3BGVA

Crystal structure of mrna cap guanine-n7 methyltransferase in complex with sah
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
309
structure length
269
Chain Sequence
RIFYLRNFNNWMKSVLIGEFLEKVRQKKDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQLPLGTLSKSEWEATSIYLVFAFEKQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA cap guanine-N7 methyltransferase
publication title The crystal structure of human RNA (guanine-7-) methyltransferase in complex with SAH.
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 269
sequence length 309
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2007-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3bgvA00
2HMYB 2GS9A 1EQAA 2G8NA 4PYOA 4CKBA 2QRVB 3FPFA 1KIAA 1RJDA 1KPGA 2EJTA 3P9IA 3I58A 3EVDA 4GEKA 3E8SA 2XYRA 5DXAA 4GBED 1VP3A 1YZ3A 1ZGJA 3FPHA 3KQOA 2R3SA 3GDHA 3LBFA 3NDIA 2YX1A 1FJXA 3FTEA 2ZW9A 2IGTA 4KDRA 5E9QA 3ER8A 2QYOA 3NDJA 3GJYA 2G71A 3D2LA 2ZBPA 5EGSA 2PLWA 1XDSA 1YFLA 1JQ3A 2C7PA 3LGAA 3I9FA 1KR5A 3HVJA 5K05A 1ORIA 3T0IA 4IKPA 2AN3A 3C3YA 1MHTA 3OU2A 3ELDA 2YTZA 1P39A 4MTLA 2QRVA 4RX1A 3C6MA 4PCLA 3KQQA 1ZQ9A 3GRUA 1SUSA 2AS0A 2PGXA 1B42A 3KPVA 3LCUA 5DSTA 3KKZA 3M33A 2QM3A 4R8RA 3B5IA 3P97A 3FRIA 1MJFA 3LPMA 3UZUA 3DLIA 3ER9A 1X1CA 3GO4A 3EVFA 3SVZA 4CTJA 2FYTA 1M0EA 1XXLA 3ELWA 2XVMA 1NW8A 1PRYA 2FRXA 3B3FA 2H00A 3SX0A 4C08A 4G56A 1ZKDA 4ER0A 10MHA 3OZRA 3RIEA 5ICEA 4OA5A 4DA4A 4ER3A 4FSDA 4M36A 4RTKA 4XCXA 4RTSA 4GOMD 4PCAA 1M6YA 2VDVE 3PB3A 4UOEA 2Q41A 3DOUA 4KVZA 1ZGAA 1BOOA 4HGYA 4NECA 4PYIA 5CVJA 4Z2YA 5K0JA 2AR0A 1XJ5A 4HTFB 4RV9A 3TOSA 3HTXA 3HCCA 5FA5A 3UJ6A 1L1EA 2FPOA 2ORED 3AWIA 3LECA 4PIMA 3E7PA 3NMUF 1YB2A 1AV6A 3I53A 3UJDA 3EEOA 1O54A 4Y30A 3KQTA 3KQPA 5KVAA 1VPTA 2K4MA 2ZZMA 1RJEA 3VC2A 2EJUA 1M6EX 2ONYA 4PYMA 1R8XA 2IFTA 3PFGA 4R8SA 4YV0A 3KR0A 3PLAE 4AZTA 3SR4A 2OB1A 1NE2A 1VLMA 1VIDA 2VS1A 2OZVA 3OZTA 3LCVB 4PYQA 3TFWA 4RSRA 2Y1XA 2NP6A 2P40A 2VP3A 2BM9A 3GRRA 1R74A 4AZVA 2JH9A 3M4XA 4BY9E 4A6EA 4F84A 5CVEA 3FTCA 4HTFA 5E1OA 5FQOA 4ZTBA 2WK1A 3EVEA 1KPIA 3BKXA 5JUWA 3FUUA 5GP1A 3OCJA 1IXKA 1QAOA 3FZGA 3GCZA 4X41A 5HILA 1X1AA 1VP9A 3GWZA 4A6DA 2B3TA 1EIZA 5EIFA 3QOXA 9MHTA 4PGHA 3HNRA 4MQ4A 2JHPA 3NTVA 5T6BA 1Z3CA 4GOND 4HSGA 2DULA 3MQ2A 4DZRA 2V74B 4E30A 1XCLA 3HCDA 4E2XA 3MTIA 2YXLA 3S68A 4E2WA 2FCAA 3FUTA 5CCBA 4WVLA 2AOUB 3TKAA 5LQAA 5LQUA 5EKUA 4CKCA 3NJRA 3DUWA 4BLVA 1SVUA 2O0LA 4LG1A 4MHTA 1HMYA 3T7SA 1G8SA 3HCEA 3LSTA 1ORHA 2VZ9A 4U7TB 3JWGA 2CMHA 1KPHA 3P2EA 3AJDA 3BUSA 5FCDA 4AZSA 2IBTA 3AY0A 4GC9A 4GUAA 2I9KA 4KW7A 4C03A 1XCJA 2JJQA 5BXYA 1DL5A 3CJQA 2LD4A 3LDGA 4GC5A 4U7PB 4R05A 3OFJA 2I62A 5FWAA 3GIWA 3KR9A 1L3CA 2B78A 3ME5A 4YUVA 1EG2A 1JSZA 2H11A 3NWBA 5FULA 4CKEA 1YUBA 2BR4A 3RODA 3M6WA 1SUIA 5KYGA 1JQDA 2EG5A 3B89A 3LX6A 5DSXA 1V39A 4E32A 3LL7A 3P9KA 1XVAA 3UA3A 2O06A 8MHTA 2AOUA 3UFBA 4RTJA 3TM5A 4JXJA 3EEYA 5CVDA 5EIWA 2AZTA 3DLCA 5C0OE 3R3HA 3ORHA 3G8AA 4QVGA 3A25A 3KPUA 4FT2A 4PIPA 4Y2HA 5DLYA 1QANA 5EHGA 4CTKA 2BR5A 4RVFA 1VE3A 4BP3A 5CIYA 5DTMA 2BH2A 1YZHA 2P35A 2ZZNA 4KWCA 3SXJA 2C7OA 5GINE 3DXXA 1RI1A 2ZBRA 3GGDA 4R6XA 5H02A 3SSNA 5FADA 5EKXA 3MHTA 4PYJA 1P91A 3HEMA 1N7IA 2ZSUA 5DM0A 1P1CA 3JWIA 1I4WA 1KYZA 2ZTHA 3IYLW 3HCBA 5BP7A 3C3PA 3SSMA 3UJBA 3GRVA 4E70A 5BW5A 1I9GA 3GRYA 2R6ZA 5DX1A 2GPYA 4HRAA 1R00A 2OB2A 1DCTA 2YR0A 2B2CA 2UYOA 2PT9A 3DULA 2AVDA 3M70A 5ERGB 1SG9A 4C4AA 2IH5A 1NW7A 2Z6UA 3KPYA 4F86A 2ZWVA 4KIFA 3I64A 3FRHA 1U2ZA 4IWNA 4RWZA 4GOLD 2PVCA 4FSXA 1VL5A 5EMKA 3A7DA 4YUZA 5HZMA 3UJ9A 1TW3A 2C7QA 1YF3A 1R18A 3G7UA 2IBSA 2CKDA 3BGDA 3ELUA 3FPJA 1G60A 2PX5A 2ZBQA 3HM2A 3P71T 3P9CA 3NVKI 2ERCA 3KQYA 5K0FA 4FR0A 3IHTA 4HH4A 4RVGA 1WXWA 4YMHA 4GOOD 4YUXA 1UWVA 5EQJB 4ATNA 5LQCA 3P8ZA 2O05A 1UFKA 4IV8A 4EVIA 4M7RA 4QDJA 5G02A 1RI4A 5K03A 3MCZA 3HCFA 2P7HA 3IEIA 4QPPA 3T7TA 3THSA 3NVMB 2PX4A 1KP9A 4P7FA 2NNWB 3LKDA 2B9EA 2OY0A 3NW9A 3OFKA 3RW9A 5HOQA 1N7JA 3ERCA 3O31A 4LWPA 5K0CA 1TPYA 3JWHA 2ONZA 1AQIA 5CM2Z 3CKKA 3DXZA 3HCAA 3H2BA 3KPWA 4MWZA 5B1SA 4RTRA 2JHCA 3OE4A 3V8VA 3ID6C 2PXCA 1NBIA 1F38A 3HVKA 2XYQA 3ELYA 4DCMA 1D2HA 4RVHA 2AOTB 1TW2A 1KXZA 3DP7A 5EHIA 3B7PA 3EGVA 2CMGA 2HWKA 3BGIA 3DMGA 1SQFA 3HP7A 5GM2A 4K6MA 3R6TA 3SMQA 1JG2A 5DWQA 2C7RA 5E9WA 3HA3A 2V7EA 3LDUA 5MHTA 5K09A 2PWYA 1RI5A 1VQ1A 2OO3A 3B3JA 4QQKA 3FUVA 2PT6A 4P7GA 2P41A 5EEHA 1EAMA 3G2PA 4QDKA 2PBFA 5E1MA 5KQRA 1QYRA 5E9JA 4DKJA 5DM4A 2P3QA 4OQEA 2IDJA 4QQNA 5CUQA 2I6GA 2YVLA 3UWPA 4XUDA 4AZWA 5ICGA 3KQVA 4YMGA 4RTMA 2CWWA 5CCXA 3BGVA 3CVOA 3Q7EA 3SGLA 3E05A 5HIIA 3DMHA 2O07A 2PY6A 3O4FA 2UYCA 4GQBA 3OZSA 4RTQA 2Z6QA 4X1OA 3M6UA 1RI3A 2PWPA 5EC8A 4B17A 3A26A 2ZFUA 2GAFA 3A27A 1NT2A 3LCCA 3PTAA 1JR4A 1X19A 4P58A 4YUWA 4BLWA 1O9GA 3M6VA 5K0LA 3EPPA 4ER5A 2NYUA 5M5BA 1OR8A 2G1PA 4EKIA 5DRTA 2N47A 2P8JA 4LWOA 3GU3A 1INLA 1Y8CA 3L8DA 4V0RA 2KW5A 4KDCA 3E23A 4P7JA 3P9NA 2PKWA 5IKMA 1YFJA 3F4KA 3OU6A 1P1BA 2UYHA 4X63A 3LHDA 3CCFA 3T7RA 1T43A 5F2OA 3TR6A 2B25A 4QPNA 3MCTA 3TPZA 5FHRA 2GA9A 1RI2A 4MIKA 2H1RA 5HEKA 5IH3A 3UJAA 2NXCA 3EGIA 5EPEA 5K0GA 