3BGVA

Crystal structure of mrna cap guanine-n7 methyltransferase in complex with sah
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
309
structure length
269
Chain Sequence
RIFYLRNFNNWMKSVLIGEFLEKVRQKKDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQLPLGTLSKSEWEATSIYLVFAFEKQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of human RNA (guanine-7-) methyltransferase in complex with SAH.
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords mRNA cap guanine-N7 methyltransferase
total genus 94
structure length 269
sequence length 309
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2007-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3bgvA00
3FUTA 3BT7A 3TLJA 3THRA 2ZZKA 3PX2A 4OQDA 4BLUA 3I53A 1G8SA 4IKPA 4XCXA 4BP3A 3B3GA 2GAFA 4DM3A 4C06A 4RVHA 3JWHA 4XUCA 3OE5A 4QDJA 4IWNA 1ORHA 5BW4A 3BGIA 4PGHA 3HA7A 4PCLA 4ER5A 2KW5A 1TW3A 2XYRA 5LQAA 5EKUA 2H11A 5G02A 4M38A 5FTWA 3B3FA 3R3HA 5KQSA 5DX1A 1HMYA 4E30A 2YQZA 1T43A 3G7UA 4P7JA 1BOOA 2AOTB 3G2OA 1SG9A 3M70A 2C7PA 3DXYA 1G60A 5F2KA 2JH9A 3L8DA 1RJEA 2IIPA 2R3SA 3G88A 4QVKA 4AZSA 4RTSA 4X63A 4ZTBA 1XDSA 3BKWA 3MHTA 5K0FA 3NVKI 2ZLBA 3THSA 1JG1A 3EVGA 4DCGA 2IPXA 3ELYA 3OZTA 1JSXA 4FZVA 4RTRA 2ONYA 1IXKA 4QQKA 5DTMA 2BR5A 4RSRA 5K01A 2GS9A 1RJGA 2ZIGA 5E9WA 3DXXA 5FHRA 4AX8A 4U7PB 2XBMA 4WVLA 1JG2A 1ZKDA 3FYCA 5EIWA 4LECA 5C0OE 3FUWA 3UJAA 2F8LA 1QAMA 2AVNA 2QY6A 4X41A 5EEHA 1MJFA 2CMHA 3GWZA 4GBED 3A26A 5DWQA 2GA9A 1QANA 3TKYA 4F86A 1NBIA 3BGDA 2G70A 3KU1A 5CVJA 3KPWA 3M6VA 3MTIA 5E1OA 4A6DA 3TOSA 4UOEA 3LGAA 2AOXA 3DOUA 1EIZA 5EMJA 5GIPE 2NP7A 1HNNA 5GIOE 3PLAE 3ME5A 3CCFA 2O05A 5E9QA 3TR6A 5LSAA 4G56A 4FT4A 2YX1A 1O9GA 4DMGA 1EJ6A 3HCAA 3MAGA 3GRYA 2I62A 1B42A 3HVJA 4MTLA 4R8RA 5DSTA 3EPPA 2PT6A 4LG1A 1NW8A 3KPJA 2B3TA 5F2NA 3HTXA 4GF5A 5CVEA 2ZBRA 1P1CA 2FRXA 4U7TB 1XCJA 4KRGA 3HCFA 4RTMA 5FULA 2O06A 3M6WA 3RODA 4M7RA 2CWWA 5DM4A 1U2ZA 2JH8A 5E2BA 3UA3A 4FR0A 4E70A 3EEYA 3M6UA 2P40A 1QZZA 4O29A 2EX4A 3GO4A 2ORED 3GJYA 1QAOA 2NXCA 3KHKA 4FSDA 4XUEA 1KIAA 4P58A 4L7VA 1KR5A 2ZULA 3UJ7A 3EGEA 5ERGB 5JUWA 2ZWAA 5K0JA 5CIYA 3EEOA 2IH2A 1JTFA 2PWPA 4ATNA 1JG3A 2PY6A 2WK1A 3DTNA 4YMHA 1XTPA 1FBNA 2EJTA 2JHCA 2IDJA 4ER3A 3AJDA 4A6EA 4B17A 3G5TA 3OU2A 4RTQA 3ERCA 2EJUA 3A4TA 3FUVA 2FK7A 3A7DA 4KDCA 2BM9A 2HNKA 5FHQA 3K6RA 3FPHA 4C05A 4PWYA 5CM2Z 5KQRA 4CTKA 3MCTA 3QOXA 3KR0A 4EMSA 1VQ1A 3IYLW 2VZ9A 4DKJA 2NP6A 4YV2A 2PX8A 4QVGA 1L9KA 3KQVA 1RJDA 3NW9A 1QYRA 5T64A 4DZRA 1R8XA 1P91A 3GRUA 5C1IA 1AV6A 4ER7A 5EPEA 2HWKA 3LECA 3NDJA 5HFJA 3DUWA 3FRIA 2PXXA 2PKWA 1ZHFA 3R0QA 5FA8A 3PS9A 3G2QA 2BZGA 3LCCA 3SGLA 5HILA 1TPYA 3KKZA 1FPQA 5LR6A 2QRVA 3AXSA 3EMDA 1DUSA 3P2IA 1ZGJA 3GU3A 5EKXA 5H02A 3M33A 5K09A 1L3IA 3P2KA 2JJQA 3EVFA 4IV0A 3X0DA 3IEIA 2P7HA 2ZFUA 4RYLA 1AQIA 2OXTA 2Z6AA 1D2CA 3KQOA 2YUIA 3TMAA 3UJCA 2YTZA 1WY7A 1WZNA 2P8JA 3DLCA 3KQQA 4HTFA 4OBWA 3BWCA 1JSZA 2G71A 5K8VA 4CXMA 3CBGA 5DTQA 3P9KA 2G8NA 4HGZA 5K0BA 3LKZA 2IH4A 3BWYA 3LCVB 3QOWA 3KR1A 1WS6A 3LCUA 1Z3CA 5KVAA 2FCAA 3B89A 3DXZA 3G8AA 4RWZA 3PTAA 2PXCA 1N2XA 2NYUA 3NDIA 3P2EA 5E1BA 2P41A 3UJ8A 2GPYA 5LQRA 1RI2A 4MIKA 3QV2A 3DMGA 4YUZA 3C3YA 4P7GA 2VP3A 1NT2A 1X1AA 3FUUA 2I9KA 3MB5A 3GRVA 1I4WA 2PVCA 4PYIA 1D2HA 3UBTA 4MQ4A 3SX0A 1L3BA 1ORIA 4AZVA 5MHTA 3WSTA 3HA3A 7MHTA 2ZWVA 2H00A 4CWAA 4POOA 4GC9A 5ICEA 1NW3A 5ICCA 5CCXA 2AOUB 3HP7A 3VC1A 4E33A 3U81A 1R74A 1RI3A 3EGVA 4KVZA 2QYOA 2VDWA 4R6WA 3M6XA 3TM4A 1RI4A 2PT9A 2GH1A 3OFKA 4PYQA 3VSEA 4DA4A 1M6YA 1O9HA 1XXLA 5BW5A 5DRTA 2AOVA 4GUAA 4RTLA 3GCZA 2ZVJA 5DSXA 3TPZA 3KPUA 5LQKA 3DMFA 5GM1A 1NKVA 3UWPA 4AZWA 3C0KA 2P3LA 4RVFA 3LDUA 2DPMA 4PCAA 5K0CA 1V39A 3AWIA 4YUYA 4GOMD 4PYLA 4PONA 5GWXA 4RX1A 4X61A 5GP1A 4Z2YA 4HGYA 1IM8A 4OX9Y 3A7EA 1FP1D 1M0EA 4OA5A 4KIGA 3HVKA 4BLWA 8MHTA 2R6ZA 3TFWA 2G1PA 5T67A 1INLA 3HEMA 1UWVA 3BKXA 3HCBA 3GNLA 2ZW9A 3IV6A 4RTPA 3FTFA 3V97A 2AN5A 1KYWA 1Y8CA 1WXXA 2C7QA 1X1DA 2PLWA 2C7OA 1OR8A 3CC8A 5D1NA 3ER8A 2O07A 1D2GA 1KHHA 4YUWA 5KYGA 2OB2A 1BHJA 1QAQA 2OO3A 5DRYA 5E1MA 2AN4A 4E2WA 4F85A 4OA8A 3F4KA 3G2PA 5CVUA 2AR0A 3TKAA 2AOWA 4BLVA 4PGGA 4PYJA 5DT2A 4F84A 2IH5A 2CL5A 4C04A 2UYOA 3EVAA 4R6XA 5HIKA 4Y2HA 3OE4A 2YXEA 3Q7EA 5D1HA 1JQEA 2ESRA 5HIIA 2B25A 2UYCA 2I7CA 2PX4A 4Y30A 5EOVA 3RW9A 1UFKA 4CKEA 1Q0TA 2Y1WA 1VE3A 2OPBA 2LD4A 3CJRA 2WA2A 3KQPA 5E9JA 3OCJA 1R6AA 3P97A 1VPTA 4P7KA 2FHPA 2P7IA 2OBFA 3KR9A 5EVJA 3B3JA 4DCMA 4PIMA 2AOUA 3SVZA 1H1DA 1NE2A 3JWJA 2BM8A 5P8WA 4ER6A 4LWPA 4RVDA 3O7WA 4DQ0A 5EMLA 1YFLA 5EHIA 3DULA 1PJZA 4CKCA 3HCEA 3P9NA 2ZBPA 5LQNA 1VIDA 5LQJA 4QTTB 3FPJA 3JWIA 5K03A 3UJBA 4YUXA 1ZG3A 2IDKA 2BR4A 2CKDA 3EVEA 2ZZMA 1WXWA 3BXOA 3SM3A 1SQGA 4RTKA 1ZQ9A 3C6MA 5HZMA 3OZRA 2ZBQA 5HOQA 3D2LA 3T7TA 1ZGAA 3GXOA 5EIFA 4AUKA 2P1DA 2PX2A 3I64A 3KPYA 4GQBA 5EMKA 3MQ2A 1SUSA 4MHTA 2V74B 4M37A 1YFJA 3KR2A 1M6EX 4FGZA 5EG5A 5HIJA 1VL5A 5FA5A 5CUQA 4C07A 3UJ9A 4RVGA 3O4FA 5DXJA 1AQJA 3GIWA 3BGVA 1NW7A 4BP1A 1X19A 1EAMA 4RTOA 3NMUF 4OQEA 3HCDA 3PT9A 3G2MA 5K0GA 3CVOA 3REOA 1FJXA 2NXEA 3FYDA 1RI5A 2I6GA 1R8YA 1X1BA 5EQJB 1BKYA 