3BH6B

Crystal structure of the rp2-arl3 complex bound to gppnhp
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
314
structure length
314
Chain Sequence
PKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 3
publication title The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 105
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2007-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07986 TBCC Tubulin binding cofactor C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3bh6B01
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3bh6B02
3FC9A 4EK2A 1NSQA 1HIYA 1NLKL 1NHKL 3ZTSA 4F36A 3BBCA 2DXFA 4V02C 3FCVA 3BH6B 3EVWA 3WX8A 3NGUA 3L7UA 4DUTA 1NUEA 3BBFA 3ENAA 3Q8VA 1S59A 2B0RA 3ZTQA 4ANCA 3EMTA 3Q83A 1S57A 1WKLA 1JXVA 4UOFA 3MPDA 1UCNA 4FKXA 2HURA 5CABA 2HVEA 1BHNA 3ETMA 2AZ3A 1NDKA 3FKBA 1NCLA 2DXEA 1W7WA 1F6TA 1HF2A 1NDLA 4KPCA 3DKDA 4HR2A 1BE4A 1NSKL 5C7PA 3EVOA 3PRVA 1HHQA 3FBCA 5IOLA 3ZTPA 1KDNA 3Q8UA 1WKKA 2AZ1A 2YUHA 1NDPA 2DXDA 3VGSA 2B8QA 1XIQA 4O0NA 2ZUAA 3EICA 3VVTA 1BUXA 5BXIA 1MN7A 3ELHA 3VGUA 4W98A 4F4AA 1B99A 1LWXA 2DY9A 1NDCA 4ANEA 3VVUA 3VGVA 2CWKA 1K4ZA 4UOGA 1WKJA 3ZTRA 4CP5A 3B54A 1U8WA 1HLWA 1S5ZA 1LEOA 4FKYA 4ANDA 2DYAA 4WBFA 1VYAA 3EVMA 3Q8YA 1NB2A 3DDIA 3Q89A 1NSPA 3FCWA 4DZ6A 2BX6A 4UOHA 3Q86A 3PJ9A 3VGTA 2NCKL 3B6BA 3NGSA 4C6AA 1B4SA 1K8FA 3GP9A 1F3FA 3NGRA 3NGTA 1XQIA 3FBBA 1K44A 2B8PA 1KQ5A 3BH7B 3JS9A 1EHWA 1PAEX 3GPAA 1ZS6A 3EJMA 2VU5A 3BBBA 2HVDA 3EE3A 4DI6A 3FBEA 2BEFA 3R9LA 5CAAA 3G2XA 4S0MA 3FBFA 1PKUA 4ENOA 1NPKA 3EM1A 1MN9A 3ZTOA
chains in the Genus database with same CATH superfamily
3M6WA 5EGYA 5A8RA 1DBOA 1RT1B 3MDFA 4DFJA 1ZAWA 3M9NB 1CJVB 5E33A 2YKMB 3H8YA 2QZAA 5ETLA 2J9DA 3O8WA 1BHNA 2BRLA 5CYJA 4DR7F 3C6TB 4DPOA 3BN7A 5DDOC 3OLBA 4OZYA 5EX0A 1Q7YT 1H98A 1HQ2A 4DF4A 2A2DA 3I5AA 2GVZB 4AT1B 3HHKA 2ZBQA 2BKPA 4A8FA 4PG4A 5J2PB 2Z56B 2R7TA 4RWWA 1RT7B 3LGNA 3TJAA 1IM6A 3MECB 5JXSA 4LSNB 3QIPB 2WONB 1PBAA 4DQQA 4OV1A 4J7CA 3NGRA 2XLKA 1RTHA 5BYRA 2Q3PA 4ZPAA 3N90A 4M5KA 3W2VB 4EFAC 3I56S 4CQ1A 1PG5B 3IG1A 4QBUA 5J2NB 4DJBA 1ZZFA 1GXTA 1G7CB 4WE1A 3LTOA 3BBFA 3RUBL 7FDRA 5F8HA 1IR2A 5D6GA 1UFKA 1VRTA 4M5MA 3V81A 3KLHA 4N5SA 2AZ3A 4RW8A 2Y1RI 3HVTB 1WDDA 3X3UA 3BPDA 1RK8A 1IBLJ 1VCTA 1DFDA 4BBYA 2JRSA 4WU2A 1HQUA 1R3NA 1NHCA 3BO4A 3VSVA 3IWXA 1R8BA 5DZ7A 4CWBA 4F4XA 4FF3A 2E66A 4DHVA 3KFWX 2A3JA 5E0OA 3TW0A 2DGQA 2O1DA 3ETOA 4I2PB 1QE1A 4WP8A 1RU2A 1I3OB 2BX6A 3ENWA 2U2FA 4PR6A 3RB3A 2UXCJ 4LF8F 1GQEA 2NUUG 2BM4A 2MQLA 1S1VA 2MQMA 1HBNB 7FD1A 4OZ0A 4L76A 3N4WA 5KT2A 1HNWJ 3MEGB 6FD1A 1U1KA 1E6VA 1NPRA 4NX9A 4LF2A 1V3SA 1ZAXA 2H9ZA 2KVQE 1GH8A 1BGXT 2AJQA 3QJPA 4F3QA 2E9RX 1UEVA 4NLGA 4PWWA 4FNHA 2IA6A 4MK9A 3HI9A 3I0SB 2I8EA 1HHSA 4XNFA 1FDNA 1M5OC 2YUHA 5M2UA 1FEEA 6AT1B 5F9LA 2NTPA 1TMJA 3ZTRA 3WWGA 2AV5A 2EWEA 4X84A 3J80U 3OTDA 4Q8EA 2CQIA 2LQ5A 1S0NA 4FDFA 3JSMA 3N6ZA 1TKZB 3W62A 3DC2A 3L7OA 5HATA 2NPFA 5ETSA 1ZOTA 1M1HA 2I2YA 5KFIA 4NCGA 2XS7A 4URSA 2C2DA 1S48A 1VQLS 2RS2A 1U25A 2JOQA 2QYUA 1RHUB 1NNDA 2FJDB 3HSJA 2VV5A 2IQ7A 3TP2A 3MR7A 1IKYB 4KO0A 4ZK7M 1TTHB 2HVEA 2YWHA 4MFBB 4PYAA 5AXNA 1TKTA 3NMRA 3I4HX 2ZH5A 3MM9B 1EP4A 5E3CA 3PEHA 4LF5J 1CSJA 3C19A 4OHVA 3CDUA 1U2RA 1HBOA 4ZCMA 1YWXA 3AB4B 4F26A 3G4SS 2Q66A 4KHPJ 3THPA 2AWZA 5CCMA 4YY3F 4YOEA 3IBFB 2XTWA 3M8WA 3E01A 1CULA 3K5PA 3W5ZA 4NI2A 2RILA 5K8MA 1J5EJ 1RAGB 4JV5J 5KG2A 1OPIA 1N88A 1IDKA 1NJYA 3Q2TC 2ZM6F 3SQGB 3RBZA 1QA1A 4ID5A 1TFWA 3H42A 5KOWA 1F5AA 4DPUA 3P6YC 4WYWA 2NYHA 3QLHA 5CABA 4I7FB 1KFSA 1SKWA 1GX6A 1W7WA 2D3UA 2C3PA 1O6XA 5A0YA 4KBIA 2G0JA 4NEYA 3SSRA 2YWWA 2G0YA 2B7CB 4U6PA 4RNOA 2IBOA 3KMSA 4J9UE 3VGVA 2KRRA 1VBLA 2RAQA 3MPUB 1PXZA 3MGJA 4IOAQ 1NMEB 5I3UA 4CDIA 1XNRF 1F9HA 3R5AA 5LMUJ 4ED7A 3TNVA 2BABA 2DEJA 5D4NA 3R5DA 4NZ7A 3KTQA 3MEEB 3KHHA 5K8PA 3KXDA 1FXLA 3CT9A 1QSYA 1CLWA 1ZA1B 3ZNJ1 2OO4A 1QSLA 2XCPA 4NLDA 1BQNA 1FERA 4X4RA 1RTJB 3R27A 1KVIA 4QU6A 2EFNA 4OX6A 4HI2A 2OAUA 3GONA 1UW9A 1QA2A 3IRWP 3CCZA 1O8GA 3VAGA 3MFIA 4Z03A 3VHQA 2QZ8A 2FHJA 3BDEA 4B02A 5DJBA 1R0AA 4DR4F 2GNKA 4FPRA 4WTYA 5HMZA 4ECVA 1H38A 3MEDB 1NEEA 4EO8A 3HKZD 1DTTB 2FY1A 1VQPS 4HTJA 3KK3A 2BM7A 1U0HB 3EICA 1JNRB 3PIPQ 3ITHA 3TX8A 4DV4F 4ILLA 4DV2J 2UVRA 3G8QA 2Q1LA 4I2QB 1Y4ZB 1TV6A 3BYRA 2SXLA 1DZ5A 4TN2A 3AAWB 3M6VA 1RCOB 4WZQA 4XQFA 1H2TZ 2WVCA 5T7LB 3V4IB 1D9FA 1Q86T 1XMQF 2DHAA 3QATA 2GMHA 2Z2MA 4DR6J 3BH7B 4KPYA 2DB1A 2XI3A 3KNGA 1UP1A 2C2MB 3DMJB 4YZXA 4DG1B 2VOOA 3WX4A 1S9GA 5DGBA 4PWDB 3RBXA 2EKYA 4CT9A 4RJVA 3VAIA 5KFRA 5IT4A 4A8WA 2CJBA 3SEOA 2YKOA 3A3NB 2C2OB 2WVDA 1WC1A 1TYUA 2O3DA 4V1Ak 2CG8A 1RWNB 4C3KA 2UVFA 4RW9A 2HFVA 1QJVA 2ZH4A 2MJNA 3GRHA 1Y5IB 3BPSP 2X3HA 3D54A 2HQIA 1EETB 1UJ5A 1T05B 2A6OA 4UF4A 4C8KA 2NYIA 4OZLA 2DHSA 2DXDA 2E7XA 2ZVIA 1VMBA 3BGRB 5L46A 3HP6A 4RL1A 4WKRA 4Q43A 2VG6A 1VGYA 4OZZA 4CI0B 4CP5A 4F02A 4FYVB 3SIPB 1NK8A 3P96A 4B3RJ 2LQ8A 3PX6A 2WCXA 3IFEA 1WHVA 3BZQA 2V4JA 4M1KA 3GTYX 3PKYA 3I32A 3K2YA 1IWGA 2ATCB 3NRBA 5SZTA 1DLOB 1WTFA 4BDPA 1RBAA 2PC6A 2DNNA 1TL1A 3NAIA 2BQRA 3P5TL 4EYIB 1SCJB 1YBUA 2GFFA 4FF1A 2PYHA 2JSXA 2FYXA 4MIWA 2FHOB 1FT8A 1U02A 3GIKA 2W9BB 4ZVQB 6FDRA 1G4CA 1RXOB 1NCLA 4O3NA 2YPYA 1VC6A 2JEIA 2WB1D 1G6BA 3AA9A 1N36F 4WP9A 2ZBRA 3FSIA 2YX4A 4Y2KA 4B08A 3U02A 3NG8A 3ZFVA 3IBCB 3M2UB 3MWBA 3D6TB 4K2XA 2XC1A 4DV7F 2XT2A 1OY6A 2QXZA 3EUNA 5C24A 4KH0B 1KS2A 2RUGA 2ZZNA 2KT5A 4Y00A 5EUHA 2P9CA 2NUHA 4J90A 4E98A 5G0RB 3G87A 3BO3A 4YMEA 2E29A 1YBAA 1FESA 3KRGA 1HA1A 2VBZA 1GMUA 2OUGA 2PN6A 1YG0A 1RLDA 1CJKA 1R8PA 4DS5A 2GJFA 4QYZJ 1KSPA 4F36A 1T03A 3GIMA 1XTZA 3GYXB 2NT6A 4K4WA 1F5CA 5IS2A 2VQFF 2AGOA 2FJVA 2QN6B 4AL7A 5LJ5Y 4P2XA 4JI4F 1N0VC 3UD4P 4YB7A 2INUA 1KR4A 3S01A 2VD3A 1MROA 4GMKA 1RZMA 1CEZA 3IS9A 1SVDA 3QT8A 1RT3B 2RQ4A 4GVLA 3UCZP 3DRRB 1RT7A 4GO7X 1T9VA 1YHQS 4OI0A 1WG4A 3MECA 4C98A 3LP2B 4LSNA 3LALA 2WONA 1YJTA 4OJLA 3AQOA 4RW7A 4LJMA 2HZCA 2RSQA 2HFSA 1FXRA 2MLYA 2UVUA 2OJ3A 2MYFA 1S6UA 3P49B 3CO9A 3UW1A 2VPWB 1KOOA 4K0KJ 5J2NA 4OJ5A 3GV8B 2HQ3A 1K0VA 5A2QU 2M2BA 4I67A 2VUGA 3TUZC 4KH1B 1U24A 3VMVA 3OFEA 2PA3A 5DLFA 3T9ZA 5L1JA 3G2XA 2GQCA 4X4VA 4WFNQ 4W8TA 1MU2A 1VQ9S 3ZTOA 3ULHA 1ZA2B 3MMAB 2QYGA 2EEYA 3BJYA 3HVTA 1EE6A 1BQMB 4DV5J 2HSEB 4DQSA 3AOCA 3T5KA 2LECA 4K5SA 3KG0A 2V9WA 2CYYA 3OTEA 4PYDA 3ILOA 4KGKA 4H4MB 5F8NA 2RHSB 3V4MA 2G2OA 2FJEB 5JVGQ 1KONA 5DO2A 5F41A 3M2VB 2R8KA 2V2VA 4ZITA 2DPIA 4QU7A 4YEIA 3CIMA 3DRYA 1WHYA 1JLFA 4J5OA 4KHRA 1NM2A 4EYHB 2JFKA 2W2PP 3M8PA 2RKIA 4X66J 1F0XA 2UUBF 3KK1B 2IBKA 2FVCA 1JK9B 4P7TA 2ZH2A 2FVPA 4RNFA 2H4WB 2BE2A 4IH6A 3MEGA 3DLBA 4HT7A 4KGZB 4QR2A 2F3LA 4A8XA 3A8JA 2HNDB 5IT9U 4XOPA 1OJ4A 5D0RA 1RWRA 2QT7A 2AQ4A 4WU3A 2JH3A 4NZ0A 5KFEA 2FZGB 2MZSA 2QL9B 5D0GA 4B3MF 2B0GA 1FNMA 5GMKa 1VIOA 1T94A 2UV8A 5CZVA 5H1SV 2YH1A 1JRGA 1XN9A 2W24A 4DL6A 3PW4A 1WELA 1Q8IA 1TAQA 4C2MA 5K9FA 3F73A 3QT6A 3PZPA 1W25A 2E5GA 5B0AA 2HVZA 1F3VA 3UPFA 1LW0B 1TKZA 1CQNA 4YR3A 4ZN3A 3GG0A 4ZLPA 4D3HA 5CD4A 4C0BA 3EQOA 2WSEC 2EK6A 4Q8FA 4NXMJ 1S6QB 4NLTA 4C48A 2H51B 1T9TA 2QLJB 1OS5A 2HKEA 3TAPA 4BWJA 3ZZTA 1HKAA 2CDRB 2OPQB 3H4DA 5LMNJ 4YZQA 4MKAA 5B09A 4LBHA 4XDCA 3AXMA 2CQ2A 1RWOB 1LK5A 1NPKA 1APSA 3IN5A 4MFBA 1JXLA 3PSSA 3SV3A 1AZSA 3TZWA 4XO0A 5ETPA 3N6NA 4ZVPB 4I69A 2IAJA 3MM9A 4J9KA 2IJFA 4F0HA 2D3OR 3TVYA 2V63A 3E8OA 1U6BA 1PSDA 1N5YA 5E3PA 4QIEA 5H9FK 3GFHA 4DBQA 3J81j 4AUKA 4USJC 2XMAA 2HQDA 3FNNA 1XIQA 5BXIA 3LP1A 1FRMA 1KOHA 3FK4A 4PABA 4J9LA 2HMIB 1QDUB 5FDLB 2MMYA 3EZOA 1KKHA 4WFXA 2I6WA 1QRBA 4LSLB 4IRKA 5L8RC 3FSXA 2YY3A 3HVWA 1QAIA 3KMQA 2VH7A 2J8AA 4R5PB 4X4NA 3MXHP 3PJ9A 3SQGA 3TZYA 1IQTA 3AOBA 3U27A 5LSLA 2AF6A 1XR7A 4DL0C 4OYOA 3P3DA 3HD2A 1PCAA 3K7RA 4H54A 2HVIA 3L4BC 2K7KA 2HK2A 4JV2A 2W4CA 2ZKUA 2VPYB 4I7FA 2XGQA 1RACB 1JJ2R 2VA3A 4EK2A 2L9NA 3SYJA 5IM0A 1RT4B 2HQFA 1WOSA 1ZBTA 4FVCA 4F50A 4WFYA 5KFLA 3GFYA 3BSOA 3ISZA 5D4PA 4OYZA 3J81Y 1SL0A 1FX2A 1UA0A 3M8YA 3FDSA 2VFUA 1K73T 1C4AA 3UCGA 2VBKA 5E3QA 1X5OA 4F4WA 1X0FA 4CH1A 2J0XA 3R1LA 1UFWA 4DLEA 1LXJA 1HR0J 5T14A 1W2BR 3MEEA 1CQMA 3EQNA 2OPSB 5K8OA 2G4BA 2HHHF 3QFWA 2ZD1B 5LMUF 3Q8YA 3D4JA 1RTJA 1IR1A 3OVAA 1IBKF 3VZHA 3CD7A 4ZVHA 3CJKA 5GADU 3VAMA 2BW2A 1N34J 1D9AA 1Q5YA 4YHHJ 4IRCA 3NS5A 4KV8A 5KG1A 3HVRA 5THWA 2P6TA 4IKAA 3FBFA 3OW2R 5BJRA 5HANA 1IJFB 2DT9A 1NLKL 1UW4A 1S7IA 3MEDA 4UQGA 1DTTA 1WOPA 4G1IA 4F8RA 4O44B 3M7VA 1U0HA 3SDEA 2N7YA 3EPGA 2VFQA 4QQBA 4Q45A 4QIVA 4LF7F 2V4RA 4CLYA 3G6ES 4EI2A 3ZZ0A 3OJUA 4A8MP 4NLOA 4DV2F 1TQLA 3VCDA 1UVMA 2KTQA 2ZHAA 1F9FA 1JLGA 4TU7A 2BVZA 4NLSA 1IDJA 2EFPA 2E9ZA 4YELA 3T5HA 1WDTA 4DG1A 2N3OA 2BE7D 3CW2C 1V3RA 2R7QA 4NLWA 1Q8LA 4DLGA 3M2RB 3QGIA 2IFXA 1FKOB 1LWCB 3UWTA 5EWEA 2R8JA 1SJ4P 1H74A 1XERA 4JI0J 1LK7A 1RHRB 3DDKA 2UUCJ 1SXLA 4K4XA 4MIBA 1JLBB 4WJBA 3UI3A 3OJSA 5J2QB 1HWLA 1RI7A 3Q2SC 3CJ3A 4V19J 3KUGA 3DCAA 2HRUA 1WC5A 3H40A 2VODA 5KFKA 4OJPA 4ZIWA 3SFGA 2HZVA 4BC9A 4PQUB 4OV6A 2CDQA 2VOPA 4RUBA 2DISA 3NWGA 1RT6B 2AYMA 4ER8A 3CJ5A 3MPVA 3FBCA 3QT7A 4NYOA 4CIOA 3VV2B 3CPWR 2XNQA 1PJ7A 1O0PA 2BDPA 4HT5A 3OFGA 4WKYA 5CYMA 3RRGA 4PKDB 3RBDA 3CC4S 1IBMJ 1LW2B 4MK7A 2HFOA 4LBIA 2DYAA 1N8RT 2W2NP 3S7RA 5KFMA 1QVGR 3G96A 4RW6B 3F44A 3IM9A 1EX8A 3SYZA 4NK6A 5EDWA 2DKOB 2RF2B 3K5NA 2CIMA 2VDHA 3TO8A 2EW9A 2MY7A 4LF6J 2W9BA 2DHXA 1F60B 2HHWA 4WTOB 1VQMS 1N4LA 2Y1IA 1FJ7A 3QNWB 4ZPTR 4K4VA 3HT3A 2HS3A 1WF0A 2UUWA 1NH7A 1PGZA 3CJQA 3IAM9 3OTBA 1S97A 3DDNA 2RU3A 2J6TA 2XMTA 1U47A 2HHXA 3M2UA 3GE9A 2ROPA 2V2QA 4MAKA 3TA1A 1SH0A 5CHCB 4AYBD 1LLWA 3H7HB 1HW8A 1HWKA 5J1EA 1YBTA 2Y0BB 5EX3A 1XMOJ 2XO7A 2RE1A 1MMLA 2CQHA 2IVYA 4DV6J 1X5PA 4DPWA 4EUVA 1X8DA 3JQJA 2JVOA 4LRBA 4ZKAA 5DDQC 2CNOB 4LFAF 2R4FA 4WBFA 3DU6A 3QRQA 3OXLA 2AEFA 4XMYA 5HBMB 2NSCA 3B6BA 3NGSA 4DV1F 1TMMA 2D74B 2POKA 1WWHA 2MKIA 1T9WA 2K1RB 1S99A 5DGAA 4MJKA 1ZS6A 1JLAA 4LSZB 5KFVA 2AX0A 4QIFA 1GMVA 4USWA 2VB6A 1NK9A 4XOTA 4ICLB 4YEAA 3EVWA 3AJ1A 3IGNA 5HVGA 2ZOMA 4E0DA 4YDDB 5SUHA 2V68A 3OUYA 3W5XA 3ZZPA 3PHTA 1ELOA 3MOZA 2MKSA 2OTJS 3M8SA 5DQGA 5C25B 2MPUA 1S72S 3CCJS 2CPIA 2HYIB 4DUYF 1BHEA 2H5IB 4DV0F 2PMWA 3D2WA 1B99A 1D3WA 2JEJA 2NZCA 2FDNA 3MCSA 3HHLC 2DO0A 2QL7B 4RNHA 2MKKA 3TX0A 2GMJA 2DR8A 4CLTA 3KLIB 5CD4H 4FKYA 5F9NA 2JVRA 2FTRA 2BE9B 3UFCX 4XLEA 5F3ZA 4HDHA 2JJ4D 4K0KF 4EO6A 2Y8YA 3N9UC 4P7VA 4C8NA 2HFUA 1Q0NA 4TLQA 1BQMA 1Q8BA 5GAEI 2E5IA 3GJTB 2GJIA 2HVDA 3R97A 3R6GB 2FC9A 2YQ3A 2DGTA 3KKFA 4RBTA 2F8MA 4H4MA 1QY7A 2QX0A 4DU7A 5AE1A 2CJYB 1JKHB 2MSSA 5ETOA 4BHQA 3A12A 5GAGU 1UPPA 2G2YA 4DV5F 1DURA 1AYEA 3SI8A 1YRUA 3OHBA 2C2EA 2V34A 4NEZA 2WVEA 2AD9A 4PXCA 1UVJA 3R6LB 1O8IA 2MSTA 4U8VA 2DHGA 3QGHA 5HROB 1FEHA 3FFIA 1VISA 3D67A 1UEKA 4IO9Q 4CO2A 3DLEB 4TYAA 1ZETA 3ICLA 3EPIA 1H3DA 2FC8A 4LUBA 3I4PA 2BW7A 2JZ5A 2XYPB 2BJ9A 3EVMA 3PRBA 2HNDA 2F4VF 2XGPA 1I6JA 3CWJA 2YWEA 2HWHA 4BC7A 4X65J 3GPAA 3ENVA 2VBMA 3IRXB 4DV3J 4ED3A 2YWKA 2ALYB 2QGFB 4IG3A 4OJ1A 2IPOB 1O8HA 5KFTA 4M94A 2LKZA 3R5JB 4DF8A 2XCAA 1YJVA 2QJ3A 3EMTA 2DIUA 3HSDA 2MY8A 2HG4A 1LW0A 3MPDA 2LP4A 3IP0A 1LWFA 2RQCA 1OIAA 5GAHU 2AYEA 4EGLA 2B6AB 1HBUB 1CVJA 5LL6d 1UMJA 3GFXA 4QWCA 4DSIA 2ASDA 2HIQA 2HLUA 