 2YR0A 3HY6A 2KLBA 4KPYA 5B1HA 4TV8F 3R7AA 1X77A 4QTUB 1OA0A 2AG6A 4JWTA 2FWRA 4PYKA 5BSRA 1RTKA 4BNDA 1OZFA 1Z4NA 2NXJA 4DLAA 3ETLA 1VOTA 5EWMA 1BE0A 2B7BA 2QBYA 1P7PA 3RO7A 4KIUA 1B41A 1RRFA 2XUIA 1R50A 1XHLA 3L0IB 4A26A 3D6NB 4A36A 4EI7A 3T1TA 2PKXA 1JLKA 2RC5A 1K86A 1E4OA 1XXHE 2A0YA 3EXHA 4J7XA 5JRZA 4FCTA 5CAEA 5KWJA 1KYYA 2V7GA 5C34B 1OAKA 2O2IA 3AW8A 1P19A 2JA2A 3R9WA 2DPGA 3JR3A 1O96A 1IJEA 4BQPA 3DLHA 1P7ZA 2IYOA 1EUQA 2SBTA 4WKGA 4ZAFA 1WW3A 3A1FA 3QVOA 1EFLA 1J99A 3BE4A 1XC7A 4EKYA 7YASA 3IHTA 2LDBA 3AI2A 3GT0A 3RU7A 2WE7A 3PJFA 1FYDA 1RQGA 4HR7A 1FZTA 1NOJA 2G80A 1ACJA 1E2DA 1RM5A 3BD9A 1R6XA 1P44A 3FPSA 2FN9A 4GZ5A 4RPGA 4ED9A 1UWLA 1EVLA 5CNIA 3G1UA 4PLGA 4JI6B 4H3VA 1SR8A 1R0BA 1NJSA 3W9UA 1UP6A 3I4FA 1KIAA 3LECA 4FDLA 2AKAB 3CY6A 3N2NA 4M1SA 1P9RA 3WYDA 4R1SA 5DBFA 2BGGA 5IAOA 4ZIRB 5LMCA 3U4QB 2A58A 3HDYA 3ZD8A 1OTXA 2VDVE 3EEFA 4F3KA 3KPUA 2NV2B 3NEJA 3UG6A 2QQ5A 1YQTA 3Q6IA 4BTEA 1CRPA 1CF4A 5B6JA 1QV6A 3PFIA 3EAQA 3A6GA 4OXXA 3CO0S 4S0XA 5FBRB 4BIIA 5CURA 1B23P 3ZWDA 4D96A 4XDZA 2XCIA 1VG8A 3KZ1E 3DPIA 3VC3A 2AN1A 4J0GA 2PSFA 2X86A 3GPCA 5H7XA 4C1BA 1YSCA 4WN9B 1E1QA 1V95A 3KZVA 1NWHA 1BGVA 2BEVA 3IPAA 3P9RA 4BB0A 2WUVA 1GCUA 1MIHA 1UPAA 3CH6A 3QELB 4EHLA 4NYIQ 1IBSA 4GC9A 1BYIA 3S7ZA 4Z7JA 1PNOA 1BRMA 4NWIA 4FFLA 4H4DA 4H6VA 4IRMA 3U4DA 5CYGA 1QNLA 3GGOA 4L75A 3ZKWA 1G5IA 1TLTA 4WNIA 4YT5A 5ALGA 1ORDA 4AX4A 3K32A 2HF9A 5KNBH 2FI1A 3TNLA 1PJSA 1YA8A 3MINA 2OV4A 2J32A 2C20A 3OPVA 3WQBA 1WU8A 2XWJI 3WFZA 3ZWCA 4BZWA 4LF4B 1ARZA 4BLWA 3DL2A 5I5GA 1X8KA 3O74A 2AR7A 2QV0A 4FCVA 3ESDA 5EUMA 3S40A 3SQMA 2ODNA 2YQ4A 4CWAA 1NVWQ 2RGNC 3FYUC 3GP3A 2GERA 2CEAA 1JBQA 1EVKA 2LRHA 1YR9A 2XDWA 2RFLA 3P0JA 1A2OA 4LWPA 4QXOA 4X1KA 4I8IA 3DEYX 4RBNA 5LU9A 1SKUA 3PCXA 2QRZA 3NCHA 4FM9A 2Q8NA 5FR1A 3HMQA 4QTTB 2H3EA 2ZWIA 2G9VA 1PJ2A 