2CMGA 3JWGA 2YR0A 1NV9A 2HV9A 3EMBA 4E32A 2C7RA 5EGSA 5C9ZA 2IGTA 4AZTA 2XVAA 4LWOA 1SUIA 1O54A 3KQSA 1MHTA 3C6KA 1R00A 2ONZA 3AXTA 5FADA 3LHDA 4K6MA 4NECA 2O0LA 1VP9A 5HIMA 4QDKA 3ANXA 1VBFA 2BR3A 4YUVA 5DTRA 3DLIA 2ZSUA 1KP9A 2O57A 3LKDA 3V8VA 5CCBA 2PV0A 4EK9A 3E7PA 3HNRA 1IY9A 4WXHA 2EFJA 2UZ4A 1SKMA 1KXZA 2P35A 4ISCA 5ICFA 4RV9A 1Q0SA 2Q41A 3ER9A 3Q87B 3KPVA 3KQWA 3EVCA 3GDHA 4JXJA 2VDUE 3LPMA 4KW7A 1G38A 2JG3A 4X1OA 2ADMA 5FQOA 1G8AA 1N7IA 1XCLA 5FUBA 1X1CA 5B1SA 2GLUA 5DXAA 5U4XA 10MHA 3E8SA 1RJFA 4DF3A 3G5LA 3LSTA 3ELWA 1EG2A 2DULA 3GRZA 1R18A 5KS2A 2H1RA 5E2AA 1NV8A 5E8JA 4YMGA 4PINA 3MCZA 5FWDA 2V7EA 1JQDA 3MERA 4E2XA 2AZTA 3CJTA 2ZZNA 3P9CA 1WG8A 4KWCA 3VYWA 4PYNA 3R9XB 2UYQA 3DMHA 3P9IA 2AS0A 5CD1A 2OB1A 3SSMA 3SSNA 3VC2A 4ER0A 3B7PA 1JTEA 3PFGA 3SSOA 1UIRA 3PB3A 5DX8A 3LDFA 2K4MA 2NXNA 3R6TA 3EVBA 4HRAA 4FS8A 3PVCA 1KPGA 2ZIEA 4OBXA 4QQNA 3HA5A 5E1DA 3DP7A 3G89A 2QM3A 3HM2A 5EHGA 2FYTA 3CGGA 1JQ3A 3KQYA 3G8BA 5CVVA 3BUSA 2YXDA 5K05A 2Z6UA 4CKBA 5IH3A 3FTCA 4RTJA 5HEKA 2E5WA 4GOND 1G6Q1 4P7FA 3K0BA 2Z6QA 3CKKA 2B78A 3PFHA 4H0NA 3DR5A 4HTFB 2B2CA 1JG4A 1SQFA 5EMMA 3HCCA 1EJ0A 2PXAA 3NWEA 1VLMA 4PYMA 1XDUA 5DM0A 2P3QA 5K0NA 4C08A 2OZVA 2XVMA 1F3LA 1DL5A 3LBFA 3O31A 2JHAA 3RIEA 4C4AA 3C3PA 1EQAA 1XDZA 2IP2A 4FP9A 1YZHA 5FWAA 3HVIA 3T7SA 2IBSA 2PJDA 3OPNA 1YZ3A 4KIFA 2ZCJA 1I9GA 2IFTA 4X60A 2QRVB 2BH2A 1F38A 2AVDA 5EZQA 3DH0A 4C03A 1VP3A 1P39A 2ZTHA 3KQTA 3BWMA 3CJQA 3FUXA 3IHTA 4GOLD 5DLYA 2WA1A 2OYRA 3T0IA 4E31A 3B5IA 4XUDA 3NVMB 9MHTA 4PIPA 1L1EA 2N47A 5DM2A 3UZUA 4E2ZA 3NJRA 3PX3A 3BZBA 4BY9E 5M5BA 4V0RA 3I5UA 2QE6A 3UJ6A 4IV8A 1YB2A 3BWBA 4RTNA 3E05A 3NTVA 4EQZA 1NW6A 2ERCA 1G55A 3I58A 3SR4A 3ID6C 2G72A 2NNWB 3NWBA 1N7JA 3ORHA 3MGGA 3HVHA 4M36A 4QTUB 1KYZA 4QPPA 5DM1A 1NBHA 3M4XA 5GINE 4PYOA 5LQCA 4EKIA 2OY0A 2A14A 3TRKA 3FTEA 3EVZA 5K0LA 4YV1A 3OZSA 3TQSA 4HH4A 4GOOD 3FTDA 1NW5A 3ELUA 2XYVA 1AF7A 1SVUA 5DPMA 3MTEA 2Y1XA 2P3OA 5T6BA 3UJDA 3A25A 3P71T 3KQMA 5GOZA 4FT2A 1YUBA 3P8ZA 5CVDA 4E2YA 3T7RA 2VDVE 3LX6A 3UA4A 1JR4A 2HMYB 3LL7A 1KPHA 1FP2A 4PNEA 3A27A 3LDGA 3SMQA 1XJ5A 2FPOA 2HTEA 4GC5A 3FPFA 1PRYA 2NXJA 4R8SA 3GGDA 5EC8A 2HR1A 2FK8A 4GEKA 2EG5A 2OKCA 2B9EA 4R05A 5LQUA 1YF3A 5BXYA 4HSGA 2YVLA 4YV0A 1BC5A 2GB4A 3EVDA 1L3CA 3LBYA 4KDRA 5FCDA 3GRRA 1RI1A 3I9FA 5IKMA 2UYHA 1XVAA 2VS1A 2XYQA 2PBFA 1I1NA 3E23A 1DCTA 3FRHA 2PSSA 3OU6A 2YXLA 2JHPA 3UFBA 2AOTA 4FSXA 3AY0A 5GM2A 3EGIA 3FZGA 1KPIA 4CTJA 2PWYA 4PYKA 2PX5A 4V0QA 5ICGA 5E8RA 5BP7A 2IBTA 4HG2A 3SXJA 4HC4A 3OFJA 4EVIA 5EEGA 3FPEA 3R24A 1P1BA 3H2BA 4QPNA 2PGXA 2ZIFA 5F2OA 3S68A 5JR3A 5DX0A 5K0EA 5FQNA 3ELDA 2AN3A 5EZSA 4MWZA 3TM5A 3OU7A 4EKGA 1TW2A 3FPGA
chains in the Genus database with same CATH superfamily
2VF2A 1EJBA 1CBUA 2OCGA 1V3TA 2BHLA 3GELA 3KWLA 3VZDA 2P9GA 2Q27A 3HJHA 5EWJB 3WE7A 1PJCA 2GAFA 1ZGCA 1Q0LA 2VTKA 3INGA 1P61B 2JFVA 4MQ5A 1L8LA 3INRA 1OFHA 1SHUX 2VDMB 1Y37A 3F9IA 4KLRA 3FLBA 1M74A 1RHUA 1M5UA 2RGNC 3MT8A 1PR6A 3NRJA 1NGSA 4R2KA 4E30A 1LRLA 3Q12A 1E4YA 3QFCA 4HS9A 4V39A 1O58A 1YH3A 2YWBA 3OTWA 3OHPA 5DHAA 3L8DA 4ZQFA 1YVPA 4CVNA 5CJ2A 3KOWA 2CEKA 1BROA 1XDSA 1J90A 3LQRA 2FSGA 1FUIA 1RRKA 1U1GA 3CZPA 3DO8A 2IK8A 2OGWA 3K15A 3QLVC 3ZNNA 3EVGA 5BQFA 1NP7A 2O8NA 3K09A 2O20A 1RM3A 4Y1RA 4DSUA 3L1JA 3D5QA 5F52A 4R3UC 1F4PA 2ONYA 1MDFA 3DTVD 4IVQA 1A9SA 5K01A 3ABZA 2NWQA 5E9WA 3IVMA 4D4HA 1T9HA 4DIKA 1JHYA 3BF7A 5ARBA 1EDDA 3FYUA 2IOFA 1MB2A 2I4MA 3O9ZA 1OX6A 4LXTA 2GDZA 5GGXA 2RGEA 3PV0A 2AH5A 4DMMA 3NKVA 3BFXA 3JVDA 4IDQA 5SYAA 2RAFA 1Y9AA 2H52A 3GRKA 3TKYA 5EUQB 5IHXA 1KYIA 3T4XA 3OVMA 1HE1C 5JJIA 3E03A 3MTIA 4LY3A 2P9QA 3TOSA 3KYDB 3MVEA 2AOXA 4R2JA 5EMJA 4ESEA 5K8JB 2XWPA 4ZCRA 3OM1A 4MAFA 1PK8A 2E82A 4K9PA 2GHTA 4HRYA 4O02B 4XPZA 4PZCA 4DC1A 2IY8A 3HXKA 3IV9A 2WSSA 1NU6A 5KOYA 5K51A 1R0CA 2WP8J 4CLOB 3PWZA 3AR6A 1JIVA 4HQ6A 3KPJA 1LJLA 3IQEA 4ZCPA 3PX7A 1HK7A 1P1CA 2BP7A 3NM6B 3X44A 4U7TB 2C97A 5B6IA 2HMWA 2XYGA 4L0MA 1UINA 4B31A 5FULA 2DR3A 4OM7A 1PG2A 2CWWA 4GZMA 3G17A 3KXKA 4J4HA 1B2RA 2JIOA 3CH7A 3JZMA 2XCQA 4L3WA 3TOCA 4CKWB 1BW9B 4ILEA 2XCSB 3MSXA 3U44B 3VSCA 2C8VA 2I1QA 3LWBA 4L50A 3ZBTA 5CEJA 1OI2A 1TUBB 4E2FA 1SR8A 3LC7O 4NK4A 4A4DA 1NLMA 1E2BA 4V02A 1NXSA 1SOMA 4KKVA 4ITRC 3CW9A 3SQMA 3TTVA 1C0EA 3IHWA 1SBQA 2DE0X 3F8WA 3NUZA 3WIVA 1VLJA 4QYXA 1B1AA 1VIVA 2P30A 3TQRA 4G0VA 4E3WA 5AM2A 1XCGB 4FJ1A 4C4ZA 5AVOA 3KVRA 4US2R 1FMFA 4NQZA 3A1NA 5AXBA 3LUKA 1OFGA 1HKHA 2V7WA 1PR4A 4CG1A 1SQ5A 1XLTA 3VDNB 5A1JA 3CNLA 2XA2A 4P6VF 1TJ3A 2BRUA 2HFJA 5IF9A 1SO8A 3L0SA 2FK7A 1ZDMA 2BFBB 4UULA 2PZKA 1W0JA 4W8HA 4WNCA 4AJKA 5JWRA 1OYVA 4ARSA 1ZUNB 4TKVA 4FK8A 4F3KA 4Y6LA 1HLGA 1GYPA 1QYRA 1VJTA 2WYIA 4G41A 3WRVA 1YDHA 3GRUA 4P3XA 3LFTA 1Y3HA 5AICA 3I23A 1MZPA 2C07A 3LECA 3A4IA 1A9RA 4H16A 2I4NA 1YT5A 5THKA 3UWMA 3SFTA 1CZOA 5CA0A 3P0RA 4RGBA 3WKEA 1RU3A 3G2QA 3E82A 1U99A 4LDZA 4Q66C 1WVMA 3KKZA 2GEUA 3QEJA 5F7ZA 3VYSB 3O38A 3DD5A 4OHBA 4IJ6A 4E6PA 3FOEC 4F3NA 4N7RA 4W4TA 1E6EA 2FE4A 5FR2A 1M67A 2GT1A 1Q14A 2W2LA 2WTXA 3Q7RA 4CM8B 2P2SA 3D2AA 4QYWA 1WDMA 4D80A 5BWLA 