3BGVA

Crystal structure of mrna cap guanine-n7 methyltransferase in complex with sah
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
309
structure length
269
Chain Sequence
RIFYLRNFNNWMKSVLIGEFLEKVRQKKDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRYEDMKNRRDSYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMMLRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDFNLEDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQLPLGTLSKSEWEATSIYLVFAFEKQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of human RNA (guanine-7-) methyltransferase in complex with SAH.
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords mRNA cap guanine-N7 methyltransferase
total genus 94
structure length 269
sequence length 309
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2007-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3bgvA00
3M33A 3TR6A 1FBNA 5DM1A 3GWZA 5HIIA 3DP7A 3LDUA 1XDZA 1SG9A 4HH4A 5E8RA 5LQCA 2PBFA 3HA5A 5GINE 2AOTB 2LD4A 3DR5A 3BWYA 3GRUA 3OU2A 1N7JA 5LQUA 3KPWA 4PYQA 2P3LA 3LCVB 2CL5A 2H11A 3SXJA 1VQ1A 1HMYA 3JWHA 5CVDA 4E70A 3OE4A 5F2OA 4FT4A 4KVZA 4R8SA 5BXYA 1ZG3A 1RI3A 5DXAA 5CD1A 1KIAA 4PYOA 1QAOA 2EX4A 2P3QA 2YUIA 3NWEA 4HTFA 5DSTA 5FADA 4G56A 5EHGA 4YMHA 2ESRA 5DT2A 5K0CA 3R9XB 1N7IA 3GIWA 3E23A 5EZQA 2QRVA 3KPYA 1ZHFA 5LR6A 3CVOA 1WS6A 5EMLA 5DTRA 4PIMA 2ZBQA 3QV2A 4MIKA 4PYNA 1SUSA 4X41A 5FQOA 1JTEA 4PYLA 3TFWA 4E31A 3ERCA 3Q87B 4GOND 3FTDA 3GRYA 3K0BA 5DRTA 4YUYA 5HZMA 5E2BA 3DMHA 4PCAA 5EMJA 3THSA 2FHPA 1BHJA 1DCTA 2UYOA 2QM3A 1NT2A 3ELUA 5DLYA 3TQSA 3UJBA 2JG3A 1P91A 3ER8A 2PKWA 3NDJA 4BY9E 5BW4A 5HIKA 2IFTA 3R0QA 2ZZKA 1QZZA 3BWMA 4U7PB 2HTEA 3LBYA 4RVGA 2Y1WA 4IV0A 2B78A 5K0NA 4CKBA 3H2BA 1RI1A 1L3IA 2VS1A 3P71T 4DZRA 2YXEA 3U81A 3TKYA 1WZNA 4LWPA 2AOUB 2O07A 5K0LA 4E2YA 2GS9A 1AQIA 4FSXA 3DTNA 3MTIA 3KQPA 2BR4A 4HC4A 3DXYA 1XJ5A 2PVCA 3GXOA 3HA7A 3IV6A 4OBXA 4RVHA 4A6DA 1JSZA 3CCFA 5P8WA 3SGLA 3KKZA 2EJUA 2P41A 3EVZA 3HCBA 3KPUA 3LCUA 4P7KA 2ONZA 5GOZA 4RVDA 1Q0SA 2PX8A 4KDCA 4ATNA 5K0JA 4RTRA 2ZIFA 2IPXA 2YTZA 4MTLA 3TM4A 2XBMA 2A14A 1O9HA 1ZKDA 2JHCA 2P8JA 3TKAA 1JG1A 5HIMA 4MHTA 2GLUA 1QANA 1JG4A 4CTKA 2P35A 5DSXA 2KW5A 2GAFA 3VYWA 5E8JA 4GUAA 4AX8A 1FJXA 2O05A 5IH3A 1R00A 3A27A 1FP1D 5EZSA 3DXXA 3OCJA 2ZZMA 2GB4A 1H1DA 3GJYA 3BT7A 2NXNA 3JWJA 3LSTA 5U4XA 1JR4A 3BKWA 4GOOD 4AUKA 3T7SA 1IXKA 3L8DA 2ZULA 1KPGA 1SVUA 3PS9A 1I1NA 3HCAA 5DRYA 3PTAA 2WA2A 4DCMA 4ER7A 3CGGA 1G6Q1 2ZBRA 4AZSA 1MJFA 2G70A 2OY0A 1KXZA 3KQMA 3LX6A 5FUBA 5C9ZA 3EGIA 2ZBPA 5BW5A 5LQAA 5FCDA 2XYQA 4KDRA 3AXSA 3AWIA 3TRKA 2IBSA 3FUTA 1AF7A 4OQDA 1XTPA 2FK8A 5GIPE 5DM4A 1Z3CA 5DTQA 4EMSA 4M7RA 4B17A 1R8YA 3OZRA 3FTEA 4EKIA 1R8XA 2K4MA 2C7QA 2CMGA 4DMGA 2IGTA 4RTOA 1F38A 1L3BA 2PX4A 3EEOA 2CWWA 4PGHA 2JHPA 3EEYA 2ZW9A 3ELYA 2PWYA 2VP3A 2AOTA 3CC8A 5DM0A 1TW2A 3UJ9A 4FSDA 5EIWA 1NV8A 1L9KA 3HCFA 1XVAA 4EQZA 2IH2A 1VPTA 1ZGJA 3FPGA 4O29A 4PGGA 3UJ6A 3NMUF 1XDSA 5KQSA 1Y8CA 3EVFA 2I9KA 1P1BA 4MWZA 5FQNA 2PLWA 3P2IA 3MB5A 1RI5A 3KQSA 3KR1A 4IV8A 4E32A 3HVJA 2AVNA 3CJQA 3OZTA 3Q7EA 5FWDA 5F2NA 1KPIA 2FPOA 4V0RA 3UJDA 2IH4A 5CUQA 4RTNA 4GC9A 4H0NA 3G2MA 5KYGA 2P7IA 2EJTA 4KIGA 1VP3A 3LKZA 2OKCA 3FYDA 3I64A 1QYRA 3EVCA 3ORHA 3M6XA 1NW3A 3HM2A 1QAMA 3LCCA 5K8VA 1NW6A 3PFGA 1RJEA 3B7PA 2P7HA 4L7VA 3UA3A 1WG8A 2R6ZA 3LGAA 1EJ6A 5HFJA 4C05A 4LG1A 4GEKA 1G60A 2FYTA 1RJFA 3THRA 4M36A 1Q0TA 3G5LA 4YMGA 2XYRA 5EKXA 3BZBA 4XUCA 2E5WA 5IKMA 4YUZA 2YX1A 1PJZA 2BR3A 3BGDA 3DUWA 4R6WA 2ADMA 5C1IA 2FK7A 3DMGA 4GC5A 3HA3A 3B3FA 3QOWA 4XUDA 2PT6A 4PYIA 3UJ7A 3C6KA 4CTJA 1U2ZA 1B42A 3DOUA 4R8RA 4C04A 3A7EA 1X1AA 3G88A 1KPHA 1XCJA 2OYRA 3O7WA 4RYLA 4POOA 3HVIA 3PX2A 4YV1A 3CJRA 3E7PA 1VE3A 4E33A 4RTSA 5DTMA 3SSOA 3CJTA 2IDJA 1YFJA 3C3YA 3DMFA 1F3LA 1JG2A 4GOLD 2C7PA 3I9FA 1AQJA 4X1OA 3LDFA 5KQRA 3MCTA 2AOUA 4QVGA 3SM3A 1IY9A 2I62A 4E2WA 2PGXA 2YR0A 2ZIGA 5E2AA 2OBFA 5EQJB 3FTFA 4RV9A 2HV9A 2PX5A 3MERA 5EPEA 3T7TA 3SSNA 2NXEA 1OR8A 3SX0A 4DQ0A 3HNRA 2NP6A 5E9JA 2CMHA 7MHTA 2PV0A 4QDJA 3FPEA 3M6VA 4EKGA 5ICGA 2N47A 1XDUA 4BLVA 3LECA 4F85A 3EVGA 4QPNA 2ZVJA 1X1CA 4FR0A 5C0OE 1NW8A 2XVAA 4BP3A 5DX1A 2PSSA 2QE6A 1VIDA 1O54A 2JJQA 4Y2HA 5FHRA 5FWAA 1M0EA 2HMYB 1YUBA 3NWBA 4AZWA 1P39A 5T6BA 1PRYA 5ICCA 1NW5A 2PT9A 4YUVA 3SSMA 2UYHA 1X19A 5G02A 4YUWA 2O0LA 3KHKA 5F2KA 4ZTBA 1XXLA 3MAGA 4HGZA 3ER9A 1QAQA 2ZTHA 1FPQA 3JWIA 2QY6A 5HOQA 2AOXA 4FGZA 2AOVA 1KYWA 3QOXA 1YFLA 2JHAA 2ZWVA 1R18A 1R74A 3P9KA 5LQNA 1VBFA 3O4FA 2JH8A 5EHIA 1HNNA 2AN3A 2P40A 3M4XA 4DM3A 2ZSUA 4RTQA 2PXXA 3EGEA 3R24A 2O57A 2ERCA 1M6EX 5EG5A 5JR3A 5E9QA 2VZ9A 1G8AA 1I4WA 5EKUA 5KVAA 1YZ3A 5GWXA 4CKCA 5E1DA 3R6TA 2WA1A 3P9CA 4V0QA 3S68A 4E2ZA 4P58A 2YXLA 5LQKA 2IIPA 3X0DA 5EGSA 5ICFA 1D2HA 1R6AA 1DL5A 2OZVA 1WXWA 2NXJA 3B89A 1ORHA 3CKKA 3AJDA 4GBED 4QVKA 2I7CA 4XUEA 3WSTA 1G38A 1NW7A 3KQVA 4Z2YA 4QQNA 2XVMA 3EVBA 2Q41A 1UFKA 4FZVA 3HEMA 3A7DA 3BGVA 3G2PA 3OFKA 4GOMD 4LWOA 4X61A 3LL7A 3R3HA 4RTLA 1JQ3A 2IP2A 3IHTA 4JXJA 1JG3A 4PIPA 5DXJA 3OPNA 2BM8A 2YXDA 3KQWA 2G71A 3V8VA 1ORIA 3FPFA 1UWVA 3VSEA 5K0FA 3FYCA 5CVUA 3GRZA 