3KU1A 1PJZA 1H1DA 4RTOA 3FUXA 3FTFA 5ICFA 3VYWA 5KS2A 2CL5A 4PINA 1WXXA 2ZZKA 3UJ8A 4AUKA 3R24A 2YUIA 3MB5A 3CBGA 4EQZA 3BWYA 4OBWA 4PGGA 4XUCA 2VDWA 5DTRA 2FHPA 2ZIFA 2OPBA 2PX2A 3Q87B 3MAGA 3PT9A 2WA2A 3GXOA 4OQDA 5E1DA 2PJDA 1L3IA 4BP1A 4DM3A 1FP2A 4QTUB 3TLJA 5DM2A 2Y1WA 2JG3A 1FP1D 2GB4A 1FPQA 3OE5A 1VBFA 3HA5A 5GIPE 3BT7A 2AN5A 3EVGA 1UIRA 4OX9Y 3GRZA 2JH8A 1RJFA 5ICCA 4C06A 1JG3A 5JR3A 2G72A 3EMBA 3G5LA 4PYKA 2IH2A 1N2XA 5DM1A 4KIGA 5GWXA 1AQJA 5FWDA 3MERA 1JTEA 4CXMA 5HIKA 3BWMA 2UYQA 4RTPA 4V0QA 5K0NA 3R9XB 5EG5A 1R6AA 2P7IA 2YXEA 3PS9A 3X0DA 5T64A 1XDUA 3EMDA 3P2KA 2BZGA 3G5TA 1I1NA 5EVJA 3BXOA 3G2MA 2O57A 3G88A 5CVUA 3HVIA 3FYDA 3TKYA 4E2YA 4FT4A 3KQSA 1XTPA 2DPMA 2XYVA 1L9KA 1D2CA 3K6RA 2HTEA 4PYNA 3TRKA 4PNEA 1D2GA 5T67A 4IV0A 5K0EA 1KHHA 2WA1A 4OA8A 5DRYA 3KQMA 1NKVA 3QOWA 4DF3A 5LR6A 2ZWAA 5FUBA 4CWAA 5EZQA 1WS6A 1X1BA 1WG8A 3G2OA 4ISCA 5E8RA 1DUSA 1G6Q1 4C07A 3KPJA 1SKMA 4PWYA 5LQNA 3OPNA 3ANXA 2IH4A 3I5UA 3UA4A 3FPEA 5LQRA 5E2AA 4F85A 1G8AA 1R8YA 3P2IA 4YUYA 2OKCA 3FUWA 2AOXA 3UBTA 2JHAA 3EVZA 2ZIGA 3PVCA 4PYLA 3VSEA 2OBFA 1JTFA 5EEGA 1X1DA 2ZIEA 1NV8A 3LBYA 4YV1A 3CC8A 3LDFA 4R6WA 3M6XA 2AOWA 5DX8A 5D1NA 5HFJA 4KRGA 1G38A 1HNNA 3EVAA 3MGGA 4BLUA 1ZG3A 2UZ4A 2EX4A 2PSSA 3SM3A 3PX2A 1SQGA 3KQWA 2I7CA 4H0NA 3THRA 1IY9A 3B3GA 2P3LA 3AXTA 3DMFA 4EKGA 1NBHA 3KHKA 5E2BA 3G89A 4FZVA 5EMLA 1WY7A 2YXDA 5DX0A 3KR2A 4M38A 2G70A 3LKZA 3REOA 1NW3A 1NV9A 1O9HA 3PX3A 2YQZA 3DXYA 5EOVA 4ER6A 5LQKA 4O29A 4DQ0A 3CJTA 2QY6A 4LECA 5D1HA 3KR1A 2IIPA 5EMMA 2FK7A 3EGEA 4XUEA 5GM1A 3SSOA 2FK8A 4C04A 1JG1A 3HA7A 1BHJA 2ADMA 2NXJA 3TQSA 5BW4A 2ZVJA 1XDZA 1EJ0A 3C0KA 3FPGA 4FGZA 4RVDA 1WZNA 5DPMA 5FA8A 4C05A 2BM8A 2PX8A 3BZBA 2XBMA 1QZZA 2Z6AA 4X61A 5FTWA 5GIOE 2HNKA 2IP2A 2NXEA 5EMJA 4ER7A 5GOZA 4PONA 5HIMA 4EMSA 3U81A 1AF7A 2IDKA 3CGGA 2PXAA 7MHTA 2AOTA 4QTTB 1QAQA 2XVAA 1Q0TA 4AX8A 5F2NA 3WSTA 1JSXA 5C9ZA 4FS8A 5KQSA 1Q0SA 2AN4A 5C1IA 2VDUE 5U4XA 3A4TA 2A14A 5K01A 3DTNA 1F3LA 3A7EA 3QV2A 4GF5A 3EVBA 2EFJA 3FTDA 2F8LA 4M37A 1BC5A 2NXNA 3MTEA 4OBXA 5LSAA 2BR3A 3DR5A 4DMGA 1IM8A 3V97A 2PV0A 5FHQA 4WXHA 3BWBA 1L3BA 3IV6A 3DH0A 4YV2A 3UJ7A 4FP9A 1FBNA 5P8WA 2E5WA 3O7WA 5K8VA 3AXSA 3GNLA 4X60A 2AOVA 4EK9A 1NW6A 5HIJA 1ZHFA 3HVHA 3FYCA 4E31A 5LQJA 3OU7A 1QAMA 5E1BA 4E33A 3UJCA 4POOA 1BKYA 2OXTA 2ZCJA 3G2QA 2ZLBA 2AVNA 4HC4A 2HR1A 3PFHA 2IPXA 3NWEA 2HV9A 1KYWA 1EJ6A 2PXXA 1RJGA 5DT2A 3JWJA 3VC1A 4RYLA 4HGZA 3BWCA 2OYRA 2GLUA 1NW5A 2ZULA 3BKWA 2NP7A 1JQEA 2P3OA 3CJRA 1G55A 3TMAA 5FQNA 4RTNA 5DTQA 5F2KA 4HG2A 5CD1A 5CVVA 5DXJA 2GH1A 3R0QA 5EZSA 1JG4A 2QE6A 3K0BA 2ESRA 3EVCA 5E8JA 4RTLA 3C6KA 3G8BA 4QVKA 5K0BA 2P1DA 4DCGA 4E2ZA 4L7VA 4P7KA 3TM4A
chains in the Genus database with same CATH superfamily
3BWEA 4YLYA 1LI5A 3N8DA 3LC1O 4MVJH 2WUDA 2YHUA 1C9EA 1F8GA 4YAUA 3LC0A 5KTTA 3EVDA 1RLTA 2XR1A 2Y6UA 3KJXA 3MRTA 3PLNA 5TLSA 5C4GB 4P0PB 3W2EA 2GBGA 2O8DB 2A1UB 4RPLA 1HY3A 1JHOA 4PX5A 4OQ4A 2PCLA 3TW8B 1DKNA 1UQTA 1FQWA 1L6IA 2CJFA 3HDGA 2DC1A 1Z68A 3GJYA 2QT9A 3SF0A 3GLTA 3D2LA 2CXSA 2OM6A 2R2AA 3DOEA 4G81A 4XWWA 1P33A 4BC1A 1IB0A 4E21A 5BN4A 4FONA 5CAEA 2J4FA 2V0CA 4R0NA 4PLCA 5DLPA 1H3NA 1KJNA 2GCEA 5DP2A 3EA5A 1M1YB 1WTAA 5FX2A 2DR2A 4HNGA 2VUIB 1O6CA 2JARA 4G1VA 1ZM3A 1KSGA 1N6NA 1ISFA 1QGYA 1THZA 1NI4B 3IUMA 4DYVA 1PV1A 3G5UA 4J16A 4V2IA 1I5OA 1X70A 3H0KA 4DIOA 4HFNA 4R8RA 4AO8A 3U6BA 1AURA 2I1QA 2I66A 2Y1EA 4CTJA 5AVWA 2C59A 4B3GA 2FYTA 1JNYA 4Q19A 4KLCA 4PXAA 1P4SA 1VPEA 4YHHB 2IYEA 1N6OA 4RVUA 5CA1F 2EKZA 3FFWA 3LYLA 4XFDA 3SN6A 1W9HA 3OZRA 5D5HA 1QJCA 3EARA 3M2TA 3R7WB 3BMOB 3AR7A 4RFSB 4IZIA 3OX4A 2J6CA 4P3OA 4PXSA 2C9CA 2Y27A 1LVUA 2L69A 3NT4A 1UJ5A 2Q5LA 3PNVA 4DQVA 5HZGA 3BD8A 1BXGB 2WYWA 4RIFA 1OX4B 3ILYA 3CG4A 2VQ6A 3KJFA 3W6NA 3EQ7A 1V5FA 3QRWA 3I12A 2VF4X 3M5CA 1L1EA 4HV4A 1YS9A 2GEKA 2NWQA 4IM7A 1L5QA 1W25A 3T3IA 3LUBA 3AY3A 2HZ7A 2OQIA 4O02B 1ZMTA 2H2HA 3QF4B 4O1HA 1FDIA 2JIDA 3GOQA 4KE6A 2GZMA 5DGIA 3H1GA 1R8XA 3DMPA 1QG4A 4IFTA 3MJVA 4L8LA 2XQFA 1NE2A 2JCVA 3CFYA 1P5ZB 1T4MA 1BN7A 3OZTA 1BS2A 3L7BA 4QBTA 2J0UB 1QJ4A 1GYRA 3E9NA 4BB6A 4BNUA 4CKCB 4YREA 2XOKD 3M4XA 3ZCVA 1P80A 3L1UA 5ESXA 1YS4A 1VPVA 4L6IA 2AHOA 4AG3A 2XT6A 4PIVA 2EQBA 4FE3A 3ZJTA 1T2NA 1ZN2A 2IRWA 3ESBA 2W4IA 1VI6A 1HDIA 2DH5A 3L41A 2RFLA 4IJWA 2QD3A 2AT1A 4UPVA 3B1FA 4Q1VA 3KSMA 1R6BX 1VHQA 4XD7A 2QJTA 3M0EA 2OA0A 3OF3A 4P8RA 5JMWA 4WECA 3MQ2A 4QEDA 1UJCA 1B93A 2O5VA 5EP3A 2I7TA 3D4BA 4LVCA 3C4QA 1XTUA 4QOFA 1CEEA 3LKBA 2P2ZA 4H7KA 4QGHA 3OCZA 3MT0A 4RIEA 3N6VA 4GNRA 3PEVA 3C6QA 4FNGA 4K88A 2MIIA 4N54A 4CVNA 1BTOA 1O89A 3FNHA 4MV6A 1KOGA 3BIWA 3LY5A 1UBCA 2P0YA 1YRLA 3EAQA 3E9QA 4I1YA 4KR0A 2PQ0A 4QXRA 3VNBA 4G0OA 2E49A 1F5SA 3BUSA 1TX4B 2G8LA 4FLFA 4MAFA 3L06A 5I7OA 2WKRA 4N47A 4AUNA 3WMXA 2HWWA 4EUKA 2PHZA 3BF8A 1J2RA 1P1JA 3H8SA 4NCIA 1IHYA 3WISA 3ZY5A 3M9LA 4Z1MA 3TYXA 1XDDA 1ZVKA 4JBWA 5AVQA 2GNPA 4YJ2A 1WMBA 4MPRA 4MGIR 3M6WA 1VECA 2OO5C 4CHGA 5AR1A 3KQLA 2PUAA 2HLHA 1C0PA 2X13A 5JAPA 1ZXLA 2XQGA 4KIJA 3NOQA 1SHLA 2AN9A 1XZNA 3V8BA 4ARZA 3MGAA 1ZN8A 1LA2A 2XITA 4R83A 5I01A 