3BH6B

Crystal structure of the rp2-arl3 complex bound to gppnhp
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
314
structure length
314
Chain Sequence
PKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords ADP-ribosylation factor-like protein 3
total genus 105
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2007-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07986 TBCC Tubulin binding cofactor C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3bh6B01
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3bh6B02
3BH6B 3BBFA 2HURA 4UOFA 3FKBA 2HVDA 1NCLA 3VGUA 3EM1A 1K44A 1PAEX 3R9LA 1KQ5A 3FCWA 4DUTA 1PKUA 4ANCA 3Q83A 1S59A 2DY9A 2B0RA 2BX6A 1NDPA 3B54A 2ZUAA 3BBBA 3ZTPA 3ELHA 3FBCA 1U8WA 2DYAA 5C7PA 3FCVA 1HHQA 4S0MA 2B8QA 1S5ZA 3Q8YA 1HF2A 2DXFA 3VVUA 5BXIA 1ZS6A 4DZ6A 1BE4A 4EK2A 4V02C 3BH7B 1JXVA 1KDNA 3Q8VA 3NGUA 1HIYA 3VVTA 1NDCA 4F4AA 3DKDA 1XQIA 3L7UA 2YUHA 3BBCA 1NHKL 1K8FA 1NDLA 1B99A 1W7WA 1NSPA 3G2XA 4CP5A 3FBEA 4UOGA 3VGSA 3EMTA 5CABA 1BUXA 1VYAA 2HVEA 3ETMA 3PRVA 4FKXA 4F36A 2CWKA 4ANEA 3EICA 3JS9A 2B8PA 3GP9A 4WBFA 4C6AA 3VGVA 3ZTRA 1NSQA 2BEFA 2DXDA 1EHWA 5CAAA 3EVOA 3ZTQA 1F3FA 1UCNA 4UOHA 1B4SA 3ZTSA 2NCKL 1F6TA 3EE3A 1XIQA 1K4ZA 1BHNA 1S57A 3NGSA 3B6BA 3PJ9A 3EJMA 4KPCA 1LWXA 2DXEA 3ENAA 4W98A 2VU5A 1WKJA 4ANDA 4ENOA 3Q89A 4FKYA 1NSKL 3DDIA 1WKKA 3FBBA 1NUEA 3EVWA 3Q8UA 2AZ3A 1MN7A 3FBFA 1LEOA 3VGTA 3MPDA 4O0NA 1MN9A 3ZTOA 1NB2A 1WKLA 3GPAA 3EVMA 1NPKA 3NGRA 3Q86A 3FC9A 3WX8A 5IOLA 4HR2A 1NDKA 1NLKL 1HLWA 3NGTA 2AZ1A 4DI6A
chains in the Genus database with same CATH superfamily
3ZZYA 3RGIA 4OZJA 2IBKA 1PC5A 1TKXB 1HQUB 2B5JB 3OSPA 3GQ9A 1DTQB 5CYMA 2F4VF 1MMNA 2CQ2A 1CZFA 2FGOA 1OJ4A 2KT5A 4PG4A 4O3QA 2BUNA 3M30A 1TKTB 3ZNUA 1SJQA 2YWHA 5D4NA 3W5ZA 5LJ5Y 2OFGX 1F0XA 3BREA 1WC6A 4RW7A 1N5SA 4JI5F 1EA0A 4WKRA 1WC3A 1F2HA 4NLSA 5KG5A 3KK2B 2RRNA 2YVSA 4UQGA 4ES1A 4OZYA 3V6HA 3MUTP 2VONA 3MR3A 3N6MA 3RR7A 3H09A 1GQ8A 1IJFB 1V5IB 2CQCA 4I84A 4YR0A 1PLUA 1S9GA 2PMHA 3MD3A 5CZVA 4ECQA 4OI6A 1FA0A 2ACMA 1MG7A 3MECA 1ROFA 1ZM3A 4ED7A 4G1QB 2HHHJ 3U02A 1WTFA 1IM6A 3VSVA 1QJHA 3N28A 1S12A 2MZ1A 3CW2C 4C48A 3D6FB 3LP0B 1N6QA 4O3PA 2F4VJ 4LF2A 3S7RA 3MM6B 1S1XA 1T95A 2PSZA 2ZNYA 4QPXA 1M1GA 4LIRA 4J9LA 3TQ1A 3I5BA 3SBMA 2LA4A 3RW6A 1K1QA 3OXFA 2UUCF 1OWXA 1VCTA 3EDQB 2O1PA 4NLXA 3HHNB 2ZZMA 3HHEA 1A7GE 2HZCA 3JQJA 3GSDA 2C2RA 4FF1A 2BM5A 1L3UA 1DZ5A 5KFTA 1AROP 2I1RA 4R0JA 1JLCA 3BQ2A 1RWMB 2AMCB 3VQTA 1GMVA 3DHXA 5F9NA 1YIJS 1U6BA 5KFGA 1LWCA 1MROA 3PW5A 4RUBA 1HD0A 5ETPA 2RT3A 3K0JA 2VG6A 3M1VA 1RKIA 2IJRA 3BPSP 1BUXA 3M32A 2HS4A 2AGOA 3MEGA 1SJFA 1U8SA 1GMWD 3BZQA 4A8WA 1C2PA 2XHWA 1LWEB 1FXDA 1UVJA 2IVYA 2HFSA 2ILZA 4NLDA 1I6JA 2XMKA 2MY8A 5L9NA 5L1LA 2VKZG 4PRFA 3GZ7A 1VJWA 1FK9B 2CZVC 5ETQA 4CTAB 2M8DB 3L95X 1HR0J 1S6UA 2MKJA 4WXWA 3KJQB 4G3IA 1FJCA 3W65A 1F9FA 3UN3A 2IHR1 1S0OA 2DHXA 3JSYA 1WHWA 4V1Ak 5JVGQ 1U6FA 1SL0A 5LSLA 4DR6J 3A12A 5DNSA 1QA1A 2J8SA 3P4UB 2EKYA 2V2VA 2IPOB 3L9ZA 5GAGU 3TUZC 2XNQA 1P8GA 2GO9A 4ID5A 2VBWA 4OJGA 2VBMA 2XS2A 2B56A 1U47A 3V6JA 4KT0C 2GHWA 1IKYB 2HZAA 1S1UA 4CZCA 1IBLJ 3T3FA 3PRDA 1PYSB 4CIOA 1WOPA 1DTTB 2P2CB 2FZKB 5J1EA 3KJVB 4DG1A 1HYSB 1ZTTA 1NK8A 1XEZA 1IBKJ 2V8GA 3QIDA 1EQ0A 5I42B 1FFWB 3BQ0A 3DMJA 1KCCA 2C3PA 2MZJA 3KKFA 4EGLA 1GX5A 5DG9A 5HQMA 1U45A 3EZ5A 2P9GA 3OV7A 4WFZA 1QSLA 1K0TA 2GJFA 4LRAA 3PIPQ 1LQ9A 3VV2B 2EK6A 4JI3F 3IG1A 4EUVA 4DLEA 2DIVA 1PCAA 2CPYA 5KG1A 1HD1A 1QRCA 1XERA 2D3UA 3MAAB 5DRKA 3GPAA 4RNNA 2LCWA 3NGRA 4N7TA 1TZ0A 3N79A 3HX9A 3TUIC 1KBRA 3IM8A 3UN5A 2XY5A 5D3GB 1PXZA 4LSNB 3FRZA 2XY6A 2M5YA 2OTLS 2QA1A 2NSCA 2UVEA 1JLEA 1VS3A 2ZITA 2Z56B 1V3RA 3D2WA 2V2KA 4QW8A 1U1MA 2NTPA 4B3TJ 4O4RA 3KLHB 2XTWA 2O6WA 4C8OA 4FXVA 2DNHA 3M8QA 1UEVA 3M2VB 4UOFA 3UO0A 3H4BA 4J9KA 5G0RB 3OPKA 2ZH4A 2B9WA 2J6SA 5GAHI 2Q66A 2DR7A 1ZA2B 1Z4UA 3MMJA 3VAMA 1RTHA 1TL1A 2IA0A 2W9CB 5ETVA 3BGUA 4C8MA 2XS5A 4ECXA 3CPWR 2YTCA 2DR8A 2YPYA 4XLHA 5B09A 4JYAF 1FRXA 2XO6A 1C1BB 1MNEA 4BCAA 4WF9Q 4XN3A 3I0SA 3Q83A 2BM0A 4ILLA 4C3KA 4B9SA 3CD6S 4MK7A 3CMES 4G1IA 2NXNA 1HBUB 3ICLA 3C8YA 5FJ4A 2V0NA 2X1AA 3H8YA 4ECRA 2VH7A 4I64A 2VC0A 1U1QA 3D3CJ 3JAMU 1S77D 5E3QA 5DJBA 1JX4A 1TL1B 5BJRA 3TH0A 1Q79A 2CQ3A 1XMQJ 3VVUA 1EP4A 1O8KA 2NYIA 4NZ0A 4ZPWR 4ETZA 1S4FA 3M9MB 3K5LA 5J2MA 2PEHA 3EWGA 1Y11A 4YZAA 3DRXA 3OUYA 3KLGB 4ZDNA 5DETA 4F4XA 1HNIA 2HK3A 2KB2A 1S76D 3M2RB 3C15B 3ZZTA 3PX4A 4DR2F 1T7PA 5J2NA 4K2JA 3CEDA 3F41A 2DNLA 4GO5X 3NY0A 3IS9B 2B9XA 2XTYA 4I2PB 4HTJA 3TVKA 2DPIA 1JB0C 1TL7A 1EARA 1PJ6A 4BWMA 4B02A 4O44B 2VBKA 2XM3A 4ZVHA 5A2QY 1HI0P 2OP5A 3MD1A 2XYHB 2CPXA 5EX3A 1RE1B 1W7WA 4WYLA 4HH0A 1AUSL 1HQEB 1O8BA 2JJ4D 1IN0A 2H54B 3FBEA 3PJXA 4USJC 2W9AA 4OLPA 5A2QU 4TYBA 1QTNB 1YQHA 1VYAA 2DNOA 1HQUA 2GGPA 2KKHA 5F8HA 4J9NA 1IKXB 3EX7B 1XMQF 4Z06A 2J76E 2W4CA 3ETMA 2MQQA 1QVGR 3M32B 1YRTA 4ZOSA 3VAFA 2V50A 5IZHA 1T9WA 3HT0A 3TZXA 3TP2A 3CJKA 4EMDA 1O8JA 3MFIA 1AFJA 2GS8A 4Q2LA 4C6AA 2XTXA 2J9DE 1SH3A 1HWIA 3LPYA 3J7Z5 3KLEB 5KG6A 4YS2A 4DV5J 4MIAA 2R7XA 4LRCA 1S10A 1JLAB 3K5NA 7AT1B 4AQYJ 3BR8A 4NOHA 3AQPA 4IFVA 4RJVA 4I6AA 3RBZA 1UCNA 2KHDA 3ENVA 5LSOA 2Y1JA 2JWNA 3PZPA 4KFBB 4YFUA 1REVA 2MKYA 2VPWB 2LVWA 1FWPA 3DLGB 4RO0A 3D66A 1BHNA 2PGCA 3MTJA 4XORA 3NCPA 4CLUA 3QT7A 3DYAA 1RA6A 1GTEA 2E1AA 3EJMA 1LWXA 3SQGB 3VTIA 2JHEA 5CCMA 2L41A 1VQ4S 4Q0BA 3N9UC 4DUYF 4DV0J 3RBEA 2R8JA 2HS0A 3C19A 2E7WA 3K8WA 3ZZ0A 2J5AA 2X6WA 2HNDA 2XBPA 3SCLE 3T1YF 4KHPF 3CJRA 4F0MA 2OAUA 4Q43A 4ECWA 1I94F 2HHPA 1BY9A 3ET6A 4RBUA 3KK1B 2WRMA 4D3HA 5L1KA 1QDUB 4Z05A 4LRDA 2DHSA 2CG4A 1WHYA 2N7YA 1SL2A 4C8KA 1J5EJ 1SC1B 3C14A 1LWCB 1MROB 2ZZTA 3HVWA 5J2PB 2R2TA 1WHVA 2CQGA 3POTA 4NEZA 5LXYA 