2AOWA 3D2LA 4RVFA 4RX1A 2QRVB 5B1SA 3RODA 4PCLA 1VP9A 2ORED 1BC5A 2AS0A 5D1NA 1M6YA 3G8AA 2OXTA 4F84A 3HP7A 2BR5A 4HRAA 1ZQ9A 4X63A 2OO3A 3HVHA 4PONA 5CM2Z 3GU3A 1JTFA 9MHTA 3GCZA 4PYMA 1G8SA 3MCZA 3KPJA 3E8SA 4OA8A 5EIFA 3E05A 4M37A 5GP1A 3TPZA 5EEGA 4FT2A 4GQBA 4AZTA 1G55A 4C06A 1JQEA 2YQZA 3C6MA 4MQ4A 4CKEA 4P7GA 1TW3A 2FRXA 3UJAA 3A26A 5LSAA 3EPPA 3SVZA 1KP9A 1NKVA 1UIRA 4QTUB 4RTPA 3FTCA 5CVEA 3EVDA 3P2EA 5ERGB 3TM5A 3UFBA 3GRRA 4C07A 2H1RA 1NBHA 1AV6A 3FZGA 3PB3A 3ELWA 5FA8A 4RTJA 3SMQA 2Z6QA 3UA4A 4LECA 4OA5A 3O31A 4M38A 5CVVA 3P9NA 2VDVE 3B5IA 4FS8A 2OB1A 2NP7A 4KW7A 4YUXA 2AZTA 2C7RA 1SUIA 3UZUA 4QTTB 3G5TA 2AVDA 3EMDA 4YV2A 1SQGA 5K09A 1KR5A 4ER0A 5MHTA 3HCCA 3MQ2A 3NJRA 5E1OA 2XYVA 4HGYA 3DLIA 5EVJA 1WXXA 3LPMA 3PT9A 1P1CA 5DM2A 3SR4A 5LQJA 3T7RA 1L1EA 2IBTA 5HIJA 4C03A 4UOEA 2ZFUA 4F86A 3PFHA 5HEKA 3GRVA 4P7JA 3BUSA 2GA9A 1FP2A 3RW9A 3BKXA 2OB2A 4X60A 3FRHA 3UBTA 2Z6UA 1DUSA 2UZ4A 5GM2A 5JUWA 3RIEA 1EQAA 3TMAA 2EG5A 1WY7A 4AZVA 4YV0A 4PINA 3ANXA 3KR0A 2EFJA 2AN4A 4ISCA 1ZGAA 4DA4A 1JSXA 5EMMA 1MHTA 3OE5A 3P9IA 4IKPA 5E1BA 2I6GA 1KYZA 3G8BA 2UYCA 1RJGA 1INLA 3EMBA 3B3JA 3FUUA 1YZHA 3LBFA 5K05A 3OZSA 1D2CA 3DXZA 5E1MA 3ELDA 3M6WA 3DLCA 3I53A 3KR9A 4DCGA 2G1PA 5HILA 3HCDA 3BGIA 4RWZA 1EIZA 2NXCA 3M6UA 1RJDA 5GM1A 3V97A 5ICEA 4OX9Y 5DWQA 4KIFA 4FP9A 2NNWB 4RSRA 3P97A 3HTXA 1EJ0A 1N2XA 1XCLA 3HCEA 5FULA 5T64A 3FUXA 4IWNA 3NW9A 1NBIA 2G8NA 2Y1XA 4BP1A 10MHA 2PY6A 2WK1A 2JH9A 2ZIEA 2PX2A 3P2KA 3P8ZA 2P1DA 3GO4A 2F8LA 2OPBA 5CCXA 4ER3A 2G72A 3T0IA 3BWBA 5EC8A 1RI2A 3REOA 2ZLBA 3C0KA 1RI4A 3KQOA 4E30A 3GDHA 2Z6AA 1L3CA 4ER6A 4EK9A 5T67A 3EVAA 3KQYA 3EVEA 2GH1A 1V39A 3DH0A 5LQRA 4CXMA 1YF3A 2IH5A 4BLWA 1TPYA 3LHDA 5EMKA 3PVCA 5D1HA 4ER5A 3FPHA 2V74B 5EOVA 4C4AA 8MHTA 2UYQA 5K0BA 4KRGA 1O9GA 2C7OA 5K0EA 2AR0A 3TOSA 2CKDA 3FRIA 3I58A 3NVMB 5FHQA 1BOOA 4R05A 5E9WA 3GGDA 2BZGA 2FCAA 5DPMA 5H02A 2ONYA 1NE2A 4K6MA 2AN5A 3TLJA 5FTWA 2H00A 4CWAA 3PX3A 4NECA 2BH2A 2PXAA 3IEIA 5BP7A 3I5UA 5GIOE 1KHHA 3VC2A 2B2CA 5K01A 1IM8A 3MHTA 5EEHA 2HWKA 2IDKA 2VDWA 3DULA 4DF3A 4OBWA 2VDUE 3KQQA 3NTVA 2V7EA 3AXTA 4QPPA 4XCXA 4RTMA 2B9EA 4EVIA 2B3TA 5K0GA 3HVKA 2ZWAA 5K03A 3NVKI 3FUVA 4GF5A 3CBGA 3KPVA 3OU6A 1VLMA 1NV9A 3AY0A 3EGVA 2DULA 1SQFA 3NDIA 4HG2A 2BM9A 3UWPA 5CIYA 1JQDA 3B3GA 3IYLW 3PLAE 3ME5A 3OFJA 4RTKA 1EAMA 3C3PA 4C08A 2O06A 2HR1A 4QDKA 1D2GA 3KU1A 4KWCA 3MGGA 4DKJA 3FUWA 3KQTA 4PYKA 1X1DA 2QYOA 2P3OA 3A4TA 3BXOA 2YVLA 4Y30A 1I9GA 2DPMA 3GNLA 3VC1A 1EG2A 4PNEA 5CCBA 1T43A 2ZCJA 3MTEA 3FPJA 3K6RA 3LKDA 2NYUA 2GPYA 2B25A 5DX8A 3LDGA 2PXCA 4OQEA 4HTFB 3UJ8A 4BLUA 1VL5A 3BWCA 3G2QA 3G7UA 3ID6C 3KR2A 2PWPA 4E2XA 4HSGA 4A6EA 4QQKA 4U7TB 2ZZNA 5DX0A 5CVJA 5M5BA 1SKMA 4PYJA 4PWYA 1BKYA 2HNKA 4WVLA 3A25A 1X1BA 3M70A 3OU7A 4P7FA 5FA5A 3UJCA 3F4KA 3JWGA 2PJDA 3G89A 4R6XA 4WXHA 3G2OA 5KS2A 2R3SA 1YB2A
chains in the Genus database with same CATH superfamily
1Q1BA 1CC1S 1S1CA 1ZD4A 3Q8WA 4IHQA 5HIIA 1A2OA 3LDUA 3C3AA 3LFUA 3GLGA 5LD2C 2FUCA 2ZDHA 4TV9B 5CB0A 5FTNA 4AJHA 1HFJA 2ZU0C 1UWKA 1Z7GA 1SBHA 1MP0A 1Z5WA 2AOTB 4D92A 3EFOB 4TVBA 1KYYA 2FZWA 3FDXA 3TBFA 1USUA 4DSNA 3F3SA 4CQNA 1CRQA 1NXSA 2ACEA 4M8LA 4PZDA 3LLUA 4OFWA 1IZ8A 4MWEA 5EERA 1VYTA 2HF2A 2RB5A 1E0KA 2OBXA 2HU5A 3OTOB 2DFTA 1M2VB 2Z9BA 1EK0A 2XRMA 3C3BA 1E8MA 1M1NA 4R2XA 4JL8A 4CLRB 4DAEA 2Q6TA 4M1QA 1KDYA 5HM6A 1P0PA 3GF4A 2WM8A 4A15A 3V80A 1U7WA 2J3EA 5A71A 3N5KA 2YWRA 4GP9A 2ZJ7A 1A2KC 2X3YA 3BDAA 4LHEA 4DB4A 3BB1A 5E2BA 3DMHA 4D0NA 1YL6A 2W2MA 1JWBB 3SIRA 5EMJA 3RREA 4OHBA 4EECA 5AH0A 3NDJA 3R7FA 3TLBA 3BJRA 1PV4A 1KK2A 2ODWA 2ZG6A 4ZREA 3OIWA 3OT5A 3CINA 1JHOA 3D0QA 3RS0A 4JEUA 2FI1A 3QFFA 3H2BA 2BJVA 3NHUA 1N3IA 3NHKA 1X1SA 5AM2A 3OCUA 1SHLA 1OA0A 4HOYA 3WLPA 1B41A 3AI1A 3M89A 1OW3B 1T6BY 3TMKA 4WK4B 2NU7B 1EFPB 3UANA 2V45A 1BD3A 1IWOA 1BXRA 2WKPA 3DTNA 4OYYA 4PBTA 1DE0A 1N3LA 1VJCA 5G1OA 5HCIA 4OCZA 5IRCD 1WMEA 3DXYA 3IV6A 3IBYA 4OBXA 4DDTA 2FWBA 4J0EA 4ZIRB 3SGLA 4YJ2A 4XD7A 1SC6A 1PFQA 2ZWPA 5ICSA 4ZCIA 1ZYUA 1O9HA 4Z4HA 3QNMA 2ZJFA 4HGQA 3OQHA 3MWDA 3NEYA 5HIMA 5IAKA 3FZQA 3T5AA 1SK8A 1YZYA 1P1FA 1C8KA 1PZXA 2XUJA 1MT3A 5FWXA 4J07A 1QDEA 4L75A 4AN0A 4BHTA 3LXMA 3D8RA 1KP3A 3EXFB 2F8TA 3JARA 5KQLA 2PZEA 1FJXA 3LIIA 1GV1A 2JA2A 3JQ9A 1PYOA 3IP7A 4EJ0A 1V47A 5EZSA 4KH0A 1MEEA 1ZOIA 4I2VA 2MWMA 4LY0A 1JILA 1NVDA 4K9NA 3T38A 4R1NA 1RM3A 3DW3X 3HABA 4FDLA 1DKMA 1RNLA 3GNQA 3KKEA 4TL6A 3QXGA 4RE6A 3T7SA 2WJWA 4JC8A 4ZVTA 3ZD9A 1KPGA 4FYPA 1CR4A 4U6NA 1F17A 1OV4A 4XLZA 3STTA 3QVVA 1SRQA 5CEEA 1H69A 2C7GA 4BMOB 1T35A 2EC5A 1JE1A 4ZQIA 4IXTA 3FIUA 4G67A 3SIWA 4E5YA 1SUFA 5H70A 4ZPJA 1KO7A 3L6BA 4G63A 4MRMA 2D5LA 5T4HA 4B47A 2Y68A 4R0MA 2EJCA 1P18A 1YFZA 2HPAA 2JCVA 1EKXA 2QTGA 5FCDA 5HMMA 1OLXA 2PL1A 4EA7A 3JAKA 5EHXA 3F90A 4KXQA 2QMUA 1HQKA 5LUBA 5HX7A 3MCAA 2I8AA 1H3EA 4MP8A 1FU4A 2WILA 4DILA 1WQ4A 1FFGA 4ERXA 4EY3A 1RACA 2ZBUA 4OQ4A 1EWKA 4AT1A 2K4MA 2QM7A 1CF2O 4GGOA 3TOXA 1FTQA 1RTKA 4F4UA 5LFAA 3ZGYA 1K98A 1KVQA 3O93A 4R1PA 3PUZA 2QU7A 4X95A 2EGHA 2BFCA 4KPUA 3UJ9A 3W4IA 1QR2A 2GN8A 4HDKB 1L9KA 3DEAA 5J4KA 1JA9A 1JEYA 5FAXA 