3BGVA

Crystal structure of mrna cap guanine-n7 methyltransferase in complex with sah
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
309
structure length
269
Chain Sequence
RIFYLRNFNNWMKSVLIGEFLEKVRQKKDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQLPLGTLSKSEWEATSIYLVFAFEKQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA cap guanine-N7 methyltransferase
publication title The crystal structure of human RNA (guanine-7-) methyltransferase in complex with SAH.
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 94
structure length 269
sequence length 309
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2007-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3bgvA00
1ZKDA 5K8VA 4MHTA 2VZ9A 3Q87B 2PX2A 3JWGA 4DF3A 1NE2A 3SGLA 4YUXA 4HTFA 4Z2YA 3T7RA 2JG3A 5F2OA 1L3IA 2QRVB 2UYCA 3PTAA 4ER7A 2R6ZA 1QAQA 2UZ4A 1KP9A 3IV6A 2AN4A 4AX8A 3MGGA 5DXAA 1JG2A 2AOTA 3GNLA 4FZVA 4QVGA 5FTWA 5LQUA 1G38A 4E2XA 4ER6A 2P40A 2PX8A 3BUSA 2B3TA 4P7KA 4KW7A 4EKIA 1ORHA 2IPXA 2GPYA 3KQSA 5CD1A 1F38A 4WVLA 2UYQA 4GUAA 3PX3A 1WG8A 3CVOA 1NV9A 2AOUB 4GC5A 3EMDA 5GOZA 4EMSA 3FTEA 5E8RA 2K4MA 4OBXA 3B5IA 3R24A 2BR5A 3OE5A 4E33A 3G2QA 5F2NA 2Y1WA 3EGVA 3BGDA 4P7FA 3SXJA 3I58A 4G56A 1B42A 2OKCA 4XUDA 3HCFA 3HM2A 4E2WA 3EVBA 3E23A 3OE4A 1P91A 3G7UA 3TM5A 1ZG3A 4DCGA 4JXJA 4E2YA 2AN3A 1G8SA 5CVDA 2H1RA 3BKWA 5LQJA 3OZSA 4KWCA 3AWIA 4RX1A 3TR6A 2ZWVA 3HVKA 3SM3A 5BXYA 2WA1A 1JG3A 1OR8A 5GINE 1XCLA 2P7HA 3M70A 1YUBA 1EQAA 3BGVA 1HMYA 1ZHFA 2O57A 3NDIA 5EG5A 3T0IA 3TM4A 4YUWA 3P97A 2Z6QA 5HZMA 4MQ4A 4DA4A 1XJ5A 2EJTA 2GAFA 2NNWB 4GBED 4HSGA 3MAGA 2LD4A 2FK7A 2EFJA 2IDJA 2IH5A 3CJQA 2PX4A 4XUCA 5EMJA 2HNKA 3UA3A 1BC5A 4X1OA 5DM1A 3OZTA 3C6KA 3FUUA 3RODA 3CJTA 3K0BA 3PX2A 3BWMA 3E7PA 4E30A 5HIKA 3M6XA 4YV2A 4P7GA 5CM2Z 3MERA 2PXXA 4CTJA 2QE6A 4FGZA 3A25A 3G5LA 5EPEA 4IV8A 5EMKA 4BP1A 4QDJA 3VC2A 3IHTA 2YR0A 3KQMA 3B7PA 3LGAA 3A4TA 3OU7A 5G02A 5K0GA 3KKZA 3HCBA 5E8JA 2ZCJA 5EQJB 1T43A 3VC1A 2FPOA 2GH1A 1AQIA 1XDSA 2IGTA 3KR0A 1AV6A 4Y2HA 5DSTA 4E31A 3EPPA 3GO4A 3KU1A 1NW8A 3ELDA 4IV0A 3UJ7A 2ZIFA 3TFWA 3P8ZA 4RTJA 4X61A 3SX0A 4GF5A 3UJCA 5DM4A 3TKYA 1L1EA 4F85A 1X1DA 3TMAA 3DLCA 1JG1A 2XYQA 4FS8A 4UOEA 2NXJA 1I1NA 2O0LA 3HVJA 3I64A 3DXZA 3CKKA 1O9GA 2P3QA 2ZVJA 3FTCA 3P9KA 4FSDA 1VQ1A 3SSMA 2AOVA 4OQDA 5K0FA 8MHTA 4PONA 3LSTA 5FHQA 3GWZA 4DQ0A 3TOSA 3P9IA 3LCCA 3THRA 5FCDA 5FA5A 1G6Q1 2OY0A 4KVZA 3DXXA 2O06A 1FP1D 3MCTA 5HEKA 3SSNA 3PLAE 3UA4A 2BM9A 5GIPE 4KRGA 4U7PB 5GP1A 3NWEA 5EIWA 1VL5A 2BR4A 3HVIA 4P58A 5CIYA 2CMGA 2IFTA 3AXSA 3LECA 3ID6C 3UBTA 5DWQA 1XTPA 1XDUA 3GGDA 1KHHA 3M6UA 4XCXA 1RI5A 4O29A 3SMQA 2C7QA 2Z6UA 4IKPA 3U81A 1KIAA 2ZBRA 4MTLA 3ELYA 4ER5A 3V8VA 4RTKA 1RI4A 1TW3A 3EMBA 2CKDA 2YVLA 4EVIA 1M6EX 3CGGA 5JUWA 5LSAA 2ORED 3PT9A 3QOXA 2XYRA 1ZGAA 3EVEA 2ERCA 4PGGA 4BLVA 4DCMA 2IH4A 5KQRA 3FPJA 3ER9A 5K0JA 2OB1A 3R3HA 1L3CA 4KIFA 1NBIA 5DLYA 1RJEA 3ORHA 2HV9A 1VPTA 2PGXA 2PT9A 4CTKA 3KQTA 4PINA 3A27A 4DM3A 4F84A 3BZBA 3LCVB 1NW7A 2ZTHA 2ZBQA 3M4XA 3EEYA 3BXOA 1YZHA 3A7EA 2P1DA 3FPEA 3G2PA 2DPMA 4PYMA 1YFLA 2IH2A 3MHTA 3OFKA 4OX9Y 1O54A 1RJDA 3B89A 1BOOA 1XVAA 5DTMA 4LWOA 2B9EA 5FUBA 4QVKA 4YUVA 1X1AA 1QYRA 5LQCA 4HRAA 2V74B 1YB2A 2ZW9A 4RTLA 4C04A 4YUZA 3I9FA 3LKDA 4K6MA 3THSA 4AZWA 2AZTA 1R00A 3KR9A 5EZSA 1RI3A 2JJQA 4R6XA 3G89A 4E70A 3DR5A 3KPYA 5FADA 2FK8A 1QAMA 1VLMA 2FCAA 5E9JA 5FQNA 5LQKA 5FWAA 4PYNA 4C05A 2AOWA 2YXDA 5E1DA 5K0BA 3KQQA 3DMFA 1YFJA 1ZGJA 1PJZA 3PFHA 5GM2A 3KR2A 4ATNA 5EEHA 5CVJA 5BW4A 1TW2A 2JHPA 5T64A 3RW9A 3A26A 1JSZA 2JH9A 2ZLBA 2PXAA 3DXYA 5LQRA 3C0KA 2AOXA 2YQZA 4RTNA 2YXLA 4P7JA 1NKVA 1WXWA 2ESRA 3SSOA 5K0CA 4CXMA 1XCJA 3R9XB 1SUSA 4C03A 2VS1A 4RTQA 2OXTA 3HA5A 5FWDA 2UYHA 1G55A 2WK1A 3FUVA 3HNRA 3CCFA 1KPIA 1X1CA 3FUWA 4KDCA 4R6WA 4CKCA 1SKMA 3ER8A 3TQSA 5GIOE 1NV8A 1P1BA 3B3JA 5M5BA 3CC8A 1KYZA 2G8NA 2NXEA 5CUQA 5DRYA 5EGSA 4C06A 3HCEA 3QV2A 2C7RA 1NT2A 5EZQA 4KDRA 3FRHA 4V0QA 2XYVA 4X60A 3TPZA 3VSEA 4LG1A 2ADMA 2BR3A 3R6TA 1FPQA 3ME5A 2VDUE 3FPGA 4QQNA 2YX1A 1P1CA 2PT6A 3G8BA 1ORIA 5C0OE 2B78A 1D2GA 5JR3A 2ZZNA 1V39A 3LX6A 5ICGA 2PVCA 1JQ3A 4KIGA 4R05A 3S68A 1I9GA 2C7PA 4YMGA 3HP7A 1DL5A 1VE3A 1EAMA 3ELUA 3AXTA 3LBFA 3G88A 2PKWA 3LCUA 5EOVA 3T7TA 3IYLW 3P71T 4ER0A 2HWKA 3PB3A 4FSXA 2IBTA 4A6EA 1Y8CA 2OO3A 2VDWA 4RVDA 4GEKA 4XUEA 1X19A 2GLUA 4MIKA 3KQOA 3G2MA 5IKMA 2ZZMA 1IM8A 5DSXA 1NW3A 4PYKA 3PVCA 2HTEA 4RSRA 4U7TB 5FHRA 5EEGA 4HGYA 3M6WA 2P8JA 2GA9A 3DTNA 3GJYA 4HC4A 5DPMA 3DULA 1JR4A 4C08A 2V7EA 5E1BA 3HA7A 5BP7A 4QDKA 1RI2A 3EVCA 1P39A 1R74A 2JH8A 4LECA 1HNNA 4BLWA 2OPBA 1KPGA 3FUTA 3HCCA 3NTVA 4X63A 5T6BA 5KS2A 2ZSUA 1NW6A 2PLWA 1IY9A 3FPHA 3G2OA 3E05A 3P2EA 5F2KA 2PJDA 2I6GA 3GRZA 3K6RA 1KPHA 3LBYA 2ZWAA 2H11A 2EJUA 2VP3A 3O4FA 5ERGB 5C1IA 2WA2A 3GRUA 1R8XA 4YV0A 3NVKI 5CVVA 5GM1A 1SG9A 2EX4A 2XVAA 4AZTA 10MHA 4M36A 4RTSA 5HIMA 4PNEA 3IEIA 1D2HA 3FZGA 1VIDA 4RV9A 4AUKA 1M0EA 5E2AA 2PWYA 1EIZA 2OB2A 3MTEA 4EQZA 3CBGA 4R8SA 2ONZA 3DUWA 5EHIA 1G60A 3C3YA 1O9HA 2O07A 5KQSA 1JQDA 3D2LA 5K0EA 5IH3A 3GCZA 5FQOA 5FULA 