3CH6A 4BQSA 2AX3A 1FFSA 3OJOA 5K8VA 4HTFA 1P0PA 3C7CB 2XJ9A 3SXUA 3CG4A 2W2NA 4M1ZA 1NKSA 3SYKA 1B0ZA 3LKZA 1I9CA 2VWQA 4MMZB 1MEEA 3I9KA 4D4JA 1CVRA 3B38A 4Z4EA 4OUKX 4C6HA 3SX4A 4GZ6A 1FTWA 1BN7A 1CNMA 4YPVA 3M81A 3P9SA 3PP8A 5ALHA 4EO7A 5DHSA 3UJ8A 3IVXA 3DVAA 1MJHA 4IQGA 3MUOA 3EZ7A 2WJ6A 5A6SB 4HT3B 3GRVA 3I9OA 1GRNA 2YJ3A 1K3FA 1Q83A 3H2JA 4N18A 4PG4A 5HF9A 4JSRA 4ZI2A 1EX6A 1DKRA 4I9UA 4EJSA 5I9NA 3F96A 3NTQA 1OLXA 2BTOA 3EDRA 3S99A 4HVCA 1L5VA 3EGVA 1P4HA 4ZEVA 2BGNA 1U7WA 2FSPA 1RI4A 3DE2X 1F1JA 2GH1A 3M6MD 3MOGA 5HZKA 2DFLA 5FPTA 2F59A 4OH7A 5KKNB 1KZGB 4HUTA 3SZRA 1O94D 1GV1A 1UBRS 4F45A 2C2XA 3DC2A 3DM5A 3AEYA 3LDUA 3THXB 5A0TA 3DFMA 2HRRA 4CPDA 5BRNA 1VPDA 1MP0A 5A7FA 2XGJA 3H2GA 4O4HF 3EIQA 2CJWB 1H2HA 3L1KA 1B3BA 5BVHA 1F2VA 3QPUA 1WBJB 4X5OA 1Y6ZA 5KQPA 3T3PB 3IBGA 4YH1A 3THOA 3V2GA 2GCOB 2HJWA 4B79A 1PNQA 2G07A 2N1MA 3MJTA 3DEZA 4AN0A 4XIIA 2VUSA 4ZCLA 3RSOA 4DLUA 2I33A 4OJQA 3OQIA 1S6YA 4PO1A 1W6UA 4MUKA 3ER8A 1JL3A 3EISA 4HX2A 2IP1A 4L4YA 3R74A 2AN4A 2VUUA 1VG9B 1K9SA 1DAPA 1ONNA 4QYIA 1CR4A 1TLTA 1W59A 1A9QA 3GLHB 1EVYA 1SZCA 3KO8A 3L18A 3PU6A 1O4VA 5DNWA 4XEHA 3RSHA 1H3FA 3RUPA 3V34A 4B2YA 1TM7E 1S3GA 2C5FA 1E2FA 2ETVA 4IDBA 3GJ5A 3IUSA 1L4MA 2BM0A 4F8EA 4XDGA 1BQ3A 2DB3A 1OT3A 3CF2A 4Z3OA 5DBIA 4GS5A 4UCXA 1QBGA 1IN4A 3GA7A 4BMCA 1NPTO 4B8YA 1DTEA 3AEXA 3O8DA 2AE1A 4YJDA 2VXOA 1Z8HA 4PR3A 4JJ4A 2WIKA 5CNKA 2GNAA 1ISHA 3EGDB 1KI6A 3RSSA 3V46A 3DZJA 1MB3A 2VP9A 4PLPA 1YS4A 5LFAA 1U7OA 2QNIA 2M1XA 3O7WA 1MJGM 3A04A 2ZITA 3PQ3A 1U3FA 1UZUA 4XB1A 4XVQA 2QPTA 4BC0A 1UZNA 3BTUA 1FDIA 5EERA 5AJVB 5IXJA 1EP9A 2F00A 1A9YA 2EJVA 2FQ1A 1O97D 4ZT5A 5JAUA 4X54A 2HNBA 5HW0A 1KAHA 2R86A 3R8CA 1XZGA 3UB2A 4J9UE 4BKOA 2BGJA 1TOAA 3IESA 3M7IA 1T6ZA 1O94C 4J0HA 4BTEA 3KKMA 3SM3A 3OIVA 5DB4A 1Y4AE 4FZJA 4QFBA 4RD3A 3KV1A 4BOYA 2PGIA 3OESA 1B8NA 1IK4A 1V43A 2PX2A 5CYGA 3GEEA 4RW0A 5DK6A 3ZD6A 3KR2A 2QTWB 4U7JA 5HIJA 5ALJA 1ZRMA 4Z8YA 2OORA 5FA5A 4DA6A 1CQJA 3BGOS 2JANA 2HYDA 2CSXA 3D6FA 4HAVA 4BV3A 1EUCA 3LLMA 3QVKA 3A6HA 5L53A 1A1VA 3R0JA 1XK7A 5FNZA 1C0PA 1EZ4A 1M73E 5DBOA 4P54A 1SY7A 4X64B 2HB6A 1M2OA 5AW2A 1EQ2A 2QROA 1D2RA 2G9UA 4EA7A 2OILA 4PTZA 1BKYA 4TUYF 3O93A 4JOCA 2M6RA 3OKFA 4MINA 5FBVB 1S8OA 1Z0UA 1P60A 4NFLA 1Q22A 3AZOA 2GD6A 5C9ZA 5KYXB 3C3XA 1QB8A 4C4XA 2DERA 1R6DA 1RLUA 2HJ9A 1PO7A 5D01A 4OX9B 1GCAA 4NL4H 2QP4A 3VPFA 2XGGA 3LTNC 3CNHA 1JQBA 4RH3A 5J9FA 2XMCA 4ZVNA 2O9JA 1DDOA 1SA0B 1SH7A 3KK0A 4IXNA 2QIPA 3Q3IA 3QOYA 4BAUA 1RWNA 2Z2IA 1D4AA 1VL6A 4B76A 4EK9A 3E7PA 4ZXPA 3L5KA 4Z5XA 2XUFA 1IY9A 3IT2A 4AJ1A 1PHRA 4TS3A 1IOZA 1AY0A 2FZLA 4IFIA 2YJ5A 4ISCA 1ZH8A 3GJ4A 3GLTA 1ACMA 4KUHA 4MV8A 4PE5B 4R1NA 5TQVA 3U4GA 5HXAA 3O95A 2WD8A 3EVCA 3OZBA 4OSOA 5DO9A 2ONJA 1UAAA 4I1YA 4ZAXA 1XCLA 4FLMA 5FQOA 3I2GA 3ZHQA 4DNFA 2G83A 3CEMA 2OHHA 4KOAA 3EFOB 5I8WA 1IZ0A 3BD9A 1F4VA 3AZQA 3LSTA 5KS2A 4DY4A 2CY0A 1P75A 5ALUA 5E8JA 2P2LA 2O6LA 4YMGA 3HADA 3PUIA 1KXJA 1PFUA 3CLRD 4POAA 1R50A 3A2LA 5BUZA 1DAGA 2WR8A 3CW8X 3DUFA 2PZGA 4OKSA 3A37A 1WG8A 2RCNA 3A9VA 1F2UA 3DT6A 3BYZA 2H4JA 4JLBA 2IUTA 2OB1A 1IBMB 1W4ZA 2K7FA 4NCJA 4RL6A 3GCWA 1QH1B 1YS1X 2BDTA 2R1VA 3SSOA 3ZV5A 5CDGA 3LDFA 4LY0A 3SS7X 4G5FA 1WDLA 5JECA 3FCUB 1APBA 1AG9A 1RWKA 3U3KA 3D6JA 3REQB 3KKPA 3DP7A 2WKSA 4MK4A 4MUEA 2JIZA 3VZQA 3KQYA 1KSGA 2ZTMA 4RO0A 5ALGA 3WGVA 4AXXA 1XMIA 5J2UA 4Q7JB 5IH3A 1PV2A 3FTCA 3U37A 3WK5A 2OZLA 2Z8XA 2PJZA 3PDHA 2A7QA 2FPXA 5CT5A 3NHPA 2XBLA 3NC4A 4G3XA 3RIXA 3W4IA 4CLXA 2IV3A 5EJAA 1RQPA 1SIBE 1W34A 1WUKS 1ZITA 2JIBA 2ZYGA 1QH9A 3Q5DA 2BTQB 3D2CA 2QSYA 1KMHB 1V7QA 4L95C 3U4CA 5AWFC 1N5IA 4MLPA 1DL5A 4ECEA 1XZFA 4DLPA 1J1ZA 4PXYA 1EQAA 1KO5A 2QJTA 4DS3A 4XWOA 2BEJA 5IAEA 3JQAA 1Y34E 4FGWA 3ZK9A 1UXOA 3CU5A 2PKQP 4UTVA 4FBGA 4OPMA 2B37A 3AF6A 3H9UA 2O14A 4FN4A 1HRKA 3PQFA 3DH0A 4I4TA 5DU2A 4DNOA 3MWEA 1OA0A 2XDAA 1BA3A 4B73A 4DJEC 2Y0CA 5B6JA 3DDCA 2IS6A 2QSUA 2X76A 2ZUBA 1XNRB 2JD0A 1CR1A 3BZBA 3MW8A 4L08A 3W7BA 1PUJA 4FHEA 3CFYA 1N36B 4ZPJA 1HO3A 1OWMA 1GUDA 3U0BA 5AI6A 1WMDA 1OWNA 2IXAA 1RQLA 1GNRA 1G5HA 2BMAA 4R41A 3R76A 4EJSB 1TLLA 2IUSA 3HVHA 3ORFA 4GYYA 1CV2A 5HJ7A 3GLFA 3EEBA 2BT4A 3RJTA 4W6ZA 2OD2A 1UFVA 3O4RA 2JCSA 1MC8A 4QUKA 1R2QA 2CNNA 3T5TA 5IUNC 4CM4A 3A9RA 1H1TA 4Y2RA 4LOKA 1V11A 4Y2JA 3VDXA 4EL0A 1CUBA 1W75A 1N6RA 5A71A 3ZHZA 5E7MA 5EIOA 3PPWA 3NDBB 1CS0A 2FFJA 2OZPA 4NYIR 4Q93A 3P71T 4TTJA 5BT8A 3FOZA 3AUAA 5ALYA 5IBQA 1C1DB 5M7EA 3ETHA 4TYPA 2HMYB 1Z0JA 4LTDA 4QYIB 1R64A 3DCYA 3NOOA 4GMKA 4RJTA 1ANKA 3A27A 2O0JA 3OPQA 1N5DA 4I5EA 1NASA 4Z51A 3SKYA 4PEVA 1DJPA 2AJCA 4PPFA 1AXRA 2CHQA 5DBHX 2X19A 1PJ8A 3HXOA 2XMSA 1E99A 1U7DA 3MLAA 3GFFA 3RNOA 1L5HB 2V4ZA 1Z7BA 1EVJA 5KINB 3I9FA 1YRYE 1EGHA 3SOPA 4COKA 5J4KA 2AOTA 1L1RA 3LKBA 3VV2A 1V25A 4L8YA 2Q6LA 4CYMA 1TZMA 2PX5A 5E8RA 3HUFA 2PH3A 2HQBA 3SXJA 3AI1A 4HC4A 3BD7A 1WM1A 4EVIA 5EEGA 5EINA 1UKVY 4I5FA 2GHQA 5E9AA 4LFCB 4A27A 4P2BA 3HUTA 4ZI7A 1SXQA 2J1LA 5EZSA 3DL2A 4EKGA 1NOKA 3UYKA 2Z56A 3H8VA 4MMXB 1JSLA 4KU4A 1L5LA 1RLIA 4OD0A 4RA9A 2QN8A 3WV5A 2ZANA 4DARA 3IE1A 4XCXA 3RYCA 2AJDA 3FZQA 