1BMQB 2W7PA 5T7LA 1Q1KA 4ZP8A 1FDAA 2PI4A 5KFBA 4E2FB 2W9CA 3W2VA 4B3MF 5KFYA 1RBOB 2BW7A 2G0YA 4MR0A 1UEKA 2DGSA 2WONA 3AD9C 4R8UB 2YH1A 4M8LA 3GIRA 3NRBA 2V8PA 3AJ1A 3M8QB 2XSFA 1DTQA 5KFXA 2WVBA 2X1FA 2R4FA 1GXTA 2FGCA 2G0CA 2DRBA 1H2UX 3HMJG 2IM3A 5A8KA 2ALZA 1IA5A 3FMBA 2B7BB 5K8MA 1K44A 5DLFA 4Q7AA 3V6DA 4DL4A 2OMOA 4OI0A 1TUGB 5D3GA 4JI4F 2KJWA 4USMA 1PKUA 2FLOA 1C1CA 4HEA9 3H90A 4NI2B 5DZ7A 2RNEA 4PPZA 1RTJA 4RNMA 2JFDA 1S0VA 2D9OA 4ICLA 2OD6A 2W01A 4QIWD 3OR1B 3DLGA 3R5AA 1W2IA 2M52A 3MMAB 4RLEA 4UF4A 2FY8A 1RYSA 1C1BA 2MXYA 4W8SA 3OTOJ 2CQPA 3O2IA 3V4IA 2BJ7A 3I0RA 2CAJA 4NEYA 4P74A 4ZPAA 1C0TA 3M05A 1QCXA 1Z2LA 2YWWA 4U67Q 3G86A 4YP3A 1FRLA 4WFAQ 1R8PA 2ADCA 3CC7S 1Q78A 3J7AN 2F8EX 2V63A 3KJNB 4CNYA 3WIUA 1NH8A 4U7UD 3LH2S 5HMZA 3TZYA 2OPRB 3R1HA 5CYJA 2J6UA 4PWDB 1KDNA 1TYUA 2YXLA 4P2SA 4DSFA 1DARA 2K1RB 4J5OA 3BGFA 1KEKA 4NLGA 1VBLA 1IBLF 2GGPB 1VQPS 1KFSA 1KD1T 2FVPA 2BW2A 1O8EA 3T19A 4IO9Q 1MU2A 3OFEA 4U96A 1NBEB 3HHDA 2MYFA 2NYHA 4FYVB 3QT5A 4KH0B 3EGWB 5DGBA 4Y0FA 4BHQA 4QBUA 5DM7Q 1VC6A 1K9MT 3VMVA 2ERRA 2OLWA 3GU0A 5EWEA 4DSJA 4PPDA 2Z2LA 3BBCA 5I3UA 1K8FA 5IT0A 4TNOA 2WHOA 3RUBL 4OI2A 3AJ2A 4XL9A 3I96A 2W7OA 1HW8A 2PO4A 1JNRB 1XTZA 2ZJQQ 5I3UB 3F44A 1LWEA 1LKZA 4DR7F 3TA2A 2ZE2A 2XMUA 5ETSA 2W7ZA 3ETOA 2NSBA 3OHAA 2IBOA 1HW9A 1NMEB 3DOLB 4MYTA 3LAMA 4EWTA 2PD1A 3NGDA 5D78A 4HI1A 4YMEA 2BV3A 5ETMA 3RB0A 1Y9OA 4ZVOB 2MTLA 2VBZA 5KT6A 2BEFA 3RYLA 2G1HA 1JLBA 1RAAB 4J9UE 4TXSA 2VA2A 1U2RA 1VDHA 2XSJA 3LPEA 3MM9B 3MTKA 3QZ8A 3HKWA 4EI2A 1P1LA 2JNJA 3MMAA 1RU4A 4L74A 4M94A 2MJNA 1HNVA 4UUWA 4DV3J 3FEXB 2PYGA 2IJNA 1VQOS 3M6VA 3V6KA 2CPFA 3BSCA 2DGXA 4W98A 4ANDA 5C25B 2V4JA 2PYHA 1SC3B 3NBPB 4LBIA 5DZ6A 5MAOA 1R89A 1VC5A 4NCBA 2E1CA 3C46A 1KQFB 3A1YG 2F3JA 2E5JA 3SI8A 3MURP 3BSNA 1DJ0A 4NCGA 3DCAA 3IAS9 1HA1A 4YEJA 1MW7A 3SEOA 4ZLNA 2R7UA 2IIHA 1YJ9S 2QYGA 2DEIA 4DUZJ 4PCQA 3TZZA 4PMHA 1FEEA 4MKBA 3AOAA 3OTOF 2UUBF 1O5JA 1UVLA 4X4NA 2CQBA 1WOOA 2RJZA 1N5TA 1UTAA 4LBPA 3Q22A 3PETA 1L5UA 2E66A 4DV6J 1CJVA 3GV7B 4QIVA 3T9ZA 5D77A 3W2VB 2NS1B 4LSNA 4J9PA 3EVMA 1FKPB 4LVOP 5HP1B 2OPQA 4DQIA 2VJIA 5IT9U 4K5RA 2ZOFA 4M5DA 4DX6A 2OTJS 5D15A 3R7SB 1N0UA 5E3PA 4JI8J 1TMJA 1NLKL 5K5MA 1O8DA 3NEKA 3J7A1 2DO0A 4KPYA 2IA6A 1NZ8A 4DQSA 4ZIWA 1M5PC 2BE2B 4F3QA 3SQOP 1T3NA 2UV8G 1EKSA 2OPPA 3G87A 1S99A 4KKOB 4U7CA 1NM2A 2OMLA 3DI6B 5F3TA 3FEZA 3SV3A 3U1MA 4CM0A 4IG0A 3EQOA 1CJTA 2ZD1B 4ED2A 2YKMA 1TK5A 4LSLB 3C2PA 1QLNA 3KOAA 1FXLA 3RR8A 1KC8T 1CS4A 2Z2YB 3WBZA 2GVZB 3CJ0A 4DWIA 1VFJA 4H4KA 2ZUAA 2LDYA 4QPTA 3SSSA 1Q53A 1VR6A 1NZAA 1S1TA 1U0SA 3CCWA 2F3LA 4RBVA 4XN0A 1JLQB 1HI1A 2BM1A 2YX7A 4OZ1A 1LW0A 1HHQA 4PUOA 4QR0A 1ZAVA 2JLGA 1FJGF 2XWXA 2CFXA 4BC9A 5C24A 3MM5B 2BABA 3O8WA 4KJIA 2ZD1A 4DX8H 1KOHA 2VASA 5RUBA 2ZJRQ 2N4DA 3DGVA 2B5JA 1QAYA 5ETOA 2PC6A 4AD6A 3DLLQ 4XKVA 1TFYA 2KYZA 2KXHA 2QFIA 2HYIB 2CYYA 4USUA 1JXLA 3CCJS 4Y6IA 4Y2IA 1HIYA 4ZLJA 2XCAA 1OFMA 3AHPA 3RBXA 1CPZA 2QIFA 4K4SA 2DGVA 3GCXP 4DDFA 1UVNA 3LA0A 2J0WA 3MGJA 2Z8QA 1NHUA 2I8EA 3MEEB 1YJVA 2KDOA 4NE9C 2YNGB 4OYMA 4TVAB 3ISND 4Q2MA 1WF2A 5E2QA 4JUZA 3UR3C 5HVGA 3OJSA 2YQ3A 4ECVA 2FY1A 4M1KA 3HSZA 3KUEA 3ZZOA 3EMTA 4QZVB 3LWMA 3F73A 2J0QD 1L3KA 2ZHBA 2NT9A 5C5JA 4LF5F 4ELUA 2E5HA 1NK0A 2CPHA 4X4PA 3AOCA 4OMFG 3Q8SB 2BA9A 4FDFA 3GR1A 1D9AA 4TYAA 4OPWA 5KFEA 3KLEA 3JSMA 3BJYA 2AEFA 4KKOA 2NXEA 2DR5A 4B3SJ 1RLDA 2C3UA 3AB2B 4USWA 3VGVA 4DPYA 3NCQA 3A3OB 2HHHF 1U25A 4KYZA 4V19J 2U2FA 4DFPA 5DQIA 1T9TA 4ZIVA 1FDDA 2DJWA 3UDVA 3V4MA 3PW7A 1KQKA 2HSEB 3MECB 4YB5A 1CVJA 3EVOA 3MMCA 4RNOA 2WCXA 4OYOA 3KLFA 1B4SA 1XK8A 2V5IA 3QLHA 1RHQB 2VIHA 1DBOA 3NGSA 4ZKAA 3QGIA 3SFGA 4P7TA 4USVA 2G2OA 2YH0A 5KFNA 1SJ3P 2KZMA 3MR5A 2YKNB 3FCHA 4Y34A 4OYBA 4XKWA 5HP1A 3Q89A 2VODA 3U1NA 2V8VA 2GVDB 3AA8A 1X4EA 1RAHB 5C2GA 4WZMA 2GQQA 1XMBA 3FJ2A 2AYEA 3PV8A 8AT1B 3EGZA 4YZ0A 1AXQA 2EBGA 4L3NA 4B3TF 1CJTB 4R5PB 1WC4A 2FC9A 3HVRA 2DKOB 4OYWA 1EJ7L 4EO8A 4TLRA 4P52A 2UXCJ 4C8ZA 4XO0A 2FPHX 4NXNJ 3GIJA 3PHTA 3E8OA 2J9DA 2E5GA 2DNQA 2HGNA 2BQUA 1AIRA 1X5OA 3Q86A 4W4MA 3DDNA 2DPJA 1IXKA 1T02A 2GC8A 5IQQA 2OSRA 1LV5A 2WSEC 3JYTA 4EZ9A 3J81j 1B70B 1RZMA 2RHQB 4N56A 2W2OP 3PJWA 4HH1A 1TAQA 1Q81T 3DLEA 2E7VA 1KN6A 1TYXA 1T8EA 2HIYA 2K7JA 5LSRA 5F41A 4YELA 1NNDA 1RLCL 1YJTA 1OFLA 1CJVB 3UQSA 2BM4A 2P8IA 3AXKA 2B43A 2QLXA 2ZC3A 4QR1A 1O8LA 3D68A 4TU8A 3KHHA 5G0RA 3WZ0A 1VQ5S 3R5DA 3GMGA 4NYOA 1TKZB 1S1UB 3LF0A 2X85A 5I3QA 2CPIA 4EFAC 1Q7YT 4LFBF 3KK3A 3K17A 3LP1A 5DGAA 4GKJJ 2LQBA 4F0HA 5DLGA 4KSEB 3B54A 4A8QA 3ELHA 2JEIA 1QVFR 2OEMA 2BANB 1EZGA 2QMXA 4KR0B 1FXRA 2AT1B 4XNFA 5DO2A 3CJ5A 4OYPA 4J9MA 1HR0F 4DX5A 1UPPA 2QA4G 2C3OA 3H5YA 4ED8A 3MAHA 3R7BB 4NZ7A 3B82A 4ZN1A 5BXIA 1M5OC 4KO0B 1SL1A 1IDJA 1AFIA 2UVFA 1HARA 2VDIA 1S6OA 3AT1B 3HFKA 1RT2A 3T9NA 4V02C 1RWPB 4J37A 4DHVA 1Q5YA 2FVQA 1J27A 5EHHA 1YBAA 3VAIA 2V9WA 1AB8A 4MAKA 2VBYA 3CWJA 3EUNA 5DDQC 3LW5C 4PAAA 4GC7A 5KG0A 5KFJA 2AWZA 2WK4A 5IWAF 2ZH9A 3DOKB 4DR3J 1PYTA 1WG4A 1MWQA 2ZBQA 2ZBPA 3UW0A 3G8QA 2PIIA 5KFZA 1KOOA 5KFOA 4QWAA 1RHUB 2AEJA 3PACA 3K5MA 4X66J 1XC9A 4FBUA 1I5OB 1YBUA 4UOCA 3VZIA 2W8KA 2B0GA 3OVBA 2OJ3A 1DBGA 1IBCB 4ILRA 4JV5J 3PDNA 3QGHA 3W2WB 1HNWJ 2VBXA 4JI3J 3CB4A 2HVEA 3ZZRA 3TVZA 1IUJA 4FYYB 2WBMA 2CWKA 2PMZD 5KFLA 3H0PA 2IVFB 2XT2A 4DUYJ 4PG7A 1T9UA 4C97A 2DHHA 4RW8A 1UA0A 1FEHA 1H2VZ 3CCZA 5F9LA 3OVSA 2E9TA 7FD1A 2HAIA 2VG5A 2HAFA 3R6LB 4ZP9A 1G3OA 2VPXB 2OO4A 3R97A 1SB6A 1DABA 2IMOA 2UUAF 2IM0A 3UDEA 3CD5A 1RJJA 4Z37A 3W7BA 1RWKB 2QX3A 1BXNA 1ZM2A 2QT7A 1Y00A 4ZPTR 1H98A 1IR1A 3ISZA 1A6LA 1RT1A 2R8HA 2OKQA 1X9MA 2VFRA 4R5PA 3GR0A 1S57A 4OX7A 2FHMA 3OHBA 2Q43A 4CLZA 4L76A 3VSTA 2ZJPQ 1GNKA 1U2FA 1V5VA 2C2MB 2KXNB 3M8PB 1FWKA 