5AM4A 2QRJA 2RH4A 1CQIA 1G8HA 3JZMA 3O8BA 3MQ2A 4YBRA 1QTIA 4WXYB 5DHAA 1UKVY 2P65A 5F3DA 3K1YA 3KJXA 4HDAA 2QS9A 4QT0A 1HC7A 1J42A 2C84A 1OR8A 3RUCA 2EW2A 4G8JA 1NAHA 4BZXA 5K20A 1E1DA 1Z6XA 4Y2JA 2NYUA 1U5CA 4OLAA 2ASEA 4JBLA 5AWFC 2CLDX 4L1KA 1X7YA 4FXOA 3HKEA 5M3BA 1XSEA 1W48A 3EDRA 3G2PA 5EZSA 4I36A 4G85A 4LDJA 4MA4A 5T7BA 4WACA 4EJMA 3SDBA 3SYNA 1M1YB 2FP4B 3M1LA 2E89A 1FJGB 2ZI5A 3B9PA 4DC9A 1FJ2A 3TOVA 3RS2A 1CJSA 4YVFA 3SZRA 1Q7EA 1QZ3A 1NVMB 2DAPA 2WA1A 2XTAA 3HBMA 1XDZA 4PXAA 3WJ1A 4RMHA 1W87A 2VWPA 5COQA 5EKTA 1FW8A 4ZHQA 1SQFA 2WJ4A 5BWLA 1U2SA 5LXTF 3ZLUA 1IEQA 1SUPA 4ZT4A 4URYR 5AKGA 1XLUA 1JDBB 5EINA 2WV9A 3BCHA 3KOMA 4NK5A 2ZITA 1PZHA 5EFZA 2VNJA 3UUGA 2XEXA 3WWPA 1T8UA 1LH0A 1W0JD 1EUDA 5CPFA 2HOQA 3ADKA 3V4PB 2XUAA 1RPZA 4Z86A 1VXRA 3K5HA 2BD0A 1PYOA 3BAZA 3FUUA 4TYWA 1Z7GA 1FSFA 3G2IA 3PKIA 4N3BA 4N8DA 5KMGB 1H9AA 2PRYA 1DHRA 3NCTA 2WHEA 3RVLA 5HGXA 3ASZA 5JDIC 2I54A 4JC8A 1EKXA 2QL5A 5ENZA 1TK2A 1PYGA 3TR5A 4E5YA 4ADSG 1T5DX 4ZVMA 4EG7A 3CNOA 4MW5A 4YECA 5FA8A 4ZN6A 4YQYA 5IT9A 4F06A 4KIFA 5DCYA 1ZD1A 3QHPA 4UTPA 3DBIA 3QU9A 4NCNA 2W6ZA 1D0SA 3IQGX 1YJCA 3L8HA 2NU9B 2VTKA 3RS3A 3UAZA 1QIFA 2OCKA 2XMCA 1FTWA 3AEKA 4HY3A 3EGEA 3UXEA 3QM1A 5F5NA 3C0KA 1JG3A 3OQHA 3STVA 5JD5A 1SURA 2WIDA 3FNIA 4IQFA 3HRIA 5IF9A 1ZN9A 4M21A 4FXPA 1JQAA 2AHRA 3L5KA 2YWHA 2CKMA 4EW6A 4LFBB 1ZONA 1FRZA 1OCEA 1NDUA 2VT7A 3Q8WA 3KYDA 1K5HA 1KDPA 3T9AA 5BRJA 3B9RA 2B8WA 1PR6A 4OJQA 3LX5A 5J5AA 1XMQB 1LD3A 3LY7A 1HE1C 1OX4A 4FGZA 3PNSA 3TXAA 1MO6A 4MWZA 4MV9A 4PV7A 4ZIRA 2IE8A 3VYRB 1FTSA 5ADUS 3A6ZA 1VQ1A 4JVLA 1KMHB 1TQ2A 4DR6B 1FDIA 5DBEX 3RAPR 4IL5A 1W85A 3PNKA 3RCBA 1FS5A 3SBDA 2Q9CA 2Z8XA 3SHFA 1Z2CA 4EY6A 3M6LA 4HWTA 1VPWA 4JYAB 3BWDD 5DTMA 4B46A 2D0IA 3IJPA 4PSCA 2GPJA 2YHBA 3HU2A 3IV6A 1EK1A 1KVUA 1S2MA 1TCCA 1QKKA 3COVA 3FPFA 3QA3E 