2HBRB 3BN4A 4G1QA 5DETA 1DJ0A 2ASJA 4FYWB 4LREA 3AK5A 2BJ7A 3BM7A 3DNCA 1FE0A 1KD1T 4O4RA 4DWIA 2XZWA 3R5CA 5BYQA 3PR4A 4LRFA 4OX8A 2JWNA 2A10A 4RLEA 1VC5A 1M90T 4PG8A 1KQ5A 4B9SA 1NK0A 3N5BA 3VZIA 2OD4A 4RKUC 3D3BJ 2ZUGA 1HNVA 3WC0A 3UR3C 3FQLA 2PI4A 3KHGA 2WVFA 4ZMMA 1SJ3P 4GC6A 2FIUA 4U96A 4E8UA 1VK3A 5L9NA 2PEBA 1X4EA 3MR6A 1WKLA 3MD1A 3HVAA 3MM8B 3DOLA 2Z57B 1I5OB 2HMIA 2BBEA 4CLZA 3PW5A 5FDLA 1VHIA 1IVZA 5AE3A 2IDLA 2WVBA 4CYUB 4RW4B 2VBEA 4LSLA 2C2NA 4OYXA 2J0WA 2HAIA 3UCUP 1X9MA 4R5PA 5KG4A 2ERRA 2AJ1A 3QSIA 1FKPA 1FX4A 3EGZA 3DRSB 1HNZF 3NWRA 1S4EA 3B4MA 4ZVTB 1RAHB 3D68A 4LR9A 3BSAA 4AQYF 2HRYA 4KC5A 2VG5A 2CFXA 1F3FA 4LFBF 2LXUA 4PXBA 4U7CA 3JS9A 1FA0A 3NCQA 3SCIE 2QG9B 3LOUA 1V3ZA 1VFJA 3PRDA 2HNYA 4EBEA 1JLCA 2RQMA 3D0HE 8AT1B 1E6YA 4C8LA 1U6ZA 3N6LA 1JWWA 3WIVA 3SUCA 2J0QD 4CO5A 2AYGA 2XMJA 2YNHB 5FIIA 4X64J 1HNIB 5E7OB 5KFFA 1HQEB 3H98A 2V6AA 1UKUA 2RIJA 3FKBA 5D78A 1LV5A 2OPSA 2LQJA 2VQEJ 2ZD1A 4C11B 2XSFA 5A8KA 3HLUA 2DBBA 3MUTP 2FB0A 1N56A 5ETKA 1RYSA 1RKJA 2KJWA 1PYTA 1VRUB 3D1HA 3FEZA 4XLCA 1K47A 1HPZB 1Z2LA 3DU1X 5H9EJ 1NHVA 2ZJPQ 3J7Z5 1H0HB 3HPOA 2O67A 4PQAA 1NO8A 2HBZB 2MJUA 2LEPA 2IY5B 3BYPA 2VL1A 4A8YA 2B9YA 4Q2LA 2H65B 2E1CA 4YHHF 2BJ1A 2IC3A 1BQXA 4NPOA 1R8HA 2ZH1A 2CPDA 1J27A 1SC3B 4WZMA 5DG7A 4ES3A 1PYSB 3FQKA 5L39A 2UXBJ 1J5OB 4CRJA 2CNLB 4ZP7A 3GQ7A 3P4GA 2JX2A 2DXEA 4JI3J 1F6TA 1XR6A 3HHLA 2DRAA 1WMRA 3NNHA 3PG9A 3GU0A 5C7PA 1FDDA 4QYRA 3HHDA 4WCEQ 2HPUA 2P5VA 3NS7B 3OFFA 4N76A 5J2MB 3O1LA 1HBMB 5L1KA 4P73A 2Q43A 4U8YA 4C3MA 2H54B 3PX0A 2BZ2A 2P2CB 3KG4A 1FKOA 1LWCA 1VYAA 3RGIA 1BLUA 4I1TA 4YR0A 4U9RA 3J81U 4LF9F 1CJTB 4DCOB 2D1CA 1JLBA 2V94A 5HJYA 4DQRA 3GP9A 1SH2A 1RWUA 5IWAJ 4OFZA 1NK7A 3GQAA 1RJJA 3E2EA 3SZ2A 3B90A 3R9LA 1K1SA 1XBWA 1NJZA 2MB0B 2MGZA 4QW8A 2ZBCA 4Z06A 1WOOA 3W66A 1RT6A 1AFIA 1T3NA 1JTAA 3Q8VA 4CZCA 2OIHA 4AXJA 2V5HG 1FE4A 5AJ3F 2APOA 3C16B 2BUNA 1KC8T 4IOCQ 4ZLLA 2OPRB 2CQCA 1LW2A 4DL4A 1RSCA 4OZJA 2MZ1A 4Z05A 2YNGB 4ZPDA 3UN3A 1VLOA 3EXYA 4RW6A 2WB4A 1EARA 1I94J 2BA9A 4K4ZA 1V5VA 3AODA 3DLJA 1LM1A 3BDPA 2OMLA 4B9TA 4XK8C 5CYQA 1WHWA 3MI7X 3Q86A 2PYGA 1K8FA 3AD7C 4EEYA 3D3CJ 4QJVA 3O6QA 5KG6A 2HBQB 4M8LA 3NLCA 3WIUA 4KKOB 3IA0A 1S1WA 4LF6F 1AB8A 4WXOA 4Q5VA 2Y0SD 2Y1LB 3OTOF 4RBUA 3ZTSA 5GMEA 2JC1A 3KJVA 4V02C 3MM7B 3FCVA 1BXNA 3OSPA 3KLGB 2C3OA 4Y65A 3GV7B 3OR1A 2MEWA 2YQ0A 3I82A 4OLOA 1H72C 3U7JA 1CJUB 5KFBA 1GTHA 1OQ3A 3GIRA 4M63A 3SSSA 3OXGA 4CLWA 1KDNA 1NJIT 3VSUA 1JJHA 4OJ6A 9ATCB 1XMOF 2CJ9A 2XSJB 4F7VA 1IKXB 3IO1A 1YI2S 1R0CB 4DSLA 1I1GA 3JX8A 3KYLA 2GX8A 2J9DE 3AA8A 3TAMB 2CNKB 4DR5J 2B5JA 4CH7A 3PJWA 1PO6A 2JDJA 1S1UA 4ICLA 3NNCA 1Q81T 1RDRA 3C66A 2CKWA 3EJMA 1N54B 4RO0A 5DZ6A 3CXCR 3W8PA 2UXDF 1RCXB 1RT5B 3MOJB 2UUAJ 4ED6A 3W61A 3FJ2A 2HHVA 4RU9A 4NXNF 1FFSB 1PJ5A 3C14B 3HF5A 4LR8A 4CLKA 2WOMB 2RD5C 4YUDA 5C25A 4ECXA 4ID8A 4TU8A 3JAMY 3HM9A 4TKTA 3BGOP 1SC6A 4XPCA 4YEJA 1NDKA 1WG1A 4UZBA 1D8ZA 2DO4A 2LA4A 4OI6A 2PA8D 1C1CB 4TQRA 2ADCA 4B3SJ 3VGUA 2BM1A 3DLKB 2HQCA 2KFNA 2J7WA 2B51A 1WACA 5FLXY 1NJXA 1RBOB 2W25A 2OD6A 4X4TA 1IKWB 3M1VA 3TQ1A 1PC5A 3Q89A 4DZ6A 5KT7A 4B3TF 3CCVS 3KWMA 1ZAVA 4L74A 2QMXA 3BREA 2UU9J 2HFZA 1UWBA 1XG2A 1P8GA 3RAMA 2ILYA 4B3OB 3QFHA 5IFMA 4ECRA 4LIWA 4XN3A 4A8OA 4GVBB 4I68A 1FD2A 2XC9A 4GO5X 2Z8GA 4FYDA 4L3NA 3LH2S 2N4DA 3E51A 2H5EA 4DUZJ 2VF3A 3M30B 3FCHA 1NZ8A 4LVOP 3O2IA 4YB5A 3KHRA 4P10A 2D9PA 2O04A 1A7GE 5BR8J 1U4BA 4JBCA 3DLEA 2CQBA 1FCAA 2G1DA 2ZWPA 5E3RA 5HMXA 2COLA 1O88A 2LDIA 3DLLQ 1NDPA 2IIHA 2VFSA 1LOUA 2WAQD 1V9OA 2F40A 3M32B 2O01C 5HLFB 1RT2B 2VZ9A 3OVBA 1LQ9A 3IRXA 2CQ4A 1FRKA 1S1XB 3G82A 1P9QC 3ISNC 4XIUA 4UOHA 5HQMA 4C6AA 2E7WA 4XLFA 2IMWP 3W2WA 4DS4A 1UZDA 1RWMB 3NNAA 4F25A 4JYAJ 2M8HA 2QLWA 2WW4A 3BO2A 3LWMA 1D1UA 1VI7A 1RHJB 1DTQB 1O8EA 3RR7A 4GKJF 4DV3F 4C4WA 1HI8A 3LP0B 4IH5A 1SV5B 3ZO7A 4FXWA 4Q0BA 1SQFA 1HBUA 1NK5A 2R7XA 4DL3A 2XY7A 4PXDA 4RR5A 2A2CA 1S57A 3H2LA 1JXVA 3OR2B 4DPXA 2NLWA 4WXWA 1UAWA 1S6PB 3OL7A 2L3MA 1OWXA 1N32J 2ZDPA 1UVKA 3A8EA 4EW9A 1QLNA 4KHMA 2IJRA 1VQOS 2M8DB 4PWUA 4P2MA 2C2RA 4W98A 5HP1A 2FVSA 1OOCA 1Y9OA 4CLSA 3AH6A 1VJQA 3KUEA 2HFNA 1KBRA 3GFZA 2R2SA 1VR6A 2Y9HA 1F9EB 4DCJB 1DARA 1SL2A 2VBYA 1KCDA 1H7XA 1FRJA 3L9ZA 5I3QA 3H2VE 1N33J 2U1AA 3B4NA 2MLZA 4U95A 1X4FA 4ED8A 1UJ4A 1JB0C 1TFYA 2CPEA 3EM1A 2Z30B 1GMWD 1FJCA 5AT1B 1RWVB 1OGMX 4F4KA 1UJ6A 5B0EA 2B3TB 1Y3KA 3BH6B 1Q16B 3ILIA 3BQ1A 3MUMP 1T0TV 2B0RA 4WK1A 1HWIA 5D0HA 3QPIA 2CJAA 4UOFA 1RTDB 1WXRA 1HI1A 1YZ6A 2YTCA 2ZNZA 3RTVA 1FVQA 1TK8A 3AHPA 4I6AA 1VRQC 3QGPA 4PG5A 2KL8A 5IV3A 4F0MA 3FEXB 3T1HJ 1VQSA 3FZ2A 4HTIA 5I3PA 1YDLA 2LYVA 1KQFB 2QX3A 3DRXA 1RWXB 2EC2A 1X4DA 1WKJA 3H4BA 4DFKA 3FY3A 1R43A 1XNQJ 1DY3A 1TZ0A 2X85A 3J7AN 3KLVA 3TUJC 4PPDA 3KG1A 3QAUA 2QRRA 2NCKL 2FJWA 3AD9C 4WYLA 4GKKF 1TL3A 3HFVA 2KJVA 2GIFA 2OI2A 1TU0B 2D3ZA 2IYIA 5ETRA 2J0SD 1S1TA 2BKNA 2MKHA 4X62J 4CH0S 2KFYA 2EI5A 2YNHA 1HQEA 4KRWA 3NBPA 3DI6B 3CDBA 3M6XA 2V8DA 3KJFB 2EG1A 3FVYA 2YNIA 4C11A 4ZCIA 4NK8A 2UVWA 2QA2A 3I9ZA 5CA5A 5KG7A 2OPPA 4LVNP 5ADZA 4HWVA 1VRUA 3TARA 1VHFA 4WFZA 3RZAA 1HHQA 2YKPA 1R27B 2GZOA 2RB7A 3LYCA 1N5VA 2M3DA 3MAAB 4LFCF 4ZVRB 3KLFA 1CS4B 2ZHOA 4GRSA 2DNHA 1REVA 2B4OA 2CWKA 3W64A 1SKRA 2LXIA 3MM6B 5IV4A 1OMSA 3DHXA 4JI6F 3UNGC 1FJGJ 3MF5A 3FCWA 2OKQA 5E41A 2VFOA 1Y3JA 2HEKA 4QYZK 1W2IA 3DYAB 1UPMB 4JI1F 4B9UA 4LRCA 5IXUA 3D28A 1O8LA 1TKXA 2AHOB 3LW5C 4JI5J 4ELVA 3D5MA 3I0RB 5D77A 3CMAS 3W63A 4OYMA 5CXTA 4AL6A 4DR1J 2I9SA 3G6VA 1JQGA 4CTAB 2I0XA 4F3OA 2MKYA 2HURA 3LPYA 3CVKA 2VA2A 1C0UB 4IR1A 1HBMA 4KQZA 2HHTA 4RZRA 2K2PA 2DVIA 2NXJA 5B08A 3M8RA 4DN0A 1F2HA 1CJTA 3HFKA 2CQ3A 5A8RB 2C42A 2JL9A 4J9PA 4Z7YA 1O8MA 1PE9A 1X4AA 2XQCA 2XBPA 3DDIA 2AJ4A 2OP5A 3UVJB 3T9GA 4EZ9A 4MKBA 2CNNB 4O3QA 1GQ8A 2YWGA 1TP7A 3DGPA 3CJRA 2NT9A 3DRPA 2PECA 5IWAF 3PV8A 4XDDA 3OXFA 3RRKA 2XO6A 4USVA 4QWEA 2N3LA 3IWLA 4KTQA 1WI8A 4DFPA 5HO4A 3C16A 1B3TA 4HH1A 1QUVA 3BGFA 5KFHA 4TY8A 2OPRA 1DQAA 3N0VA 4DPTA 1TUVA 1TL5A 4CNZA 3JYTB 1F5BA 3H5SA 1IB4A 4JP8A 3JURA 3MM5A 1EZZB 1XWLA 4IDKA 4O3PA 3EGNA 2BANA 1S9EB 3D6MB 1FTRA 3F41A 1MMDA 1U48A 4IFYA 3J80Y 4F3MA 2EVZA 2C3YA 3IG1B 2VBXA 2O66A 2W9AA 2Q79A 1JIHA 1FDBA 1MG7A 4LR7A 3N5FA 2X6WA 2F8HA 3R8YA 5IC6B 1I94F 5K20B 2J6UA 3FZBA 1H73A 1P27B 4DR2F 3KLHB 1A6LA 3IMQJ 4YZ0A 3B4DA 1SJ1A 3PNIA 1Y7PA 2GV1A 2E1AA 5F8LA 2JC0A 4BWMA 2CQPA 3NAHA 4OYWA 2IYGA 2F63A 3X1LB 1S77D 2CAJA 5K8NA 3SZEA 4ETXA 4F67A 5KFAA 3IR6B 5A8WA 4LF8J 4J9SA 2B9WA 1TVRB 3ILJA 3T1YF 2OMOA 3TEHB 2XSJA 2W7ZA 4N7TA 4BS2A 4R8UA 3C3LA 3A1YG 5D3GB 1MSWD 1S1VB 4E2FB 3TAMA 4USKA 2KM8B 3TUPA 2AEJA 1M1KT 4UY85 5D4OA 3AXKA 1WJ9A 2JHEA 1B0PA 2O5DA 2C28A 1E6VB 1B0TA 1U8WA 3NS6A 4A4JA 1S5ZA 4ZJOA 2YX1A 2DR7A 1CC7A 4UUXA 1RE1B 4DR5F 3C14A 3POTB 1KQGB 3QQCD 1OYEA 1X5SA 3PETA 3HDSA 3QWPA 3DU5A 2B43A 2R2UA 3ZPPA 2FLNA 2VFMA 4TLRA 2W2MP 4ENOA 1DQ9A 2A6MA 1TKDA 1U2FA 1RTIA 5D4LA 1ZYQA 4PG7A 2H4YB 4AFFA 2OEMA 4K8RA 1C1CA 2GHWA 3PDNA 3BKFA 1RGVA 2HGNA 3H59A 2X3GA 2VIHA 3WBZA 1C0TA 3DLGA 4B9VA 3NOCA 5GVQA 4NYZA 2ZEJA 2V8PA 2D3O1 2AJ2A 4DQIA 5HVFA 2WSFC 4KAIA 1TYXA 4B3SF 2QV6A 1KNZA 2FD2A 1BN8A 4NE9C 2V2ZA 3BKTA 4M5LA 3TEGA 2QO3A 4KO0B 3VGTA 1OQ6A 2FJBB 2OTLS 3QZ8A 4LT6A 3KLEB 3J7A1 1TKTB 4DL7A 3GR1A 3M30A 1EP4B 4L73A 1RU4A 5MAOA 3BQ0A 1SKUB 1H6KX 4J9NA 1HBOB 3NGDA 3QAEA 3LWLA 2ZHBA 3N79A 2XTXA 1KQSR 4DUZF 1VBYA 2GGPA 1RHQB 2DITA 2CQGA 2KI2A 3GWCA 2ZM6J 1CULB 2E1RA 2FLOA 2YKNA 2Y8WA 4NI2B 5KFYA 5HLFA 3I55S 5MLCV 3FRYA 3VQSA 2MHEA 4JB8B 1RKIA 4J9QA 4Y2CA 3NKYA 3E3XA 3GSIA 4HEA9 2I38A 4G6VB 2FGCA 1HYSB 4ID5B 2YX7A 1JNZB 3AJ2A 1U6FA 1HLWA 3HD1A 3IM8A 3FUYA 2VJIA 3KDOA 4M5DA 3B8HA 3LP0A 4LQ3A 4JI2J 1FF2A 1SV5A 1U09A 5ETQA 1IA5A 3D1QA 1N5TA 4O3OA 2CRLA 1XNRJ 2HWTA 4N8NA 4F04B 3P8BB 1X4HA 3PEJA 1TSPA 4KJIA 5E5NA 2YWFA 2HIYA 3H25A 1IQZA 1FWKA 1WC3A 3Q22A 3JQMA 2XLJA 5KG0A 1S49A 3MZIA 4OHZA 3MTKA 3W60A 3MFHA 4QW9A 2PI5A 1YX2A 2XHWA 1VOMA 3MMJA 4PEOA 3I87A 1MMNA 2HGLA 4EZ6A 1VBZA 3IBWA 3M8QA 3AB2B 9RUBA 2LVWA 4XLAA 1BQNB 4C2LA 3ELHA 5GADI 2D9OA 4DR4J 4EMDA 2DGXA 2ZH9A 1RT1A 3C8YA 1CJVA 4B9LA 2YKMA 1B70B 1AFJA 2FHKA 1RA7A 1TK5A 1L3VA 4Y6IA 2M7SA 3C6TA 1R0AB 4DV4J 1N33F 3AFGA 1T8EA 2E1MC 4Z37A 5F8IA 2W01A 4A47A 2DNQA 4YFUA 2VJUA 1BWEA 2GVZA 3PSZA 1RTDA 3ITHB 3BEGB 2PFFB 4OHYA 4I84A 3G8TA 4ECZA 1KLNA 2NTQA 4OI1A 1XMQJ 5J2PA 2B56A 4IH7A 1TV6B 4P71A 1NUEA 1S6OA 4O3RA 1KVKA 1G3OA 3CGIA 2W8KA 5L9XA 5KFQA 1WC4A 2R8GA 4X2BA 3ZZRA 2GAGC 4F2RA 3QIPA 3UDVA 2KT2A 2EFVA 2ASLA 2N4CA 2CPZA 1CBKA 4RBVA 5D8HB 3W2VA 4HDGA 4MT1A 1FI4A 3D7SB 1FRIA 5DLGA 4O0NA 4ZDNA 5KFOA 1F1BB 1S9GB 4TYBA 5HK4A 2QSFA 2VDIA 1ZM2A 4CM2A 4CM0A 1EKRA 3CD0A 1ITPA 1R31A 2CWXA 3THVA 1SH3A 4F4ZA 1RWKB 4C97A 1S79A 3GZ7A 4ZPBA 3Q8PB 1XQIA 3DI6A 1KHVA 1EQMA 3T6JA 1PAEX 4QZVB 2ZH6A 4OZ3A 4OM9A 1P6TA 1K0TA 5LJ3Y 3OVSA 2VASA 3SXLA 2RRBA 1WEZA 2DK2A 5HQ8A 1Q8KA 3CMQA 2DNGA 3HMJG 2VG6B 2MQQA 4U7UK 2YNFB 1IBLF 4ECUA 1BY9A 2PO4A 4URRA 5JUMA 1X4GA 4I2PA 2RHQB 3MAAA 1JLQB 4RUHA 2LQBA 2LCWA 1CS4A 5A76A 1P1TA 2V4JB 1LFPA 1NDLA 4C9DA 3IXQA 1TL7B 4OI3A 3MM6A 4MKYA 3BGUA 5F8GA 4MIAA 1D8YA 3T41A 1FD8A 3NOGA 2WK4A 3J7YU 4G3IA 2AT1B 3VGSA 4YR2A 2B8QA 1TL1B 1HBNA 1BWVA 3GCXP 5JMNA 2R8HA 3VVUA 1Y5LB 3C15B 1ZTTA 2XY5A 1N36J 2UXCF 5A2QY 3DYAA 1V5IB 4ED0A 3FSYA 4RPFA 5ETMA 4ANDA 1NB2A 5HI7A 3L3CA 4CO1A 1FJGF 5A6PA 4DX8H 2DNYA 3PYFA 3T6BA 3CIZA 1HNWF 3HJVA 5KFDA 3I0RA 4O4GB 2QYCA 3I0SA 4DV7J 3GIIA 4G1PA 2CVEA 1HNXJ 4UZCA 2L48A 4CO0A 2ZVSA 1UTAA 3RB4A 1G1XA 3BBBA 2OSRA 4PAAA 3HSGA 3MMCB 1YJ7A 1C0UA 2XHCA 4JI5F 4ILRA 2QA4S 2G2ZA 2VFPA 1PIEA 1L3TA 3MPWA 2ASYA 2CPXA 1RA6A 4A8QA 2BOAA 3F56A 2KXHA 2OHDA 3UN5A 3ZZYA 2VQFJ 3TOQA 4ZP6A 1Q82T 3CNQP 4JI4J 4JV0A 3UVJA 3GYGA 1EB0A 1CJKB 1GX5A 2RJZA 3OL8A 3T5JA 2GS8A 4ZVOB 1T03B 1WC0A 3GLJA 3SCJE 4RUAA 4FS2A 1BMQB 2B7BB 5F3TA 2LMIA 1GT8A 3BKUA 4X4PA 1IKYA 2RQKA 1KTVA 2J5AA 4KR0B 5E3AA 2CQ1A 1MROB 1CC8A 4DSEA 5IT9Y 2RT3A 2YBVA 1NKBA 3IS9B 4GC7A 2BACA 5IT0A 5AXLA 3CB4A 3GJQB 2O0WA 5I42B 3JYTA 5CAAA 4ECTA 2NZMA 2BOPA 2XT4A 1AT1B 3MR2A 3NY0A 4FBUA 4L72B 4TXSA 1S9EA 4RW7B 2DGVA 1RB0A 2DNRA 4Q2MA 3PTWA 1U0SA 4NCAA 4B9NA 2BQUA 4ZCLA 4LF5F 4OPWA 2VC0A 3N6MA 4OYAA 1RYRA 1URRA 4DSJA 1OO0B 1KEKA 1GNKA 4KHPF 4UW2A 3EWGA 2MZJA 1Y10A 2BJEA 2E9TA 4YB6A 4XN0A 3M9MB 4EWTA 3K58A 2NSPA 1MU2B 2ADBA 5DG8A 1GAOA 1J5EF 3SCKE 4PUOB 2XNRA 3IAS9 4JV5F 3QYYA 1YSJA 1UVLA 2BSPA 2NXUA 2X7IA 1L3UA 2FHMA 2M5YA 2F8EX 2MZQA 1X0CA 1Y11A 3K17A 1VQ8S 2KH9A 1MWZA 5GAGI 2W2OP 4J9MA 2WBMA 3GYNA 3H5XA 2EWHA 2XYHB 3P5BP 1N5QA 2UUBJ 1TVRA 1QVFR 2G13A 4MYTA 1JLFB 4WIQA 2K06A 1H7WA 2WRMA 3WHIA 4DFMA 2LEAA 2X1BA 3UD5A 2GJ2A 2W2QP 1O8FA 3M8PB 2ZH3A 3H5UA 5D3GA 2RKIB 2XZTB 2Z4PA 3RAQA 1R7IA 4OJGA 3CCRS 1DRZA 3HZGA 4ZP8A 1DAXA 4ZVUB 4FKXA 2J8IA 2RRNA 1WSRA 1S10A 1U8SA 4UUWA 2BE2B 2P6SA 4B3MJ 2P9GA 3QRPA 3BQ2A 3T5LA 4DOZA 3PXGa 4NCBA 4YCQA 1RABB 1W26A 1YJUA 2UUTA 5F0UA 3HT0A 4ALZA 4JOUA 3POTA 4X4UA 1VQKS 2E44A 3HHEA 2G0CA 1S0OA 4RU2A 4HACB 3CCSS 1H80A 3CCLS 2HNZB 1GEHA 4HHJA 4DEZA 2KN4A 1QD1A 2MXYA 2AJFE 1O8KA 4DPYA 1RAEB 2VJVA 4ZPVR 1QAXA 2NXNA 3FC9A 5GAHI 2CUYA 2MDAA 2HBYB 4A48A 2F3JA 4I2QA 1QUPA 3G6XA 2X3DA 