3IQFA 3UKOA 1VKNA 4KRXA 1AUOA 3W7VA 4BEVA 1ZVKA 2WJPA 4C9BA 4Y6RA 2DXIA 2WF5A 4R2IA 2RHMA 3KB2A 4MB2A 1RKVA 5JADA 1ORHA 1S5PA 1DKNA 1G8YA 2H4XA 2V65A 1LD3A 2KW5A 1TW3A 2MSWA 5G02A 3N2YA 2HMVA 4BV9A 1MV8A 5FTWA 3B3FA 2G4LA 3H1PA 1T43A 1M1XB 2PUVA 4K8OA 2BUCA 1GCOA 1SG9A 1P4GA 1EVEA 4QNMA 4DUPA 1P81A 3IB6A 3ZV6A 2VPTA 3L79A 1PL8A 1ZW1A 3QNUA 4UPEA 2ZLBA 3DAOA 1EFRD 3BCRA 3OCVA 1SKAA 2XQGA 4KYIB 2FJUA 4M21A 4R9SA 1AIPA 3RAEC 2HGSA 2WWFA 4RSRA 4WY2A 3QKWA 3LCMA 3DXXA 3F6YA 4P22A 4WX2B 3L92A 5ALSA 3RLFA 5C0OE 4LECA 1W48A 2Y67A 2CXNA 4ZZIA 2BPOA 3ZIAA 1I6KA 4KLAA 3GWZA 3UMVA 5DZSA 1FFBA 2NZUG 4QOSA 1P33A 1R3UA 1W581 1G5QA 1QGDA 5D2CA 2QTNA 5AUQA 4CV0A 4ZGBA 2PMFA 3PLRA 4DJTA 1C3LA 1DAEA 2NV6A 3P9XA 4JZKA 5TDHA 1TYZA 3IUBA 1KDRA 3NYQA 4F06A 1XLUA 3IAXA 1HV8A 1R5OA 2X2EA 2XQFA 4FHDA 3SHWA 3TNJA 3TR6A 3VZPA 3JRXA 3GVHA 2D7CA 3MRTA 4US0R 1A72A 4WW0A 4OO3A 1ZC4A 4I55F 4Q4AB 2I7XA 1TQ4A 2X9QA 4IIBA 1LKZA 5F2NA 3PI6A 5AW1A 1RZRA 2Q8NA 3N0XA 3V8EA 4LRWA 2VPIA 3BCHA 4KRGA 1SU6A 3BRWD 3Q9NA 3T1QA 3VX3A 2WWRA 1ZW6A 4OXKA 5AHRA 1YBHA 5DM4A 1MU0A 3JU3A 4Q3KA 3VO1A 1U0TA 2E2WA 3DDZX 3TMKA 2FNAA 3WZMA 1MO5A 2C59A 4NATA 3ZHUA 4Y9TA 1GAWA 1J25A 1K4KA 3A6EA 3R9IA 3GBSA 2J9XB 3UXMA 1ZMRA 4YBRA 1GG9A 3B6EA 3PPIA 2CLFB 4OFZA 4YJKA 5KYUA 2J6HA 4TV8A 3UHAA 2XF2A 1B6GA 4OJMX 3NM4A 4K2AA 2ZRLA 3EGEA 4GMFA 4MS4B 3WK8A 5B7PA 3GJ8A 5EJEA 1HTBA 2GBPA 2HBZA 4DT1B 2QRLA 1ZNXA 2ODTX 4C43A 1PIWA 1RRMA 1THGA 4YMHA 2D3TA 1G8PA 2WHRA 3BG5A 1NDQA 2R8OA 4B17A 4Y2SA 4EZEA 2XKKA 4PBRA 2V0GA 5JNTA 1XRJA 2FG6C 3DOCA 2AJBA 3VI4B 1PQPA 4K9MA 4MKFA 4OQMA 2R8EA 1YRLA 4BHTA 1E4OA 1XV5A 3ESXA 2IE8A 2QL7A 3CZAA 4YV2A 3EXIB 1MV5A 1RJDA 2CVZA 3NWPA 5EE9A 2A33A 2ZJBA 5JOQA 4GKKB 3VU1A 3L7DA 1G7TA 5T4BA 3VZBA 2AGVA 1QUEA 3BE8A 4BFVA 3OC0A 4E7PA 3WYBA 5DIZA 1TZ2A 1NMYA 1L5HA 3A3OA 1OE0A 3VJRA 4QECA 5CFQA 2JJ1D 3Q9UA 4KR9A 3VPAA 2R62A 2P2ZA 3L0PA 2C2ZA 2H4FA 4XAQA 3DEYX 5H02A 5JSFA 2UXBB 2OP1A 1E3WA 4UXIA 3UGKA 1NUUA 2XB6A 3IMCA 2ZJAA 4KAFA 5JH7A 2IZOA 4BGVA 3TZCA 4ZYXA 4J0QA 3GHYA 1LJ8A 4JP1A 4C4TA 1Z5VA 2PR2A 3E0XA 2V7XA 3NHRA 3NXKA 2DTEA 4OHUA 4EG0A 1ONBA 4IS3A 1PVVA 2IOYA 4Z49A 3QLUC 1USKA 2AFVA 1X8JA 3KR1A 3QU4A 4URWR 4Y6PA 2GTPA 1PGQA 3EA4A 3OPYA 5JZVA 3H5NA 4OLAA 4Y9RA 5FPHA 1HNZB 4M4SA 1NLYA 1S3IA 4V0MA 5T6MA 2ZJYA 1GGEA 1MX5A 2LW7A 3F6SA 2C4KA 1P1IA 3G1TA 4MIKA 5JISA 3FUUA 3T4PA 4EVSA 3EXEA 5HIAA 3H65A 4KXQA 3FNRA 1OILA 5CTAA 3WKCA 3A2MA 2PVCA 3EDQA 3PF9A 4A91A 1RZRD 1NQ5A 3EXFB 6REQB 4HUJA 3GEGA 1ENPA 2QX8A 2AXNA 2X1HA 4MRMB 5CXSA 3DV2A 3K6KA 5F77A 1Z6YA 1SUAA 1EDZA 4CWAA 4Z4FA 4JQCA 1NJGA 4Q6BA 2AFHA 5KVQA 4HPJB 5TMDA 4AUEA 5EWJA 4WWHA 1VJ1A 2CUTA 4WZAB 3WIBA 5IAAA 4PYQA 1BWQA 3GRAA 3VU3A 3S2EA 1X2EA 5FOVA 3A1CA 2GM9A 1X7GA 1FRQA 4BQPA 4KO8A 1K8QA 1YVUA 4TLBA 2KS6A 1LY1A 3NTXA 3O1HB 4AZWA 3VZCA 2ONKA 3QVLA 4CBVA 2DBRA 2OUIA 3DDNA 4Q21A 1Y8AA 5K0CA 3D3EA 5ALOA 3E3OA 3K1JA 1T6XA 4PYLA 2OL4A 1WB5A 3ROTA 4B48A 4EYOA 3QELA 1Z0AA 2VTDA 2V5UA 1BKSB 1NLZA 1CZHA 2BMVA 4NOJA 2O2SA 3RS9A 5JSYA 4FYJA 3SG0A 3SFZA 1INLA 4BJ5A 1Y8ZA 2QVBA 1I2BA 4MO9A 2JNWA 1GRQA 2P2CA 1XK6A 1Y6JA 5KCMA 3SQNA 3WGOA 4BZZA 3W7AA 4HGQA 1XEAA 4PZ0A 1BU5A 4BWYA 2CXOA 2F1KA 1OTYA 1P80A 4W5JA 4D02A 1OROA 1HZZC 1QFYA 1XDWA 2WJIA 3EXG1 4J91A 4WVFA 4A0HA 1H0RA 1CZRA 4RVCA 5DWDA 5JPDA 3Q8KA 1Q1ZA 2BSXA 3Q6IA 2SICE 4TMXA 5CT6A 2EBUA 1G6HA 5H3CA 1I33A 1IN1A 3GX1A 4JJIA 3OLZA 4REQB 2WDZA 5DM60 4EECA 1V6AA 4PZEA 4GBMA 3EJWA 5AJUA 1WD7A 5HA5A 1QCDA 5KVSA 1NUPA 1V9LA 2PK3A 1ORRA 3Q7EA 1QVRA 2JD1A 3IT0A 5D1HA 5F9FA 4ZYYA 5FBWB 1AA9A 1QH8B 1V9CA 1ZU5A 3L01A 5DHQA 4AJ9A 2GN9A 4CDGA 9LDBA 2RGBA 3IELA 4Y2TA 4CIVA 4XYGA 1Z2OX 3EXFA 1O3YA 3ZWNA 6REQA 1GPMA 4NCBA 4DNXA 1EFPB 1NVBA 2C1XA 2CC2A 1PE0A 1BSVA 2FHPA 3DHNA 4KO4S 2QTFA 4N7MA 3EWAA 1UADA 1SB8A 2NM0A 5A4JA 1Z0FA 3FIUA 1SCQA 3CLTD 3NEYA 4WNYA 1YFLA 2A67A 3LHKA 4RPCA 4YXWD 4ENSA 2R47A 3V3TA 3VVLA 2G80A 2RG7A 4W5TA 3ISVA 3QMMA 2AG5A 3HYTA 5IM5A 1ATIA 4TLDA 3UWKA 3AUYA 2OM2A 1Z0ZA 1R8QA 3U3MA 3ROQA 5KWJA 2C00A 2OLKA 5BVGB 3G5AA 3SPXA 5K1ZA 1WL8A 4C0KA 1BNCA 1BYIA 1Z4MA 5GZ1A 1G2IA 2F1HA 3LW8A 1B0AA 1X7WA 2XNCA 1U2SA 3PG5A 4JWKA 4O5OA 2J0VA 2BBOA 4UNSA 5EE1A 3FF4A 5I6DA 2FZCA 2WV9A 4OLHA 1UH5A 1RRPA 2JFNA 2J07A 1WHTA 1E9DA 1KERA 2DHQA 3BH0A 4GGMX 1R6UA 4Q5IA 1KQGA 1DKMA 1XO1A 4M8SA 3OSZA 4I8XA 3EC2A 4Z7QB 2VFAA 3AV0B 5IYZA 4LX0A 1HQCA 1TU3A 2F3SA 2CVFA 3WGZA 1B6TA 1KVQA 1H93A 2C9ZA 2X23A 4ZDKA 1R5NA 3UUEA 4B6EA 4E4TA 2XVAA 1BXGB 2F1RA 5K0ZA 1ZFNA 4L4UA 3F97A 4EZIA 4NJEA 4UEJA 4TT3A 3KZ1E 4ROTA 5AKEA 2P77A 3LQFA 4BLOA 3DFFA 4DBLE 1C80A 2TSYB 9LDTA 3N2LA 4C7OB 1Q44A 3I3OA 4HEA6 4HMOA 3C5HA 5AUOB 2YCBA 3H83A 3KTOA 1KNQA 2OV6A 1Z17A 1PGJA 1XROA 1YVEI 4B4KA 3C24A 3FRJA 2VPWA 1F0YA 3JZDA 1ZSVA 3AOGA 3LQYA 3NBQA 3QNMA 4KE7A 2D2IA 5AM4A 5JFOA 3KM0A 1LC0A 1R1DA 1U9ZA 3TTWA 4EEXA 4L02A 3LDHA 3F5MA 4XX0A 1U63A 4D9EA 3VVBA 3HJGA 4FDTA 4EHLA 4J1NA 4OHVA 4EKDA 3OFVA 4QPZA 2RK6A 4HNUA 1UR5A 2XCLA 2XUIA 3V8BA 1UMDB 1GPUA 4M9XA 2X1VA 3ZVRA 4DF3A 3ASZA 3G5LA 4GP9A 4AT1A 1NYQA 2JAWA 1JS1X 2DECA 4RFSA 4YS6A 3GK3A 2P9JA 