2C3MA 2P9CA 1FO1A 4OYXA 4DQQA 1BN8A 2B4OA 2GNKA 2W2NP 3OL6A 3LWLA 1VQ6S 3Q8UA 3OJUA 2PECA 3GIIA 2V6AA 1LNQA 1YJNS 1TKXA 2W25A 3GYGA 1LK7A 3ILJA 4JOUA 1X60A 3VR1A 1N0VC 3VCDA 1VBKA 3AK5A 5A6WA 2W4DA 3MF5A 4RUAA 3QLHB 2HVIA 2GHPA 1VK3A 5I3PA 3SYZA 1VQKS 2GV1A 2XMVA 4NLYA 6AT1B 2ZEJA 5GADI 2FLNA 2MKCA 3DXSX 3T5JA 4O3SA 1VMBA 1Y10A 2BYCA 3CJ3A 3KHRA 1C4AA 3AODA 4ZCLA 2UUBJ 4HWVA 2DB1A 3CULA 5D4LA 5IOLA 4WE1B 2VFPA 3I9ZA 3R3TA 3CJ4A 1VQYA 3MR6A 3T1AA 3Q2TC 1RTIA 3CC4S 3H98A 3RAMA 3FQKA 3SQGA 2HVHA 3DFEA 3NLCA 1S1TB 3A13A 3ITHB 2I0XA 2J8IA 4HACB 5ITHA 1OPZA 2KXFA 4GVLA 4DSEA 2R7SA 1S9EA 3OVAA 4MK8A 2VUGA 4NLWA 3QAUA 4PABA 4CRJA 1R8AA 2MSTA 2G0IA 3GJSB 5KFAA 4C0OC 3UI3A 1AUDA 1LOUA 4URQU 5HROB 2YKMB 4Y65A 3UCZP 2H5EA 5HJXA 3MI7X 1GFWB 4DUTA 2O01C 2H4WB 3OLBA 3IM9A 1XN9A 5J2MB 2DISA 4O3OA 2HWTA 2NSTA 3AA9A 1RHRB 3N5FA 4URGA 1HBMA 4C11B 1W25A 2X1BA 3CCQS 3BBBA 1HQEA 2AF6A 2L3MA 1RACB 3HHLC 4KV8A 1TQLA 4CLPA 3K5PA 3J7ZT 3HXMA 1N32F 1ZAWA 1RT3B 2WW8A 1F9EB 1KP6A 3QBCA 4QIGA 2XLJA 2D3OR 4A8FA 1S5ZA 3LO3A 4JI2J 4QYZK 3KG0A 3CJ2A 5F0UA 2RMLA 3DHWC 3RIQA 2G13A 4ATNA 1UMJA 1JLGB 3JURA 2VB6A 3CDEA 3IBCB 4CM2A 1CQNA 4CI0B 2DO4A 1AZSA 2HRTA 2QXZA 2Y0SD 3BGRB 4OL8A 1TSPA 4I2PA 4LJMA 3Q8VA 1NKBA 3KK3B 2CUYA 3NP5A 3GTYX 2DK2A 4RW9B 1H6KX 5DS7A 4MH8A 3BO4A 1Y0HA 4PG5A 4LF4F 2D74B 1TVRB 2LYVA 2QLFB 2AJ4A 2Y0BB 3E01A 4BBYA 4WTOB 4ED3A 2UXCF 5BYSA 4K0KF 5B7WA 2IC3A 5HBMA 3J7YU 4WU3A 1VK8A 1K0VA 2UXBJ 1NSPA 1RWUA 5KG4A 1N52B 3MOZA 2PMWA 3GFHA 2MKIA 3C66A 3Q8QB 4OYZA 4PG6A 5CABA 2I5JA 1I94J 2XB2D 1ZPVA 1SC6A 4FZVA 4IH6A 3ZPPA 2KRBA 4JI2F 4FF2A 4IYQA 2QO3A 3PG9A 3TANA 5LL6d 1U1PA 2CVIA 3QWUA 1YDLA 5KAKA 3MAQA 2VQFJ 4DLGA 1T05A 2VA3A 3UVJB 3HO1A 5IT4A 4YHHF 3P4GA 1IBMJ 3OTDA 2FZCB 4LR9A 3P5BP 4ZMMA 1UKUA 2UU9J 3D54A 3DLHA 2MLXA 2ZH3A 1YLXA 3US5A 5H9FJ 2X6YA 3WDOA 3ZTQA 2M70A 4WTYA 4YEAA 2MZSA 4MFBB 5HK4A 1K4ZA 1FX4A 1WSRA 3BKTA 3GG1A 1QAIA 4NLPA 2CPJA 2N4CA 4ZHRA 4LF4J 1E6YB 4DR1J 4ENOA 3ZXWA 4DF8A 2GAGC 1RGVA 2DCUB 4GVBB 1JJCB 4M5JA 3RRGA 1U7LA 2YX1A 4J91A 3LAKA 2UUWA 3WQPA 2N7CA 2KM8C 2R9LA 3FVYA 2GJIA 1RUSA 2A10A 2CKWA 3N4WA 1TR0A 2GQCA 4YR2A 1RCOB 4NA2A 2YKAA 2O0VA 4Y28C 4ZK7M 4OJPA 2LQ9A 4C9DA 3RU0A 2RD5C 3VGTA 2JSXA 3M8ZA 3MAAA 3W64A 2KZZA 1KVIA 3CJ8A 3EZOA 5H9FK 1LW2B 3NMRA 4Z7YA 2CQDA 3DRPB 5HJYA 5LMUJ 4ED0A 1PE9A 5H9EK 2FTRA 1Q8LA 2ZWOA 2HNYA 1S72S 2BRKA 1SC4B 2HQDA 2YNHA 1SKRA 4YCQA 2YKPA 5BR8F 2JOQA 5F8JA 1BC6A 4KQZA 1TV6B 4B17A 2NZ4A 1EETA 2E1RA 1F3VA 2M88A 2C42A 5HANA 2ZM6F 2YNFA 3ILLA 2YWEA 2WVDA 2AQ4A 2ZOMA 1YWXA 3VMWA 2PI5A 3E3XA 4CO5A 3BSOA 4U49A 2DGTA 4F50A 1URNA 1AW0A 1H72C 4HHJA 3I55S 2JZ5A 3BPDA 3SYJA 3I87A 3K59A 4PQAA 4JI7F 1MLAA 2L9WA 3T5HA 2EW9A 4NCAA 1S1XB 4W8QA 1VRUB 1R7IA 4ECZA 2LXUA 2HWHA 1RCXB 2FYXA 1U0HB 1FK9A 1H7XA 2I2YA 4MFBA 4H4OA 2XWYA 2WBRA 1Y5IB 2NPFA 3T5LA 1HBMB 2MKHA 3W8PA 4C11A 1UAWA 2AKWB 1TK0A 5LMUF 2DH7A 3FCVA 1QM9A 2CNLB 2X51A 4QR2A 2CZ9A 4ED4A 1YTYA 3PO5A 4N76A 3S6EA 4K4UA 1TELA 1NK6A 1NRKA 2HMIA 4OX9F 5EGYA 4MT1A 2BKOA 3ULHA 4K4XA 2C1EB 4YB6A 5DDPC 2D1CA 2OHDA 1OSCA 1N36J 1M0SA 1GK8A 3CO0P 2K3KA 5LXRA 4NX9A 3D4JA 2HFVA 1WWHA 2QSWA 1YSJA 3NGUA 1HHSA 1WDTA 2BKNA 3IGVA 4YY3F 3LGMA 3N01A 2JRSA 1CQMA 3DKDA 2APOA 2HNZA 2F9DA 4H4MB 5CZXA 4NI2A 3MPUB 4IG0B 3MUMP 3M7VA 4OLOA 4UZBA 2JH3A 5A76A 4MJKA 2HNZB 2A0FB 2CDRB 2ZKUA 4H4MA 1X4GA 2OPSA 2CJAA 4OI1A 5L38A 2EFGA 3NXZA 3G6XA 4J9RA 5I4MA 1WF1A 1VBXA 4DU8A 4HKQA 2HHSA 1RTZA 4DSKA 1KQSR 2AJQA 3GYXB 3V5RA 1FNOA 5DQHA 2HZVA 2M2BA 1F1BB 2QL5B 4BDPA 4O3RA 2FJWA 2MGZB 1HMVB 2VF3A 4QWCA 4XR6A 1TP7A 3PTWA 1BQMA 5KT4A 1CC8A 4DV2J 2AX0A 2HQFA 4OYIA 3WIVA 3GQCA 1TKDA 5DG8A 4URRA 1KR4A 3PEHA 5C42B 4B3MJ 3T1HF 4NMLA 1HMVA 1VQSA 2RKIA 3JQMA 3KNGA 1N5YB 4DSLA 3SSRA 4J9VA 5IM0B 4L72B 2EFQA 4KBIA 1EZZB 2LDIA 3POTB 3LUYA 3W62A 1CG2A 3FNNA 1R43A 1UETA 3ZTSA 4Q8FA 4B9MA 1P1TA 1G1XA 3EE3A 4F4YA 2FIUA 4CT8A 3LP0A 4KGKA 2XLIA 1JWWA 2UUAJ 2AJ1A 2CXEA 2ZFHA 2XMMA 2DVIA 4C2MA 4X4SA 3E2EA 1HL6A 3GRHA 2EKNA 5KOXA 2AJFE 3M8SA 3GV5B 1TL3A 3TJ8A 5AJ3F 3EVWA 3JB9k 2NQPA 2Q6BA 4UZCA 4L6V3 3BDEA 3BF4A 1P27B 4M5KA 4AE5A 1VLOA 3WX4A 4DQPA 1VLYA 1G6BA 2QJ3A 3MWBA 4UW2A 4LF7J 4LF9J 3VF0B 2MSSA 2DHGA 3MMBB 4WK3A 1S6PA 3CCMS 1FD8A 1B0PA 2DR6A 1FHTA 3IAM9 4DL2A 1TKTA 2FHJD 2YNHB 5E7OB 3I56S 1GQEA 4C7QA 3HD1A 5L1IA 1SUQB 3PYDA 4IG3B 2DH9A 3DI6A 1TV6A 2HHWA 4WWSA 4K50A 1EE6A 2F65A 2NTBA 2B51A 4LUBA 4MYUA 1ZZNA 1VQNS 5HI7A 1DQ8A 4HTIA 2VL1A 1S48A 5CYQA 3GIKA 4ERDA 4GKKF 4WXOA 4QW9A 1BWEA 1KWMA 2KYXA 3JXOA 2AX1A 4TU9A 2KFZA 1FJ7A 2DT9A 2V34A 4DL3A 1IR0A 2DEJA 2VHGA 1IVZA 3TAQA 4QU6A 2E1MC 3I31A 1JKHA 2P9EA 3RRKA 2FJAB 4CCHA 2UXDF 5MLCV 3HJVA 3EQNA 1F5BA 1KQ5A 1UW9A 2GMJA 4O0IA 2XC1A 1OIAA 1VIXA 2IFXA 2RDDA 3K5OA 4U4BA 3QGGA 5AXLA 2LECA 2VICA 3T5KA 2ATCB 4ZHRB 4IR9A 1K5CA 2IRYA 2QE5A 3UD5A 1SQFA 2QL9B 3FGVA 4DR6F 1RHJB 4GVBA 2DRAA 2MZQA 2B0RA 1RKJA 2X3GA 3BS9A 3AJDA 4I6YA 2MJUA 1AA1B 2ZBRA 2DYAA 3HPOA 1IQZA 3WHIA 2L9DA 2YWGA 4DJBA 3H2LA 3MM8B 5IV3A 5JJBA 3CO9A 1C0UA 1XR5A 2R2RA 4DV7F 1RA7A 4ZP7A 4K4WA 4C0HA 1YJWS 2RRBA 4K59A 2OIHA 3FQLA 4DXLA 1PSDA 1I1GA 2XG8A 1ZS6A 3D1OA 1X4BA 2QMUB 1FKAF 3QNWB 4P71A 1OGOX 3QWPA 1FNMA 2LEBA 3RAQA 2VFUA 3N90A 5F8LA 1XNQF 3OFGA 4Y00A 3OFHA 1QTMA 1IKWA 3QIPB 6FD1A 2ZOGA 3KLFB 1RTHB 1DRZA 4CLYA 1G2EA 2DGUA 1SVDA 3N6LA 1C1CB 5GADU 5A8WB 2IC3B 9ATCB 4XM3A 5HBMB 4EYIB 1NJYA 3CC2S 4XDDA 1D1UA 2ZBCA 1S0NA 1NDLA 2UV8A 1TVRA 3E01B 3KG1A 2YBVA 3RAXA 1YZ7A 2B4PA 1JNZB 3QSIA 5ETKA 1HBNA 2ASYA 3TJ9A 3CXCR 4I67A 2NZMA 2QTWA 1HFEL 1Y3JA 4K4YA 3SCKE 3TAPA 4LF9F 3S1TA 4R25A 4XTTA 2AJ2A 4ZPDA 5KFFA 2B7CB 5M2PA 4DV4J 1XMOJ 1JJ2R 1FRMA 1S6QA 1QQ1A 1RWRA 2ZVSA 3DLKB 3G8TA 4Q0BB 4OJOA 1RDRA 1HBOA 1UWBB 4C3MA 2VFMA 