4KGXB 2GVDB 2KHCA 3ZTQA 3JXOA 2KG0A 1VIXA 2R42A 5K14B 2V4QA 3PO5A 5T7LA 3V4IA 2RDIA 3Q8QB 1C1BB 2W8LA 3R2DJ 4F4YA 3CDEA 1WHXA 3I5CA 3CD6S 3RW7A 4NLVA 2CQDA 4KIAA 4M5GA 1Q7LB 3FGVA 4XPEA 2EC0A 3VTIA 3DMJA 2M0GB 3TJ8A 2DD8S 4NLXA 2KU7A 4PWDA 3KLEA 5AMVA 1RU1A 5B0DA 2RNEA 1AZSB 4RUCA 1YGYA 4DR6F 2IAJB 1SBRA 4DN9A 1TR0A 3I5BA 4TQSA 3PM9A 3PX4A 4OQJA 4HHUA 3EYZA 2MTLA 2V5IA 1HARA 4ECQA 1G2EA 1Q4RA 1N5YB 2W7AA 3VR1A 2AGQA 1EETA 4KSEB 1T05A 2RDDA 4I64A 4KH3A 3BR9A 2DCUB 2F65A 3BGRA 2YPZA 3LP1B 4LQ9A 2AIRB 4HL9A 4NLPA 2OSQA 4A8KA 2QL5B 4AL5A 4OYIA 4FF4A 1TELA 1UA1A 3NGUA 3L7UA 4FBTA 1S12A 1O51A 2A18A 4F2SA 2ILZA 3RRHA 4LF1A 2DR5A 2OFGX 3W9JA 3BSNA 1U1LA 2DHHA 3N01A 3NP5A 3HJFA 3K5OA 1HWJA 3ETMA 2UZAA 4P2FA 1HYSA 3K89A 4R0JA 4JI7J 1EQ0A 4OI2A 5IC4B 5HMYA 4IQXA 1TUWA 2QC3A 1DLOA 4DMZA 3PJXA 5IOLA 4QWAA 3QT5A 1FNXH 2BM5A 4B3RF 1QAYA 3GR0A 2DY1A 2GIQA 1T02A 1MN7A 5H9EK 2AU0A 2X6YA 4DCPB 3MR3A 1T7PA 3CD5A 5IM0B 2HGMA 1ULRA 5DG9A 1RUSA 3HO1A 5DQHA 2W4PA 4ED2A 4JI2F 3ZZUA 1X60A 1FK9B 3OQ2A 1OYDA 1N52B 3MD3A 2LLZA 2EPIA 2HHHJ 3I9V9 1GTEA 1B64A 3TANA 2W4DA 2BJ8A 1RWPB 4URGA 1IBKJ 2AYBA 3KK2B 1PJ6A 1F2GA 1X4BA 2I1RA 2B9XA 2ZKTA 3HCXA 4V19X 1OY9A 1FVSA 4NA2A 3Q8RB 4KFBB 1YRXA 4OJOA 2ZC3A 2DEIA 3KUHA 3TYTA 3TAQA 2GC8A 5G0RA 3CJKB 1KQKA 1CPZA 2F9JA 5C42B 4ED1A 5JLVC 1PILA 3K8VA 3VQTA 3UD3P 4KV8B 2F5GA 1VQYA 4Y2AA 3PYGA 3CC2S 2NXCA 3K8WA 2NREA 3LAKA 3ENQA 2FY8A 1YJ9S 4DSKA 4CLLA 3TA0A 2Z2ZA 3SSQA 2CZVC 2HRTA 3UNYA 3R7BB 3PYDA 4LF7J 4DX5A 4ERDA 2ZH8A 3JTPA 5LOQA 2BRKA 3SDEB 2JFDA 3R1HA 2ATLA 4XLHA 2CJKA 1QM9A 4EBDA 1X7VA 5F0WA 4ELTA 5KT4A 2BXJA 4NLUA 3W65A 2EKNA 5ETNA 4OMFG 1RT3A 2HS0A 3DRRA 3S6EA 2OLWA 1IJEB 4C8YA 3SV4A 1PKUA 3LP2A 3RJMB 4KT0C 3DOMB 2MQOA 2P9EA 2YKAA 1N0UA 1NBEB 3SQVA 3D9BA 5KFUA 1JLGB 2KO1A 3ET6B 4O3SA 5HAOA 3TWZA 5HL7Q 2M70A 4K5RA 2A0FB 1X0PA 1R6YA 3M05A 3QJLA 4C8MA 4MYUA 1BE4A 2DJWA 3QO9B 2CZ4A 2Z0GA 1A0OB 2P8IA 2KB2A 5KFSA 1WD6A 3M6UA 3UQSA 3TRGA 3CDAA 5DRKA 4DX6A 4FP9A 3MMAA 4CT8A 2HZAA 1NJWA 4OL8A 3VWSA 3KOAA 4N41A 2EG2A 2C2KB 4L3KA 4OJHA 2BKOA 4J37A 1VS3A 4OX9J 3M2VA 3CSKA 2V69A 1S4FA 5DM7Q 2YNFA 4ZHRB 3MAHA 1FWPA 2KVIA 4NZ6A 1FNOA 4DL2A 1JLQA 4HYKA 5LSOA 1NPPA 1NSQA 1HIYA 5CYMB 2NSTA 2K3KA 4ECWA 5KFGA 2V50A 3RYLA 1TL7A 2WSCC 2XULA 2QA1A 2QLFB 4ZPWR 4IYQA 2XMVA 3KK1A 2O17A 3FMBA 4F0KA 4N77A 2JNJA 3OV7A 4YP3A 3C15A 1R89A 1B0VA 3QGGA 2IA0A 4PCQA 3A3PB 3RU0A 1XR5A 4X66F 3CCQS 4O0IA 3EXCX 4ZVSB 3GJSB 2HHQA 2DY9A 2BV3A 1NDCA 1TAUA 2PEHA 2RDJA 3OL6A 1IR0A 3O5TB 4O4GA 2H1YA 3UN2A 1R8AA 3PHEA 5KFCA 2J8SA 3EX7B 2ACMA 2NXEA 2XWYA 3GSDA 4J9RA 3MMCA 4FVMA 1NKCA 4P6QA 1WF2A 1T95A 3VF0B 4C3LA 2R7WA 3DGVA 1KRPA 2B8PA 4H4OB 1HNXF 1EHWA 4J9VA 4LFAJ 1RMGA 3NB2A 3GV5B 2O0VA 5J1EB 1FJEB 4LRAA 3MHYA 3Q23A 2EXUA 3PCOB 4DV1J 1L5UA 2GW8A 3ML3A 3QIDA 4JI8J 5IQQA 1MWYA 1RHMB 1EJ7L 2Z2LA 2G9OA 1S6QA 3A4TA 3V6HA 2KXNB 1AROP 2ACYA 2K7JA 4FYYB 3D6FB 1N6QB 3DXBA 4WFAQ 2ALZA 1IXKA 1Y00A 1VK8A 2OPQA 2QFIA 4IG0B 1NXIA 3VMWA 4KGVB 5J1NA 4NXMF 2V2KA 2FGOA 1JLAB 3MMBB 2L08A 2DGWA 2RH3A 2VG7B 2HHSA 3U1NA 3S1TA 1KVJA 5RUBA 3RB6A 5ETVA 3EDQB 5I42A 5LMNF 4DUYJ 4QR0A 1XJWB 3THTA 4DX7A 4ZLJA 1HMVB 4DV0J 1RLCL 2X6XA 2VONA 1RAIB 3OUYB 3MUVP 3NL0A 3V6DB 2DRBA 3RIQA 3SQOP 3VSTA 5KFNA 3T1AA 3KNAA 3R7SB 3BV8A 4N47A 1YIJS 2B4VA 5C1CA 3P4UB 2B4PA 4K50A 5KT6A 3KJQB 5LSRA 2FVRA 1RWWB 1R0BG 1O8BA 2CPHA 3K57A 2DNMA 1OFLA 2MQ8A 3OFHA 1QTNB 5ITHA 5K5MA 3D1OA 2QMUB 4NA3A 1KTWA 4PUOA 2R7SA 1Q95G 3PVXA 4ES2A 1KLMB 3CJ8A 2RVJA 1XC9A 1O8DA 1RT4A 2XMUA 3HX9A 4OYPA 5CCLA 4W8RA 3HZEA 1ZTWA 4JV1A 4YDXA 1U7LA 2CZ9A 1EIYB 1GXLA 2IVMA 2LU1A 4OZ1A 4P72A 2GO9A 2R8IA 1DHMA 1NH8A 1EAYC 2BYCA 2G1HA 4USTA 5KFXA 2F4VJ 2MLXA 3FFIB 1SUQB 3J7ZT 3JTNA 4K4YA 2WTFA 4PRFA 5B0GA 3TA2A 1ZZNA 1HI0P 2NTBA 1D0EA 1HR0F 4ZVGA 1MWQA 1IWAA 5L1IA 2V8VA 5HQLA 3RG6A 4U4BA 5KT5A 5C2GA 4NLRA 1VBKA 2D69A 1OFEA 4OHWA 3PRVA 3Q8UA 3Q24A 3G8SA 4PMHA 4F4AA 4HACA 4IG3B 1N34F 2HNZA 2UVEA 1K8AT 4O44A 4Z2XA 1Y5NB 2FLPA 2VFVA 2INVA 3LUYA 1UZHA 4IFVB 2EBGA 1U1MA 1U26A 2DRDA 1LWFB 1GFWB 1KWMA 2ZE2B 4LF4J 3B8YA 3NGTA 4CO3A 3CC7S 1NKEA 2AKWB 3NEKA 1HG8A 3U1LA 4DSFA 4K59A 4AE5A 2GVDA 1VDHA 2CPJA 5K14A 4G1QB 3OPKA 1Y0HA 1C1BA 1NK4A 4Y28C 1HW9A 4MK8A 2ROEA 2DCLA 5GMDA 2XWXA 2FQQB 1EZGA 1DBGA 2W7OA 2E5JA 3OD2A 1JX4A 2DIVA 3PACA 3RBEA 3OL9A 1HL6A 2Q6BA 3H20A 3IWNC 4FXVA 3C6UB 1SB6A 3H0PA 4XTTA 4OHXA 4KPCA 3BF4A 3RW6A 3M2RA 2YKQA 2PFDA 4K4UA 2V67A 3H5YA 5M2PA 2ZUAA 1LFWA 2PT0A 1HNVB 4AD6A 1SJQA 3TH0A 5J2QA 4C0HA 5I4MA 5LM7E 2CADA 1ZM3A 2LXFA 2PSZA 2DH7A 3O44A 4NA1A 1X9WA 4PQUA 3W9HA 4JI0F 1Q79A 2UUCF 2PDAA 4OI4A 1HNZJ 3DOLB 2F4FA 1K44A 4PPZA 5B0BA 2IRUA 4AQYJ 4ETZA 4IR9A 4PZVA 2O6WA 3KHLA 4TU9A 3G9CA 2DH9A 4MMOA 2DGSA 4JUZA 4LFBJ 1FKPB 3DOKB 1NU4A 2R7VA 1XK8A 1IKVB 1YJWS 3GCWP 2V9KA 2W9CB 3G6YA 1M1GA 2HLTA 2VFTA 3UDEA 2VG5B 2OEKA 3I6PA 1TL4A 2ZOGA 1U1RA 3EDRB 4JI7F 1S7HA 3RAXA 2RF2A 1IBMF 3T9NA 1PYOB 2OELA 2QEXS 2N7CA 5EWFA 2HNYB 1C4CA 1JLCB 3LQVA 4D3GA 1AUSL 2L41A 1FK9A 1E6YB 1HFEL 1O5JA 2HHPA 4W8QA 2HQGA 3C46A 3KJNB 1ACMB 1U1QA 1FWLA 4PXEA 5U47A 3UR0A 3OTCA 1FTCA 3KK2A 1RAAB 3PYEA 3TVZA 1Z1ZA 1CLFA 4IQMA 4NMXA 1SQEA 2BQ3A 1KFDA 4ILMA 4DR3J 5AE2A 4KFBA 4R0EA 1M5KC 1OGOX 3LA0A 5A8KB 4EBCA 3TVKA 1PLUA 2BMBA 2I5JB 2C2ZB 2E5LJ 2R2RA 1RISA 2Y1JA 3A3OB 2BM0A 4QR1A 5C42A 2UVVA 3MPYA 3IC1A 3JTOA 4WP3A 1U1OA 3VAHA 3NAWA 2DNLA 4B17A 2AJ0A 5HBMA 3A8IA 5KFPA 2XLIA 3QWUA 1SQGA 4ECSA 1LWEB 1RHKB 4OIXA 3IR7B 4HLBA 4DV6F 2K1RA 1S0MA 2KFZA 4KB7A 2IC3B 3SY2A 3LJYA 1B7FA 5AXMA 4FF2A 3BR8A 2XS2A 4QWBA 3CTRA 5CZXA 2ODLA 2GO8A 4PG6A 4J91A 2C3MA 4M5NA 3GQ9A 2AP6A 5KG5A 1SC4B 5EN1A 3LO3A 1SIZA 2FZKB 1X4CA 3DOMA 2DNZA 3HHLB 1L3SA 1CG2A 3ET6A 1SL1A 5LXRA 4DI6A 3NCPA 4P9SA 5L1LA 3Q8SB 2VFNA 2ROGA 1X9SA 4LF9J 1KN6A 1MN9A 1FFGB 5HN0A 2HW3A 2KG1A 1EKSA 4W4MA 1YVFA 2HS4A 2XYGB 3QO9A 3KLIA 4ZCKA 1V6HA 3Q83A 3HHLD 1T9XA 3P45B 2GHVC 3CULA 3V2UC 3VAJA 3CDWA 2ZBPA 1RBLA 2IM2A 2VKRA 2C1EB 2OH2A 4WFBQ 1RAFB 1QAJA 4CO4A 3G71S 2GQQA 5AJ3J 3W8GA 1ZM4A 4KGMA 3OLAA 2MGZB 4LRDA 3CCWA 5ETTA 2G0IA 1JKHA 2E1PA 3V6JA 4ZHRA 3FRZA 4W90B 4K2JA 3B78A 4USHA 1WUUA 4URQU 3LANA 1NRKA 1S76D 3W3SA 1PC4A 1QSSA 2QMWA 5LXYA 4OX9F 4U7UD 4C7QA 2M4MA 2DR9A 3R5GA 3FBEA 2IOUG 2LFVA 3PFOA 5HROA 1Q1KA 4CNYA 4USUA 4OZNA 1XMBA 4ZS6A 4JRAC 1KTQA 3CE8A 8ATCB 3BB5A 3IGVA 2MHNA 5CYQB 4CCHA 3GMGA 3OTOJ 4FPIA 3GQCA 3DKDA 1S9FA 4HR2A 3KDNA 2O1PA 5D0EA 4XL9A 2X1AA 3VVTA 1S1WB 1R8CA 4I4BA 1WEYA 2K3IA 3KJVB 2GA7A 4X4OA 4H4OA 2PMZD 4X65F 1AW0A 1NZAA 3S8SA 3OR1B 4MH8A 5EHHA 3CF5Q 4H4KC 2B6AA 4FNIA 3HK2A 1GXUA 3SFUA 1HD1A 2QLXA 4XKVA 1SIWB 2LDYA 3L7PA 4OX7A 3DM2B 4K4SA 5KG3A 2IM0A 1D09B 1SI9A 1N6QA 4U49A 3BSCA 3I96A 3LPEA 2UP1A 4YFOA 3JSRA 4JI8F 2YQ1A 2PD1A 4IG0A 2UXDJ 4ATNA 4DQPA 3MMBA 4NXNJ 5AXKA 2VG7A 4QPXA 3VAKA 2B5JB 3AY0A 4TNOA 1S1UB 2Q6CA 2XY6A 1WORA 5DQIA 5DS7A 4NOHA 4ZA1A 3CEDA 4HVZA 1HMVA 2JEGA 1UVNA 2IRXA 3V6DA 3EGWB 2D41A 1K4ZA 1LNQA 3K5LA 3ZZOA 4MXNA 4Y34A 5HMWA 4CLFA 2XS5A 1CZFA 3MM8A 1WC6A 2J6SA 3W5YA 4AVZA 3HXMA 2KDOA 4CYUA 4W92B 4RW4A 4YB1P 2AX1A 1FFWB 3A8KA 2X1FA 2EFQA 2NS1B 1SKSA 2DGOA 2QFJA 2H3EB 3US5A 1JLEB 4DDFA 2KKHA 4QCLA 3DRSA 2X1GA 1U1NA 4B3TJ 1UWAA 1M5PC 1VQ6S 4BCAA 1YITS 3K5MA 3CJTA 2N82B 3L95X 5J1PA 3AD8C 3CO0P 3M1VB 1KLMA 4Y3CA 2ZWOA 4M5IA 1MLAA 4YZAA 2VFRA 1I51B 3TR5A 5HSPA 4MTPA 1LXNA 2YVSA 1UWBB 2CG4A 2DNPA 2QY1A 1RAOA 5FJ4A 2CXEA 5H9FJ 4C8ZA 3EZ5A 2R3VA 1IUJA 3A13A 1QQ1A 1K5CA 2FZCB 1JJ4A 3B54A 1T3OA 2WZ1A 2B4UA 3JQKA 2PGCA 1HNIA 3Q0AA 5F8MA 4X4QA 1SUQA 1S0VA 4YS2A 2R2TA 4M5JA 4FZVA 2XTJP 1IM4A 1N48A 5D15A 2ZZMA 1BD6A 4X64F 5F8JA 5G4DA 1QCXA 2BR0A 3GILA 1HPZA 1PAUB 2VQEF 1M0SA 4GKJJ 1DQ8A 1OFDA 1DABA 3G82B 4XAKA 4OLPA 1UCNA 4QWDA 2VKZG 4Y2IA 3W2WB 2VHGA 1QJHA 4Y2MA 3R7NB 3LMWA 2ZH7A 1NHUA 5IQ6A 4AXIA 4IFVA 2IMOA 1TK0A 3W9IA 2C3UA 4Q0BB 2MZTA 4NASA 2ZE2A 5JMCB 2F7VA 3CJ0A 4ES1A 5FD1A 4ZPCA 1LEOA 2H5JB 2LQ9A 4WIIA 1J5OA 3AJDA 3ZSCA 1NSPA 4ED5A 3UE2A 1X31C 1HD0A 2M9KA 4LF4F 2F9DA 2RU9A 2FVQA 5HVHA 2UXBF 1FDAA 4LBPA 5HP1B 5J2MA 4BLGA 2A1BA 3C6UA 1NHKL 2HVHA 4JI3F 3M9OB 4XKWA 2Z58B 2HK3A 1OSCA 1FO1A 2Z8QA 2HAFA 3UW0A 2DNOA 4UTGA 3WQPA 2FUG9 4TY9A 4DR7J 4ZJLA 4OZ2A 2J7KA 2IJNA 2MKJA 3AT1B 3LF0A 2AGPA 3ZZZA 3D0GE 3CJ2A 3ZTPA 1H2VZ 4ELUA 2AW0A 3TZXA 1LKZA 4UOGA 3VALA 2CJQA 3PW0A 2KZMA 2VPXB 3MURP 2DR6A 3V5RA 3SMZA 4IOBA 3U1MA 2UV8G 3DOKA 4I6WA 3JSBA 1IKVA 4OYBA 4M95A 2QIFA 4QPTA 5KAKA 3OT9A 2W9CA 4IO1A 1JJCB 4ECYA 2OEJA 3ONQA 1XEZA 1FRXA 2XTYA 2F1FA 2YNGA 4P52A 2XI2A 1VBXA 7AT1B 2KZZA 1HWUA 3TUIC 4A46A 4GKKJ 3CCUS 1FKAF 2D7SA 3MEKA 4YQWA 2JLGA 1RTHB 1EA0A 2E5HA 5JJBA 2BJDA 3ENAA 3M8ZA 3T19A 5KOXA 3AQPA 2VPZB 3H90A 4Z7CA 4YDTA 2AMCB 4P2SA 4NWBA 3DHWC 4MKVA 3R5BA 1NB7A 2J9EA 1TL3B 4WE1B 1S1TB 3CCTA 3LAMA 3BS9A 1NK6A 4KKOA 1VRTB 2KYXA 3M4XA 4I0WA 3TZZA 5DNSA 3V81B 3MCOA 3OHAA 3WC2A 1LWXA 3NBPB 4H4KA 4RW8B 2QTWA 1JMTA 3PO4A 3MM7A 2QA4G 2V8GA 1TUGB 1FHTA 2IDEA 3QZ7A 2R7OA 3KLGA 2YNIB 1HQUB 1M5HA 1X5TA 4LFCJ 3DN9A 4G65A 2I5JA 4A8SA 2OPPB 3R3TA 2OFHX 2VICA 1CJUA 2JLFA 1ZM9A 3HKWA 3CUNA 1A9NB 1Z4UA 3R2CJ 3UDCA 2FJXA 2ZJRQ 4UY8T 4DR3F 2NQPA 1RTZA 4JI6J 2JEFA 1QE1B 2NPIA 3KLFB 2DH8A 1REGX 1LWEA 1REVB 3PIOQ 2E5LF 4WF9Q 1IKXA 1UFLA 4JI1J 1H2UX 2ZBIA 3IR5B 2CQ0A 1NSAA 1P1LA 1WG5A 3J7YI 4C0OC 3NXZA 2GQ2A 2KRBA 2CJXB 3DFEA 2NSBA 3CCES 2MZRA 2FPHX 4R25A 4N56A 3I31A 1VJWA 1WKKA 1RT5A 2EFGA 4DZDA 1YJRA 1TKXB 1YTYA 1Q5VA 1C2PA 1WSVA 3ILLA 3UDLA 2WOMA 5L38A 4WPAA 1Z2ZA 3H09A 4DU8A 1M5VC 3K59A 3MCNA 1VQNS 2GIRA 2UUAF 3NCRA 3CCMS 4ZVFA 4MR0A 3TJ9A 4UOCA 2J9CA 1ZPWX 3BGLA 2RMLA 1AXQA 2PIIA 4FN5A 3OBIA 2HHUA 2ZC4A 3EE3A 1IN0A 4DL5A 2HWIA 2NR0A 3JSMB 2VJJA 1M5SA 2IHR1 3DLKA 4LIRA 1ZH5A 3H2UB 4ZOSA 4XORA 1DBDA 2BJ3A 3PKMA 1WTBA 4NRUA 2R7RA 1GK8A 3GIJA 4Y0FA 4NCGB 4NLQA 1S59A 5GAEU 2MKCA 1IKWA 4KY3A 1YK9A 2MQPA 1WEXA 4P74A 1VQ5S 1U49A 2ZDOA 2ZITA 1R6VA 3DGPB 2J7UA 1SJRA 3VAFA 1ZPVA 3WZ0A 3DRPB 2XM3A 4OJ3A 3EVOA 4B3OA 2LEBA 2RUSA 4GVBA 5KFJA 5IZHA 5C2CA 4NRTA 1VC0A 5KFWA 1VQ7S 1VQ4S 3QRRA 3GB0A 3HULA 4TY8B 4RNNA 4YY3J 2UU9F 3QJJA 2GCFA 3HSZA 5B7WA 4K4TA 2IM3A 1FXDA 4C8OA 3GG1A 2GHPA 3MM5B 1B4SA 4RNMA 1UL3A 3PFEA 3UO0A 3TI0A 4IDKB 4UT4A 4HH0A 2BANB 2Z2YB 5A6WA 2DTJA 1AUDA 4IFYB 2CPFA 3E01B 4S0MA 4FYXB 5DM6Q 2FLLA 4DR2J 4NMLA 1U45A 2KHDA 1OSDA 3W7BA 5BR8F 3M32A 3BBCA 2KXFA 2DXFA 1RT2A 5BYSA 2K8GA 2R9LA 3OSNA 3PR5B 2MQNA 1KP6A 5EWGA 1S1XA 1KCCA 4XONA 4YN3B 2J76E 2R7UA 1L3KA 3EGVA 2XZDB 2DGUA 5CQGA 1JXEA 3JB9k 4Q7AA 1TYWA 3NMAA 1YRTA 3QMQA 2M52A 3ISND 4NL5A 3JAMU 2NZ4A 1DTQA 2AEMA 2AZ1A 1NAQA 1T11A 1OFMA 2EBEA 3QLHB 1J2VA 2YH0A 1Q78A 3T1YJ 3CMES 3JSYA 4K7QA 5A8WB 2W1BA 5A0YB 1WNEA 2CPYA 4JYAF 4OZ5A 3MCMA 4XM3A 4Q44A 1T9YA 2EFOA 2L9WA 3OR2A 3V6KA 3DM2A 1AA1B 1S6PA 4ZN1A 3D66A 1L1IA 5B0FA 1ROFA 4HHHA 3GQ8A 8RUCA 5FLXU 3DLHA 1RAJA 4R8UB 3T3FA 3QBCA 2GAHC 5I3UB 3FMWA 4DXLA 4J9OA 2QLBB 2VU5A 3MAQA 2M88A 2BEFA 2LA6A 2IVFB 4P75A 4YC5A 3ZC4A 4USIA 3LGMA 1N32F 1WI6A 4QIWD 2KYZA 1GMWA 5LT5A 4UQTA 1RP5A 3D6HB 1D9DA 1QA3A 1YQHA 5KFZA 2KM8C 1P9YA 1MW7A 1YZ7A 2XEXA 3G86A 1NSKL 2VBWA 3K0JA 1KHWA 2DNKA 1YJNS 2DPJA 4I56A 3MTJA 4WWSA 1FRLA 4RWXA 1RTIB 3DXSX 2XB2D 3KK3B 2PMHA 2ZZTA 1BC6A 4W8SA 1IBCB 2B9EA 1QTMA 1JLEA 1SC1B 4QOTA 4ITSA 2PE8A 3FBBA 1C0TB 3DLGB 4ED4A 2FHJD 4ZP9A 2W7PA 2ZNYA 4XR6A 4ZLNA 3FEYB 1FRHA 4KE5A 4HKQA 1WF1A 4O23A 2ZJQQ 3RB0A 2WBRA 4LMZA 3EZUA 1OY8A 3WX8A 1VLYA 3L09A 4ZJQA 1UETA 4M5HA 3MR5A 2H48B 3T1HF 4QIGA 4TVAB 3QSYB 5M2RA 1SPBP 4ZVEA 4IRDA 1RQ0A 1XNQF 2CA9A 1PBUA 2ABYA 3CJ4A 2J8KA 2KT3A 2ZFHA 1BUXA 1QRCA 2X51A 4B9MA 3TQEA 4RW9B 3ADAC 5C1EA 5KT3A 4KYZA 2XMMA 3GJRB 4RX6A 4CLPA 1TYVA 5DDPC 4USMA 3C2PA 2YXLA 4X62F 2GGPB 2XG8A 3B82A 1RADB 3O3LA 4EU0A 2BM6A 2CVIA 2QE5A 2YKNB 1URNA 2ZOFA 2FJAB 5DDRC 3LGHA 5JVHQ 2XMKA 3AOAA 5B0CA 4CLUA 4N8OA 5T41A 1UVIA 1K1QA 5HJXA 3NGKA 1N5SA 4I6YA 5CH7B 2L9DA 3CJSA 3PY8A 1U2CA 3W1YC 1T9UA 4L6V3 4FS1A 2V0NA 3D0IE 2JLEA 3WDOA 4DUTA 2GMLA 4ANCA 2RRAA 4M5DB 2IM1A 1ICEB 2EK1A 2Y3YA 1UEUA 5C5JA 1AIRA 1HF2A 2C22A 5E2QA 4NYPA 2LU2A 4NLYA 1O8JA 1LLZA 4WK3A 1B7YB 1U1PA 4U67Q 4ANEA 2WHOA 3N28A 2RS8A 1SJFA 1HHTP 1YKWA 3SBMA 4FXDA 3HHNB 3ZXWA 2VC1A 2QSWA 4CTAA 1Q53A 2XMWA 3HFZB 2IRYA 3ZNUA 1K9MT 4HI1A 4IUFA 3PW7A 5KTQA 2E7VA 4L75A 1OPZA 2OGUA 3SCLE 2WW8A 3RR8A 1YLXA 3M8QB 5C24B 3PW2A 4DR1F 1MNEA 3F0NA 4X4SA 2V8HA 4ZIVA