2WVHA 4FILA 3U7QA 2OHVA 3MYYA 5C35A 1UAYA 4Q82A 2Y9PB 1PD0A 3MERA 2HUPA 1L9XA 2FPIB 3DZBA 3F74A 3HDHA 4ZAVA 5HG0A 2QRHA 3HJAA 1QFZA 1ZI6A 3UHOA 3GJTA 4LXGA 1ODIA 4NZNA 1T1RA 4LVCA 4RQAA 4AG5A 2ZKLA 2BKXA 3IIKA 3SICE 4P36A 3K0AB 4KPYA 2N46A 2A5LA 3WKBA 5IPFA 3EGDA 3CEJA 4M9QA 4ER0A 4Q4HB 2JCGA 3T3HA 3EA0A 1O57A 3ASUA 4MPJA 4F3YA 2DQKA 4ND8A 5BSGA 3CX6A 1OW3B 3O92A 1QHEA 4IIYA 4QEZA 4B3DA 4E5MA 1MA3A 5LQMA 4XYMA 3KB1A 5A4FS 1ORVA 3PITA 2IF2A 2YVKA 4W99A 4TWZA 3CYFA 3H6KA 4EHHA 1XVTA 2QBYB 4RVUA 3GNSA 3OTQA 4JT9A 4O4IA 4A5OA 1A1SA 1Y8QA 1MAAA 1GCGA 1JU9A 2YFKA 3Q10A 5C80A 1Z18A 1CULC 3HG7A 4X92A 3FYUB 2C2GA 1VSTA 1E0KA 1JR3E 4ISBA 2XA9A 3RSLA 2B78A 5BQ5A 3I8XA 3L6UA 3UAWA 4EB0A 2VK8A 4N3BA 1GPNA 3JD2A 3MFYA 1NNSA 1J39A 1EWKA 2PRKA 3W8EA 3TDMA 5C4IA 5GY7A 3AIKA 3PGA1 4IJKA 1TI7A 3COPA 3DNPA 3RVDA 1RLTA 1ZUHA 1RHRA 3AVTA 3ZDCA 3A3KA 3FF1A 4ZDIA 1E6UA 3I28A 4MVJH 1PW7A 1EM8B 5K45A 3NHAA 3L0OA 1IVSA 2ZUDA 2AD1A 3GMSA 5BOVA 5SICE 3I04M 3FTPA 5KU7A 4WSOA 3TVYA 3LE8A 3PUYA 3FCOA 3JQRA 5EZQA 4KRFA 2RC5A 2ZTHA 1P9OA 2IOFK 3FUXA 1QTRA 1C1HA 3MOSA 1BHO1 1TQ8A 3DZGA 3O1LA 1FRZA 3SJCA 1N0VC 4YAKA 3ZE1B 3MS2A 3JTMA 2CZCA 3OQVA 3NVMB 5FUQA 4IR7A 4XLLA 1TO6A 4MGKR 3T15A 2FUCA 3WLTA 5EHXA 1JJIA 3VDQA 2WAXA 3BL5A 3MWFA 3PXEA 2NUAB 4AL4A 1J97A 5LBTA 5KJEA 4MKRA 1RC0A 2X3UA 2PXHA 3HU2A 5K3SA 2OVFA 1IEXA 1ZUD1 3Q40A 2OFOA 2EYQA 4B6FA 1G0NA 1N7JA 2OC4A 1M2FA 3AUXA 1TKAA 1UBJS 4CKXA 4YR7A 5EIXA 3L8MA 5H81A 2G9VA 3FTEA 1QO9A 5K0LA 3OOJA 3UC9A 4L7QA 5LIRA 3LX5A 5EQDA 3FTDA 5L4LA 4N54A 1H4TA 1J0XO 3CM0A 1XCMA 4JC5A 3HJCA 4LYEA 4BPRA 3S44A 1E0DA 5FO1A 4FT2A 3ESDA 2OXCA 1OGIA 4UU1A 4GE3A 4A0GA 4ZMRA 2VDVE 2WINI 4N76A 4BU1A 3ZI0A 1JEYB 1UODA 4EI2A 3K9FC 2PHZA 4A2CA 4CW7A 2NX2A 1L7RA 3I76A 3UHFA 3KZKA 3QVVA 2O2IA 4UMFA 4AY6A 1M8KA 3R20A 3S28A 2VSXA 4JC4A 4R8SA 3LZ6A 1S8FA 1QP8A 2GLXA 1MOQA 1DQYA 2R68A 3I6QA 3KSAC 3IDSA 3D3WB 3S8MA 3I62A 2C99A 1N32B 3EVDA 3RS3A 2R84A 1YB1A 2VNJA 1M34B 1A5ZA 1W49A 4R4JA 2BMFA 4IDDA 3NHMA 3B5EA 4OUDA 4RV5A 3WS7A 3P0FA 3QEOA 4KQ2A 1WPRA 4DDHA 2AR7A 3FKSD 4EJ6A 4B3IA 2FHSA 2QUZA 4X1YA 4HRVA 3ZZUA 2PIDA 3OWHA 3INYA 5ECGC 4ZHQA 4LFAB 1U1EA 5K0EA 4S2UA 4DMHA 5F1OA 5JR3A 2XD9A 5KOJB 4UTOA 2BFNA 5TVGA 1RJ9B 4QXOA 3A1UA 3UHJA 2NPIA 2Q0XA 3AHFA 3A6PC 3R6GA 1LSOA 2Z5VA 4DV1B 2JIDA 4JL5A 1M6VB 3LY8A 2JC3A 4RMIA 3STXA 3WMWA 1S4MA 3NB0A 4WBNB 3DXFA 2DSNA 4J1SA 3FFXA 2X0NA 3B3GA 2FWIA 1B8UA 1SCAA 4RLSA 4DM3A 3W2GA 1MO4A 1OD6A 4PS0A 3R3ZA 1H22A 3C14C 3KZNA 5HCUA 1T2AA 3G7NA 3KTFA 3PGKA 4TS4A 3VYUB 4EUSA 1RXYA 2G28A 4PC1A 4F93B 3I9V6 1F0NA 3VHXA 5J4HA 3HP4A 3OIGA 3S1AA 3AQ4A 3V7YA 4KV7A 9GPBA 3U7JA 4GR5A 3KUKA 4XDYA 2IVZA 2OQIA 2RGXA 4H15A 4EJ2A 4MYTA 1BW9A 1WUTA 4MR7B 5CDUA 3KZMA 5J59A 1NUTA 1T6YA 5C8XA 5J5VA 1JDJA 3GPLA 1KEKA 2O59A 2J3HA 4A2QA 4A36A 4R2WA 3SDBA 5AKLA 3VZSA 4A8HA 4MJ3A 1N57A 3ENWA 2HF8A 5FPPA 1MH1A 3O4HA 2XA1A 4OXNA 1JFLA 4F5DA 1KDYA 2J6BA 4E5DA 2QLTA 2V7VA 4WUTA 5ECDA 2HLDD 1GCUA 1HNXB 2WMNB 1T8TA 4JQZA 1ZJWA 1G63A 1M54A 3CVUA 5B4UA 4WBNF 1U65A 4NAUA 4X41A 5JCZA 1NTRA 1ZICA 2FZ5A 5TE9A 4E51A 3TEJA 3EZLA 4CN9A 3Q7IA 1I6LA 3NETA 1T10A 2XDYA 3O2QB 5DF1A 3KU1A 3VPBA 4GG1A 2MT9A 3DBVO 4BFYA 5BV7A 3DCJA 2CNBA 4EFMA 2NP7A 1DDIA 3R77A 1ZLXA 4J3FA 5JAMA 2O1XA 1T9CA 2PD6A 3GIDA 4YNBA 5A06A 1O9GA 2IUYA 1VSQA 2A0KA 3EF3A 2XT6A 2I62A 4BNKA 1RRVA 2ZUUA 3JAKA 2WPNA 5LQSA 5JNWA 5IM4A 4RMJA 2IP4A 1BXZA 2YH2A 5CEFA 3FJYA 1CLUA 1KI3A 3FJOA 1C0IA 1FFGA 5GOTA 4PG7A 3AHCA 4KMSA 5ALDA 2QI9F 1XCJA 3Q3GE 3HCFA 5DEIA 5FOWA 3U7QB 2K5UA 1T2CA 1G21A 2X9GA 4X90A 1FB5A 2VJLA 3KD2A 4GPD1 2B61A 4MVJG 4R1PA 3HR7A 3T0FA 2PSFA 4C2AA 4UUMA 3JD3A 5FI3A 2GSWA 3HN2A 4MQFB 4XJXA 1QIGA 1SPXA 5HNKA 2R7KA 1M2VA 4NCHA 4QU0A 4BMYA 1JHPA 2D4HA 1J2JA 1QAOA 2R44A 2RFLA 3S29A 5DHTA 4D42A 1PCXA 1LPMA 5AOAA 1LVUA 2PQMA 3UJ7A 1W5SA 2QVGA 1AKWA 3VNBA 1U8UA 2VEOA 4G5XA 2H16A 4JU9A 3O4GA 5KTYA 1F7VA 2GN8A 1FBNA 4OMFG 1EK1A 3N86A 1FSFA 1YA4A 4RA9B 5CPFA 2FA9A 4ENPA 1C8BA 4CQMD 2EAUA 1XU9A 3K1AB 4Y2UA 3DZIA 4R0VA 5DHFA 1BD4A 3D7LA 3FFAA 2YXNA 4UBIA 3IBCA 3ZCTA 4EQ6A 1KDOA 5SZIA 2V3CC 4IDOA 2H2IA 3F6BX 4FDAA 1RQNA 3WIEA 3GJZA 2FLKA 4Z0TA 1H2XA 2XUOA 5I4BA 1IZZA 1YSCA 4MV5A 1R8XA 3O73A 3RC1A 3U7FB 1OH5A 4LYYA 4BJ1A 5CDTA 1JDBC 1RAIA 4FS3A 1P2VA 1YCHA 3LIPA 2XLCA 3F6PA 5JQWA 1BEZA 5CX1A 4D6YA 2PS9A 4LBWA 2IHTA 4OKNA 4LC0A 4N8SA 2I4OA 4O4LA 1PSDA 3IOBA 4PO9A 3R8XA 4I9HA 4UBNA 2AW3A 5D87A 4TROA 4C5BA 1X7WB 1U1FA 4B5LA 1DJOA 4HJXA 4JBNA 3P32A 5B53A 1AS3A 2ZRPA 1JX6A 1VHQA 3D6TB 3UMGA 3VYTB 4YYEA 1BJTA 1DO2A 3CR7A 3C6BA 2Z6AA 2YUIA 3A6KA 4XEUA 3GT0A 3LVQE 3Q11A 3G2LA 4O59O 3R23A 3TMAA 5C8YB 1AH2A 3EDYA 3ZWOA 1JMVA 2R2GA 1FFAA 1JEEA 4CZ2A 4EYSA 3LCVB 2CKMA 2AEJA 5H9VA 1TTQB 3PNPA 5E0KB 2QQ5A 4LC1A 4RKFA 2HIMA 1USWA 4K88A 1OAOA 4WEQA 3DD1A 4MV1A 3S0JA 1CYDA 2HEGA 4KFSA 3QKSB 1OQAA 2X9LA 3NAGA 3IO3A 2NV0A 3N5KA 1NT2A 1K8YB 1X1AA 4A2WA 3DV0B 3EIXA 2C4MA 2IYPA 3PQ7A 5IM4F 4X8HA 5EZ6B 1I4WA 2Z58A 3DBOB 3E53A 4AKTA 2JFBA 1OLOA 4KXNA 1ORIA 1TA4A 3C1UA 2J5QA 2BTEA 3R6LA 5CCXA 3ZYZA 2ZJ2A 4U2CA 2BKEA 5A2QA 1L7DA 4IO1A 1P9LA 