3BGVA

Crystal structure of mrna cap guanine-n7 methyltransferase in complex with sah
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
309
structure length
269
Chain Sequence
RIFYLRNFNNWMKSVLIGEFLEKVRQKKDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQLPLGTLSKSEWEATSIYLVFAFEKQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of human RNA (guanine-7-) methyltransferase in complex with SAH.
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords mRNA cap guanine-N7 methyltransferase
total genus 94
structure length 269
sequence length 309
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2007-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3bgvA00
2FCAA 1X1DA 1YZ3A 1KPGA 1L1EA 2PWPA 2PY6A 5B1SA 4A6EA 4YMHA 5CVJA 1M6EX 2ZVJA 3KQVA 2EX4A 4KDRA 10MHA 1MHTA 3NJRA 3LCUA 1VBFA 2HNKA 3B7PA 3EEYA 3UJ9A 1JG2A 4FSXA 3QOXA 2A14A 3SGLA 4R6XA 3OFJA 1R18A 2IIPA 3PT9A 1ZG3A 4RV9A 1L3BA 2NP7A 3OZSA 1F38A 3M6UA 2QY6A 5ICCA 3LKZA 3PX3A 3UJ6A 4E2ZA 3I9FA 4K6MA 5CUQA 2ZCJA 2VS1A 3B89A 4PCAA 5KVAA 3MCZA 2IFTA 3AXTA 3P2EA 5LQUA 1JQEA 1T43A 4RTSA 3ORHA 5EKUA 3UJBA 4CKBA 2CMHA 3KKZA 3OCJA 5E1BA 4PIPA 1QAMA 3EPPA 3KR1A 3F4KA 4IKPA 3CJTA 2ZULA 5EMLA 4DM3A 1WG8A 5EZQA 1YZHA 5E9JA 1SQFA 1R8YA 2G72A 3UZUA 1I1NA 2XYRA 2YXEA 5DRTA 5E1MA 3FPHA 3EVZA 3M6VA 1SVUA 3GU3A 1DUSA 5K0EA 5KQRA 4HGZA 4EKIA 3SM3A 2AN4A 2CKDA 2P35A 4BLUA 5FADA 2AOTA 4OBWA 3FPGA 4IV0A 3A26A 5E1DA 1NV8A 3SSMA 1KPIA 4AUKA 2Y1WA 5HEKA 3A4TA 4JXJA 1RI4A 1NBIA 4YUXA 2PJDA 2PXXA 4CTJA 2ZBQA 1Y8CA 3U81A 5T67A 5DLYA 2AOXA 4PYQA 4E2YA 1YFLA 4HRAA 2Z6QA 2YQZA 2HWKA 3KPYA 3PB3A 3DR5A 3KQMA 5GP1A 5K0CA 2WA2A 3VC2A 8MHTA 5E1OA 3HTXA 1N7JA 2OB1A 3TKYA 1L3IA 3GXOA 4DMGA 1XTPA 5HFJA 3FPJA 1EIZA 3EVGA 5DXAA 3ANXA 3FYCA 3G8BA 4ER5A 5BW5A 4UOEA 2KW5A 2ONYA 5LR6A 3LCVB 5E9WA 4GOOD 4M36A 5F2KA 3UFBA 2XBMA 3FTEA 4FS8A 3CGGA 4DF3A 2HR1A 2VDUE 4MIKA 4RX1A 1L9KA 2FRXA 1VE3A 3LL7A 3KQTA 2ZIFA 1JQDA 1IY9A 3M33A 2P3QA 1R6AA 3EGEA 4OQEA 1RI1A 5FULA 4GQBA 4P7KA 4PYLA 2PT6A 5EOVA 5H02A 4KIGA 5K0FA 3T0IA 4RTRA 4L7VA 2B9EA 2B25A 2BR5A 1NW8A 2GA9A 3JWHA 5M5BA 1NW5A 3IEIA 4IWNA 3M4XA 1ZHFA 3P9CA 1JSXA 2CWWA 3BT7A 1XJ5A 2OO3A 3HP7A 4E2XA 1RJGA 9MHTA 2OKCA 4E30A 2Z6UA 2JH9A 4V0RA 3DUWA 2YXLA 1AF7A 5DM1A 4PYJA 3G2QA 4RVDA 1X1AA 5BP7A 3CVOA 4X41A 2Y1XA 4CWAA 3GRUA 3NWEA 3CCFA 2P40A 1EJ6A 1FPQA 2G70A 2GS9A 4QQNA 3OFKA 2AZTA 3TFWA 1RI5A 3B3FA 2P3LA 3EVEA 5BW4A 2ZIEA 1WS6A 3EGVA 1PJZA 2EJUA 2HMYB 3BZBA 3I53A 3AJDA 1KXZA 3KR9A 3T7TA 4ER3A 4RSRA 5C0OE 3HEMA 3VC1A 1AQIA 3QV2A 3T7SA 2I6GA 5CVEA 5BXYA 3GRVA 5EIWA 3SR4A 4RTOA 4EVIA 4E32A 5DX1A 3DP7A 4FT2A 3TOSA 5FQNA 3LPMA 2I7CA 3FZGA 2PSSA 1XDSA 3FRIA 4XCXA 1VP3A 2XVAA 4U7PB 4RTKA 5HILA 2PV0A 3M6XA 4LECA 4RWZA 4X63A 2V74B 4GOLD 2AOUA 2ADMA 3PLAE 5DX0A 2ZLBA 1NW3A 5DTRA 1SKMA 3P8ZA 1H1DA 1RI3A 1ZGJA 3WSTA 3PTAA 2O07A 3DXXA 3HVIA 5EGSA 4C03A 3EVAA 3MQ2A 4BP3A 1QZZA 5K0JA 2G8NA 2ZSUA 3P2IA 1ZKDA 3DLIA 2P7HA 3C6KA 4FT4A 4HH4A 2JHPA 3JWGA 3RIEA 1TPYA 3G2MA 5E2AA 3P2KA 3FTFA 2Q41A 3TQSA 1EG2A 2DPMA 3G2OA 3GDHA 5EQJB 4E31A 3TM4A 2IDKA 1SG9A 5F2OA 5HOQA 2NXCA 2JHAA 2FPOA 4PWYA 3NTVA 3I5UA 2ZW9A 4WVLA 4KIFA 1NV9A 1DCTA 1KPHA 3RW9A 5EPEA 5K03A 2P7IA 4DZRA 4MWZA 3OE4A 1VQ1A 3LBYA 3DXYA 1QYRA 3ID6C 4G56A 3SMQA 3T7RA 1FJXA 1HMYA 1P1CA 5CIYA 5LQRA 4RTJA 1JG4A 2HTEA 5EIFA 3ER8A 3OU7A 4PIMA 4F86A 3S68A 1I9GA 2QRVA 2FK8A 3E23A 2K4MA 1NW6A 5FHQA 4B17A 1G8SA 2PKWA 2PX8A 4R6WA 1X1CA 1RI2A 4QVKA 2OXTA 4CTKA 5K0GA 3KQSA 2OZVA 5HIJA 4PYOA 5HZMA 3C0KA 4WXHA 5FA8A 3V8VA 2P8JA 4GUAA 2BM8A 3CBGA 3O4FA 4O29A 5CVVA 3TRKA 4PNEA 1RJEA 5GWXA 2PXCA 3SVZA 1JQ3A 2ZZNA 2NNWB 1KYZA 3BGVA 2ZBRA 4PYMA 5DPMA 5LQCA 2NP6A 1QAOA 3KPVA 4GC9A 3KPWA 4OBXA 3PS9A 3LCCA 3KQYA 2HV9A 1Q0SA 3FPFA 1JTFA 3C3YA 4YV2A 2AOUB 4RTQA 2PLWA 3PFGA 1JTEA 2O0LA 4MQ4A 2IH2A 4MTLA 2BR4A 3HCFA 3MAGA 2NXEA 4DQ0A 5ICEA 3NVKI 1G38A 2JHCA 2AN3A 3RODA 5GINE 5K0LA 4CKCA 2BZGA 4IV8A 5FWAA 2PGXA 5CM2Z 3FTDA 4E33A 1D2HA 2G71A 2WA1A 3I64A 3BWYA 3BXOA 3OE5A 3REOA 3NDIA 4X1OA 5HIMA 3TPZA 3UJDA 1WXWA 1WXXA 1EQAA 3FUXA 4X60A 1SUIA 3DH0A 1MJFA 2P3OA 3LDGA 4R05A 4A6DA 3FUTA 3IYLW 1VPTA 3BUSA 2NXJA 5EMKA 1XVAA 3BKXA 3PX2A 5DM0A 2JG3A 1FBNA 4BP1A 3A25A 2VP3A 2H00A 2GLUA 4EMSA 2GPYA 1SQGA 5DSXA 4DCMA 5K09A 4HG2A 3LKDA 2VDVE 5DWQA 4QQKA 5DSTA 4C06A 3TR6A 3MHTA 3DTNA 1P39A 2UZ4A 1VP9A 3A7DA 2QYOA 3KQOA 4GC5A 3UJCA 2GB4A 4GF5A 4ISCA 3OU2A 1U2ZA 3UA4A 3HA5A 4PGGA 2ORED 2H11A 5IH3A 4P58A 2PBFA 1XDZA 1KP9A 2EFJA 3LX6A 5K0NA 4HGYA 4AZSA 4DA4A 5CVDA 5FTWA 3X0DA 4CKEA 3GRYA 2XYVA 4YUWA 3MERA 4QDKA 4R8RA 1TW2A 5JUWA 5LQAA 1NT2A 2O05A 3G89A 3M6WA 2IBTA 3ME5A 3KPJA 4BLVA 1ZGAA 3UJ8A 4PYKA 5EZSA 3M70A 1O9GA 3VSEA 3D2LA 1R00A 2PVCA 3MTIA 4EQZA 2NXNA 3BGIA 1M0EA 5DM4A 1WZNA 3HCAA 3GRZA 4FSDA 4QVGA 3A27A 3FPEA 3EEOA 3LBFA 1BOOA 2PXAA 3HCEA 2ZZMA 3JWJA 1VIDA 2ZIGA 1YB2A 3SSOA 5KYGA 3OZRA 3B5IA 4Y2HA 3B3JA 3UJ7A 2F8LA 3G5LA 5T6BA 1G55A 4PCLA 5EVJA 4FP9A 3FRHA 1N7IA 2EG5A 5E2BA 4PGHA 1FP1D 4DKJA 4RYLA 2CMGA 2BR3A 5K05A 5GOZA 2FHPA 4KWCA 3E8SA 3UJAA 4C07A 2C7PA 1UFKA 4P7FA 2O57A 2XYQA 3C3PA 