chains in the Genus database with same CATH topology
3SZEA 3FC9A 4EK2A 1NSQA 1HIYA 1NLKL 3SYJA 1NHKL 3ZTSA 4F36A 3BBCA 1QA2A 2DXFA 3ML3A 4V02C 3FCVA 3BH6B 3EVWA 3WX8A 3NGUA 3L7UA 4DUTA 1NUEA 3BBFA 3ENAA 3Q8VA 1S59A 4OJOA 2VFPA 4JRAC 2B0RA 3ZTQA 4ANCA 4OJPA 3EMTA 3Q83A 1S57A 4OPWA 1DABA 1JXVA 1TYUA 1WKLA 1QA3A 4UOFA 3MPDA 1UCNA 4FKXA 2HURA 5CABA 2J8IA 2HVEA 1BHNA 3P4GA 3ETMA 1TYWA 1WXRA 1NDKA 2AZ3A 1NCLA 2DXEA 3FKBA 1W7WA 1F6TA 2W7ZA 1HF2A 1NDLA 4KPCA 2VFQA 3DKDA 5JLVC 4HR2A 1BE4A 1NSKL 5C7PA 3EVOA 3PRVA 1HHQA 3FBCA 2BM7A 2G0YA 5IOLA 3LYCA 3ZTPA 1KDNA 3Q8UA 2BM5A 1WKKA 2AZ1A 2YUHA 1NDPA 2DXDA 3VGSA 2B8QA 1XIQA 4O0NA 3LJYA 2ZUAA 3EICA 3VVTA 1BUXA 5BXIA 1QRCA 1TYXA 1MN7A 3ELHA 4W98A 3VGUA 4F4AA 4OJ6A 1B99A 1LWXA 2DY9A 3TH0A 1NDCA 4ANEA 3VVUA 3VGVA 4OJLA 2CWKA 1QQ1A 1K4ZA 4UOGA 2XC1A 1WKJA 5JMCB 3AK5A 3ZTRA 4CP5A 1TYVA 3B54A 1QRBA 3H09A 1U8WA 1HLWA 1S5ZA 1LEOA 4FKYA 4ANDA 2DYAA 4WBFA 1VYAA 3EVMA 3Q8YA 1NB2A 3DDIA 3JX8A 3Q89A 2V5IA 1NSPA 3FCWA 4DZ6A 2BX6A 3N6ZA 4UOHA 2BM6A 3PJ9A 3Q86A 3VGTA 2NCKL 4OJ5A 3B6BA 3NGSA 4C6AA 1B4SA 2VFOA 1K8FA 3GP9A 1F3FA 3NGRA 3NGTA 1XQIA 3FBBA 3RIQA 1K44A 2B8PA 1CLWA 1KQ5A 3BH7B 3PETA 3JS9A 1EHWA 1PAEX 3GPAA 2F3LA 1ZS6A 3N90A 2VU5A 3BBBA 2HVDA 3EE3A 3EJMA 4DI6A 3FBEA 2BEFA 3R9LA 2IOUG 2BM4A 5CAAA 4KH3A 4OM9A 3G2XA 4S0MA 1TSPA 2VFNA 3FBFA 1PKUA 2VFMA 4ENOA 1NPKA 3EM1A 1MN9A 3ZTOA 1QA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FC9 A;  4EK2 A;  1NSQ A;  1HIY A;  1NLK L;  1NHK L;  3ZTS A;  4F36 A;  3BBC A;  2DXF A;  4V02 C;  3FCV A;  3BH6 B;  3EVW A;  3WX8 A;  3NGU A;  3L7U A;  4DUT A;  1NUE A;  3BBF A;  3ENA A;  3Q8V A;  1S59 A;  2B0R A;  3ZTQ A;  4ANC A;  3EMT A;  3Q83 A;  1S57 A;  1WKL A;  1JXV A;  4UOF A;  3MPD A;  1UCN A;  4FKX A;  2HUR A;  5CAB A;  2HVE A;  1BHN A;  3ETM A;  2AZ3 A;  1NDK A;  3FKB A;  1NCL A;  2DXE A;  1W7W A;  1F6T A;  1HF2 A;  1NDL A;  4KPC A;  3DKD A;  4HR2 A;  1BE4 A;  1NSK L;  5C7P A;  3EVO A;  3PRV A;  1HHQ A;  3FBC A;  5IOL A;  3ZTP A;  1KDN A;  3Q8U A;  1WKK A;  2AZ1 A;  2YUH A;  1NDP A;  2DXD A;  3VGS A;  2B8Q A;  1XIQ A;  4O0N A;  2ZUA A;  3EIC A;  3VVT A;  1BUX A;  5BXI A;  1MN7 A;  3ELH A;  3VGU A;  4W98 A;  4F4A A;  1B99 A;  1LWX A;  2DY9 A;  1NDC A;  4ANE A;  3VVU A;  3VGV A;  2CWK A;  1K4Z A;  4UOG A;  1WKJ A;  3ZTR A;  4CP5 A;  3B54 A;  1U8W A;  1HLW A;  1S5Z A;  1LEO A;  4FKY A;  4AND A;  2DYA A;  4WBF A;  1VYA A;  3EVM A;  3Q8Y A;  1NB2 A;  3DDI A;  3Q89 A;  1NSP A;  3FCW A;  4DZ6 A;  2BX6 A;  4UOH A;  3Q86 A;  3PJ9 A;  3VGT A;  2NCK L;  3B6B A;  3NGS A;  4C6A A;  1B4S A;  1K8F A;  3GP9 A;  1F3F A;  3NGR A;  3NGT A;  1XQI A;  3FBB A;  1K44 A;  2B8P A;  1KQ5 A;  3BH7 B;  3JS9 A;  1EHW A;  1PAE X;  3GPA A;  1ZS6 A;  3EJM A;  2VU5 A;  3BBB A;  2HVD A;  3EE3 A;  4DI6 A;  3FBE A;  2BEF A;  3R9L A;  5CAA A;  3G2X A;  4S0M A;  3FBF A;  1PKU A;  4ENO A;  1NPK A;  3EM1 A;  1MN9 A;  3ZTO A; 
#chains in the Genus database with same CATH topology
 3M6W A;  5EGY A;  5A8R A;  1DBO A;  1RT1 B;  3MDF A;  4DFJ A;  1ZAW A;  3M9N B;  1CJV B;  5E33 A;  2YKM B;  3H8Y A;  2QZA A;  5ETL A;  2J9D A;  3O8W A;  1BHN A;  2BRL A;  5CYJ A;  4DR7 F;  3C6T B;  4DPO A;  3BN7 A;  5DDO C;  3OLB A;  4OZY A;  5EX0 A;  1Q7Y T;  1H98 A;  1HQ2 A;  4DF4 A;  2A2D A;  3I5A A;  2GVZ B;  4AT1 B;  3HHK A;  2ZBQ A;  2BKP A;  4A8F A;  4PG4 A;  5J2P B;  2Z56 B;  2R7T A;  4RWW A;  1RT7 B;  3LGN A;  3TJA A;  1IM6 A;  3MEC B;  5JXS A;  4LSN B;  3QIP B;  2WON B;  1PBA A;  4DQQ A;  4OV1 A;  4J7C A;  3NGR A;  2XLK A;  1RTH A;  5BYR A;  2Q3P A;  4ZPA A;  3N90 A;  4M5K A;  3W2V B;  4EFA C;  3I56 S;  4CQ1 A;  1PG5 B;  3IG1 A;  4QBU A;  5J2N B;  4DJB A;  1ZZF A;  1GXT A;  1G7C B;  4WE1 A;  3LTO A;  3BBF A;  3RUB L;  7FDR A;  5F8H A;  1IR2 A;  5D6G A;  1UFK A;  1VRT A;  4M5M A;  3V81 A;  3KLH A;  4N5S A;  2AZ3 A;  4RW8 A;  2Y1R I;  3HVT B;  1WDD A;  3X3U A;  3BPD A;  1RK8 A;  1IBL J;  1VCT A;  1DFD A;  4BBY A;  2JRS A;  4WU2 A;  1HQU A;  1R3N A;  1NHC A;  3BO4 A;  3VSV A;  3IWX A;  1R8B A;  5DZ7 A;  4CWB A;  4F4X A;  4FF3 A;  2E66 A;  4DHV A;  3KFW X;  2A3J A;  5E0O A;  3TW0 A;  2DGQ A;  2O1D A;  3ETO A;  4I2P B;  1QE1 A;  4WP8 A;  1RU2 A;  1I3O B;  2BX6 A;  3ENW A;  2U2F A;  4PR6 A;  3RB3 A;  2UXC J;  4LF8 F;  1GQE A;  2NUU G;  2BM4 A;  2MQL A;  1S1V A;  2MQM A;  1HBN B;  7FD1 A;  4OZ0 A;  4L76 A;  3N4W A;  5KT2 A;  1HNW J;  3MEG B;  6FD1 A;  1U1K A;  1E6V A;  1NPR A;  4NX9 A;  4LF2 A;  1V3S A;  1ZAX A;  2H9Z A;  2KVQ E;  1GH8 A;  1BGX T;  2AJQ A;  3QJP A;  4F3Q A;  2E9R X;  1UEV A;  4NLG A;  4PWW A;  4FNH A;  2IA6 A;  4MK9 A;  3HI9 A;  3I0S B;  2I8E A;  1HHS A;  4XNF A;  1FDN A;  1M5O C;  2YUH A;  5M2U A;  1FEE A;  6AT1 B;  5F9L A;  2NTP A;  1TMJ A;  3ZTR A;  3WWG A;  2AV5 A;  2EWE A;  4X84 A;  3J80 U;  3OTD A;  4Q8E A;  2CQI A;  2LQ5 A;  1S0N A;  4FDF A;  3JSM A;  3N6Z A;  1TKZ B;  3W62 A;  3DC2 A;  3L7O A;  5HAT A;  2NPF A;  5ETS A;  1ZOT A;  1M1H A;  2I2Y A;  5KFI A;  4NCG A;  2XS7 A;  4URS A;  2C2D A;  1S48 A;  1VQL S;  2RS2 A;  1U25 A;  2JOQ A;  2QYU A;  1RHU B;  1NND A;  2FJD B;  3HSJ A;  2VV5 A;  2IQ7 A;  3TP2 A;  3MR7 A;  1IKY B;  4KO0 A;  4ZK7 M;  1TTH B;  2HVE A;  2YWH A;  4MFB B;  4PYA A;  5AXN A;  1TKT A;  3NMR A;  3I4H X;  2ZH5 A;  3MM9 B;  1EP4 A;  5E3C A;  3PEH A;  4LF5 J;  1CSJ A;  3C19 A;  4OHV A;  3CDU A;  1U2R A;  1HBO A;  4ZCM A;  1YWX A;  3AB4 B;  4F26 A;  3G4S S;  2Q66 A;  4KHP J;  3THP A;  2AWZ A;  5CCM A;  4YY3 F;  4YOE A;  3IBF B;  2XTW A;  3M8W A;  3E01 A;  1CUL A;  3K5P A;  3W5Z A;  4NI2 A;  2RIL A;  5K8M A;  1J5E J;  1RAG B;  4JV5 J;  5KG2 A;  1OPI A;  1N88 A;  1IDK A;  1NJY A;  3Q2T C;  2ZM6 F;  3SQG B;  3RBZ A;  1QA1 A;  4ID5 A;  1TFW A;  3H42 A;  5KOW A;  1F5A A;  4DPU A;  3P6Y C;  4WYW A;  2NYH A;  3QLH A;  5CAB A;  4I7F B;  1KFS A;  1SKW A;  1GX6 A;  1W7W A;  2D3U A;  2C3P A;  1O6X A;  5A0Y A;  4KBI A;  2G0J A;  4NEY A;  3SSR A;  2YWW A;  2G0Y A;  2B7C B;  4U6P A;  4RNO A;  2IBO A;  3KMS A;  4J9U E;  3VGV A;  2KRR A;  1VBL A;  2RAQ A;  3MPU B;  1PXZ A;  3MGJ A;  4IOA Q;  1NME B;  5I3U A;  4CDI A;  1XNR F;  1F9H A;  3R5A A;  5LMU J;  4ED7 A;  3TNV A;  2BAB A;  2DEJ A;  5D4N A;  3R5D A;  4NZ7 A;  3KTQ A;  3MEE B;  3KHH A;  5K8P A;  3KXD A;  1FXL A;  3CT9 A;  1QSY A;  1CLW A;  1ZA1 B;  3ZNJ 1;  2OO4 A;  1QSL A;  2XCP A;  4NLD A;  1BQN A;  1FER A;  4X4R A;  1RTJ B;  3R27 A;  1KVI A;  4QU6 A;  2EFN A;  4OX6 A;  4HI2 A;  2OAU A;  3GON A;  1UW9 A;  1QA2 A;  3IRW P;  3CCZ A;  1O8G A;  3VAG A;  3MFI A;  4Z03 A;  3VHQ A;  2QZ8 A;  2FHJ A;  3BDE A;  4B02 A;  5DJB A;  1R0A A;  4DR4 F;  2GNK A;  4FPR A;  4WTY A;  5HMZ A;  4ECV A;  1H38 A;  3MED B;  1NEE A;  4EO8 A;  3HKZ D;  1DTT B;  2FY1 A;  1VQP S;  4HTJ A;  3KK3 A;  2BM7 A;  1U0H B;  3EIC A;  1JNR B;  3PIP Q;  3ITH A;  3TX8 A;  4DV4 F;  4ILL A;  4DV2 J;  2UVR A;  3G8Q A;  2Q1L A;  4I2Q B;  1Y4Z B;  1TV6 A;  3BYR A;  2SXL A;  1DZ5 A;  4TN2 A;  3AAW B;  3M6V A;  1RCO B;  4WZQ A;  4XQF A;  1H2T Z;  2WVC A;  5T7L B;  3V4I B;  1D9F A;  1Q86 T;  1XMQ F;  2DHA A;  3QAT A;  2GMH A;  2Z2M A;  4DR6 J;  3BH7 B;  4KPY A;  2DB1 A;  2XI3 A;  3KNG A;  1UP1 A;  2C2M B;  3DMJ B;  4YZX A;  4DG1 B;  2VOO A;  3WX4 A;  1S9G A;  5DGB A;  4PWD B;  3RBX A;  2EKY A;  4CT9 A;  4RJV A;  3VAI A;  5KFR A;  5IT4 A;  4A8W A;  2CJB A;  3SEO A;  2YKO A;  3A3N B;  2C2O B;  2WVD A;  1WC1 A;  1TYU A;  2O3D A;  4V1A k;  2CG8 A;  1RWN B;  4C3K A;  2UVF A;  4RW9 A;  2HFV A;  1QJV A;  2ZH4 A;  2MJN A;  3GRH A;  1Y5I B;  3BPS P;  2X3H A;  3D54 A;  2HQI A;  1EET B;  1UJ5 A;  1T05 B;  2A6O A;  4UF4 A;  4C8K A;  2NYI A;  4OZL A;  2DHS A;  2DXD A;  2E7X A;  2ZVI A;  1VMB A;  3BGR B;  5L46 A;  3HP6 A;  4RL1 A;  4WKR A;  4Q43 A;  2VG6 A;  1VGY A;  4OZZ A;  4CI0 B;  4CP5 A;  4F02 A;  4FYV B;  3SIP B;  1NK8 A;  3P96 A;  4B3R J;  2LQ8 A;  3PX6 A;  2WCX A;  3IFE A;  1WHV A;  3BZQ A;  2V4J A;  4M1K A;  3GTY X;  3PKY A;  3I32 A;  3K2Y A;  1IWG A;  2ATC B;  3NRB A;  5SZT A;  1DLO B;  1WTF A;  4BDP A;  1RBA A;  2PC6 A;  2DNN A;  1TL1 A;  3NAI A;  2BQR A;  3P5T L;  4EYI B;  1SCJ B;  1YBU A;  2GFF A;  4FF1 A;  2PYH A;  2JSX A;  2FYX A;  4MIW A;  2FHO B;  1FT8 A;  1U02 A;  3GIK A;  2W9B B;  4ZVQ B;  6FDR A;  1G4C A;  1RXO B;  1NCL A;  4O3N A;  2YPY A;  1VC6 A;  2JEI A;  2WB1 D;  1G6B A;  3AA9 A;  1N36 F;  4WP9 A;  2ZBR A;  3FSI A;  2YX4 A;  4Y2K A;  4B08 A;  3U02 A;  3NG8 A;  3ZFV A;  3IBC B;  3M2U B;  3MWB A;  3D6T B;  4K2X A;  2XC1 A;  4DV7 F;  2XT2 A;  1OY6 A;  2QXZ A;  3EUN A;  5C24 A;  4KH0 B;  1KS2 A;  2RUG A;  2ZZN A;  2KT5 A;  4Y00 A;  5EUH A;  2P9C A;  2NUH A;  4J90 A;  4E98 A;  5G0R B;  3G87 A;  3BO3 A;  4YME A;  2E29 A;  1YBA A;  1FES A;  3KRG A;  1HA1 A;  2VBZ A;  1GMU A;  2OUG A;  2PN6 A;  1YG0 A;  1RLD A;  1CJK A;  1R8P A;  4DS5 A;  2GJF A;  4QYZ J;  1KSP A;  4F36 A;  1T03 A;  3GIM A;  1XTZ A;  3GYX B;  2NT6 A;  4K4W A;  1F5C A;  5IS2 A;  2VQF F;  2AGO A;  2FJV A;  2QN6 B;  4AL7 A;  5LJ5 Y;  4P2X A;  4JI4 F;  1N0V C;  3UD4 P;  4YB7 A;  2INU A;  1KR4 A;  3S01 A;  2VD3 A;  1MRO A;  4GMK A;  1RZM A;  1CEZ A;  3IS9 A;  1SVD A;  3QT8 A;  1RT3 B;  2RQ4 A;  4GVL A;  3UCZ P;  3DRR B;  1RT7 A;  4GO7 X;  1T9V A;  1YHQ S;  4OI0 A;  1WG4 A;  3MEC A;  4C98 A;  3LP2 B;  4LSN A;  3LAL A;  2WON A;  1YJT A;  4OJL A;  3AQO A;  4RW7 A;  4LJM A;  2HZC A;  2RSQ A;  2HFS A;  1FXR A;  2MLY A;  2UVU A;  2OJ3 A;  2MYF A;  1S6U A;  3P49 B;  3CO9 A;  3UW1 A;  2VPW B;  1KOO A;  4K0K J;  5J2N A;  4OJ5 A;  3GV8 B;  2HQ3 A;  1K0V A;  5A2Q U;  2M2B A;  4I67 A;  2VUG A;  3TUZ C;  4KH1 B;  1U24 A;  3VMV A;  3OFE A;  2PA3 A;  5DLF A;  3T9Z A;  5L1J A;  3G2X A;  2GQC A;  4X4V A;  4WFN Q;  4W8T A;  1MU2 A;  1VQ9 S;  3ZTO A;  3ULH A;  1ZA2 B;  3MMA B;  2QYG A;  2EEY A;  3BJY A;  3HVT A;  1EE6 A;  1BQM B;  4DV5 J;  2HSE B;  4DQS A;  3AOC A;  3T5K A;  2LEC A;  4K5S A;  3KG0 