4YUYA 1U2ZA 5EHGA 3OPNA 2PSSA 3R0QA 1KXZA 4GOLD 4GQBA 3C6MA 5HFJA 2Z6AA 5EIFA 3GRRA 2Y1XA 4PWYA 4AZVA 2IIPA 3FTDA 2QM3A 1IXKA 5DX1A 2YUIA 3KPJA 2BM8A 4EK9A 5DM0A 5HIJA 2ONYA 3I5UA 2F8LA 3AJDA 3LKZA 4ISCA 2G72A 3WSTA 3TLJA 4A6DA 2ZIEA 1I4WA 2YTZA 2H00A 4X41A 3FYDA 5E2BA 1SQGA 4PCLA 3ANXA 4RVGA 3UJ6A 4DMGA 3O31A 3OZRA 2P41A 3GRVA 5K09A 3GDHA 2XBMA 3SVZA 3BKXA 1JTFA 3NJRA 3X0DA 3H2BA 3BWBA 5K0NA 5GWXA 2CMHA 4M38A 4PYQA 3BGIA 4ZTBA 1FP2A 2OYRA 1JQEA 2B25A 5CCXA 5D1HA 4AZSA 1EG2A 1D2CA 2I62A 3O7WA 1MHTA 5DM2A 2E5WA 3NVMB 5HIIA 5LQAA 3KPUA 2YXEA 4QPNA 5EVJA 2A14A 5FA8A 1JG4A 2EG5A 3CJRA 2IP2A 1XDZA 1RJFA 2P3LA 3HCAA 5H02A 5HOQA 2NXNA 2G70A 3DMGA 3F4KA 4RWZA 5E9QA 3UJ8A 3HEMA 3GXOA 4C07A 3G8AA 4Y30A 3MB5A 4HGZA 2NYUA 4NECA 3A7DA 3FPFA 5K05A 2QRVA 2PY6A 2ZZKA 4GC9A 3HTXA 7MHTA 2ZFUA 3M33A 3EGEA 2OBFA 4BLUA 5ICCA 4CKEA 4GOMD 2NP6A 5DTRA 1JTEA 5DX8A 2AN5A 2AVNA 3PS9A 2I9KA 1FJXA 2FHPA 3FUXA 3EEOA 3BWCA 4RTOA 9MHTA 2R3SA 3UJ9A 3JWIA 2CL5A 5MHTA 4PIMA 2PBFA 2Q41A 4HG2A 1YF3A 3HVHA 2AOUA 4FR0A 3QOWA 4BP3A 2FYTA 5E9WA 3KR1A 3M6VA 5EMMA 4CKBA 4H0NA 4R8RA 3BWYA 1JSXA 3EVDA 4RVFA 4FT2A 1SVUA 3EVFA 3FYCA 1N7JA 4FT4A 5KYGA 1XXLA 3OCJA 5DXJA 2I7CA 4CWAA 2OZVA 4PYJA 1N2XA 1WZNA 5DT2A 1NW5A 1QAOA 3LDUA 2NXCA 3NW9A 4PYOA 5CVUA 3UJDA 5CCBA 1KYWA 5LQNA 1QZZA 3P9CA 1G8AA 1AQJA 3GRYA 5D1NA 3KQWA 5KVAA 5EKXA 5C9ZA 3BT7A 4DZRA 4EKGA 3DP7A 4B17A 4QTTB 4FP9A 4V0RA 2AVDA 4RTMA 2PXCA 1TPYA 3EVAA 4F86A 1Z3CA 2HMYB 1R8YA 3RIEA 1UWVA 2XVMA 3DH0A 1RI1A 1VBFA 2ZULA 4PGHA 3NDJA 1BKYA 2PX5A 2N47A 3MQ2A 2G1PA 2NP7A 1WS6A 4M7RA 3KPWA 5DRTA 1QANA 4GOND 4E32A 2IDKA 1F3LA 2GS9A 2JHCA 1UIRA 3MCZA 2G71A 3I53A 3T7SA 1AF7A 5K03A 3G5TA 1FBNA 3LHDA 3E8SA 1KR5A 3UJBA 3OU2A 2HR1A 1L3BA 3UZUA 2FRXA 4PCAA 1DCTA 1MJFA 5EMLA 1Q0TA 3DOUA 5U4XA 4HH4A 3JWJA 3TRKA 5E1OA 3PFGA 4M37A 3C3PA 5E1MA 2BZGA 3HCDA 4IWNA 5BW5A 3EGIA 4E2ZA 2O05A 2DULA 3V97A 1VP9A 1EJ0A 2P7IA 1DUSA 3ELWA 1M6YA 4QPPA 5ICFA 3REOA 3B3FA 4PYIA 5K0LA 3JWHA 1N7IA 3LL7A 2KW5A 5P8WA 3DMHA 3FTFA 1YZ3A 3KQYA 3GIWA 2ZBPA 1SUIA 2AR0A 4RVHA 3LPMA 4OA5A 1ZQ9A 4WXHA 3TKAA 1NBHA 2PWPA 2QYOA 3GU3A 3L8DA 3KPVA 1SQFA 1WXXA 3KQVA 4LWPA 4QTUB 1X1BA 3UJAA 2B2CA 3EVZA 4QQKA 3DLIA 3UFBA 1Q0SA 1EJ6A 3LDFA 3NWBA 4POOA 4RTPA 3HA3A 3FRIA 4OA8A 2UYOA 2ZIGA 3EVGA 1R6AA 5K01A 4C4AA 4DKJA 4BY9E 4GOOD 3SR4A 4L7VA 4PYLA 4MWZA 1H1DA 3OFJA 1PRYA 2VDVE 1BHJA 1VP3A 2IBSA 2P3OA 3P2KA 3UWPA 4OBWA 3Q7EA 3AY0A 4OQEA 3MTIA 5DX0A 5LR6A 4RTRA 2PV0A 1INLA 5CVEA 3LDGA 1RJGA 2BH2A 4PIPA 4RYLA 3NMUF 2JHAA 3KHKA 3P9NA 5HILA 1UFKA 5B1SA 3B3GA 3KQPA 2GB4A 5DTQA 5EKUA 1WY7A 4YV1A 5ICEA 2CWWA 3ERCA 4HTFB 2AS0A 2C7OA 3VYWA 2P35A 3OU6A 5T67A 1R18A 4YMHA 2QY6A 3P2IA 4ER3A 2AOTB 5EC8A 1L9KA
chains in the Genus database with same CATH superfamily
4W7IA 2WKRA 1TT5A 3PT5A 4KQ6A 3K8YA 5K3AA 1G9SA 4HUJA 1ZMBA 4ICIA 2V1UA 1BMFD 2EQ5A 1ZH4A 3AJEA 3D3WB 2F64A 4O4HB 5BSMA 3GXBA 2FZ4A 4UQPA 2YY5A 1OWOA 1WCIA 2IPMA 3ABQB 3DZJA 4ZCIA 3GT4A 1CJSA 1N6IA 2O1SA 3DTTA 3L06A 1IBCA 1PR9A 4RM2A 1K5HA 3QOFA 1FSPA 4CM1A 6CHYA 4ER6A 3ACDA 4KW7A 1TF7A 3NYRA 2G76A 2YWBA 2FH5B 3PF9A 3H42B 1CDOA 5DBFA 4BQNA 5TE9A 2VUIB 4M55A 3ZLBA 5BNZA 2V6JA 3WWOA 4D80A 1XFDA 4JR1A 4U9IS 2JFZA 5G2OA 2W93A 1BGWA 3B5IA 4YQZA 4MV7A 5E7IA 2QTFA 3WGVA 4NTZA 3HL4A 2Z9DA 1B8NA 3DOCA 4JYCA 3SXJA 3Q3EA 1CF4A 1KA9H 1MMFB 3NM5A 4H7DA 1Y4AE 4HQFA 4O2AB 1PGNA 4C3UA 5KYWB 2WR8A 1EIWA 4BQEA 1RR6A 2PUTA 1I24A 2M1XA 1ODFA 1GU0A 3H83A 2H7XA 2R8OA 2AUMA 1MRSA 4MW0A 3RLFA 2HK6A 1SMKA 2GEKA 2NSJA 3ASVA 3MJVA 1MPXA 2W71A 1GPH1 4GAEA 4JBYA 5FO1A 4OKSA 3ZVNA 3CEJA 4KVAA 3QSYA 2ZYUX 2WU4A 3PENA 2G1AA 3NDIA 4ISBA 4IIEA 5T4FA 2IEDA 3WK8A 4CG1A 1V26A 2HXSA 1V43A 1TA0A 4QPDA 3QE0A 3C16C 2E1PA 3HR4A 3I72A 5AM1A 3E18A 5JJIA 2ZS7A 3O8OA 2PX4A 4K9NA 3GRKA 2QTHA 3UA3A 2OE2A 3EYAA 4Z99A 4F2HA 3JQEA 5TPWB 4CKWA 4LTMA 1W25A 3EC1A 4LK3A 4W1RA 1RW4A 3MYRA 2CV2A 3O8DA 2IEZA 3UWSA 5CM2Z 3ZK9A 3PC6A 4IV8A 1QOQB 4EYGA 4OFZA 5IBCA 1ZIYA 2EZUA 2O2SA 1JUDA 3B7PA 3M1IA 1N0WA 1YZNA 7ADHA 1S9DA 4E4TA 3F98A 1KZ1A 2J32A 3L8CA 2ZJ0A 3MD0A 4CMJA 3KSUA 4F97A 2WSMA 3OLCX 1KZGB 1SQ6A 1CDZA 3ELDA 1LPNA 3KUUA 1ORTA 2OG2A 4S0ZA 1P29A 4H4DA 3P8ZA 3QFSA 3AUXA 2H65A 4D5GA 4II7A 4P0PB 1GUFA 3A1TA 3LWZA 5C1PA 2FJPA 2WF6A 3F1KA 2QI9F 1V1RB 2XYQA 4OFBA 4YJGA 2I6TA 3G9TA 4MVWA 4FI3C 4RVSA 1HG1A 1YS6A 2VNHA 3N9IA 4LGVA 3ZCXA 3C4QA 4XIYA 5ECWA 5CFRA 1HV8A 3GBSA 2E49A 4LA4A 3HJFA 1RC0A 4GOJA 3IKVA 2ZTMA 3LO5A 2H2AA 2EX0A 1T6XA 1TQ6A 1XA3A 1OVMA 1U65A 2JH3A 3LPAA 4KVZA 2D3WA 2RH8A 4OATA 3PXAA 4QJBA 3PLAE 2W6IA 4RA9B 5TQ0A 4DV5B 1JPNA 3KZKA 3TLGA 2GD6A 1O87A 3FR7A 3NWEA 3I4FA 2BR4A 1KJQA 2CMGA 1YMQA 2JHFA 3CXRA 4FYYA 4BNXA 3LECA 1FW6A 3GOQA 1QH0A 2F8MA 2XR1A 1T8UA 1D7OA 1U5BA 1GVHA 2N1MA 3EIFA 4IZIA 4NOJA 1GTG1 4PZUA 3KVOA 4B79A 1QCZA 5KQMA 2XQJA 1G4HA 3IAM1 3QYPA 1UMKA 4FWTA 4EVIA 4DR4B 3CGGA 4RHUA 1SBCA 3R5TA 421PA 3KWFA 3O94A 1ZNWA 2VSOA 1EFPA 1QK4A 2ECKA 4IIUA 1T0HB 3WS7A 4GT1A 1O96A 4E3ZA 3R4CA 3KQUA 1OV4A 3E7FA 4G8JA 3ZGNA 3LLUA 5HRAA 2OB1A 1Y9ZA 3VR2A 1PN3A 1CG6A 2C98A 1RLTA 3G23A 3RSCA 4LV6A 3A27A 4KMOA 