2K8GA 3MCNA 1APSA 4Q44A 4IFYB 5B0AA 4ZPBA 2X6XA 3FSIA 4H54A 2ALYB 4M5HA 1S9FA 5KT5A 1VIOA 2PDAA 1TL3B 2ZNZA 1X4HA 1D9FA 2WW4A 3NWRA 1DAXA 2IYIA 2DGWA 3OTEA 1ZBTA 2I38A 2IAJB 2QL7B 2D3O1 2NREA 4LF6J 3DU1X 2V2ZA 2RS2A 4IRCA 2AD9A 1ZOTA 1TYVA 2GQ2A 3C6UB 1ZPWX 1B0VA 1OYEA 2VD3A 1SPBP 4PWUA 5K20B 3J7YI 3A3PB 3D5MA 5JXSA 5D4PA 1TYWA 2PA3A 4NLRA 2KG1A 3CCES 1VQ8S 5IFMA 4K8RA 2PE8A 4I68A 3IWNC 3OXGA 4ZPVR 1QE1B 3MHYA 1IKVB 2HLUA 1NUEA 2ILYA 3G6ES 4DV2F 2UZAA 1NK9A 2Z2MA 4OHZA 5JMCB 3GG0A 3PW4A 3MR7A 1F60B 3BGRA 1RBLA 3AB4B 1NU4A 4ZVGA 3JSBA 3GE9A 1U6ZA 4CWBA 5KT3A 5F8GA 1OY6A 1XBWA 2O66A 1PJ7A 1MN9A 4ID5B 2AEMA 4W92B 2Z4PA 3RRHA 4P72A 5CH7B 1VQ7S 4ELVA 1WI8A 2KFYA 1JLAA 4M95A 3ZSCA 1WXRA 1WUUA 3MPYA 3NS6A 4AYBD 4UY8T 1UP1A 4Z7CA 2CJKA 2BJ1A 4X84A 2VOPA 3SDEA 4RKUC 3WWGA 1RAEB 1LK5A 3DLJA 5THWA 4WFNQ 2VG6B 3HSDA 4DL5A 1XNQJ 3H5XA 3QRPA 2MZTA 1FD2A 2J7UA 3DOMA 4DI6A 4FVMA 4X4VA 5F0WA 2O04A 4YC5A 1RWWB 3TEGA 4OZ3A 1GMWA 3D0HE 4OFZA 4PWDA 4FYWB 4KTQA 1MMLA 2DNZA 2DRDA 1FFSB 3IXQA 2Y1IA 1UZHA 2BJ9A 3J81U 3MM5A 2ZZNA 2HS3A 2P6TA 1SBRA 5K8PA 2ZM6J 1ZYQA 3NB2A 1VC0A 1R0CB 2NR0A 3VHQA 4ID8A 2QY1A 2RKIB 3W66A 4RW6B 4X64F 1HHTP 5FIIA 1U1OA 2CPZA 1SQGA 4RW4A 4F4KA 2ATLA 1Q0NA 1Q95G 1PJ5A 4ZVSB 3GCWP 1S59A 4I7FB 5E3CA 4QWDA 4DR2J 3C15A 1NDPA 2PFDA 3SCJE 3KDOA 2P6SA 1RP5A 2ACYA 2RHSB 3CT9A 3FBCA 4O23A 1RTJB 3IN5A 2ROEA 5CD4H 3G71S 3R2DJ 2G2ZA 8RUCA 4QJVA 3HJFA 4P2XA 2R2UA 1YKWA 2ZHOA 2C22A 1JJHA 1NK5A 1JIHA 4PWWA 3BO2A 1X9SA 5D4OA 4X62J 1SIZA 3JSMB 4EO6A 2E5LF 1RHKB 2CVEA 2B9EA 3CDWA 4EK2A 4WFBQ 2V4QA 4OYAA 2AYMA 4WK1A 3MOJB 5EX0A 4C8NA 3CD7A 1M1HA 4ZVUB 3LMWA 2WTFA 2KL8A 5L46A 3V81A 1XR6A 4OJ5A 1MWZA 4KHMA 2BZ2A 3MM9A 1HNZF 2H5IB 3GQAA 2KI2A 5D6GA 1NHKL 1FKPA 1QSYA 2RUSA 1X0CA 3NAWA 5ETLA 5AXKA 1NSAA 3O5TB 3JAMY 1T03A 5AMVA 1O0PA 5KG3A 4J9SA 5DDRC 1K73T 3DRRB 5T41A 4C2LA 2X3HA 4ZCIA 3P45B 4NK6A 1K47A 2HNYB 2OPSB 4KAIA 4C98A 2AGPA 3KLHA 1PO6A 1WACA 2YWFA 6FDRA 4FXDA 1S1WA 1Z2ZA 3ET6B 4FP9A 5CCLA 4B3RF 3ZFVA 2ADBA 1DLOA 1OY8A 4ILMA 2IAJA 2YX4A 3IR6B 4TKTA 3UD3P 3EXCX 5L39A 3GV8B 2UVVA 1WNEA 5HL7Q 2ASJA 5KFIA 2W2QP 3NCRA 5C1EA 2BR0A 3KMQA 3DYAB 1F3FA 1JTAA 4TN2A 1FDNA 3U27A 3OTCA 3C16A 3UDLA 1FERA 4DBQA 4AL7A 4NLQA 4CT9A 1CJKA 1NAQA 3DGPA 1OQ6A 3HULA 1LWFA 4ZVFA 3P8BB 3D6MB 3T1HJ 2H5JB 1CJUB 3UD4P 1X0PA 3RB6A 4NYPA 4YUDA 4LSLA 1IWAA 3L09A 3ZO7A 3MR2A 1H80A 2WOMA 2VU5A 1FX2A 2RQ4A 2GHVC 5I42A 3OFFA 5EDWA 1GH8A 1B7YB 1HNXF 2VOOA 1WKKA 4QU7A 3MEKA 3F0NA 3PEJA 2BE2A 4P73A 1CULA 4ITSA 1SV5A 2R2SA 2V4RA 3H59A 1GXLA 3IRWP 4IRKA 1N33F 4YFOA 4P7VA 2JC1A 2XYGB 4RUHA 4NA3A 2YKQA 1U1KA 1IKWB 1NXIA 3O3LA 3M6XA 3I0SB 4ICLB 3IMQJ 3R7NB 2DNMA 2ZBIA 2XT4A 2B3TB 3K8VA 4ES3A 4LFCJ 5KTQA 4MKYA 2DNNA 4ZA1A 1N4LA 2J9CA 3CDBA 4KE5A 4LFAJ 2XTJP 1M5HA 4U95A 3FDSA 3CUNA 4IOAQ 3QGPA 1F5CA 4I2QB 4DMZA 5FDLB 2YNFB 4O3NA 4QIEA 1PIEA 1J5OA 1VBYA 3OSNA 3LP1B 2F8HA 4J9OA 1U09A 1LLZA 3R6GB 4N8OA 4ED6A 3NGTA 1LM1A 3M2VA 3MM7B 1E6YA 3AQOA 1S6QB 2K2PA 3DLKA 2B4VA 2HBYB 2HURA 4IOBA 3NNHA 1SJRA 3DNCA 4OM9A 5L8RC 4OQJA 4RWXA 4CO1A 2CWXA 2RILA 4M5NA 1NCLA 2PA8D 4PXDA 1DQAA 2JDJA 2RQMA 3UW1A 4LF5J 1CEZA 3LOUA 3QIPA 4I2QA 4U9RA 2WZ1A 3N5BA 1FRIA 4BWJA 4JV5F 4HDHA 4KHPJ 4LR8A 2EWHA 1NHCA 2OELA 3NOGA 5A8WA 4WP3A 3C14B 1RXOB 3BB5A 1Q82T 5KFCA 1K1SA 2CJ9A 2HGMA 2QMWA 2GJ2A 4NWBA 3W9HA 3KMSA 4ZCMA 3VAJA 1X4DA 2VFTA 3OL9A 4YDXA 3PX6A 2HEKA 1M5KC 4ETXA 4S0MA 3JSRA 3KUGA 4RU2A 9RUBA 2KVIA 2J8KA 1QA3A 2HNDB 2Y1LB 4JV0A 4MIBA 5GVQA 1RT4A 2BE9B 2C28A 1YHQS 2LMIA 1IQTA 4K4TA 3THVA 4CH7A 2ZH1A 3R5JB 5AT1B 1DBDA 1TUVA 2OFHX 2HIQA 4XONA 2EI5A 2X7IA 1L3VA 2DNYA 2Q79A 4MTPA 2NTQA 2H3EB 4NASA 1IWGA 1FESA 3ENWA 4I7FA 1SQEA 2Z57B 3UWTA 3WC0A 4DV1J 4DSIA 2CIMA 4LVNP 2BM7A 1R8CA 3T41A 4NLTA 1R3NA 1XQIA 4DV6F 4RPFA 4XOPA 3GFYA 1RMGA 1VHFA 2FHJA 5KFHA 3G6VA 4IQXA 3CCSS 2GMHA 1NHVA 3HHLA 4LMZA 1RTDB 1OY9A 1FT8A 1NH7A 4KV8B 1FKOB 3OL7A 2HBQB 1Q8IA 1WC1A 3TNVA 7FDRA 5B08A 1WDDA 2CNNB 2BJ8A 2OEKA 3MEEA 3MUVP 4P2MA 3HT3A 2IOUG 1RT5A 4JBCA 2ZHAA 2M8HA 4FS2A 3FSXA 3OR2B 1OMSA 1EB0A 1I3OB 2E5LJ 2ZKTA 1KHWA 1HWLA 3LJYA 2LXFA 2R42A 3M1VB 1PBUA 4J7CA 3TWZA 4DU7A 3W63A 4E8UA 2BACA 4LQ3A 1ZAXA 4L73A 1FWLA 4OJ6A 2WVEA 3I4PA 4RNHA 2BQRA 1NSQA 4RBTA 1H7WA 2BBEA 3ZZZA 1LFWA 2LU2A 2DCLA 1JK9B 2VFQA 3IWXA 1D8ZA 2VFVA 4Y3CA 1YJUA 4NL5A 1F6TA 1RQ0A 2KM8B 1XIQA 1PAUB 3NOCA 3K7RA 2BXJA 2A6MA 1TMMA 3TQEA 4JI1J 4W8RA 4DQRA 3CJTA 1RTIB 2F4FA 4EBCA 4JI6F 1XNRJ 1T3OA 4PQUA 4DZDA 4FVCA 2IDLA 1RADB 4L3KA 3UNGC 1LLWA 4RL1A 3N6ZA 1VJQA 2J0XA 1LXJA 3BSAA 2IQ7A 4G1QA 4F7VA 1KLNA 4HLBA 2F5GA 4FYXB 4YR3A 4GRSA 4RW8B 4PYAA 2XY7A 3HD2A 4AVZA 2ZDOA 3VAGA 2UU9F 4FBTA 4CLSA 2HK2A 1KLMB 2WB1D 4RX6A 3UR0A 3HDSA 3LANA 1NB2A 1FKOA 1T03B 1XWLA 4M5DB 4K4ZA 4O4GB 5IM0A 1NKEA 1TL7B 3B4DA 1YX2A 3FRYA 3NAHA 1YJRA 3HSJA 5IWAJ 1V6HA 3UN2A 4I6WA 4IO1A 4UTGA 1O8MA 1RAJA 3FSYA 3NNAA 4LBHA 4WU2A 4XMYA 4HT5A 3B78A 4NMXA 3TRGA 3TVYA 2N3OA 3AAWB 4WE1A 2R8GA 2G1DA 4B3SF 2VFOA 4PXBA 3TYTA 1SCJB 4OV6A 4A8MP 4B3OA 1HNWF 4DV7J 4J90A 4DCOB 1E6VA 3T1YJ 1BQNB 2NXUA 1X4FA 4CYUB 2KH9A 1QUVA 2IRXA 5DQGA 4DR5F 4CQ1A 4LRFA 2COLA 2KT3A 2LP4A 1FRHA 2KJVA 4PR6A 2YQ0A 4KO0A 3PKYA 2HHUA 2BM6A 4X4UA 2FC8A 4ECSA 2FDNA 2I9SA 3EPGA 5K8NA 1V3ZA 2EEYA 2DY9A 2KHCA 1R0BG 2MMYA 2XMJA 4FPIA 4KFBA 1N48A 3NWGA 1UVMA 5B0FA 2KFNA 4WZQA 1T11A 3C6TB 1OPIA 3MFHA 2JVOA 2HMIB 2BKPA 3AOBA 2VQFF 4B9LA 4LF7F 3R5GA 1NJIT 1EETB 1OYDA 4RW7B 3IWLA 1IM4A 4XAKA 2H51B 3MZIA 4WYWA 4Y2CA 5BYRA 2DXFA 5LT5A 5F8MA 1TKZA 4DZ6A 2DGOA 1Q8BA 5HVHA 3PCOB 5B0CA 5HN0A 3KHGA 1JXVA 2OH2A 5HMXA 1S1VB 2YNIB 2K7KA 3DOKA 2I6WA 2XLKA 3B90A 1NJZA 3W3SA 1Q86T 1LW2A 1XNRF 4H4OB 2A3JA 2F8MA 1SH0A 3PYFA 3J81Y 2LKZA 2LQ5A 3OLAA 3D67A 1RTDA 1KFDA 3PVXA 