A;  2V9W A;  2CYY A;  3OTE A;  4PYD A;  3ILO A;  4KGK A;  4H4M B;  5F8N A;  2RHS B;  3V4M A;  2G2O A;  2FJE B;  5JVG Q;  1KON A;  5DO2 A;  5F41 A;  3M2V B;  2R8K A;  2V2V A;  4ZIT A;  2DPI A;  4QU7 A;  4YEI A;  3CIM A;  3DRY A;  1WHY A;  1JLF A;  4J5O A;  4KHR A;  1NM2 A;  4EYH B;  2JFK A;  2W2P P;  3M8P A;  2RKI A;  4X66 J;  1F0X A;  2UUB F;  3KK1 B;  2IBK A;  2FVC A;  1JK9 B;  4P7T A;  2ZH2 A;  2FVP A;  4RNF A;  2H4W B;  2BE2 A;  4IH6 A;  3MEG A;  3DLB A;  4HT7 A;  4KGZ B;  4QR2 A;  2F3L A;  4A8X A;  3A8J A;  2HND B;  5IT9 U;  4XOP A;  1OJ4 A;  5D0R A;  1RWR A;  2QT7 A;  2AQ4 A;  4WU3 A;  2JH3 A;  4NZ0 A;  5KFE A;  2FZG B;  2MZS A;  2QL9 B;  5D0G A;  4B3M F;  2B0G A;  1FNM A;  5GMK a;  1VIO A;  1T94 A;  2UV8 A;  5CZV A;  5H1S V;  2YH1 A;  1JRG A;  1XN9 A;  2W24 A;  4DL6 A;  3PW4 A;  1WEL A;  1Q8I A;  1TAQ A;  4C2M A;  5K9F A;  3F73 A;  3QT6 A;  3PZP A;  1W25 A;  2E5G A;  5B0A A;  2HVZ A;  1F3V A;  3UPF A;  1LW0 B;  1TKZ A;  1CQN A;  4YR3 A;  4ZN3 A;  3GG0 A;  4ZLP A;  4D3H A;  5CD4 A;  4C0B A;  3EQO A;  2WSE C;  2EK6 A;  4Q8F A;  4NXM J;  1S6Q B;  4NLT A;  4C48 A;  2H51 B;  1T9T A;  2QLJ B;  1OS5 A;  2HKE A;  3TAP A;  4BWJ A;  3ZZT A;  1HKA A;  2CDR B;  2OPQ B;  3H4D A;  5LMN J;  4YZQ A;  4MKA A;  5B09 A;  4LBH A;  4XDC A;  3AXM A;  2CQ2 A;  1RWO B;  1LK5 A;  1NPK A;  1APS A;  3IN5 A;  4MFB A;  1JXL A;  3PSS A;  3SV3 A;  1AZS A;  3TZW A;  4XO0 A;  5ETP A;  3N6N A;  4ZVP B;  4I69 A;  2IAJ A;  3MM9 A;  4J9K A;  2IJF A;  4F0H A;  2D3O R;  3TVY A;  2V63 A;  3E8O A;  1U6B A;  1PSD A;  1N5Y A;  5E3P A;  4QIE A;  5H9F K;  3GFH A;  4DBQ A;  3J81 j;  4AUK A;  4USJ C;  2XMA A;  2HQD A;  3FNN A;  1XIQ A;  5BXI A;  3LP1 A;  1FRM A;  1KOH A;  3FK4 A;  4PAB A;  4J9L A;  2HMI B;  1QDU B;  5FDL B;  2MMY A;  3EZO A;  1KKH A;  4WFX A;  2I6W A;  1QRB A;  4LSL B;  4IRK A;  5L8R C;  3FSX A;  2YY3 A;  3HVW A;  1QAI A;  3KMQ A;  2VH7 A;  2J8A A;  4R5P B;  4X4N A;  3MXH P;  3PJ9 A;  3SQG A;  3TZY A;  1IQT A;  3AOB A;  3U27 A;  5LSL A;  2AF6 A;  1XR7 A;  4DL0 C;  4OYO A;  3P3D A;  3HD2 A;  1PCA A;  3K7R A;  4H54 A;  2HVI A;  3L4B C;  2K7K A;  2HK2 A;  4JV2 A;  2W4C A;  2ZKU A;  2VPY B;  4I7F A;  2XGQ A;  1RAC B;  1JJ2 R;  2VA3 A;  4EK2 A;  2L9N A;  3SYJ A;  5IM0 A;  1RT4 B;  2HQF A;  1WOS A;  1ZBT A;  4FVC A;  4F50 A;  4WFY A;  5KFL A;  3GFY A;  3BSO A;  3ISZ A;  5D4P A;  4OYZ A;  3J81 Y;  1SL0 A;  1FX2 A;  1UA0 A;  3M8Y A;  3FDS A;  2VFU A;  1K73 T;  1C4A A;  3UCG A;  2VBK A;  5E3Q A;  1X5O A;  4F4W A;  1X0F A;  4CH1 A;  2J0X A;  3R1L A;  1UFW A;  4DLE A;  1LXJ A;  1HR0 J;  5T14 A;  1W2B R;  3MEE A;  1CQM A;  3EQN A;  2OPS B;  5K8O A;  2G4B A;  2HHH F;  3QFW A;  2ZD1 B;  5LMU F;  3Q8Y A;  3D4J A;  1RTJ A;  1IR1 A;  3OVA A;  1IBK F;  3VZH A;  3CD7 A;  4ZVH A;  3CJK A;  5GAD U;  3VAM A;  2BW2 A;  1N34 J;  1D9A A;  1Q5Y A;  4YHH J;  4IRC A;  3NS5 A;  4KV8 A;  5KG1 A;  3HVR A;  5THW A;  2P6T A;  4IKA A;  3FBF A;  3OW2 R;  5BJR A;  5HAN A;  1IJF B;  2DT9 A;  1NLK L;  1UW4 A;  1S7I A;  3MED A;  4UQG A;  1DTT A;  1WOP A;  4G1I A;  4F8R A;  4O44 B;  3M7V A;  1U0H A;  3SDE A;  2N7Y A;  3EPG A;  2VFQ A;  4QQB A;  4Q45 A;  4QIV A;  4LF7 F;  2V4R A;  4CLY A;  3G6E S;  4EI2 A;  3ZZ0 A;  3OJU A;  4A8M P;  4NLO A;  4DV2 F;  1TQL A;  3VCD A;  1UVM A;  2KTQ A;  2ZHA A;  1F9F A;  1JLG A;  4TU7 A;  2BVZ A;  4NLS A;  1IDJ A;  2EFP A;  2E9Z A;  4YEL A;  3T5H A;  1WDT A;  4DG1 A;  2N3O A;  2BE7 D;  3CW2 C;  1V3R A;  2R7Q A;  4NLW A;  1Q8L A;  4DLG A;  3M2R B;  3QGI A;  2IFX A;  1FKO B;  1LWC B;  3UWT A;  5EWE A;  2R8J A;  1SJ4 P;  1H74 A;  1XER A;  4JI0 J;  1LK7 A;  1RHR B;  3DDK A;  2UUC J;  1SXL A;  4K4X A;  4MIB A;  1JLB B;  4WJB A;  3UI3 A;  3OJS A;  5J2Q B;  1HWL A;  1RI7 A;  3Q2S C;  3CJ3 A;  4V19 J;  3KUG A;  3DCA A;  2HRU A;  1WC5 A;  3H40 A;  2VOD A;  5KFK A;  4OJP A;  4ZIW A;  3SFG A;  2HZV A;  4BC9 A;  4PQU B;  4OV6 A;  2CDQ A;  2VOP A;  4RUB A;  2DIS A;  3NWG A;  1RT6 B;  2AYM A;  4ER8 A;  3CJ5 A;  3MPV A;  3FBC A;  3QT7 A;  4NYO A;  4CIO A;  3VV2 B;  3CPW R;  2XNQ A;  1PJ7 A;  1O0P A;  2BDP A;  4HT5 A;  3OFG A;  4WKY A;  5CYM A;  3RRG A;  4PKD B;  3RBD A;  3CC4 S;  1IBM J;  1LW2 B;  4MK7 A;  2HFO A;  4LBI A;  2DYA A;  1N8R T;  2W2N P;  3S7R A;  5KFM A;  1QVG R;  3G96 A;  4RW6 B;  3F44 A;  3IM9 A;  1EX8 A;  3SYZ A;  4NK6 A;  5EDW A;  2DKO B;  2RF2 B;  3K5N A;  2CIM A;  2VDH A;  3TO8 A;  2EW9 A;  2MY7 A;  4LF6 J;  2W9B A;  2DHX A;  1F60 B;  2HHW A;  4WTO B;  1VQM S;  1N4L A;  2Y1I A;  1FJ7 A;  3QNW B;  4ZPT R;  4K4V A;  3HT3 A;  2HS3 A;  1WF0 A;  2UUW A;  1NH7 A;  1PGZ A;  3CJQ A;  3IAM 9;  3OTB A;  1S97 A;  3DDN A;  2RU3 A;  2J6T A;  2XMT A;  1U47 A;  2HHX A;  3M2U A;  3GE9 A;  2ROP A;  2V2Q A;  4MAK A;  3TA1 A;  1SH0 A;  5CHC B;  4AYB D;  1LLW A;  3H7H B;  1HW8 A;  1HWK A;  5J1E A;  1YBT A;  2Y0B B;  5EX3 A;  1XMO J;  2XO7 A;  2RE1 A;  1MML A;  2CQH A;  2IVY A;  4DV6 J;  1X5P A;  4DPW A;  4EUV A;  1X8D A;  3JQJ A;  2JVO A;  4LRB A;  4ZKA A;  5DDQ C;  2CNO B;  4LFA F;  2R4F A;  4WBF A;  3DU6 A;  3QRQ A;  3OXL A;  2AEF A;  4XMY A;  5HBM B;  2NSC A;  3B6B A;  3NGS A;  4DV1 F;  1TMM A;  2D74 B;  2POK A;  1WWH A;  2MKI A;  1T9W A;  2K1R B;  1S99 A;  5DGA A;  4MJK A;  1ZS6 A;  1JLA A;  4LSZ B;  5KFV A;  2AX0 A;  4QIF A;  1GMV A;  4USW A;  2VB6 A;  1NK9 A;  4XOT A;  4ICL B;  4YEA A;  3EVW A;  3AJ1 A;  3IGN A;  5HVG A;  2ZOM A;  4E0D A;  4YDD B;  5SUH A;  2V68 A;  3OUY A;  3W5X A;  3ZZP A;  3PHT A;  1ELO A;  3MOZ A;  2MKS A;  2OTJ S;  3M8S A;  5DQG A;  5C25 B;  2MPU A;  1S72 S;  3CCJ S;  2CPI A;  2HYI B;  4DUY F;  1BHE A;  2H5I B;  4DV0 F;  2PMW A;  3D2W A;  1B99 A;  1D3W A;  2JEJ A;  2NZC A;  2FDN A;  3MCS A;  3HHL C;  2DO0 A;  2QL7 B;  4RNH A;  2MKK A;  3TX0 A;  2GMJ A;  2DR8 A;  4CLT A;  3KLI B;  5CD4 H;  4FKY A;  5F9N A;  2JVR A;  2FTR A;  2BE9 B;  3UFC X;  4XLE A;  5F3Z A;  4HDH A;  2JJ4 D;  4K0K F;  4EO6 A;  2Y8Y A;  3N9U C;  4P7V A;  4C8N A;  2HFU A;  1Q0N A;  4TLQ A;  1BQM A;  1Q8B A;  5GAE I;  2E5I A;  3GJT B;  2GJI A;  2HVD A;  3R97 A;  3R6G B;  2FC9 A;  2YQ3 A;  2DGT A;  3KKF A;  4RBT A;  2F8M A;  4H4M A;  1QY7 A;  2QX0 A;  4DU7 A;  5AE1 A;  2CJY B;  1JKH B;  2MSS A;  5ETO A;  4BHQ A;  3A12 A;  5GAG U;  1UPP A;  2G2Y A;  4DV5 F;  1DUR A;  1AYE A;  3SI8 A;  1YRU A;  3OHB A;  2C2E A;  2V34 A;  4NEZ A;  2WVE A;  2AD9 A;  4PXC A;  1UVJ A;  3R6L B;  1O8I A;  2MST A;  4U8V A;  2DHG A;  3QGH A;  5HRO B;  1FEH A;  3FFI A;  1VIS A;  3D67 A;  1UEK A;  4IO9 Q;  4CO2 A;  3DLE B;  4TYA A;  1ZET A;  3ICL A;  3EPI A;  1H3D A;  2FC8 A;  4LUB A;  3I4P A;  2BW7 A;  2JZ5 A;  2XYP B;  2BJ9 A;  3EVM A;  3PRB A;  2HND A;  2F4V F;  2XGP A;  1I6J A;  3CWJ A;  2YWE A;  2HWH A;  4BC7 A;  4X65 J;  3GPA A;  3ENV A;  2VBM A;  3IRX B;  4DV3 J;  4ED3 A;  2YWK A;  2ALY B;  2QGF B;  4IG3 A;  4OJ1 A;  2IPO B;  1O8H A;  5KFT A;  4M94 A;  2LKZ A;  3R5J B;  4DF8 A;  2XCA A;  1YJV A;  2QJ3 A;  3EMT A;  2DIU A;  3HSD A;  2MY8 A;  2HG4 A;  1LW0 A;  3MPD A;  2LP4 A;  3IP0 A;  1LWF A;  2RQC A;  1OIA A;  5GAH U;  2AYE A;  4EGL A;  2B6A B;  1HBU B;  1CVJ A;  5LL6 d;  1UMJ A;  3GFX A;  4QWC A;  4DSI A;  2ASD A;  2HIQ A;  2HLU A;  2HBR B;  3BN4 A;  4G1Q A;  5DET A;  1DJ0 A;  2ASJ A;  4FYW B;  4LRE A;  3AK5 A;  2BJ7 A;  3BM7 A;  3DNC A;  1FE0 A;  1KD1 T;  4O4R A;  4DWI A;  2XZW A;  3R5C A;  5BYQ A;  3PR4 A;  4LRF A;  4OX8 A;  2JWN A;  2A10 A;  4RLE A;  1VC5 A;  1M90 T;  4PG8 A;  1KQ5 A;  4B9S A;  1NK0 A;  3N5B A;  3VZI A;  2OD4 A;  4RKU C;  3D3B J;  2ZUG A;  1HNV A;  3WC0 A;  3UR3 C;  3FQL A;  2PI4 A;  3KHG A;  2WVF A;  4ZMM A;  1SJ3 P;  4GC6 A;  2FIU A;  4U96 A;  4E8U A;  1VK3 A;  5L9N A;  2PEB A;  1X4E A;  3MR6 A;  1WKL A;  3MD1 A;  3HVA A;  3MM8 B;  3DOL A;  2Z57 B;  1I5O B;  2HMI A;  2BBE A;  4CLZ A;  3PW5 A;  5FDL A;  1VHI A;  1IVZ A;  5AE3 A;  2IDL A;  2WVB A;  4CYU B;  4RW4 B;  2VBE A;  4LSL A;  2C2N A;  4OYX A;  2J0W A;  2HAI A;  3UCU P;  1X9M A;  4R5P A;  5KG4 A;  2ERR A;  2AJ1 A;  3QSI A;  1FKP A;  1FX4 A;  3EGZ A;  3DRS B;  1HNZ F;  3NWR A;  1S4E A;  3B4M A;  4ZVT B;  1RAH B;  3D68 A;  4LR9 A;  3BSA A;  4AQY F;  2HRY A;  4KC5 A;  2VG5 A;  2CFX A;  1F3F A;  4LFB F;  2LXU A;  4PXB A;  4U7C A;  3JS9 A;  1FA0 A;  3NCQ A;  3SCI E;  2QG9 B;  3LOU A;  1V3Z A;  1VFJ A;  3PRD A;  2HNY A;  4EBE A;  1JLC A;  2RQM A;  3D0H E;  8AT1 B;  1E6Y A;  4C8L A;  1U6Z A;  3N6L A;  1JWW A;  3WIV A;  3SUC A;  2J0Q D;  4CO5 A;  2AYG A;  2XMJ A;  2YNH B;  5FII A;  4X64 J;  1HNI B;  5E7O B;  5KFF A;  1HQE B;  3H98 A;  2V6A A;  1UKU A;  2RIJ A;  3FKB A;  5D78 A;  1LV5 A;  2OPS A;  2LQJ A;  2VQE J;  2ZD1 A;  4C11 B;  2XSF A;  5A8K A;  3HLU A;  2DBB A;  3MUT P;  2FB0 A;  1N56 A;  5ETK A;  1RYS A;  1RKJ A;  2KJW A;  1PYT A;  1VRU B;  3D1H A;  3FEZ A;  4XLC A;  1K47 A;  1HPZ B;  1Z2L A;  3DU1 X;  5H9E J;  1NHV A;  2ZJP Q;  3J7Z 5;  1H0H B;  3HPO A;  2O67 A;  4PQA A;  1NO8 A;  2HBZ B;  2MJU A;  2LEP A;  2IY5 B;  3BYP A;  2VL1 A;  4A8Y A;  2B9Y A;  4Q2L A;  2H65 B;  2E1C A;  4YHH F;  2BJ1 A;  2IC3 A;  1BQX A;  4NPO A;  1R8H A;  2ZH1 A;  2CPD A;  1J27 A;  1SC3 B;  4WZM A;  5DG7 A;  4ES3 A;  1PYS B;  3FQK A;  5L39 A;  2UXB J;  1J5O B;  4CRJ A;  2CNL B;  4ZP7 A;  3GQ7 A;  3P4G A;  2JX2 A;  2DXE A;  4JI3 J;  1F6T A;  1XR6 A;  3HHL A;  2DRA A;  1WMR A;  3NNH A;  3PG9 A;  3GU0 A;  5C7P A;  1FDD A;  4QYR A;  3HHD A;  4WCE Q;  2HPU A;  2P5V A;  3NS7 B;  3OFF A;  4N76 A;  5J2M B;  3O1L A;  1HBM B;  5L1K A;  4P73 A;  2Q43 A;  4U8Y A;  4C3M A;  2H54 B;  3PX0 A;  2BZ2 A;  2P2C B;  3KG4 A;  1FKO A;  1LWC A;  1VYA A;  3RGI A;  1BLU A;  4I1T A;  4YR0 A;  4U9R A;  3J81 U;  4LF9 F;  1CJT B;  4DCO B;  2D1C A;  1JLB A;  2V94 A;  5HJY A;  4DQR A;  3GP9 A;  1SH2 A;  1RWU A;  5IWA J;  4OFZ A;  1NK7 A;  3GQA A;  1RJJ A;  3E2E A;  3SZ2 A;  3B90 A;  3R9L A;  1K1S A;  1XBW A;  1NJZ A;  2MB0 B;  2MGZ A;  4QW8 A;  2ZBC A;  4Z06 A;  1WOO A;  3W66 A;  1RT6 A;  1AFI A;  1T3N A;  1JTA A;  3Q8V A;  4CZC A;  2OIH A;  4AXJ A;  2V5H G;  1FE4 A;  5AJ3 F;  2APO A;  3C16 B;  2BUN A;  1KC8 T;  4IOC Q;  4ZLL A;  2OPR B;  2CQC A;  1LW2 A;  4DL4 A;  1RSC A;  4OZJ A;  2MZ1 A;  4Z05 A;  2YNG B;  4ZPD A;  3UN3 A;  1VLO A;  3EXY A;  4RW6 A;  2WB4 A;  1EAR A;  1I94 J;  2BA9 A;  4K4Z A;  1V5V A;  3AOD A;  3DLJ A;  1LM1 A;  3BDP A;  2OML A;  4B9T A;  4XK8 C;  5CYQ A;  1WHW A;  3MI7 X;  3Q86 A;  2PYG A;  1K8F A;  3AD7 C;  4EEY A;  3D3C J;  4QJV A;  3O6Q A;  5KG6 A;  2HBQ B;  4M8L A;  3NLC A;  3WIU A;  4KKO B;  3IA0 A;  1S1W A;  4LF6 F;  1AB8 A;  4WXO A;  4Q5V A;  2Y0S D;  2Y1L B;  3OTO F;  4RBU A;  3ZTS A;  5GME A;  2JC1 A;  3KJV A;  4V02 C;  3MM7 B;  3FCV A;  1BXN A;  3OSP A;  3KLG B;  2C3O A;  4Y65 A;  3GV7 B;  3OR1 A;  2MEW A;  2YQ0 A;  3I82 A;  4OLO A;  1H72 C;  3U7J A;  1CJU B;  5KFB A;  1GTH A;  1OQ3 A;  3GIR A;  4M63 A;  3SSS A;  3OXG A;  4CLW A;  1KDN A;  1NJI T;  3VSU A;  1JJH A;  4OJ6 A;  9ATC B;  1XMO F;  2CJ9 A;  2XSJ B;  4F7V A;  1IKX B;  3IO1 A;  1YI2 S;  1R0C B;  4DSL A;  1I1G A;  3JX8 A;  3KYL