3TB4A 4MX8A 3U13A 4TKVB 3TLYA 4YCLA 2V3VA 4H3VA 3SQWA 1T1EA 2VYFA 1JR3E 2VHUA 3L6BA 2C5LA 1UDWA 1Z5ZA 4OM8A 5DCLA 2FFQA 1YBFA 2G9VA 1O3YA 1ESDA 1EUDA 1IZ8A 1DG3A 4KQGA 1H2FA 1ZJ6A 3OE7D 1OAOC 5ICMA 3SXJA 3V6LA 1WUIS 5IW8A 3EIHA 3LBIA 3T34A 3ZTTA 2QK4A 2BHRA 2RBGA 5JXGA 5K20A 3SQXA 3EBLA 4QDTA 3TVTA 2PPLA 3AFOA 1MABB 4UNNA 3F78A 5LOVF 3MJTA 1IN6A 3C3PA 3PA6A 3SSMA 3WDSA 1VCIA 1YCDA 3GRKA 2H7CA 3IOMA 3EXIA 2R1ZA 2XZPA 1WSWA 1XEXB 4DA8A 1NZFA 2YJZA 4UU0A 2AVDA 5ERGB 2ZUWA 1U3FA 2TMYA 1VL6A 3K8ZA 5DM60 2FEAA 1Z63A 1I94B 2XI4A 4FZ5A 3N5KA 2ZSJA 5A3JA 5BW8A 2Q8PA 4LK2A 1F8UA 3NBYC 4B3SB 1I7NA 3A7DA 5AVRA 3O2JA 2W8BA 2X7XA 1FFSA 2Q45A 3HUDA 3FPJA 1WETA 4MR8A 1H1LA 5K8LA 1QIHA 2B4TO 3W3AA 3NYQA 2HAEA 4RVGA 1E5VA 4JQSA 3VX3A 3K0SA 5HMLA 1CEXA 3OUUA 4DMCA 1PX0A 5LDHA 3DYBA 2FN3A 1LWNA 5G02A 1QO7A 3P20A 5BURA 3HCFA 3P19A 1NUSA 2AFHB 4O2AB 2FPXA 3IEIA 4AF6A 4QPPA 3HXLA 3KWJA 4Q34A 3GBSA 3BEOA 4UVHA 5D8DA 5E4TA 3W8DA 4C7BA 4NAUA 1JB1A 3S2IA 2QBYA 3N0RA 4TSFA 1X8KA 2PZEA 2YJNA 3MSXA 2C9BA 4NHOA 2XX3A 4UNSA 2BTEA 3WGLA 2ODQA 3G2HA 1PJ8A 3EASA 5KTMA 2ONZA 1WLSA 2NVOA 2OXIA 3AY6A 2PKQO 2E6UX 4GO1A 3PSAA 4TL7A 4ZT2A 2H07A 3B1YA 4L78A 5B1SA 4UD6A 3K70D 3QQPA 2QXTA 2D62A 3QU9A 3OHSX 1YZLA 4QJIA 4KQJA 4LZWA 1E2EA 1R8QA 2H8KA 4CL2A 3Q5GA 4EUSA 4FSHA 4B81A 5A4DA 3B6IA 4S1TA 4TZ0A 4KC0A 5ALVA 1GL7A 2IEDA 3BGIA 4Z4GA 2NU9A 3LX5A 4NL4H 5L9AA 2V7EA 4ZOQI 2C4NA 1RI5A 4AI6A 4ICIA 3RWBA 5I48A 5KYKA 4UHDA 4FNMA 1NVFA 1PZEA 2PBFA 1XVLA 2H7VA 3WO0A 5JATA 1Q57A 1TZJA 3HV2A 5K6AC 3ZHQA 5KBYA 1VMAA 1AY0A 1C0LA 4JEIA 4JEUA 1EWVA 2C2ZA 2GJSA 1R6DA 4YMGA 4RGVA 1S8OA 3U4HA 1U65A 4TTQA 3RUHA 4GS5A 3MCVA 4GNKA 4JDPA 3MZ0A 3V2IA 1UBFA 2ZAMA 5HVNA 2IP1A 3EHDA 3I2JA 4G1UC 3LOQA 1NUTA 3DFMA 2QXYA 2CSXA 1WW3A 2FMXA 3UK2A 4MVJD 4Q00A 2JGNA 4MW0A 3PI7A 3PTAA 2FRDC 1GP2A 2VHWA 4K6OA 1Y8RB 3EIUA 1VMKA 3HI4A 3WHLA 1C7JA 1JYFA 1T8UA 4HQRA 4V0RA 5EJ5A 4KDCA 4H7IA 5BR8B 4GWGA 3R5FA 1Z33A 2UYHA 4WACA 4NDZA 2H48A 3WXBA 4M0LA 4YC7A 1E1KA 1AM4D 2OUIA 1EUQA 1NYRA 3OPYB 3CPEA 5H81A 4MIKA 2QKYA 2X2PA 4NCBA 1RLIA 4UBJA 3SYLA 3HK2A 4IUDS 2Q6OA 1GPDG 3ABOB 5CX1B 2HD4A 1H1DA 4RTOA 3MWJA 4HVCA 3CV3A 3W34A 3SZGA 2RGDA 2BMJA 5F2EA 4D9MA 1TGYA 4JLOA 5EUBA 4LF8B 1L5VA 2GWRA 3BWYA 5DM70 5JQGA 4FINA 4CIXA 4OMCA 4MA5A 4RY8A 4TVBA 3KJEA 4IHAA 3KAKA 4Y9RA 1TEVA 1V7PC 1ZJZA 4MTCA 3L1IA 5FWXA 3U49A 2R25B 1TTHA 5JNUA 2DWPA 3ECSA 3TLMA 2PMKA 4JBIA 1IHDA 1PJTA 1S7GA 3WWPA 2XMCA 3WV5A 4CLOB 2XWBF 4D9NA 1EFUA 3UAOA 1JHZA 4MQEA 5KHLB 4L3VA 4RGBA 1OI3A 1JG3A 3IXMA 2OAGA 1LJ8A 1SG0A 4PYKA 4QYTA 3W5CA 3U4QB 4FK8A 3EVNA 3AM5A 2IHTA 3M4NA 3IH5A 5BSMA 1JZQA 1P73A 3MERA 4P22A 4CXMA 5D00A 3L7DA 5DYYA 4N7JA 5TT1A 1NLYA 3RQSA 3BA1A 2DFNA 1XTJA 1GEEA 3V8NA 3AESA 4DY6A 1O6GA 2FEXA 4NU6A 2IEYA 4CQMB 3I61A 1Q44A 5J40A 4CKWB 2NOAA 3G5TA 1KI4A 1RLJA 2B5OA 3G2MA 2R8XA 1PVDA 3HH8A 4Q7JB 3JATA 5CVUA 1JEYA 1EBBA 2VTEA 3GA7A 4CFSA 2O3TA 5KQMA 2X8LA 2DPMA 1FYXA 3SC2B 1AHIA 3OCWA 1W52X 4QIHA 5AICA 4QHSA 4W7SA 1FMFA 4EG4A 2H0RA 1D1PA 2I33A 3DZIA 2IDMA 1OE0A 1Y34E 4CWAA 2FUKA 3C6ZA 4XAQA 2P6RA 5BV8A 2D3TA 2GZRA 1J7JA 3G2OA 1QDUA 2ACKA 3BE8A 1Q50A 3BREA 3KPJA 1BDHA 1G2QA 1O57A 4KLRA 3ZK8A 4EFKA 4JLDA 2G9QA 1QP7A 5FR2A 1NVGA 1KJ9A 4XCVA 4JK3A 1AQ6A 2P75A 3DDWA 2ZDQA 3C4JA 3TF5A 1LLUA 1NQ5A 2OKCA 1BQ4A 1KYTA 1YR9A 4FMDB 3HG7A 5JW6A 3FF4A 3IUJA 5MN4A 5KYUA 1IEVA 3ZS9A 2ZT8A 5B3AA 4AT1A 1Z38A 2BKEA 2WAMA 1YTLA 1KAEA 4R6WA 4YMIA 1IK6A 1DC6A 1ZCZA 2ZWIA 4XSVA 2FMIA 2I4NA 1XQ6A 1MEOA 1C80A 1YE3A 1ZG3A 4G89A 4LHXA 2PSSA 2NGRA 5BR7A 3SM3A 4KO1S 3A9UA 2A88A 2F9LA 4HZUB 1N7GA 2RKWA 3TX6A 2XUAA 1ZIYA 4HDRA 5ESWA 2P4UA 4M9CA 5ITZA 3LKZA 1TVCA 4RIHA 3PX3A 2HCBA 4UCQA 2V0NA 5LA6F 4NSNA 1REQA 4D46A 3ZY3A 4DQ0A 5KQLA 1DHRA 3KFVA 1AUPA 2NUPA 3A4VA 5LBTA 4TKMA 4XUEA 5GM1A 3HP4A 3V33A 3K0EA 2FK8A 4QGFA 1IQUA 4CL0A 1Q0QA 3PNQA 2JLAA 2BCGY 4TX1A 4LJAA 4TL6A 1KDOA 4UPEA 4CIAA 4X61A 5DNUA 2Q2OA 4MEBA 1S2GA 2QQEA 2CHVA 5A3VA 4F45A 4Y1GA 2DQKA 5B3LA 2G63A 3KZXA 4ZGGA 4EHJA 3BB1A 2PXAA 3CLKA 2FSVC 1PHRA 2XVAA 2YOHA 2GTHA 3CKYA 3MBOA 2HCRA 2ZSFA 3L8HA 3Q9SA 4M1KA 5E6SB 1SJ9A 4KO4S 2EF1A 4Q3CA 1KJZA 4TXLA 3RBZA 4ENVA 6GPBA 3ENZA 5D6NA 3WA7A 4FS8A 4L9AA 2AN4A 2WTXA 3OZWA 4GBGA 2ATVA 4LTMA 1SXJC 1LLQA 1V5IA 3SEAA 3CSDA 3A7EA 4CMKA 1ZO8A 3U3XA 3EDMA 4G37A 2G36A 4OBXA 4ND1A 4ZFNA 4H4EA 1T4CA 2ZBUA 2ZJFA 3LQRA 4Y6SA 4URVR 2PV0A 1B6GA 2I34A 2Q27A 4PS1A 1TO6A 5KJ1A 4DR7B 3A28A 4NAVA 2SKDA 1RXVA 2C82A 4XTRA 4XIJA 4XX0A 4B3XA 4HAOA 1SUEA 4RMIA 1OH5A 3SQMA 2ZUBA 4LVOA 3JVUA 2D2EA 2A30A 3OU7A 3GDFA 2IOYA 3V2HA 5JG7A 4GYJA 2I8CA 3TINA 5COQA 3LRXA 1P2DA 4CUZA 4HC4A 3IUEA 4X54A 3TTSA 4F21A 2W58A 1CUAA 5GZ3A 4RULA 5IHXA 1DUVG 1JE0A 4J4BA 3GFTA 2ZIVB 3O26A 1GZ3A 1P29A 1QH0A 3FSGA 1NBMA 4XD2A 2O52A 4I4CA 1LTKA 5HBRA 2G77B 2BOVA 1DBWA 3MGBA 4OAPA 3I45A 2JGDA 2JIMA 2CW5A 3NKLA 1HO3A 5CVVA 1HV8A 1SHJA 2QTCA 5IN4A 2TRSB 2LE0A 3JQ8A 2JI4A 2GCNA 1HYGA 4RTLA 1RC8A 1X2BA 2PNJA 4ENRA 5BN4B 2A6PA 4AKHA 3A3OA 4MW7A 4FD2A 1DGQA 1H6CA 2ALJA 2IYFA 2WU3A 3FWPA 3QY9A 1L5KA 4AO7A 3H4TA 5BRNA 1COZA 4AY4A 1QRSA 2RONA 1VYVA 