5CBPB 2X3UA 4PGGA 1FSGA 3CUKA 4YRSA 1XLVA 3WGGA 1E20A 2A5DA 2H54A 5BSHA 4YCAA 1TA4A 2PVSA 4QBTA 1JWLA 5M29A 1MO3A 5DHRA 1YVDA 4MPPA 1W0KD 3C4VA 3CV3A 1R12A 5KQPA 4YMTA 3ECSA 3F7TA 3OZTA 4QOEA 3EFEA 1RAIA 3GARA 4L95C 2H2AA 3GAZA 2FPOA 5D01A 4A92A 3NDRA 4B8WA 1OBCA 3A4NA 4YMSA 4OBEA 3RVNA 5JBQA 3P9SA 1AH2A 3T1OA 5DE3A 1YU9A 2RONA 3I64A 3K31A 3O4RA 1XQXA 3QF7A 2JJMA 2I91A 1EVQA 1GR0A 2RGEA 3CRQA 1CDOA 2NAPA 1W4ZA 3HN7A 3UA3A 2G07A 4CIXA 2WJAA 3G2IA 3NS7A 4HDNA 3OQIA 1JZTA 4ZU6X 1JKJB 1M2HA 5KTTA 5KOHB 4Q00A 2DPGA 1NE7A 1FF9A 1FE8A 2ID7A 2IZZA 4BVHA 4UOZA 3RGWS 3MSCA 3WL8A 4RHUA 2F3SA 4JMLA 3BGDA 3DUWA 4MV8A 2C9BA 1QH9A 4EHNA 1MO2A 3VI4B 2I33A 4D81A 1QYIA 1QTNA 3DOJA 5FYDA 4GI2A 2ES4A 1MAVA 2Y1CA 3FPAA 3OAAA 1XQWA 1XKXA 4H3HB 5FNVF 4BLOA 3A7EA 1HOXA 4QA9A 4RTSA 1SIBE 1V48A 2NVUB 3BYZA 4DEYA 2BTQA 3LG2A 3ONEA 1KFEB 4PF1A 2HEGA 1WL8A 3SNKA 1L5FA 2VXOA 2H85A 3CJRA 2HEIA 1EX1A 5CLLA 1EMDA 1F0NA 2OZKA 3LUPA 2PS9A 2ZVPX 5HOEA 3VPHA 1LDYA 4L9AA 2AI3A 3B36A 2QM0A 3AF2A 1M2OA 4GGMX 3OJFA 4AQDA 2GUGA 3I0MA 3UXMA 5HP4A 5T8KA 2ZIXB 4KR0A 3NUGA 5HK8A 5DHQA 1WDTA 5CYOA 4FUQA 2NUTA 3RBAA 5KVVA 3GEPA 4R3WA 1VJGA 2XSZD 5E6UA 1QS0B 1QHXA 2J85A 1OTXA 2YR0A 1BEZA 3FSGD 4ICIA 2WUVA 3KKQA 3SN6A 5KYNA 4HAWA 5KWEA 4FFVA 5SYNA 2ZKIA 4D8UA 3EX7C 3UM9A 3G0BA 5E9JA 2QUBA 1P7VA 3LMKA 2D2VA 4NYMR 3KYBA 2ZI7A 2ZUUA 3EVGA 2WABA 2ZVJA 4FR0A 4JVLA 4O0LA 4XM2A 3RYIA 3K53A 1PFVA 2AEMA 3PDJA 5CVCA 1EUDB 9GPBA 5KVCA 2WSYB 3ZXXA 3U44A 1SZJG 2CV0A 1LWNA 3JD1A 3EISA 1QFXA 2NG1A 3Q4GA 4IZIA 4RESA 3AGQA 1BYIA 1M0EA 4EW1A 4MWSA 1NY5A 4ND8A 5T6BA 1PRYA 3F2IA 4RBNA 5EKSA 1GL7A 2II6A 4IM7A 3KAPA 5FTKA 4OHOA 3H4TA 1G9XA 1H3NA 5F2KA 2IEYA 1ZUHA 2QRHA 5AT1A 1UXHA 3PE6A 4QYIA 1NBEA 1FFYA 2GK7A 4IYRA 2G4CA 3QXJA 1ZGHA 1HNNA 1HE1C 1GYRA 2R11A 3PFIA 2W48A 1E61A 4N5DA 3C7AA 3GYGA 3KX2A 1PGNA 4PLPA 2QJRA 1FUYB 4F9EA 4GPTA 2MINA 2WJHA 1G5FA 3IESA 4I8XA 1CP2A 2QIOA 3AX6A 1DPGA 2H1IA 1ACMA 4CMEC 4WASA 3CY6A 1R6UA 1QGOA 2ZCVA 3K96A 4UKDA 1T5BA 4WZAE 2Y2UA 2WWYA 4YAEA 1PG5A 2BFMA 4A2PA 3BQ9A 2GPSA 4FKZA 4X20A 4P5PA 2PKEA 2FUG1 4EKIA 4MMYB 3AJDA 3EZ9A 4RZXA 2D7DA 4K9RA 3WWZA 3A70A 3TB4A 3KQVA 4R7GA 5A6SB 2QVYX 1KEEB 3N76A 4H9GA 4QQNA 1PD1A 4J29A 4JFRA 3WFJA 4CIDA 3PUWA 2P2ZA 4BO7A 3BXGA 3IEPA 5D5PA 1OVGA 2O6HA 3RIMA 1A8HA 1G21A 1IIRA 3MYRA 1VPDA 3BFJA 3FPFA 1P4SA 3OLCX 3KKMA 3PNPA 5AQEA 3OTHA 5L3VA 2X15A 3GFQA 5CA1B 3HEAA 5FNVB 4RVFA 1RLJA 2IZ6A 3R6LA 1DAGA 2JFPA 1SVWA 5FTJA 2XJ9A 1RPTA 1VP9A 3M49A 2PZLA 4K8RB 4AB1A 4F84A 5DW3A 2PAFA 1JR3E 1O8CA 3O8QA 2TMYA 3O83A 4OHRA 4TZ6A 1R6DA 2Y1KA 1LU9A 5FOTA 2AA3A 1R5NA 2JDID 4ZQHA 2YBEA 5LZ7A 1EDBA 1TAQA 2XZPA 3H5AA 4P86A 1JLRA 1U2DA 3CNNA 1OTYA 4URZR 2GBCA 2A57A 3MVEA 1X9HA 1Y81A 2A30A 2HLPA 1C0PA 3IV9A 5KYUA 1MOQA 1FQJA 1TJ4A 3AJRA 3VBEA 3MCVA 1Z2AA 2HA3A 5BMOA 2LRHA 2WHRA 1VB3A 2P6RA 2XIQA 4F3CA 2OZLB 5JARA 5L4SA 2QVGA 3W5VA 4DLYA 2PS3A 2R79A 3ACDA 3DNFA 1P17A 2CVPA 3DFMA 5AKEA 3TTUA 3VV2A 4B6JA 3PB3A 3VR5D 3SCZA 1KDPA 5CB4F 5FA8A 4C4OA 4D02A 1NFQA 1UBSB 4OJMX 4ETMA 1CQJB 1SVLA 1HT1E 4GOXA 3V7UA 1A5AB 1CUVA 1FB5A 4KBFA 1USIA 2YXNA 3FHCB 2VDVE 4OREX 4LFCB 2G9QA 2I2CA 4Q1AA 2I9PA 1B00A 4L5CA 721PA 1WXEA 1AHIA 4IJ6A 4J1QA 3LJKA 4YUXA 2OHVA 3LFTA 4V1CI 1WD7A 2VQEB 1KL7A 3MLBA 1ILWA 2K7ZA 3SF8B 3T15A 5B1EA 1ZSVA 1ZX1A 1KYQA 1M2OB 1YK0A 3E5HA 4E4TA 1OC2A 1NQUA 3FF1A 3O3MB 4GQAA 5A05A 3Q8LA 5AVRA 3IKVA 4KTTE 5E1OA 1J2JA 2Y3IA 3DLIA 4H1VA 3K9NA 5K99A 3Q8MA 2F90A 1YDHA 3HLKA 3OC6A 2A78A 5CYFA 1XRMA 3ZV6A 4B09A 1JPUA 2I7TA 2AW5A 4UAGA 2F3PA 3CISA 3IILA 3RJZA 3GGSA 1WEKA 2C4VA 4FMDF 5AVYA 1E0SA 1DUSA 3ZY3A 3NANA 1XROA 2YY5A 3P4UA 2ZJBA 4P93A 2ACKA 4YV0A 2IYYA 3U61B 1QZTA 1N4AA 1GU1A 1GLVA 1NWCA 3GMTA 2FWAA 3RUDA 3ZD7A 3C97A 1XF9A 2EFJA 3F9RA 1NLMA 3HYTA 5ESRA 2IUUA 3TZ6A 2MMGA 3W6ZA 3BAZA 1UJ5A 5E1BA 2GYWA 5F35A 2QT9A 4CIWA 2ILVA 2OAEA 3OJCA 2GAOA 4QDTA 5AKKA 2UUBB 5B2FA 4LA4A 2IF0A 1RWWA 5C7LO 5B1YA 3ELDA 1RKXA 2NVWA 1K7YA 3KAJA 5HILA 1CZLA 3CIFA 3NV9A 4RWZA 5ENZA 4YLYA 2Y05A 1YDWA 1U8YA 2IPNA 1RKQA 2YASA 2I6UA 1VPWA 2INGX 4DJ5X 4DQXA 1FJ2A 2VP4A 3L7DA 3HXMA 3EJ6A 1OBFO 3HCEA 1I33A 4IWNA 4MWTA 3I9MA 10MHA 2WK1A 5TQ0A 9ABPA 2DY0A 5A0VA 3P8ZA 4LJ6A 1E63A 2FFHA 1FMTA 2IP4A 3GJ4A 3A9SA 4R9NA 3U4DA 4LF5B 2FP4B 3GFTA 1RI2A 2HWXA 3LM8A 3Q0EA 4DLPA 2A35A 2IPMA 1RJWA 3GUYA 2ZYUX 3KJZA 3LK6A 2NZUG 3QFTA 3W7VA 4BX3A 4BWVA 4BV9A 3D6HA 2OAQ1 3AI7A 1Y3DE 2VNKA 4KN5A 4KLNA 1AB5A 1IPFA 1W581 4JT9A 4MI6A 1FMLA 5A03A 4GR4A 3I32A 2DQSA 4HK4A 5EJ8A 4YLEA 1J8QA 2Y9PB 3O1JC 2C5HA 3FGZA 4DLSA 1S9HA 1DJLA 3H2GA 4O2AB 2VP5A 4XD7D 3TJMA 5WRFA 5AW7A 1Y34E 4HT3B 3VTKA 2RGBA 1BYUA 5IEJA 1WMAA 3UOAB 2Z04A 1AGXA 1UPAA 2QL7A 3LT4A 2CKDA 5DYIA 2HCRA 4U0JA 1EFVB 5KJEA 1JU4A 1UZAA 3U62A 4XYMA 1NE2A 2QLLA 3G17A 4M88A 2CLFB 2H08A 1QCYA 1TYCA 1Y4ZA 4HPXB 2OXRA 4MROA 2FLKA 2Q3CA 3ODGA 2P6OA 3AM5A 1IXRC 2GHTA 2ON6A 3DOIA 4KMMA 4UEJA 3E9YA 5E7QA 5DOZA 2F62A 3BK7A 5D87A 3DGEC 3B48A 3NR2A 3ORQA 2Y1FA 4OBWA 3WBFA 5KNDD 4RTMA 1ONPA 3T7EA 2HQRA 4HUQB 2O8EB 5FLYA 2GRAA 2QD2A 5L95A 3NVKI 3LLSA 1TFRA 2VHTA 3S6JA 1TZCA 4WRRA 4WZAB 5AW0A 2Y1DA 2QDKA 