3D5QA 4F84A 2HQRA 3GB9A 1GZ5A 1OHHA 1WWKA 4L9SA 3B2NA 1B1CA 3AEUA 2CYAA 4JUIA 2UV8A 4S1OA 2IHNA 3N7AA 1OH5A 3IKLA 3GFTA 1IBMB 3MJRA 3ZE2B 3IAS1 3JQQA 4ENUA 2VC2B 2WUEA 4TYNA 4JOCA 2O2ZA 4BQSA 1J0AA 3ODPA 5GV7A 2X19A 5CX1A 1GLNA 3MWFA 2RHGB 5CFNA 4PXYA 5KWVA 3LW8A 4B81A 2V8OA 4C04A 1EU1A 2GRAA 3V2GA 3U9TA 3TEMA 5TARA 1RI3A 3CR3C 1I2AA 3ICCA 3FIUA 2PH1A 4DARA 2RHTA 4HUQA 4UZEA 1Z25A 2NZ2A 4RIIA 5JAHA 3SE7A 2VRBA 3TDKA 2D4AA 2FEAA 1EE2A 1JIVA 2QVLA 1KI3A 3NHSA 5ARCA 2X5NA 4J2HA 4N8SA 3NLLA 1J23A 4CL3A 3CUSA 2VAVA 3OSZA 4YR7A 5I48A 3TVDA 5A4AA 3CE9A 5B1HA 1BROA 3UANA 4DQUA 1IPHA 1I3LA 2JLBA 1MIOB 4JBNA 1X3SA 2CKMA 1JMYA 1TDJA 2Z83A 3Q1KA 4OQMA 5ESRA 3BA1A 4BVFA 3T5PA 1X0VA 1OYOA 1N1GA 2DOKA 2NUTB 4XJXA 1Y6QA 1HZJA 4D4KA 5B1EA 3NVDA 1I80A 4WNAB 4EECA 1SIOA 5BN5A 4WLUA 1DJLA 1P8JA 3R40A 2QAGA 5M5BA 3JSAA 2WHPB 3RJTA 2G5PA 1CUSA 4BP8A 2BM0A 5CVTA 1L5GB 4PM4A 2NT3A 2WJGA 4V0OA 4LRQA 3D5TA 1YR6A 3X2SA 1PJ8A 4PSDA 4J0KA 3PZRA 4B76A 2FSFA 4IL5A 1KVUA 1BHQ1 2Y0DA 3ND6A 3WV5A 4DAOA 3NOOA 5ICGA 1W36D 1JQ3A 1IIBA 4R40A 4XTCS 4JV5B 1D2NA 1DL5A 4RUKA 3MT8A 4J1QA 3AHIA 3MJEA 2G5CA 1U2RA 2AFRA 2TMKA 1B8PA 4AJNA 5D3ZA 4RVDA 3D7LA 4JSYA 1UC8A 4KV7A 1Z5OA 4IOKA 3U4AA 2LGJA 2C2MA 5IKMA 1LXCA 3LPDA 2ZJ1A 1EB9A 3KV3O 3W77A 4N65A 4R2XA 4BAGA 2LR0A 2HTEA 1C4WA 1WCXA 3FY4A 3RS4A 4B85A 1NXPA 1P2GA 3K72B 3PWZA 2YMLA 3P2OA 5B5SA 2G77B 1TM3E 1T3ZA 4DSUA 2JEOA 3ZQKA 5DPMA 1QDEA 5B4TA 1B73A 2P9EA 2Q5OA 3K8QA 5BNTA 2XCSB 5BP7A 5KC8A 1ZUNB 4Q0MA 5AXCA 3DKVA 3TN7A 4US2R 4FHEA 5KVSA 2HGSA 2O3RA 4BLWA 1UBSB 3HC7A 2IW3A 1T9BA 1MFZA 4AROA 4PXAA 5CB8A 1FFXB 3KZVA 1H8HA 2HA4A 1AZSC 1O2DA 2H2GA 2YXPX 3A6LA 1P4SA 3ONDA 2G9NA 5JY6A 1KPHA 2ZWAA 1KEEA 4H4CA 3A6FA 1P6QA 3FSGD 4GIBA 2R8BA 4BIIA 3UAGA 1PX2A 3T1YB 5H82A 1I6MA 3K71B 3TR5A 4HP8A 1VJ5A 3DT6A 4A2WA 1V16B 5TGDA 4V1CI 3PQDA 1F14A 4ARUA 5HIMA 4U7DA 5I9BA 1HDZA 2R6DA 3KQNA 3GQBA 1OASA 1VE9A 4GO1A 2O50A 2A30A 1PG0A 3QWFA 4WTOA 1TPZA 4XFKA 521PA 1QHYA 1U3UA 4YP6A 2PE5A 4F6LA 3OQMA 3D2LA 4IQFA 5LA6B 5K0EA 1GPWB 4NV0A 4W1SA 5IH3A 1ZD2P 5IEBA 5TMDA 5AHKA 2Q5HA 5AI5A 1XELA 4UD2A 1DRKA 2XKJE 4YJGB 4EJMA 1PNTA 1M9NA 1ZVJA 4AZVA 1P7CA 2WWIA 4QHYA 5HF9A 1CUFA 1J6UA 3WSVA 3SHTA 5LNK1 4KQ2A 4QBFA 4NG5A 2ZOSA 1STOA 1R0SA 1VGQA 5GONA 4JS0A 3KOXA 4OQFA 1E1RA 3V1MA 4ZIRA 2ZRDA 3DQPA 2VXCA 2JC3A 2EW1A 3H1AA 2FXVA 3K0AA 3K5PA 1MNQA 1FZQA 5H3HA 3U56A 5AJXA 2C59A 1SZPA 4HNAA 4GG1A 3ANXA 4L78A 1P2TA 3P5SA 4KQMA 3GRVA 3WWCA 1EFRD 3R8CA 3CSDA 4FMDF 4E5SA 2OAEA 5B4VA 2FR8A 3EZLA 2YRXA 4Q21A 2XWSA 3R6LA 5J2UB 3O74A 4AECA 1EYZA 1CPYA 2H5IA 1PGOA 5HF8A 2VYFA 3OICA 5ADUS 1M8GA 5CFOA 2FLVA 2ZBEA 3DMDA 4DL9A 3LO8A 5ELLA 1BCRA 4M7WA 3DPIA 4GXTA 1Y1PA 3D7MA 5CW2A 1NXXA 4BOYA 1TZJA 3AI1A 4IWXA 4R8LA 3I9LA 4CN9A 2EG5A 7REQA 4NYMR 2Z2ZA 3ML1A 4CKEB 4OHVA 3GZ4A 3ASZA 1CUEA 1RJ9A 1XL0A 1Z8NA 1VYUA 2NVOA 2X5OA 4G5QA 3KUXA 5AVOA 3ZDCA 3F9CA 2NYRA 2Q0QA 4U63A 3DQZA 3TL2A 2XVZA 3A7DA 3NJ8A 4ZOCA 2PGIA 1T3TA 3C97A 3SC3A 3ZV7A 4Q7LA 3BE6A 4PQGA 7MHTA 5K8CA 2FRDC 2C4UA 1X7DA 4WNYA 4CETA 3NEAA 4NMMA 3HDJA 3VHRA 1Z37A 3GLKA 3LIIA 4HL6A 2YIMA 3BHMA 1MJ5A 1N3BA 1YA4A 3G9ZA 2GOYA 4JEMA 1QRUA 4EB6B 4KCGA 4ERNA 1N2SA 1W2WB 4M3NA 2PT5A 3DZHA 3H5NA 2Q5IA 4PIMA 2PBFA 2Q41A 5AM0A 4TYQA 3RABA 2P62A 4CM5A 1NTRA 4NWIA 1NLZA 3CISA 4C6RA 3D1LA 2VTEA 3DDZX 3EN0A 4IRUB 3WL4A 4E3WA 4N0EA 4BNMA 4KGXA 2UUPA 3TG2A 4UDYX 4PAGA 1NLUA 2KE5A 4N0QA 4R8RA 1NF3A 4D4IA 4ZVNA 3EVDA 4KV9A 3PIDA 4L6AA 5A3RA 1NIJA 4EMBA 1T0BA 1XXLA 2HBRA 1E79A 2PQ6A 3ND7A 2ZT8A 2OZVA 3QPVA 4PE5B 1GL9B 3BE8A 1FQOA 3P0JA 1UPTA 4XIFA 2PX6A 3KYDA 3B3QA 3OQJA 1YE8A 4I66A 4NNPA 4U6SA 3NBQA 4KHPB 5IW8A 3P9CA 3LCRA 2BMEA 3B8HA 4JFAA 3C74A 2CVZA 1E63A 2XUGA 2PR7A 3QVXA 1O5TA 3IDZA 3EVAA 3JVIA 2YXBA 4MK4A 5JV5A 3Q8XB 2W9XA 3JQBA 4LJ6A 1XCGB 1NJ1A 4IDBA 4MGHA 5L3SA 2H1LA 1BJKA 5CA1A 1X15A 1MO5A 1CZKA 5KTNA 2G71A 3PVSA 2VNJA 1QCDA 3MRTA 2AI1A 4CMBA 3PXDA 5BW6B 5CLJA 1RQGA 5C8YA 3KZXA 4DNFA 4E46A 1YGPA 2QZ9A 2CCJA 4X84A 4OV6B 3UZUA 4X7MA 3THXB 4BX0A 4HPJB 1A95A 4NABA 1DV2A 1X80B 2DZDA 3BMOA 1NNEA 3AZQA 4GUDA 1MEOA 3CW8X 4M37A 5EAIA 2IYYA 3ZWOA 3UMVA 2G17A 5EWJB 1NZDA 3OLVA 1H6DA 4H7JA 4EGCB 1D1QA 1N2OA 1SOMA 4B75A 3WYCA 9GPBA 1PDOA 4BU1A 1E9VA 1ULHA 1LPBB 2P2YA 4LZOA 4F3TA 2B7LA 2FWIA 3BHJA 4MB2A 2FMIA 4WLVA 3VYVA 4WECA 5DK6A 2GBLC 1ZXBA 3BXHA 1AVTA 4YRMA 4GYJA 1AGYA 1N7HA 4KQJA 1KJZA 3F6PA 1IG0A 3D31A 3LUKA 1OX4A 3QF4A 4RE6A 5KYYA 2WTEA 3Q85A 5IBPA 2JGKA 2CDNA 5CG1A 1GGVA 3OT1B 1AS3A 3HA3A 1MF7A 4M0EA 2D5LA 1MW9X 3UFXA 4JFRA 2FFJA 4YP1A 4HQLA 2P78A 2GMWA 2C5AA 4M8SA 4EQ6B 5HM8A 1T15A 2LBPA 3AG6A 1CK4A 1GRQA 1E2FA 1E2BA 3FWZA 4Q9NA 5DHTA 3VZBA 4DY4A 5I7HA 2I67A 1USVA 4JJEA 5I9LA 3KEGA 3TS1A 1ZOIA 4BNHA 5ADHA 1UMCA 3H2GA 1VKOA 1PU2A 4JP3A 1E9SA 2LDBA 1FFBA 1NSTA 1Q11A 2XLCA 2YY7A 4PNZA 2YOHA 3V9AA 3ZHYA 3NMUF 1NXVA 1Z4OA 3W34A 5T3YA 3NBUA 5TS2A 3ZXYA 2XOKD 1FVHA 3O4JA 4E5NA 2AC7A 1F0KA 4RGVA 4YHHB 4L4SA 4LZZA 5AR1A 2H2HA 2XF2A 3OU6A 1RP7A 4J7CA 1G21B 3VO9A 1LVGA 1E2MA 4O2RA 3ZIUA 1SIUA 2PWAA 1JU3A 5EQTA 3ZNOA 3UAVA 2QUBA 4JLNA 2GVZC 4PGMA 5ULLA 3KDSE 