4N4AA 4OPMA 2R4TA 4ZWNA 1JYSA 1XMJA 1T3ZA 2EGHA 2HWXA 1VP3A 3CB4A 3FPHA 1Y80A 4ZIRA 1X86B 1LTHR 3WSWA 2X40A 3ZCUA 5I9LA 5A4FS 4YMVA 1E1RD 1XSEA 4I8DA 5FUMA 1COWA 2WAXA 2G1UA 2WHXA 3GLRA 4IO0A 1V47A 1QV9A 3BXHA 2QR5A 5ILOA 5TX7A 2N3ZA 1CIVA 3PZRA 2QE7A 2XHEA 1RAGA 1IDOA 3T1NA 2XCUA 1O9BA 1JKJA 3KBOA 3U44A 2FWNA 4DC0A 1ODKA 3EIXA 2MWMA 2C9MA 4RK1A 1ORIA 3AUUA 3HB1A 3WL8A 4BO1A 4CQNA 1KH3A 1AO3A 4ZDWA 1JXAA 1OREA 1TB4A 3P9RA 4NNJA 4I3GA 3VO8A 4PGAA 4DDKA 3G9UA 1YO6A 4WWHA 1FNBA 3KKOA 2QRQA 3GRUA 4UU1A 2IYOA 2QRGA 1LZLA 3KKZA 1MO6A 1CRQA 1M7HA 1E2UA 1A5SB 1ACLA 5E3IA 1NXOA 1SO8A 1QORA 3H9BA 4BVAA 1T3GA 3WIUA 4W9RA 1T3HA 4NCAA 3SDZA 4HDOB 2QLMA 3H1BA 3OOYA 1QGZA 4C08A 4LAFA 1WXDA 1G5RA 3BIJA 3I3SR 4KLZA 5AD1A 2P27A 2VHEA 3CLTC 2O8FA 1VE6A 4HOYA 5BN1A 2LTAA 2KS6A 3BYZA 2QVBA 3INNA 3LDAA 4BFWA 3DYIA 1CK4A 1I51A 2QUIA 3P7MA 2E55A 3FDXA 2R66A 5IT4A 2ENUA 2OBBA 3DNMA 5HF6A 4B6EA 4F2WA 5KX5A 3DONA 1CE8B 2F1IA 5HFAA 1N8NA 3QVMA 3AWIA 3F1KA 3MUFA 4E09A 3OOJA 3H5LA 1V5EA 5LD2C 3JQGB 3KSBC 3KALA 3LLMA 3EPJA 3QPVA 4DHWA 5KU1A 2CVPA 3UCEA 2Y99A 1P1IA 1E2GA 4JIMA 2W7TA 3THXA 2IHKA 4XFJA 3UT5B 3BSWA 1U1DA 1US8A 1OI2A 1R8SA 3FBWA 2PZAA 4WUTA 1QB8A 5AYVA 3WLNA 4PYQA 5I7HA 5KNCH 5THKA 3GVPA 2P40A 4BWYA 2BM9A 1UUFA 3NH6A 3PFFA 3R23A 1C1YA 2VYNA 4HFRA 1Z6GA 2P9JA 4NJMB 2P6OA 3THWB 1EBUA 5ECWA 2A3RA 4Y2UA 3ZCSA 3GH3A 2R44A 3IR5A 1UEXC 13PKA 1P4HA 4OIMA 4BQPA 3IA7A 3QNMA 1L7OA 2OHIA 1PL8A 2C94A 3GWZA 4XFKA 1ZD9A 1PT9A 1NLUA 1RWKA 3H19A 2WF9A 3DT8A 3LX4A 4TS3A 3BXPA 4WK0B 2NT4A 4KE8A 4A36A 1IXZA 1YQWA 3N75A 4KQCA 2F9FA 2Y0EA 3M34A 2RC6A 4TROA 4U8HA 3V7WA 2YXLA 4LEIA 3RB8A 3ZTWA 2JKVA 3U7GA 2PEYA 4FHEA 5AW5A 4A23A 4CE6A 3O9ZA 1NBOA 1G6HA 1W2GA 2QYSA 3DCJA 4GKVA 1NF3A 1Q92A 2PMWB 4EHBA 2UYYA 2HRDA 2NZUG 3CQ9A 4LMAA 5JMPA 4JYPA 5F7OA 3T7KA 4EY8A 4YV7A 3IQWA 5KJEA 1K27A 2WTUA 1E7SA 1QHXA 2DECA 3AEXA 3AY0A 1GZVA 5H59A 4ARUA 4NZOA 3ROPA 3FZYA 5AJTA 1EUDB 2QMQA 2J4CA 2QZZA 3CJQA 4GC5A 3U48A 4C89A 1B23P 4PSAA 2IUYA 4UOQA 1DARA 3D6MA 1S7CA 2XNDD 2LDXA 2X8BA 3HJCA 1HQDA 16PKA 1WZIA 2A33A 4ND7A 4CKEA 3NJ4A 2IOFA 1U8EA 5CGZA 1K6JA 1W87A 1YB6A 4E32A 1X7GA 3LL7A 1XVAA 1W94A 2OFXA 3FGPA 4WK2B 3ZN2A 1APBA 1H1TA 2AOUA 4GMFA 5F1PA 4FGWA 3UWKA 1I3LA 1PSDA 1TM7E 3H1AA 2VJMB 3QTLA 4FHZA 1SULA 1ULSA 3I2GA 1KO1A 3Q10A 1Y6RA 3NHRA 1KYYA 1FJHA 1J99A 2D59A 3CZRA 4MKHA 3UNXA 1TVMA 4NEQA 3QE3A 3IKMB 2GARA 5EHGA 4BB0A 2QVYX 4XWOA 2CUNA 2WTEA 3OWHA 5BT8A 4BGUA 1ZI6A 2W8BB 1UC8A 2XOKA 4HNAA 4BCBA 1PE0A 1QB7A 4MR8B 2NZXA 1R10A 3WNBA 3LD9A 4B71A 2PMBA 1VOTA 2ZYVX 2I2WA 1JBKA 4YJGA 3H8JA 4LHYA 4CG3A 1OFIA 1P91A 4S0ZA 4ZHQB 2XGOA 1P1CA 3GQBA 2VAVA 1I01A 4M7OA 5HF9A 3ETNA 4KN6A 3RGGA 2HJ9A 3TIGA 1E1CA 1XZHA 4JEHA 4LDNA 2IEAA 2OCLA 2NNLD 2ZYSA 4XQ0A 1DQZA 1E6MA 4AKIA 2Z5FA 4FHFA 3AR5A 3FFAA 1LB1B 5BPFA 4DUYB 3IDOA 1NASA 3UYLA 5JEEA 1AX9A 4H7PA 4DTCA 2X3FA 2QBYB 2DLCX 2D0DA 1BRTA 2W6CX 2JHGA 4TUYA 5DCYA 3R3XA 4AS1A 2DFDA 4KJZA 3B9BA 1VL5A 1NJ2A 4JXXA 1BYIA 1YQUA 4QWMA 3UJ9A 4E5UA 2GR9A 5JSQA 3ELUA 3P71T 3L6CA 3LCJA 4YMSA 5EXEA 5JS7A 4V3BA 2QT0A 1VI5A 2H17A 3I2FA 5ALTA 4YUXA 2BUAA 2H51A 2X23A 3H9UA 4RZUA 5JH7A 1JWBB 2GZ3A 1JXMA 1T8TA 2H5IA 2B1IA 3KFXA 4LYFA 4UVGA 3RV3A 4B4DA 4INJA 1PTKA 5BSEA 5J2TB 1QU3A 3P52A 3NC1C 3PCXA 4YQZA 4BEJA 3WAGA 3L9WA 3NVMB 4IRXA 3OMWA 2WICA 3UHPA 3TL6A 3I2IA 3W1VA 2OY0A 4BNTA 4G8BA 3L4BC 3W5AA 4U3JA 4HLDA 1XTIA 4JAVC 2ZJZA 4XVRA 2ZWMA 1M67A 2O2CA 3GP3A 1AZLA 5IJWA 4LWPA 2PMFA 3JWHA 4DCSA 2GTIA 1T9DA 4UFPA 1YDHA 4L4XA 1I32A 2EZ4A 4IZ6A 4MUYA 3H5OA 2V59A 2FUG1 2JLWA 3G5MA 1QMPA 1S2LA 3W9BA 1E62A 1LPSA 3QVXA 3KO8A 1C3LA 1BX0A 3LLVA 1U7TA 1X7XB 1LVHA 5I8WA 2QTZA 4DN6A 1SKBA 1ZONA 1YC2A 3DT6A 5TXGA 1BGXT 1XXHE 1U9JA 3OBBA 3Q6MA 4M1WA 1TYAE 2OFOA 3A6LA 1RIFA 3QI2A 4FR2A 2H4XA 5GM2A 4FGLA 2Q2QA 4J9VA 3ZHVA 3KOYA 1JDJA 5AW4A 4G0WA 2XE4A 3B3JA 1FLNA 2CBZA 2IZ0A 2HEGA 1XLUA 2V7UA 3CMCO 3IEUA 1H23A 1WKBA 4PBSA 5DH9A 2CMKA 2P9GA 1QRRA 4CLXA 5E9JA 3TJZA 1E8DA 4KYUA 1T4BA 2GD2A 2VZ8A 1RS0A 1Q6ZA 1VA5A 2AG0A 2JI8A 4OQMA 5CUQA 4ZREA 3QEAZ 4JJFA 3EG5A 2NUAA 2XQIA 4XUDA 4ZV4A 2E5LB 3BCUA 4KREA 1T8WA 1QH8A 3KDSE 3OM1A 2RHBA 4EKYA 2EAUA 1YJQA 5ER9A 3I37X 1N6HA 5HA5A 5JXWA 3RC8A 5M7EA 3EDRA 5DGCA 4L9WA 3FCAA 1R16A 3BMNB 3EQ8A 5A03A 3AVUA 2GRJA 4GGMX 1KQNA 1J8YF 4W5HA 5M2QA 4LYDA 4P58A 1Y81A 4Z5XA 3C5WP 3B1JA 1MH9A 4MMYB 3ZNPA 1EHCA 5JQGB 4UHCA 1KXJA 3SMVA 3VR0A 5EE0A 1DC3A 4Q7MB 4OFWA 1FRQA 4NJOA 3V1LA 4EFLA 1INLA 2CUTA 2W2NA 4DSOA 5DIFA 5CXQA 3KSAC 1DE0A 1CDDA 2DT5A 2VJCA 2VR1A 3E23A 2QS9A 4KJXA 1UMCB 1W6UA 3FDJA 3O82A 4MI6A 3EZ2A 1SEPA 3OSZA 1FTGA 4NHEA 4ANFA 3CZPA 2IE0A 1AUVA 2VJLA 1E77A 4IGAA 1CQPA 5SYAA 5KVQA 4EZIA 3I8SA 3VVBA 1CNEA 2H1RA 3WLQA 1A50B 4K3VA 4ZVLA 5IAAA 4DR6B 3T1TA 2FOXA 1Q74A 1UXOA 1KZ4A 2BJWA 2ZZKA 4FJ0A 3UB2A 2OSBA 2R1VB 3LW8A 5E6UB 3DLBA 1GFSA 2OPBA 2NZVG 3AF0A 5HK9A 5E7MA 1DTEA 1NVVQ 5A06A 4II3A 1JEYB 1FRNA 1NFRA 1QSGA 2FQ1A 2JG3A 1ORTA 3V8QA 4JVNA 4I5EA 5C7IO 1NN5A 1ZMXA 3H5NA 4YLEA 1EWQA 3WS7A 1BOFA 4BJ1A 4DG5A 3AHGA 3ESZA 2O2IA 2JDID 4FYPA 3G5LA 4BWGA 3AJEA 1NOKA 2YQ4A 1A88A 