5LWHA 3C1OA 1SG0A 4U9IS 5CIYA 2ZYRA 5I9TA 1PGPA 3ESQA 2IW1A 3OIFA 5DXFA 4ZAVA 5JCZA 4BEJA 2CNBA 4MPRA 2P77A 1GPUA 2WB2A 4GBMA 1RXSA 5L3RA 4FR2A 4GXQA 4TV8A 1KSGA 4GL2A 2VIIA 4RO0A 3EF3A 4JC4A 3TL2A 3U3DA 4XIFA 4DAOA 2H07A 3G0IA 4S1PA 1E96A 3ZD8A 2CD7A 1QM5A 1G66A 4QELA 4CMHA 2XKAA 3LKDA 1DKNA 1Y4AE 2QMQA 1CKEA 1KJ9A 3IIEA 4OQEA 1OH6A 1R0SA 1DIAA 2WTMA 4XDYA 3VTFA 4AYTA 4ZICA 5A3RA 4ZT5A 4BZZA 2H0QA 3N74A 3CVJA 4DR4B 3C8ZA 4P8RA 4DR5B 3R9IA 1DEKA 1TGVA 2HNKA 3JQAA 4FI3F 2QVXX 3KOYA 2PYIA 2ZB8A 3M70A 2W2OA 4GU5A 1WCIB 3G2OA 4O3MA 4F7WA 4EA6A 2ZSEA 1BGWA 1XKQA 3D3JA 4UHJA 3H9JA 4I55A 1XXHB 3OJLA 4N9QA 2NU8B 2ZB3A 4AG5A 1IL0A 1PSWA 3OP4A 1PX0A 3WGVA 4BKOA 1MR3F 2H2DA 2NO4A 4HH4A 2OENG 3DKKA 4D6XA 2X0NA 4HXGA 1GNQA 1R4MB 4WKGA 3NJ8A 1U9JA 4ETWA 1GPMA 1U9ZA 4HHEA 3GRUA 2OPHA 3TX2A 1OZ0A 3T5GA 2F3UA 3LCVB 2DBZA 4HAZA 4DBZA 4X24A 3PZRA 1H6BA 2LW7A 2H0AA 4UATA 2C4NA 2A7XA 1J2RA 5BXYA 1BS2A 3IPXA 4G4SO 4Y2QA 4A26A 1R6XA 1QP4A 1O94D 2PQ0A 3NWEA 3E70C 5HKKA 2Z30A 1EK1A 4NFLA 1O6CA 3UAXA 3UUGA 1QFZA 3A1DA 2Y1OA 2RIRA 1DINA 4FWTA 2VJPA 1QF7A 4WJZA 5C8VA 1X8XA 4PZAA 4X41A 3UC9A 2PZGA 1JR6A 4F5EA 3DLBA 1R4NA 2DY1A 2IXFA 3OT4A 5L7TA 1FJGB 2QROA 1V5IA 3LPNA 4YAFA 1EE1A 1M34A 3KD3A 4OGGA 5TIIA 4AQYB 4E5NA 5IEBA 1UIMA 4PR0A 3OFND 4QRIA 1NUSA 3PT5A 3IA2A 2W2TA 5CT5A 4ZVOA 4A1FA 3L79A 3ER8A 1Y3FE 1X74A 2PKWA 3SKXA 4UMFA 4J9UE 3VTZA 2PBRA 3O7MA 2P3SA 2ZQYA 1YKFA 2GARA 4U7PB 3IAXA 1HEIA 4CKBA 4XWKA 4M0EA 3U4HA 3S1SA 1NNI1 2XGMA 2PKXA 1GU0A 1SBQA 1UPTA 1YQTA 1ZN2A 3EB9A 4GSLA 5T4EA 2YNMD 1R0RE 1RWBA 1Q3TA 4E2YA 2VBCA 5EJFA 4D44A 5EJ4A 4MLZA 5BN5A 3D4BA 1GNRA 1ZLXA 4UHHA 1QYCA 3HA7A 3OECA 1T3TA 3ZWQA 3GPLA 1DRKA 5TX7A 4MQFA 1JSZA 2Q1TA 1W35A 4LY6A 2Q3BA 3FB4A 5BQ5A 4RVDA 4AJLA 5EJEA 3WMGA 1ZC3A 5KSYA 1ULBA 4XJVA 3WJ2A 5SV2A 1FK8A 3VOAA 4X65B 2EWVA 4ENVA 3WB1A 5C7YA 4UU1A 1JR2A 2PSHA 2HQOA 1PNQA 2B4TO 1NVUQ 2W71A 4N6NA 4TUYB 3U56A 3PPIA 4R1QA 2BFBA 2V03A 2QAJA 2VRWA 3CTMA 2IJGX 4M53A 2YJZA 1QIFA 3PFWO 4R54A 1TUBB 3WIOA 1VJ5A 2O0MA 3N2IA 2PV7A 2YW2A 1VG0B 2NTEA 4J75A 1G5RA 1D8TA 1AIPA 3IAM1 5U4XA 4E7OA 3MA0A 3NHPA 4QASA 1UEJA 3WO0A 3T5BA 2G9RA 1YB4A 3L8DA 3FFXA 1MIHA 3M1IA 3OC0A 3BD6A 2NOAA 3DBRA 4Q16A 3U31A 1H05A 3SHTA 2FWMX 4MVJM 4Q4DA 3GDWA 1G20E 3UEOA 4B3CA 4EVQA 3G8CA 1N6LA 3PPWA 5TMDA 4JWTA 3F74A 4ND4A 4D0RA 5BW5A 3FY4A 1WCIA 4KYUA 4ZVUA 1WSBA 3W5UA 1P8JA 1ZD1A 3WX0A 1AF7A 3GELA 4K9QA 2L0XA 1XTPA 4TM8A 3AEKA 3ANTA 4G36A 1D2EA 2C2BA 4JJ7A 4WT7A 2VCYA 1HZZA 4IAOA 4YECA 2I6FA 4QGSA 3THXA 2VQDA 4YJHA 2JI7A 5EESA 1KK1A 2DFKB 3WG9A 4DMGA 3FBWA 4E5MA 1F38A 3DMRA 1GZ6A 1KK3A 4IY1A 5CT9A 3NAQA 2W4QA 3F8SA 6ADHA 5JRDS 4XIGS 1XVAA 2KBEA 3KT8A 4C3VA 1GZ4A 2CVOA 2C8LA 1UP7A 3JVVA 1VA5A 2GF9A 3NZEA 1YA6A 3VR4D 2BKAA 1MT0A 3DP9A 4ZDWA 2GBLA 4O08A 3O8LA 2GOYA 5AO9A 3KQUA 3RKSA 2QSYA 1CW2B 3Q6MA 3PUJA 3T9EA 3VUEA 2F8SA 2XWBF 2P0YA 3A1WA 3LPCA 4OKNA 4PRZA 1XZBA 1QUEA 3CJQA 1CETA 1EUYA 3KOXA 1CUSA 3GRCA 2P7IA 1KI3A 4KIGA 2F9FA 4NTZA 1YR8A 1E9AA 1T2DA 2A0XA 2PD4A 1AO3A 2PMCA 5EZYB 5J2UF 1Z6AA 1XU9A 3D6VA 1I5OA 1Z0IA 3H4MA 3PFGA 3WADA 4F5DA 2R00C 3Q3GE 4DCOA 4BVAA 3OQBA 5B6PA 2NQ8A 1G60A 4JOQA 2BM0A 3QNUA 5AVKA 1REQA 3DWFA 4IQ0A 2QRLA 3ZY5A 2H7CA 5KWSA 4M60A 4UUPA 2VUHB 1RFLA 2YZ2A 4R6WA 4WLOA 2ADMA 4F4CA 2ZIZA 3RADC 3HM9A 2E4VA 4NABA 5JSFA 2R6HA 3G85A 2V5VA 3BQMB 4N6OA 4N3BA 5K0SA 4CQLA 2QN9A 2HKIA 1I30A 3HRHA 4CTMA 3E1KA 1TNDA 1DVRA 1TU0A 4UTPA 3OIGA 4CLDA 1RQLA 3IEXA 4XGQA 1VJDA 5CLGA 4CUJA 2LKDA 2HXSA 2JFOA 4MRAA 2OD2A 1FZQA 3PRJA 4R71A 4FTWA 4M8IA 4QOHA 4M3NA 4HAVA 1YFJA 4D3YA 5IZ4A 5ALIA 4NU8X 1B3RA 3BCSA 1GFSA 3I9FA 3KCQA 3HI6A 4NQZA 4Y6LA 1AQJA 4J0CA 1LK7A 3A6FA 2W7TA 3OLVA 2NU6A 3D6UA 2W9XA 4PZEA 3SM3A 1KVUA 2GO1A 4RZ2A 1ZVJA 1MU0A 3SBEA 2OAP1 1I0LA 4LOAA 2HJSA 4US1R 1EJ2A 3LX5A 3NIGB 5JMWA 2ZXEA 3OURA 1XRQA 1ZVQA 2Q0SA 1YDEA 1QHGA 4XA8A 4D4GA 2PV0A 4K81B 4AFNA 2OCXA 3ESRA 2N47A 3INYA 1XVUA 4F85A 3L6RA 2ZVQX 4UXIA 1X1CA 4YI5A 4NJOA 3FYHA 1JXAA 3DFIA 3HJBA 2V6GA 3A6JA 3RJMA 4BP1A 4OLAA 4M9SA 1KEUA 1JFFB 3ZE7A 1JIIA 3EC1A 3DVRX 3FI0A 4KDEA 2WNHA 7REQA 4KDFA 2W6JA 1E6LA 4LDQA 4CM1A 3DDHA 3A2LA 4G9EA 4YUVA 4LXYA 1GUAA 5KBYA 2WICA 4YBZA 3B6IA 5KREA 1E3JA 1LSOA 2GJ8A 3RTCA 4BNHA 1JH9A 4HBGA 5K7SA 2VDMB 5HKLA 3U7HB 5TEVA 3U3MA 5DO9A 3UMBA 2H6EA 1Z8NA 2C4MA 2EX0A 2QN2A 3OY2A 4TQAA 5B53A 5BN4A 1YFLA 1BEEA 1ETHA 1U28C 4UHBA 4H31A 1H8HA 4G9GA 3BJZA 4IWYA 3H2HA 3GMDA 3OG9A 4QGAA 4WOCA 5JAQA 3SU8A 2BWJA 3UCXA 5KSWB 1T1EA 4GM0A 3EOZA 2R4QA 4LJLA 1CVIA 2L82A 3UK6A 6CHYA 4DMCA 1A8UA 2Q7DA 1EXVA 5G40A 2HA0A 3GP3A 1WXDA 3RWOA 1TJYA 2MYUA 1FRFS 1MO4A 2QUAA 1UC5B 2XQKA 3CMMA 5TGTA 4LBVA 2C0PA 4V0QA 4E2ZA 5EZYF 4AYWA 2X2FA 4KO8A 3U60B 4GMFA 5EGSA 2FZGA 3PR1A 5ER6A 3DZGA 1MC5A 3PDIB 3D8TA 3EUWA 3AG6A 3CKKA 5DIZA 1YS1X 2EHJA 1ORHA 1PWXA 2NQ2C 3OIVA 3Q3CA 3BK2A 3MT8A 2FAXA 2RG7A 1MLDA 3FFWA 3MILA 2HFKA 4HL6A 2Q1WA 4KMSA 1L5QA 2VSOA 2WAMA 3WMWA 2F4VB 2HDNB 4DJFC 4PZ0A 5TPZD 2P68A 2XIJA 1YE3A 2Z43A 3LGXA 1CQJA 2TMGA 2Z4TA 4D3DA 5B4VA 3QKSA 2G1UA 3TRIA 1M5RA 1OYYA 1ZN7A 1ZRHA 2R87A 3OSUA 3Q1KA 4ND3A 4QTYA 5K0FA 1W5AA 2DKOA 1ZXLA 