3H20A 1RWOB 2LFVA 4A47A 4X4QA 3H25A 1B99A 1U49A 2HHVA 1QD1A 3FMWA 1H0HB 1RABB 2VPYB 2IDEA 3P5TL 2QLBB 2QV6A 4U6PA 4YHHJ 4DS5A 1A9NB 1N54B 2BJEA 4I0WA 1HBOB 1QY7A 3A8IA 1IJEB 2IVMA 2WAQD 3O1LA 4OZ2A 3Q24A 1X5TA 4MMOA 3PRVA 2JX2A 1YG0A 3A8EA 4KGMA 3T9GA 1CULB 4IQMA 3IRXA 2XI2A 1YGYA 3JS9A 1MU2B 5A8RB 1JJ4A 2WSFC 2H1YA 4USHA 2GFFA 3PYGA 3QJPA 3HFVA 2MHNA 4DS4A 4WBFA 2ASLA 2A2DA 4YZXA 1F5AA 1JLCB 4DF4A 5CHCB 2AYBA 3C6TA 3ILIA 5IC4B 1P6TA 5G4DA 4WCEQ 2IYGA 1D0EA 2QX0A 1Z1ZA 4AT1B 3SQVA 4PXEA 4YZQA 2NCKL 4GMKA 4C3LA 2MKKA 2YKNA 3PM9A 2QA2A 3DRYA 1YRXA 2MEWA 2LQJA 3HM9A 3KTQA 4FN5A 3L3CA 3WC2A 1PILA 1BLUA 2V69A 2B9YA 3H2VE 2FLLA 4DR5J 5AJ3J 3DDIA 4WIIA 2U1AA 4CTAA 3HHLD 4JB8B 3D6TB 4DX7A 2Q6CA 4C8YA 3NNCA 4K4VA 1YI2S 1ZZFA 5KFDA 1H38A 3PRBA 1S1WB 2WVCA 3PW0A 2R3VA 1S1VA 2YNIA 3LGHA 5BR8J 4TU7A 3Q8RB 4NA1A 4P2FA 1UFLA 1JXEA 1N34F 1O8FA 4X4OA 1ULRA 3PXGa 1UEUA 2AHOB 1UFKA 4OI4A 3SFUA 5A8KB 3PIOQ 1FTCA 3CE8A 2RRAA 4CO0A 3G96A 2XMAA 2JEJA 4ED1A 2Z8GA 5J1NA 2XHCA 2CQ1A 3B8HA 5FDLA 3VZHA 4ZLPA 1D9DA 4B08A 5CA5A 5GMDA 4RZRA 2KN4A 3D6HB 4NZ6A 2HWIA 2CQ0A 3V4IB 5EWFA 5J2PA 4YB7A 3I6PA 4XLCA 2H4YB 3B8YA 2YY3A 4A8SA 2B6AA 1YRUA 3DU6A 2RAQA 3PR5B 1P9QC 4LR7A 5LMNF 2V9KA 1KNZA 2BJDA 3BH6B 1NKCA 1M5VC 5FD1A 3D7SB 1FE4A 1OGMX 2R7RA 3BGOP 2IMWP 1HG8A 3MM6A 3CD0A 2VZ9A 2DH8A 3S8SA 4F0KA 2UVUA 4KHRA 4FPRA 3K58A 2QSFA 3A8JA 3HFZB 4CH0S 1Y7PA 3VGUA 4ZITA 5DDOC 1SKWA 5L9XA 4DN9A 4FS1A 4F67A 1E6VB 1RWXB 2ZDPA 1SUQA 2WVFA 3ZZPA 3DRSA 3MCMA 3T6BA 2MPUA 1FRJA 1S9GB 5A6PA 4X2BA 3RZAA 5KFPA 4EW9A 3TJAA 4OI3A 3W9JA 4LREA 4FF4A 2FZGB 2RU3A 2WB4A 4RW4B 1IB4A 1U8WA 3D0GE 5KFWA 4QIFA 3BR9A 5HSPA 4RNFA 4KH3A 4P75A 1L1IA 1TUWA 1MMDA 1QE1A 1WC5A 3MEDB 4TQSA 3GILA 2W2MP 3Q8YA 3CNQP 3Q0AA 4IOCQ 1N56A 5HMYA 4A8OA 1WEXA 3DRSB 2MY7A 3TA1A 2VBEA 3U1LA 5GAEU 2DTJA 4G6VB 4RWWA 2GIRA 1U24A 3G82B 3BH7B 2O5DA 4M5MA 2NPIA 3OR2A 1RAOA 4C0BA 3LALA 1ICEB 5CXTA 2D41A 3OD2A 4U8VA 4ZVTB 5HROA 3SDEB 1NDCA 5LJ3Y 1X0FA 2HHXA 3CDUA 2LEPA 1OSDA 1U1NA 1FJEB 3CIZA 4Q5VA 5CD4A 2BDPA 1N5YA 1BGXT 3ISNC 1LW0B 4IG3A 2VJJA 1PBAA 2OEJA 3H42A 1U02A 3KJFB 4A4JA 4IKAA 5E41A 1NK4A 4JI5J 1Q5VA 4ECYA 1SJ1A 1SIWB 2INVA 3M8PA 2QC3A 3HHLB 4KB7A 4CLLA 4BS2A 4O44A 4Q45A 1YZ6A 1JLQA 2CQIA 4PUOB 1OFDA 2CPDA 2V2QA 4XPEA 2QG9B 3ENQA 3QJJA 2MQMA 3GJQB 3M8WA 2A2CA 3RTVA 2KVQE 1SKSA 2XMWA 1YK9A 1M90T 4LQ9A 4ZVPB 1HNIB 3EXYA 3LP2A 4ZJQA 2EC0A 1EX8A 1FVQA 2GIQA 2O67A 4I56A 2NXJA 4IDKB 4KGXB 3W9IA 3CCLS 5JMNA 5CAAA 4JI1F 3C6UA 4TLQA 3FK4A 2NSPA 5EN1A 5U47A 3DXBA 3H4DA 5H9EJ 4QYZJ 1GT8A 1ITPA 2EXUA 2KT2A 2J6TA 1X9WA 3I5CA 1W26A 4LFCF 5AE3A 4MXNA 3DC2A 4DUZF 2GAHC 3N6NA 2O0WA 3PJ9A 4DPXA 4IR1A 2XNRA 1YBTA 2JLEA 3M6WA 3ENAA 4CO3A 1WHXA 4CLFA 1KTQA 1R0AB 3OL8A 3HCXA 3PY8A 2QLWA 3FZBA 3N0VA 3QO9B 4Y2MA 1JLBB 1ZM9A 3MXHP 1WI6A 4LIWA 1VBZA 2UVRA 2UVWA 5J2QA 5F8IA 3H5UA 1IBKF 1NPPA 3TI0A 5CQGA 1ZM4A 4YN3B 3JTPA 3MM7A 3NS7B 3Q23A 1N8RT 3MPDA 4NCGB 2VG5B 1RT1B 4ZJOA 1WC0A 3ZTOA 4CNZA 4D3GA 4K0KJ 4WPAA 3PO4A 2OPPB 3CCTA 3PFEA 1GAOA 2HFZA 1AYEA 5E3RA 4TQRA 5IQ6A 4XQFA 3TX0A 2JEGA 3NMAA 1JMTA 1VRUA 1HPZB 2MQLA 2HRUA 3L4BC 1JLEB 2R7OA 1X5SA 3CMAS 1VRQC 4HR2A 4I1TA 4N47A 5AXNA 4HDGA 1SI9A 2F7VA 3DU5A 2FD2A 3CTRA 5FLXY 4ZPCA 4MK9A 5H1SV 1URRA 2QGFB 4WFYA 2YPZA 3DMJB 1N88A 1RT7A 2C2NA 4OZNA 2BOPA 1TU0B 1RK8A 5KFUA 3UDCA 2FVCA 3EM1A 5JUMA 2E9ZA 4DCJB 1N5QA 2LU1A 5ETTA 2EFPA 2DGQA 3THTA 1NK7A 3OQ2A 3GWCA 1PYOB 3IR7B 2XZDB 4MKVA 4ZCKA 4CLTA 4NXMJ 2RH3A 2VJUA 1HWJA 1Y5LB 3DDKA 2NT6A 1S6PB 2W1BA 3DRPA 4DV3F 1TFWA 4N77A 2A18A 4DPTA 3PSZA 1C0TB 1HQ2A 3CCVS 3DLBA 1WEYA 3PKMA 3TA0A 2V5HG 1HI8A 4IH5A 4JYAJ 2W9BB 1HWKA 1U0HA 2HFUA 1TAUA 2ZE2B 4YY3J 4P6QA 3HKZD 1JLGA 2ASDA 2BANA 3JYTB 2W9BA 5D0GA 1VRTA 3GLJA 4ER8A 1HF2A 3TOQA 3CCUS 2DNGA 4YEIA 1UWBA 1QJVA 1BE4A 1CLWA 3L7OA 4CH1A 1U1LA 2D69A 4IUFA 2OUGA 1VISA 3BKFA 3MEGB 4JP8A 2H65B 1R27B 4KC5A 1RT6A 1MSWD 1BQNA 3IFEA 2N82B 3EDRB 3KYLA 2FB0A 1DHMA 2E5IA 3BYRA 1UZDA 3QQCD 4HHHA 2HHTA 5K8OA 1V3SA 4UY85 1RHMB 1CBKA 3I82A 4A8KA 2C2KB 3QATA 2W24A 2CA9A 3OTBA 2CQHA 5BYQA 2OD4A 1O51A 4E98A 1TL5A 2VPZB 3JTNA 1A0OB 1IKYA 4ZS6A 1ELOA 1KHVA 2FHOB 2WONB 4QWBA 1R31A 3RB4A 1SJ4P 2Y8WA 1N36F 3AD7C 4OZ0A 5SZTA 3GQ7A 3W8GA 1GMUA 2HFNA 2P5VA 5AXMA 3C16B 2MGZA 4ECUA 3KNAA 1ZA1B 4DEZA 3D9BA 3ITHA 4HACA 1UA1A 1S7IA 1N33J 1KVJA 1KONA 4A8YA 3DLEB 3QPIA 4FKXA 1S7HA 4ZVRB 3TR5A 4AXIA 5ADZA 1FRKA 8ATCB 3G4SS 3EICA 4ZP6A 4GKKJ 1XG2A 3GP9A 3QFHA 4JI6J 1DFDA 2PFFB 2ZH2A 2POKA 4P9SA 2OI2A 3RBDA 1SH2A 3RG6A 3GYNA 2ZUGA 3JX8A 3ONQA 3BV8A 4DR4J 5ETRA 1Q16B 3KDNA 3IP0A 4B3OB 1EHWA 2CG8A 4ZVEA 4OV1A 1RAFB 2ABYA 2B4UA 3VSUA 5KG2A 5HQLA 3MDFA 1J2VA 4OJLA 2L9NA 4UOHA 4DPOA 5K14A 4AUKA 1UJ6A 2BMBA 4TY8B 5SUHA 5LM7E 4AL6A 4EBDA 1YJ7A 4Y2KA 2UUCJ 3TO8A 4NYZA 1S97A 3G6YA 3FZ2A 1AZSB 3EPIA 3ILOA 5IXUA 4O4GA 2IRUA 2MQPA 1N34J 3QT6A 3QO9A 1KSPA 4WP8A 4U8YA 2INUA 3SIPB 3UVJA 2LA6A 3M30B 2ZH6A 2XZTB 3V81B 2EFVA 4QYRA 4DV0F 4B3RJ 1QSSA 4NRUA 4K5SA 2AZ3A 5B0GA 4ZJLA 3M9OB 4CLKA 3GFZA 3FBFA 3RW7A 3D1HA 1Q4RA 4DN0A 4DOZA 3M9NB 1I51B 4TY8A 2CRLA 2MQ8A 4CO4A 2QA4S 1WMRA 4DR1F 2MLZA 4OHWA 4B9UA 3T6JA 5CYMB 2BSPA 4LFAF 2L48A 4CO2A 4ED5A 3H2UB 4CYUA 2DY1A 5GAGI 3QAEA 2BE7D 2XS7A 1VQ9S 1RT5B 3HF5A 1U4BA 1D3WA 1H2TZ 2F63A 1TK8A 3BO3A 4EU0A 1QA2A 2MZRA 3FC9A 3J80U 5JVHQ 4Z2XA 2ROGA 4H4KC 4TY9A 2RQKA 4LT6A 3P6YC 2D3ZA 1GXUA 2R7WA 4J9QA 1F9HA 4B9TA 4R8UA 2QLJB 4Z03A 2V67A 2NZCA 2QRRA 3W61A 4JV2A 2HBRB 5ETNA 1HNXJ 1S79A 2GCFA 2D9PA 2YNGA 3THPA 3FEYB 4A48A 4RU9A 4QWEA 2J8AA 2A6OA 1ACMB 3FKBA 3CJSA 1IKVA 1W2BR 4YDTA 1X7VA 2HVDA 1FTRA 3CJQA 3TW0A 4DV4F 1XMOF 1R8BA 2ODLA 2RDIA 3KHLA 5M2UA 3NL0A 1NEEA 2QZ8A 1RU2A 2RB7A 3LQVA 2Q1LA 4GO7X 4Y2AA 1F2GA 3H40A 2FJEB 2NXCA 2Z2ZA 