4JLVA 4YJDA 1I6LA 5GONB 2HHAA 1VXOA 3C5EA 2GHQA 2X77A 1KWKA 2C2HA 2JNWA 1Y3DE 1EFTA 2N9UA 4TYYA 5EG5A 4CZ2A 5IYZF 1R6AA 3SE0A 3IKJA 3KWLA 4MWEA 5EWJA 5BUQA 4LSGA 4HD8A 2A4MA 2HREA 4X64B 1N8SA 3IVAA 2ZXUA 1ACMA 1N4DA 5TPZD 3VH2A 1SOVA 1TLTA 1WEHA 2W2XA 5ALZA 3FROA 2F62A 4ZPJA 4DLNA 4EZEA 1NONA 3C5VA 4MVJA 4DZTA 2FWIA 4KLNA 1PR1A 1U8YA 1QG0A 3R4VA 4ESVA 1T0UA 5K0EA 5C2JB 1NWCA 4IV0A 4K9MA 1XLTC 2GO7A 1RYBA 1Z6ZA 2WABA 2WWGA 1L4YA 4JSTA 4PNZA 4C4OA 3CLRC 3IMGA 3CZAA 5E8RA 4CLHA 1BE6A 4ZEVA 2CLFB 5I6DA 4MUMA 1K7YA 5KNCD 1IN1A 2HRCA 2R86A 1YMVA 3UA4A 2Q21A 5ITZB 3WL7A 1F4PA 2EEPA 3TAHA 5CT9A 2FEMA 1KAQA 1REQB 2NZYA 3SYMA 2J3DA 4C4XA 1V7QA 3C85A 2JHAA 1UT6A 2ILTA 2F43A 2FG5A 5K8UA 1LNQA 4F96A 3NNSA 3JQ9C 4FFBA 1NX6A 1XA0A 5GZ1A 4HVAA 3IC5A 4CIYA 1R3DA 1QHNA 3II6X 1O95C 1H6BA 4LXYA 5LMCA 1GSOA 3Q5DA 4E5DA 4AG5A 1O4WA 1NMEA 3Q8MA 4CTMA 3THRA 5BSRA 4EUEA 4HNTA 1CJCA 1FYWA 4NYMR 1GZSA 4XQEA 1TMGE 4RETA 1NBHA 4BDTA 3L04A 4FZVA 1AQUA 5KNDH 1CZHA 1M2OA 1NW3A 4WD3A 4JC0A 2J87A 3UAXA 3UK6A 3PUXA 4DV7B 1DEOA 2YNMD 4RA6A 2O2EA 5TEVA 2CFCA 2D4HA 1AK1A 3C3JA 3R7NA 2WIKA 1WXEA 2IPLA 5IASA 4G4JA 4KXWA 1Z2DA 3CVYA 3U7JA 1JT9A 3AERB 4AYTA 3NHLA 2MMGA 2YJGA 3AFIA 1DO8A 2XGMA 2RDMA 1T6YA 1T4CB 3QI7A 4IFEA 5EUQB 3JZIA 1HG0A 4MRMA 1VKHA 1HNZB 1AXRA 4CV3A 2B83A 4KUEA 5EJIA 1U1GA 2BGIA 1N2IA 2Q1WA 4O4JA 2FQWA 1D7AA 2HU5A 2NSHA 4F9FA 1PK9A 5L45A 9GPBA 2A7XA 3I5MA 3HB0A 4S3MA 5EQTA 3RRJA 1NG9A 2QTGA 3HR4A 2RGYA 1KP2A 4F5DA 5U4XA 3I72A 5J4VA 2O2ZA 5F5XA 5H1YA 3R20A 2QRUA 4G65A 3T5AA 1X8XA 2EFJA 1PU2A 4H59A 5AHRA 5FV7A 2FVYA 2JGDB 2WE8A 3G7SA 2IYXA 1R3UA 4YUAA 2IS1A 2AG8A 1T1SA 2JBAA 2A5FA 3AHEA 1RRVA 1S9HA 2ZB8A 3ITDA 3QPWA 3JYNA 4F4UA 3LWBA 1W5AA 2FX2A 4NBTA 1SZJG 5KVCA 1LBEA 4JVSB 1GTMA 2AXPA 1E32A 1VJ0A 1JDVA 4DLYA 2O0MA 5AQ1A 1SQSA 4IIJA 2H1VA 1KY2A 1WOMA 2JS7A 4PQYA 1A9QA 3ITEA 4QELA 2OXTA 1PR9A 2ZLBA 3CT6A 1JEOA 1FRFS 4RHUA 4BFSA 5IAOA 3D5EA 1J97A 4V0MA 1CF2O 3IUNA 1UOPA 2DKFA 3RIGA 3R6WA 3V2UA 5JD5A 1BDJA 2CLOB 2CLDX 1K63A 3BULA 2NP7A 3VJMA 1I5EA 3WK8A 1HUQA 1T15A 2HIAA 4QKQA 2BGGA 2C07A 2IHZA 4A2WA 2XE7A 2ZSAA 3Q1KA 5DXJA 1KJIA 1MO3A 3M6MD 3PQ3A 4OU4A 4C7VA 2WG2A 3ZQ4A 3DEIA 2E6KA 3FMPB 4TMFA 3TI9A 2ZSEA 1M2WA 2RGWA 4FDAA 3TQQA 1JKJB 1T2UA 3ESYA 5ELLA 3WP0A 1UFVA 2AUMA 2QPTA 1EEHA 1NZDA 4P08A 3EUAA 1BVUA 1AKVA 1DJNA 1Q0ZA 3L7MA 3GFQA 1YJ8A 3CTPA 5FOWA 5FT9A 3DE6X 4JUDX 4YRTA 4P3XA 1E7RA 3GLGA 1NFQA 5LWQA 2XLCA 3I5YA 4D8YA 3GDHA 4KVGA 1OX5A 4YCNA 3IUBA 2YV2A 1TZMA 3DBHB 3IIIA 1MB2A 3ITKA 4UBMA 3RBVA 3GFSA 1PJ3A 2X0NA 4BYMA 1ZK3A 5LLDA 2R2GA 1JPJA 4AJPA 4Z8YA 1DDOA 2ZBPA 2JAWA 4IXTA 5EGSA 3RT7A 3WX0A 5K8IA 4RJ2A 3X43A 4UQLA 3PJRA 1E5QA 3PGLA 5C18A 3LGAA 4G63A 4LJ5A 1YZTA 2XUZA 4HNUA 2AN3A 3HKEB 3X1KA 4MLDA 1XGKA 1ID1A 3ORSA 1HWYA 1RC1A 2SICE 1NATA 2Z2IA 3KEQA 5JVDA 2WJZB 4ZCQA 4MEAA 1URPA 2VOJA 3KC2A 5I47A 5FUVA 3WSVA 5JY6A 4Q48A 4AJEA 1TUBA 1DS6A 3V8EA 1DHTA 3ZGZA 1ISIA 4J43A 1K97A 2IEGA 2AFIB 3QLJA 5J63A 5HNKA 1O2DA 2Q4BA 3UFXA 1JBQA 4R3NA 1TCVA 5D51S 2G0NA 3RSGA 1DKLA 1XXLA 3ZQKA 2CUKA 5D3ZA 4QXAA 3CNHA 4F12A 4LBYA 4QJ4A 1DRJA 4U0JA 4AURA 4E4TA 1PV4A 2IXDA 4L4UA 1ZH2A 4DA4A 1M2JA 1K3UB 2VK4A 3F7TA 1ZCBA 3QLTA 4PCAA 2UV8A 1M6YA 3PB3A 3UKOA 3MBKA 1DDGA 1OYOA 1TIKA 3CX3A 2KB0A 1L4BA 1Y6JA 2X7HA 3HU3A 4W4TA 5I7WA 2VATA 4PC2A 1K8XB 1JQAA 3BWVA 3STYA 1EP2B 2O0KA 3TOSA 2AC2A 5CU7A 2MR6A 2B21A 2CDRA 1U4NA 2Q3EA 3E7PA 4XJSA 1JEDA 4Z6KA 2BFDA 2A9RA 1UXGA 4NCXA 4RENA 5T4FA 1FFGA 2BFWA 4Q37A 2IE8A 3S6JA 4CLEA 1FU8A 4G5QA 2OESA 4IL5A 2BBSA 1OBFO 4MP3A 5DWVA 3BXGA 3VC2A 4QM7A 3IBCA 4Z3DA 1THTA 1NOJA 4RESA 3RLFA 3CPJB 3MRVA 3HDJA 2OB1A 4ZZ2A 1VMIA 1BWRA 4OLHA 4M76B 3TR5A 3RTAA 5K6TA 3PA8A 2NP6A 2IYZA 2Y4OA 1OKKD 2Q28A 3HBMA 4EW3A 5FUXA 2OUKA 1ZITA 2WWWA 2XQKA 1E3TA 1PEAA 4QNRA 3UATA 4DSZA 5KYYA 1B8NA 4HTFA 2H85A 5FOSA 3O4HA 1RRFA 3COJA 4GZ6A 5HJ7A 5CB4F 2NTVA 1IMJA 1XTQA 2C0PA 5HQ3A 1VP9A 3RNLA 3T9CA 4GOJA 3P9SA 4RY2A 1SRQA 5AFSA 3QHQA 1NLMA 2POQX 1E0DA 3A4YA 1N0IA 1AC5A 2DULA 5EGNA 4NS1A 4P31A 4WZBE 1DFHA 3HEAA 4HYEA 5SY6A 4QDXA 4CKEB 1N78A 5AUPB 1DMRA 1CUDA 4FDVA 5HUJA 3S68A 1ESMA 2PKEA 3L7OA 2I4OA 2AOUB 4TSRA 1ITZA 5LQAA 1LXCA 4ERXA 1QHEA 3DUWA 5CG1A 3VZSA 2EHJA 4IR7A 3RD5A 2X5OA 3S7TA 4OJYA 3NU1A 1XUOA 4DMKA 2GK4A 4LDZA 1SQ5A 4WXRA 3CH5A 4ZARA 4TT8A 5IP5A 4YO7A 1EPUA 1YQGA 2RGRA 2G4VA 2Y67A 1JAXA 1HI9A 3AOGA 5K0TA 1B0ZA 1C8LA 1GQFA 2QZ4A 2YDXA 3C8UA 3GMSA 5K0SA 5DNYB 4ZO7A 4NULA 1G8HA 4YJGB 1S8NA 3C3EA 4IIGA 4YJFB 2BR4A 1AZWA 3OH8A 1SUIA 5IWCA 2FVXA 3GQBB 2QQ0A 4ZYYA 3FBGA 4LS3A 1TCBA 1YC5A 1Z4IA 5KQPA 2ZJ7A 2X22A 2ZIXA 3G5AA 2Q3CA 3SIRA 4BE9A 2WV7A 4KO2S 4KMOA 1B1AA 4JEMA 3L8YA 1KH2A 3GB9A 4FKMA 4B3BA 5DGDA 3SICE 1E3LA 4EI2A 3ORHA 2BGRA 2GF9A 2QP4A 2ZKIA 3GLHE 4TUYB 4PIPA 4CMJA 1I4LD 5A1TA 5BSVA 4DE5A 1DAGA 4NZZA 4ASUD 4DABA 5A5VA 3CNNA 2X86A 2HRRA 1SEVA 1BW9A 2P35A 1AN9A 5SYMA 5IVPA 5B6IA 4TTPA 1ZRSA 4URXR 1Z8DA 5HF5A 2HMTA 2ZBRA 1R9JA 3GGDA 3N2LA 3UOWA 3VYUB 3WB9A 5CMLA 1MX9A 2B61A 2GZHA 1PR2A 2ZSUA 1RWWA 1B41A 2MSNA 4K2HA 5CK4A 2WNIA 1Y9ZA 2N42A 1I9GA 4X24A 4JBHA 1IUKA 2GPYA 3D3JA 