4INZA 3LAWA 1U0EA 2J9FB 3AF0A 3ECSA 3LUAA 1E7SA 3LBNA 4NCIA 4P98A 5LYJF 4NC9A 3QF7A 1L7MA 4YCMA 2OUKA 3SYNA 1K3TA 2XH8A 4IIDA 3E15A 2GQ0A 1EWTA 3V4FA 3HS3A 2QJFA 3IPCA 4GRAA 4X6LA 5HCNA 5KNDD 2EVWX 1KDPA 2P3LA 4FFLA 1DG1G 4HI0E 2DPMA 2DUUA 4HPXB 4UHHA 1E1QA 1E2JA 4JKIA 2OWEA 1A95A 3M8KA 1Y5MA 5D3KA 4BB9A 1P7PA 3K6SA 3OEYA 1XF1A 2JLUA 2C5LA 4H60A 4X6YA 2CHUA 3TFWA 4JBGA 3TRFA 3AB7A 3QBDA 1XZBA 4KRYA 5GTDA 4OUDB 5JS6A 2ZE5A 3UANA 1KVRA 2X7HA 5D6OA 3T3GA 1VRVA 3D0OA 3SIRA 3PIIA 5KDDA 1JE0A 2C7OA 2QTZA 2OCKA 1ZN7A 2PRSA 1GZ3A 4MRRA 4I5IA 4H6WA 5K20A 1RAFA 8ADHA 4K6GA 1G2OA 2A9OA 3ND6A 4EYQA 4NNPA 2ZWOA 3U7EB 2AOWA 2P9ZA 3KUXA 1LLCA 5KOHB 3TI9A 1FIUA 3ZU2A 5MFPA 1E69A 4O3MA 3IDZA 3LO5A 5JTUA 2P79A 3D3QA 5TPWB 2IYFA 2XUDA 1FC0A 4FI3C 1QHNA 2WWTA 1VL2A 2BGMA 1OFUX 3BB3A 4F4IA 4G67A 1LCIA 2GXQA 1XHLA 2CXHA 4JCCA 4L6IA 2WA2A 1GPDG 3OCJA 2XUQA 3CZMA 3ZLJA 2BGWA 4EHNA 5FPYA 2O1WA 4GIBA 1DPFA 4OAPA 4CM7A 1H1DA 1XMQB 5EJ9A 3K32A 2EEPA 3EW9A 3QBTA 4RMGA 1FUUA 2ZCVA 3NOVA 3QUBA 3R7BA 1DMSA 2FF7A 2FX5A 2VHVA 4QLAA 2JGMA 4BGUA 3OIYA 3N3BC 4WZBB 4TRMA 2ZBPA 2ZM5A 1Q92A 3O0TA 3G82C 3KEFA 4B9AA 1N6KA 3ZDRA 1P4JA 2XBUA 3UKDA 1AM4D 1Z26A 1MLDA 5AJTA 1U2DA 1GTRA 3AI7A 2FMTA 2ZYUX 5I7WA 2W8ZA 3NATA 1ZBQA 4RHTA 3QU9A 2WB2A 1HDOA 1KVSA 1ZGAA 1H9AA 4QELA 2WC1A 2R66A 4GQBA 4AUKA 3LWDA 5KJFA 2Z83A 3PF8A 3MQ2A 5REQA 2RHLA 4KJZA 4G0QA 4ZT2A 3H2ZA 3AV3A 4NZZA 5EIAA 1K6JA 1ZZGA 2IODA 3VMMA 1E3WB 5AR1A 2I8LA 4OMUA 5JZMA 1IAVA 3AI3A 3LV8A 3WA6A 1OVMA 2GCNA 5EI5A 5LA6F 3E18A 3U31A 5JH7B 2J6IA 1MABA 1IUKA 1IN6A 3I61A 1RHKA 4REMA 4UJ3A 3K4PA 1FVOA 3ND7A 1RLJA 3HCDA 4R7GA 4CF3A 2B5VA 1CZLA 5CBKA 5LN1A 3QE4A 2JBHA 1WOMA 3EARA 4ID3A 3PUZA 5EQJB 5HK9A 2ODNA 4MYCA 1NV9A 2YYAA 3AY7A 2L2QA 1ZOIA 1WSAA 3FBWA 3DOHA 5F78A 3O2JA 4HDSB 3OIDA 1CF2O 2JFYA 1W19A 2AZXA 1DXHA 2FR8C 4HDMA 3C6KA 3EHEA 2FJPA 3AXTA 2YMLA 5CFLA 3MF4A 1Q84A 4ZVKA 4BRSA 3ZGYA 2O0LA 1IB0A 4M0FA 3PQ2A 3FNGA 4QDKA 2XGMA 3DL0A 4KH1A 2YMMA 4EG5A 1NG1A 3DLIA 4WOKA 1RDFA 1YKSA 3LKDA 2MINA 4UE3S 3BDVA 3VKFA 4QDXA 3BBPA 1GXSB 1WXQA 1NC1A 3C8UA 4G5YA 3HBAA 4OP2A 5JCOC 3KLBA 2UZ4A 3CS3A 2P35A 3B8EA 5CB4F 1DKLA 5JVDA 2XSZD 3N58A 5BWBA 2GAJA 3NCHA 3PENA 2OBMA 3Q87B 3QKSA 3KQWA 4TV8F 3RO7A 4W1SA 2C03A 1UFOA 4PO3X 2ADMA 2B6HA 1GVHA 4GD3Q 2I3AA 2VBGA 1GM5A 4AKHA 1BYUA 1J07A 3P52A 4JYZA 3UFXA 3KZOA 2WYHA 3FMPB 1JU3A 3HGTA 2WKQA 4RA6A 5JU6A 2Y66A 2YASA 3PUJA 5J2TF 1MNAA 1FEZA 4E2XA 2NW6A 4L8VA 3PDUA 3TCNA 5HF6A 1E79D 3DFZA 4O4JF 1KYQA 1M5TA 3FCAA 3WO1A 1VYTA 3WFZA 5CA1A 4PYNA 2GEVA 5ALFA 1DAIA 4ZCMA 1S2GA 2FKAA 5ER9A 1FXSA 1FNNA 4M1KA 5CFMA 1M75A 3SSMA 1CY0A 1QRAA 3SSNA 5JQGB 1XEWX 1U2QA 4UM9D 9ABPA 3I2JA 1MJNA 3PIDA 1S3SA 2KBEA 2FN7A 3FLMA 4JQOA 2AN9A 2V0CA 3AFMA 3AM4A 4NCKA 3A9SA 2Z2ZA 4MQEB 2X58A 3B6JA 4JX8A 3DE7X 1OIVA 1JB9A 2C2YA 5K99A 4CKBA 2OLEA 3SBXA 1Y3CE 4BX0A 3N74A 3DBHB 2O2YA 2J0UB 2ZSHA 3N0VA 1CUJA 4K9OA 4KQ6A 4H1VA 2JA2A 4GLLA 3R7FA 3CB2A 2IEBA 1CUHA 3AW9A 4IP0A 4JT2A 3QVOA 4B47A 2PPLA 2Q2WA 1I7PA 5EMMA 2A1TR 2X9VA 2OCIA 1UOPA 3B3AA 3NDRA 4UUQA 4CFZA 5HKKD 2VJPA 3D6AA 4TWRA 2GPWA 3OURA 4R8MA 5K3AA 3O3MB 4WZBA 1L5MA 3QPCA 5J4YA 4CQMA 4F2PA 3AL0C 1TJYA 2IP2A 2ZQZA 1DU4A 4PZLA 5FWAA 2BUBA 4WZBE 3LUGA 3PC4A 1G42A 1RHJA 1P19A 2C8LA 2B82A 2CHEA 4RIFA 5CG2A 1Y4DE 2QN6A 3AEQB 2JLYA 2X4LA 1U9IC 4D82A 1I4EB 5DGDA 4X60A 1U28C 5FR1A 2ZVQX 1VOTA 2BH2A 1X7XB 4Q4JA 1T9GR 2VH1A 4GOLD 3O8OA 4KXVA 2WWHA 3G0DA 2ZB8A 3IPAA 1TUIA 5CURA 1Y3FE 4NV3A 3USES 4LXIA 3EZ6A 5IJ0A 1FSGA 3UPDA 4D9BA 5LWHA 3Q3EA 3RROA 1YK0A 4XTCS 2VT2A 4Y6OA 5M5BA 2XIJA 1QH8A 4JEHA 3ANYB 3EULA 1TFUA 3L0ZA 1KETA 4YRJA 3EIHA 5FEMA 3W5BA 4U2GA 1K98A 1AK2A 1IK6A 2ECKA 4G09A 4YGXB 3DHVA 2XRZA 1TK3A 5TEWA 2MSCB 3T9EA 3TTXA 3CX7A 5MGNA 3SR4A 2VZLA 1H2YA 1TM3E 5GONB 2G72A 5L7TA 4U63A 1I3CA 2E49A 1CK4A 5J1TB 1KYZA 3LW7A 4R81A 1QPZA 1FX0B 4M88A 1YJ8A 2RHWA 3PD1A 2XAAA 3HDGA 3A28A 4LJ9A 4X1YB 4ZFNA 2DR0A 1RZ3A 2YNMA 3EVZA 3HKEA 5MGBA 5GWXA 1FP4B 2ATVA 2ZAYA 3W9SA 4M0CA 1V4NA 2ZSBA 3TQIA 1NPYA 4MW5A 4BBPA 3KZCA 5A5FA 3E35A 5ADUS 4RL4A 2YOGA 2ZXEA 2OO7A 1VI2A 2BTQA 3QEMB 4Q37A 2VDLB 2BGIA 5A02A 3L4JA 1M8FA 1N1GA 3F47A 1KPHA 1JNXX 2FW1A 2X5JO 1FP2A 4FFRA 1WDWB 3G0HA 2GEBA 4KLNA 1XJ5A 4C76A 3L9WA 3I9MA 1ZO8A 4TM8A 5EC8A 4DLNA 4YK7A 3M9LA 3G2HA 2B20A 1ESDA 4MYUA 4BZPA 1M5RA 2IHZA 2I54A 5IT5A 1L3CA 3A6LA 4IINA 4LC9A 1BCRB 3T4UA 2GJ8A 2XYQA 4X3CA 5IANA 4W5RA 2A57A 4DCVA 1VKZA 1P7VA 1XGKA 4CTJA 3FYUC 2BSQA 1V26A 2NUPA 5LP6F 3PA8A 2JLSA 1PQUA 4WTOA 1PT9A 5JAOA 1J0DA 4ARZB 3JYPA 1P1BA 1DXQA 3DMRA 4IHQA 3PUHA 1S8NA 4S05A 2YQ5A 3VC3A 1HPLA 1TK9A 2P62A 2XQVA 3R3XA 1SC1A 2FMFA 4X93A 4LYJA 1Z6TA 2PRIA 5AI5A 4JL8A 3DEIA 3FW1A 2FEKA 4TXNA 5IN5A 4BP3A 1QF6A 3UT6A 3P9QA 4U9IS 4L16A 1U0GA 4BKQA 3CLTC 5I9BA 1L5SA 2R85A 1LJUA 2PKRA 2EHJA 2IYLD 2O3JA 2E1PA 2BFMA 1Z4QA 2XOXA 3PKIA 4HK4A 2DP4E 5KWVA 2OD7A 5LQAA 1YAJA 1NSTA 1UPXA 4K9QA 4D9MA 4N3AA 1C7JA 3T1VA 1OH7A 3BM5A 1SC4A 4KFTA 3LT4A 3NONA 3GAAA 3MC1A 3UV6A 1E77A 3GEDA 4L9RA 4AZSA 4ERXA 3IUEA 4RTSA 4I55B 5CT4A 4FCWA 4AZ0B 1EUDB 2Y93A 2RHHA 4J7UA 1PKEA 2NU8A 