4XM0A 4KI0A 1B6TA 4BO8A 1HE2A 2RK6A 5FBWB 1V8BA 2XQGA 3OLYA 4Z2YA 4CN8A 1VPEA 4L4UA 3R3XA 1QQBA 3UO8B 5BYAA 4D2IA 2B69A 5INTA 4OD0A 3O0TA 3RTCA 1JG2A 2L2QA 3L4BA 2CSUA 3EEBA 4FZVA 4IDCA 2H1SA 4P3PA 1GGKA 4RPJA 1Q12A 4EB0A 5HX7A 3Q3JB 2B7BA 4CCWA 2IEGA 4IXNA 2C5SA 5AK5A 4LTDA 4D9HA 2FPLA 1ORHA 1F6WA 2C9DA 2H7CA 5THQA 5SYNA 4CLRA 2ZJ7A 4IXDA 2Z1NA 1U8CB 4MVYA 4WVLA 5JC1A 4FXOA 3RVNA 2C2XA 2Q3FA 4ZVLA 1KH2A 3CX4A 2ZKIA 1KDPA 2K4MA 3RCBA 4Q1DA 2WHYA 3G2QA 5T8KC 5EXSA 4BDTA 3D6HA 4UUMA 3I58A 3L92A 4JL6A 3EMKA 5BYBA 1ZCZA 1XZMA 3PGJA 1TLLA 2C3MA 1YFZA 3HM2A 4OSPA 2P79A 2VN8A 2CXTA 1S96A 2VDQB 1HDXA 4GP7A 4GI1A 3U61B 1RABA 2FOXA 2ZKLA 2RGGA 1JLLA 3R5XA 5F73A 3TR6A 4QJ4A 4PG6A 3SM3A 3Q9UA 2OXCA 4YRGA 3DOFA 4UHEA 1A2KC 3DTVA 3FZYA 2P2ZA 1ZHFA 4QPCA 3T0IA 2QNBA 3VJKA 2WUFA 1YJQA 3EDOA 1ZCJA 2LD4A 3DB1A 3ZWDA 5KINB 5T6MA 4DREA 4EW3A 2V7QD 2GCGA 3WLLA 2EBUA 2IU6A 2X5JO 3EODA 3D7KA 4BWFB 1XU4A 5B58C 5TJ9A 5HIKA 4AKHA 3OKPA 1XZFA 3EZ6A 2J5BA 4MP6A 4XWAA 1H0SA 2NU6A 5CPBA 2FNAA 2IPNA 3M34A 1E1CB 1WP9A 3H9EO 4NOLA 1MN6A 3HU5A 4J1SA 3LA6A 4GRAA 5KNCA 4KN5A 3KQMA 1W85A 4JI8B 3KE9A 3OX3A 2WTUA 2YKGA 3QUTA 1P4HA 4M9QA 2FPOA 1AV6A 3MWDB 2OQ2A 5JXGA 3MF4A 1T5HX 4A16A 3D2CA 4E31A 3GO4A 1QS0B 4FIDA 1N2CB 1RE0A 4IV0A 3ANYB 2BE7A 4ZQBA 1FFSA 1OYYA 3VDNB 2C4WA 3TLGB 5AVKA 2WUVA 4A91A 1SN7A 1FQKA 4DEXA 3S8EA 3CX3A 4LYGA 4G0NA 4BQOA 4MPRA 2P91A 2P4QA 3JATB 1YONA 4TL8A 4KOEC 1I2ZA 5AKGA 3IGFA 1XRNA 5KREA 1PDVA 1FDUA 2AOVA 5EFOA 1MA3A 5IC4A 1IBKB 4MIOA 1QZTA 4A7PA 4PONA 4M1ZA 4M49A 1NI4B 2HRCA 3QWBA 5BN1A 2ZU0C 3GWZA 4H6XA 1EX7A 3TD6A 1EWKA 3G59A 3ITDA 5EJAA 4FGSA 1C4OA 1G7RA 1JF8A 2JKVA 4M9ZA 4AI6A 4ASUA 2SHKA 3WNBA 3NTLA 4ACAA 1DXYA 1SBNE 1PWZA 2VUUA 2QD4A 4JU8A 2RARA 3L82B 3HGTA 4EG3A 4WKBA 2XQVA 1KK1A 3TIGA 3F47A 3IOYA 4A0GA 4BZQA 2QRUA 3G8DA 4QU9A 1PK8A 4QE3A 2Q3HA 1GSOA 4WBNA 2R85A 4XCXA 1DQZA 2WWXA 1E3TA 3BDAA 5F33A 2C04A 1YCGA 3OJFA 3U81A 5LDDC 1KIAA 4TXMA 1V9CA 3C24A 4Z53A 5EWLA 2O0KA 1P80A 1W5BA 3GPIA 3NKFA 4INOA 1L7OA 4IQ0A 1XNRB 4XWYA 4B6SA 3U4MA 1RRPA 4W1QA 5L95A 2DUUA 2ETVA 4DJAA 3OCWA 1PVDA 4NAUA 1I3OA 2JCVA 1ZGAA 4B45A 1NIPA 4JU9A 2GZ2A 2W6OA 1Q74A 1M2HA 2ERCA 3S81A 4FE4A 1JWBB 5KQRA 1Y8RA 2H18A 3R7DA 3WB1A 4JLWA 4RIEA 3WHPA 1TUBB 2CLKB 1OGJA 2DTXA 1NJGA 4KIFA 2FG6C 1DI0A 1RJEA 3OZDA 2HV9A 1Q0RA 1TIPA 3THWA 3H6HA 3NIBA 3OA2A 4MVJH 4DB4A 1F7UA 2FUCA 4D9MA 1OZGA 3JQ6A 3D3KA 3OJCA 3X44A 4QYMA 4GNKA 2HA2A 1UKVY 4CQMB 4NI5A 1PWEA 1N0UA 3G0CA 1JWLA 4AVYA 1RVV1 5JJLA 3BAFA 4KQ1A 5FUBA 3G0HA 3HQ4O 1J07A 4R9VA 4YXWD 4TL7A 1ONPA 2C7GA 2WDPA 4O4HF 2AG8A 1YNOA 2UZ4A 2CV0A 2A9RA 4WL0A 1EEHA 2XY4A 2ZW9A 2O8EB 3QKRB 1XQWA 4O59O 3VR6A 1ZAYA 1KDYA 4LYJA 1E3WA 1HDIA 2I54A 4JR0A 4RL6A 2HA7A 5HWSA 2E18A 3U19A 2O8BA 3W3ZB 1UJBA 4WESA 5F78A 2Q3JA 5LDHA 1YZKA 3MXTA 3CZPA 1C0EA 3MIIA 1RQPA 3D8TA 1JZTA 3W8DA 6AT1A 3JVEA 2GYUA 3W3AA 5K0BA 2BH9A 2HA6A 2WWHA 3HHEA 4DUZB 4KXNA 3L77A 4Q1FA 2XWPA 5HF6A 5EQFA 3ZN2A 1KI9A 2QF7A 1KQ3A 3CY6A 4UTZA 2EQBA 2I1LA 4JJ7A 4K3VA 1GEGA 3Q3CA 4I9UA 4O2AF 1SH7A 4TQUS 2OBBA 2W22A 1V7ZA 2PSJA 2Q0HA 1QH9A 3L1JA 3LF2A 5EYPA 5JRJA 4CKCB 5K0SA 3QA3E 3EQ8A 4ZOEA 1E77A 2DTEA 1BDHA 1YJXA 3LP5A 3EXAA 1MOPA 4PLTA 2AWOA 2VHEA 3N2NA 1D4OA 2E9SA 3VC3A 2B35A 4JX9A 3R9XB 1SUSA 2WWFA 4ZQCB 3VTKA 2CMDA 1FQJA 4D7AA 1K3FA 4MGZR 5JFTA 1Z7GA 5J4VA 2WK1A 2PKCA 1GKLA 1UEJA 3CZQA 2RSLA 4DW8A 3LK7A 1RQ7A 1EFVA 1Q7BA 4NBVA 1BH6A 1QG0A 2PL9A 4QQFA 3ZV6A 2G8NA 2CHUA 3FOWA 4CZ2A 1ODTC 5JVDA 2XGSA 4CLEA 4D3FA 4OXRA 3FRHA 1GTVA 2L82A 3ZHOA 5DI3B 1SRRA 1V3TA 2IF2A 4IICA 3VSEA 5DN6A 3ME5A 3NALA 4LVOA 1XEWX 1GXSB 1X74A 3IBTA 1C3LA 2OC9A 4LOIA 1JJVA 1GT6A 1OA1A 3TO5A 4TTSA 2ZGVA 1BFDA 3AXTA 1GZUA 3G88A 3NHPA 4UKDA 4PPGA 4DANA 3G0BA 1OFUA 4Q7MB 1EE1A 4C4PA 3ZBUA 2J33A 3ICPA 5J47A 1J20A 2ZEJA 3IXLA 4L76A 3BDVA 4FI3F 1AGXA 3D2AA 2BI8A 2QRHA 2O2JA 5FWXB 5HVNA 4EHIA 1B8VA 2X8LA 1AF4A 1JN0A 2COUA 2WFLB 2QDKA 1SVWA 3A4LA 3DWEX 1J9EA 3DULA 3EUEA 3IP3A 1SD2A 4AWXA 3CNNA 4R2JA 4LYDA 4K05A 3IUYA 2ANCA 3B36A 3QUQA 4W5TA 4K6KA 1DC5A 2YYYA 2AE1A 1QYCA 3EXEA 2P2LA 4XX1A 1QFMA 3AKDA 3TK1A 3EWSA 1I7LA 4CLXA 3MLAA 3A3KA 5JZSA 4LN1A 5BSTA 1AX9A 2KLBA 3BFXA 3TLEA 4C4OA 2ODEA 1K7EB 5IYZB 4UHHA 1K8QA 4IJ5A 4LC0A 4C2UA 2WYHA 4ZCPA 4IMPA 1G5QA 2R96A 1P0CA 2PH5A 5JH7B 1DBRA 1ZSVA 3C5VA 3IR5A 1RHMA 5EJFA 2KX7A 2FQ1A 5DNUA 1IU9A 3EWNA 3OF2A 2REOA 5J2TB 4RGQA 1RKBA 3A1EA 2JF0A 1YQEA 2JI9A 3G2LA 2JEZA 4D8VA 3MWYW 4QATA 4RXTA 2YHIA 4GLBA 3CBGA 1WAMA 1KSFX 3GP5A 3KXDA 1MVNA 4LRUA 1GAJA 1HMPA 4PXSA 5EHIA 3ZWMA 4CF3A 5DTIA 4ZAFA 4E0BA 1ZESA 4MQBA 1YT5A 3O8QB 2XMCA 4QBGB 3FRJA 2GKOA 4AL4A 3EFBA 1EVEA 1Q19A 3PXCX 5FULA 1RSZA 2IP4A 2Q1UA 3EC7A 4J0HA 3WK5A 3LC1O 1WU7A 5JCPA 1SR8A 2Z6AA 1AG9A 4Y18A 3L0CA 1R2QA 2I2FA 5IJ0B 3L49A 4EJSC 2IIQA 1GJRA 4UXHA 4HAXA 4DG9A 2F6RA 1NMQA 2VJDA 3OO0A 4K5QA 1BRTA 4GE0A 3RUIA 3KOZA 3WJ1A 3HR8A 2PO7A 4KODA 3A6ZA 4XDYA 4FVTA 5AI4A 1I7NA 1TM1E 2I91A 2ZIEA 2ORYA 2F1JA 5C8XA 2P6NA 1TZ2A 5HK9A 5IC6A 1K86A 1H66A 1OYWA 5JPCA 2EARA 4MQ6A 4DZZA 5CNKA 2QV0A 1T4DA 4LZLA 1GARA 1HGXA 3ZEIA 1ISJA 3BGSA 4C7MA 5LC1A 