4NYIQ 2FOIA 4Q6BA 4C0LA 1MQ9A 3Q12A 2PT9A 1UXJA 5KNDD 1LUAA 1UDAA 3NWJA 4HAXA 4UNQA 4U3JB 5AWFC 3ZDXB 5KVSA 3IPYA 2VHZA 4GOLD 4KWHA 5GJVC 5D6OA 3PRYA 1JKMA 1O08A 4MDEA 3W7VA 3MD9A 1R64A 4EUFA 4Y2YA 4L57A 2PL5A 3CRVA 5A4KA 4S1WA 2PX5A 5ECYA 3RUDA 4AP5A 5L4NA 1EJBA 3IP5A 4F9EA 4EMTA 1N5DA 4CFYA 2PZKA 4TOIA 2II6A 3G9QA 1UWVA 1GDTA 3E9RA 5GPBA 4DCUA 3MG9A 5L4LA 1NPYA 3RRMA 1TZBA 4BRZA 8GPBA 2CF6A 4ZI7B 1VFNA 4YS6A 4D2IA 4MQFB 3V00A 3OC0A 3VR5A 1SXPA 4L8YA 1R0ZA 4H35A 3HM9A 4JBLA 4M89A 1WQ3A 3AM4A 1KO7A 3IOYA 1N8TA 3KTAA 1UBGA 1RRPA 3ENWA 2B9EA 1RWQA 2ODNA 4MS1A 4XQ9A 1CFJA 1XMXA 5AW0A 1X2EA 1HDEA 1M2HA 5HFNA 2IEBA 4IYJA 1JDUA 2RBEA 3OP4A 5DHQA 4ESOA 3OT1B 2B6NA 2WDZA 4KB5A 1R0BA 4B5KA 5CM2Z 1MAHA 2C8LA 4BPBA 3P45A 1YD7A 3U7HB 3EMVA 1L5NA 3FPLA 3IV9A 2J9GA 3UK1A 4FGUA 4FN5A 4GLJA 5FORA 2VHXA 2BMEA 1QH8B 5C35A 1N9ZA 2ZJ2A 3ELYA 4N3AA 3I9LA 4Y2TA 3RH0A 2C1XA 1A8SA 2PE5A 5EIXA 4M22A 3DP7A 5CT8A 2CVZA 3AVTA 1DT3A 1T5DX 3EGVA 3GGSA 4W5WA 1XALA 4AECA 1HTWA 4KXVA 2Y68A 1JFLA 1DC5A 4HAUA 3O03A 1R7RA 1YQEA 2RHLA 1P6UA 5ERYA 3HFSA 2Y8EA 1SCUA 3IIJA 3PKZA 4KPFC 5JMOA 4J0GA 4H6VA 4RK6A 3P0RA 1RTTA 3JD3A 2NSYA 2Q3DA 3PTLA 4IKEA 4PHGA 4QQNA 3IL2A 1KY4A 4LNHA 3OQ1A 5K3OA 3V4FA 2V98A 3B1ZA 2OGUA 4GMXA 4U4AA 5CT4A 1I3MA 3UGKA 4JI5B 3ENVA 1BYUA 3DMHA 5KDOA 4EA6A 4RMNA 4HB3A 4F4FA 2FN8A 3IHLA 3FJOA 1CZLA 3OZSA 1PYOA 3L0SA 1Z0AA 4HFMA 4FFRA 4MJLA 3DS8A 3TCNA 1PWHA 3EH2A 3O74A 4TLBA 3K70B 4RKFA 2Q1TA 1KE2A 2XDQA 1JR4A 2O2XA 1XAIA 3Q98A 2FPLA 5BYKA 4KGVA 5CTJA 4F0JA 4DQUA 1Z5WA 2GPJA 2CXOA 3PQ7A 3RTEA 1OR8A 4QUKA 3JPYA 5K4GA 3TCXB 3S3TA 1R0XA 3KT3A 3D31A 2KW5A 5KWIA 3FX2A 1EDEA 4AKGA 4P7JA 1YFJA 2PKWA 5HKAA 5C53B 1HZZA 2YWDA 4KODA 1JRLA 2Z4TA 5AUOB 5BV0A 5LLTA 1QKKA 1J56A 1RHQA 2HK6A 3T15A 3BSFA 3PD7A 4G25A 4E7PA 5CA1A 3N74A 1YUMA 1TKBA 3DFUA 2NLOA 1RWXA 5FHRA 4E5VA 4I1PA 5HEKA 1Z36A 3TZEA 1V1RB 2BTQA 3EXHC 1N75A 4BX9A 4EECA 1QNFA 1SBHA 2CNBA 2O5EA 2E37A 2VO1A 2W2TA 1BE8A 2AH5A 4IXDA 3K0AA 4J0JA 3OICA 4OI1A 4DV5B 1Z0IA 2HQ1A 2VWPA 4QUEA 4QTYA 3IP6A 1XVTA 2X9GA 2X1LA 2Y66A 3UUFA 7GPBA 4URYR 3WXMA 1NU6A 3Q2IA 5A02A 2ZJYA 2XRYA 3D7KA 3P27A 2J48A 4BXOB 1P9WA 3MUNA 4JJ6A 2GB4A 4NCJA 4Y9UA 5BV1A 5UKDA 1MKYA 2PUVA 2GAAA 1HEIA 2ZAOA 3OZGA 4TM8A 2A0FA 2CDAA 4FYIA 3X1YA 1G63A 2WOOA 4V38A 3FWHA 2DPYA 4HL6A 1K98A 1XU9A 1XZMA 3HQ4O 1E18A 1C14A 4XRGA 8LDHA 1JSCA 1XZFA 3F5FA 4ND6A 2AK3A 3KB1A 3EE6A 1E94E 5JAMA 1O0BA 3TZKA 3TE6A 1C41A 3KTOA 1WHSA 2NZ8A 4NU5A 3T9EA 5A6VA 1GEGA 3KZKA 4U5QA 2HLDD 2IU4A 5KSPA 1ZEJA 3GA5A 3EFOA 3GZ4A 4GPAA 4KI0A 4N49A 4N6NA 3R6DA 1FUYB 1AKEA 1LY1A 1MB0A 1O94C 3CRQA 3D8TA 4CM9A 4CGZA 3G0DA 3M1YA 1WQ4A 3EMKA 3PV0A 4V03A 1ABEA 1IXRC 2FEKA 5DBFA 1G9XA 3ETCA 3CW2A 3HR7A 3ON5A 3LQ1A 5B1EA 3KWMA 1TKAA 3ZOZA 1TM1E 3ORFA 1V8PA 4WDQA 4DF3A 5MN5A 3O73A 5JSZA 1LSJA 2KM1A 4AJHA 1XZEA 2FUG6 2PKRA 2HDNB 1H2WA 3GYBA 5EJ6A 2BMAA 4DQKA 2DLNA 4WKBA 6ABPA 2WJJA 2VSOA 1FQOA 3OZIA 4WOPA 4BBAA 4X1YA 3PDUA 3RC1A 2ZGVA 4E08A 1F0YA 1S2OA 5SYNA 5BSFA 4RA6B 5FPYA 4Y7DA 5TJ9A 3K0CC 2F8SA 3VSEA 2FUNB 4G9BA 5C8YF 4HI0E 2JGKA 1OWMA 1YBHA 2HMWA 1EVLA 1XFDA 5CR9A 5LP6C 1RHUA 3JQDA 4WXYB 2P5TB 3M6XA 1GGNA 5DX8A 2IPAB 2EGGA 2QLTA 1SOWA 4MVXA 2BYTA 3IEVA 3ZY6A 4KRGA 2JJ1A 2NU7A 3COYA 3AO0B 3KM0A 5TPWA 1IATA 1GR0A 2PUWA 4PEVA 4BPRA 2BEUA 3FLEA 3STHA 1F6DA 3JZDA 3WO1A 1JZTA 1P0MA 3DAPA 4HRYA 2BP7B 1VBNA 3ZI0A 1UAAA 4ZAVA 4K6CA 1WY7A 2F3RA 3IJPA 1BEZA 1WMFA 5JECA 5KREA 3U1BA 2G4CA 1VJCA 4K5QA 4C0SA 3EZYA 4O29A 3CJTA 3ZH9B 2JAHA 1THMA 1NXXA 4C2UA 4IVPA 3ED5A 2GDJA 4V02A 1ECCA 1YNSA 1YT5A 4JOBA 2LCFA 3EGEA 1XKQA 5TGDA 1ABFA 4L28A 4OAQA 4I0WB 4J3NA 2CHGA 3PQ2A 4TT3D 4CKYA 1WB9A 1CS4C 2A1TS 3K5HA 3Q11A 3V46A 1FTSA 4C1NA 3TLZA 4QRHA 4GXTA 3WZLA 1C81A 1NYQA 3L0ZA 5TPZA 3O8OA 4D8UA 2HWUA 4CTOA 5GIOE 3VYTB 3D2AA 1DAIA 3KLPX 2B2XA 1YNOA 3MFYA 3GYGA 5LOVA 2MSKA 2IDKA 4IIJB 3CGGA 3T41A 4BP9A 1NI5A 4MGHA 4AJKA 2TMKA 4KMMA 3MJ4A 4P93A 5MGBA 3IJ5A 2VDRB 1U81A 4LMBA 1B1CA 2ZUDA 2JA2A 3PGKA 5GADl 2HADA 5HBGA 1AHPA 3TUJC 3OTWA 3DA8A 5C1IA 4LN1A 4HWSA 2HU8A 3NXKA 1UP6A 4FYVA 2NPOA 4LRTB 2J09A 4NV0A 3U0BA 2F8LA 2OV2A 3IDQA 1RYEA 2G76A 1KJQA 4M0FA 2HV8A 1FP4A 2DJIA 4ITVA 2P9TA 4XJVA 5HPYB 2YBEA 4MVJP 5DIZA 3S5JA 4RXTA 2IYSA 1R4MA 2FZWA 4Q9JA 5PGMA 3UJ7A 4FGSA 1YI0A 2FR1A 2XB9A 1ISSA 1OROA 3AXSA 2JLCA 3N2YA 4XKJA 1ZCFA 4L50A 1G20E 5AP9A 5FPSA 3FYCA 3QVGA 4ZD6A 3T94A 4E31A 1GTRA 3AMVA 3BL6A 3FHJA 3L0OA 4PRKA 3KK0A 5FBVB 2H6EA 3WNDA 1XHEA 1G21B 2ISQA 4Z54A 4MQMA 1P5FA 3T9AA 4F97A 3GLGB 3NWEA 1E2NA 1JUDA 1OXKB 1JI3A 1M6VA 1NY6A 2GCGA 2PAAA 3A9TA 3I42A 3PICA 4RYLA 3BQ9A 2P6MA 1A2KC 5AT1A 2RSLA 2QQGA 4JR0A 4JUBA 3AT1A 3HRHA 2AX3A 2I76A 2CJXA 3MMNA 1HFWA 5J5CA 2ZYWX 4YRSA 2V3CC 4NOJA 5JI2E 2FN7A 5F35A 5ANRB 3UYKA 3C1TA 2Q3LA 4QVKA 4WI1A 4ECAA 2J0EA 3ZZNA 4ZYTA 4R69A 3GT7A 3KQUA 4TVOA 2BFOA 3I9KA 1SK9A 2RGBA 4NONA 2BGMA 3NPMA 4BAGA 5JVDB 3TD2A 1U5AA 1Z2NX 1XL0A 3EAGA 3L8FA 4HEQA 4ETWA 4IGKA 1FOEB 4JNKA 1HZJA 3U17A 4BVJA 1YZNA 5CVCA 1TUBB 1KI8A 1RLUA 1CX9B 2B99A 3E9ZA 3GAMA 3H3JA 5JIBA 3NDIA 4NXNB 3M3HA 3RJ9A 2I2XB 3VHQA 1U1EA 