4KQ9A 4LF9B 3EGWA 3OZTA 2D7JA 2BP7B 3CX3A 1YZTA 1QMPA 1MGOA 2UKDA 3EFBA 3TS1A 3Q9SA 2IYUA 1KFCB 1LI4A 2GBIA 5JJKA 2F3TA 4INOA 2OSBA 5HS6A 4OI0A 3WB0A 4HAYA 1ZKDA 2F8LA 3F3KA 1NX6A 2EWWA 2H06A 2OP0A 3Q6MA 4RD6A 1SCIA 3H0EA 3WDLA 3LT5A 3LZDA 2QLMA 1G59A 5IBRA 1ZJ5A 2WKWA 3Q7QA 3SY8A 4YJ3F 2QLJA 3ZGVA 4YMLA 2DJ5A 1FDOA 1U81A 2CYBA 1XZMA 4MLDA 2JKVA 5EPOA 3CGWA 5A4KA 5GIOE 4B3BA 3KTDA 2QT1A 1N6HA 2C96A 4F56A 2IS1A 2WUEA 3DLPX 3TGPA 3EXHA 4MVJF 4MUGA 3WMXA 1ZWKA 2H1FA 3H1EA 4MTLA 4AB1A 4KPFC 2ZYHA 3CQ9A 2XQIA 4KCGA 1FVXA 1TZJA 3T7IA 4REOA 3V1YA 1XP8A 4O4JA 5IDYA 4PHCA 2R6GA 4R51A 5C37A 5HPYB 5KX5A 4GPZA 5G0TA 2ORYA 2W6PA 2DVMA 2INGX 4GO1A 1OIWA 1RIFA 4ZVLA 4IX9A 2JFWA 3NQ41 4G0ZA 4QNNA 1YOBA 3N8HA 1KIFA 2FFBA 1J7JA 4HX5A 4JLKA 3DKKA 5FWXA 4J49A 3H1FA 3ZR4B 1AUXA 1P1RA 3WFJA 3L9XA 4O29A 3I5YA 2FUG6 2EWMA 2CNLA 3H5VA 3IP5A 1U2EA 2AN1A 3E7XA 3DMDA 5B55A 4KK3A 3GFVA 4MGEA 2BHRA 1KJIA 3QXXA 1Y5IA 2Q62A 2RKOA 3EWNA 3NP9A 5ENVA 2WIGA 3SI7A 5MN6A 5AVXA 1DFIA 5CDSA 1WW3A 2VNSA 3EBPA 1YBVA 1U3UA 4PN7A 1G8GA 2EJTA 4IO0A 4KO1S 2I8CA 4CCWA 4DLLA 3L0BA 1RRCA 1SVKA 1GZSA 2WWIA 1RTKA 3G9XA 4FONA 3MMNA 2Q3DA 1A7KA 1XAHA 3L1HA 2HCFA 4Q9JA 4R5HA 4AULA 5TT1A 4C21A 3L6EA 4QVGA 1NMSA 3QVUA 4XJTA 1VCIA 4U39A 1VMAA 3R0ZA 3ENNA 1G7CA 1D6NA 2FW0A 2QUBA 2X86A 3KU4A 3RS2A 5IC4A 3UWSA 4EX7A 3U1BA 1ZD1A 2VP4A 2AZDA 4MZXA 2C92A 4G5QA 5JDCC 2REBA 3UC5A 5IYZB 1QVVA 2IYWA 3PD7A 3PS9A 4XIGS 4IDAA 4WH0A 4ZQIA 2CMDA 1ILWA 4BVLA 4EG4A 3R5HA 1NVMB 4PXAA 1U90A 2PU5A 1DQZA 3TINA 1MFZA 1P9WA 1G41A 1ZGJA 3A6FA 1WWKA 3M33A 3T5PA 3ZJVA 1AKQA 2DSTA 1ZNZA 4WLEA 5A7GA 5BSEA 1XZEA 2QOEA 2P7HA 5FWXB 2A7XA 2RK3A 1UJMA 4QHTA 4C0SA 1V7CA 3FCYA 2P8JA 1WUIS 1VE5A 1R27A 1LDYA 2J67A 1KE2A 1I3LA 2YHIB 4DGSA 1VJGA 1X1TA 4D2IA 3RWMB 4O2BB 1ORWA 2LIPA 3EQ7A 2XZPA 1NRXA 3FIJA 3LCUA 3OHMA 3G8AA 3PE6A 4RWZA 3PXDA 4B6SA 3SP1A 1VBNA 1X7DA 3KSZO 5GV7A 4D97A 4DIMA 2P41A 2VAWA 5IF3A 3FHJA 4I6JA 5GVRA 1UPAA 2SECE 2AYYA 1SBTA 1MQSA 2E6KA 1QM5A 2YL2A 3AF2A 4PF1A 3O9VA 3T6KA 1YZKA 2XZOA 3IV7A 2WJZB 3M5DA 4J0IA 4OYHA 4RK5A 2OT3B 4NZ9A 4MQ4A 3GFTA 3D5EA 1JWBB 4POOA 4IHKA 4HQOA 1NW3A 4TN1A 2ABWA 2QIOA 3OF3A 3VC1A 1O6CA 1Y81A 2Q2NA 3AKYA 3O8QB 1IHXA 4ZAZA 3IQDB 1CJBA 5FFFA 1QPBA 2VDRB 3IRUA 4CR8A 4UTZA 1YBAA 2QQGA 1Y42X 2PT9A 3TM4A 1JXAA 4KUGA 1RXCA 1V48A 5EL0A 6NULA 3UO8B 1VPEA 1Z73A 3TLCA 2AOVA 1VG8A 3TPZA 1PN3A 5AW0A 1K7CA 5BR8B 4RH1A 4MDEA 1CRPA 1ICIA 5IC5A 4MYHA 3ZCQA 4HD8A 3COSA 2X42A 4JXKA 1G21E 2RBEA 4UZEA 2OV1A 1NATA 4XASA 1MT3A 4PC3A 4QUBA 4M46A 2O5EA 4BLQA 3ND9A 3T5AA 3RTEA 3EH1A 3AL3A 1XWIA 2OG1A 1QIIA 2WM3A 3DE4X 4GYWA 5IYZF 5UKDA 3TQHA 1OX5A 1Q6YA 1VJRA 1YZGA 3M34A 4RE6A 5FTLA 1P45A 2HMUA 2V7BA 3JWPA 4IPTA 3CPEA 4A5SA 3DJFA 3LXRA 3OI7A 5K6AA 5E6SB 4PANA 3D0QA 3DOEA 3PQ8A 4B8WA 3JQDA 4DCOA 5AVWA 1KEEA 5F3DA 1QX4A 3FGZA 2OB2A 1QAQA 1J56A 3UW3A 3AUUA 2Z04A 2X2FA 5AVYA 1G20B 1T1EA 3GYGA 3GOHA 4DAEA 2J5KA 2JK1A 4MUXA 3K4QA 4NBVA 3FOCA 4XGKA 3RUCA 4UARA 2YNMD 5DOZA 4D57A 1XRNA 2UYOA 3BWXA 3H5IA 3QFRA 2C4HA 3QFFA 4L3VA 4C0AC 1RIIA 4LGCA 3QX8A 2R6CA 4JUAA 3INNA 1Z4IA 2CL7X 2W37A 2M32A 4YFVA 1ZCFA 3MBKA 1BMTA 2C83A 4OF4A 3D1JA 4C0HA 5K0SA 2YWEA 4NAVA 3MTGA 2G5CA 4FFNA 5H4GA 2P4SA 3S2ZA 5LMZA 1E2LA 1JQKA 4QGHA 4WCFC 4C3VA 4Z4IA 4FNOA 2C4WA 1B0PA 1RT9A 4GMDA 2BONA 4L51A 4XQ9A 3QEBZ 4LS3A 2A5GA 1W7AA 1C7EA 1PK7A 1GN8A 2IOQA 4NZOA 3H2SA 1EIWA 1UT8A 2E48A 4CTMA 3KCQA 1CY2A 5EZ5A 1T4DA 2Q6KA 3OX2A 1JJ7A 4QTTB 3JWIA 2I2AA 3MLEA 1FPMA 3L8ZA 4XSVA 1J2RA 2EGHA 2Q8QA 3OJWA 2WPDA 1T29A 1UJ5A 2VT7A 3GN1A 1IZ9A 3NWOA 5AJZA 3BXOA 3C8DA 2R6R1 4U5XA 5C8YA 3SXUB 4D3FA 3C6MA 3SQWA 2ZBQA 5HOQA 2PE5A 3I9JA 1FYXA 4GHWA 5KHLB 3N6RA 2VUHB 4LAFA 3SSAA 4G36A 7GPBA 2CBXA 3BEOA 2XR1A 2D1QA 2H2FA 2EQAA 4KYVA 2AIRA 1L4BA 1P44A 3FLAA 4LF6B 1UBUS 1W1UA 3O9MA 1XCPA 1V0JA 4OQLA 2C5BA 2ZYIA 3JR7A 4D0GA 1N2SA 1T36A 3JV7A 4MVJI 2WIDA 3KFXA 4CLRA 2GD0A 1B74A 4R83A 1G98A 2J59A 1Y98A 3N3AC 1SZDA 3HM9A 1NW7A 1DBQA 3VR3D 3TGLA 1UBEA 1F8YA 3MILA 5G1NA 3RRBA 2QE7A 5A0FA 3CVOA 3QPBA 1GA4A 2NXEA 3C8MA 4R2MA 4YRPA 1RYMA 3D7RA 1JR3D 3OZAA 5DSZA 1E5VA 5T5QA 3SFVA 2YV2A 3OWXA 2FZEA 1GDDA 5HE8A 2CMGA 5K6TA 1VIAA 4CMJA 1PGNA 4DDKA 1V5FA 1TVEA 1H05A 1O95A 4M0LA 1LZKA 5BV8A 5CB6A 3CH5A 3GLIB 1LLUA 3ANSA 1BIFA 4HNGA 4Q3NA 5ESXA 5KYYA 3A70A 4KX3A 2EKPA 2ZDQA 3CXRA 2D0OB 4ASUD 1IXYA 2HNAA 3DUFB 2DM6A 1FNMA 3W90A 1J24A 2HJVA 5GONF 2DFKB 3AUSA 2CNKA 4G89A 5EWMA 2QGFA 2HRQA 1T1SA 3WSVA 1RP1A 3IPYA 1OJ7A 2BLLA 3GGPA 3GPDG 3G2NA 3HPQA 4BQNA 4WUVA 1DS6A 3HY6A 3LUFA 1RACA 2QU7A 3PCXA 3EFOA 3S6JA 1HFJA 2QXUA 1TM4E 2I87A 3TDNA 4OYLA 5IVKA 2VDKB 3BB1A 4HYTA 3UV3A 1O5OA 4B84A 3H9GA 1WABA 1U0OC 3JQ8A 3T3MB 221PA 3FGOA 4FOPA 1SBCA 1KYTA 3LPMA 4QU5A 1QYXA 3HBFA 4IIGA 5I7UA 5C51B 2HW8A 1QRUA 4EFLA 1K7XB 3BD8A 2C9CA 1IN7A 1KVUA 1NONA 1XDBA 2FU5C 1PSZA 1ZISA 2V8BA 4JBYA 1CR0A 4JQSA 3O8NA 5CDFA 3F6EX 3E8SA 1PR0A 3BJEA 3C7TA 5JCXA 4MS1A 5KMGA 1R18A 5DTIA 3KJQA 2C42A 2FRDC 3QJGA 1SOAA 4CNBA 2IDZA 3DZDA 3DHWC 1XPJA 1YO6A 2VWGA 1OXXK 1YRBA 4XIYA 4ESOA 4PCVA 2G9ZA 5MDHA 4IYJA 4Z4HA 3D3JA 4XH9B 1K89A 3IODA 