1JLSA 1GFWA 1GVHA 3HKEB 4IS3A 4TRRA 5H82A 3X1KA 4E12A 1XDBA 2AF3C 2QRVB 1PT5A 3TG2A 1C0IA 1GCOA 2ZJ5A 4OLHA 3AR3A 5B3JA 5LZ8A 4Z4FA 2HI0A 3E22A 2QTCA 4PONA 1CUZA 3JASA 2QZJA 3EF0A 4O6VA 2GCIA 3BWDD 4FT2A 4CW7A 4AZTA 5B1IA 5CAEB 1RYHA 4FKBA 5FLKA 2YQZA 4FDMA 4A0SA 4PQRA 1J20A 3LVFO 3BMOA 2VSQA 5BV1A 4Q3DA 1PN3A 2YZNA 3SVZA 4EPTA 3I23A 1QE0A 3KALA 1QONA 4CIVA 1E32A 5A7FA 3L6EA 2ZI6A 1IZ7A 2G88A 2RGAA 1Z2OX 2J8ZA 3EFBA 4KOEC 4MQEB 3H0KA 1AOXA 2IU3A 1JPVA 3NGMA 4NY1A 3SXPA 2JFWA 5KHAA 4C29A 4EJSB 3KTFA 1QU2A 4RJ2A 1Y1PA 1Z7YA 2H65A 2Q4DA 1UFQA 2PGNA 2YJGA 4QUGA 3X1JA 4ZMSA 3IR7A 2BFDA 3PQ8A 2Z83A 4KQMA 3VBCA 3NU1A 3ZW7A 1OLUB 3PXEA 1N2BA 2NYRA 4BL5A 5DN6D 1IQPA 2Q7OE 5JDCC 2OB1A 1O5IA 1KJQA 3U3JA 2NP7A 1OX4B 1YWGO 1F0YA 2NZJA 4QTTB 1O0BA 5K09A 1JR3A 3D1LA 3OPYI 4FGJA 4XVQA 5TPWA 4DBLC 4FGLA 3JZIA 4WK6A 1K08A 4BGIA 1C8VB 3H5LA 1PV2A 3BEOA 3V8MA 2HJRA 2QRJA 4WFKA 4EUHA 3DG9A 5ED4A 1M2KA 1ZK0A 1JW9B 3PJGA 5HIJA 4EVSA 2PO5A 4UVGA 3G6WA 5CK4A 3FWYA 5EUMA 1IK6A 1EWQA 4TSRA 2QI9C 4F86A 4JU8A 4P2BA 4PGAA 3UCEA 3WLFA 5LL6P 3DE4X 1OXUA 4D0GA 1SQ0A 1B8VA 4BIMA 3S2YA 3JQRA 4ND8B 2WTUA 2Z57A 2VAPA 4RXMA 3ZCPA 4RDIA 2WHYA 5PGMA 3A0RB 3MCUA 3GEMA 1LJ8A 4P3PA 4CL2A 5JUWA 3ZJVA 1NJFA 1ZRSA 3PDWA 2IXBA 3VHXB 3L18A 3I5YA 1JECA 1R0BA 2D5IA 1U7XA 3LF2A 1EDDA 5JLJA 2VATA 4HGPA 2V7WA 4ISCA 2JIDA 3NOQA 3I1FA 1K4MA 2R85A 4LGCA 1W85B 5A3QA 4PTYA 1E5DA 3IPAA 3TLGB 3P9ZA 1YZHA 4UVDA 3WKDA 3ZWMA 5AFSA 3O8CA 4MYTA 5G1PA 3K09A 4OYHA 4R69A 1PUIA 1RP7A 1L5VA 4HD8A 1TTQB 4HDRB 1OXTA 5EFOA 3FNGA 4QPCA 1X80B 2NXCA 1C81A 1JA1A 4NDZA 5TPWB 2IYEA 1XCBA 4IQ4A 3WWEA 4I81A 4KIFA 4YRLA 4QAJA 1HY3A 4FP9A 1G9TA 1R5OA 1TTPB 4B3IA 5CDGA 3Q85A 3JQBC 4Z1OA 4H27A 4URHA 1G38A 2XEXA 2CW5A 1F4VA 1CIVA 1E5LA 4RF5A 5AI9A 3L41A 3IL2A 1GTJ1 3R0ZA 3ZHBA 5EJ7A 1U8ZA 4G01B 2ZIEA 1T3HA 2PX2A 1J1IA 3BD7A 3M4ZA 2I67A 2IZOA 4YBRA 4ZQBA 4S35A 4JI6B 5KQGA 1P4HA 2R8YA 3MS4A 1RLOA 3R5JA 4ZYXA 1B73A 3A1SA 1WB5A 5FBLB 2G28A 4KNWA 1JLKA 4Q4AB 3RGGA 2CFTA 2JD2A 3GOQA 3WNBA 3ZLTA 5TGZA 2GH1A 1HWYA 1ZI6A 4P6VF 2WSMA 3ABRB 2EZ9A 3V4VB 2XBUA 4C7JA 4JUIA 5HFNA 2ZRLA 2IH5A 5EMKA 1Z47A 3PVCA 5EWMB 3I52A 1MOSA 1XT6A 4II7A 1E4OA 4U2BA 4CVNA 4P84A 5CYGA 4PLVA 1GM5A 1H3FA 1DX4A 2BMWA 1SHUX 5DM60 5CAEA 4LHWA 1A9XA 4X9XA 2Q3MA 5BYKA 1JJAA 4AECA 1I7LA 4OGLA 5K6TA 1P5ZB 3GGDA 1BZYA 1C4WA 4TZ0A 3B3QA 4RE5A 2GAAA 4UE3S 3QIVA 2IF2A 4CWAA 3W5AA 1YC5A 1C5KA 4P9NA 4PCVA 3RIYA 4G0XA 3DBLA 4JIMA 4LDZA 1IM8A 4GKVA 4B85A 1JDZA 4NDAA 3LZCA 2QE7A 3TQRA 4F9FA 3JPYA 4INPA 4YXWA 3PEFA 4NQRA 2WYWA 5DNUA 2PWBA 2QRZA 3ZNQA 3BMCB 4B7UA 3OU6A 1XLWA 1RS0A 2P5TB 4BQIA 4RQUA 1CUAA 5AUQA 2DULA 3JQ8A 4LVCA 4EYGA 3U9SA 1UXJA 3G1WA 4CG3A 3QSYA 3OFJA 1YQDA 5J5AA 2QTVB 4FFBB 4RQAA 4PC3A 2QX9A 1BKDR 2OP0A 1TADA 4K2AA 1MEJA 3MGGA 4QEZA 1LQUA 3VO8A 3CHYA 3IQEA 2PFGA 4E11A 1X1DA 3BXOA 1TLLA 3OO0A 2PH5A 3VI3B 4LMRA 4E1AA 3W05A 2WSIA 2DUWA 3D31A 3FZNA 4J7AA 1N2OA 2N0SA 4EGQA 2CXRA 1DAPA 3G7UA 1AKWA 4OHPA 3C6QA 5E7MA 4EAQA 4LMBA 1KQPA 1W0CA 4HMQA 3PTLA 5CG2A 1NP3A 1PVVA 2ZATA 3KXLA 4EDHA 1OXMA 3BX1A 3A25A 1X1BA 2XTAA 4IFIA 1IMOA 3L8YA 3OX1A 4Q1BA 5BW6B 5IJWA 4D2IA 3GLIA 2HSWA 2ZJ3A 5EUBA 2BZ1A 1B6RA 4A03A 2ZUTA 4NF2A 3WR5A 4LXTA 5JU6A 1XZPA 2PGOA 1IPHA 2AB0A 2VCHA 4I1RA 4IIHA 4OGFA 3RIGA 1N75A 1RM5A 2IDZA 5LQCA 3DYIA 3R7WA 4NK5A 4AVYA 3KTDA 1TJ5A 4DC9A 1F60A 1QCDA 5A5DA 3C6YA 4HDRA 5KU1A 2C9YA 5K8JB 1IXYA 4RV5A 2BPOA 4JWKA 2QTRA 1M2JA 2EEZA 2RHRA 1M2FA 2BUAA 1ACLA 3KBBA 4RWEA 4E3WA 2QBYB 4C43A 4KVZA 1DQZA 4LZAA 3LFHA 2EX4A 1CB7A 2HMUA 1T3ZA 5DSTA 3ZWXA 1CZOA 1TE2A 1GPBA 4GZLA 5DT2A 1I5EA 1AKTA 2QB5A 4RPCA 4ZC1A 3JQ7A 2I4OA 2Q4BA 1T91A 1XSEA 1B8NA 4JYPA 4P98A 4RPGA 4W1PA 1Y3IA 2GD6A 2W00A 4PIMA 3TFWA 2JHFA 4DLBA 1QRAA 2VAXA 1ISMA 2M9MA 4M83A 3KJHA 4NCKA 4LRUA 3HU1A 1YUNA 3TNYA 4D8TA 1XJCA 2H4FA 3EPHA 5EIHA 4J4HA 2IELA 3JAWA 1RQGA 1L0BA 2G04A 2D4HA 1TK2A 4YJFB 2R5FA 4BKUA 4YPVA 3N0XA 1FXWF 4C22A 2I03A 4MW2A 4KQIA 1O95D 3H18A 1IXZA 3IMEA 3N39C 3ZH2A 5KJCA 4GQIA 2Q8QA 1J56A 2B4QA 1IZYA 3BN3A 3SS8A 2D1TA 2YMPA 1N6RA 1N0UA 1Z4NA 5IAGA 5TC4A 4V2UA 2XT0A 4AC9A 5BR8B 4OMUA 3EGXB 3EZNA 1RI1A 1ORTA 2JD0A 2VS1A 3BRSA 1HQCA 5EP4A 1KJJA 1DX6A 2OQVA 3WZMA 2A3RA 2H0RA 3ITKA 2WTEA 2JG3A 1HL7A 4ZVNA 1JQAA 1ZUNA 1UKZA 2Y9MB 1AHPA 2G1KA 1SCQA 1ADJA 2NO6A 5AK5A 4B4KA 4CMIA 4HC4A 2AWOA 1PQPA 1MTOA 4QLOA 1G98A 2QD3A 4X1KB 4AWAA 2P41A 4ACAA 1QG0A 3JZFA 2Y67A 1ZD2P 1P7ZA 1IHXA 1Q0SA 1E7QA 3QLUC 1Z4JA 1I0ZA 4KDCA 1ZVMA 2ANBA 2FQQA 2IPXA 2XA2A 2XLCA 4DDHA 2BHRA 1XU4A 1U8EA 2V6IA 4H4DA 3IP6A 4MS1B 4IMPA 4DLZA 1XI2A 4U7HA 3LNCA 1KZ7B 1N25A 1QRTA 1YRBA 2XLBA 3N07A 5DLEA 3ZHXA 5FL3A 1EG7A 2C2OA 4P5EA 3NHFA 5BVGA 3LSYA 1FNMA 5IH3A 2OC4A 4O1MA 1E9SA 3A2MA 2C1EA 5DNAA 4MW1A 4E15A 1U5BB 3DFZA 3G02A 5I5GA 2GDZA 4OB7A 4D3ZA 2Q62A 1JXQA 4TTAA 1Q21A 3MS7A 5MF6A 4ZT2A 1JFSA 3QMMA 3HWRA 3BBLA 4OAPA 5FWNA 1EX7A 1PUXA 1AGPA 1CNMA 1ZOPA 1I1NA 1AA9A 2R7LA 3HCAA 3CN9A 4Q12A 3ZJYA 2VTVA 2ZPTX 4ER7A 3DCIA 1JB1A 5HGJA 4DNPA 4KXVA 3TW8B 3P0JA 3I45A 3THWB 3PA6A 3F6BX 4GZMA 5FUBA 1HE8B 4DRXA 1DPFA 1XIVA 3IAS6 3TRKA 1KEKA 4HJXA 1O87A 1U1IA 2JLWA 2ZTLA 