A;  2GX8 A;  2J9D E;  3AA8 A;  3TAM B;  2CNK B;  4DR5 J;  2B5J A;  4CH7 A;  3PJW A;  1PO6 A;  2JDJ A;  1S1U A;  4ICL A;  3NNC A;  1Q81 T;  1RDR A;  3C66 A;  2CKW A;  3EJM A;  1N54 B;  4RO0 A;  5DZ6 A;  3CXC R;  3W8P A;  2UXD F;  1RCX B;  1RT5 B;  3MOJ B;  2UUA J;  4ED6 A;  3W61 A;  3FJ2 A;  2HHV A;  4RU9 A;  4NXN F;  1FFS B;  1PJ5 A;  3C14 B;  3HF5 A;  4LR8 A;  4CLK A;  2WOM B;  2RD5 C;  4YUD A;  5C25 A;  4ECX A;  4ID8 A;  4TU8 A;  3JAM Y;  3HM9 A;  4TKT A;  3BGO P;  1SC6 A;  4XPC A;  4YEJ A;  1NDK A;  1WG1 A;  4UZB A;  1D8Z A;  2DO4 A;  2LA4 A;  4OI6 A;  2PA8 D;  1C1C B;  4TQR A;  2ADC A;  4B3S J;  3VGU A;  2BM1 A;  3DLK B;  2HQC A;  2KFN A;  2J7W A;  2B51 A;  1WAC A;  5FLX Y;  1NJX A;  1RBO B;  2W25 A;  2OD6 A;  4X4T A;  1IKW B;  3M1V A;  3TQ1 A;  1PC5 A;  3Q89 A;  4DZ6 A;  5KT7 A;  4B3T F;  3CCV S;  3KWM A;  1ZAV A;  4L74 A;  2QMX A;  3BRE A;  2UU9 J;  2HFZ A;  1UWB A;  1XG2 A;  1P8G A;  3RAM A;  2ILY A;  4B3O B;  3QFH A;  5IFM A;  4ECR A;  4LIW A;  4XN3 A;  4A8O A;  4GVB B;  4I68 A;  1FD2 A;  2XC9 A;  4GO5 X;  2Z8G A;  4FYD A;  4L3N A;  3LH2 S;  2N4D A;  3E51 A;  2H5E A;  4DUZ J;  2VF3 A;  3M30 B;  3FCH A;  1NZ8 A;  4LVO P;  3O2I A;  4YB5 A;  3KHR A;  4P10 A;  2D9P A;  2O04 A;  1A7G E;  5BR8 J;  1U4B A;  4JBC A;  3DLE A;  2CQB A;  1FCA A;  2G1D A;  2ZWP A;  5E3R A;  5HMX A;  2COL A;  1O88 A;  2LDI A;  3DLL Q;  1NDP A;  2IIH A;  2VFS A;  1LOU A;  2WAQ D;  1V9O A;  2F40 A;  3M32 B;  2O01 C;  5HLF B;  1RT2 B;  2VZ9 A;  3OVB A;  1LQ9 A;  3IRX A;  2CQ4 A;  1FRK A;  1S1X B;  3G82 A;  1P9Q C;  3ISN C;  4XIU A;  4UOH A;  5HQM A;  4C6A A;  2E7W A;  4XLF A;  2IMW P;  3W2W A;  4DS4 A;  1UZD A;  1RWM B;  3NNA A;  4F25 A;  4JYA J;  2M8H A;  2QLW A;  2WW4 A;  3BO2 A;  3LWM A;  1D1U A;  1VI7 A;  1RHJ B;  1DTQ B;  1O8E A;  3RR7 A;  4GKJ F;  4DV3 F;  4C4W A;  1HI8 A;  3LP0 B;  4IH5 A;  1SV5 B;  3ZO7 A;  4FXW A;  4Q0B A;  1SQF A;  1HBU A;  1NK5 A;  2R7X A;  4DL3 A;  2XY7 A;  4PXD A;  4RR5 A;  2A2C A;  1S57 A;  3H2L A;  1JXV A;  3OR2 B;  4DPX A;  2NLW A;  4WXW A;  1UAW A;  1S6P B;  3OL7 A;  2L3M A;  1OWX A;  1N32 J;  2ZDP A;  1UVK A;  3A8E A;  4EW9 A;  1QLN A;  4KHM A;  2IJR A;  1VQO S;  2M8D B;  4PWU A;  4P2M A;  2C2R A;  4W98 A;  5HP1 A;  2FVS A;  1OOC A;  1Y9O A;  4CLS A;  3AH6 A;  1VJQ A;  3KUE A;  2HFN A;  1KBR A;  3GFZ A;  2R2S A;  1VR6 A;  2Y9H A;  1F9E B;  4DCJ B;  1DAR A;  1SL2 A;  2VBY A;  1KCD A;  1H7X A;  1FRJ A;  3L9Z A;  5I3Q A;  3H2V E;  1N33 J;  2U1A A;  3B4N A;  2MLZ A;  4U95 A;  1X4F A;  4ED8 A;  1UJ4 A;  1JB0 C;  1TFY A;  2CPE A;  3EM1 A;  2Z30 B;  1GMW D;  1FJC A;  5AT1 B;  1RWV B;  1OGM X;  4F4K A;  1UJ6 A;  5B0E A;  2B3T B;  1Y3K A;  3BH6 B;  1Q16 B;  3ILI A;  3BQ1 A;  3MUM P;  1T0T V;  2B0R A;  4WK1 A;  1HWI A;  5D0H A;  3QPI A;  2CJA A;  4UOF A;  1RTD B;  1WXR A;  1HI1 A;  1YZ6 A;  2YTC A;  2ZNZ A;  3RTV A;  1FVQ A;  1TK8 A;  3AHP A;  4I6A A;  1VRQ C;  3QGP A;  4PG5 A;  2KL8 A;  5IV3 A;  4F0M A;  3FEX B;  3T1H J;  1VQS A;  3FZ2 A;  4HTI A;  5I3P A;  1YDL A;  2LYV A;  1KQF B;  2QX3 A;  3DRX A;  1RWX B;  2EC2 A;  1X4D A;  1WKJ A;  3H4B A;  4DFK A;  3FY3 A;  1R43 A;  1XNQ J;  1DY3 A;  1TZ0 A;  2X85 A;  3J7A N;  3KLV A;  3TUJ C;  4PPD A;  3KG1 A;  3QAU A;  2QRR A;  2NCK L;  2FJW A;  3AD9 C;  4WYL A;  4GKK F;  1TL3 A;  3HFV A;  2KJV A;  2GIF A;  2OI2 A;  1TU0 B;  2D3Z A;  2IYI A;  5ETR A;  2J0S D;  1S1T A;  2BKN A;  2MKH A;  4X62 J;  4CH0 S;  2KFY A;  2EI5 A;  2YNH A;  1HQE A;  4KRW A;  3NBP A;  3DI6 B;  3CDB A;  3M6X A;  2V8D A;  3KJF B;  2EG1 A;  3FVY A;  2YNI A;  4C11 A;  4ZCI A;  4NK8 A;  2UVW A;  2QA2 A;  3I9Z A;  5CA5 A;  5KG7 A;  2OPP A;  4LVN P;  5ADZ A;  4HWV A;  1VRU A;  3TAR A;  1VHF A;  4WFZ A;  3RZA A;  1HHQ A;  2YKP A;  1R27 B;  2GZO A;  2RB7 A;  3LYC A;  1N5V A;  2M3D A;  3MAA B;  4LFC F;  4ZVR B;  3KLF A;  1CS4 B;  2ZHO A;  4GRS A;  2DNH A;  1REV A;  2B4O A;  2CWK A;  3W64 A;  1SKR A;  2LXI A;  3MM6 B;  5IV4 A;  1OMS A;  3DHX A;  4JI6 F;  3UNG C;  1FJG J;  3MF5 A;  3FCW A;  2OKQ A;  5E41 A;  2VFO A;  1Y3J A;  2HEK A;  4QYZ K;  1W2I A;  3DYA B;  1UPM B;  4JI1 F;  4B9U A;  4LRC A;  5IXU A;  3D28 A;  1O8L A;  1TKX A;  2AHO B;  3LW5 C;  4JI5 J;  4ELV A;  3D5M A;  3I0R B;  5D77 A;  3CMA S;  3W63 A;  4OYM A;  5CXT A;  4AL6 A;  4DR1 J;  2I9S A;  3G6V A;  1JQG A;  4CTA B;  2I0X A;  4F3O A;  2MKY A;  2HUR A;  3LPY A;  3CVK A;  2VA2 A;  1C0U B;  4IR1 A;  1HBM A;  4KQZ A;  2HHT A;  4RZR A;  2K2P A;  2DVI A;  2NXJ A;  5B08 A;  3M8R A;  4DN0 A;  1F2H A;  1CJT A;  3HFK A;  2CQ3 A;  5A8R B;  2C42 A;  2JL9 A;  4J9P A;  4Z7Y A;  1O8M A;  1PE9 A;  1X4A A;  2XQC A;  2XBP A;  3DDI A;  2AJ4 A;  2OP5 A;  3UVJ B;  3T9G A;  4EZ9 A;  4MKB A;  2CNN B;  4O3Q A;  1GQ8 A;  2YWG A;  1TP7 A;  3DGP A;  3CJR A;  2NT9 A;  3DRP A;  2PEC A;  5IWA F;  3PV8 A;  4XDD A;  3OXF A;  3RRK A;  2XO6 A;  4USV A;  4QWE A;  2N3L A;  3IWL A;  4KTQ A;  1WI8 A;  4DFP A;  5HO4 A;  3C16 A;  1B3T A;  4HH1 A;  1QUV A;  3BGF A;  5KFH A;  4TY8 A;  2OPR A;  1DQA A;  3N0V A;  4DPT A;  1TUV A;  1TL5 A;  4CNZ A;  3JYT B;  1F5B A;  3H5S A;  1IB4 A;  4JP8 A;  3JUR A;  3MM5 A;  1EZZ B;  1XWL A;  4IDK A;  4O3P A;  3EGN A;  2BAN A;  1S9E B;  3D6M B;  1FTR A;  3F41 A;  1MMD A;  1U48 A;  4IFY A;  3J80 Y;  4F3M A;  2EVZ A;  2C3Y A;  3IG1 B;  2VBX A;  2O66 A;  2W9A A;  2Q79 A;  1JIH A;  1FDB A;  1MG7 A;  4LR7 A;  3N5F A;  2X6W A;  2F8H A;  3R8Y A;  5IC6 B;  1I94 F;  5K20 B;  2J6U A;  3FZB A;  1H73 A;  1P27 B;  4DR2 F;  3KLH B;  1A6L A;  3IMQ J;  4YZ0 A;  3B4D A;  1SJ1 A;  3PNI A;  1Y7P A;  2GV1 A;  2E1A A;  5F8L A;  2JC0 A;  4BWM A;  2CQP A;  3NAH A;  4OYW A;  2IYG A;  2F63 A;  3X1L B;  1S77 D;  2CAJ A;  5K8N A;  3SZE A;  4ETX A;  4F67 A;  5KFA A;  3IR6 B;  5A8W A;  4LF8 J;  4J9S A;  2B9W A;  1TVR B;  3ILJ A;  3T1Y F;  2OMO A;  3TEH B;  2XSJ A;  2W7Z A;  4N7T A;  4BS2 A;  4R8U A;  3C3L A;  3A1Y G;  5D3G B;  1MSW D;  1S1V B;  4E2F B;  3TAM A;  4USK A;  2KM8 B;  3TUP A;  2AEJ A;  1M1K T;  4UY8 5;  5D4O A;  3AXK A;  1WJ9 A;  2JHE A;  1B0P A;  2O5D A;  2C28 A;  1E6V B;  1B0T A;  1U8W A;  3NS6 A;  4A4J A;  1S5Z A;  4ZJO A;  2YX1 A;  2DR7 A;  1CC7 A;  4UUX A;  1RE1 B;  4DR5 F;  3C14 A;  3POT B;  1KQG B;  3QQC D;  1OYE A;  1X5S A;  3PET A;  3HDS A;  3QWP A;  3DU5 A;  2B43 A;  2R2U A;  3ZPP A;  2FLN A;  2VFM A;  4TLR A;  2W2M P;  4ENO A;  1DQ9 A;  2A6M A;  1TKD A;  1U2F A;  1RTI A;  5D4L A;  1ZYQ A;  4PG7 A;  2H4Y B;  4AFF A;  2OEM A;  4K8R A;  1C1C A;  2GHW A;  3PDN A;  3BKF A;  1RGV A;  2HGN A;  3H59 A;  2X3G A;  2VIH A;  3WBZ A;  1C0T A;  3DLG A;  4B9V A;  3NOC A;  5GVQ A;  4NYZ A;  2ZEJ A;  2V8P A;  2D3O 1;  2AJ2 A;  4DQI A;  5HVF A;  2WSF C;  4KAI A;  1TYX A;  4B3S F;  2QV6 A;  1KNZ A;  2FD2 A;  1BN8 A;  4NE9 C;  2V2Z A;  3BKT A;  4M5L A;  3TEG A;  2QO3 A;  4KO0 B;  3VGT A;  1OQ6 A;  2FJB B;  2OTL S;  3QZ8 A;  4LT6 A;  3KLE B;  3J7A 1;  1TKT B;  4DL7 A;  3GR1 A;  3M30 A;  1EP4 B;  4L73 A;  1RU4 A;  5MAO A;  3BQ0 A;  1SKU B;  1H6K X;  4J9N A;  1HBO B;  3NGD A;  3QAE A;  3LWL A;  2ZHB A;  3N79 A;  2XTX A;  1KQS R;  4DUZ F;  1VBY A;  2GGP A;  1RHQ B;  2DIT A;  2CQG A;  2KI2 A;  3GWC A;  2ZM6 J;  1CUL B;  2E1R A;  2FLO A;  2YKN A;  2Y8W A;  4NI2 B;  5KFY A;  5HLF A;  3I55 S;  5MLC V;  3FRY A;  3VQS A;  2MHE A;  4JB8 B;  1RKI A;  4J9Q A;  4Y2C A;  3NKY A;  3E3X A;  3GSI A;  4HEA 9;  2I38 A;  4G6V B;  2FGC A;  1HYS B;  4ID5 B;  2YX7 A;  1JNZ B;  3AJ2 A;  1U6F A;  1HLW A;  3HD1 A;  3IM8 A;  3FUY A;  2VJI A;  3KDO A;  4M5D A;  3B8H A;  3LP0 A;  4LQ3 A;  4JI2 J;  1FF2 A;  1SV5 A;  1U09 A;  5ETQ A;  1IA5 A;  3D1Q A;  1N5T A;  4O3O A;  2CRL A;  1XNR J;  2HWT A;  4N8N A;  4F04 B;  3P8B B;  1X4H A;  3PEJ A;  1TSP A;  4KJI A;  5E5N A;  2YWF A;  2HIY A;  3H25 A;  1IQZ A;  1FWK A;  1WC3 A;  3Q22 A;  3JQM A;  2XLJ A;  5KG0 A;  1S49 A;  3MZI A;  4OHZ A;  3MTK A;  3W60 A;  3MFH A;  4QW9 A;  2PI5 A;  1YX2 A;  2XHW A;  1VOM A;  3MMJ A;  4PEO A;  3I87 A;  1MMN A;  2HGL A;  4EZ6 A;  1VBZ A;  3IBW A;  3M8Q A;  3AB2 B;  9RUB A;  2LVW A;  4XLA A;  1BQN B;  4C2L A;  3ELH A;  5GAD I;  2D9O A;  4DR4 J;  4EMD A;  2DGX A;  2ZH9 A;  1RT1 A;  3C8Y A;  1CJV A;  4B9L A;  2YKM A;  1B70 B;  1AFJ A;  2FHK A;  1RA7 A;  1TK5 A;  1L3V A;  4Y6I A;  2M7S A;  3C6T A;  1R0A B;  4DV4 J;  1N33 F;  3AFG A;  1T8E A;  2E1M C;  4Z37 A;  5F8I A;  2W01 A;  4A47 A;  2DNQ A;  4YFU A;  2VJU A;  1BWE A;  2GVZ A;  3PSZ A;  1RTD A;  3ITH B;  3BEG B;  2PFF B;  4OHY A;  4I84 A;  3G8T A;  4ECZ A;  1KLN A;  2NTQ A;  4OI1 A;  1XMQ J;  5J2P A;  2B56 A;  4IH7 A;  1TV6 B;  4P71 A;  1NUE A;  1S6O A;  4O3R A;  1KVK A;  1G3O A;  3CGI A;  2W8K A;  5L9X A;  5KFQ A;  1WC4 A;  2R8G A;  4X2B A;  3ZZR A;  2GAG C;  4F2R A;  3QIP A;  3UDV A;  2KT2 A;  2EFV A;  2ASL A;  2N4C A;  2CPZ A;  1CBK A;  4RBV A;  5D8H B;  3W2V A;  4HDG A;  4MT1 A;  1FI4 A;  3D7S B;  1FRI A;  5DLG A;  4O0N A;  4ZDN A;  5KFO A;  1F1B B;  1S9G B;  4TYB A;  5HK4 A;  2QSF A;  2VDI A;  1ZM2 A;  4CM2 A;  4CM0 A;  1EKR A;  3CD0 A;  1ITP A;  1R31 A;  2CWX A;  3THV A;  1SH3 A;  4F4Z A;  1RWK B;  4C97 A;  1S79 A;  3GZ7 A;  4ZPB A;  3Q8P B;  1XQI A;  3DI6 A;  1KHV A;  1EQM A;  3T6J A;  1PAE X;  4QZV B;  2ZH6 A;  4OZ3 A;  4OM9 A;  1P6T A;  1K0T A;  5LJ3 Y;  3OVS A;  2VAS A;  3SXL A;  2RRB A;  1WEZ A;  2DK2 A;  5HQ8 A;  1Q8K A;  3CMQ A;  2DNG A;  3HMJ G;  2VG6 B;  2MQQ A;  4U7U K;  2YNF B;  1IBL F;  4ECU A;  1BY9 A;  2PO4 A;  4URR A;  5JUM A;  1X4G A;  4I2P A;  2RHQ B;  3MAA A;  1JLQ B;  4RUH A;  2LQB A;  2LCW A;  1CS4 A;  5A76 A;  1P1T A;  2V4J B;  1LFP A;  1NDL A;  4C9D A;  3IXQ A;  1TL7 B;  4OI3 A;  3MM6 A;  4MKY A;  3BGU A;  5F8G A;  4MIA A;  1D8Y A;  3T41 A;  1FD8 A;  3NOG A;  2WK4 A;  3J7Y U;  4G3I A;  2AT1 B;  3VGS A;  4YR2 A;  2B8Q A;  1TL1 B;  1HBN A;  1BWV A;  3GCX P;  5JMN A;  2R8H A;  3VVU A;  1Y5L B;  3C15 B;  1ZTT A;  2XY5 A;  1N36 J;  2UXC F;  5A2Q Y;  3DYA A;  1V5I B;  4ED0 A;  3FSY A;  4RPF A;  5ETM A;  4AND A;  1NB2 A;  5HI7 A;  3L3C A;  4CO1 A;  1FJG F;  5A6P A;  4DX8 H;  2DNY A;  3PYF A;  3T6B A;  3CIZ A;  1HNW F;  3HJV A;  5KFD A;  3I0R A;  4O4G B;  2QYC A;  3I0S A;  4DV7 J;  3GII A;  4G1P A;  2CVE A;  1HNX J;  4UZC A;  2L48 A;  4CO0 A;  2ZVS A;  1UTA A;  3RB4 A;  1G1X A;  3BBB A;  2OSR A;  4PAA A;  3HSG A;  3MMC B;  1YJ7 A;  1C0U A;  2XHC A;  4JI5 F;  4ILR A;  2QA4 S;  2G2Z A;  2VFP A;  1PIE A;  1L3T A;  3MPW A;  2ASY A;  2CPX A;  1RA6 A;  4A8Q A;  2BOA A;  3F56 A;  2KXH A;  2OHD A;  3UN5 A;  3ZZY A;  2VQF J;  3TOQ A;  4ZP6 A;  1Q82 T;  3CNQ P;  4JI4 J;  4JV0 A;  3UVJ A;  3GYG A;  1EB0 A;  1CJK B;  1GX5 A;  2RJZ A;  3OL8 A;  3T5J A;  2GS8 A;  4ZVO B;  1T03 B;  1WC0 A;  3GLJ A;  3SCJ E;  4RUA A;  4FS2 A;  1BMQ B;  2B7B B;  5F3T A;  2LMI A;  1GT8 A;  3BKU A;  4X4P A;  1IKY A;  2RQK A;  1KTV A;  2J5A A;  4KR0 B;  5E3A A;  2CQ1 A;  1MRO B;  1CC8 A;  4DSE A;  5IT9 Y;  2RT3 A;  2YBV A;  1NKB A;  3IS9 B;  4GC7 A;  2BAC A;  5IT0 A;  5AXL A;  3CB4 A;  3GJQ B;  2O0W A;  5I42 B;  3JYT A;  5CAA A;  4ECT A;  2NZM A;  