2HLTA 1YVFA 2W2PP 4EEYA 5D8HB 1VOMA 5KFMA 2E9RX 1DURA 4URSA 4MIWA 2VFSA 3CJKB 3CSKA 2OPQB 3M4XA 2QZAA 5E3AA 5IS2A 4N41A 3IA0A 1S0MA 5A0YA 1X31C 3QFWA 2AU0A 1NJWA 1K8AT 3OXLA 2F40A 2JLFA 1XR7A 3TUPA 2XULA 1X5PA 3SSQA 4DR4F 1RSCA 2ZH7A 3RB3A 2DBBA 1FF2A 2WSCC 1KS2A 4QQBA 3QSYB 3P49B 2VFNA 2B8QA 2C2DA 2H9ZA 4XPCA 1R6YA 2J7KA 3MEDA 5C2CA 4PKDB 2PEBA 1S9EB 1Q7LB 1RYRA 2AW0A 1QAXA 4I69A 4LSZB 3OUYB 3KLGA 4PZVA 4AFFA 1MWYA 1ZTWA 4V19X 3I32A 3M2RA 3EGVA 5LOQA 2E7XA 5B0BA 3K89A 5IV4A 1RAIB 1T9XA 3L7UA 5KFQA 1IR2A 5EWGA 1VQLS 2W8LA 1WG5A 1OO0B 4BLGA 2R7VA 1WJ9A 2DHAA 2NLWA 3HSGA 1T9VA 3G2XA 4JI4J 1RT7B 4UOGA 3SV4A 2V4JB 4DCPB 1R8HA 2XO7A 3FUYA 2XC9A 4NLUA 5KFVA 4XLFA 3EGNA 2HG4A 2RU9A 1UPMB 1V9OA 4ANEA 1UFWA 3PNIA 4DR7J 3W2WA 3DM2B 2B6AB 1GTHA 2PT0A 3CMQA 3IG1B 2RIJA 3IS9A 4M63A 5KFSA 5B0DA 1G7CB 1H74A 2K3IA 2VG7B 3NAIA 1KRPA 4NLVA 2VQEJ 5KG7A 4DFKA 4NLOA 2M9KA 2MKSA 4DPWA 4B9VA 5GMEA 2EK1A 5T14A 1D8YA 1O8IA 4RW9A 4DL7A 4KGZB 3HP6A 4XLEA 2XQCA 1DY3A 4JI0F 3BEGB 3I4HX 3QJLA 1T0TV 1RT4B 2EVZA 2GX8A 2V8DA 3IGNA 4MKAA 3BQ1A 1JLFB 2LQ8A 3B6BA 4CDIA 5FLXU 2CJYB 3UCGA 4ES2A 4F8RA 2H48B 5B0EA 2KG0A 1WKJA 3TZWA 4HYKA 2FHKA 2EG1A 2VG7A 2G4BA 2XEXA 2YWKA 2E44A 3BYPA 3HI9A 2R8KA 1HBUA 1CC7A 1JKHB 3FBBA 3KWMA 2YQ1A 3PFOA 3NBPA 3R5CA 5D0EA 2W7AA 5GAEI 4F4WA 2MQNA 3AXMA 2VJVA 5LMNJ 1B3TA 2QEXS 4ECTA 2HRYA 2OGUA 1MN7A 2IJFA 2DNRA 2XSJB 3GONA 3HK2A 2HGLA 1LEOA 3A3NB 1JQGA 1SV5B 3KLIB 3MPWA 2ZH5A 2J0SD 2DD8S 1EKRA 3IBFB 1WD6A 1R6VA 2J9EA 2O1DA 1CLFA 1S49A 1FVSA 3UFCX 3M2UB 2FQQB 3U7JA 4IDKA 2IY5B 1HNZJ 1NPKA 1J5EF 1DTTA 1WSVA 2XI3A 4C4WA 4DV1F 1FDBA 3MM8A 2CNOB 3EZUA 4K7QA 5HLFB 5D0HA 3M2UA 4AQYF 1LWFB 4X64J 5KFKA 2BRLA 2AP6A 2JC0A 3AFGA 2EPIA 2CNKB 3LTOA 1B7FA 1UJ4A 3H5SA 5F3ZA 2O17A 4DFMA 3KLIA 1YITS 2Y3YA 3PSSA 1M5SA 4UQTA 1RU1A 4WIQA 4N5SA 1L3TA 3SY2A 3KXDA 3BM7A 3HZEA 3PHEA 4P10A 4PYDA 2CDQA 2RDJA 4HHUA 3BGLA 2NUUG 4HT7A 2Z30B 3SXLA 4XLAA 2CZ4A 2OSQA 1PAEX 2G0JA 2V94A 3HVTB 2F1FA 3GJTB 1UW4A 3OBIA 4OZZA 1TL4A 4JI8F 4A46A 4OJHA 3UCUP 3AH6A 1O8GA 3TARA 2PN6A 3QRQA 2FUG9 2JVRA 2K1RA 2XGPA 2KTQA 4OZLA 2FJDB 2KU7A 1Y3KA 4YOEA 1GX6A 1BD6A 2EFNA 1KVKA 3HHKA 1LFPA 4NRTA 3ZC4A 3SZ2A 5J1EB 3QRRA 2HQIA 2WOMB 2Z0GA 4X4RA 2VQEF 1HWUA 3I0RB 3R1LA 1ZH5A 1GEHA 3NG8A 3UNYA 2XCPA 4DPUA 1WEZA 3X1LB 3MMBA 4RW6A 4C8LA 2CADA 3KK2A 2JL9A 3W5XA 4F3MA 2GW8A 2RF2A 1NJXA 4W8TA 3R27A 3PX0A 2BOAA 4USTA 2GVZA 3V6DB 3ADAC 3VVTA 3VWSA 4F04B 3HLUA 4WKYA 3UPFA 2EBEA 3TAMB 1RBAA 1DLOB 3KK1A 1QAJA 2CPEA 2EFOA 1KKHA 3R5BA 2HKEA 3DOMB 4OJ1A 4EYHB 2BJ3A 4F3OA 2C2OB 1CSJA 2XZWA 3M8RA 3TAMA 3TEHB 4LF6F 2AJ0A 4LF1A 3KLVA 1N6QB 3I9V9 2XGQA 3NGKA 4B9NA 2AV5A 3PYEA 3HVAA 3VGSA 1Y5NB 1Q8KA 3GSIA 4LF8F 4KRWA 2RF2B 4F2SA 2UXDJ 4G1PA 2QYUA 3L7PA 1B64A 1FCAA 4QOTA 3B4NA 3QMQA 4LF8J 1PC4A 3QZ7A 4K2XA 4USIA 1VHIA 2B8PA 5C42A 1WELA 1RB0A 4X65J 5EUHA 3M6UA 4BC7A 2G9OA 2KO1A 4IFVB 3ZZUA 1FJGJ 1BQMB 4GC6A 4KIAA 2DR9A 2DXDA 1O8HA 4XDCA 4FNHA 4GKJF 4FYDA 2VV5A 5T7LB 3C3LA 4LFBJ 2K06A 3R2CJ 4UUXA 1RWVB 3NKYA 4NXMF 1M1KT 5A0YB 3CCRS 1KLMA 5DM6Q 2VKRA 1REGX 4YDDB 1FFGB 1FI4A 2RUGA 1IKXA 4KPCA 2MQOA 5C1CA 3IO1A 4DL0C 3G82A 2RS8A 5E0OA 5J1PA 3J80Y 2QYCA 4LRBA 1QRBA 4WP9A 1EQMA 3K57A 2IM2A 2FJBB 1NSKL 3JTOA 2W4PA 3LP2B 3S01A 3P3DA 3X3UA 4CLWA 4JV1A 2Y8YA 3OT9A 5C24B 2QFJA 1OOCA 1UJ5A 1UVKA 4PXCA 4PQUB 5C25A 1LXNA 5KFRA 2VC1A 4X62F 2V8HA 3DN9A 4F02A 2Y1RI 3NS5A 3HZGA 2FVSA 4ZN3A 3G9CA 1HNVB 5IC6B 4U7UK 3FFIA 4M5LA 3PW2A 3B4MA 4O0NA 1REVB 3P96A 4OHVA 2JEFA 2HW3A 3D28A 2GIFA 1WKLA 3G8SA 2L08A 4X66F 4EBEA 1L3SA 2CQ4A 4JI0J 1D09B 4FXWA 5HMWA 1C4CA 1RI7A 4XOTA 1VQMS 1AT1B 1HBNB 4JI7J 3WX8A 2DNKA 2HVZA 2V68A 4M5IA 4G65A 3MPVA 5DG7A 3CIMA 1UL3A 2GZOA 2VDHA 4WJBA 1FE0A 5A8RA 5HLFA 1HLWA 1NO8A 1EIYB 5HVFA 1RAGB 1T9YA 2D7SA 3EYZA 3K2YA 3TUJC 1RT2B 3BBFA 4F26A 3AD8C 5HAOA 4AL5A 4OZ5A 3I5AA 3O6QA 1HKAA 2HBZB 3HVTA 4IH7A 4M5GA 1BHEA 4IFYA 4OX8A 1VRTB 3A4TA 5E5NA 5KT2A 4Q8EA 2M4MA 4OX6A 5J2NB 3R9LA 5E33A 1WORA 3FCWA 4DFJA 1U48A 1P9YA 2X3DA 4F25A 2X1GA 2AIRB 2CJBA 3CF5Q 4AXJA 4DR3F 3SMZA 4ANCA 3D0IE 3GQ8A 3E51A 2BX6A 4OHXA 2ZVIA 4L75A 5K14B 1B0TA 5M2RA 3SCIE 3W1YC 3ZTPA 1JRGA 1N5VA 3FY3A 1H73A 1T94A 5C7PA 4X4TA 5HQ8A 1NPRA 3OW2R 1X8DA 3D3BJ 5K9FA 1PG5B 1KCDA 4X65F 2OPRA 4YQWA 4DL6A 4KH1B 1FNXH 1EP4B 2CJXB 1J5OB 2SXLA 2GVDA 4RUCA 1T05B 2YKOA 4I4BA 2ZH8A 4OIXA 5D0RA 3VALA 1NB7A 1TTHB 1U26A 3Q8PB 4F2RA 3MCOA 1KQGB 5AE2A 2ZWPA 3GFXA 5KT7A 2FLPA 5AE1A 1BWVA 2E1PA 4N8NA 3D1QA 1QUPA 3CGIA 3OR1A 5HO4A 1G4CA 3W5YA 3BDPA 2MHEA 3Q2SC 4F4AA 3IR5B 3MMCB 4IRDA 4OHYA 4UT4A 1H3DA 2A1BA 2DNPA 1XJWB 2GO8A 2HQCA 1HPZA 2MDAA 2YUHA 2XMTA 3GB0A 3O44A 5HATA 4ZLLA 3BKUA 1DQ9A 4YB1P 2UP1A 4FF3A 5JLVC 5L1JA 1JLFA 1S4EA 3SUCA 3A8KA 3QYYA 2BQ3A 3BN7A 4CP5A 1O88A 4W90B 3CDAA 5GAHU 4EZ6A 3DOLA 1C0UB 5GMKa 4NPOA 2F9JA 1RT6B 5IT9Y 1KTVA 4A8XA 5J2QB 1CJUA 4F36A 2FJVA 4KGVB 2HPUA 1UVIA 3SZEA 3JQKA 1BQXA 2EG2A 2G2YA 2EC2A 2HQ3A 2QN6B 1UWAA 4FNIA 3QT8A 3RJMB 3UE2A 3W60A 3H7HB 4HL9A 4PEOA 1R0AA 2GMLA 3ZTRA 2EWEA 3DM2A 2FVRA 1O6XA 2C2EA 3CVKA 4HI2A 4HVZA 3ZNJ1 3MCSA 2JFKA 2LLZA 1WTBA 2IM1A 4NK8A 1OQ3A 3ML3A 4QCLA 2M3DA 1N32J 1OFEA 3R8YA 1U1RA 3F56A 4NXNF 3IC1A 2I5JB 2Y9HA 1WOSA 1IBMF 3LGNA 2NUHA 4ELTA 4RR5A 4DV5F 2RQCA 3V2UC 4R0EA 4XIUA 1OS5A 3TX8A 3KJVA 3KFWX 2J7WA 2DXEA 3VQSA 5CYQB 2HQGA 2UUTA 2E29A 2O3DA 3DRRA 1EAYC 2C2ZB 2LXIA 2LEAA 2Q3PA 1RISA 2KRRA 2Z58B 4FKYA 4USKA 1SXLA 3BN4A 4XK8C 2R7TA 1ZETA 4E0DA 1X4CA 1U2CA 4DG1B 1HYSA 4KY3A 3FFIB 1WF0A 3IRXB 4ZVQB 3KUHA 2HFOA 2MLYA 4ALZA 2RSQA 2FJXA 4OX9J 1RWNB 2M0GB 4F4ZA 4OJ3A 3LYCA 1SKUB 2R8IA 3IBWA 1CJKB 2ZC4A 3DGPB 1CS4B 3AY0A 2BVZA 2AYGA 3VAHA 2N3LA 2ROPA 2XYPB 5KOWA 1X4AA 2AGQA 1VI7A 2UXBF 2HHQA 2C3YA 2GA7A 4JRAC 3M8YA 2R7QA 4PG8A 1KTWA 3PR4A 3VAKA 4WFXA 1RT3A 1Y4ZB 3GJRB 3GIMA 1PGZA 3KRGA 5F8NA 2MB0B 1IDKA 2DITA 2RVJA 2CJQA 1NDKA 3KG4A 2DIUA 2RE1A 1VGYA 2M7SA 2AZ1A 1WG1A