1UWVA 3HVKA 3ER9A 3EMDA 1X1BA 2IH5A 3L8DA 4C05A 4QTTB 1ORIA 3R0QA 3G5TA 3E7PA 5GM1A 4QDJA 1KIAA 2C7QA 4OA8A 3I58A 3G8AA 1G6Q1 3DMGA 1V39A 3NWBA 1INLA 1NE2A 3FUVA 5GIPE 1B42A 2FK7A 1TW3A 5D1NA 5ICFA 5C9ZA 2UYOA 3EVFA 4Y30A 2R6ZA 4AZVA 2O06A 2GAFA 4OX9Y 2AOVA 3CJQA 3DXZA 5FQOA 1R74A 3ELUA 3FYDA 2OYRA 4OA5A 1YFJA 1VL5A 4M7RA 3SX0A 2AR0A 5KQSA 3EVDA 4PONA 5EEGA 5U4XA 2UYCA 1G60A 1Z3CA 2YVLA 3THRA 1BHJA 1NKVA 3ELWA 3GRRA 1NBHA 2ONZA 4P7JA 4U7TB 2AN5A 3TKAA 1PRYA 3C6MA 5E8JA 5EHIA 1JSZA 1IM8A 2N47A 5GM2A 1UIRA 3PFHA 3NW9A 5LSAA 4YV1A 3E05A 3R3HA 2YX1A 4EKGA 5ICGA 5T64A 5IKMA 2IDJA 2V7EA 3KPUA 5E8RA 5K8VA 3CC8A 1M6YA 3P97A 1EAMA 4LWOA 3SSNA 3EVCA 4RTLA 2Z6AA 4KRGA 3FUWA 5EMJA 3ELDA 1AV6A 3AXSA 3R24A 4PYIA 2ZFUA 3VYWA 2BM9A 1FP2A 2OBFA 2UYQA 3JWIA 2GH1A 2AOWA 3PVCA 2QRVB 4R8SA 4C4AA 5LQJA 4XUEA 5F2NA 4ER0A 4BY9E 3GIWA 3HNRA 3BWBA 5FA5A 4QPPA 4FZVA 3HVHA 3EGIA 5DTQA 4YMGA 5HIKA 2IBSA 3P9KA 5DTMA 3V97A 1R8XA 2I62A 3DMHA 3LDFA 3UWPA 5EC8A 4ATNA 5EKXA 3TMAA 4H0NA 4X61A 2LD4A 4YUYA 1BKYA 3KR0A 1WY7A 5K01A 2DULA 2BH2A 4HC4A 4POOA 5DM2A 4HTFB 5JR3A 3O31A 1ZQ9A 4ZTBA 2H1RA 4RVFA 2AVDA 1AQJA 1N2XA 4EK9A 2I9KA 4DCGA 3ELYA 5CCXA 1YF3A 4YV0A 3P71T 3HA3A 1VLMA 3NDJA 4FR0A 4PYNA 4E70A 4PINA 4BLWA 1HNNA 1D2GA 3HCBA 4AZWA 1XDUA 1KYWA 3DMFA 1SUSA 3HVJA 3IV6A 3KQQA 3KQWA 3LSTA 4RVHA 4QTUB 5ERGB 3FUUA 3TLJA 2B3TA 5EEHA 4RTPA 2XVMA 1XCLA 3GJYA 2NYUA 4OQDA 1QAQA 3Q87B 3R9XB 3KR2A 1NW7A 4YUZA 2AS0A 1IXKA 1XXLA 1KR5A 5MHTA 3QOWA 2OY0A 3DOUA 5G02A 1F3LA 3BWMA 7MHTA 1P91A 1DL5A 2E5WA 2VZ9A 1BC5A 2IGTA 2PX2A 3G88A 4GOMD 4KVZA 3UA3A 4AX8A 5LQKA 2ZWAA 4F84A 2EJTA 2R3SA 3LECA 2ZBPA 2VDWA 3K6RA 3ERCA 3KU1A 4V0QA 2ZZKA 2ESRA 2YTZA 3MTEA 2JJQA 3EMBA 3H2BA 3P9IA 3CJRA 3MCTA 5K0BA 2OB2A 3DLCA 3NVMB 3A7EA 2ERCA 1OR8A 2IP2A 4HTFA 3HCCA 3TM5A 4ER7A 5LQNA 3FTCA 4NECA 5CVUA 3BGDA 2P1DA 3KHKA 1YUBA 4QPNA 3HM2A 3BKWA 1EJ0A 5KS2A 3GNLA 1QANA 4YUVA 4LG1A 3LDUA 1O9HA 2B78A 2QE6A 2C7RA 3OPNA 3O7WA 4RTMA 1JR4A 1XCJA 1P1BA 3UBTA 5FHRA 3G2PA 3LHDA 1JG3A 1KHHA 3KQPA 2PWYA 4M37A 2IH4A 4MHTA 5FWDA 4AZTA 4KDCA 4RVGA 5D1HA 2IPXA 2PX4A 2YXDA 3EVBA 3MGGA 4FGZA 2UYHA 3GO4A 2AOTB 3GGDA 3OU6A 3P9NA 4F85A 3AWIA 3CKKA 3R6TA 4XUCA 5E9QA 5CCBA 1O54A 4RTNA 2OPBA 2WK1A 5C1IA 5EHGA 1JG1A 1G8AA 3G7UA 4ER6A 1L3CA 3HCDA 4GOND 3SXJA 2G1PA 3BWCA 5FCDA 5DT2A 3THSA 4CXMA 4C04A 3IHTA 1Q0TA 5P8WA 3GWZA 5HIIA 3AY0A 5DXJA 4Z2YA 5CD1A 1RJDA 2YUIA 4HSGA 5EG5A 3B3GA 2AVNA 5GIOE 3OZTA 1ORHA 4C08A 3Q7EA 3MB5A 3GCZA 2B2CA 4GEKA 2YR0A 4P7GA 2JH8A 2FYTA 4GBED 4M38A 5DX8A 2P41A 3HA7A 4LWPA 2ZWVA 3DULA 5FUBA 5DRYA 1I4WA 3LGAA 5EMMA 4E2WA 2C7OA 2PT9A 4XUDA 3NMUF 1X19A 2CL5A 2ZTHA 3K0BA 4KW7A 2QM3A 1D2CA 2PX5A 1RJFA
chains in the Genus database with same CATH superfamily
4GLFA 4LOAA 4ACAA 1C5KA 1T2FA 4X6YA 1GTJ1 4HPWA 1L4YA 3K4PA 1VBFA 2QYHA 5IJZA 2QTWB 2F3PA 3SGLA 1QG0A 2VDQB 2E4UA 5HCNA 2IIPA 1TEHA 1ODSA 4MQUA 3TW4A 4R4JA 1E2KA 2P2GA 3O8QB 5DASA 3I5AA 4G5HA 1ESEA 3I6MA 3C3EA 3K8YA 3LG2A 3LBHA 3TQRA 3G0BA 5YASA 4K81B 2QZJA 2VP4A 3B6EA 3BMNB 4FE3A 2ZCUA 4O4JA 3MGCA 1OX5A 3VX3A 4YAIA 3A9VA 1EX1A 1CVIA 2D8MA 3F6RA 3JWPA 4LI3X 4YT2A 5JW6A 4JP8A 3AF5A 5ETJA 5B7GA 1TJ5A 4GZ6A 3R3YA 4FC7A 2JI4A 4G0ZA 2QX8A 4EELA 5KJEA 3QJGA 4WL0A 4A8HA 4F38A 1V11A 1FNDA 5AW3A 3CLRC 3OP4A 5K0EA 3HR4A 3HB0A 4HGZA 3SG0A 1RR6A 2FPIB 4H7DA 3E3NA 3ODGA 3QFFA 4W5JA 3WIDA 2ZJFA 5CLIA 4K3UA 1DIBA 3EZNA 3F74A 1Y6JA 4BBZA 4DPKA 1AV7A 3I8OA 3LQRA 1GKYA 4DLSA 4OGKA 4YUXA 2VPXA 4PGMA 2GM4A 4OFWA 1ZIYA 3OEHA 5GJCA 2C2GA 4OY3A 2BKVA 2PJUA 4QXQA 3QVMA 1BVRA 5T67A 3SX2A 3VTAA 4YXWA 1XZKA 1SVIA 2Y4OA 5KKCA 1PUIA 1SAYA 1N5MA 1U3DA 1YR2A 3STXA 4DLWA 3ITNA 4CF5A 1FTWA 4BFCA 5GP1A 3WMEA 4EO4A 2BYTA 3BL5A 1M2OA 1PFUA 2H07A 4B33A 4BFLA 3KWFA 3GB9A 1E4EA 1FQJA 3PF8A 4PZLA 4MRNA 1NXXA 3PIRA 4P3KA 2Z4SA 2R48A 4RORA 5H7XA 4EHBA 4RNCA 2JL1A 1EK6A 4I8XA 4LVOA 2ONYA 1EXMA 4EF6A 5E9WA 2REXB 2WWVD 4YYEA 2D59A 4HWTA 1HNXB 3OZWA 4LC1A 2Z2IA 1IJFA 2D1RA 3QXXA 2HR1A 2E6KA 1Q3HA 2GUGA 3FWZA 3ZDXB 3W04A 5BVGB 4EI9A 4QNMA 4EKEA 4TUYA 3WVNA 3PWSA 2LIVA 2A1UA 3OTGA 2DP4E 4FD2A 4Q02A 3RUAA 2AT1A 3TZCA 4IMJB 1FRQA 2XUZA 3QNMA 2C57A 2JLUA 4WH0A 4XPZA 4DARA 3G2HA 1U7WA 1PW7A 4G1CA 3R3ZA 2XY4A 1FFHA 2HWWA 5DGCA 4I5EA 2QV7A 4YWJA 1IEWA 1I3CA 4BPRA 5HFNA 5CXUA 4K05A 5I7OA 5K0SA 3K7EA 3GBVA 1NC1A 1T9AA 2YZNA 3AIOA 1V45E 1D2NA 2MMGA 3LT1A 1Z5WA 4UBOA 5EN4A 2BL4A 4NCAA 3G3EA 4ZVQA 1GD1O 3OQMA 4XIFA 3T4UA 1UEJA 3JQBA 4FYIA 5F7JA 3CE6A 2YCBA 2WTXA 1JJBA 5U9CA 3EGVA 1PJZA 3I53A 3LYUA 4LDQA 2G1PA 2EEZA 2HWXA 4RSRA 4AP9A 4IKEA 3DD5A 2DUUA 1AQIA 3VC1A 4RIHA 3DF7A 5JNSA 1VSUA 3QV2A 1T9HA 3RRYA 1SBZA 1KU6A 4KGDA 3SR4A 3T1HB 1F4PA 3P9PA 5LDDC 5IT9A 4DV4B 4TRRA 2EFCB 2I80A 1LVHA 4PX9A 1N8SA 4BJ1A 2HJVA 4HGRA 1U7OA 2W2NA 1JHRA 5H4GA 4DR1B 4Q7MB 4JUFA 4OK6A 1KDTA 3N8NA 2PZJA 2VHZA 4YYZA 2ZI4A 4I2VA 2G3YA 2V74B 3T7CA 3TOXA 4JOQA 5JXWA 1JJVA 1K63A 1U31A 4EBFA 4HUQB 4XX0A 1NXVA 3BFXA 3VI3B 3KJNA 2LUOA 4YJ3A 4C03A 1JQKA 3N86A 2OHGA 3QA3E 1M1NA 2JGMA 4QQ8A 2XNKA 5J2TF 4TOIA 2J9GA 1Z0UA 3O2SB 3WO0A 1JDNA 4HDCA 4OHWA 4UULA 2MU1A 5HKKD 