4OY3A 1XA4A 1V3QE 4KVGA 3W2TA 1HK7A 3E35A 5LYYA 4XD7A 1SZJG 4PO8A 4XSVA 2CY0A 1ONNA 4P4UA 4BJ6A 4CEHB 4AP5A 3QLVC 3BGIA 3CRW1 2WM2A 3C8UA 4HO1X 4YMIA 1FP6A 4IUBS 5I4BA 3UPTA 3KB6A 2H0RA 2VYCA 1AXEA 2Z8YA 3B1ZA 4EY6A 5IDQA 1L7BA 4R9RA 2H9YA 1W2HA 4RULA 3PC3A 1U9YA 4XWOA 2Q1YA 3ZCQA 4LNHA 2VDOB 3X2FA 4BMSA 2ZM6B 3DLBA 2WEKA 1SA0B 1EA5A 1GTL1 2RGXA 1YI0A 1QU3A 2IWHA 3PEFA 1UM9B 3MB5A 1XPRA 2OD7A 3HE3A 1E9EA 3KJIA 4MRVA 3DO5A 3H5WA 5FXMA 3G6KA 4Q3OA 3S40A 2GHQA 5B55A 2O54A 4UU1A 2UAGA 3ODGA 3WNVA 2YY6A 2JPDA 3FN4A 4CKBB 3H5TA 2C57A 1NVBA 4QYIB 4RZHA 1V2HE 3GLUA 1X14A 2ZP1A 2XCRB 3SXUB 3W5SA 3HXQA 1BU8A 1HDRA 1FFDA 2J9RA 1PX0A 1W0JD 1Y6ZA 2F55A 3P0RA 2AOUA 2XIQA 5EZ5A 3CKMA 3SS8A 4D4JA 3OJOA 3HUDA 3QU9A 1Y1TA 1I7QB 3ZNNA 2CLDX 2WT4A 1XK7A 1CUJA 4WJLA 4O4LB 1ISPA 2X0JA 1U81A 3K0EA 3RKUA 1SVUA 3FYCA 3FUCA 1RAEA 3PDWA 3RARA 1EINA 3ITNA 3OCJA 2X0DA 5TV2A 2G9ZA 1MQSA 2QTGA 2BFEB 3RJZA 4JVSB 1M5UA 1RMTA 1TQHA 1DKOA 2XNKA 2EHJA 3AEQA 3NVAA 4J3FA 1IN8A 4PYOA 4RDHA 1XVUA 1H3NA 1WPQA 3WIUA 1UPFA 4B3BA 3M6FA 4DVJA 4XWKA 5JYBA 2D06A 1FUEA 2AEJA 2CDCA 4URWR 2AVDA 3TMYA 2DSTA 2PXCA 5KB3A 1RWBA 3C6ZA 4ZRDA 1FMFA 1PYOA 1U0JA 2IX9A 2FFHA 1Z2CA 3AFOA 3L7BA 2OM6A 2AD1A 4EUSA 2B4KA 1SCUA 1XUOA 4W5QA 3T95A 3A14A 4NESA 5FLXA 3AVYA 1DELA 3U4HA 1Y8AA 1PTJC 3T7EA 5HGXA 1G5PA 1MCZA 1ZN9A 2HEGA 3K6JA 5CFZA 3A3OA 1RRGA 1UZAA 4EL0A 3AVXA 1MX9A 2CFRA 3EOZA 3EY4A 2OQVA 3F78A 2PUAA 4G4GA 4NKRA 1P45A 2GF2A 3WZ2A 4X54A 1KWKA 3V97A 4UZSA 2DQSA 4MUGA 5C53B 1SXQA 1NL3A 1MTOA 1XTSA 5K0LA 4CF6A 3ZU2A 2KW5A 1KGSA 4HY3A 1RLUA 4KFUA 1L8XA 4NJEA 4YP9A 3VZCA 4B7ZA 4F5ZA 4PSCA 2BFFA 3T4UA 2BEJA 2QN6A 3QFFA 2P6OA 5KZMB 3TZBA 5LKRA 3VM6A 3TZLA 3QSGA 1KZ7B 4B6JA 4ZRMA 2GGSA 3BBPA 4TV8B 4ETMA 3DLIA 2W4QA 2L0XA 3EY9A 2I2AA 3E7XA 5LA6F 1SCDA 3S8MA 1YBFA 4DN6A 1N2ZA 2H1CA 3HCPA 3LT4A 4H0FA 3I9JA 4I1SA 7ABPA 4BJHB 5FFFA 4BFVA 2QZZA 4TUYB 5JSUA 1F4VA 5LWQA 5LBUA 1LX7A 3L0BA 3NQ41 3G9QA 2IBSA 4MDEA 4N39A 1J0DA 3OP1A 2JW5A 4DDUA 2P3OA 2FUEA 1QQTA 2FPKA 1LTHR 1E4EA 2YJGA 3BMQA 3MTIA 3OZEA 1F8GA 3Q3VA 4CV0A 4KACA 4KH1A 4X8LA 3W8NA 5AQ1A 4MGIR 5IFLA 3E48A 3OOWA 4R9SA 3WRXC 1PQ4A 2JLCA 2ZI9A 5E4YA 2QXYA 1X7ZB 2ODWA 1HYHA 4URUR 5FOXA 3FPLA 3NT5A 4CRWB 4GSKA 1EAYA 3JVUA 1R18A 1UKEA 2Z1MA 3V2HA 3A1SA 4B0PA 4I3GA 5J2UF 3P2IA 1LRKA 2CK3A 1DB3A 1DRUA 3CMCO 3QY0A 2NN3C 3OZ7A 4J4HA 4YPFA 4MHTA 4EZBA 4OQPA 2E21A 3CLSD 4HJRA 4LNUB 5DLQC 2FSIA 5CJPA 4UC0A 4XWWA 3T7RA 1VSUA 1TRHA 4J16C 1EUDA 1AGNA 2JK1A 1L7RA 3GHYA 4ZJYA 3HFGA 1K8ZB 4G1MB 1HT1E 3UG6A 1E6EA 3K1AB 4NP6A 2LW7A 5LQUA 1Z4IA 4JJAA 3KTAB 4MWSA 1FMTA 5CB0A 4Q4JA 2IC5A 4GHWA 1WHSA 1IHUA 1HE1C 1U3CA 4HX9A 1R0RE 4G8DA 4ZANA 3AFGA 1R0XA 2NUPA 3CVOA 1Q1GA 1ST3A 3I32A 5CLLA 1PL0A 3R9IA 3C3BA 5G3ZA 4EJ0A 2C42A 2V9CA 5FEMA 1ZR4A 1G21E 3AETB 3QTBA 5DCYA 3U7QB 5HDQA 3NHRA 3RSHA 5KQPA 5CYPA 1EGQA 2HZBA 1GR1A 4OSEA 4AKTA 1XLTC 4M1KA 4B3XA 3E23A 4DBLE 3BMXA 2W7TA 4CMEC 3MQFA 2GJ4A 1SKUA 1A4IA 3FCUB 4ZU1X 4J0JA 1DIOB 1RAIA 3WZLA 1XCLA 1I10A 4WY8A 4X00A 1QNFA 1N33B 1QJCA 5A5EA 1JKXA 2EJTA 2H92A 2NNWB 2XE8A 1L4GA 2IYUA 3MAGA 4FGLA 4HWSA 4V0SA 3UB3A 1SCKA 1V5EA 4ALJA 1A72A 3GLHA 5EN4A 3EXHB 2EAUA 4P54A 5TIIA 2IU3A 1FK8A 4EFKA 3KSZO 3AV0B 2V6GA 3HY3A 5K3OA 2AQ8A 4P7GA 4EKYA 3GQVA 1U9CA 2QE6A 2XMSA 1W88A 1B14A 2VBCA 4JI3B 3TLXA 3AU9A 2QG4A 2VA8A 4FOTA 5CR9A 3DFIA 3IDOA 1DIBA 4J0QA 4QDJA 3C87A 4RYDA 3VMFA 4Y2JA 3ZZTA 2O6LA 4HNGA 1Z39A 3R74A 3G1UA 4AG5A 1EGVB 1MAVA 1WE2A 1V11A 5IMBA 1Z2EA 4L72A 4R1NA 3W8EA 4B4OA 3WL5A 1CNMA 3QELA 4GVXA 5E6SA 1TO2E 3SN6A 2ZSDA 3NHWA 3CUUA 1U1EA 1X7XB 2HMTA 2L69A 2IUSA 2PL1A 4GM0A 3T35A 5C7LO 5JAOA 1XQ6A 5AW1A 2GEVA 3DXZA 4Y0AA 3KDPA 3C3DA 4CEJA 3RTAA 4C4YA 4OK6A 3EZXA 5EHQA 3Q6MA 1HL3A 3LSTA 5CYFA 1C3VA 2RGBA 1OBCA 2JJYA 3MSCA 4R5HA 3UV3A 3QF7A 5AW3A 3SSAA 3B2EA 3PFFA 2IYFA 2IJGX 1JDBB 1T9AA 3T8YA 3MCTA 4D6YA 4LRTB 3FA2A 3IVMA 1ZJ4A 4B8YA 5DK4A 4KOAA 1OLXB 2Q8NA 3M1AA 4Q01A 5ALTA 3R8FA 2XMZA 2MYUA 4H3VA 3ZE9A 4MRAA 5EKDA 3GLFA 4AWAA 2XQIA 4WXYB 4FONA 4UAGA 3QTTA 4IJKA 4MTLA 1T0IA 4AJ1A 3ZJVA 2OOSA 4BBAA 3GMDA 1RI4A 1US8B 2I8AA 1OZFA 2XBUA 2YVLA 2LRHA 2JJ8A 3QPCA 4WZBA 4HNVA 1PJ2A 3RF6A 1GA6A 2XSZA 1OKKA 1UBTS 4S2EA 1CEQA 2Z2XA 3QVWA 1EVKA 2V7PA 2OFFA 3STUA 1E2PA 1HLDA 2PSEA 2PZGA 4GOKA 1A97A 5BOVA 3FPJA 4LQCA 3Q0EA 1PO7A 3L3BA 4JK3A 2V7WA 5G3YA 1QVWA 5SY6A 3MBOA 5HRCA 1II0A 2QRJA 4N3BA 2EV9A 3IP8A 4H7PA 4S3MA 2ZUTA 1PYDA 2P8SA 3B6MA 3RSQA 1D8TA 1TAUA 1YR1A 1ZU4A 4MS1A 2P6RA 3MOIA 1BDIA 5JXWA 1KI4A 2KM1A 2PAAA 4FE3A 3MHTA 4BX9A 3KX2A 1Z0SA 1TK2A 1P1FA 2B9EA 2Y8EA 4QOFA 1GPLA 4O3FA 2J6IA 4RK5A 2EQAA 2PZLA 4V24A 2I1VB 4N7MA 5DH9A 1WKCA 4Z3OA 2RAUA 4RWEA 5SZJA 1IJKA 3OIVA 3CLKA 4I4LA 4RD4A 4AZWA 2W6QA 4V0ME 2VF4X 2X8BA 2FDCA 5EZSA 2FDXA 4MX8A 4TS4A 1Z17A 2Q5QA 1IATA 4H7IA 4Q02A 3FKQA 4WCFC 2AFIB 2YVUA 2FCAA 4WBSA 1DJNA 1N6NA 4O1HA 4YS6A 5FQNA 3TMKA 1A4XA 2FF5A 3QUCA 2OXFA 3Q1LA 4P3NA 4RPGA 3NWOA 4MR9B 2HADA 4C6HA 1ZOSA 4F56A 4M88A 3M9WA 5SZIA 2HB6A 1KDZA 3VPBA 3E22A 1X7WA 4MAFA 3HXTA 3PX7A 3WLMA 3ZXSA 1O08A 3ISVA 1O8BA 3T1QA 4KN6A 5A7HA 3REGA 1LZLA 1NX6A 