4NLLA 4WVFA 3I2KA 2NO4A 5E2AA 3IRUA 3CX7A 1DZIA 3P9IA 1C3LA 1LTQA 3GUZA 1O6CA 1Z8DA 3KFXA 3UG7A 4EDFA 4F1WA 2C5EA 2J5QA 1YR6A 3MS7A 2RC6A 3QXSA 2R4TA 1JAXA 3I8XA 4NBLA 1PDOA 3W4KA 2HW8A 1BHQ1 1KPGA 2A1TS 4M1MA 3TLEA 4BFYA 2B1IA 4M1EA 4GE3A 2HU8A 4FMPA 4CEHA 4RZ3A 3HCPA 1DIOB 3GAMA 4ZO6A 1Z6ZA 5FX2A 3FKSD 4D44A 1UK7A 3NM4A 3RSOA 4AKIA 4P3XA 1E7QA 1Z47A 2D0DA 4G4GA 1E2UA 2J30A 4JT2A 4YJ3A 1VKZA 1XAJA 4ZDWA 3M5DA 1PEYA 4O6VA 3JQBC 1K2WA 1Q7RA 4P82A 5B2EA 2BYTA 3Q12A 1MO3A 3E3AA 3BK1A 3K3PA 3GRAA 3SNKA 1I01A 1L7QA 2YIVX 5KUTA 2GF9A 3BCRA 4XDGA 5EJ6A 2CZQA 1ZWKA 1SG6A 1Y63A 4CMIB 1N9GB 2O23A 5JD3A 1RPNA 4PX2A 1GLNA 4EFNA 5BWMA 2HMWA 1RWKA 2A92A 1UIMA 4LZWA 3BILA 1J6UA 4XIYA 5LQJA 5IVDA 2WHQA 1OPRA 1IY1A 5J2TA 1GCIA 4PR0A 3PUJA 3V46A 1VRVA 3OD1A 1FTQA 4Y2TA 2C98A 1QKIA 3GMSA 2HJGA 1IL0A 1IE3A 3W3AA 3DR5A 3HEMA 3A6FA 3LO8A 4OFWA 4O0LA 1NP7A 4MJLA 4D3ZA 3OIFA 5JH7B 3GDOA 4R8MA 2IOHA 2F59A 2PA3A 2VJMA 3ZHQA 1IH8A 3UVEA 4HGPA 4R2XA 5FPKA 5TV2A 1KJNA 2FVXA 1XU4A 3PZRA 5E8JA 4CCWA 3SLRA 4H16A 1T9GS 8MHTA 1JALA 4LY6A 4ZK6A 1H3FA 2PWYA 3FAKA 4G5RA 3JQ8A 3AY0A 2J0UA 1JV2B 1GG8A 4GD3Q 1I5EA 2YV3A 3OPXA 3QPVA 2A1IA 3WICA 3NHKA 1XEWY 3AIOA 1ZH2A 1E6UA 1GTJ1 2IVFA 2Y1KA 3BWYA 4O33A 4WVLA 4EOGA 5DXFA 5K99A 1Z5WA 3ENNA 2BKUA 5DYTA 4HWOA 1FX0A 1LPMA 2D5LA 1YDFA 5SV2A 2FOXA 2FSFA 5HFAA 2AZXA 5EWMB 4F6RA 1WKVA 5ALVA 3WQHA 4QM6A 2CVPA 4BMPB 2YRFA 3PBKA 4QHTA 1KO1A 3K9BA 2QPLA 2VJQA 3C3EA 3DHEA 4G5QA 5AHXA 5AI0A 5B3LA 4H3KB 5CFLA 4CTJA 3D4OA 4AIIA 1E6WA 2FWMX 3UNXA 3EIEA 4AO8A 3R9KA 4RGYA 1JG6A 5TJ9A 2PX3A 1R9JA 1EDDA 1RXUA 2AN9A 2H4HA 2XMGA 3JARA 4YT8A 1TCAA 2ODEA 3NANA 4V1CB 1O9BA 5L3VA 4QLOA 2C3OA 3NC4A 2ECFA 3DZHA 1YR1A 3NRCA 1HK7A 3E1KA 4K6OA 5FUXA 4KODA 4B2LA 3RRFA 4QQKA 4E1VA 3REQB 3EB9A 2I8CA 3PUKA 2FPGB 4TSKA 2YWGA 2B8JA 5HTKA 5CCEA 1MVNA 5JNVA 1NJ2A