4MCIA 3T1OA 2XGMA 3FMIA 4YQZA 3ZV4A 2YKGA 4AD8A 4DJEC 2NZWA 2QSUA 1MGPA 3NBAA 4Z7OB 1HRKA 3E8MA 3GAAA 1WZUA 4RF4A 1KDVA 5HMLA 4MEBA 5KC9A 4L85A 2JLXA 3PGMA 3PFNA 5TQJA 3AY7A 1S2DA 3ZX5A 5JXGA 1XNRB 2Z2JA 2L42A 4E2WA 2OK7A 2CVQA 4MR7B 5F5LA 5BUSA 5HTOA 2PZLA 4DNXA 3DXYA 2DKFA 2GFQA 3H5IA 2PUFA 1FS6A 5AI9A 2LCQA 2H5EA 5LQRA 1RLIA 4B2IA 2WDPA 3E9MA 4O5OA 5AKIA 5JU6A 4UMVA 3E23A 2QT0A 2GJSA 1XRRA 2JI6A 3FUCA 1DQZA 5ALIA 1XTTA 5F64A 1MPXA 3GJ4A 3K5PA 5HZMA 1YQEA 5JDIC 3EZXA 5IC6A 1WP4A 1GL9B 1EXWA 4IIXA 2J67A 4D3FA 1WZ2A 1W36B 1CTQA 3GT0A 3K96A 4MIOA 4CMEA 4U0KA 5B4VA 2BEWB 3VKHA 4X7BA 4IH1A 4NJMA 2EKDA 5IVHA 3LC7O 3BJRA 4FFBA 1CQPA 2WR8A 1PQUA 3IQDB 1X13A 3LCCA 1FYDA 4OL0A 1WOMA 2P9GA 4R9UC 3MJVA 4EVQA 4MAFA 4YV2A 1ZS9A 2PLWA 4ZZIA 1WXDA 4MQ4A 1ZC4A 5D01A 4LOHA 1Z9BA 4IHJA 3LJKA 4X20B 1E9FA 3T4PA 5KBYA 4IXMA 3P52A 4TSFA 4E15A 1TZCA 4NBSA 1AQUA 2XWQA 4J0GA 1A7AA 5KB3A 4R9NA 1C1HA 5CHEA 1T1JA 4WZAB 1Y8AA 4JDPA 5EIXA 2R7LA 3TPZA 2HBRA 1LPBB 2JRLA 1KSJA 5HIMA 4JGGA 3RYIA 3W06A 1M73E 4MROA 5SYNA 1L8OA 1RBMA 2D4HA 3TBHA 3KKMA 2EATA 1CLEA 2EGUA 1KVSA 3MJCA 4CI9A 4C0LA 2BKLA 5AKJA 3DV9A 4DIKA 3U17A 2VPYA 4XVHA 3R9KA 5FPHA 4AUEA 1FVHA 1QZUA 2QZSA 5I47A 2ZXFA 3NONA 2IYQA 1BXGA 4KO8A 4F6LA 4MV8A 4W5TA 5EWJB 2V6GA 1Q19A 2ACWA 4YP9A 3O1JC 2HB6A 1N6PA 3E4DA 3L7LA 2H6EA 4KFRA 2XKJE 3I37X 2QMYA 3C7AA 4LN1A 1SURA 4O1HA 3CMCO 1Q11A 1YZUA 1U2ZA 3UA4A 3L6CA 3N2IA 2GNPA 3U16A 3H9JA 2GD0A 1XDZA 4ND4A 3U7IA 3WO1A 2BGRA 2OV2A 3B38A 3MEQA 4PF1A 4ZVRA 4AMVA 4KQCA 4HAUA 1YONA 3WLNA 3OHSX 3AVXA 2QSYA 2MYUA 2TMKA 4QSHA 2P0EA 4EHDA 2FN9A 4I4TB 4M98A 1JHDA 2B4KA 2H2IA 2WUFA 3GDWA 3LT2A 1P7PA 5CB4B 3I9V6 3Q3GE 1H8ED 4PCUA 3PPVA 2GF0A 2C7VA 4HDAA 3F9RA 3CXUA 3EW9A 3WK8A 4R1PA 1O57A 3CINA 3G17A 2XKBA 3ZU2A 2YBDA 1XEWX 3QYPA 4F5YA 5KYYA 3UC5A 2ZIGA 3RUHA 3S70A 3X1KA 1X7XB 2VKQA 2NO5A 4XJVA 3FHJA 3OZDA 5LD2C 1NRXA 2WIJA 4PCLA 5FUXA 4S12A 3R5XA 3VO2A 3JALB 5K3EA 2EG5A 4UDYX 5KTPA 5DT9A 3ZD6A 4L4RA 4Q1EA 4TL6A 4ZHQF 2CFIA 1HT2E 1ZA1A 5JMWA 4OLHA 3RAFC 1UFKA 2B5OA 5BNWA 5L40A 3PF9A 1Q6ZA 2JGLA 3COPA 3UCEA 1HFWA 2FR1A 3QHQA 4RAQA 2PKQP 1K7SN 5DE3A 4ENWA 1XVLA 4FK8A 2YFQA 1G42A 1RKXA 2ZRHA 5DO9A 3R9WA 3COWA 4V39A 1GSAA 2QTVA 4LMRA 4EFDA 1NIJA 4EGQA 2O4UX 4IG4A 4Y1RA 3MWDB 3DZHA 2AXPA 1R0KA 1NQOA 1X1RA 5F7ZA 3W2IA 3ENQA 4YRMA 1R8JA 3HJTA 3AVPA 4RV5A 3HV0A 1GZHB 3I6IA 2IIBA 3SNHA 3ZWDA 2GBLC 1NVEA 3ELUA 2VK4A 5HGXA 1IZYA 1E5LA 1FMCA 5K6AC 3RJ9A 1C4KA 2DFPA 3IP3A 4XW2A 1JSRA 2IE8A 2L69A 2BIFA 3WWCA 1TLTA 2I8AA 4Y2QA 4PFQA 5F9MA 3RSFA 3WSWA 1QIDA 1DWOA 2XW6A 2ATVA 1B8OA 1RP7A 2IYNA 3PFHA 3Q12A 4YALA 4ZDWA 4QEDA 4ZO9A 1V95A 3IQZA 3E05A 1JWAB 3NB0A 3QGMA 4D02A 1QIFA 1YI1A 5KOHB 1YRAA 2JA2A 2OECA 5CDSA 1UXOA 2IDJA 1JJ7A 1OZHA 1FU7A 2QQFA 2IZ5A 2HCFA 2PFKA 3NJ8A 5F12A 3NUQA 4NV1A 4RF2A 3ELDA 2ZIZA 1JMYA 4TWJA 4Q4AA 2O2JA 1H2BA 4D82A 5L53A 3JWIA 5CA1A 3VNSA 1WPXA 4JROA 3TW8A 1NJ8A 4BY9E 5F2NA 5FA5A 4AMZA 3UAWA 1L8LA 3INNA 3WYCA 2W6JD 2Q45A 3WL4A 5E6UB 2A1IA 5B58C 5BSEA 4UHHA 4HNUA 3JQQA 3N0VA 4CDRA 1YIDA 2GAIA 1CUXA 4DLVA 5BN3B 4B3HA 1ZFNA 3TUJC 4H0NA 4YP0A 4BQRA 4ARCA 2OESA 3T9EA 4EIWA 2YYAA 2CCJA 2JFWA 2WNSA 5C4GB 3AEUA 5TDHA 3TMKA 4EX6A 4TXJA 5FAKA 3ZVKA 4B4WA 1H9BA 2ECKA 4BVFA 2VDPB 1ZQ9A 4CM7A 2XMQA 3B2NA 3KB1A 1C30A 1AQJA 4B87A 1UL1X 2AE1A 1YASA 1N7HA 1EVJA 1ORRA 1ISIA 2WF6A 4D46A 4B3RB 5HQ3A 1H3NA 1X77A 3A1VA 3ITDA 1BKDR 5FTKA 1A7JA 1F20A 4E7PA 1GFSA 3B7GA 3BB1A 1P2BA 4JLAA 5AM5A 3ISTA 5AI8A 2G17A 3OTWA 5DLEA 3FGOA 5TQVA 4KAJA 3HVJA 4P4NA 4TV9A 4KE6A 4V0LA 4X3CA 3FUUA 1A97A 4RKQA 2HQSA 1N5LA 1XD8A 3H4MA 1R1DA 4M88A 2J3EA 4S0ZA 4TMKA 4BFVA 4EFNA 4OFBA 1ISSA 1HLFA 2B6HA 4AFNA 1P81A 1Y7HA 3LZDA 3PQ4A 4PM4A 4C7XA 4BGUA 2A1TS 3AR2A 3PSAA 2PMWB 2HF7A 1QVWA 2NVUA 2Q4DA 3EQ2A 3IURA 3JPYA 4ZOAA 2PMEA 4AX8A 4BNGA 4D9KA 3FSGD 2XADA 3ERCA 2ZBPA 2PN1A 5HR5A 4KGVA 1W2HA 2NU7A 2PL5A 3IIMA 2WD9A 3WOVA 3P9IA 4G8CA 4MRSA 4AS2A 1OJ7A 4L5BA 6ABPA 1KJIA 1MAVA 4QBGB 1FP7A 1OR8A 3LOQA 3KOUA 4WXMA 2FX5A 3OKFA 5AIBA 1G19A 1XEAA 2LVBA 1TC1A 3ADPA 3HN2A 3EA4A 1TM1E 3ND9A 3OJOA 4OJTA 121PA 5I9BA 4B71A 1US8B 2W6QA 1EFVB 4D4HA 2QE6A 3QKSB 3ZPXA 4A16A 1OVGA 4B4UA 1Q0HA 1JR4A 3I6YA 4OP2A 3C41J 1P1BA 3ABZA 5MN6A 1LPSA 1W9HA 4MS1B 1XHFA 1XYVA 3G2PA 1RPAA 2Q9CA 4FHEA 2FRVA 3OEWA 4KYUA 4QGFA 4ZVOA 3UB3A 1QHNA 4KDCA 4F7WA 1Z35A 4GUDA 1U0LA 3ROXA 2UYHA 2HK6A 2W2TA 4ZVNA 4FGWA 4U7FA 4DM7A 1Z0KA 1HSOA 3ZE7A 1QDEA 2CL0X 1TZMA 5EFZA 4CT0A 1BWSA 3LHIA 2G77B 1MO2A 2WU4A 2IEDA 1KAOA 1OWNA 5KU1A 5FCDA 1ORDA 2D5LA 2GGSA 4UBJA 2QRHA 1UZUA 3VYTB 1XL0A 5FBVB 2GD1O 3IQHX 2QXTA 2PGJA 3V4VB 1TT7A 4NAHA 3VR3A 2EKBA 2V0NA 4CM4A 3DDUA 2B8JA 2HPVA 4BYGA 4F2DA 1XO1A 1PR2A 2XWJI 4FMDB 4M9RA 4EJ2A 1EUCA 4IG9A 4JWKA 1UQUA 1YTLA 2OVBA 3ELBA 5F4BA 3FNRA 4DLPA 1NMYA 4OKIA 4ECAA 3GCZA 2GTHA 4D9GA 4GEKA 1J56A 1NUQA 4XEHA 4R1UA 4BZZA 3CX6A 3AEQA 4TRJA 2QR5A 1J8QA 2JAQA 3HXKA 3BH0A 1RKQA 2GPSA 5KNBH 1LTKA 4FQ5A 4MAAA 2YWEA 2DG2A 1R0YA 2YFKA 2CL5A 3TIIA 2Q5QA 3G2NA 1ZSVA 3PIIA 4JYAB 4HEQA 2RGXA 1D2CA 2N46A 3G7SA 3ZEIA 2GA8A 4MR9B 3I8SA 1TYAE 4PRKA 2Q8PA 2Q7OE 