1XN1A 5CFQA 1Z3CA 5F5NA 3SKYA 4BQSA 2OEPA 5DTJA 4IV5A 3SVLA 2FW1A 2GX6A 3KLNA 1I3KA 1RMQA 1VRWA 2BKEA 2V7TA 3IOMA 4PAGA 3RS2A 4F11A 4XTRA 1YRLA 4B4VA 3EXFA 2PBZA 1GZSA 5B4TA 2C9MA 4B83A 4QE3A 3Q3JB 4RXTA 5CDHA 1KQFA 3PCXA 1SU4A 1OT3A 3L8CA 1O6FA 1PQ4A 1ZGJA 3H99A 3LAWA 3N0WA 4JL5A 3DV9A 3DVAB 2AJCA 4M7WA 3TS1A 4ALNA 5KQSA 1W2GA 3LX8A 1T9AA 3CONA 4R1UA 3KSAC 2RJOA 2PUJA 3U7GA 1AJEA 2WWTA 2IZ7A 5F33A 4JHLA 2W6QA 3EBLA 4E32A 5KINB 5C80A 3E1GA 4B33A 3EMKA 5A5FA 5CNKA 1SBTA 2X9LA 3LC2O 3N28A 4OK3A 1VB5A 3DMNA 3ZVLA 1HUQA 2BAGA 4DIBA 1QIKA 2XE7A 1GA6A 3R3JA 1E7WA 2CJPA 2MIIA 3EWIA 1R4NB 3DDNA 4K0KB 3QE2A 3UICA 1MPTA 2FX3A 4NC9A 4WFJA 2JK1A 1LV7A 5SYAA 3QFSA 4DA8A 2E85A 3K94A 5KTKA 4Q7MB 3ZTYA 1EWTA 5JI3E 2O7QA 2B8JA 4LGMA 2HGSA 5LXTB 4YMGA 2DG2A 3OPVA 5JD4A 1QYDA 4CU5A 2RAUA 1NAHA 3BXZA 3ZXSA 3S5UA 1JXOA 2LKCA 5HHTA 1UMCA 3HDTA 2Z1DA 1NMQA 3IC5A 3KVYA 4D82A 1YRQA 3RBXA 4B71A 2JFXA 5EUQB 3T5DA 4QOJA 2V8BA 1DKLA 2CCJA 3BERA 4Q7QA 5TY0A 2W6IA 3BJEA 4EPXA 3CLSC 2YN2A 1XCJA 2FWJA 3D3NA 3GJRA 1DC3A 3SFZA 3TIFA 3ZK8A 3DEJA 5JWRA 1E0AA 2O2GA 3LK7A 5FOXA 1FS4A 1H1LB 3P2OA 4IDPA 4BE7B 3RF6A 4XDHA 1RWOA 3COYA 4JGBA 4K28A 3SIXA 3ZKWB 4AD8A 4KCGA 4B45A 3F9CA 1IY0A 3S1AA 1ZJ6A 1G2QA 1S89A 5H4HA 1PGOA 1NRWA 3WY9A 4B32A 1OFVA 1O3YA 1NFRA 3LXRA 4JBWA 5ILOA 4CGZA 3ZV5A 3HBLA 1TXGA 3NBZC 4WH0A 2VBFA 2DJ5A 5K20A 5BR7A 2AFHB 3CW8X 3B5JA 2C29D 3JTEA 4BB6A 3W6PA 1UAAA 3P19A 1WB4A 1K5DA 2OM6A 2JJ1A 2O7NA 4YAJA 3VMMA 3K0EA 5AXCA 4NJMA 3L7CA 2BFAA 2FN9A 1O5TA 2WF6A 3JVUA 4CTKA 1I10A 3HU2A 4K6OA 3IQHX 3TCNA 4WIAA 2F6RA 1X7ZB 2QS9A 1EWRA 1V1RB 4OHWA 2Y92A 1XRLA 1L1FA 2GPNA 2G5PA 1UEIA 2QE6A 3G2LA 3AF4A 4Q9HA 4RFSA 2K2QB 3K2EA 3Q11A 2MSEB 5FWAA 1C3OB 4OATA 4HUTA 1TZBA 3EXG1 1MFZA 1QZ3A 2PT9A 3KZCA 4PQYA 3C8UA 2W2LD 4TMZA 2P4SA 1GUBA 4CETA 1QNFA 1QTRA 1VE7A 4Q0MA 2G1AA 1QTQA 4C1NA 1N2GA 1W52X 1O1YA 5FFNA 3DPUA 4TKVA 2ZTHA 1UBNA 2NPOA 1MGOA 2ZJ8A 5DYTA 4P3KA 2VUSA 1ADYA 1IEWA 1E1RD 1ESEA 2Q5HA 4LYGA 2B7LA 3MRTA 2GZ1A 2V6MA 16PKA 1L4NA 2G5CA 4OHXA 3UMRA 1D9XA 2HADA 1KGDA 2PUVA 4YRCA 4MARA 5I3ZA 4GX5A 3BL5A 4FKMA 2GFHA 1D5WA 1I4WA 4FEAA 4UZSA 4QULA 1P7PA 3M6AA 4OY3A 5GWXA 2QL9A 3WQSB 2PCJA 4D9MA 5MN4A 4COOA 5KNDA 1Q7GA 2PKYX 4NJMB 3RHSA 4MEJA 1YAJA 4J0JA 4MUGA 1U5CA 2IH4A 3ZS8A 3RUAA 1YDFA 2R60A 3KG2A 2COEA 4N41A 5ULLA 2XAUA 1Z29A 4CN9A 4MA0A 5AVQA 2QTZA 4FZVA 5EKDA 1O95A 4H7PA 5G0SA 3ZLUA 2IP2A 4CCYB 4MW6A 1KTVA 1UH5A 2VUUA 2AG8A 5DXJA 2QGFA 1V7CA 3MGAA 3R7SA 2YXDA 3RPEA 2XZLA 2HT1A 2OV4A 3NHZA 4FCVA 1WV1A 4IF4A 4YRGA 3MBKA 5BMVB 3FYCA 4K9LA 1YCHA 3OEED 5CVUA 2V97A 2CL0X 4C7VA 2QN1A 4YJHB 1HO3A 3RBZA 2YVAA 4PX2A 3KXIA 3MGBA 1XMPA 4M1OA 1Z45A 3L2OB 4KLAA 3OM0A 3RUEA 3EOBI 2OSVA 5LUAA 4QREA 2ZDGA 1ZXXA 1A4RA 1QHYA 3BBPA 2RHMA 2H7YA 3KZ1E 3OMLA 1QC5A 2AQKA 2Q45A 3NH6A 2NTYC 4LOHA 5PNTA 4X62B 1G55A 1KJWA 1UDAA 3OOHA 4P4SB 2CLKB 3ZIAA 4AZ3A 3N7AA 4QUKA 3DA8A 2O8VA 5I7EA 1A8QA 3FZYA 4QO8A 2Z5LA 1E64A 4KGVA 1GJRA 2RAFA 1GITA 4OP3A 2CNDA 4RTPA 1SIUA 2QR2A 3KDSE 5ERGB 3KJGA 1I6WA 1Z18A 3W3AA 2SKDA 2YV5A 3H9QA 3O03A 4Q3CA 5TQVA 4C0WA 1NBHA 1I5RA 2B6HA 3IIKA 1X0XA 3BHJA 1PNTA 3Q9NA 1PJBA 4XDGA 2Z6QA 4HH3C 3N6RA 2G0TA 1WEHA 3EC7A 1RWMA 4PEVA 5JY1A 3H1GA 3P9NA 1R10A 2Y71A 2J32A 3B5IA 1PHRA 3DONA 3H1FA 4IJKA 3IQWA 2IVZA 1LDMA 5I9SA 4U6SA 3DD5A 2ZXUA 4RMJA 5HOQA 4XWWA 4AUNA 1XTBA 4F72A 3COPA 4QJ3A 2IODA 3R0JA 2A0FA 3HVUA 5K6AA 3GLTA 3VDMA 3F6SA 1Q1ZA 3BS4A 1Z83A 3NNDA 3V34A 1RE0A 4G0QA 5D6OA 3HJGA 3GFBA 4TVSA 5CH8A 3TXXA 3DHEA 1FP2A 2JIRA 3P9XA 2PMEA 2OYSA 1P5RA 1SH7A 3EEBA 5ANRB 1Z88A 4DTIA 3WIBA 4TYPA 1R1DA 1ECLA 4FZJA 3OEHA 1S2MA 2QVZX 4F3TA 2H1OA 3DO8A 1T2EA 3CBQA 4PINA 2FMHA 1MBZA 3FMFA 1T0IA 2Z9CA 4ZT7A 4JI2B 1N4DA 3B1FA 4ZCQA 1XZKA 5I3CA 1ZGAA 4W9NC 1NUHA 2CLCX 2EKZA 1OLSA 1ZK3A 2YC4C 4QQ8A 5EMMA 5HR5A 5KNLA 4UXHA 4Q4HB 1CZUA 1GCIA 4ID3A 3RYFB 3WHIA 4NENA 3A6GA 3FZEA 3NDPA 2IWRA 5NLLA 5AYVA 3ZPXA 1SEVA 2BBTA 3AKDA 4G85A 3G3EA 1IZ9A 3BGIA 1LPSA 1RJDA 1R15A 3D4OA 3FCSB 3PITA 3J7AC 1G8PA 3OPYA 1M75A 3CH7A 3DKRA 4QXPA 4WCFA 5G2OA 2ZT5A 5HE8A 3AFGA 2XITA 3TUJC 2BVNA 1Q1AA 2G8NA 2ID9A 1KI2A 4MIYA 1KEPA 4ZJYA 4E46A 3MD0A 1TD1A 3A6KA 5EZ6B 2F8LA 2GF0A 4AMUA 3VKGA 2PUCA 4RLHA 5EC8A 2R62A 3REOA 4ESEA 4MEBA 3QLTA 1XTZA 1HNXB 2N1MA 5HZKA 3QVOA 4HKTA 3CR7A 5HG0A 1QKIA 2VWHA 3LOUA 1H2XA 1TRHA 3VR6A 8OHMA 4W6ZA 5J47A 5IZCC 3F6YA 4OXYA 1QVWA 4W1SA 3AF6A 5LP6A 2FZCA 5IT4A 4CODB 2C2GA 5IANA 1XZCA 2FW8A 4JQYA 3FPHA 5DCUA 1VSQA 4L9WA 1VIMA 1ABBA 3RVOA 5EOVA 4WNAA 5IXSA 2EEPA 1G19A 2ASEA 2VPYA 3INTA 3PXCX 3C7KA 1QWSA 1O9GA 3OJWA 4ENPA 1N2ZA 4EHKA 4B2LA 1RRMA 2Z3ZA 5A7HA 1BGXT 1CZRA 1N7GA 2OM2A 3DL0A 4OLJA 2BZGA 4D45A 1JAXA 2G5GX 1QF9A 2LIVA 4BN5A 3KKOA 2ANCA 1V5FA 5HF9A 3ZUPA 4NEQA 4BRSA 3LCMA 4A73A 2DT5A 2QZ4A 2XMQA 3NKFA 1WIWA 2HBRA 2V96A 4G5FA 4Z1MA 3UAYA 3WWPA 2WP8J 3LUHA 5C5IA 5LWQA 1YSCA 1PL8A 4QGBA 1O5OA 1GAEO 3OH8A 4N1AA 5IDVA 4ARBA 5K03A 3P0EA 5IJAA 3AFIA 1CFJA 1E62A 2XY4A 4FW9A 4OP2A 2I4IA 4RVUA 1N5LA 2PX3A 2O06A 3ZWKA 4LMPA 3VA7A 4CKYA 5CMLA 1ZIYA 2QSUA 2A9PA 5HE9A 1NUQA 2WZQA 3KQTA 3A4TA 4WKNA 2P3OA 3ZU5A 3DOEA 2L2QA 1T1GA 