chains in the Genus database with same CATH topology
3BH6B 2VFOA 2J8IA 1TYXA 3BBFA 2HURA 4UOFA 4OM9A 3FKBA 2HVDA 1NCLA 3VGUA 3EM1A 2BM4A 3SYJA 1K44A 1PAEX 3R9LA 1KQ5A 3FCWA 2XC1A 4DUTA 1PKUA 2BM6A 4ANCA 3H09A 3Q83A 1S59A 2B0RA 2DY9A 2BX6A 1NDPA 3B54A 2ZUAA 3BBBA 3ZTPA 3ELHA 3FBCA 1U8WA 2DYAA 5C7PA 2F3LA 3FCVA 1HHQA 4S0MA 4KH3A 1QA3A 2VFNA 3TH0A 1S5ZA 2B8QA 3Q8YA 1HF2A 2DXFA 3RIQA 3VVUA 5BXIA 1ZS6A 4DZ6A 1BE4A 1CLWA 4EK2A 3BH7B 1TYUA 4V02C 1JXVA 1KDNA 3N90A 1TSPA 3Q8VA 3NGUA 4OJ5A 1HIYA 3VVTA 2BM7A 1NDCA 3DKDA 4F4AA 2BM5A 1XQIA 3L7UA 2YUHA 1NHKL 3BBCA 1K8FA 1NDLA 5JLVC 1B99A 1W7WA 1NSPA 3G2XA 4CP5A 3FBEA 4UOGA 3VGSA 3EMTA 5CABA 2IOUG 1BUXA 1VYAA 2W7ZA 2HVEA 3ETMA 3PRVA 1QQ1A 4FKXA 4F36A 2CWKA 4OJOA 4ANEA 3LJYA 3EICA 3SZEA 3JS9A 2B8PA 3GP9A 4OPWA 2VFMA 4OJ6A 4WBFA 4C6AA 3VGVA 3P4GA 3ZTRA 1NSQA 3JX8A 2BEFA 2DXDA 1DABA 1EHWA 3ML3A 5CAAA 2VFQA 1QA1A 3EVOA 3ZTQA 1F3FA 1UCNA 4OJLA 4UOHA 1B4SA 3ZTSA 2NCKL 2V5IA 1F6TA 3EE3A 1XIQA 1K4ZA 1TYVA 1BHNA 1S57A 3NGSA 3B6BA 3PJ9A 3EJMA 4KPCA 1LWXA 1TYWA 2DXEA 3ENAA 4W98A 2VU5A 1WKJA 4ANDA 1QRBA 4ENOA 3Q89A 4FKYA 1NSKL 3DDIA 1WKKA 3FBBA 3N6ZA 1NUEA 3EVWA 3Q8UA 5JMCB 2AZ3A 1MN7A 4OJPA 3FBFA 1LEOA 3VGTA 3LYCA 3AK5A 3MPDA 4O0NA 1MN9A 3ZTOA 3PETA 1NB2A 1QRCA 1WKLA 3GPAA 3EVMA 1NPKA 4JRAC 3NGRA 1WXRA 3Q86A 1QA2A 3FC9A 3WX8A 2G0YA 5IOLA 4HR2A 2VFPA 1NDKA 1NLKL 1HLWA 3NGTA 2AZ1A 4DI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BH6 B;  3BBF A;  2HUR A;  4UOF A;  3FKB A;  2HVD A;  1NCL A;  3VGU A;  3EM1 A;  1K44 A;  1PAE X;  3R9L A;  1KQ5 A;  3FCW A;  4DUT A;  1PKU A;  4ANC A;  3Q83 A;  1S59 A;  2DY9 A;  2B0R A;  2BX6 A;  1NDP A;  3B54 A;  2ZUA A;  3BBB A;  3ZTP A;  3ELH A;  3FBC A;  1U8W A;  2DYA A;  5C7P A;  3FCV A;  1HHQ A;  4S0M A;  2B8Q A;  1S5Z A;  3Q8Y A;  1HF2 A;  2DXF A;  3VVU A;  5BXI A;  1ZS6 A;  4DZ6 A;  1BE4 A;  4EK2 A;  4V02 C;  3BH7 B;  1JXV A;  1KDN A;  3Q8V A;  3NGU A;  1HIY A;  3VVT A;  1NDC A;  4F4A A;  3DKD A;  1XQI A;  3L7U A;  2YUH A;  3BBC A;  1NHK L;  1K8F A;  1NDL A;  1B99 A;  1W7W A;  1NSP A;  3G2X A;  4CP5 A;  3FBE A;  4UOG A;  3VGS A;  3EMT A;  5CAB A;  1BUX A;  1VYA A;  2HVE A;  3ETM A;  3PRV A;  4FKX A;  4F36 A;  2CWK A;  4ANE A;  3EIC A;  3JS9 A;  2B8P A;  3GP9 A;  4WBF A;  4C6A A;  3VGV A;  3ZTR A;  1NSQ A;  2BEF A;  2DXD A;  1EHW A;  5CAA A;  3EVO A;  3ZTQ A;  1F3F A;  1UCN A;  4UOH A;  1B4S A;  3ZTS A;  2NCK L;  1F6T A;  3EE3 A;  1XIQ A;  1K4Z A;  1BHN A;  1S57 A;  3NGS A;  3B6B A;  3PJ9 A;  3EJM A;  4KPC A;  1LWX A;  2DXE A;  3ENA A;  4W98 A;  2VU5 A;  1WKJ A;  4AND A;  4ENO A;  3Q89 A;  4FKY A;  1NSK L;  3DDI A;  1WKK A;  3FBB A;  1NUE A;  3EVW A;  3Q8U A;  2AZ3 A;  1MN7 A;  3FBF A;  1LEO A;  3VGT A;  3MPD A;  4O0N A;  1MN9 A;  3ZTO A;  1NB2 A;  1WKL A;  3GPA A;  3EVM A;  1NPK A;  3NGR A;  3Q86 A;  3FC9 A;  3WX8 A;  5IOL A;  4HR2 A;  1NDK A;  1NLK L;  1HLW A;  3NGT A;  2AZ1 A;  4DI6 A; 
#chains in the Genus database with same CATH topology
 3ZZY A;  3RGI A;  4OZJ A;  2IBK A;  1PC5 A;  1TKX B;  1HQU B;  2B5J B;  3OSP A;  3GQ9 A;  1DTQ B;  5CYM A;  2F4V F;  1MMN A;  2CQ2 A;  1CZF A;  2FGO A;  1OJ4 A;  2KT5 A;  4PG4 A;  4O3Q A;  2BUN A;  3M30 A;  1TKT B;  3ZNU A;  1SJQ A;  2YWH A;  5D4N A;  3W5Z A;  5LJ5 Y;  2OFG X;  1F0X A;  3BRE A;  1WC6 A;  4RW7 A;  1N5S A;  4JI5 F;  1EA0 A;  4WKR A;  1WC3 A;  1F2H A;  4NLS A;  5KG5 A;  3KK2 B;  2RRN A;  2YVS A;  4UQG A;  4ES1 A;  4OZY A;  3V6H A;  3MUT P;  2VON A;  3MR3 A;  3N6M A;  3RR7 A;  3H09 A;  1GQ8 A;  1IJF B;  1V5I B;  2CQC A;  4I84 A;  4YR0 A;  1PLU A;  1S9G A;  2PMH A;  3MD3 A;  5CZV A;  4ECQ A;  4OI6 A;  1FA0 A;  2ACM A;  1MG7 A;  3MEC A;  1ROF A;  1ZM3 A;  4ED7 A;  4G1Q B;  2HHH J;  3U02 A;  1WTF A;  1IM6 A;  3VSV A;  1QJH A;  3N28 A;  1S12 A;  2MZ1 A;  3CW2 C;  4C48 A;  3D6F B;  3LP0 B;  1N6Q A;  4O3P A;  2F4V J;  4LF2 A;  3S7R A;  3MM6 B;  1S1X A;  1T95 A;  2PSZ A;  2ZNY A;  4QPX A;  1M1G A;  4LIR A;  4J9L A;  3TQ1 A;  3I5B A;  3SBM A;  2LA4 A;  3RW6 A;  1K1Q A;  3OXF A;  2UUC F;  1OWX A;  1VCT A;  3EDQ B;  2O1P A;  4NLX A;  3HHN B;  2ZZM A;  3HHE A;  1A7G E;  2HZC A;  3JQJ A;  3GSD A;  2C2R A;  4FF1 A;  2BM5 A;  1L3U A;  1DZ5 A;  5KFT A;  1ARO P;  2I1R A;  4R0J A;  1JLC A;  3BQ2 A;  1RWM B;  2AMC B;  3VQT A;  1GMV A;  3DHX A;  5F9N A;  1YIJ S;  1U6B A;  5KFG A;  1LWC A;  1MRO A;  3PW5 A;  4RUB A;  1HD0 A;  5ETP A;  2RT3 A;  3K0J A;  2VG6 A;  3M1V A;  1RKI A;  2IJR A;  3BPS P;  1BUX A;  3M32 A;  2HS4 A;  2AGO A;  3MEG A;  1SJF A;  1U8S A;  1GMW D;  3BZQ A;  4A8W A;  1C2P A;  2XHW A;  1LWE B;  1FXD A;  1UVJ A;  2IVY A;  2HFS A;  2ILZ A;  4NLD A;  1I6J A;  2XMK A;  2MY8 A;  5L9N A;  5L1L A;  2VKZ G;  4PRF A;  3GZ7 A;  1VJW A;  1FK9 B;  2CZV C;  5ETQ A;  4CTA B;  2M8D B;  3L95 X;  1HR0 J;  1S6U A;  2MKJ A;  4WXW A;  3KJQ B;  4G3I A;  1FJC A;  3W65 A;  1F9F A;  3UN3 A;  2IHR 1;  1S0O A;  2DHX A;  3JSY A;  1WHW A;  4V1A k;  5JVG Q;  1U6F A;  1SL0 A;  5LSL A;  4DR6 J;  3A12 A;  5DNS A;  1QA1 A;  2J8S A;  3P4U B;  2EKY A;  2V2V A;  2IPO B;  3L9Z A;  5GAG U;  3TUZ C;  2XNQ A;  1P8G A;  2GO9 A;  4ID5 A;  2VBW A;  4OJG A;  2VBM A;  2XS2 A;  2B56 A;  1U47 A;  3V6J A;  4KT0 C;  2GHW A;  1IKY B;  2HZA A;  1S1U A;  4CZC A;  1IBL J;  3T3F A;  3PRD A;  1PYS B;  4CIO A;  1WOP A;  1DTT B;  2P2C B;  2FZK B;  5J1E A;  3KJV B;  4DG1 A;  1HYS B;  1ZTT A;  1NK8 A;  1XEZ A;  1IBK J;  2V8G A;  3QID A;  1EQ0 A;  5I42 B;  1FFW B;  3BQ0 A;  3DMJ A;  1KCC A;  2C3P A;  2MZJ A;  3KKF A;  4EGL A;  1GX5 