3EEYA 3EH2A 4X5OA 1FU4A 1AF4A 3JARA 3OJXA 1TPZA 5EKDA 5G1OA 4W8GA 5C5DA 3TK1A 1DUIA 3PXXA 2ECQA 2OOKA 3R7NA 2C9OA 1Y8ZA 3GYBA 3C3DA 3PC8A 1LFAA 4BFXA 4NH4A 4JI4B 1VG0B 3GN1A 4C4PA 4F9FA 1KY3A 3IR5A 1KZ6A 2RSLA 4A10A 3DSRA 5FPKA 3G2IA 3TTVA 4K9NA 3W5IA 4A0HA 3NVDA 3KJQA 1UQTA 3F1KA 2QN1A 2YUTA 1U0TA 2Z2XA 3D4BA 5EMLA 1F60A 4GD3Q 4HQOA 4TWAA 3JQ7A 2B5VA 4IIJF 5IT5A 1MB4A 4Q3BA 5H3CA 4YPOA 3AB3A 2F1KA 4MV6A 4RSHA 5LMUB 5DRTA 5E1MA 4GT1A 5F5NA 2DPYA 5F78A 4HJXA 5JMTA 5KVCA 4HH1A 1WKCA 1N3YA 3O4JA 1DNPA 4PQFA 3WS7A 2CHVA 1KP2A 4J90A 1FMJA 4RK6A 3EZGA 4B3TB 1IN8A 4TKUB 3T7JA 521PA 5MDHA 4XZ3A 1H1LA 5FBZA 3G8CA 1YUNA 3I34X 2X1VA 3NRBA 3EK2A 2PJDA 2AK3A 4F3RA 4HPXB 3ROGA 5IS2A 1BHSA 1VDMA 3JR7A 1L7DA 1ZNZA 2H0QA 3K0FA 1KEVA 3E6AA 3QU7A 3PB3A 1F2TA 4HNHA 5BMVB 2I99A 8MHTA 2ZYIA 3UWOA 2Y1LA 2QD5A 2JGAA 3U3DA 2E3JA 1MOZA 4E3ZA 1F8YA 4I1OA 3UMMA 3IR7A 2C8VA 3IAXA 3G02A 2M2IA 2UUPA 3B20A 3TI9A 3I23A 4ZTZB 4O4HA 1PJAA 3NHMA 3HU5A 3IUQA 2BGWA 4BATA 1UZAA 1IXSB 4Y2UA 3IE1A 4EPVA 1UDAA 4JR1A 4PLCA 2DWPA 1ZO8A 4KJXA 2RH4A 4OUDB 1NYTA 2Q5FA 3BC1A 5BV2P 4MV7A 1G2QA 4GGMX 1KI8A 3N3BC 3HU1A 5K0FA 4HAVA 1DWQA 3M81A 2J3DA 2HLDD 1J9ZA 5AK0A 1BH6A 5ALFA 2LDXA 3KETA 1A95A 1NW5A 4IWNA 5CXSA 1KAMA 2VHYA 3JYOA 5CRIA 1CUDA 3VC3A 2CXUA 4YMUA 5HKKA 1W52X 3V7UA 1DOZA 2JH9A 3CPHA 4ZRDA 2XITA 1MAWA 3KEMA 1DJLA 1MU0A 4K86A 4CKXA 3GLGA 5LJIA 1Q1EA 1DQSA 5FBWB 1DADA 5BSRA 5CT9A 1SZCA 1ZUNB 2CJWA 3JARB 2HM7A 1ZUIA 2BBOA 3EGOA 5TEWA 5CHYA 5EAIA 1Q74A 1ZI8A 3QNWA 5HKOA 3WRXC 4ERNA 1ZINA 1VJ5A 3F96A 4MR9A 2NPOA 5JFOA 1GGKA 1WS6A 5AM2A 2HMYB 3T7TA 3FOAA 1GKIA 3OPVA 3CZ9A 4OCZA 1B6RA 3TTYA 2JEOA 3W2GA 4MO2A 2O23A 4HUJA 1KSFX 1FFXB 2DSTA 3VU9B 4HF7A 2VUTA 4M8LA 1IUOA 3RDPA 4EP1A 2HIMA 2G40A 2AFIE 3TDKA 5LQDA 3WA7A 2NO9A 2I65A 5E6RA 5LNK1 3SLRA 1GAXA 5J63A 1NG1A 3R3WA 4PSAA 1FRFS 2G8LA 4Q1DA 4UDXX 1QJCA 1J9GA 1W5SA 3FNGA 1L5LA 4P4UA 4E21A 1VE5A 3FRIA 4IP0A 1QO7A 2HQRA 4BX3A 2XDQB 5D8DA 1Z4MA 2A33A 4Z6KA 3PXAA 1T4MA 3DMYA 1E3DA 1CU1A 4G5SA 1ZITA 3QPVA 5DTRA 2I54A 4RANA 3GZ4A 1NI4A 3FVQA 5ESRA 5K8CA 1KWKA 4AS1A 1SUBA 3OLVA 1LBHA 5A7GA 3HVIA 3DXXA 1TNDA 1DBRA 4P6VF 1S3FA 1U8XX 2C3MA 4OSEA 4Q24A 1QF9A 3MQ2A 2QR2A 4U9HS 1ZKDA 2FFHA 3DE2X 4BLTA 2Y1EA 4HEJA 2C95A 1FDVA 1EWKA 2ON6A 1SVNA 3MUNA 2HK7A 2RGGA 2FEXA 2YHBA 5EYPA 4ZJUA 1V4VA 1S3GA 2CK3D 2VK2A 3GH3A 3FNEA 3AF2A 3MWYW 4H3HB 4KCGA 3CZ4A 2FPOA 2I29A 4BO1A 2EF1A 2FXVA 1YA4A 4A2CA 2OMKA 4QGBA 1YKGA 1K5HA 1CJCA 3DEZA 3NS7A 2GN1A 1MP0A 3LV8A 4E11A 4MUGA 1NTOA 3BIOA 1V37A 1QYRA 3T4XA 3ZIAD 3EG5A 5DDIP 4DN6A 1Q7BA 1IU9A 4XM0A 3IIIA 3B1WA 4DYDA 2XBUA 2QRVA 4ZAVA 4IOLA 1IAQA 4RL4A 2ARKA 3FHOA 3KOOA 5EHQA 2G36A 3DT6A 4G23A 3BVPA 4IRUB 4N3BA 4XOUA 2CEAA 1N2CE 4REQA 2JKYA 1C7EA 1G4UR 3CBQA 3NWOA 4DWOA 5CVVA 1HDIA 1M34B 4UHEA 4URWR 3SVZA 1AQ6A 1D03A 1K9VF 1UK7A 3HG7A 4K28A 4TL9A 3EZYA 1SOUA 4KR3A 1G21E 3UV3A 4K2HA 1RBQA 4GC9A 1Q7EA 2XQVA 4RDIA 5ELMA 1WVIA 4BO8A 4EBBA 4EW6A 3EPJA 3ETLA 1EAYA 4PHCA 3TTTA 5CB4F 5EE0A 4AZ3A 3L02A 4LRSB 2FPPB 3QVGB 1Z5GA 3JRWA 4W4TA 3VR5H 5BSKA 1KY5A 1EMDA 1CZUA 5LP6A 2ZBEA 5ELLA 3U4DA 4XH9B 3BCHA 8OHMA 4MTLA 1V3VA 4TV9B 3M9LA 3L8YA 3QEKA 1EHIA 1CDZA 2HEIA 3VVLA 2A4KA 4CEIA 4RA6A 2BZGA 3V4OA 3U3XA 2VT2A 5C1PA 4ZAFA 3GUHA 3NHYA 1M0EA 1AOXA 1QO0D 2IYXA 3H2SA 1TVCA 3Q8XB 4G85A 4LA4A 4Z8XA 5G0TA 1YA6A 2BFNA 1KZ4A 5F7OA 3FVVA 1NW4A 4DILA 2A2ZA 4BFTA 4XWGA 4GOJA 2FY8A 4YDQA 2XMRA 4B7CA 1HDXA 1V8DA 4JLSA 5C1DA 2YIJA 4EITA 1GPLA 1GPYA 1M6VB 2C9YA 2HLPA 2J5KA 2PZGA 2QAGB 4CG0A 4JHXA 1NPTO 1ELOA 2RCNA 4PZAA 5H68A 4AMBA 3PX2A 5FXMA 5JCJA 1KAEA 1YDMA 2CK3A 1YVRA 1MX9A 2QX9A 2WD7A 3M83A 5IF3A 2GARA 4DCMA 1RS0A 2PUCA 2INGX 3I12A 4MMZB 3WL5A 1EXVA 2GK6A 2VDVE 1X42A 1XOIA 3ZNPA 3U62A 3AJ9A 1P39A 3GK3A 3ZV5A 3V4PB 4XASA 3CRNA 2QZ9A 3RSSA 3LZ6A 3A6LA 3P27A 5FA6A 1X8KA 1YMUA 4COKA 5LYJF 2PZBA 3CRRA 1QRAA 1W59A 4IIYA 4HDQB 4NSNA 4PSVA 4PG8A 5JYBA 5DGTA 1CQXA 3LX6A 2VT6A 2UXCB 1A7KA 2GVDC 4MV1A 1ZU4A 3CTMA 4YUWA 1K8YB 3TKLA 2GJAA 4NCXA 4I08A 1WSBA 4GVLA 5LP6F 4OQPA 1E8DA 2IQ5A 4BLVA 3EH1A 4QBKA 1MJGM 3OTHA 3IT0A 3VSEA 4ENRA 5M3BA 1Y33E 1Z08A 3SZRA 3RFVA 4MPTA 4EQZA 2NXNA 7AT1A 2G80A 5TF4A 2QENA 3QVKA 1N5OX 4D8WA 2J7PD 2MYPA 4GYKA 1L7BA 5CLQA 3DMRA 3ZY6A 2BFEA 4OXIA 2F59A 3VU3A 2VHCA 3P5BA 3GUYA 2FFAA 2WU0A 1G4AE 3HHPA 5KO2A 4R83A 2JANA 3L0DA 1FC0A 3TPFA 4F4HA 3GJSA 3CE9A 2Q6IA 2BGLA 3G1TA 4IJ6A 5E2BA 3L8ZA 4YRSA 3TQTA 3HWRA 1GKLA 4IIJB 2FHPA 4HGQA 4ZEWA 1Q95A 4QPZA 1UWVA 3KCQA 1AG9A 3H6GA 4TM7A 4MUAA 3ESDA 1VJ0A 2FLWA 2FMHA 3H11A 4LY0A 3V1TC 2C7QA 5AVYA 4KFSA 4K87A 1KARA 2ZRCA 3L84A 3JQ8B 3G8AA 3H3JA 1TDJA 1ONOA 2F90A 2GBFA 3IIEA 2CD9A 3AVOA 4S3MA 1CRPA 4Z3OA 1CERA 2RHMA 4JBXA 4TLCA 4Y18A 1MXFA 5F1KA 4EY4A 2VYND 3VPGA 4O2BB 4BVJA 1I4TD 3H6HA 1C0EA 4JI2B 4OX9Y 2XUAA 4LHWA 2DBVO 2NSDA 5D00A 2WJ4A 5F35A 1QIGA 2AR0A 2VJBA 3KDPA 621PA 4BL5A 1JIXA 1Z36A 1QJ4A 5B3JA 5GJBA 1CWUA 1LBSA 3HFGA 3IC5A 5I48A 1ZBQA 1DIGA 5EHIA 4UTPA 3EEQA 5DXFA 1JSZA 1SBYA 5KTRA 3L01A 5T4FA 3EARA 3VBCA 1J4AA 1QE3A 3M5PA 5IAOA 5BYKA 4ALNA 1FL9A 1RMTA 1W25A 3CISA 4P7BA 3H13A 2G4VA 