2BOP A;  2XT4 A;  1AT1 B;  3MR2 A;  3NY0 A;  4FBU A;  4L72 B;  4TXS A;  1S9E A;  4RW7 B;  2DGV A;  1RB0 A;  2DNR A;  4Q2M A;  3PTW A;  1U0S A;  4NCA A;  4B9N A;  2BQU A;  4ZCL A;  4LF5 F;  4OPW A;  2VC0 A;  3N6M A;  4OYA A;  1RYR A;  1URR A;  4DSJ A;  1OO0 B;  1KEK A;  1GNK A;  4KHP F;  4UW2 A;  3EWG A;  2MZJ A;  1Y10 A;  2BJE A;  2E9T A;  4YB6 A;  4XN0 A;  3M9M B;  4EWT A;  3K58 A;  2NSP A;  1MU2 B;  2ADB A;  5DG8 A;  1GAO A;  1J5E F;  3SCK E;  4PUO B;  2XNR A;  3IAS 9;  4JV5 F;  3QYY A;  1YSJ A;  1UVL A;  2BSP A;  2NXU A;  2X7I A;  1L3U A;  2FHM A;  2M5Y A;  2F8E X;  2MZQ A;  1X0C A;  1Y11 A;  3K17 A;  1VQ8 S;  2KH9 A;  1MWZ A;  5GAG I;  2W2O P;  4J9M A;  2WBM A;  3GYN A;  3H5X A;  2EWH A;  2XYH B;  3P5B P;  1N5Q A;  2UUB J;  1TVR A;  1QVF R;  2G13 A;  4MYT A;  1JLF B;  4WIQ A;  2K06 A;  1H7W A;  2WRM A;  3WHI A;  4DFM A;  2LEA A;  2X1B A;  3UD5 A;  2GJ2 A;  2W2Q P;  1O8F A;  3M8P B;  2ZH3 A;  3H5U A;  5D3G A;  2RKI B;  2XZT B;  2Z4P A;  3RAQ A;  1R7I A;  4OJG A;  3CCR S;  1DRZ A;  3HZG A;  4ZP8 A;  1DAX A;  4ZVU B;  4FKX A;  2J8I A;  2RRN A;  1WSR A;  1S10 A;  1U8S A;  4UUW A;  2BE2 B;  2P6S A;  4B3M J;  2P9G A;  3QRP A;  3BQ2 A;  3T5L A;  4DOZ A;  3PXG a;  4NCB A;  4YCQ A;  1RAB B;  1W26 A;  1YJU A;  2UUT A;  5F0U A;  3HT0 A;  4ALZ A;  4JOU A;  3POT A;  4X4U A;  1VQK S;  2E44 A;  3HHE A;  2G0C A;  1S0O A;  4RU2 A;  4HAC B;  3CCS S;  1H80 A;  3CCL S;  2HNZ B;  1GEH A;  4HHJ A;  4DEZ A;  2KN4 A;  1QD1 A;  2MXY A;  2AJF E;  1O8K A;  4DPY A;  1RAE B;  2VJV A;  4ZPV R;  1QAX A;  2NXN A;  3FC9 A;  5GAH I;  2CUY A;  2MDA A;  2HBY B;  4A48 A;  2F3J A;  4I2Q A;  1QUP A;  3G6X A;  2X3D A;  4KGX B;  2GVD B;  2KHC A;  3ZTQ A;  3JXO A;  2KG0 A;  1VIX A;  2R42 A;  5K14 B;  2V4Q A;  3PO5 A;  5T7L A;  3V4I A;  2RDI A;  3Q8Q B;  1C1B B;  2W8L A;  3R2D J;  4F4Y A;  3CDE A;  1WHX A;  3I5C A;  3CD6 S;  3RW7 A;  4NLV A;  2CQD A;  4KIA A;  4M5G A;  1Q7L B;  3FGV A;  4XPE A;  2EC0 A;  3VTI A;  3DMJ A;  2M0G B;  3TJ8 A;  2DD8 S;  4NLX A;  2KU7 A;  4PWD A;  3KLE A;  5AMV A;  1RU1 A;  5B0D A;  2RNE A;  1AZS B;  4RUC A;  1YGY A;  4DR6 F;  2IAJ B;  1SBR A;  4DN9 A;  1TR0 A;  3I5B A;  4TQS A;  3PM9 A;  3PX4 A;  4OQJ A;  4HHU A;  3EYZ A;  2MTL A;  2V5I A;  1HAR A;  4ECQ A;  1G2E A;  1Q4R A;  1N5Y B;  2W7A A;  3VR1 A;  2AGQ A;  1EET A;  4KSE B;  1T05 A;  2RDD A;  4I64 A;  4KH3 A;  3BR9 A;  2DCU B;  2F65 A;  3BGR A;  2YPZ A;  3LP1 B;  4LQ9 A;  2AIR B;  4HL9 A;  4NLP A;  2OSQ A;  4A8K A;  2QL5 B;  4AL5 A;  4OYI A;  4FF4 A;  1TEL A;  1UA1 A;  3NGU A;  3L7U A;  4FBT A;  1S12 A;  1O51 A;  2A18 A;  4F2S A;  2ILZ A;  3RRH A;  4LF1 A;  2DR5 A;  2OFG X;  3W9J A;  3BSN A;  1U1L A;  2DHH A;  3N01 A;  3NP5 A;  3HJF A;  3K5O A;  1HWJ A;  3ETM A;  2UZA A;  4P2F A;  1HYS A;  3K89 A;  4R0J A;  4JI7 J;  1EQ0 A;  4OI2 A;  5IC4 B;  5HMY A;  4IQX A;  1TUW A;  2QC3 A;  1DLO A;  4DMZ A;  3PJX A;  5IOL A;  4QWA A;  3QT5 A;  1FNX H;  2BM5 A;  4B3R F;  1QAY A;  3GR0 A;  2DY1 A;  2GIQ A;  1T02 A;  1MN7 A;  5H9E K;  2AU0 A;  2X6Y A;  4DCP B;  3MR3 A;  1T7P A;  3CD5 A;  5IM0 B;  2HGM A;  1ULR A;  5DG9 A;  1RUS A;  3HO1 A;  5DQH A;  2W4P A;  4ED2 A;  4JI2 F;  3ZZU A;  1X60 A;  1FK9 B;  3OQ2 A;  1OYD A;  1N52 B;  3MD3 A;  2LLZ A;  2EPI A;  2HHH J;  3I9V 9;  1GTE A;  1B64 A;  3TAN A;  2W4D A;  2BJ8 A;  1RWP B;  4URG A;  1IBK J;  2AYB A;  3KK2 B;  1PJ6 A;  1F2G A;  1X4B A;  2I1R A;  2B9X A;  2ZKT A;  3HCX A;  4V19 X;  1OY9 A;  1FVS A;  4NA2 A;  3Q8R B;  4KFB B;  1YRX A;  4OJO A;  2ZC3 A;  2DEI A;  3KUH A;  3TYT A;  3TAQ A;  2GC8 A;  5G0R A;  3CJK B;  1KQK A;  1CPZ A;  2F9J A;  5C42 B;  4ED1 A;  5JLV C;  1PIL A;  3K8V A;  3VQT A;  3UD3 P;  4KV8 B;  2F5G A;  1VQY A;  4Y2A A;  3PYG A;  3CC2 S;  2NXC A;  3K8W A;  2NRE A;  3LAK A;  3ENQ A;  2FY8 A;  1YJ9 S;  4DSK A;  4CLL A;  3TA0 A;  2Z2Z A;  3SSQ A;  2CZV C;  2HRT A;  3UNY A;  3R7B B;  3PYD A;  4LF7 J;  4DX5 A;  4ERD A;  2ZH8 A;  3JTP A;  5LOQ A;  2BRK A;  3SDE B;  2JFD A;  3R1H A;  2ATL A;  4XLH A;  2CJK A;  1QM9 A;  4EBD A;  1X7V A;  5F0W A;  4ELT A;  5KT4 A;  2BXJ A;  4NLU A;  3W65 A;  2EKN A;  5ETN A;  4OMF G;  1RT3 A;  2HS0 A;  3DRR A;  3S6E A;  2OLW A;  1IJE B;  4C8Y A;  3SV4 A;  1PKU A;  3LP2 A;  3RJM B;  4KT0 C;  3DOM B;  2MQO A;  2P9E A;  2YKA A;  1N0U A;  1NBE B;  3SQV A;  3D9B A;  5KFU A;  1JLG B;  2KO1 A;  3ET6 B;  4O3S A;  5HAO A;  3TWZ A;  5HL7 Q;  2M70 A;  4K5R A;  2A0F B;  1X0P A;  1R6Y A;  3M05 A;  3QJL A;  4C8M A;  4MYU A;  1BE4 A;  2DJW A;  3QO9 B;  2CZ4 A;  2Z0G A;  1A0O B;  2P8I A;  2KB2 A;  5KFS A;  1WD6 A;  3M6U A;  3UQS A;  3TRG A;  3CDA A;  5DRK A;  4DX6 A;  4FP9 A;  3MMA A;  4CT8 A;  2HZA A;  1NJW A;  4OL8 A;  3VWS A;  3KOA A;  4N41 A;  2EG2 A;  2C2K B;  4L3K A;  4OJH A;  2BKO A;  4J37 A;  1VS3 A;  4OX9 J;  3M2V A;  3CSK A;  2V69 A;  1S4F A;  5DM7 Q;  2YNF A;  4ZHR B;  3MAH A;  1FWP A;  2KVI A;  4NZ6 A;  1FNO A;  4DL2 A;  1JLQ A;  4HYK A;  5LSO A;  1NPP A;  1NSQ A;  1HIY A;  5CYM B;  2NST A;  2K3K A;  4ECW A;  5KFG A;  2V50 A;  3RYL A;  1TL7 A;  2WSC C;  2XUL A;  2QA1 A;  2QLF B;  4ZPW R;  4IYQ A;  2XMV A;  3KK1 A;  2O17 A;  3FMB A;  4F0K A;  4N77 A;  2JNJ A;  3OV7 A;  4YP3 A;  3C15 A;  1R89 A;  1B0V A;  3QGG A;  2IA0 A;  4PCQ A;  3A3P B;  3RU0 A;  1XR5 A;  4X66 F;  3CCQ S;  4O0I A;  3EXC X;  4ZVS B;  3GJS B;  2HHQ A;  2DY9 A;  2BV3 A;  1NDC A;  1TAU A;  2PEH A;  2RDJ A;  3OL6 A;  1IR0 A;  3O5T B;  4O4G A;  2H1Y A;  3UN2 A;  1R8A A;  3PHE A;  5KFC A;  2J8S A;  3EX7 B;  2ACM A;  2NXE A;  2XWY A;  3GSD A;  4J9R A;  3MMC A;  4FVM A;  1NKC A;  4P6Q A;  1WF2 A;  1T95 A;  3VF0 B;  4C3L A;  2R7W A;  3DGV A;  1KRP A;  2B8P A;  4H4O B;  1HNX F;  1EHW A;  4J9V A;  4LFA J;  1RMG A;  3NB2 A;  3GV5 B;  2O0V A;  5J1E B;  1FJE B;  4LRA A;  3MHY A;  3Q23 A;  2EXU A;  3PCO B;  4DV1 J;  1L5U A;  2GW8 A;  3ML3 A;  3QID A;  4JI8 J;  5IQQ A;  1MWY A;  1RHM B;  1EJ7 L;  2Z2L A;  2G9O A;  1S6Q A;  3A4T A;  3V6H A;  2KXN B;  1ARO P;  2ACY A;  2K7J A;  4FYY B;  3D6F B;  1N6Q B;  3DXB A;  4WFA Q;  2ALZ A;  1IXK A;  1Y00 A;  1VK8 A;  2OPQ A;  2QFI A;  4IG0 B;  1NXI A;  3VMW A;  4KGV B;  5J1N A;  4NXM F;  2V2K A;  2FGO A;  1JLA B;  3MMB B;  2L08 A;  2DGW A;  2RH3 A;  2VG7 B;  2HHS A;  3U1N A;  3S1T A;  1KVJ A;  5RUB A;  3RB6 A;  5ETV A;  3EDQ B;  5I42 A;  5LMN F;  4DUY J;  4QR0 A;  1XJW B;  3THT A;  4DX7 A;  4ZLJ A;  1HMV B;  4DV0 J;  1RLC L;  2X6X A;  2VON A;  1RAI B;  3OUY B;  3MUV P;  3NL0 A;  3V6D B;  2DRB A;  3RIQ A;  3SQO P;  3VST A;  5KFN A;  3T1A A;  3KNA A;  3R7S B;  3BV8 A;  4N47 A;  1YIJ S;  2B4V A;  5C1C A;  3P4U B;  2B4P A;  4K50 A;  5KT6 A;  3KJQ B;  5LSR A;  2FVR A;  1RWW B;  1R0B G;  1O8B A;  2CPH A;  3K57 A;  2DNM A;  1OFL A;  2MQ8 A;  3OFH A;  1QTN B;  5ITH A;  5K5M A;  3D1O A;  2QMU B;  4NA3 A;  1KTW A;  4PUO A;  2R7S A;  1Q95 G;  3PVX A;  4ES2 A;  1KLM B;  3CJ8 A;  2RVJ A;  1XC9 A;  1O8D A;  1RT4 A;  2XMU A;  3HX9 A;  4OYP A;  5CCL A;  4W8R A;  3HZE A;  1ZTW A;  4JV1 A;  4YDX A;  1U7L A;  2CZ9 A;  1EIY B;  1GXL A;  2IVM A;  2LU1 A;  4OZ1 A;  4P72 A;  2GO9 A;  2R8I A;  1DHM A;  1NH8 A;  1EAY C;  2BYC A;  2G1H A;  4UST A;  5KFX A;  2F4V J;  2MLX A;  3FFI B;  1SUQ B;  3J7Z T;  3JTN A;  4K4Y A;  2WTF A;  4PRF A;  5B0G A;  3TA2 A;  1ZZN A;  1HI0 P;  2NTB A;  1D0E A;  1HR0 F;  4ZVG A;  1MWQ A;  1IWA A;  5L1I A;  2V8V A;  5HQL A;  3RG6 A;  4U4B A;  5KT5 A;  5C2G A;  4NLR A;  1VBK A;  2D69 A;  1OFE A;  4OHW A;  3PRV A;  3Q8U A;  3Q24 A;  3G8S A;  4PMH A;  4F4A A;  4HAC A;  4IG3 B;  1N34 F;  2HNZ A;  2UVE A;  1K8A T;  4O44 A;  4Z2X A;  1Y5N B;  2FLP A;  2VFV A;  2INV A;  3LUY A;  1UZH A;  4IFV B;  2EBG A;  1U1M A;  1U26 A;  2DRD A;  1LWF B;  1GFW B;  1KWM A;  2ZE2 B;  4LF4 J;  3B8Y A;  3NGT A;  4CO3 A;  3CC7 S;  1NKE A;  2AKW B;  3NEK A;  1HG8 A;  3U1L A;  4DSF A;  4K59 A;  4AE5 A;  2GVD A;  1VDH A;  2CPJ A;  5K14 A;  4G1Q B;  3OPK A;  1Y0H A;  1C1B A;  1NK4 A;  4Y28 C;  1HW9 A;  4MK8 A;  2ROE A;  2DCL A;  5GMD A;  2XWX A;  2FQQ B;  1EZG A;  1DBG A;  2W7O A;  2E5J A;  3OD2 A;  1JX4 A;  2DIV A;  3PAC A;  3RBE A;  3OL9 A;  1HL6 A;  2Q6B A;  3H20 A;  3IWN C;  4FXV A;  3C6U B;  1SB6 A;  3H0P A;  4XTT A;  4OHX A;  4KPC A;  3BF4 A;  3RW6 A;  3M2R A;  2YKQ A;  2PFD A;  4K4U A;  2V67 A;  3H5Y A;  5M2P A;  2ZUA A;  1LFW A;  2PT0 A;  1HNV B;  4AD6 A;  1SJQ A;  3TH0 A;  5J2Q A;  4C0H A;  5I4M A;  5LM7 E;  2CAD A;  1ZM3 A;  2LXF A;  2PSZ A;  2DH7 A;  3O44 A;  4NA1 A;  1X9W A;  4PQU A;  3W9H A;  4JI0 F;  1Q79 A;  2UUC F;  2PDA A;  4OI4 A;  1HNZ J;  3DOL B;  2F4F A;  1K44 A;  4PPZ A;  5B0B A;  2IRU A;  4AQY J;  4ETZ A;  4IR9 A;  4PZV A;  2O6W A;  3KHL A;  4TU9 A;  3G9C A;  2DH9 A;  4MMO A;  2DGS A;  4JUZ A;  4LFB J;  1FKP B;  3DOK B;  1NU4 A;  2R7V A;  1XK8 A;  1IKV B;  1YJW S;  3GCW P;  2V9K A;  2W9C B;  3G6Y A;  1M1G A;  2HLT A;  2VFT A;  3UDE A;  2VG5 B;  2OEK A;  3I6P A;  1TL4 A;  2ZOG A;  1U1R A;  3EDR B;  4JI7 F;  1S7H A;  3RAX A;  2RF2 A;  1IBM F;  3T9N A;  1PYO B;  2OEL A;  2QEX S;  2N7C A;  5EWF A;  2HNY B;  1C4C A;  1JLC B;  3LQV A;  4D3G A;  1AUS L;  2L41 A;  1FK9 A;  1E6Y B;  1HFE L;  1O5J A;  2HHP A;  4W8Q A;  2HQG A;  3C46 A;  3KJN B;  1ACM B;  1U1Q A;  1FWL A;  4PXE A;  5U47 A;  3UR0 A;  3OTC A;  1FTC A;  3KK2 A;  1RAA B;  3PYE A;  3TVZ A;  1Z1Z A;  1CLF A;  4IQM A;  4NMX A;  1SQE A;  2BQ3 A;  1KFD A;  4ILM A;  4DR3 J;  5AE2 A;  4KFB A;  4R0E A;  1M5K C;  1OGO X;  3LA0 A;  5A8K B;  4EBC A;  3TVK A;  1PLU A;  2BMB A;  2I5J B;  2C2Z B;  2E5L J;  2R2R A;  1RIS A;  2Y1J A;  3A3O B;  2BM0 A;  4QR1 A;  5C42 A;  2UVV A;  3MPY A;  3IC1 A;  3JTO A;  4WP3 A;  1U1O A;  3VAH A;  3NAW A;  2DNL A;  4B17 A;  2AJ0 A;  5HBM A;  3A8I A;  5KFP A;  2XLI A;  3QWU A;  1SQG A;  4ECS A;  1LWE B;  1RHK B;  4OIX A;  3IR7 B;  4HLB A;  4DV6 F;  2K1R A;  1S0M A;  2KFZ A;  4KB7 A;  2IC3 B;  3SY2 A;  3LJY A;  1B7F A;  5AXM A;  4FF2 A;  3BR8 A;  2XS2 A;  4QWB A;  3CTR A;  5CZX A;  2ODL A;  2GO8 A;  4PG6 A;  4J91 A;  2C3M A;  4M5N A;  3GQ9 A;  2AP6 A;  5KG5 A;  1SC4 B;  5EN1 A;  3LO3 A;  1SIZ A;  2FZK B;  1X4C A;  3DOM A;  2DNZ A;  3HHL B;  1L3S A;  1CG2 A;  3ET6 A;  1SL1 A;  5LXR A;  4DI6 A;  3NCP A;  4P9S A;  5L1L A;  3Q8S B;  2VFN A;  2ROG A;  1X9S A;  4LF9 J;  1KN6 A;  1MN9 A;  1FFG B;  5HN0 A;  2HW3 A;  2KG1 A;  1EKS A;  4W4M A;  1YVF A;  2HS4 A;  2XYG B;  3QO9 A;  3KLI A;  4ZCK A;  1V6H A;  3Q83 A;  3HHL D;  1T9X A;  3P45 B;  2GHV C;  3CUL A;  3V2U C;  3VAJ A;  3CDW A;  2ZBP A;  1RBL A;  2IM2 A;  2VKR A;  2C1E B;  2OH2 A;  4WFB Q;  1RAF B;  1QAJ A;  4CO4 A;  3G71 S;  2GQQ A;  5AJ3 J;  3W8G A;  1ZM4 A;  4KGM A;  3OLA A;  2MGZ B;  4LRD A;  3CCW A;  5ETT A;  2G0I A;  1JKH A;  2E1P A;  3V6J A;  4ZHR A;  3FRZ A;  4W90 B;  4K2J A;  3B78 A;  4USH A;  1WUU A;  4URQ U;  3LAN A;  1NRK A;  1S76 D;  3W3S A;  1PC4 A;  1QSS A;  2QMW A;  5LXY A;  4OX9 F;  4U7U D;  4C7Q A;  2M4M A;  2DR9 A;  3R5G A;  3FBE A;  2IOU G;  2LFV A;  3PFO A;  5HRO A;  1Q1K A;  4CNY A;  4USU A;  4OZN A;  1XMB A;  4ZS6 A;  4JRA C;  