1Z9BA 3W77A 3C5EA 3ZZTA 1O96B 1JXMA 1DFHA 4I0WB 2GM5A 3VYWA 5JH7F 4HTAA 5FBRB 1JHRA 4JC0A 4Y6SA 1XOIA 1RHMA 3AJ9A 4FWTA 4P32A 3HEAA 5A3QA 4F2HA 2N42A 3DDOA 1R9MA 3CZ4A 1EHYA 5EJ2A 2G6BA 3STUA 4G0YA 5A04A 4LVOA 3UMMA 4E5VA 1B23P 3OKPA 2O5VA 3R2JA 5E1DA 1PYGA 4WJLA 1YJQA 1XPOA 2QRMA 4TKMA 1ISIA 5IZCA 5JAHA 1SXHA 2Q3CA 2XDWA 4JJEA 4UEWA 1ADYA 1KJNA 2PVPA 1L7NA 1HG0A 2VH5R 2VYNA 3P7MA 4L8FA 4PNZA 3MCWA 2OHGA 2XNJA 1QKJA 2C7GA 2FZVA 2ISQA 3BA6A 3DLTA 3IUQA 4UUBA 1FZQA 4LOLA 4Q1DA 3ZCPA 4B85A 1E8MA 1KEWA 1OAKA 2GN1A 3H1AA 1PJAA 5JXGA 1LNQA 2PEZA 3FFTA 3K0CC 5LOVA 1EJ0A 3HJNA 5ARCA 1RPZA 2IJGX 3NKLA 2ZJ8A 3DBRB 3WRWA 3WRXA 4EITA 2WU0A 4HGNA 5FPQA 3BE4A 4EZBA 1IULA 1XZAA 2JHAA 1Z68A 1GUZA 4KWEA 3EEQA 4G4GA 5K3FA 4URVR 3F71A 1AQUA 1GYRA 1YZHA 4QDUA 2QW1A 1UMDA 4BV8A 5LU9A 2Y1KA 3G2JA 2G88A 5JG7A 3TCKA 3H99A 1US8B 1KI1A 1C81A 1UKYA 3HI4A 4LXXA 1I9GA 2I71A 5AVKA 3K94A 4ME6A 1VPLA 1JKXA 4RD0A 3CJQA 3AJRA 2CV1A 3B5IA 5TS3A 2ZRKA 4M1YA 3ABIA 1E2IA 2SKDA 4NBUA 3KE8A 3HDQA 3IAUA 1L4UA 4MTCA 2EX0A 2B0CA 3ET4A 4XKJA 3BXEA 5KVVA 2C2OA 2GWHA 2Q2QA 3GRFA 3GZNB 3OM0A 3HWX1 4QASA 2HA2A 2AQ8A 3GDFA 2ZAOA 3IJ5A 3M4JA 1CUXA 5KSPA 2D1FA 1OLUA 2CBGA 1ECLA 4QQRA 2FLVA 3TTUA 2B4AA 3MRXA 1G55A 2QMZA 3I58A 1HTTA 1M7GA 3HH8A 3F7NA 2Y99A 4G4SO 4Q4AA 5U1PA 4GUDA 2HU8A 2RI0A 1CE8B 3QXGA 1CFJA 1Z2CA 3BVPA 3IUJA 4PSKA 4QTUB 5LNK1 4MGIR 4ZHQF 1H4VB 3AVUA 2FW9A 1TQ6A 3FOFC 1D2NA 1JPUA 5COBA 5L45A 2OTCA 4IKOA 3DMNA 5JC8A 1ZSNA 3I01M 3CZ5A 3U4IA 5ENDA 2YVQA 3AFNA 3PGMA 1YRAA 2DR2A 1Q1BA 1YHZA 4OSPA 3C48A 4J8PA 5CBPA 1JFRA 1SXJB 2ZB4A 1P0MA 1BDMA 1UKAA 3DTTA 2XCTB 1Y3IA 1H3EA 3RI3A 4LDRA 3U3ZA 1O6BA 1NY6A 1U3DA 4K1XA 1M1NB 4I2VA 1RXWA 2FXVA 4LDQA 1T24A 1NQUA 3A14A 1G9XA 3DM9B 1SXIA 1T26A 3MWGA 2ZYAA 1U3TA 2FB9A 2X3YA 2XMZA 3FPFA 2QA5A 1C50A 3LS2A 1WB9A 4IVNA 2RIRA 5I7FA 4MSUA 1QTIA 2P65A 1FDWA 2DBQA 3DKPA 4CIYA 4BECA 5CM9C 3DPSA 3WWOA 3KC2A 5FCDA 3G9ZA 1RI1A 1XJ0A 4JP3A 2A5JA 3OOHA 1IXRC 2D8AA 1QQBA 2PSSA 3QE2A 3W3AH 3GLFB 4EH1A 1CC1S 1KPIA 4IUDS 2XECA 2Z6VA 1DLIA 2RC6A 1I5RA 3I42A 5CX4A 4HBZA 2A58A 3QLJA 3R1IA 4TRNA 3RU7A 4P81A 1T5LA 4LJAA 2REQB 1BE8A 2X13A 4I81A 2V5AA 3E1GA 5HJEA 3LRPA 1ZONA 4XQEA 1ZH2A 4TRJA 3DYVA 5ALLA 2CW5A 3HA2A 2Z5FA 2FV8A 3CE9A 4PBTA 3T1NA 1YDFA 3SNHA 4EO9A 4X8MA 2Y0BA 4AO6A 1I0IA 2XTNA 1Z5PA 3MWEB 4RVHA 2GRJA 1ZX1A 3OE5A 1IOWA 3KHTA 1T8RA 4K5QA 5T3UA 4PGHA 5AJHA 4HFNA 4B7XA 1DWUA 1KQFA 4EB6B 1PVOA 4Y2VA 2EKZA 4JBIA 3ZJ5A 1AS2A 1SQSA 3DL4A 5KNCD 3AEQA 4BVKA 3G2OA 1CUZA 1QVZA 2AOTB 2JGJA 3DFIA 1A97A 2YFHA 4WADA 3S81A 5CLJA 2ZM6B 2UXDB 3G88A 2MTBA 5AP9A 3K2EA 1MUUA 3FSGA 2F43B 1Y5RA 2HIGA 1I24A 3N8NA 3HLYA 4EP1A 5K9ZA 3A1FA 1P1FA 5JY1A 1NQXA 2HJHA 3JPYA 2FSVC 3FETA 5GAJA 4M76B 2XB9A 1I6MA 3AINA 3O8CA 4O2AF 4YJ2B 2XBMA 4QQFA 3EZYA 5LB2A 1DBPA 4Q34A 3T4EA 5BQPA 2I2WA 2YQ4A 3FG9A 3KEMA 3ZBPA 2Q3MA 3BZWA 4KLZA 1U5AA 4WFIA 2CLCX 1FTGA 4D6XA 1JHXA 4XYLA 2Q3FA 4DV7B 4Y98A 4DZTA 1QRRA 3D8SA 3DKRA 3S2UA 1VDZA 3X2EA 3ABOB 5CLIA 3WYNA 2A30A 1PLJA 4Q18A 1S2OA 1QYCA 2D1TA 1SCBA 3O91A 4A6DA 1EU1A 1WJGA 3JVIA 3O90A 5FAKA 5AUNB 1PNVA 3ME5A 4D1YA 1WMEA 1M8GA 3GH3A 3P2JA 4G56A 4U3JB 3TIGA 3A3YA 1V8FA 4LE0A 2AG8A 3L7JA 1X7ZA 3HCAA 2QLFA 1IUOA 5GGYA 4N49A 1T15A 2IZ5A 3VOBA 2DLNA 2FSUA 3PFKA 3ZUGA 4DUYB 4PXSA 4LBYA 2Q3LA 1TQHA 3U6KA 4KFCA 4JA2A 1CRZA 3T1YB 2V6FA 2PZBA 3GLHE 4DXHA 3G23A 4JP8A 1Z74A 2JCXA 2CHVA 4IQFA 2H4HA 2J8ZA 3O21A 4HLUC 1JE1A 4GOKA 4F96A 1LEHA 3NT4A 2VHJA 3L40A 4Q9NA 2I2BA 1FY2A 2P6RA 3RYHB 3EQ9A 1YHYA 5AVUA 4B0OA 2PYZA 2Q21A 4YREA 4CI9A 2Y92A 3IIIA 3V1TC 3CVYA 5B57C 4RK7A 5AOVA 3NBAA 4XDZA 2G04A 4D9CA 1ZRHA 3F5FA 3A9WA 3AR9A 4FSDA 4NEGA 1SRRA 1XZCA 1I1QB 2X8LA 3Q15C 1FP6A 4QUDA 1LVHA 1HMPA 1M2EA 3AR5A 1WQ1R 4NBTA 4G9EA 4RIIA 3HI6A 2HHAA 1TTTA 3F4LA 3BL8A 4RLHA 4WKPA 3IEPA 4C7OA 3R6WA 2VXCA 1ZI9A 4DR6B 5A9RA 3C3BA 2QW8A 4X1KB 3RFTA 3AIOA 4NQRA 1F5NA 4RAOA 2RARA 1P31A 2XUGA 3HRHA 1Y0BA 4MQUA 4PW0A 3NORA 3W8DA 1JHVA 4AY4A 4X1KA 4ES6A 4L0QA 4BMNA 1WIWA 3BIJA 4BB0A 4TYWA 2YCLA 2YXPX 5CFNA 4DKJA 2V6IA 3KQVA 2OESA 2RGYA 4P4SB 5T64A 3VDMA 1ZUWA 1TUEA 3DOFA 1Y1TA 2XYHA 1JJFA 1P91A 4IDCA 4MEBA 4DMFA 5IKXA 1LI7A 1E7YA 2QM0A 3LUBA 1TVKA 1ULBA 3C3WA 1JPVA 1BH6A 2DCMA 2R11A 3DUWA 1U0RA 4EY5A 5C5IA 3R8FA 2WT4A 4ZOAA 2HCRA 3BMNA 1AZWA 3NH9A 4B3FX 6LDHA 1OXMA 2QDKA 2VBFA 4ANFA 2I66A 1J09A 3VU0A 1RHQA 2HK7A 2Q50A 1BDHA 2J9YB 1F8XA 1JU4A 1RZVA 1DELA 3GU3A 1PTKA 2CLIB 4WIAA 4ZJYA 3C43A 3HN7A 2QTLA 1L3IA 1JEJA 1KAMA 2YZNA 3EVFA 3WVNA 3T5GA 3IEIA 1BVHA 4WV3A 3IEXA 5FL7D 1O2DA 4ZEWA 3SC4A 3UICA 4Q12A 3RE1A 2WJAA 2Y3IA 5IASA 3J80A 2NU6A 3FPCA 3OM8A 3GD7A 3HV0A 4PIVA 3SE7A 5K8IA 4BXOB 3CRRA 4ZN6A 1Y3BE 3NUQA 3OTOB 3CBGA 5TQ0A 4HGZA 1MAUA 3BFJA 4UAVA 1Y8RA 2IH4A 1A9ZA 1WS6A 1ND5A 2GXSA 1A8HA 5HRCA 2I3GA 1EDEA 5T4FA 1GKUB 3JRWA 1W9HA 1C9YA 2HK8A 3MJSA 3C1TA 5HWSA 3I05A 1GLGA 2P6UA 2MYTA 2JGLA 1P7CA 3I2IA 4BBZA 4J7AA 4DA9A 1A9XB 4QO8A 1KKLA 3LPDA 4MR9B 1HY3A 2FSIA 2YY7A 1D9ZA 4MIYA 3G0GA 4I4CA 1K68A 3K6JA 5JBQA 1EE1A 1E1CA 2VI5A 2J4CA 4P4SA 3VSEA 1M6YA 1BXGA 5BW5A 4OP3A 2R5FA 1NVVR 2HY7A 2W2OA <