2W2LD 4M0UA 1PNQA 3DDCA 2I0FA 4UHDA 4Q03A 4M7OA 3TQFA 4Q4CA 1GGHA 3RVRA 4YRBA 2ZFUA 3NDBB 1N6KA 3VISA 3LDHA 1Y9DA 2QQ0A 5BORA 2JLWA 3HNRA 1TIBA 1Q15A 4LJYA 4E5NA 3UGQA 5AVWA 4E5KA 3EQ9A 1XRPA 5KNCA 4OQZA 2IBSA 3QMPA 1MB9A 1N4DA 2JNWA 3V97A 2QX6A 4WESB 3U09A 4WCFA 1AX9A 5JSHA 4QOJA 4FEAA 3L7KA 4CT5A 4EX7A 2ERYA 2C97A 1ZUHA 3BWDD 1BKYA 1EWYA 1GPKA 2DULA 5BRAA 4BMSA 3JQGB 3GQVA 1NQTA 1BGVA 3SNKA 1T4CB 1G291 2BELA 2RGYA 1Z39A 4R54A 1TYDE 5GY7A 3VOAA 2MYNA 3A9RA 3B7WA 4H1VA 3WWDA 2FMIA 3I04M 2ATXA 3OPYB 1JXQA 3UWDA 4IDNA 2PIDA 2ENUA 1Q17A 3SHQA 3DEYX 1Z7GA 5BWLA 4KSBA 1AS3A 3T3PB 3EF3A 1QNFA 1Z7WA 1QGZA 1SVKA 2ZRBA 3UB4A 4GICA 1AB6A 3PHBE 3N8HA 4QJ4A 3E9ZA 2QTCA 4M9QA 1ST3A 3OO0A 5CPFA 4N1AA 4NIMA 3VXKA 4II3A 4XCQA 5BRJA 1Y9ZA 4YJDA 4NKRA 2ZWMA 3MBKA 1OVMA 3HN7A 5IBQA 5AVQA 5L4NA 3LT0A 4IFEA 4YLGA 4FFBB 1PR1A 5F9HA 3OX3A 2GLTA 3UA3A 4R51A 1HURA 2WVHA 1CJBA 2OCKA 2R3SA 4L51A 2EZ8A 3QLTA 1P18A 1FDSA 5COBA 4Z9BA 4O4LB 4DDWA 4HNVA 5JD6A 2NVBA 1CNEA 5TJ9A 4DIEA 3OQBA 2LRHA 3B1JA 5GV8A 4ZJZA 1NMXA 3G1UA 1RLJA 1OKKA 4AG5A 1NP6A 1LW7A 1NQUA 3MINB 1AK2A 4MI9A 5CVUA 4XB6B 1ZXXA 1XLVA 2I71A 3WYBA 4Q39A 2FUKA 5GQSA 1SBCA 4QATA 4A6PA 4YUVA 2W6MA 3CLTD 1IUNA 2BHRA 1M0SA 4PLVA 5ESDA 5L3QA 3DQPA 2X9NA 4Z4IA 2I55A 3GEHA 3ASZA 3NM6B 2CNWA 3MFQA 3W3AD 4WOJA 3T6KA 3SICE 2X6RA 5IPFA 3NTLA 5KTKA 4DLLA 2HXGA 3U3RA 3PDWA 3TB4A 5ALRA 5F23A 4WOCA 3M5WA 3WQHA 1M1YA 4D9NA 4YRRA 2NU6B 3HKEA 3OT1B 3RE1A 1Y6QA 2B1RA 2AOTB 1ABEA 3EXIB 3H8WA 4BXOB 3WIUA 1JHVA 1PQ4A 1ZK0A 3AM5A 2BKUA 1A8PA 2P9TA 4MQFA 2C5BA 1PAUA 3NATA 3H5LA 3VHLB 5AOAA 4X95A 4YJ3B 2CHQA 2VLIA 4PRYA 1LY1A 2QA5A 2EHJA 4W1QA 3O8NA 4D8UA 4B82A 1NYLA 4PR0A 1AUPA 2JK1A 1PP4A 3OFND 2GJ8A 1UR5A 2PKCA 3ADKA 3I6BA 5DHSA 3LHFA 2BW0A 1UPTA 2GBPA 4IOKA 2PUDA 2PRJA 1UT5A 4MVJE 2NOAA 4C0KA 3IBYA 4POAA 4N0QA 2Q4RA 3EUWA 3MB5A 1ZUD1 4NNOA 1JAHA 5PNTA 2GN2A 4A2WA 4BFZA 1F2UB 2AKYA 5GZ1A 4YJ2A 3RHZA 3JATA 1EVIA 1NATA 3WBFA 3Q2OA 4UHBA 3IKTA 1A5AB 3USCS 5JHHB 4LKRA 2O8EA 4LOJA 2B1GA 2K7FA 1SCDA 2E7ZA 1OBFO 1YZQA 1PL0A 5I7HA 2QM3A 2NPFA 1O0BA 2BUBA 5ALMA 4GLLA 1N2HA 1NQXA 1YR8A 1W8DA 1F8UA 4JR2A 3FZEA 1BRMA 1PJ2A 3EFBA 4BZWA 1MHTA 4LZZA 1HG1A 4B3BA 1O2DA 1AUVA 3VU8A 3ADCA 4DMMA 4DV6B 3VV3A 4BCCA 3TQHA 5F3WB 1DS6A 5H70A 2OORC 3UAGA 3IAUA 3K9HA 1EUYA 1CUHA 1IATA 2YWJA 4P54A 1Z4PX 4RUKA 4HHEA 4O4IF 4IEFB 1B4DA 1Y4UA 4JIGA 1NGSA 3RCBA 3GP5A 1VXRA 2BFCA 2BKEA 2OHHA 3MCZA 3ZCSA 4DQVA 1QYVA 4Z7QB 4IQ0A 1NNEA 4BAZA 2HWUA 3A3OA 3PFBA 2I22A 4HGNA 4XPIA 4BB5A 1GRQA 4DRXA 5JBQA 1OOEA 1AA6A 4QODA 2CBZA 1WG8A 3SIPA 4DR4B 3J80A 1DU4A 1U0HC 2VSFA 4TUYB 1IY8A 1ORWA 4GR5A 3HB1A 2Q8NA 1UJMA 2QN6A 4PS1A 3D7SA 5B6PA 2MCFA 3SM9A 1Z8HA 3N2LA 1LNQA 4J0KA 2O1EA 3S2GA 1QGUB 4ZOEA 3VNUA 4DSOA 1T2UA 4Q66C 3PC6A 1Q0UA 3FYUC 3FPLA 2GFHA 3A4LA 3RU2A 1SBNE 4G24A 3PNQA 4Z4GA 2X41A 1E4EB 3KJGA 1P6UA 4KIWA 1NBIA 3H5RA 2GFIA 4IH4A 1U0FA 4EG1A 3QFSA 3QU5A 1OYVA 4JQOA 2C5SA 1DV1A 3CUUA 4ZVPA 3LW8A 2C7BA 5E1OA 1IZZA 3L4JA 2WV7A 2GRJA 2VDKB 2YH2A 3O4GA 4OV6B 4PAQA 1YMVA 1JJFA 3CT4A 1XJCA 1TIKA 2C9CA 4MLCA 1W4RA 3G8BA 4LCEA 1AGRA 4WN9B 4UOEA 5JFTA 1DKLA 1M83A 4WKGA 3RRBA 3I09A 4BEJA 4CNBA 5BYAA 3ZCRA 5CXQA 4HB0A 4DF3A 4II2A 3QY9A 1ISPA 2VDUE 4GPD1 1I2DA 3NHRA 1ACMA 4X3PA 3E18A 4HLUC 2JIBA 2QZ4A 4P8RA 5FO1A 2J46A 3CKMA 2EIXA 2JEYA 4RD4A 3H3FA 2JIPA 4P7KA 5EOVA 1WUHS 4AP6A 3W79A 4JSYA 5FX2A 1C4OA 1GL3A 5KVQA 5LB4A 1CUCA 4V3CA 5IM4A 1E7QA 1ODCA 2IZ6A 5LYJA 3HUDA 3T15A 4UEQA 1E2FA 2AZMA 1CUFA 3DAGA 1GUDA 2GO1A 2YXLA 4N4AA 4F92B 3QXGA 3R6DA 4Z1MD 1J00A 4ZDJA 2Y0DA 4X41A 5DW3A 1BX1A 5KDOA 3HXMA 2AUTA 1PTKA 4CE6A 1EE9A 1FNMA 4C2UA 1JT9A 2VJCA 1KYTA 3K3PA 2DCUA 4QQNA 4AKTA 4JA2A 1ETUA 1RI5A 3KAPA 1YE3A 3LKBA 4UNNA 5MFZA 2VLBA 1XAHA 1X9IA 2BD0A 3AJDA 1KXZA 5CBPA 2D2VA 3AEYA 1X38A 4D92A 2X14A 1I3NA 4ZZ1A 3A3YA 3LUCA 2BFDA 1VE9A 4WEQA 1Y5LA 4P4TA 1FSSA 3B3QA 5L8VA 3UG6A 4E32A 3WKAA 3QWFA 4NRDA 1GR0A 4G86A 3TOSA 1XZFA 3DWEX 3STWA 3CLTC 1OCEA 4OKNA 4TS1A 2G9NA 2OGUA 2R8XA 1QHGA 3E9EA 2C2KA 3L8CA 4RLSA 2I87A 1L6IA 4KH1A 4RK7A 4OJYA 2VTVA 4B8ZA 5BOSA 4W5HA 5CDGA 1GT6A 4Q7JB 1EPUA 2C92A 1LBIA 3LUJA 2XMCA 3ISVA 4B3XA 2Q3LA 4RWZA 3ESZA 4GOLD 5K3SA 2WWGA 3OKPA 4D9FA 5E4JA 2P5YA 3ANLA 3K6SB 4QYIB 1Y9EA 4CR7A 3C4VA 4WY8A 4YPFA 4BX0A 1Y3AA 3OC0A 5SY9A 4XSGA 5B2EA 1NUSA 3IQFA 1Q20A 2XLBA 3PKJA 4OIMA 2BI8A 4FI3F 2EX0A 1E96A 2C61A 3EVAA 4MKHA 2PZ8A 4U7HA 5K0JA 3HDHA 4NZNA 1CB7A 1M8JA 2NZYA 2RHTA 1LS6A 1Z7BA 4JCCA 2ZJ6A 1P2DA 1Q92A 2E37A 4HZGA 4Y1FA 3TQSA 3OIVA 2GKSA 1IC6A 2WB4A 1ZH6A 2B7BA 3FHLA 3G9QA 3GDHA 3WGZA 2ACKA 2N42A 2RAPA 4BNJA 4FB5A 5F2OA 1GTZA 2ODQA 3L7AA 1FDWA 4MQBA 3I5UA 1YE8A 1Q2XA 2ZW9A 2ZI6A 3L77A 4IY1A 3VKGA 3T4EA 3VKFA 5IVIA 1DJNA 2OA0A 5C52B 4X65B 1JYEA 2E87A 1W6RA 1RQRA 4KXNA 3TSCA 1U2SA 4MP6A 4KFCA 5BT9A 2CXHA 2MSLA 5DGXA 4LSMA 4OXKA 4KOAA 4C7BA 3O21A 3OT4A 1ZMTA 3AB7A 4BJHB 1XCGB 1Q16A 4F86A 4AXXA 4ZYXA 3ECAA 1XQVA 3MYYA 3BWXA 3TLBA 1OV4A 1U02A 3LLCA 3W5DA 3PWZA 2OOSA 3OIGA 4RV4A 1V8ZA 5BNTA 2P8JA 5J4LA 3A6KA 2ZIUB 2JJ8A 3CUEF 1B6SA 5GJVC 2D1SA 1KYZA 4JUAA 4E4YA 2GN4A 2ZVDA 2C00A 1ZNWA 