1KTQ A;  3CE8 A;  8ATC B;  3BB5 A;  3IGV A;  2MHN A;  5CYQ B;  4CCH A;  3GMG A;  3OTO J;  4FPI A;  3GQC A;  3DKD A;  1S9F A;  4HR2 A;  3KDN A;  2O1P A;  5D0E A;  4XL9 A;  2X1A A;  3VVT A;  1S1W B;  1R8C A;  4I4B A;  1WEY A;  2K3I A;  3KJV B;  2GA7 A;  4X4O A;  4H4O A;  2PMZ D;  4X65 F;  1AW0 A;  1NZA A;  3S8S A;  3OR1 B;  4MH8 A;  5EHH A;  3CF5 Q;  4H4K C;  2B6A A;  4FNI A;  3HK2 A;  1GXU A;  3SFU A;  1HD1 A;  2QLX A;  4XKV A;  1SIW B;  2LDY A;  3L7P A;  4OX7 A;  3DM2 B;  4K4S A;  5KG3 A;  2IM0 A;  1D09 B;  1SI9 A;  1N6Q A;  4U49 A;  3BSC A;  3I96 A;  3LPE A;  2UP1 A;  4YFO A;  3JSR A;  4JI8 F;  2YQ1 A;  2PD1 A;  4IG0 A;  2UXD J;  4ATN A;  4DQP A;  3MMB A;  4NXN J;  5AXK A;  2VG7 A;  4QPX A;  3VAK A;  2B5J B;  3AY0 A;  4TNO A;  1S1U B;  2Q6C A;  2XY6 A;  1WOR A;  5DQI A;  5DS7 A;  4NOH A;  4ZA1 A;  3CED A;  4HVZ A;  1HMV A;  2JEG A;  1UVN A;  2IRX A;  3V6D A;  3EGW B;  2D41 A;  1K4Z A;  1LNQ A;  3K5L A;  3ZZO A;  4MXN A;  4Y34 A;  5HMW A;  4CLF A;  2XS5 A;  1CZF A;  3MM8 A;  1WC6 A;  2J6S A;  3W5Y A;  4AVZ A;  3HXM A;  2KDO A;  4CYU A;  4W92 B;  4RW4 A;  4YB1 P;  2AX1 A;  1FFW B;  3A8K A;  2X1F A;  2EFQ A;  2NS1 B;  1SKS A;  2DGO A;  2QFJ A;  2H3E B;  3US5 A;  1JLE B;  4DDF A;  2KKH A;  4QCL A;  3DRS A;  2X1G A;  1U1N A;  4B3T J;  1UWA A;  1M5P C;  1VQ6 S;  4BCA A;  1YIT S;  3K5M A;  3CJT A;  2N82 B;  3L95 X;  5J1P A;  3AD8 C;  3CO0 P;  3M1V B;  1KLM A;  4Y3C A;  2ZWO A;  4M5I A;  1MLA A;  4YZA A;  2VFR A;  1I51 B;  3TR5 A;  5HSP A;  4MTP A;  1LXN A;  2YVS A;  1UWB B;  2CG4 A;  2DNP A;  2QY1 A;  1RAO A;  5FJ4 A;  2CXE A;  5H9F J;  4C8Z A;  3EZ5 A;  2R3V A;  1IUJ A;  3A13 A;  1QQ1 A;  1K5C A;  2FZC B;  1JJ4 A;  3B54 A;  1T3O A;  2WZ1 A;  2B4U A;  3JQK A;  2PGC A;  1HNI A;  3Q0A A;  5F8M A;  4X4Q A;  1SUQ A;  1S0V A;  4YS2 A;  2R2T A;  4M5J A;  4FZV A;  2XTJ P;  1IM4 A;  1N48 A;  5D15 A;  2ZZM A;  1BD6 A;  4X64 F;  5F8J A;  5G4D A;  1QCX A;  2BR0 A;  3GIL A;  1HPZ A;  1PAU B;  2VQE F;  1M0S A;  4GKJ J;  1DQ8 A;  1OFD A;  1DAB A;  3G82 B;  4XAK A;  4OLP A;  1UCN A;  4QWD A;  2VKZ G;  4Y2I A;  3W2W B;  2VHG A;  1QJH A;  4Y2M A;  3R7N B;  3LMW A;  2ZH7 A;  1NHU A;  5IQ6 A;  4AXI A;  4IFV A;  2IMO A;  1TK0 A;  3W9I A;  2C3U A;  4Q0B B;  2MZT A;  4NAS A;  2ZE2 A;  5JMC B;  2F7V A;  3CJ0 A;  4ES1 A;  5FD1 A;  4ZPC A;  1LEO A;  2H5J B;  2LQ9 A;  4WII A;  1J5O A;  3AJD A;  3ZSC A;  1NSP A;  4ED5 A;  3UE2 A;  1X31 C;  1HD0 A;  2M9K A;  4LF4 F;  2F9D A;  2RU9 A;  2FVQ A;  5HVH A;  2UXB F;  1FDA A;  4LBP A;  5HP1 B;  5J2M A;  4BLG A;  2A1B A;  3C6U A;  1NHK L;  2HVH A;  4JI3 F;  3M9O B;  4XKW A;  2Z58 B;  2HK3 A;  1OSC A;  1FO1 A;  2Z8Q A;  2HAF A;  3UW0 A;  2DNO A;  4UTG A;  3WQP A;  2FUG 9;  4TY9 A;  4DR7 J;  4ZJL A;  4OZ2 A;  2J7K A;  2IJN A;  2MKJ A;  3AT1 B;  3LF0 A;  2AGP A;  3ZZZ A;  3D0G E;  3CJ2 A;  3ZTP A;  1H2V Z;  4ELU A;  2AW0 A;  3TZX A;  1LKZ A;  4UOG A;  3VAL A;  2CJQ A;  3PW0 A;  2KZM A;  2VPX B;  3MUR P;  2DR6 A;  3V5R A;  3SMZ A;  4IOB A;  3U1M A;  2UV8 G;  3DOK A;  4I6W A;  3JSB A;  1IKV A;  4OYB A;  4M95 A;  2QIF A;  4QPT A;  5KAK A;  3OT9 A;  2W9C A;  4IO1 A;  1JJC B;  4ECY A;  2OEJ A;  3ONQ A;  1XEZ A;  1FRX A;  2XTY A;  2F1F A;  2YNG A;  4P52 A;  2XI2 A;  1VBX A;  7AT1 B;  2KZZ A;  1HWU A;  3TUI C;  4A46 A;  4GKK J;  3CCU S;  1FKA F;  2D7S A;  3MEK A;  4YQW A;  2JLG A;  1RTH B;  1EA0 A;  2E5H A;  5JJB A;  2BJD A;  3ENA A;  3M8Z A;  3T19 A;  5KOX A;  3AQP A;  2VPZ B;  3H90 A;  4Z7C A;  4YDT A;  2AMC B;  4P2S A;  4NWB A;  3DHW C;  4MKV A;  3R5B A;  1NB7 A;  2J9E A;  1TL3 B;  4WE1 B;  1S1T B;  3CCT A;  3LAM A;  3BS9 A;  1NK6 A;  4KKO A;  1VRT B;  2KYX A;  3M4X A;  4I0W A;  3TZZ A;  5DNS A;  3V81 B;  3MCO A;  3OHA A;  3WC2 A;  1LWX A;  3NBP B;  4H4K A;  4RW8 B;  2QTW A;  1JMT A;  3PO4 A;  3MM7 A;  2QA4 G;  2V8G A;  1TUG B;  1FHT A;  2IDE A;  3QZ7 A;  2R7O A;  3KLG A;  2YNI B;  1HQU B;  1M5H A;  1X5T A;  4LFC J;  3DN9 A;  4G65 A;  2I5J A;  4A8S A;  2OPP B;  3R3T A;  2OFH X;  2VIC A;  1CJU A;  2JLF A;  1ZM9 A;  3HKW A;  3CUN A;  1A9N B;  1Z4U A;  3R2C J;  3UDC A;  2FJX A;  2ZJR Q;  4UY8 T;  4DR3 F;  2NQP A;  1RTZ A;  4JI6 J;  2JEF A;  1QE1 B;  2NPI A;  3KLF B;  2DH8 A;  1REG X;  1LWE A;  1REV B;  3PIO Q;  2E5L F;  4WF9 Q;  1IKX A;  1UFL A;  4JI1 J;  1H2U X;  2ZBI A;  3IR5 B;  2CQ0 A;  1NSA A;  1P1L A;  1WG5 A;  3J7Y I;  4C0O C;  3NXZ A;  2GQ2 A;  2KRB A;  2CJX B;  3DFE A;  2NSB A;  3CCE S;  2MZR A;  2FPH X;  4R25 A;  4N56 A;  3I31 A;  1VJW A;  1WKK A;  1RT5 A;  2EFG A;  4DZD A;  1YJR A;  1TKX B;  1YTY A;  1Q5V A;  1C2P A;  1WSV A;  3ILL A;  3UDL A;  2WOM A;  5L38 A;  4WPA A;  1Z2Z A;  3H09 A;  4DU8 A;  1M5V C;  3K59 A;  3MCN A;  1VQN S;  2GIR A;  2UUA F;  3NCR A;  3CCM S;  4ZVF A;  4MR0 A;  3TJ9 A;  4UOC A;  2J9C A;  1ZPW X;  3BGL A;  2RML A;  1AXQ A;  2PII A;  4FN5 A;  3OBI A;  2HHU A;  2ZC4 A;  3EE3 A;  1IN0 A;  4DL5 A;  2HWI A;  2NR0 A;  3JSM B;  2VJJ A;  1M5S A;  2IHR 1;  3DLK A;  4LIR A;  1ZH5 A;  3H2U B;  4ZOS A;  4XOR A;  1DBD A;  2BJ3 A;  3PKM A;  1WTB A;  4NRU A;  2R7R A;  1GK8 A;  3GIJ A;  4Y0F A;  4NCG B;  4NLQ A;  1S59 A;  5GAE U;  2MKC A;  1IKW A;  4KY3 A;  1YK9 A;  2MQP A;  1WEX A;  4P74 A;  1VQ5 S;  1U49 A;  2ZDO A;  2ZIT A;  1R6V A;  3DGP B;  2J7U A;  1SJR A;  3VAF A;  1ZPV A;  3WZ0 A;  3DRP B;  2XM3 A;  4OJ3 A;  3EVO A;  4B3O A;  2LEB A;  2RUS A;  4GVB A;  5KFJ A;  5IZH A;  5C2C A;  4NRT A;  1VC0 A;  5KFW A;  1VQ7 S;  1VQ4 S;  3QRR A;  3GB0 A;  3HUL A;  4TY8 B;  4RNN A;  4YY3 J;  2UU9 F;  3QJJ A;  2GCF A;  3HSZ A;  5B7W A;  4K4T A;  2IM3 A;  1FXD A;  4C8O A;  3GG1 A;  2GHP A;  3MM5 B;  1B4S A;  4RNM A;  1UL3 A;  3PFE A;  3UO0 A;  3TI0 A;  4IDK B;  4UT4 A;  4HH0 A;  2BAN B;  2Z2Y B;  5A6W A;  2DTJ A;  1AUD A;  4IFY B;  2CPF A;  3E01 B;  4S0M A;  4FYX B;  5DM6 Q;  2FLL A;  4DR2 J;  4NML A;  1U45 A;  2KHD A;  1OSD A;  3W7B A;  5BR8 F;  3M32 A;  3BBC A;  2KXF A;  2DXF A;  1RT2 A;  5BYS A;  2K8G A;  2R9L A;  3OSN A;  3PR5 B;  2MQN A;  1KP6 A;  5EWG A;  1S1X A;  1KCC A;  4XON A;  4YN3 B;  2J76 E;  2R7U A;  1L3K A;  3EGV A;  2XZD B;  2DGU A;  5CQG A;  1JXE A;  3JB9 k;  4Q7A A;  1TYW A;  3NMA A;  1YRT A;  3QMQ A;  2M52 A;  3ISN D;  4NL5 A;  3JAM U;  2NZ4 A;  1DTQ A;  2AEM A;  2AZ1 A;  1NAQ A;  1T11 A;  1OFM A;  2EBE A;  3QLH B;  1J2V A;  2YH0 A;  1Q78 A;  3T1Y J;  3CME S;  3JSY A;  4K7Q A;  5A8W B;  2W1B A;  5A0Y B;  1WNE A;  2CPY A;  4JYA F;  4OZ5 A;  3MCM A;  4XM3 A;  4Q44 A;  1T9Y A;  2EFO A;  2L9W A;  3OR2 A;  3V6K A;  3DM2 A;  1AA1 B;  1S6P A;  4ZN1 A;  3D66 A;  1L1I A;  5B0F A;  1ROF A;  4HHH A;  3GQ8 A;  8RUC A;  5FLX U;  3DLH A;  1RAJ A;  4R8U B;  3T3F A;  3QBC A;  2GAH C;  5I3U B;  3FMW A;  4DXL A;  4J9O A;  2QLB B;  2VU5 A;  3MAQ A;  2M88 A;  2BEF A;  2LA6 A;  2IVF B;  4P75 A;  4YC5 A;  3ZC4 A;  4USI A;  3LGM A;  1N32 F;  1WI6 A;  4QIW D;  2KYZ A;  1GMW A;  5LT5 A;  4UQT A;  1RP5 A;  3D6H B;  1D9D A;  1QA3 A;  1YQH A;  5KFZ A;  2KM8 C;  1P9Y A;  1MW7 A;  1YZ7 A;  2XEX A;  3G86 A;  1NSK L;  2VBW A;  3K0J A;  1KHW A;  2DNK A;  1YJN S;  2DPJ A;  4I56 A;  3MTJ A;  4WWS A;  1FRL A;  4RWX A;  1RTI B;  3DXS X;  2XB2 D;  3KK3 B;  2PMH A;  2ZZT A;  1BC6 A;  4W8S A;  1IBC B;  2B9E A;  1QTM A;  1JLE A;  1SC1 B;  4QOT A;  4ITS A;  2PE8 A;  3FBB A;  1C0T B;  3DLG B;  4ED4 A;  2FHJ D;  4ZP9 A;  2W7P A;  2ZNY A;  4XR6 A;  4ZLN A;  3FEY B;  1FRH A;  4KE5 A;  4HKQ A;  1WF1 A;  4O23 A;  2ZJQ Q;  3RB0 A;  2WBR A;  4LMZ A;  3EZU A;  1OY8 A;  3WX8 A;  1VLY A;  3L09 A;  4ZJQ A;  1UET A;  4M5H A;  3MR5 A;  2H48 B;  3T1H F;  4QIG A;  4TVA B;  3QSY B;  5M2R A;  1SPB P;  4ZVE A;  4IRD A;  1RQ0 A;  1XNQ F;  2CA9 A;  1PBU A;  2ABY A;  3CJ4 A;  2J8K A;  2KT3 A;  2ZFH A;  1BUX A;  1QRC A;  2X51 A;  4B9M A;  3TQE A;  4RW9 B;  3ADA C;  5C1E A;  5KT3 A;  4KYZ A;  2XMM A;  3GJR B;  4RX6 A;  4CLP A;  1TYV A;  5DDP C;  4USM A;  3C2P A;  2YXL A;  4X62 F;  2GGP B;  2XG8 A;  3B82 A;  1RAD B;  3O3L A;  4EU0 A;  2BM6 A;  2CVI A;  2QE5 A;  2YKN B;  1URN A;  2ZOF A;  2FJA B;  5DDR C;  3LGH A;  5JVH Q;  2XMK A;  3AOA A;  5B0C A;  4CLU A;  4N8O A;  5T41 A;  1UVI A;  1K1Q A;  5HJX A;  3NGK A;  1N5S A;  4I6Y A;  5CH7 B;  2L9D A;  3CJS A;  3PY8 A;  1U2C A;  3W1Y C;  1T9U A;  4L6V 3;  4FS1 A;  2V0N A;  3D0I E;  2JLE A;  3WDO A;  4DUT A;  2GML A;  4ANC A;  2RRA A;  4M5D B;  2IM1 A;  1ICE B;  2EK1 A;  2Y3Y A;  1UEU A;  5C5J A;  1AIR A;  1HF2 A;  2C22 A;  5E2Q A;  4NYP A;  2LU2 A;  4NLY A;  1O8J A;  1LLZ A;  4WK3 A;  1B7Y B;  1U1P A;  4U67 Q;  4ANE A;  2WHO A;  3N28 A;  2RS8 A;  1SJF A;  1HHT P;  1YKW A;  3SBM A;  4FXD A;  3HHN B;  3ZXW A;  2VC1 A;  2QSW A;  4CTA A;  1Q53 A;  2XMW A;  3HFZ B;  2IRY A;  3ZNU A;  1K9M T;  4HI1 A;  4IUF A;  3PW7 A;  5KTQ A;  2E7V A;  4L75 A;  1OPZ A;  2OGU A;  3SCL E;  2WW8 A;  3RR8 A;  1YLX A;  3M8Q B;  5C24 B;  3PW2 A;  4DR1 F;  1MNE A;  3F0N A;  4X4S A;  2V8H A;  4ZIV A; 
#chains in the Genus database with same CATH homology
 3SZE A;  3FC9 A;  4EK2 A;  1NSQ A;  1HIY A;  1NLK L;  3SYJ A;  1NHK L;  3ZTS A;  4F36 A;  3BBC A;  1QA2 A;  2DXF A;  3ML3 A;  4V02 C;  3FCV A;  3BH6 B;  3EVW A;  3WX8 A;  3NGU A;  3L7U A;  4DUT A;  1NUE A;  3BBF A;  3ENA A;  3Q8V A;  1S59 A;  4OJO A;  2VFP A;  4JRA C;  2B0R A;  3ZTQ A;  4ANC A;  4OJP A;  3EMT A;  3Q83 A;  1S57 A;  4OPW A;  1DAB A;  1JXV A;  1TYU A;  1WKL A;  1QA3 A;  4UOF A;  3MPD A;  1UCN A;  4FKX A;  2HUR A;  5CAB A;  2J8I A;  2HVE A;  1BHN A;  3P4G A;  3ETM A;  1TYW A;  1WXR A;  1NDK A;  2AZ3 A;  1NCL A;  2DXE A;  3FKB A;  1W7W A;  1F6T A;  2W7Z A;  1HF2 A;  1NDL A;  4KPC A;  2VFQ A;  3DKD A;  5JLV C;  4HR2 A;  1BE4 A;  1NSK L;  5C7P A;  3EVO A;  3PRV A;  1HHQ A;  3FBC A;  2BM7 A;  2G0Y A;  5IOL A;  3LYC A;  3ZTP A;  1KDN A;  3Q8U A;  2BM5 A;  1WKK A;  2AZ1 A;  2YUH A;  1NDP A;  2DXD A;  3VGS A;  2B8Q A;  1XIQ A;  4O0N A;  3LJY A;  2ZUA A;  3EIC A;  3VVT A;  1BUX A;  5BXI A;  1QRC A;  1TYX A;  1MN7 A;  3ELH A;  4W98 A;  3VGU A;  4F4A A;  4OJ6 A;  1B99 A;  1LWX A;  2DY9 A;  3TH0 A;  1NDC A;  4ANE A;  3VVU A;  3VGV A;  4OJL A;  2CWK A;  1QQ1 A;  1K4Z A;  4UOG A;  2XC1 A;  1WKJ A;  5JMC B;  3AK5 A;  3ZTR A;  4CP5 A;  1TYV A;  3B54 A;  1QRB A;  3H09 A;  1U8W A;  1HLW A;  1S5Z A;  1LEO A;  4FKY A;  4AND A;  2DYA A;  4WBF A;  1VYA A;  3EVM A;  3Q8Y A;  1NB2 A;  3DDI A;  3JX8 A;  3Q89 A;  2V5I A;  1NSP A;  3FCW A;  4DZ6 A;  2BX6 A;  3N6Z A;  4UOH A;  2BM6 A;  3PJ9 A;  3Q86 A;  3VGT A;  2NCK L;  4OJ5 A;  3B6B A;  3NGS A;  4C6A A;  1B4S A;  2VFO A;  1K8F A;  3GP9 A;  1F3F A;  3NGR A;  3NGT A;  1XQI A;  3FBB A;  3RIQ A;  1K44 A;  2B8P A;  1CLW A;  1KQ5 A;  3BH7 B;  3PET A;  3JS9 A;  1EHW A;  1PAE X;  3GPA A;  2F3L A;  1ZS6 A;  3N90 A;  2VU5 A;  3BBB A;  2HVD A;  3EE3 A;  3EJM A;  4DI6 A;  3FBE A;  2BEF A;  3R9L A;  2IOU G;  2BM4 A;  5CAA A;  4KH3 A;  4OM9 A;  3G2X A;  4S0M A;  1TSP A;  2VFN A;  3FBF A;  1PKU A;  2VFM A;  4ENO A;  1NPK A;  3EM1 A;  1MN9 A;  3ZTO A;  1QA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...