3UK1A 3JRNA 3PHHA 2D7JA 5ERYA 4OXKA 3WKAA 3WTCA 1TECE 1K3TA 4MRRA 4KAJA 3AUUA 4YVFA 3BORA 2H06A 2X14A 4NV0A 3PUKA 4E2XA 1NR7A 1A5ZA 3O90A 4N3GA 2QK4A 3HGQA 4KXXA 4AJEA 2X8AA 4M9ZA 1ZUIA 2FPGA 3G0OA 4BN4A 4N48A 4GI7A 2PYZA 1X7YA 4DG5A 1DO8A 1G3UA 2YS6A 3T5CA 2BFDB 5BQXA 4JQSA 1PR6A 1WDWB 2ATIA 3L6CA 4KGZA 1SBNE 1K2VN 3KS9A 3HACA 4R6XA 4W7IA 4WXHA 4Q9NA 1QV9A 2XXAA 2IT1A 4AY6A 3JYPA 2WWWA 1JI3A 3R3XA 1ECBA 2PHZA 1O97C 4XE5A 4N7JA 1VSTA 3PYXA 3R3SA 5EPOA 3G8YA 3BE4A 3LLMA 4DIEA 3GGPA 3HA5A 1FEZA 1LX6A 1F2VA 2JI4A 2IHKA 4FE7A 1LY1A 1TL7C 1NYQA 4GX1A 5CRIA 3PSHA 1EZZA 4XGRA 3FG9A 2VJAA 2BE9A 4XLLA 3ZCUA 4DQDA 1Y4DE 3HXTA 5U9CA 3GX1A 1M73E 4ZJUA 1XMXA 2ACVA 2FSGA 1AVTA 1KH2A 1YZUA 2CE7A 5BUCA 2FFQA 4TLDA 4ACBA 4Y2XA 5D00A 1DBRA 4H15A 2FPXA 2CEKA 2BFOA 1B0AA 1VKJA 3DL2A 1J7KA 5ALJA 5GQSA 1N7IA 5KCMA 3E5NA 4BLQA 2V4MA 2QRVA 3KLBA 4CF7A 4I8IA 3E9QA 1DXYA 3ZHTA 2H9IA 1QVAA 3KWJA 4JOSA 3DZKA 1UKBA 4QFMA 3Q87B 3GLVA 1XEAA 1TAGA 1Y5RA 5LBTA 2M6KA 1SC4A 4YJ3A 1RYBA 2P9HA 4KE6A 4OSOA 3WNCA 1XAHA 1YQEA 1AUVA 3W3ZB 5A4DA 3RYFA 1E0JA 1JVSA 3VPXA 1THGA 1XMVA 3Q0TA 4D99A 3GG9A 1P4RA 4EPRA 4JXXA 1A9QA 3HKEA 1HT0A 1QVVA 4MR9B 3DEFA 4N01A 4P83A 4BLSA 1OKKA 1R0WA 3FYUB 5C8YA 1U0NA 2JIOA 1Z6XA 4D9HA 3CX3A 1RHKA 1YCDA 2Y1WA 1OXKB 3P71T 3PDHA 2OG2A 1YL5A 4JUDX 4NBSA 4IGFA 4P53A 2DECA 4PZUA 3ANLA 5EP2A 5AXBA 1IY8A 2Y6UA 4I1UA 3OA2A 2IYOA 4LWPA 3WZLA 3AHHA 4WY8A 3I34X 3DOHA 4J8PA 4LXHA 2GRUA 4I4CA 4DLNA 4I8DA 4Y2SA 5SZHB 4BQFA 2WP0A 3MBOA 4KFRA 1C3XA 4L8WB 5C46F 3HO6A 4B3GA 3G68A 4WLNA 3CCFA 4HZIA 3DB2A 4JLVA 4UE6A 1JLLB 3TEJA 2HGZA 2VBIA 1KZHA 2XOKA 4EUKA 1B1CA 1W5TA 1EVLA 4RTRA 4NXNB 4X00A 5JJLA 1C41A 4R01A 2C03A 4B3JA 3L06A 4DSUA 1RQ2A 5F12A 5I7WA 1A7AA 3L46A 1BFUA 2PPLA 5LC1A 3S5JA 2XA1A 4KWIA 3RSFA 4CDNA 1F2DA 2PRKA 5E8JA 3KB8A 3NYIA 5LOVA 4FWBA 5IN5A 5C8ZA 5E3HA 3TD2A 1WW2A 1TYAE 1UKVY 2OCKA 4C7MA 1FFXB 1LTHR 3O1LA 4PN7A 2HH9A 3MF4A 5C31A 2PMWB 5JXGA 3SG0A 4DGSA 3G1TA 3JQDA 3OD5A 3BAFA 1H1DA 1HG1A 4KVGA 3SQWA 2GZHA 2VJQA 4H35A 3PC4A 1PGQA 3UWKA 3X1ZA 4Z3DA 1YJBA 2WTXA 3R3WA 3E9NA 1F2UB 1FRZA 1TU4A 1J9ZA 3B6ZA 2X2EA 4I6JA 4HB0A 4YNBA 1I0IA 2H2GA 3EE6A 5FPYA 3U17A 4DCMA 3K70C 3IUMA 4KO2S 3OUTA 3LP5A 3PRKE 4ZAFA 1D4OA 2G70A 5TT1A 5SY6A 3V46A 1E2BA 1Z74A 4WACA 3EEFA 1KI6A 3TSCA 4F1WA 5DFAA 1L5GB 3SS7X 4BPBA 1WF6A 3NCTA 1FYWA 3WBBA 4EMSA 1ULUA 1MIOA 4HRXA 5I4IA 4O2LA 4RELA 3RASA 3NPAA 4O8CA 2CZCA 2H4ZA 2QAIA 1ZK1A 3AHIA 4P80A 1XP5A 3IOEA 4E51A 5J2TF 2NU7A 2JHPA 3B7GA 4PGHA 1SU8A 4Y1GA 4ZQCB 4HEA6 1E1QD 2R7NA 4JYZA 4LF4B 1IVNA 1NV8A 1PW7A 4TL9A 4EQZA 4UMEA 3IDQA 4O29A 3UJ6A 4G1UC 5IKEA 4R31A 1R7RA 3HQ4O 4I36A 1G8KA 3B82A 1C4KA 1NI5A 2RI1A 2BRUA 2PLWA 2WYIA 4Q01A 3GLGE 1DOZA 2X9NA 1R64A 1IQUA 4DQLA 5FWDA 1D2MA 4ZT3A 3COSA 3N8KA 3OEYA 3HDYA 3AM1A 1ODJA 2HQSA 2ZRFA 2OQ2A 4AI6A 1JR3D 3LKZA 4EO9A 2XMSA 3NJ4A 1FLDA 3GJTA 3K9LA 4YCNA 4DUGD 2UYYA 3KKLA 2C4UA 3H5IA 1CUBA 3DV2A 5BY2A 1XO1A 2NADA 2PK3A 3A6EA 3BIXA 3EAFA 2P7HA 4PVCA 1SCAA 5DOVA 3G59A 4UVHA 2PTGA 3V1NA 4BQPA 1SVKA 1NDHA 4UNIA 2UKDA 1WP9A 2RKOA 5REQA 3FDFA 2CMKA 1TEZA 5B7NA 3RFFA 2BR3A 3TTWA 3M81A 1I13A 1VZ3A 3AHGA 4YR9A 1KJYA 4ZHQA 4DR6B 4L8YA 4HCJA 1T1IA 4GC5A 4DIUA 2BI7A 2XI4A 5LLTA 4OB8A 1S7GA 4UU7A 4LSZA 3IVAA 1U2ZA 1WXGA 1MJ5A 4EEXA 5BNIA 1WXFA 3W5SA 5BSKA 3GFFA 3OFNA 5AJHA 2IKQA 3LHSA 1WZCA 2WR8A 3QU2A 2HRRA 4FZ5A 4ZOLA 3W8EA 4POOA 5K8UA 3IQIX 2FWRA 2PKQO 3H2KA 1AKNA 2G67A 2VCEA 4MJ3A 1ZWLA 4TKVB 2XKJE 1TM7E 1UDCA 3C3YA 1NR5A 4M1KA 1JG2A 2B4AA 1IDN1 5IVPA 3CUSA 1YR2A 3CRVA 3O4VA 4X1OA 3U5TA 1UPXA 1K9VF 1NP6A 4CQMB 4WEOA 4GWGA 2IXGA 3AVPA 3KVNA 4QVGA 5T4FA 4BNUA 3T06B 2X0IA 4J3FA 2OCYC 5IBRA 2WM2A 5E2AA 5EWJB 3B9PA 4DQVA 4YREA 4AKIA 1NBMA 1GKYA 2GUWA 1CULC 4IIJA 1H2AS 4G8JA 2EFGA 4RVOA 4F2PA 1Q91A 3MTDA 4ZGBA 1UL1X 2E4ZA 2RFLA 3ULKA 3ZEAA 3AKCA 5H3HA 7MDHA 4GO1A 1ZMXA 4EKGA 3CEHA 4DNOA 4EJ2A 1HE5A 1TVCA 2I2BA 3QPVA 1K5PA 4LQDA 1NW8A 4HPWA 5CGQB 3FFAA 1P9OA 4XM1A 1D2RA 3M3PA 1U2QA 4UMVA 4QGGA 4ANFA 1IMJA 3NEAA 4BKPA 2R5WA 4DTCA 4GKKB 1P62B 2RGGA 1XAGA 3QP9A 1TM5E 2HHAA 1G3IA 2FZ5A 2LP4Y 4H6XA 4HSEA 3JWIA 5HPYB 2QMEA 3I04M 3INGA 4IG4A 4M0DA 4B8YA 2J07A 4MMZB 1E1CA 2HC9A 3A37A 4ALLA 3A1UA 4D4LA 4QWMA 3WWCA 1G5HA 3MPOA 3D2AA 1SWWA 3COWA 2ZSUA 1VYHA 1SWVA 1XG5A 3GFSA 2GFIA 3ZY2A 3PNOA 4URFA 3WIVA 2P2SA 1I3CA 3R24A 2YZ7A 4A0RA 5BV8A 4JBIA 1Q6YA 1Z4MA 3KJFA 2GXAA 2H1LA 2G9UA 3A6DA 2HFJA 2HNBA 3R6TA 3LQRA 3JQGB 4LBZA 5T5QA 3RU9A 3U1VA 4DC1A 4PLTA 1ABFA 4U5XA 1LKZA 3DZ8A 3EN0A 2B92A 4JKIA 5JDIC 3WB0A 4RK0A 9LDTA 2OZVA 4BUZA 3MWFA 2KS6A 4NE7A 4P38A 1TM4E 1ZH0A 1JFFA 1AZTA 1UR5A 1QTIA 3JQEA 2Q41A 2NIPA 1V16A 3CLUD 2IE8A 3ECCA 1R6BX 2RHGB 3F6RA 1LFDB 3X1YA 2YOGA 5KNCH 3BCRA 3E53A 1KAGA 2I4LA 2DTEA 3QXSA 3KJQA 4GNRA 3EA0A 4HVCA 5A62A 3IT1A 3W6UA 1DUVG 3TGPA 3N6XA 121PA 4I4LA 4B76A 1MX1A 1OJ7A 2NTJA 2MYNA 4I9HA 4JC0A 5B57C 3PCTA 5KYVA 2QIPA 4J2TA 1LPPA 3BM5A 4XFDA 1O6BA 4BOYA 1P5FA 3VC3A 4XZ3A 2FZVA 2R8XA 1EFKA 3AF1A 2AYXA 3N8GA 5JISA 4OHMA 2JLZA 4OX9B 2C3OA 4XQ0A 1TPZA 3MCZA 3U4GA 4IIVA 1FU7A 3A4YA 3S81A 4FQ5A 4CPDA 2GAIA 4K05A 4ZRNA 1EK2A 4HNGA 4MQ4A 