2E4AA 4DTCA 3GLIA 3PC4A 1ZRSA 4EYKA 2FW7A 2VJAA 1Z25A 3GBPA 4JP2A 4ZJPA 4MW6A 5AW2A 2O20A 3LNTA 1DEXA 3B51X 4J75A 1BOFA 3EC7A 4L3WA 1DPGA 3MT9A 5H9WA 5LMCA 3ZDCA 4YJGA 4XB1A 2O0LA 2IH2A 2PG3A 1RC8A 2FEMA 4KQWA 1FSFA 1B26A 3PYMA 3A6DA 3B1YA 3EWAA 1KMIY 5GINE 3S40A 4W1RA 2YWGA 5CM2Z 4CUJA 5KJ6A 1D2HA 1EE1A 4QXMA 3L0CA 1YDEA 2DQSA 2EQ5A 3MGAA 3HR7A 1HOXA 1ZESA 4KN9S 5AK5A 4MVJP 3EIHA 4XKJA 4M8IA 2PEYA 1ECLA 4Y6RA 1D2EA 2V97A 3F3MA 3H9EO 1MJFA 1QG6A 1S8OA 3LDGA 3PUKA 4O4HB 1I0IA 4OG2A 2P2LA 1D04A 1VPTA 3EGXB 5CLLA 1O89A 2C03A 2NXJA 4ISBA 1O77A 4XEUA 5I5GA 4QG7A 2WT8A 1HLDA 5H83A 1ZH4A 4DPMA 3PR3A 2AA3A 2PSEA 2DUMA 4JHLA 4TLEA 2G7ZA 1XK6A 3WMRA 4RENA 2WWYA 2GEJA 4XX1A 4W5QA 3MHTA 2W48A 2IHYA 4ZOQI 1M2EA 1FP4A 1TMYA 3KQOA 4UATA 1NLFA 3BMCA 4YGYA 5DYYA 4HX5A 1T5LA 4U2FA 5HF9A 4MZDA 3BCRA 4PGGA 3RRZA 2WWHA 4KAXA 4TWZA 1U8TA 1Q1NA 2RGEA 4LHXA 5DI9A 1J42A 3UTDA 1FQKA 2ACEA 3ZQJA 3QVOA 4IZIA 2QD3A 1N8KA 4HMOA 4LRUA 1J1UA 1P80A 1RXEA 4MW1A 3EDQA 1JUDA 3E7FA 3M6WA 1DTSA 1ESNA 3GV0A 4RS4A 4BE4A 1VKZA 5KYWA 3ME5A 4G37A 3WDLA 1IEQA 1ZGAA 4B79A 3L1VA 3THYB 3QEBZ 3HXQA 2R6R1 3MLAA 4WY5A 1YB4A 3JQ7B 4QU0A 5FUVA 4N7BA 3QA9A 4WDQA 2ZUSA 3C16C 1XDDA 3NFYA 4OOFA 5C51B 3LBFA 5G2OA 2KLBA 2P67A 1WB4A 4ZO6A 1BQEA 3R7DA 3SSOA 1YZVA 5BN3A 1T2DA 3DZBA 3IP7A 1V41E 3QITA 1ES9A 2BBSA 5JSKA 4EOGA 1AIPA 3WAJA 3H1TA 4W9NC 3WLJA 2CFRA 2W0MA 3DGEC 1OWOA 2O5CA 5CT4A 2BHNA 1OXUA 4LHYA 2WM3A 4HMPA 5KNLA 4XM1A 1M2NA 3MZ0A 4U9IS 1ADFA 5E4FA 3PTZA 4LYFA 5DHUA 2XYQA 5KTYA 1RYZA 5T4HA 4NG5A 2DWCA 3L8DA 4I3HA 3SS9X 1P9LA 2VUSA 4GP7A 1XZPA 4V2IA 3LXMA 1K8RA 1KBOA 3DBLB 5EIAA 4U2CA 5A05A 1XP5A 3NLLA 2R25B 4RMNA 3ZYZA 3RFCA 4B85A 5GMOA 4XSHA 4I46A 5GIPE 3E5NA 4KQ6A 5DBIA 1QCDA 3AFIA 1A04A 1PJCA 1VL0A 3AEQB 1RRMA 3SJUA 1SKAA 3MC1A 2VSQA 1A9RA 1KNXA 1OHHA 1RLTA 1WW8A 3MCVA 1C1DB 1VL5A 4L4UA 3AUKA 2P11A 2ROQA 2X4DA 3CX4A 4YA6A 3V4ZA 1ODTC 4NCKA 3EEOA 3QUTA 4N0DA 2COUA 3O91A 3ZWWA 1ESMA 5E8JA 1UJ5A 3KSAC 4OKSA 5DVZA 3HS3A 1JAIA 2P2CA 2JGIA 2Y76A 2Q0XA 3OWOA 5DFAA 5B64A 5HJ7A 1TQ2A 2E5LB 3BGOS 4G9EA 1FFDA 1NQAO 4RQAA 1USGA 2AUNA 3K8ZA 3FLMA 3UIEA 4CMJA 2XWSA 2AGVA 1AZWA 1XBTA 3R5JA 3RVKA 2GAJA 2V03A 1ZYUA 3FUWA 4BTLA 3EX7C 4QUKA 4OGLA 3W6NA 3R24A 4GFDA 2BMVA 1CUYA 1SKYB 2MIIA 1HQYE 1SXJE 2XE4A 2HQOA 2Y6UA 4HZUB 1JSLA 1FXUA 2CE2X 4QPPA 3UF0A 4MS1A 4JGIA 1MT0A 4NLLA 1PK8A 4NMMA 1U8UA 2Q2OA 1IULA 2QTHA 3DCIA 3EGIA 1X7YB 5FNVB 1JR3E 3F3SA 2W37A 3EUFA 1B8PA 3VYVA 4QWWA 1FUUA 1C7JA 4IDCA 4Q18A 4E5SA 1DKOA 2BI7A 2DLDA 3IGFA 5FOVA 1IH8A 5EKXA 3MINA 1JLSA 1ZK4A 2D5AA 4XB2A 1E58A 1WY7A 2R65A 4M83A 2I6QA 2ZRAA 2AE2A 4Z4EA 1D6MA 3K5IA 3D0OA 2Z8XA 2Y8EA 4U7JA 1S2IA 1LRJA 3N70A 2YNMC 3BXPA 5SZJA 5K20A 1UXKA 2HW8A 3H9QA 3SBDA 1IRXA 3MCWA 2YW9A 1P5HA 1YOVB 3B5EA 1C7ZA 1LPNA 3GPCA 4UUNA 3NGXA 1UAYA 2FHSA 3T9AA 3N58A 1XV5A 3SMVA 3PJFA 1MB2A 2BJHA 4O33A 3HFJA 1XJ0A 1ZMRA 3MXOA 2R5WA 3HJGA 1FPMA 2JB9A 4IF6A 3UMYA 2IT1A 4K9LA 4B8YA 3CZRA 3K0AA 2Q3CA 5LUAA 5JCOA 1TRKA 3K9GA 3Q8LA 4CGZA 4RU1A 5BV1A 2I3AA 2OLKA 1ETHA 4D4JA 1E9DA 1ZUWA 5BPFA 3C15C 1KKLA 2Z3WA 3UMCA 1KAQA 3JAKA 4H4CA 5GV7A 4ZC8A 3IV7A 2OCPA 4CLHA 2ASVA 5F5XA 1RABA 2JJQA 2G88A 4J3NA 5CBPB 4OU5A 4W7SA 2NIPA 1B15A 4HSEA 2Z95A 1YQDA 2NV2B 2LPMA 4MJLA 1ZRNA 2GJ9A 3DVQX 1MZPA 1U3WA 4URHA 3AF0A 3ZE1B 1H4TA 4B09A 4LXHA 1C1XB 1Z5ZA 4UAUA 5KSPA 1CPYA 3WYFA 4BQPA 1ISGA 1KJWA 3AOEA 5K7SA 4GSLA 4X6XA 3M1AA 4F4CA 1XCJA 3OESA 5C7IO 1B41A 4NV0A 5FHRA 1AC5A 1XU7A 1R9MA 2YC4C 3ROTA 2HWYA 1J8DA 1ZH0A 3A6FA 3QLVC 1K6JA 2OYSA 2Z8YM 3R0XA 1FX0A 3UG7A 1U99A 2PX4A 4BGIA 5KAPA 1MC8A 1VL6A 4DIOA 4EMUA 1E3EA 5EJ9A 4TZ6A 3KC2A 5SYMA 4XQ0A 4RTNA 3Q5DA 4BFSA 2IZ1A 2NXWA 3D3NA 5GADl 4S24A 1NMQA 5E3HA 1JTVA 2WP8J 1G8AA 3GYGA 3KIPA 5C31A 5SZIA 4EFLA 1CR6A 5ALNA 4B40A 3UV6A 2OO5C 2YJNA 2QRMA 2VQSA 4OHYA 1N2SA 4JUBA 2PUEA 1G8FA 1RKUA 1XLWA 3OTQA 3VPAA 3IHTA 2I3ZA 1GLGA 1ULBA 1DOHA 4Q4JB 2P2NA 5AXCA 4CV3A 5C7OO 5JARA 1N5JA 1DB3A 1NSTA 1NXSA 3RC9A 4JC0A 2HMWA 2NU8B 1FTYA 3UNXA 4XVUA 4RIFA 2ZS9A 2FUCA 3Q15C 4JLUA 1DX9A 2EAUA 2O2XA 2QLMA 3PNKA 2VF2A 1N0IA 2K7ZA 1GU7A 3M6IA 1SK9A 1ZW1A 2WPDA 1X86B 5LC1A 2XNCA 3IMKA 2J9ZB 3LGAA 3UWKA 3ECSA 3TSYA 1J21A 2WVGA 1FJ2A 4BWVA 3T3NA 2WJIA 3GRZA 2A7QA 3QUBA 5JJIA 1SB8A 4D25A 2FCAA 4KEAA 1E1DA 2PWPA 4XWOA 2XCTB 2PQ6A 3QTLA 2OHOA 3DMPA 2XUQA 4PBSA 4E6EA 1O5OA 1TEVA 4ZCQA 3TLXA 3WK7A 5A7HA 5DNCA 4RZHA 1YE5A 4DEXA 5HUQA 6ADHA 2QRKA 1WP9A 4OXXA 3AJAA 4PXAA 2PQMA 2R00A 1XEXA 3CEAA 2C96A 3PJRA 1K66A 3LYLA 5A0FA 4Q3CA 3MIZA 3DT8A 2V7WA 2ZCJA 2VS1A 3B89A 5EPOA 3REGA 4G07A 1X7XA 2ZUUA 4MDHA 4Z0PA 2X0NA 5EUMA 1T43A 2M6KA 1HA3A 2CMHA 4GBGA 4UAGA 5EL0A 1QAMA 2ZT8A 4Q3AA 2WZCA 4BVEA 2ANBA 4PC7A 4KMOA 4DM3A 1Y1SA 4DKXA 1NU8A 4LGYA 3RGWS 4LJLA 1JAZA 4P84A 4GI2A 2ODTX 1P2TA 1GKKA 3BX1A 4I2NA 4NYIR 3RQIA 4CT4B 1OI3A 1KS2A 1SVUA 4I8DA 5EHNA 2W6JA 4D74A 4NI5A 2G1AA 5KQRA 3DE0X 1EVKA 4MV9A 3U0VA 3A9UA 3BMQB 1GFWA 3IOYA 1KY4A 1DKNA 3CN9A 5FOUA 1EXDA 1HUQA 5ALTA 3TX2A 1GV1A 4E07A 3UENA 3AW8A 1UBNA 3DBOB 3ADDA 3RFFA 3V9PA 3BD6A 3ZY3A 3LFTA 3CKYA 4U8GA 2WWFA 3PGJA 2QRLA 2DLNA 3GEDA 