2R751 4AAYA 3AWDA 1T24A 4FNMA 3ROPA 3ESZA 3Q3GE 3LGXA 5A06A 2GN1A 3SS7X 1P1KA 2VZ8A 3FPAA 4KLNA 4PZPA 3ZHCA 1TLTA 1OILA 2D62A 1NURA 4RTQA 2WKQA 5IEJA 1AS2A 2RGWA 1UKCA 2ZRCA 3HA5A 3R3UA 4LF9B 1JBEA 5YASA 3SQLA 2WMOB 3T4EA 1RXYA 5FEUA 4EY4A 3P2YA 2H1OA 1M2WA 1NV8A 3QFCA 1P1BA 1KF0A 3B3JA 2NXEA 4MAMA 2IX3A 1GAEO 1HI9A 2B1RA 3AGPA 3QV2A 1XT6A 3A2KA 4DJDC 4HDKA 3KYCA 3QI7A 1XNJA 1EQUA 4NARA 1YQUA 1FRQA 2BR3A 4PZYA 2B20A 5HE9A 2VDUE 2QENA 3D4PA 4QQNA 3AESB 5DNEA 5B3JC 2GFHA 1U0SY 4KH0A 5C8DA 5F64A 1F5SA 1SC9A 2EZTA 4KLZA 2CEAA 4MKZA 3VZQA 2BC9A 4B43A 4YRBA 5TR9A 2PVCA 1XHFA 2IEYA 3L5KA 3PA6A 1JBKA 3SP1A 5GZ6A 4CMGA 4REQA 3SYRA 4C5CA 3GJXC 1H6CA 1S2NA 4Q00A 1SCQA 4PG7A 1M1XB 5J5AA 4E5YA 1XMVA 3TZCA 3N8KA 3A4IA 4KLAA 4P92A 4GEGA 5H70A 3GN2A 1O57A 4RK4A 5DEIA 4DIUA 3KDAA 1QOPB 4XYLA 1M2VA 1E9RA 2QIPA 5C7IO 4BJ5A 4ZGWA 2A35A 4ZYTA 4F8JA 1L8QA 2WHQA 3C98A 2PU5A 4C0XA 3M6WA 3ZHVA 3KKEA 5JNVA 2BGWA 2HEIA 2HH9A 4OJQA 4NICA 5FIUA 4DAEA 5BRAA 3VX3A 3GF4A 3NAMA 5GJWC 4B31A 4FYVA 3S2YA 4G2TA 3TH5A 1T8YA 4FFOA 3RC3A 5KS2A 3NTVA 1XLWA 1JILA 1EWQA 1BXKA 2C5HA 1G18A 1SG0A 3FPHA 4Q19A 5KVCA 5ED0A 1MJGM 3K6RA 4ENQA 5CXQA 1P0PA 2VP3A 4LCBA 3VZPA 4EGQA 1XP8A 3LY8A 5GM1A 1RCFA 1XD2B 2XVAA 4CM8B 4M54A 3ILHA 3ZDEA 3JAKA 5DFAA 1JJ7A 2XTJA 1HC7A 1JALA 3O9MA 1LCIA 4LE1A 3EQZA 4N0MA 4PZZA 1W4RA 2JIDA 3FZGA 3K9QO 5A9TA 5JWRA 3COPA 5CW1A 4Z4FA 2BHLA 1IY1A 2BCEA 4KYIB 4LDJA 4OHWA 2ILTA 4JBLA 5E2AA 1ZK2A 3FPCA 3UWMA 1YVUA 1XX6A 1QFJA 3GK3A 4MS4A 3HXMA 4P0TA 1Z74A 1DT3A 1GG5A 2P6UA 4KL8S 2QJOA 1M6VA 5IX8A 1DT5A 1PKEA 2JFWA 3R0QA 1OFUX 1P5HA 2OCKA 3I52A 1NR7A 1UC9A 3GX1A 1NLFA 1DX9A 1MC8A 5HIJA 3ZDDA 4LXTA 1RXVA 2W43A 2NU9B 1LB1B 3TTUA 3TOVA 1KHTA 2IXFA 8ADHA 3DEIA 1QWSA 4FYIA 3RKRA 4A0HA 1V35A 2RAVA 4C22A 4K8RB 4PCLA 3WGOA 1TK3A 1FS5A 1S89A 1E0DA 4L22A 1RQXA 1NG1A 1U98A 1TO6A 3RHZA 4D0NA 2BKEA 2QD5A 3PQCA 2IQIA 4CM3A 1KK0A 3LQKA 4L5JA 2HJWA 4Y6RA 5K0NA 1LNSA 3WK6A 4GSYA 3RS5A 3ZGXA 3QW4B 3PC7A 1YFKA 3I2JA 2R8RA 2ZPAA 2DBVO 1NBOA 4FZ5A 1T36A 3FAZA 3R6DA 5CIQA 2BKVA 3RUAA 2A7XA 5TEWA 2XD4A 4FKZA 2YJNA 1NJ5A 2PS9A 1P77A 1OU0A 3WOHA 1KSHA 3KOMA 3EXG2 2QEQA 5JDIA 2VF5X 3TRIA 3DE7X 3DFUA 4RVOA 2P3LA 3CLSC 4FWIB 4NDNE 2YHBA 4G4SP 4YP0A 3AC0A 3DJYA 4HPWA 5B3LA 5KOYA 1XAIA 3QY9A 4RWZA 4KAJA 1XV5A 3EIEA 3UJ8A 3GXOA 1OF1A 3OUZA 4NECA 4EJ2A 1OAOC 2H9IA 2V4ZA 3E3NA 1DC6A 2PY6A 2E87A 3INNA 2OAGA 3HV2A 1PP4A 3AI3A 1PBTA 2G36A 3U7GA 1B43A 2C95A 2J41A 2NP6A 4O2BB 4TVKA 4DA0A 4KC0A 2W8BA 4UE3S 1DCKA 3ZHBA 5K8TA 1LPOA 4KR2A 4JEIA 3CPSA 4B34A 1QRRA 4RTOA 3FSRA 5D6NA 5THKA 2X4IA 5DB4A 4CPDA 2IHJA 3OLXA 1JI3A 3BJMA 3PRKE 2VH1A 1NULA 4LKRA 1CSEE 3R76A 1EVJA 2G1JA 5DOVA 3NIGB 4BO1A 2OT3B 4ZCRA 1FYVA 1F2DA 3M6VA 1DX4A 4AZ0A 1DLJA 1LDMA 3NRCA 3V8EA 1HT2E 3IEPA 1EVIA 3H5AA 2C3PA 1B0ZA 1MX5A 5DW0A 2YJ4A 3RNLA 3KHSA 4ZYLA 2IZ6A 1QHHA 4A10A 2O0HA 1TO1E 2WSBA 2AK2A 3GUVA 5C51B 2NYAA 1DP4A 2W6ID 1G8AA 1M2NA 1MX1A 4GRIA 2HC9A 3W4IA 5EE0A 2CVQA 5FAXA 8ATCA 4YT8A 2FWMX 4OG2A 4V0RA 4P3KA 2HMYB 5EP2A 2ZVPX 3DH0A 2XVMA 1I2BA 2CLMB 3CNHA 4IIYA 3ZHTA 2F8SA 2L17A 4R1MA 2PX5A 3PQ5A 1J39A 1V6CA 4I2NA 4QX6A 4EO9A 3ZW7A 1ISHA 3W7AA 2RGCA 4NBTA 3P2JA 4LF6B 2QN9A 1ZLXA 1RFGE 4F4FA 1I0LA 2PR2A 1P6UA 2QQEA 3IB6A 4DR5B 4NAHA 5ALRA 1OTYA 2HM7A 4C7JA 4J3JA 3CVXA 13PKA 2Q27A 2BZGA 3HCDA 5KMGB 3H1EA 1IHXA 2RE8A 5EXXA 1EPUA 4I1PA 4DDHA 4OHPA 2BEUB 1HFEL 1GNVA 2C83A 3PGLA 1YE3A 3VR2D 1RRMA 4AJ9A 2Q1WA 2OENG 3C4VA 5FPKA 5JH7F 4LOJA 3LHFA 3B3FA 5P8WA 5BN3A 5J2TF 4WIAA 2QVGA 4D81A 1NP7A 3AEXA 1OHHD 3QIVA 4W9NC 5DYTA 2BTQB 4EZIA 3GLGE 3A4YA 3R0IA 5KVVA 2ZI4A 4DNXA 5ITSA 3LPMA 4GP9A 3AERA 3U3DA 2XTNA 3L8DA 3RRZA 3WGQA 1OLUB 2E37A 2UVPA 4YV2A 4LJ4A 2ZUFA 1W96A 3R9KA 4C89A 5CLHA 3OX2A 4UARA 1Y1RA 1W4LA 4MYSA 2OAP1 2ZIGA 4EVRA 1ZM2A 3U6BA 2QT9A 5CEFA 1V5FA 1WIWA 5J4YA 1AKMA 3WDKA 1TYBE 2JAOA 1FTNA 3P32A 4MOWA 1Q1EA 1WMSA 3A6EA 3DVAA 5IN4A 1APBA 4E07A 2WWGA 1BQ4A 2G9RA 4GPEA 4AG3A 1ETHA 1BHJA 4N5IX 4NPHA 5D5HA 1H4VB 2IUYA 1A5TA 2XDQB 2CBXA 2DLNA 4RZSA 4BMDA 2D0IA 1NYQA 5DX0A 5TEVA 3WIDA 3KU4A 4M8IA 3UATA 1JDJA 2ID8A 1SBYA 1M33A 1KBZA 3T5GA 2PUJA 3KHKA 1DFIA 1ENPA 1FDOA 4HNHA 4IX9A 1TJPB 1LWOA 2XOEA 4YV1A 3M6IA 1GR0A 3JTMA 3EIOA 1B41A 1K3UB 1UODA 3QOYA 2BFOA 2AS0A 3RHTA 3ERCA 2AG0A 4IUCS 5T4EA 3UOGA 2JCYA 3LUHA 4DNQA 1BCSB 3D9QX 2WYIA 3DE1X 4ER3A 2VJPA 3JARB 4R7TA 2AZXA 3PP8A 1XRJA 1U2DC 1SVKA 3DBVO 5DHQA 4ZJZA 3U26A 3SX2A 4KNVA 2GVNA 2Q45A 3ES9A 4PC3A 2XXAB 3I6IA 4ALNA 4GOXA 2BMWA 2PH3A 2QYTA 4HTFA 3FFTA 4Y2YA 2QZ4A 3EZNA 1Y5NA 3GCGA 1P1JA 2OYCA 3F90A 4DWOA 1VIMA 1QAQA 1CR1A 2MWMA 2UXBB 3LLSA 2YVQA 3O38A 5AJZA 1VG0B 4AS2A 4FHDA 2J48A 3BWDD 4PN7A 2GUGA 3VOBA 5DT9A 4AUNA 4MPDA 5L9AA 1NVFA 3NYWA 2CCKA 4NZMA 3FWNA 3QFTA 5F21A 4XGNA 3WFJA 1J56A 3ZIDA 3PZBA 4LF7B 1V96A 2C4TA 3A31A 3NT2A 4PSKA 1VKNA 3SPXA 1DTEA 1EGHA 5F2NA 4KO4S 1Q50A 2Z3ZA 3ZWKA 2HHHB 1G16A 4HLUA 4QA9A 4XIIA 4L8GA 1LDNA 1T8PA 1VHJA 1RYHA 1K97A 3PGMA 2ZCVA 1FYEA 2XCUA 1R8QA 4IKOA 2FR1A 3UJ3X 3EVBA 2HF9A 3G7UA 2O0MA 1OTXA 1VJ1A 1X3LA 3TM5A 1W48A 2BEVA 4W82A 3MRXA 5EIXA 3I01M 1UMDB 3BKWA 1H3FA 