1TZ2A 4IV5A 2RI1A 3DQPA 4FB5A 1M1NA 3DGFC 2IGTA 4JUCA 1M34E 2RHJA 3QK7A 4CT4B 3NH9A 4GRIA 4LYEA 1DRVA 1UKZA 1SUDA 5IANA 3DM5A 2ZYGA 5CD9A 1X42A 2CKMA 3W9UA 3GLSA 3QU5A 4L3OA 1DKRA 3ZWOA 1SUFA 1I4TD 3DDUA 1SD1A 1KVUA 3T0IA 1G98A 1WTCA 4OEHA 4O33A 2PFSA 1XK6A 3GF4A 3OU2A 3QBJA 5FBQB 3W77A 3K2IA 4EI7A 2PGAA 3N2ZB 4BFYA 4K6KA 1GM5A 4QD3A 1VE1A 1H2AS 3EWSA 4MH0R 4OG2A 4CIVA 5IXSA 2VJBA 2F4VB 3NIBA 3I9NA 2QR2A 1ZLXA 3B5IA 3CZMA 3FRIA 2PQ6A 5JDIC 2AEJA 5K8CA 3VZDA 4CDRA 2HYIC 4EPVA 2H9IA 1K92A 2QUAA 3K9LA 1UM9A 3EVFA 3SVZA 2B6HA 4WY5A 5K5EA 3WHKA 3N05A 1NW8A 1PRYA 5AJZA 4EW2A 3A2MA 3G0CA 3EPKA 1OUMA 1C1HA 3AKEA 3EXEB 5C8XA 1FVFA 2YYYA 1JIJA 3LUDA 5ESRA 3VR6A 2RHWA 2Q8NA 2XF8A 2DCUA 4GQAA 4ZQCB 1KDYA 2HIHA 2CGEA 2LNDA 5EZYB 4XWGA 2UDPA 2OMKA 2J0SA 2Z3ZA 2P78A 2ZB2A 4KH0A 3QFSA 1PNOA 4HTFB 1XRJA 4QXQA 4E5KA 2HPHA 1MORA 4PLVA 1SXHA 4K9PA 4GDMA 1ETHA 4NBVA 4HNSA 1P4RA 1YOVA 5HQ3B 3I53A 1SB8A 1QP4A 3EEOA 1O54A 1ODIA 2R96A 1U0SY 5L7TA 2VTBA 1VDZA 3GEDA 3GT4A 3CX6A 4QASA 4W99A 1P9LA 4Y1EA 4EO9A 2JIBA 1ODSA 1EB9A 3PFGA 3LGSA 2HPAA 1P3DA 3W5SA 3RFXA 2YBDA 4RAQA 5JARA 1HDCA 3NGLA 2PUGA 2GFHA 1QZXA 2ILVA 4DR5B 4FGKA 2MU1A 4R16A 1W73A 2X2OA 3AI1A 4Q21A 3HBAA 1HSZA 1UOEA 2RKBA 1XZLA 3LQFA 4Z9XA 4BNFA 1MC5A 3ZH2A 3TZLA 2X1HA 4OX9B 4YP0A 3NDBB 2WK1A 4BQOA 1UT5A 1XP5A 1NURA 3ZJVA 3AFGA 5GP1A 4Q1CA 2X42A 3PVSA 5A5DA 3LHIA 1PZHA 2ZRMA 2BAGA 1EIZA 3VNAA 1L7VC 1D4AA 3SYKA 2GYYA 3NBAA 5AKIA 2W6QA 4DVJA 1TEZA 1AKRA 3PXEA 1Z39A 2HDWA 2WYIA 3NZEA 4TV9F 1E58A 5I9BA 5JISA 5IT9A 2CNKA 1XCLA 4NE7A 5COBA 2AF3C 2QZ9A 5L51A 3EUWA 4ZVQA 5B55A 2X76A 1XB2A 2ZIXB 3E35A 3F97A 4WVLA 3ZHZA 5EKSA 2JHFA 1UKVY 1OXSC 4B80A 4G0ZA 4UHEA 4F2GA 3E5NA 5ERXA 5G1OA 2X6QA 2X9LA 1WY5A 1XQVA 2I7VA 2NO7A 3QE4A 1IUOA 4QYWA 1IOVA 5FTJA 1R1DA 3I2HA 4TTIA 3OG9A 2IZ7A 5FUQA 2YYZA 1EVZA 1XD9A 2XMPA 4UASA 4ACAA 4BAZA 4U7PB 3TXAA 4OJTA 3OFJA 4JYMA 1VA4A 4HYQA 2D2IA 1EG2A 3LA6A 3LWZA 3NBUA 4OSPA 3MUOA 4YAFA 5F1KA 5YASA 1YUBA 4N8SA 1ZNQO 4DA6A 1QKIA 2GN0A 4GAEA 1QQAA 3D8RA 1U6JA 3U5ZB 4E5PA 5F5NA 4YMWA 5AM2A 3FCCA 3TM5A 1SBCA 3H16A 3EEYA 4ARSA 3PQ6A 4C3UA 4QATA 3AETA 4U7GA 1W6RA 3K1AB 2HT1A 4QVIA 3A25A 2QSYA 3OT4A 1TYZA 4TKZA 3Q0TA 5LA6A 3T9FA 4AF8A 5KPDA 4D8VA 4PZLA 4DYDA 1DJLA 5HP4A 2H65A 4TMWA 2BH2A 3D7MA 2GXUA 2VPYA 2W6MA 3D1VA 3WLMA 2JPDA 3FMVA 1ZIXA 1HA3A 1O96A 3I09A 3D6FA 4CEIB 1ESCA 3RFFA 3NT5A 2X0FA 2Z2YA 4YMLA 1Y42X 1N5MA 1NP3A 2B8JA 1QYVA 3CO5A 3JYLA 4CTNA 4J0HA 4S1NA 4DLSA 3H9GA 4LFCB 4URUR 4CI9A 3B1VA 3LVBA 5C5CA 4Q3NA 4DWWA 4ETIA 2WHEA 5AVUA 1Y5LA 3OOHA 5LZ5A 4K46A 2IY8A 1G4HA 3F9IA 5AM4A 4B83A 1U5BA 3PD0A 1T4GA 3KTAB 4G1MB 4MW5A 2Z6UA 1YA6A 4RD2A 1OTHA 4EKIA 2EATA 1XNGA 2OZLA 3U40A 2PD3A 5T4BA 3UBMA 3U56A 2A9KA 2C7QA 2QZPA 3BGDA 1P2SA 3B8EA 2IUFA 2ZBQA 3PL1A 4CM4A 1ADYA 1X9IA 2HQRA 3B52X 3LF1A 3OLVA 2NYAA 3EQ2A 1S96A 4HH4A 4TLDA 5BQ3A 3DVAB 2D6FA 4P3KA 4JV5B 3UAWA 2I78A 2YINC 4HUJA 3OIUA 4QDJA 4ZAYA 2FFHA 3HEBA 4S04A 3DMRA 3OJEA 4JB8A 3IHKA 4YP9A 2UUBB 4C3OB 2WZBA 4EQ6B 3NV7A 3AF3A 2IJGX 2EVWX 3C1UA 1NJGA 2C96A 1A9YA 2PU7A 1W85A 2LKCA 3L46A 3M83A 5DHTA 1Z26A 5K8TA 2BSAA 2D8MA 4J7CA 3H5TA 4F4DA 4RD6A 3RYCB 4FWIB 4C6TB 1SC9A 2OENG 3QF7A 4QU9A 1M3SA 5IJAA 3HB9A 3RKRA 2GPNA 4JLBA 5CX4A 5F9FA 1CPYA 3H2BA 4OHXA 3KPWA 2JHCA 2I2AA 3ZC3A 1SXJD 1FCJA 4HRXA 1N5LA 4HYTA 2PN1A 2WUWE 2XYQA 1F1JA 1CR4A 5KNBA 4RVHA 4O25A 1YSCA 1PZXA 2WP8J 4XVHA 1U2GA 3Q8LA 4J6EA 1PJBA 3KB8A 3OJ0A 3W0LB 3EDQA 3AR9A 5U4QA 2DBQA 3DE4X 2PU5A 5CXXA 6CHYA 2XDQB 3R6TA 3G6KA 3OQOA 2J85A 2ACEA 2QX7A 2H2GA 3N59A 1ELOA 1UBTS 1QTRA 2PT6A 1AKNA 2H8GA 2VF7A 4KFRA 3CH6A 3TQFA 1JDNA 2UVPB 4ZQIA 4A8JB 1S3IA 3AUXA 4MHOA 2FPKA 3QX8A 3QVUA 1OJLA 1RMTA 1KH1A 3OKPA 3NBKA 4Q93A 5IKOA 4DB4A 1GGJA 3QXXA 3BAZA 1H3FA 4GU5A 4NICA 3AR4A 2H63A 2CCKA 3UANA 2CWWA 3BTSA 3N87A 1Q0UA 5CA1B 3WA6A 2ZDHA 5HG0A 3IBGA 4JB3A 1JVSA 3WRWA 4X1OA 2ZTUA 3DBIA 3O75A 4NEGA 1A4UA 2FZ4A 3J7TA 4W9NA 4EGSA 4PN3A 1KMNA 5ALGA 1EXVA 4BMYA 4YRLA 3DLPX 2QTNA 3K0AB 4NESA 4PG6A 2ZYHA 1SURA 2QMHA 5IAEA 4TMVA 5G4KA 5HTOA 5KQGA 4WGFA 5A4JA 2G1PA 3P2JA 3QLUC 3W5DA 3PIIA 3BMXA 1HNWB 4OOFA 4AJ4A 2I0FA 1C30A 2O2SA 3BILA 3E7FA 2VK2A 3MD0A 1ICEA 1S3FA 1K7SN 3M5DA 3C7AA 4Z51A 2BELA 1WQ1R 2Y3IA 2ORYA 3MS2A 3OJWA 4X20A 4JI8B 1OT5A 3RWOA 4BQSA 2CYAA 1NC3A 3LBNA 4N3GA 4C43A 5FAKA 1KMQA 3TRHA 1GAWA 2BSQA 1GPJA 1QOQB 3DWEX 1NULA 2G5CA 3NONA 5ABPA 2WQZA 2D1FA 4NH4A 1N25A 1PWYE 1S2MA 1U2DC 2VI5A 3IEMA 2Z8YM 2I7DA 1XEWX 1F48A 3SJAA 1FLAA 3SNHA 4EPXA 3NWPA 4O2LA 5B57C 4MDYA 4HDKA 1WV1A 3ZY2A 1WXXA 3HS3A 5LXTF 1EUCA 3T5TA 9LDTA 1WHSB 4KQFA 2BDEA 3R09A 2GD0A 2FV8A 3M82A 4NZYA 4BQNA 5BN3B 2OZPA 2ZRHA 4C5BA 4J90A 1V8OA 2PRIA 3EFOB 3V7YA 4M9XA 4N7RA 2DKNA 1T13A 2DQSA 1KQGA 4BUCA 3FKJA 3PEYA 1K8RA 3LQKA 2V7TA 1V6CA 3HBJA 4FEAA 3KZMA 4IS2A 4I5FA 3T5MA 4OX9Y 2IYWA 1DIGA 4RJTA 5TT0A 4BJHB 4JXZA 3AOEC 3EMBA 721PA 5CLHA 2ID4A 2M32A 3NBFA 2GPTA 3I9JA 4HS4A 5AJUA 2I9PA 3E2PA 4L2IA 1JTEA 3WLPA 4FS3A 1JALA 2EX1A 4V0QA 3L8MA 3R77A 3OCVA 2WU0A 2Y2VA 4GIBA 3CLTD 3HNOA 3IULA 3MEQA 2IXEA 5IARA 1DCFA 1ZA2A 2BZGA 3CZ9A 3KCNA 2J3LA 