2QUZA 2FSVA 4NAUA 4AVYA 1V8PA 4JJEA 1N6IA 1F2UA 4G5FA 3KQMA 4HOYA 4EY8A 1XR3A 3VC2A 3H83A 4M9XA 2FAXA 1BXKA 4UPVA 4IXDA 4JBLA 1U0RA 1HYGA 5JWRA 3OTIA 2D7DA 1Y6GA 1O8CA 1XTPA 5HFJA 3DBIA 5EJ8A 2OAEA 3U7FB 1S96A 4BB9A 3EVGA 4N6GA 4RPCA 5BW5A 3GMIA 4KQ1A 4LV6A 1DRUA 1EK1A 1MCZA 3FTEA 3ZNQA 1A5SB 1QZTA 3ICPA 4W5WA 3RKRA 5ALEA 3KDSE 3H1PA 1G6KA 4W8OA 4M8KA 1WPGA 4WKPA 4EHIA 3WLLA 3MILA 4CDMA 3EIFA 4MINA 5F33A 5G4KA 1P3Y1 2Z1MA 3QF4B 3LL7A 1UJNA 2HIGA 3H5WA 4DIUA 1DRVA 1N6LA 2P3QA 4KWTA 3UMSA 4BRSA 5IF9A 2W4IA 5H02A 2REOA 5KJ1A 1TLFA 4XQGA 2XNHA 1UKBA 2HCJB 1T9ZA 2B25A 1VMAA 1UMDA 5CNKA 3GDFA 4IIUA 3WIOA 1CRQA 4A23A 4Q9KA 3QIAA 5GOTA 1DBVO 1WU7A 5LB2A 4C0QC 2FE4A 2X5KO 3SQNA 1CEEA 1U2TA 3A58B 1TC2A 2AZDA 2P75A 2X19A 4ARAA 5HVNA 4J8PA 4LNAA 2VDRB 3JYHA 2WTNA 1UKAA 4Y9UA 4JQZA 4CM3A 4QVIA 3UGJA 4CEJB 1YULA 4PN3A 1KE2A 2H16A 1GCIA 4TMTA 3THWB 2FSPA 4MW0A 4UREA 2BKAA 4QAJA 3SDBA 4M46A 1Z0SA 2RHWA 3UYLA 1P2UA 4RCYA 1WRBA 4WBNA 4AY5A 4EA8A 2I91A 1K97A 1NI3A 2AHOA 5GGYA 3C45A 4EG4A 1OX4B 3BZBA 3CPJB 2HJWA 3C7CB 4Q1CA 1FJGB 1DV2A 4CQLB 2F8SA 2FPIA 4YECA 3Q4GA 4IIBA 2SCUB 4IIVA 2I6GA 1PO7A 1W2WB 1MDBA 4FDLA 2G1JA 2LTAA 1J5EB 2HXYA 3P19A 3DVAA 3LPMA 4JT2A 1RQGA 1POWA 2FZ4A 1V5IA 2NZ2A 3FMVA 3IUBA 4IQ8A 4KG7A 3DE6X 4M7WA 1FRVA 1R0LA 5FI0B 3QMWA 3NT5A 1Z63A 4XCXA 2DUJA 4QM7A 3DW1X 1ZIOA 1P1KA 3OECA 2ZB7A 1FX1A 3M6XA 4B6FA 2J4FA 5HRAA 1R12A 3ZQUA 2XKKA 3T1QA 3WHKA 2IC5A 5CA1F 2Q99A 4RJLA 1GDTA 3RSQA 2RGBA 3CNNA 1H1DA 2B1JA 1MQAA 3CYFA 1AY0A 3FE2A 3URMA 4RJIA 1RWPA 4C20A 2O3SA 4DR2B 1M6WA 1XTUA 3ZEAA 5KTOA 1G98A 2BM1A 2G8NA 2P4QA 3MOIA 4G1MB 3ICOA 2AYYA 1EX6A 2XQIA 3FNQA 2P7HA 3KLBA 3OPYA 3VDRA 4EG7A 2VATA 3ZD7A 2GR9A 2FPGA 1PZGA 5EE9A 1HZZC 1GG2A 3CZMA 3HCOA 3QEOA 3IOCA 2WJPA 1EUZA 1T5DX 4MJXA 3BWEA 4ZAWA 4J7AA 3FAZA 3VR4A 5LWHA 1RZVA 1KIFA 1GTMA 3ZXIA 5JNUA 1M2VB 1DP4A 4JYBA 3C98A 4EYGA 5TMPA 5BN4B 3EQ6A 5C35A 3BD9A 3KKEA 2ZSIA 3LLUA 4GLOA 2N3ZA 4JLPA 4EEXA 5E3JA 1G9XA 5CIYA 4JLWA 4EB6B 1JG4A 2BP7B 2VJPA 2GN9A 3H5NA 3OU7A 2GVNA 3HYCA 4FONA 5BN5A 3LUDA 3DE5X 3UHAA 4EQ6B 2FK8A 3FCAA 2ZYRA 2IYRA 5SY6A 4NPCA 3UM9A 1ZOLA 4FFVA 1NBEA 4A0FA 2BONA 3EIXA 2WZDA 5FJIA 3MD9A 3V8VA 1PVDA 5DK4A 2PT5A 4O29A 4ZD6A 1P19A 4ITVA 5LD2B 1M33A 1HPLA 4BVBA 2HI0A 5LQCA 4KODA 4HX9A 1Z15A 2BMEA 4IINA 1QH8B 4XD7D 4LFCB 5DIFA 5J4VA 1SXJD 4UMFA 7YASA 1G6HA 3BD8A 5CX1A 1QV7A 2HHCA 2OHIA 4M54A 1P3JA 3TQQA 1U63A 4NXMB 5BQFA 3H17A 2GK7A 2AI1A 1EVZA 3BZUA 1WZIA 1UBEA 2D2FA 2FMKA 3HDGA 4L4XA 4YO8A 1F6BA 1MENA 3OPYI 4U4AA 3U7QA 3SQXA 4D9JA 1THTA 1AZSC 6Q21A 3DKRA 3VOTA 2ZU6A 3R3XA 3RODA 5KSWB 2P78A 4HDMB 3R7WB 3WBJA 2QAIA 5FOWA 4ALMA 3Q7IA 3U19A 5HZKA 5DCUA 3Q7QA 5BRNA 3W6ZA 4F3YA 2VT3A 4DJAA 3MMPA 2B2XA 2H7CA 4GXTA 4MR8B 1VL8A 3VHQA 2BISA 3EDCA 3JQ8A 3UW1A 3JASA 2MSEB 3DZCA 4P5PA 3U13A 3FUTA 3H11B 1MT3A 4AJLA 2E85A 3MOSA 1NN0A 4MRMA 4U8HA 4B75A 1CUSA 4BNHA 1H5QA 1JJAA 4UOQA 2EKZA 1BW9B 2GBIA 3D4OA 4BNMA 2FDXA 3X2FA 4EHKA 5CBKA 4Y8VA 1SIOA 1XTSA 4YI5A 5I4IA 1ULTA 2WF8A 3HYSA 2LP4Y 5EWMB 2RJ3A 4EMSA 4NXNB 3FNBA 4S04A 1A2BA 3MS4A 4URVR 2UXBB 2J32A 1PL8A 1M2OB 1V7QA 2Y1KA 1J5XA 3K15A 3IX7A 3PFWO 4LYDA 3T7IA 3USZA 4K5QA 2YWXA 4N47A 5KPDA 2VCHA 4C06A 4S1NA 1GNTA 1UQRA 3NORA 2VZLA 4HQNA 1D6JA 2F9FA 4IIGA 3RVSA 4FVTA 3EUEA 1UKCA 4TKVA 2X5XA 2XT9A 1A8QA 1WL8A 2NYVA 2YL2A 1WJGA 3HUEA 3L9XA 3QVWA 2ZI7A 4KQXA 3M7IA 2V58A 4N7MA 4P58A 3NHJA 3HJRA 5BR7A 1KP9A 3WGLA 2JD2A 3PC3A 1NJ2A 2QNIA 4OXYA 4JLOA 5CVDA 3TNJA 4MO9A 4CKEA 4Y2JA 1JR3A 3PCRB 2YN2A 5JUWA 1HT0A 1SHZA 3G89A 1E1RA 1MABA 1ULUA 3IAM1 3BJZA 3L7IA 4JKOA 1MG0A 4RHFA 1WXHA 2IBTA 2IKSA 1G4HA 3O4HA 2I1VB 1U81A 2QL9A 4MI1A 1NONA 4PYKA 5KSYA 2OO5A 1C3OA 3L40A 1AKRA 2OM6A 5JI3E 1XTVA 1Z3IX 2VJMB 3C5WP 3LCJA 3MCAA 3Q98A 4GKVA 5B3LA 3UAXA 2QNBA 2J0SA 1QHHB 2Z4TA 1I3KA 4MH0R 5AOCA 5H3LA 2ZI3A 1YB2A 1K68A 1G0OA 1WPQA 3CX8A 4K46A 4C4XA 2PV7A 4J1TC 1YHYA 2UZ3A 4ZOLB 4ZMBA 3HP1A 1C8VB 4LQCA 3FRHA 4Y2YA 3SYLA 4BIMA 2FW0A 4GRIA 1KVRA 3KZXA 1JEJA 3LL4A 1CFZA 2BR3A 5DYWA 1WLYA 2CJYA 2UZ1A 2XI4A 3B78A 3OPQA 5JQGF 4RD6A 1WF6A 2KX7A 2JIOA 4OBBA 1X39A 4CF7A 1PFQA 5IWCA 3U6BA 4KO4S 2X77A 3KHSA 3FKJA 5BWCA 3OETA 5IXYA 3JQCA 1II9A 1NC3A 3H9GA 5EZYA 2CUZA 3I58A 4DXHA 1NN3A 1EK2A 1CVRA 1MMFB 1Q91A 2WHPA 5TQ0A 4I9NA 4ZU6X 3ZVNA 1YCFA 5JDCA 3EVFA 5HW0A 2NSHA 3I3SR 4Q9HA 4NX2A 1P1HA 1DBIA 4C6RA 1IZ0A 3HY4A 1UJ6A 1C50A 4QJ5A 5KDDA 1R74A 3FYDA 3RF7A 4G1EB 4CW7A 1XXHE 4OYLA 3VNBA 5JZSA 3SX0A 4D44A 1BX3A 4P9NA 4R16A 5T4BA 4AJKA 2JVIA 2QROA 3WMXA 2UYCA 3AZQA 5CIQA 3TPCA 1PR9A 5JC1A 3OSUA 4QUJA 2F67A 5CCDA 1G8JA 2ONZA 1LQ2A 1NOJA 2DH5A 3A1TA 4UASA 2A3RA 3GUCA 4CLEA 5A6VA 4OGWA 3K71B 2GF2A 1CUBA 1N5DA 3PGA1 4JT8A 4AWBA 2W71A 3GP3A 1W7AA 3G13A 2HREA 3K0HA 2J85A 4LJSA 4PAOA 1RAHA 4B31A 4HYQA 4P5DA 4E5YA 2I4OA 3OEHD 1ECCA 2NACA 1T6XA 3AETA 4V3BA 1KVUA 4EHJA 1TZBA 3GJ3A 1T3LA 3G0HA 2FGJA 1YQTA 3TFQA 3KT3A 2AOWA 3R0ZA 1F12A 4BB0A 5KEIA 2JLZA 4F6RA 3BWBA 3V2HA 2OFOA 1H0HA 1V1RA 3MYRA 5F4ZA 1O08A 1RHRA 3V00A 2FF5A 1QGED 2X8WA 4FGLA 2J9RA 3TEMA 2KI5A 3UJPA 3JYQA 4HDSB 1QIEA 1C4XA 1EFRD 2LWIA 3AHIA 1G5IA 