3I6ZA 3UT5A 3EFHA 4YDQA 2J5XA 4FDMA 1QZXA 3V4OA 3RVOA 2R00C 4EFLA 1OGIA 1V4VA 3NRJA 1N92A 2FKAA 2VUHB 4AQ7A 2F00A 1K7FB 4O4LF 4XGRA 5EG5A 3GFGA 5FI0B 1KE2A 3WIEA 4IDHA 4D9GA 1RWKA 1XJ5A 1YOBA 2V98A 2WJHA 4GR9A 4B3CA 4K0KB 1JEAA 2BEKA 2NMVA 1THMA 2V55B 4W5HA 1D9ZA 1QB8A 3QIAA 2DAPA 2DKFA 2HNKA 1QORA 2C77A 4RC9A 4AIRA 3ROQA 3RODA 2I78A 2GPAA 3A10A 3QXGA 4YAJA 2H0AA 1Y3HA 1H8HD 1GTZA 1THTA 3MJCA 3QPDA 3WGNA 4AJ2A 2JARA 4EJ6A 4EI8A 3KXPA 4RABA 2J08A 2YN0A 4KXQA 4WPGA 3KWLA 5D7BA 2UZIR 3JD2A 4TZTA 2YR0A 3OU7A 3FVRA 1PGQA 4RJKA 3KKZA 4DA6A 2IGTA 3KFVA 5I4KA 1I13A 3LWBA 3LUBA 4LKOA 4YI3A 5GQSA 5ILGA 2A9FA 3L04A 1S2LA 1IXZA 1NOJA 4ZC1A 4GF5A 2O14A 5BQPA 3M4JA 3DHEA 1PWYE 1GAXA 5KTPA 2F59A 1S7GA 4ROSA 1X1DA 4TMTA 2M6RA 2VDKB 2EW8A 4P80A 4EF4A 4OKNA 3IPCA 4TRMA 5ECDA 1QGUB 1VQ1A 3R3YA 2BKXA 2VDRB 2F1IA 4X0EA 4YIKA 3W2GA 1RQNA 4QPZA 5E95A 3FCXA 2QGZA 1XQ1A 3BC1A 2ZRMA 3I04A 4QL3A 3SG0A 3LFHA 3THRA 1OXMA 2A5JA 1Y9EA 3OH8A 4J75A 2PFGA 4JGIA 1E1RD 3LP6A 2AW3A 4XLLA 4ND1A 3BJEA 1J2TA 3P0FA 2HBZA 3GFFA 5H9VA 2C9ZA 4G09A 4TV8F 4D0RA 1E1KA 1NR1A 1SEVA 2ID9A 2IFTA 1L8OA 3DEKA 1QKIA 1XTPA 1IRIA 1K92A 1HOXA 2ETXA 2QZPA 3EUFA 3IODA 1TXGA 2WC1A 4IZOA 4MMZB 3ACCA 1VIYA 2FN7A 4QUKA 4ZXPA 3QU7A 3CE6A 2BFCA 3W5JA 1EP9A 1T34A 3AM4A 3MQ4A 1WVMA 4OH1A 1YR9A 3V80A 2WZDA 4QQ8A 2MMGA 4RY8A 1Z6TA 2ZYSA 1MXFA 1M6EX 4AYTA 1U8EA 3R23A 3UHAA 2A9QA 4Q4AA 5CXSA 4EF5A 4NZOA 2DH6A 1JEYA 2VXOA 3E9ZA 4DRXA 1Z45A 3K15A 3U17A 4RNDB 3RTEA 2LCIA 3WIBA 2H2WA 3EG9A 4ZMRA 4MUHA 2QU8A 3LUCA 1Q7EA 5C34B 3ESCA 3BQMB 1VCOA 4WINA 1VPDA 2WDZA 1XQXA 4TSRA 4MRMA 4UE6A 4ZCQA 3TW6A 2F43B 1BWPA 2ZBQA 2X0RA 4YR9A 1JNXX 1UFOA 1YFLA 4W6ZA 1FLNA 1SRQA 1FYWA 1O97C 4Y0VA 5ED4A 1MJNA 1XVAA 1E5QA 1AUQA 1GPUA 3IJPA 4OJNA 4R7ZA 4GZLA 4OHYA 5BQ5A 1NATA 3VR4H 4KIUA 2VCEA 3PQFA 4FR5A 5FL7A 1FFWA 4XGKA 1E61A 4JI1B 3ZV5A 3TE6A 3JCZA 2ZB4A 1H65A 2AL7A 2Q9UA 3LPLA 3HO6A 3V8MA 1Z12A 2N42A 1A9XB 3RFFA 5C81A 4A15A 3SQWA 5HJEA 1V9LA 4RLQA 3OUUA 5CGQB 3DR5A 5AT1A 3F6RA 1X8XA 1XPJA 2H3EA 1JA9A 3FLAA 3UOWA 3EPKA 5A4IS 2O8CB 2PXHA 1GUBA 3MB8A 2DTDA 4XOIA 3TTXA 1QX4A 1YKSA 4WKOA 4RM3A 4F5WA 4Y1RA 2XUAA 2XUDA 1HE5A 1XEFA 3HU1A 3PDIB 4PX9A 2GHRA 4MWGA 3DZCA 1EDZA 4WLEA 1E79D 2DUMA 3VHXB 3SD7A 1V5WA 2B9VA 4G0XA 5F1PA 1YHNA 1UF9A 2C8JA 4L0MA 1L8LA 3O9VA 5I9TA 3VSDA 5C3MA 1SFRA 3ZLUA 2JH9A 1SKBA 1VHWA 2QX6A 1P44A 3NGLA 2ONJA 3O4RA 2EP5A 3N28A 5AOVA 4E4YA 3I5XA 3O8OB 4EO7A 1WUHS 3LHSA 2JRLA 1YIOA 1WXWA 4M83A 5D5PA 3IUPA 3CH4B 3H2IA 3LXUX 4G5HA 3STWA 1KMIY 3IMKA 1ND6A 1QV7A 3G1WA 4PAOA 4XASA 4HWTA 5A1TA 1GZSA 1PZEA 2QMYA 1AXGA 2B4RO 4BGDA 2Y76A 2CXHA 3M83A 4TKUB 1KPIA 4U3JB 2AFIE 4OX9Y 1PR2A 3EDMA 1ML3A 4LZJA 1ORRA 4S1TA 4PGFA 1QV6A 3F8SA 3EXFB 3FSJX 1IN6A 3K94A 1PNQA 4IXTA 3UK1A 2F1HA 3E0XA 4UBLA 2IXEA 1U1GA 1Y7PA 1FJGB 2CXXA 3Q7IA 3PEYA 4DHEA 3ZH9B 1GM5A 1L7NA 5B6IA 4X5OA 3CHYA 3RC2A 2FFAA 3I4LA 1ZK4A 4GM1A 2WU1A 3K2EA 4L75A 5KOJA 5ES4B 5JR3A 2Q5EA 2OCIA 3R5JA 3LX6A 4YCBA 3STTA 4K7JA 3VU8A 4D6PA 3E53A 3L6OO 2H8KA 4D9NA 4KGZA 1KVTA 3CKYA 4PSVA 2J8ZA 3IAFA 5AW5A 1M67A 3U3MA 2P9BA 5IRCD 1E0AA 3LLCA 4O25A 4OB7A 1T5LA 3KQOA 3LZ6A 1ULAA 1VDZA 2D2IA 4HVAA 4XIJA 3BS4A 3TQQA 2BMJA 4NPAA 2I3BA 4WRRA 5TQ0B 5IU6A 1UFQA 2GAOA 2WBLC 2A1TS 2IVFA 1XHEA 2HSEA 3HI6A 1FDVA 1XZHA 3HUFA 2HOQA 3OHSX 4HX2A 1QIEA 1F9EA 4JL8A 3UAWA 1Y3FE 2SBTA 4XYBA 3TZHA 2K7FA 1CUZA 4QPJC 5I9IA 1JEOA 1GO2A 2D2VA 5AXDA 5IKEA 3D43A 3MTQA 1KK2A 1PFVA 4H6VA 5ELMA 1MV5A 1RYMA 1XTQA 3EDCA 3GC6A 4X63A 5BVHA 5FR2A 1QP0A 5IZCC 1G2QA 1GA1A 4OFXA 1V48A 1P33A 4AS3A 4X3OA 2WOOA 3DUFB 2RBEA 5F3RA 4LJ9A 3PUJA 5JPIA 5LP6A 2OMKA 4FILA 4AJLA 4AZ3A 3WLQA 3AQ4A 1SG9A 1QE3A 3HCOA 3OZWA 1Z4PX 1RPAA 3TD9A 1ODCA 2JK0A 4X64B 1A1VA 2SCUB 2XPCA 1I9CA 5D6OA 3SJAA 3LK6A 3QU4A 3FD8A 3H8SA 3DP9A 3QLTA 3W9SA 3D0QA 3QVSA 1EWTA 4EB8A 4OQZA 2ONZA 3DUWA 5AOBA 4ARAA 1VL0A 2P2GA 1W4CA 1D0SA 3ZHXA 4JEHA 3CF4G 4Q18A 1UK9A 4TWBA 4G0MA 3RDPA 4BQIA 1P2DA 2AJ8A 4YQEA 3SOZA 2PHZA 3B1XA 3WMEA 1BWRA 4C4ZA 5KQSA 1R5BA 1XXHE 1EFCA 5JZMA 5EHGA 3PYXA 1W87A 3DDUA 4QOJA 2JGNA 1J42A 2DUWA 1C0IA 4FCWA 4EFMA 4GPIB 4N7BA 5IPFA 4O8ZA 2VIIA 2WF7A 3W5VA 3SVTA 3AR5A 6PFKA 3H3JA 3VU1A 5HR5A 1I6WA 2VTDA 3BB1A 3I5UA 3OZAA 2F8LA 2C1XA 1ELOA 2P9CA 2Q9AA 2Z09A 1A2OA 1A1SA 3MC1A 1M75A 1XF9A 5JQWA 3IQXA 4BQRA 1FXWF 1YSCA 5KBYA 1ITZA 1UINA 2ZBGA 1UBMS 2XZLA 2LIVA 1IN1A 1GPJA 4HFRA 3TYXA 4M76B 1FRVA 3H1GA 5EZYB 2JIQA 2X2OA 4RDIA 4C87A 1ZISA 4MVJA 4MYRA 1LS6A 5AW2A 4QUAA 3D4NA 1QIKA 2JIBA 1R5NA 1R6VA 2HJGA 2HRBA 1TCVA 2CMHA 2Y4OA 4B4WA 4BZZA 3H6KA 3CRRA 3E1GA 2CYCA 3DQQA 3DTVD 2PJRA 3IR7A 1KL7A 4G9GA 5ITWA 2HA0A 2PMBA 2ZRJA 2JI6A 1WDWB 1L7AA 2JGEA 1GUYA 3L46A 3BAZA 4H77A 3RFXA 2F17A 5HZHA 1C9JA 4QYTA 3GEPA 3ECAA 5FA8A 3KZNA 4PS1A 3H2KA 1GLGA 2JFVA 3CSSA 4OGLA 1U8UA 4DUPA 4LWZA 1SCAA 2WYWA 1XG5A 4BNWA 1FMLA 4A8JB 4MNTA 3F4KA 3IBSA 4R1PA 2EZ4A 3I2YX 4G67A 5HBRA 2M1ZA 1WKBA 5IVKA 1JIQA 2X5KO 1I32A 4RPHA 4WK4B 1FP4A 1HZZA 4P35A 5J63A 5FWNA 4U4AA 2Q3DA 2Y6VA 5KNCD 3G13A 2J1LA 4BLUA 2ZTUA 3PITA 5ICCA 1O95A 1SBHA 2JBAA 4P38A 5DTRA 3C8ZA 4M0MA 4UUPA 1DS6A 4NYIQ 