2JAQA 4CT0A 4QT4A 3SE0A 4RHFA 3IULA 3LH5A 4II3A 5JEEA 2G76A 1H4VB 1FLNA 2UZIR 2CDAA 1EP9A 1FDUA 3ANYB 1RLTA 4OTZA 3L49A 3ZI7A 3BMXA 4JASB 3RSQA 2VWPA 5CVEA 1M10A 1PZHA 1CEYA 3DNMA 1DP4A 3K0FA 5IYZF 3RCBA 5C1DA 1V45E 3FOAA 1R3DA 3DHYA 3OZXA 1KC3A 2GD1O 1SQ5A 4RSHA 5HQTA 3R8CA 4WEQA 4XWYA 2J3IA 4GPD1 1DBPA 2JFGA 5CNMA 4B6PA 4M38A 3UAOA 4DIOA 1BDHA 3PFCA 5DB4A 1MQSA 2LIPA 1L6RA 5ILGA 5I5EA 5HNKA 4EG7A 1E18A 3AH8A 1UXKA 2C2XA 2C2YA 2IOYA 2ODTX 3ZU6A 2APJA 3RVDA 4AULA 1MN6A 1ID8A 4L85A 1WETA 2XMCA 3G8DA 3SYMA 3UHOA 2NT3A 3HCCA 4PICA 3MQ2A 4KL8S 5BXQC 3TUZC 1EFRD 2AEJA 4CR6A 1WXXA 4YAKA 1EVZA 1KU0A 1P1CA 5I01A 3E7WA 4MRSA 1CT9A 1Z7EA 1NBAA 2PGLA 4CL3A 2HV8A 4I5FA 4IVPA 4Y67A 3G2JA 2V0GA 3PFHA 2B5VA 4ALMA 1P7YA 1QLJA 3BUSA 4LVOA 2Z5GA 3CKLA 1C1XA 3HKCA 2WU4A 3K30A 3RW9A 1CUDA 4QDOA 2H48A 2VXYA 4XIIA 1Q2UA 2HWYA 3IDZA 5I9IA 1E7MA 1WPRA 1KKMA 4BNNA 3CNEA 1B4DA 1EXMA 2HPVA 3FVQA 5IDQA 4INZA 1NXVA 2GA8A 3MIIA 4H7JA 3UGTA 1SQ6A 1QQ5A 3JD3A 5IAJA 3WWOA 4DG8A 2JFNA 4ES6A 1W36B 4P08A 3P0RA 4OYRA 2H9YA 1ZK2A 4D3FA 4D9JA 2WV7A 3NTRA 3X2SA 2ZSHA 5IDXA 1RAFA 3ZYZA 4F6RA 1F6BA 1SOVA 1N2IA 2EQAA 4Z4IA 4PU0A 4EHHA 4IYJA 5KNCD 1SAYA 3OQ1A 2PGIA 3A9WA 1XTJA 4I4TA 3AG5A 2WM3A 3TBHA 2ZITA 5TXGA 5L53A 1QIGA 3CVWA 2GLTA 1JV2B 3CRNA 3VVLA 2P4HX 2Q5OA 3G82C 1UT5A 2XT9A 2J0UB 4Z9BA 4OQLA 4O2AF 2H52A 3RF7A 2XF2A 2XUFA 3DWGA 3HBAA 4QL3A 1F0PA 4RW0A 4UHDA 3LDAA 4TTRA 3LOQA 5T64A 3FUXA 4ATNA 4C78A 1J22A 3ADBA 2IEIA 3WMRA 3NG1A 1FS5A 3QLEA 1U2RA 1YR9A 3BMNA 2W83A 3RKRA 4IMIB 1NTRA 1RVV1 3WL6A 4EABA 2OCDA 1NMZA 3E15A 1SHJA 4RKWA 3W5IA 4FYHA 1OZFA 3WO1A 3K9BA 5CITA 1RI4A 2YIJA 3QE9Y 5JQGF 3IVCA 1JYSA 4NFSA 5EXEA 3D8BA 5K1ZA 3YASA 1L1QA 1SUAA 1DCFA 1AQUA 2QQEA 3NRJA 4R7ZA 3KQYA 4UEOA 5T67A 4BNTA 2RC5A 4BS9A 5KWJA 1XEXB 1JQLB 4M0MA 4GLBA 3W4JA 4RDHA 3KHTA 4BLWA 1YQXA 5D1HA 3IJ5A 5CT4A 4M9XA 2QTBA 1Q22A 3R6GA 1YD7A 2OFWA 3LBIA 3FWHA 3DL7A 3QX8A 4C4AA 3ORSA 3IQZA 1PR3A 5K51A 4F5YA 3FM9A 2UU9B 2ZYVX 5LQSA 2VUTA 3FRIA 2ORVA 2ZRAA 3DKPA 1A69A 2WD7A 2YOFA 3ETLA 3I4FA 3M5DA 5GV7A 1IVSA 1FDWA 1DO2A 5DPMA 4KH1A 2JEZA 3GN2A 5DGXA 2AN5A 2E49A 1IAQA 2HNAA 4B3HA 2YC2C 3ZTWA 4DPLA 1PNOA 1U11A 4ZKDA 5ALVA 5BR1A 4J43A 1VIVA 4L07A 4YFYA 3M8KA 1MV5A 4IO1A 4O2RA 3KZKA 3IJRA 1CB0A 2V7EA 1VFPA 2FKNA 3LUCA 4KQ2A 5TQ0B 3ZWBA 3P26A 4LK2A 4X64B 4BZWA 2HYIC 2BJWA 1KO4A 2BEUB 1Y1SA 2FX2A 2N42A 4J16A 1EDEA 4MQ5A 2P75A 4Q9AA 1Z5NA 3MAAC 4KUHA 1K6MA 1VI2A 1OTHA 4NL4H 2RCYA 4NAUA 5KPDA 3T9BA 3U5ZB 4TT3A 3C3PA 1AKYA 3PIIA 3WDMA 2D2FA 3N2NA 4AMBA 1NVKA 3N7TA 3FOBA 4WY2A 4LTNA 1T1SA 2R8BA 2W43A 1TA0A 2BSXA 3B8EA 3EARA 3JZDA 1N2EA 4HBZA 1I9GA 3PRYA 4UFOA 3VR3D 4L2IA 3ZWNA 1SOAA 2JAWA 4UDYX 3OF2A 1RQRA 4YUAA 2RK3A 2MR5A 3W6NA 1U1DA 2C58A 3OWXA 3P2MA 2E87A 2XX3A 2YW9A 3HGTA 1LLUA 4JB2A 3RT1A 2BGKA 4D4HA 2J30A 3CE9A 4QQKA 5K3FB 3RS3A 4TYWA 1HORA 5DX0A 4KQWA 3BMCA 5BNWA 4Q3AA 4EQ6A 3FNBA 3PICA 3WDLA 5FX2A 1B14A 2WSBA 1HV8A 5IVDA 2PA3A 4X71A 4BO5A 5KS2A 3HVHA 3T99A 1KS9A 1GT91 4F92B 1USWA 3UMJA 3TR6A 4NOKA 1Z08A 4ZK2A 3MJDA 2CKMA 1L7BA 4WUVA 2ZBEA 3L9WA 1JHAA 1ZM9A 3BILA 3WYBA 2H1CA 2B7BA 2B37A 3S2ZA 1NVTA 1U2GA 3WK8A 2AX3A 2V7PA 4CN8A 3A36A 2EWWA 1QRRA 2HZ7A 1V5EA 5CIQA 2GVZC 3LQFA 2GM5A 2H11A 3SHOA 1QXSA 2IOFK 3C7TA 3GCGA 4YRRA 3U3OA 4M46A 5KEIA 4MVJG 4FT4A 4P81A 4WK0B 5EQFA 2C4KA 2RHHA 3WXBA 1RI3A 3PPVA 4J94A 4EEKA 2QJFA 3AR6A 2R4TA 4B3TB 3B78A 2W58A 4GPIB 4G56A 2BKUA 3VM6A 1KOLA 4BMPB 1JIVA 3EZFA 3T7DA 2VPXA 3O94A 4ZV7A 2GM3A 1ZCBA 3JSXA 4GGPA 2DF8A 3CVOA 3DDUA 3H1TA 3QW4B 4TLBA 1YONA 4EGCB 4UASA 2GEDA 3PPYA 4KQ9A 4PYNA 5FBVB 1PT9A 2H4JA 5B58T 3L0ZA 2XB4A 1LB1B 5HRCA 1RXVA 3FTDA 3RHZA 4FSHA 1LC3A 4PZLA 2Q3LA 1XCPA 4Q6WA 2VYNA 2OK8A 3ENZA 4X91A 3GQVA 3GC6A 2OWDA 1W8DA 3EIUA 4JLOA 5F23A 2FJ0A 5JWOA 1BDIA 2EERA 1W93A 1NT2A 1P81A 1LF0A 2CJYA 1IJKA 2FW6A 2YHAA 2B1GA 4XKJA 5EN4A 2Y1EA 3TIIA 3EZLA 4GX2A 3T3IA 5E3JA 5HRAA 2EJWA 4BY9E 4KX5A 4DBVO 4ZJZA 1NZFA 3L0DA 3H11A 4WLVA 5FEMA 1H0SA 2VPIA 3LD9A 4G24A 5F76A 3PFNA 2J3DA 3WL4A 3CLUC 1PR4A 4MR7B 3T3PB 5IXYA 4UM8B 2AOUB 3SYRA 4CEHB 2VRCD 3EGWA 2CEAA 3X1XA 3QI7A 4DREA 2XKKA 2FKAA 3BSYA 2VTDA 4GVPA 1ZJZA 1OBOA 1K1EA 1U3UA 4GWLA 1CY2A 3FPCA 3I92A 4HWGA 4WNCA 4YCJA 5CJPA 5GOZA 1UBGA 3RUFA 1TQ2A 2O2EA 2WE8A 3HYRA 3P9YA 2HWUA 2XB9A 2Y0PA 3TM4A 3IPYA 3V42A 2ZBFA 2WPDA 3H9EO 5H7XA 4FLEA 1X3LA 2X1HA 2GM4A 5SYMA 1E2MA 2A1TS 3EHEA 3A4VA 4NYJQ 4CMKA 2EV9A 1CF4A 2TMDA 3UWSA 4RPKA 1H0KA 2DUNA 3L1UA 1U65A 3LIPA 1A72A 4XJXA 3A2NA 5TPZA 4OUDA 4U39A 4UTXA 2PZAA 2GN6A 1IN6A 3R7NA 5K3EA 5JCOC 1P77A 4F4IA 4E1VA 3H5VA 3DDCA 2J6CA 3VSCA 5KVQA 1IG0A 3PQ7A 1Y7LA 2P8SA 3HXKA 4PGMA 5KTOA 2IEBA 3AKYA 2REQA 1USGA 2AC2A 2PQMA 2VQ3A 4RVNA 4DDUA 5JYEA 3IHLA 4LC1A 4OUKX 2ICAA 5C5DA 3A1EA 3ZW9A 3F5QA 2QQGA 3QY9A 4M1WA 5I9MA 1JFVA 1NQOA 2ZT8A 4S1NA 1DHTA 1HL3A 3T4XA 3VR2A 1KMHA 3UUWA 4HQOA 3IAUA 2QTLA 3EAGA 3ETNA 4L0CA 3UWDA 2XYQA 4BYMA 3BA1A 3NOXA 1SGWA 5EE3A 1I2ZA 3I12A 3JQBA 3RAGA 2ETXA 2OORA 1LRJA 4HAUA 4N5NA 4R5MA 4TZTA 2I34A 2C7QA 1UK7A 1M6WA 1L3BA 1G8JA 4ZTUB 4UM5A 3W04A 3ENKA 3QE3A 1X7XA 4DADA 1SZCA 1MB3A 1T3LA 2OSBA 1FOEB 1LDBA <