1QONA 4DYHA 3GXBA 3IT1A 4QPDA 1SKUA 4DSTA 4YRLA 1UOEA 1TZJA 4MQMA 3N1UA 1NVXQ 3UK1A 1C3LA 4RHCA 4P2BA 5TS3A 4OMUA 3WL8A 5G4LA 3LY9A 3K6KA 2DR0A 2HGSA 1PR6A 5LPNA 1HYHA 5BWBA 5L51A 1U8AA 2A5FA 4MIEA 3Q5EA 4P93A 4L5YA 3U49A 3G2KA 1HNNA 4BWFB 3E1SA 2HFKA 1V96A 5JAHA 2P6OA 3TNLA 3WA6A 2Q4EA 1W93A 3IV6A 4YJHA 5ERGB 2PE5A 5TMDA 4IO0A 3P0JA 1T1GA 2Q8QA 3CX7A 2G76A 1H42A 4UUBA 3TL3A 1QAQA 1VPWA 5JZ9A 4D9IA 6GPBA 1GPAA 1NW7A 3LCRA 3SEAA 1NYQA 2BOVA 3V2GA 4RQTA 5B55A 3A0UA 1WX1A 4B3JA 4B4KA 3OWXA 2BPOA 2LKCA 2CVHA 3I1IA 4TXNA 1KSGA 1I4EB 4DUPA 5TEVA 2Y66A 5ITSA 1N6RA 3D3EA 4NMLA 1Y80A 2SBTA 2VNAA 3PUWA 4PLTA 5FNVF 1C29B 4NCHA 1T34A 2OHXA 1Z26A 1Q1GA 4I1UA 3AT1A 2W2PA 3TW0A 1RCFA 3KHKA 4XE5A 4XUGB 3RV3A 1ZUNA 2CJWB 3HM2A 1Y8QB 1EJ0A 4UNQA 3RGGA 2OMEA 3WMFA 3UYKA 2C7RA 5DLQC 2H1FA 2QP9X 3G82C 3QF7A 1C3VA 4IWYA 4LZPA 4BJ3A 4DDTA 5MGNA 4HBZA 4ML3A 4PPGA 3BG5A 3FW1A 4R8KA 1TJYA 2EWMA 3IAAA 3LHDA 2A5JA 4Q4AB 3VPSA 4OP1A 3ZGYA 5JWOA 3SFZA 3Q7PA 2KPOA 3B8EA 3P4YA 2ZSAA 2GMWA 3UEOA 3GFBA 5BSHA 3JD1A 3CKKA 2D8AA 2Q2QA 2FW1A 4G36A 5GONB 4YRQA 4REOA 4URZR 4TTQA 3ZZTA 3WK9A 4N54A 1NOKA 2VSNA 4QZVA 4ER6A 1JG1A 2C2WA 2UV8A 821PA 3BWCA 1NFFA 3W7VA 4QDUA 3MWEA 4RM3A 3A04A 1G3MA 4UCFA 1EYZA 2JCXA 1JALA 1R9JA 2Y6VA 5EWJA 3AIIA 4E12A 3ORQA 3PPYA 3R44A 4TV8B 4KR2A 1Z5PA 3RROA 2BAGA 2P3SA 5D7BA 1N2GA 1U6KA 3E53A 5EXEA 2NUPA 4BNYA 1E6EA 2YY5A 4EDFA 3UN1A 1KC1A 3UFXB 1C9MA 2BZSA 1EKXA 3UMGA 1NHWA 2COEA 2DM6A 4DADA 3I30X 2NUTA 2ZBDA 4LTNA 5BMVA 5KNDH 3FA2A 1SBHA 2JGNA 4LXGA 3TJMA 3OQIB 1JBKA 3LWBA 4TXHA 1T8TA 4J7CA 4U2EA 4ZVLA 3TWOA 4Y0AA 3C3MA 5KX5B 2ZTHA 3A9CA 3CPSA 4RDHA 3JQ9A 3NV7A 5A5EA 4BNKA 1RJFA 1Z7EA 2QN9A 3ROZA 3FOFC 2FWNA 1JZTA 4DA0A 2PUAA 5CVJA 2J6CA 4PLWA 1UM9A 4YT8A 3OVMA 1M5TA 1GLVA 3QOXA 4UZEA 5DHTA 3I2FA 1R18A 1RHMA 2C83A 3NUGA 4KXYA 1L3BA 1V4NA 2CXTA 1IDN1 3AR8A 4JBNA 4K9MA 2O54A 1RYHA 4ZT3A 4E2ZA 1PLLA 3NRJA 4MUHA 4C4RA 4KV9A 5EJ4A 3G6KA 3IQGX 1JHZA 1X8JA 3WGNA 5K3FB 5LQUA 1ZM3A 3ET5A 3T1VA 1LI4A 3ZKWA 5IN4A 2VFAA 1U0JA 1XDBA 2C2OA 1X1EA 4C22A 4R0VA 1GGJA 2OFWA 3F4KA 3NBMA 4C0AC 2C8LA 2O8CB 1NNSA 5I8WA 1EWVA 2P4EA 4BDTA 1Z29A 3MJ4A 2RCYA 2XSZD 3JD4A 4Q47A 4JKIA 2YXEA 3IXMA 2V6JA 3EG9A 2R7NA 3FPHA 2UVPA 3DE4X 1LSOA 3M6VA 1G1AA 1GUYA 3QPAA 4O08A 3GEEA 1U2PA 5JNTA 1RZ3A 4IDQA 2W58A 4GX0A 1PFWA 2VC2B 2YFYA 3Q9SA 3U9LA 5AKZA 2VNSA 1PVVA 3T5GA 3FD8A 1V5FA 3N3AC 2FWAA 1HDOA 4GVXA 5FR2A 1IOVA 2P6PA 1E20A 1RRGA 4JXJA 1D2MA 4LPSA 4RNDB 2IUUA 1YJ8A 3RK1A 4ZO8A 4BP9A 4DNPA 2CXQA 3WGMA 2PQ2A 4R2WA 3I9MA 5LJLA 3R4CA 1HM5A 2AR7A 1P17A 3PT5A 1ULSA 1EVLA 4PSUA 1R4NB 4FIDA 5ALXA 3AP2A 5KCMA 13PKA 1REQB 5F98A 2BI4A 4OHUA 4BNDA 3W4KA 4EJ0A 2JFGA 3H5OA 3KLMX 4GMXA 4YCAA 3SYKA 2F48A 2OGTA 1EUCB 3TR5A 5ITZA 1IBRA 5B53A 2Q5CA 4J4TA 4YCJA 3L0PA 3C39A 3FPJA 4P0TA 4B3SB 3K09A 1EIZA 3TGPA 2YJ5A 2G0TA 2JFPA 3FDIA 2HU7A 2KW5A 4UU8A 1PBTA 5AUNB 3KTOA 4QFMA 5LDGA 4HNTA 2EARA 3TIFA 5KWVA 3A1NA 2FJUA 4MIKA 5JS6A 5JAPA 1RWBA 3GA0A 5AUQA 4YJFA 4ED9A 3V1MA 1RWXA 1U9IA 4J3FA 4EUSA 4D57A 2B9VA 4OQEA 2FSHA 4PYLA 1QP8A 1N2CB 1QRRA 2QQEA 4XJSA 1Y81A 4XTRA 3T0IA 2O8CA 3B6ZA 3BFVA 1ISRA 1WMAA 2CUKA 3DO6A 1K2VN 1OWLA 3CG4A 3ITEA 4UU1A 5JZBA 4GO1A 4E1BA 3DS8A 2XMSA 1NP3A 3EFEA 4HQLA 3T99A 1M6NA 1HZZA 1TRHA 4F71A 3LF1A 2IYZA 3AC0A 4L15A 4KR6A 3T3OA 1AF7A 3EXG2 4NK5A 1WU8A 3G2QA 3L06A 5AVVA 1ZK2A 4RD0A 4CWAA 2LW7A 1EM8B 2QTFA 3V3TA 1ADGA 2I7TA 3CCFA 4M0EA 3C1TA 3AHDA 5HS4A 1U0BB 1YB1A 1SUEA 2BT4A 1PR3A 2QMEA 3QKWA 1PL6A 4A2PA 3WQRA 16PKA 4ER3A 3MTGA 1DO0A 3MSXA 4NTZA 4X93A 5A71A 1BHO1 1TYCA 2X9VA 4OQFA 1PIWA 2PKEA 4TXMA 4TT3D 3I52A 3V8RA 3WBKA 1J0AA 1WIWA 3EE6A 4BP8A 1W30A 3LUPA 1TD9A 5EJAA 5HJ2A 4EARA 3GPLA 3W8RA 4DVJA 1GTRA 1UOOA 4GS5A 3A9SA 1ZVQA 4EG5A 2YDXA 5TSDA 4E13A 1B14A 4CMAA 5JANA 1EU1A 4F3TA 4KNYA 1G3UA 3K9WA 2NVOA 3D3WB 1PT8A 3FZGA 3IDOA 3QENA 4PSDA 1GQQA 2W43A 3HZZA 2W4QA 2BHLA 1KGSA 5K3BA 4MNTA 3K1YA 5ER9A 1P5JA 2JFOA 3I01A 1K86A 2IVZA 2ZT6A 1JPNA 3Q9LA 4OMCA 1ZD8A 3P9SA 1G8MA 3TINA 4D41A 1N1MA 3V8MA 5AR1A 2TECE 4J2HA 1MAAA 4MX8A 1PZNA 4HD8A 4KP7A 4EKNB 4GP6A 5GONA 1RRVA 2X1MA 1WDLA 2Z30A 2AI2A 3AHGA 3FTFA 3T7DA 1V26A 2Z04A 3F5QA 3FKSA 3ZCXA 1T0HB 2G9RA 1QCYA 3A1WA 2OBNA 3CEHA 2DF8A 1N1EA 5EQJB 1ZOIA 4GBMA 1FFEA 1RZRD 1YDWA 2JHAA 1G8KA 2NXCA 1TUGA 2TMGA 2ZK7A 3I83A 2PKXA 1UFQA 1KZGB 4UEOA 3S4YA 1IBKB 1V3UA 1YA8A 2ZYGA 4MWZA 3U3KA 2VPWA 3CZPA 3L46A 2V7UA 3DE7X 4ITRC 4JEUA 2OKGA 3I9KA 3QFRA 4Q9LA 4YONB 4FNMA 4Y2SA 1X80A 3NIDB 1MN6A 5JS8A 2YS6A 2AIRA 2IHVA 1A9SA 3DFUA 4JB0A 1JT2A 4PIMA 2ADOA 4UVEA 3TW8B 2K4MA 5A62A 4JJGA 2OXTA 1KKMA 1KVQA 1PCXA 2F3UA 2GZ2A 2HAEA 2JFXA 3EA5A 1A2OA 1PQWA 3H87A 3TN7A 3RYCA 1GZDA 4OAOA 1ATIA 3CBGA 2X6QA 3O4FA 4JA0A 3V8BA 4NFSA 3GG9A 1QTNA 3SC6A 2NNWB 1AQLA 1TM2A 2H29A 2IOHA 3KT8A 5TQ2B 4DCUA 5FTMA 3MLEA 4J4HA 4ZDIA 1F2DA 1U98A 1KWGA 2NQTA 4DABA 4D6YA 2ZPTX 2ZR9A 3CT6A 3K1AA 3SYMA 1N78A 2HV9A 3HI4A 4PR3A 5CJ2A 4AYXA 3FNIA 3S2UA 4KGZA 2AOUB 4PAMA 2Z3ZA 3MWFA 4WD3A 1JTEA 4Y1EA 3OE7A 4DCNA 4HQ6A 2AQ8A 2I2FA 1O6CA 1TD1A 5GONF 2G1KA 5K8UA 4HUTA 1UK6A 4BS9A 1OFVA 4EG3A 1OBOA <