2BGMA 4NL4H 3TOXA 3QLEA 3DG9A 3LS2A 4J94A 3LC2O 5AO9A 5DDIP 3KYIB 4ZO8A 3ILSA 4BB5A 4Z5XA 4MARA 3O95A 2QVBA 1N1MA 3YASA 1C9EA 1SB9A 1XNHA 3I9V6 3KB8A 2FLWA 3KWMA 2TSYB 1J97A 3ZCTA 5BXQC 1FTWA 3BM5A 2CHGA 3FYTA 4H0NA 2ZJ4A 3P94A 4IJMA 3RRNA 3OKAA 3CPEA 3HSSA 2O2XA 4TMWA 1N7JA 4N6GA 4NU5A 4IEEA 2I7CA 5CT5A 3UTDA 2ON6A 4ASUD 4YGYA 4C4RA 2EATA 2KSQA 1SQ0A 1M2KA 4JA0A 5ILQA 3MS2A 3I30X 1AUXA 3U7RA 4DDKA 2JIRA 1CWUA 1II8A 2JL1A 2PMWB 2F1KA 2VK2A 2ZR8A 4LOHA 3JPWA 1TCUA 1XO1A 4OHOA 1V6AA 1EP2B 1VBFA 4R41A 2WIKA 1W9HA 3DD1A 3C7CB 2N47A 4NJOA 1FU8A 4Q15A 1WS6A 2J45A 3QHAA 4FW9A 1AMUA 5BMOA 1U4NA 3MMNA 1TEHA 3ZI7A 2D2XA 2F7SA 1ZW1A 5K03A 5F5LA 1XJWA 1E2NA 5A2GA 3OEWA 1QHGA 1IZZA 3WY9A 3KHUA 4PCAA 3K4QA 3K20A 4N9WA 3DOUA 2PGAA 4IJQA 3CWQA 4JGGA 4N5MA 4YP5A 5EMLA 5FBKA 3TRKA 4KRXA 1JRLA 4ZARA 5CAEA 4IS3A 3FLEA 1JQJC 1TJ5A 4DIKA 3B12A 2EFCB 5FLEX 4DCVA 1Q1ZA 4HEJA 1Z0UA 4Q4DA 3W5AA 1P4GA 4B73A 4E4RA 1FMJA 1S6YA 1Z7BA 2GF9A 2VH2A 2ZB3A 3OM1A 5C3UA 2FPGA 3BXPA 1IJBA 3V7UA 2W2NA 2PO5A 3NNNA 2OWDA 4BP9A 4HEHA 4N9QA 3TKAA 4R2MA 4H7FA 4F1KA 1T4CA 3AEZA 3LKBA 3P4XA 1G0OA 4LWPA 4F92B 3KIPA 4B5LA 4B3JA 3DBHA 1N8SA 4AKEA 3FDZA 2XH8A 1GITA 3SYMA 3STYA 5DBEX 4EGAA 4B71A 1UMBA 3L43A 5REQB 3RC7A 1V25A 3INGA 1VYVA 1ZN2A 3IPAA 3K0AB 3K5WA 2UYOA 3VR6D 4CG0A 3NTOA 4GQAA 3RJMA 3HJCA 2EDCA 2EWMA 3I1IA 3G68A 3MFQA 4L7VA 4DNOA 3RGWS 5B64A 5H3LA 3X3HA 1E7WA 4IV5A 4RDCA 2B5WA 4B46A 2EJWA 2YW2A 4L6CA 4MMYB 1X6VA 2H7VA 3W3AD 3GPLA 1F17A 1PSWA 2FR8C 2G04A 1TUIA 3C2QA 1NSFA 5JZOA 4Q47A 2BH2A 5GMOA 1U2TA 3HDVA 5HILA 1K6JA 1L5VA 2YYZA 2C9YA 2NT4A 3RAGA 3B3GA 1A96A 2IXGA 5DGIA 4BNLA 2G4CA 1FUUA 1B4DA 1DNPA 3NWPA 1JDTA 3O3NB 4EI9A 4B2LA 1Q1QA 3FMFA 4WZBE 3FHLA 4EB3A 3UKDA 3ZD8A 1M2EA 3ZYCA 4OXYA 2QLFA 4NH0A 3OIFA 4DDVA 1KRWA 1DAKA 1G98A 3HBMA 1JHZA 3QQPA 4Y98A 3S2UA 3EFOB 3L4SO 2HLDA 2PX2A 4TMKA 4BASA 1JQ5A 3M8KA 4DQLA 4TKVA 4YJFA 2F8TA 4BNUA 2OFXA 3UY4A 4R16A 2DJIA 1RVDA 1JLKA 3AM3A 3ESRA 3NATA 3AR6A 1B0PA 4ZT7A 1UIMA 3HB5X 3DWIA 2DFTA 3ET4A 1GKYA 1ADJA 3TQHA 4KMSA 1ZI8A 1A2BA 3P5BA 1DIHA 3MT7A 4W8HA 3OZCA 5ALLA 1QMPA 1H22A 1ZK1A 2AWNA 2XNJA 4FWBA 4G86A 4HAWA 3LFTA 3GRFA 4TT3A 5AHXA 5JYDA 1B6SA 3OTHA 5DN6D 2HU7A 4H16A 1YMVA 2J6CA 4D9BA 2RFLA 3LXXA 3U62A 1IOZA 3CUVA 4GGMX 2GN0A 4EMSA 4UAJA 1P5RA 3V3TA 2GSWA 3CG4A 1FSGA 4ZVMA 5GIOE 2AXPA 3MD9A 4O2BF 2IYAA 4E12A 1Y89A 2JFQA 4YASA 2G6TA 4FS3A 2CB0A 2P5UA 2EYQA 4DSAA 4MGYR 4OHRA 2GJSA 3H2YA 4P31A 3RS7A 1BD4A 3MM4A 1EWVA 3BE4A 4GLOA 5JNRA 4EPXA 1RZRA 4BMOB 2VHXA 1NDHA 3GT3A 1QIDA 2BHRA 3HXPA 3P4UA 4KWCA 4LE0A 4KQKA 3W5IA 4UTNA 1SELA 2QXTA 1DU4A 2JKZA 1Y8QA 4IHJA 1GTRA 2QNRA 4CL0A 1UEXC 3TQIA 1XMJA 2P7HA 1XL1A 2MJLA 3IVXA 3OIUA 3LT0A 1DQRA 2QJTA 4L5IA 4JKOA 4JUAA 1PJQA 2QWXA 1C1HA 2R4TA 4ZDKA 4OXIA 4DOMA 5I01A 4TRJA 2HDNB 4G5RA 1TX4B 3C6YA 4I1OA 5NULA 2W11A 3WQRA 5IT5A 4WEOA 1TEZA 5KYXA 1PTKA 4XUCA 4X1OA 2BUBA 2ZUVA 4I9GA 1N4AA 3FUUA 3OLWA 2RONA 1CE8A 3BFKA 1J2JA 1N4DA 1VTKA 3VR5H 2J3EA 2CMFA 4UVIA 1Y3BE 3U37A 3ETLA 4OUKX 4UOQA 2QGNA 2YV5A 5HSGA 3T9AA 5JFGA 2PRYA 2GHIA 3KBOA 3LGAA 3LRTA 1TVCA 3QX7A 4XR9A 4YCCA 5B2FA 1F6BA 2EOAA 3H8JA 1XDSA 4H6PA 4ENPA 4A6XA 1S5PA 3N2GA 3M3DA 3KE8A 1SHKA 2EIHA 2ERYA 1AMNA 1YCDA 2A5YB 3DLTA 2ST1A 5LVAA 2D8MA 3E84A 3ETEA 4XDHA 1HQYE 5BUSA 1JEQB 2NXJA 2F1OA 3P9ZA 3P0IA 4H7EA 4Q03A 1OX4B 4QNRA 1O9GA 5CH5A 2JLXA 2K87A 3HBFA 4OUDB 2WMYA 4UNNA 5A3JA 1PV4A 3Q40A 2HMAA 1QB7A 1F1JA 3NOQA 3O4GA 4RMHA 5IAJA 4UFNA 1V7QA 3UFXB 1OB5A 1PS9A 2VJNA 1P5ZB 1Z62A 3NETA 1NFFA 4LSMA 3HZOA 4TQ9A 3HYRA 3DXXA 1V37A 4UUQA 3TXYA 5GIPE 1R1DA 1ABFA 2Y66A 1V8DA 3TJRA 4MCAA 2DPGA 1AK2A 1C3JA 4YBZA 4BMYA 4Z0PA 5CIYA 3OX1A 1BHSA 3DA8A 4DQVA 3QNWA 1YJCA 3VBEA 3O92A 4IIBA 4UDOA 4CJXA 4RJTA 4ZKDA 4ZVPA 721PA 3PEUA 3UK7A 4KYUA 1HQCA 3HACA 3KVVA 3ENKA 4GI7A 3ZE0B 1QG4A 2XDAA 3FMPB 4OI0A 1W8IA 1KVQA 1C29B 2AZDA 2V7BA 4XD7D 4RTKA 4G1UC 3AEYA 1G8KA 4J2OA 3FR8A 2WIDA 4K86A 2YS6A 5BSVA 1PD0A 3OIDA 4BATA 2YC4C 3FJOA 3PT9A 5JNUA 1F2TB 3AI2A 1YL5A 4YLYA 1QO0A 4I55B 3ZY4A 4C20A 4X65B 2EP7A 1Z47A 3CPHA 2ZXFA 4IG4A 4X91A 2H29A 3ZDFA 2HFJA 1ZVQA 3FE2A 4NDZA 4QFDA 4UTOA 2Y0BA 1KIMA 2GN2A 4UUBA 3ZNQA 2OV3A 1XDDA 3GH3A 1Y63A 2E3JA 4H15A 4U7WA 2ZAMA 3WRVA 2PT9A 3KOYA 5LZ7A 3HYNA 1VJTA 1O9BA 3LCVB 4CM6A 3QEMB 4KWEA 1QYWA 1E6MA 2PVPA 2WICA 3NP7A 2J7PA 5ALIA 3S70A 3T0FA 4HQNA 2NSDA 4JBHA 3TOZA 3HGMA 3GPBA 2D0OB 2HLNA 3HDQA 2IU0A 1IEQA 1JS1X 1WRBA 2A5DA 4X1KA 4F4DA 1YHYA 1XTRA 3H6GA 3M4YA 2J9YB 2BUAA 4DC0A 4XQ0A 1D7AA 4B1FA 4D99A 2HMWA 3GCWA 2C4VA 3LKDA 3LXRA 4J7AA 2VP4A 4K9QA 4Q3CA 1F2VA 3ENZA 4IFBA 1L4LA 4MIYA 4RY0A 3RU2A 4QTYA 4C0JA 3B1YA 4LOKA 2Y68A 4RK1A 4AO6A 4NNOA 2VT7A 4FYXA 3UUFA 5FFMA 1ONBA 3WKDA 4PHCA 2ZYDA 3W6ZA 3IL2A 1Q95A 4NYJQ 2IBMA 4ACBA 1OWPA 2H4YA 4BNDA 5HUQA 2AOWA 4ZO4A 1Q92A 2OCXA 3KUDA 5TQVA 4OREX 1GILA 4J7UA 3RS2A 4ATNA 4KE9A 1R66A 2CXNA 3U31A 4ZHQB 1GZHB 1NYLA 5LIPA 3LQFA 2G7MC 2JGDA 3RGGA 1XMQB 2GYWA 3A26A 4MDHA 1QDUA 4P98A 3NC4A 4ENWA 4WQMA 2R6JA 1MAWA 4MUKA 5ALMA 1Z34A 3TQFA 4CDMA 3DT9A 1VSTA 5DGTA 4AJKA 4H59A 1MORA 1DRJA 3VNAA 1IBSA 1NVVQ 1HEIA 1ZAKA