2JIQA 2OP0A 2EOAA 3PJEA 1T91A 1KFJB 4XWKA 4N3NA 4I1OA 3OX3A 4UMDA 3X2EA 1IM5A 1XTPA 2NQ2C 3AZQA 4RD3A 1DJMA 5IBCA 1D2CA 1R27A 3NBXX 4ZAXA 1V7ZA 1ONOA 1RZRA 4ZDIA 2NU7B 1MVOA 1C9JA 1N6KA 1FF9A 1NX9A 3MT8A 2JFNA 4MR7B 4GGOA 1N2BA 2BEUB 4QUBA 3WIDA 4RBNA 3OKAA 1AGPA 5H68A 4FDLA 5KDDA 5F3WB 4KXLA 3F8TA 1BWPA 1GILA 1JIXA 3EQ6A 4CN9A 5P21A 4MMXB 3T95A 2AI2A 2WTBA 4D79A 1AA9A 1E9EA 1A7UA 3C7CB 3CM0A 3F5QA 2AWNA 3O8QA 5EHQA 3TGWA 5B7QA 1NR1A 5AVOA 1NRXA 2J41A 5LB4A 4MW9A 2ZPAA 4GSLA 3QWHA 3A9RA 1OTYA 4UTPA 1YU6A 2BFBA 2IYRA 3WYAA 1GUBA 4EHKA 1YTUA 4DA0A 5T8KC 1ULUA 3MJHA 4DGQA 5HE8A 2JFHA 4I66A 1JMYA 5HFJA 1U7ZA 1KY3A 4QOHA 2QENA 4E1BA 3GVXA 2RC5A 3SKXA 1GXSA 1JA0A 5LOVB 2ZAGA 1IEXA 1MENA 3PX2A 1O6FA 1SQGA 2GM5A 1AUQA 4RPJA 1IY9A 1JDBB 2OC9A 3FNRA 4UJ5A 1XRLA 2RAPA 2QG4A 3ILVA 2BRUC 4W5JA 2GN2A 4KIWA 3WMGA 1GPH1 3QXCA 1K7CA 5CW2A 3D0QA 5ITWA 5CTAA 5ALSA 1O9HA 1YL5A 2CE7A 3KEMA 4FCWA 1UPXA 1CU1A 3KSRA 4J2HA 4YASA 5LQKA 4OHKA 1A0OA 3G0OA 4M1OA 1XBTA 4W8OA 2O8CA 1CZOA 3DAFA 3KR1A 1XTBA 3DMDA 5LVAA 3LLUA 1RM4A 4MB2A 3PC2A 1BHO1 1V0JA 4OL0A 3HZRA 1XDZA 3S2SA 1LDBA 1I8TA 3AUKA 2EWVA 3ZW8A 2HLDA 2VJYA 2CV2A 3ELBA 4MGKR 3DBOB 1FW6A 2XB2A 2GXAA 1PK7A 3VSCA 3BRQA 2VKQA 4D0NA 1GQ2A 4INZA 2DUWA 3PDIA 4IEIA 1ES9A 4NYJR 4C0WA 4AWXA 1UAGA 3SDSA 3WZ2A 4ND4A 4Z9AA 5T3YA 1SOUA 3CXRA 2JGJA 1D7OA 1LH0A 2HRQA 3RRNA 1M2KA 3U1TA 1VCMA 1JE1A 2HMVA 2GLXA 3RNOA 1KS2A 3DMYA 2OXEA 1OT3A 1YB5A 1M6VB 3IMKA 5KQSA 2JW5A 5F9HA 2VDUE 2YYAA 4BKUA 4TRJA 3V3KA 5I9NA 3L07A 1QK3A 3A3NA 1QHHA 1UJMA 4V2UA 3RYHA 1E5XA 3P2YA 4BGIA 3O90A 4A4DA 3DBRB 3Q3VA 4ZGBA 1CJUC 1PG2A 3E58A 5TQ0A 3LRPA 3EY4A 3V97A 4AM8A 1EXMA 2EJWA 3BBLA 2OLKA 1TM2A 4B6JA 1J5EB 2XZOA 1EGVB 4FP9A 2HT6A 4RKYA 3PXGA 4OXYA 1M33A 5C8VA 2XIQA 2O0JA 1R12A 5JAZA 5LZ9A 1PD0A 5E1BA 2VNJA 1T36A 1K2WA 1YR8A 2VUSA 1GFIA 2AIRA 2YIDA 1W47A 3AF5A 3K8QA 5GGYA 1N1EA 1Z0UA 1DBPA 3D0RA 2A0UA 2VHQA 2HV9A 3ZK7A 1EJ6A 2CC2A 1U2PA 2L18A 3AC0A 4FNOA 4I9NA 5TARA 3T7EA 4KE7A 3VDXA 2YZ7A 3IB6A 3ZHCA 4ZVTA 4CMIB 3CJRA 4UPDA 4YAJA 3I28A 2FFJA 4NABA 1C1DA 4KI7A 3W4KA 4CNBA 2FZGA 3LBAA 2L2QA 1L8AA 3PJDA 2FPWA 1H5UA 3B85A 2REXB 2GZ2A 1R4NA 1R2QA 2I3DA 3CUSA 3Q3EA 4M9RA 4D9GA 1FTWA 1MCZA 4QQ8A 3IFSA 3SXUA 3QE0A 1N33B 3S8YA 1CY0A 4R41A 4YT5A 4TZTA 1D2NA 4TT3A 1G291 5KIAA 3HWWA 3TGPA 5EXDA 4QG3A 1MGPA 4TTTS 2HFJA 4X9XA 2OM2A 5DXAA 3RAPR 5LP6F 1PKEA 3E8SA 3VKWA 1T5OA 1L5RA 4ZYWA 3KL2A 2WE7A 2Y9PB 3JARB 3GJ5A 2YX1A 2B5VA 3OZUA 5I3CA 4RFVA 1E3DA 2OO5A 3HN6A 3R5HA 2JJMA 3ZXUB 3ER8A 1I2BA 2C8KA 4HKTA 1FDWA 3T3PB 3NEYA 1NVUQ 3KOOA 4MR9B 2FZCA 3CF2A 3MLEA 4B3FX 2IUEA 1SZDA 3X2FA 1Z0JA 2ASVA 3VC7A 4ZOLF 3I9FA 1WSBA 3PT5A 2BMDA 1AQLA 1Y5MA 2UZ1A 3C1OA 3MN1A 1N2HA 4QSMA 1ONPA 1XU7A 2C2YA 1FU4A 1P75A 2CE2X 2ZYTX 4FU0A 4P3NA 4KNYA 4F3TA 3B3QA 2PRSA 3UN1A 1OAOA 3MQ4A 3RSCA 5G41A 1MJHA 1ULZA 4Q3KA 4F06A 4AJ1A 1YOVB 3UZUA 3WVNA 2VNSA 2NTNA 2FKNA 4K7JA 2DPLA 3LUFA 4I1RA 3TW6A 4EGJA 4P84A 1G2PA 2IW1A 1KR2A 5EL0A 4XYLA 3ETEA 2FMKA 2WUEA 4JT2A 5JHHB 2WQ6A 2D0PB 2ZSBA 4Y98A 5KJFA 4AY2A 2IYUA 1NA5A 1XOIA 4BVGA 1EK1A 5KEIA 1BSVA 1G7RA 1G8JA 2B0CA 3C87A 3EWNA 3QBTA 1RPTA 3OZFA 1U7DA 4RVNA 2AJCA 1WCIA 3K0FA 5TRTA 4F8YA 3TMYA 3FOCA 1U8XX 2XUIA 1DRKA 3FOAA 5EJ8A 1QE0A 2Q5FA 3WOHA 1BOOA 1HKUA 4MKXA 3ZWBA 4QLOA 4KHZA 1Y9AA 2AR0A 3JALB 3P9XA 4E07A 4LGYA 1RHKA 3OLQA 4BN0A 2WKWA 3ZI7A 4DLKA 1QLJA 3LECA 1ZISA 3PUIA 1H2BA 4TTAA 3ZV6A 2Q2WA 3D3QA 3R7DA 2HJGA 1T8RA 4IVRA 3KEOA 1NBAA 3SHWA 3KQTA 2L82A 3CRW1 2JRCA 2Q0XA 1J23A 3H0EA 2VH1A 1RJEA 5E0KB 3RO7A 4D26A 3RBXA 1WPRA 3K16A 5JJBA 3DKPA 3EH1A 4PX2A 1TQDA 5JJCA 2C00A 2IHBA 4Y0VA 3FCSB 2OZVA 7ADHA 1RCFA 3JAMA 3G9ZA 4MVJI 3CBQA 3S2YA 4BY9E 3RCBA 5JLJA 5IYZA 3EXG2 3JQ7A 2CD9A 3L1HA 4NATA 1RJ9A 5J5VA 2O2JA 1K5GA 3GGGA 5K1ZA 4AWAA 1A9TA 1G41A 1LBHA 4EPTA 4EO4A 3BKXA 1A97A 3FCXA 3L8EA 4A3SA 4AKEA 4ZYXA 2BY4A 2RJ3A 3FUUA 3MTAA 2BW0A 4LJ7A 3FZGA 4RACA 3KUCA 4NE9A 4X94A 4HDNA 5DYIA 2B4YA 2FPRA 2JHPA 5AOVA 4YMUA 5DTIA 1KEEA 2XMSA 3Q72A 2IHJA 1WSAA 4RK7A 3D59A 3UMMA 3MTIA 4D0LB 1AVTA 2PUJA 2XADA 3FKSA 3E7WA 2VLBA 1QWOA 3C14C 3FZNA 4WKGA 5D85A 1SVUA 3Q3GE 3JAWA 1SBYA 3U0VA 2B4AA 3AETB 3O4VA 2QPOA 4M86A 1IFXA 1ORHA 1DPFA 1VHLA 1FLVA 5K6AA 2YOFA 3VPHA 4KPUA 5LA6B 5C5EA 2O7RA 4GC9A 4D9IA 4REQA 4C03A 4KL8S 1QFYA 1ZVMA 2PXHA 3RGWS 1GCOA 3HU5A 3JZFA 2VTVA 3AIMA 2EP5A 4WK6A 2OAQ1 4TTSA 1O96B 4EATA 2OQ2A 3NWBA 5G53C 4CMEC 1NXVA 3DCYA 3JASA 1U9IC 3U19A 4OQZA 1CEYA 4FXOA 4J07A 2FRDA 3RANA 3NWOA 1Q7EA 1ZD1A 3QFCA 1AO0A 4Q4JA 4ABTA 2H1SA 2VF8A 2NIPA 1I9CA 5KSWB 2Q4TA 4RLSA 3FZQA 4FILA 2KLBA 4KDEA 3TOCA 1E1YA 3R3HA 1WO8A 3E6AA 3IDAA 2R7KA 4Y2HA 1PLJA 1FVHA 1QANA 1MBZA 1MTZA 2W98A 1OXTA 2OZLB 3GCXA 1P19A 2FI1A 3TMAA 5JI3E 1VE3A 2PBLA 2JLQA 4IGEA 1XO1A 4IDQA 2ZZNA 4KWCA 4OGLA 3DW1X 5ALYA 5GINE 2CLSA 3MMPA 4FZRA 5H02A 4B34A 2PJZA 1XC7A 4WN9A 5FADA 3HRKA 5L3QA 3GLIE 2DAPA 5C1PA 1EFVA 1KP3A 1SM4A 3ZPXA 2HXSA 1E2FA 3GRVA 4JT4A 2LPMA 4UAJA 1RPJA 5CDGA 1RQ7A 4HWKA 3ENNA 1EAYA 1NDQA 4ZT5A 1PEYA 4BN5A 1Z25A 2O1SA 3ZW7A 2WEKA 4WNAA 3A32A 5EUCA 3HN2A 1N2CA 2B8EA 3T3GA 3QBDA 3WB0A 5I7VA