A;  5DG9 A;  5HQM A;  1U45 A;  3EZ5 A;  2P9G A;  3OV7 A;  4WFZ A;  1QSL A;  1K0T A;  2GJF A;  4LRA A;  3PIP Q;  1LQ9 A;  3VV2 B;  2EK6 A;  4JI3 F;  3IG1 A;  4EUV A;  4DLE A;  2DIV A;  1PCA A;  2CPY A;  5KG1 A;  1HD1 A;  1QRC A;  1XER A;  2D3U A;  3MAA B;  5DRK A;  3GPA A;  4RNN A;  2LCW A;  3NGR A;  4N7T A;  1TZ0 A;  3N79 A;  3HX9 A;  3TUI C;  1KBR A;  3IM8 A;  3UN5 A;  2XY5 A;  5D3G B;  1PXZ A;  4LSN B;  3FRZ A;  2XY6 A;  2M5Y A;  2OTL S;  2QA1 A;  2NSC A;  2UVE A;  1JLE A;  1VS3 A;  2ZIT A;  2Z56 B;  1V3R A;  3D2W A;  2V2K A;  4QW8 A;  1U1M A;  2NTP A;  4B3T J;  4O4R A;  3KLH B;  2XTW A;  2O6W A;  4C8O A;  4FXV A;  2DNH A;  3M8Q A;  1UEV A;  3M2V B;  4UOF A;  3UO0 A;  3H4B A;  4J9K A;  5G0R B;  3OPK A;  2ZH4 A;  2B9W A;  2J6S A;  5GAH I;  2Q66 A;  2DR7 A;  1ZA2 B;  1Z4U A;  3MMJ A;  3VAM A;  1RTH A;  1TL1 A;  2IA0 A;  2W9C B;  5ETV A;  3BGU A;  4C8M A;  2XS5 A;  4ECX A;  3CPW R;  2YTC A;  2DR8 A;  2YPY A;  4XLH A;  5B09 A;  4JYA F;  1FRX A;  2XO6 A;  1C1B B;  1MNE A;  4BCA A;  4WF9 Q;  4XN3 A;  3I0S A;  3Q83 A;  2BM0 A;  4ILL A;  4C3K A;  4B9S A;  3CD6 S;  4MK7 A;  3CME S;  4G1I A;  2NXN A;  1HBU B;  3ICL A;  3C8Y A;  5FJ4 A;  2V0N A;  2X1A A;  3H8Y A;  4ECR A;  2VH7 A;  4I64 A;  2VC0 A;  1U1Q A;  3D3C J;  3JAM U;  1S77 D;  5E3Q A;  5DJB A;  1JX4 A;  1TL1 B;  5BJR A;  3TH0 A;  1Q79 A;  2CQ3 A;  1XMQ J;  3VVU A;  1EP4 A;  1O8K A;  2NYI A;  4NZ0 A;  4ZPW R;  4ETZ A;  1S4F A;  3M9M B;  3K5L A;  5J2M A;  2PEH A;  3EWG A;  1Y11 A;  4YZA A;  3DRX A;  3OUY A;  3KLG B;  4ZDN A;  5DET A;  4F4X A;  1HNI A;  2HK3 A;  2KB2 A;  1S76 D;  3M2R B;  3C15 B;  3ZZT A;  3PX4 A;  4DR2 F;  1T7P A;  5J2N A;  4K2J A;  3CED A;  3F41 A;  2DNL A;  4GO5 X;  3NY0 A;  3IS9 B;  2B9X A;  2XTY A;  4I2P B;  4HTJ A;  3TVK A;  2DPI A;  1JB0 C;  1TL7 A;  1EAR A;  1PJ6 A;  4BWM A;  4B02 A;  4O44 B;  2VBK A;  2XM3 A;  4ZVH A;  5A2Q Y;  1HI0 P;  2OP5 A;  3MD1 A;  2XYH B;  2CPX A;  5EX3 A;  1RE1 B;  1W7W A;  4WYL A;  4HH0 A;  1AUS L;  1HQE B;  1O8B A;  2JJ4 D;  1IN0 A;  2H54 B;  3FBE A;  3PJX A;  4USJ C;  2W9A A;  4OLP A;  5A2Q U;  4TYB A;  1QTN B;  1YQH A;  1VYA A;  2DNO A;  1HQU A;  2GGP A;  2KKH A;  5F8H A;  4J9N A;  1IKX B;  3EX7 B;  1XMQ F;  4Z06 A;  2J76 E;  2W4C A;  3ETM A;  2MQQ A;  1QVG R;  3M32 B;  1YRT A;  4ZOS A;  3VAF A;  2V50 A;  5IZH A;  1T9W A;  3HT0 A;  3TZX A;  3TP2 A;  3CJK A;  4EMD A;  1O8J A;  3MFI A;  1AFJ A;  2GS8 A;  4Q2L A;  4C6A A;  2XTX A;  2J9D E;  1SH3 A;  1HWI A;  3LPY A;  3J7Z 5;  3KLE B;  5KG6 A;  4YS2 A;  4DV5 J;  4MIA A;  2R7X A;  4LRC A;  1S10 A;  1JLA B;  3K5N A;  7AT1 B;  4AQY J;  3BR8 A;  4NOH A;  3AQP A;  4IFV A;  4RJV A;  4I6A A;  3RBZ A;  1UCN A;  2KHD A;  3ENV A;  5LSO A;  2Y1J A;  2JWN A;  3PZP A;  4KFB B;  4YFU A;  1REV A;  2MKY A;  2VPW B;  2LVW A;  1FWP A;  3DLG B;  4RO0 A;  3D66 A;  1BHN A;  2PGC A;  3MTJ A;  4XOR A;  3NCP A;  4CLU A;  3QT7 A;  3DYA A;  1RA6 A;  1GTE A;  2E1A A;  3EJM A;  1LWX A;  3SQG B;  3VTI A;  2JHE A;  5CCM A;  2L41 A;  1VQ4 S;  4Q0B A;  3N9U C;  4DUY F;  4DV0 J;  3RBE A;  2R8J A;  2HS0 A;  3C19 A;  2E7W A;  3K8W A;  3ZZ0 A;  2J5A A;  2X6W A;  2HND A;  2XBP A;  3SCL E;  3T1Y F;  4KHP F;  3CJR A;  4F0M A;  2OAU A;  4Q43 A;  4ECW A;  1I94 F;  2HHP A;  1BY9 A;  3ET6 A;  4RBU A;  3KK1 B;  2WRM A;  4D3H A;  5L1K A;  1QDU B;  4Z05 A;  4LRD A;  2DHS A;  2CG4 A;  1WHY A;  2N7Y A;  1SL2 A;  4C8K A;  1J5E J;  1SC1 B;  3C14 A;  1LWC B;  1MRO B;  2ZZT A;  3HVW A;  5J2P B;  2R2T A;  1WHV A;  2CQG A;  3POT A;  4NEZ A;  5LXY A;  1BMQ B;  2W7P A;  5T7L A;  1Q1K A;  4ZP8 A;  1FDA A;  2PI4 A;  5KFB A;  4E2F B;  2W9C A;  3W2V A;  4B3M F;  5KFY A;  1RBO B;  2BW7 A;  2G0Y A;  4MR0 A;  1UEK A;  2DGS A;  2WON A;  3AD9 C;  4R8U B;  2YH1 A;  4M8L A;  3GIR A;  3NRB A;  2V8P A;  3AJ1 A;  3M8Q B;  2XSF A;  1DTQ A;  5KFX A;  2WVB A;  2X1F A;  2R4F A;  1GXT A;  2FGC A;  2G0C A;  2DRB A;  1H2U X;  3HMJ G;  2IM3 A;  5A8K A;  2ALZ A;  1IA5 A;  3FMB A;  2B7B B;  5K8M A;  1K44 A;  5DLF A;  4Q7A A;  3V6D A;  4DL4 A;  2OMO A;  4OI0 A;  1TUG B;  5D3G A;  4JI4 F;  2KJW A;  4USM A;  1PKU A;  2FLO A;  1C1C A;  4HEA 9;  3H90 A;  4NI2 B;  5DZ7 A;  2RNE A;  4PPZ A;  1RTJ A;  4RNM A;  2JFD A;  1S0V A;  2D9O A;  4ICL A;  2OD6 A;  2W01 A;  4QIW D;  3OR1 B;  3DLG A;  3R5A A;  1W2I A;  2M52 A;  3MMA B;  4RLE A;  4UF4 A;  2FY8 A;  1RYS A;  1C1B A;  2MXY A;  4W8S A;  3OTO J;  2CQP A;  3O2I A;  3V4I A;  2BJ7 A;  3I0R A;  2CAJ A;  4NEY A;  4P74 A;  4ZPA A;  1C0T A;  3M05 A;  1QCX A;  1Z2L A;  2YWW A;  4U67 Q;  3G86 A;  4YP3 A;  1FRL A;  4WFA Q;  1R8P A;  2ADC A;  3CC7 S;  1Q78 A;  3J7A N;  2F8E X;  2V63 A;  3KJN B;  4CNY A;  3WIU A;  1NH8 A;  4U7U D;  3LH2 S;  5HMZ A;  3TZY A;  2OPR B;  3R1H A;  5CYJ A;  2J6U A;  4PWD B;  1KDN A;  1TYU A;  2YXL A;  4P2S A;  4DSF A;  1DAR A;  2K1R B;  4J5O A;  3BGF A;  1KEK A;  4NLG A;  1VBL A;  1IBL F;  2GGP B;  1VQP S;  1KFS A;  1KD1 T;  2FVP A;  2BW2 A;  1O8E A;  3T19 A;  4IO9 Q;  1MU2 A;  3OFE A;  4U96 A;  1NBE B;  3HHD A;  2MYF A;  2NYH A;  4FYV B;  3QT5 A;  4KH0 B;  3EGW B;  5DGB A;  4Y0F A;  4BHQ A;  4QBU A;  5DM7 Q;  1VC6 A;  1K9M T;  3VMV A;  2ERR A;  2OLW A;  3GU0 A;  5EWE A;  4DSJ A;  4PPD A;  2Z2L A;  3BBC A;  5I3U A;  1K8F A;  5IT0 A;  4TNO A;  2WHO A;  3RUB L;  4OI2 A;  3AJ2 A;  4XL9 A;  3I96 A;  2W7O A;  1HW8 A;  2PO4 A;  1JNR B;  1XTZ A;  2ZJQ Q;  5I3U B;  3F44 A;  1LWE A;  1LKZ A;  4DR7 F;  3TA2 A;  2ZE2 A;  2XMU A;  5ETS A;  2W7Z A;  3ETO A;  2NSB A;  3OHA A;  2IBO A;  1HW9 A;  1NME B;  3DOL B;  4MYT A;  3LAM A;  4EWT A;  2PD1 A;  3NGD A;  5D78 A;  4HI1 A;  4YME A;  2BV3 A;  5ETM A;  3RB0 A;  1Y9O A;  4ZVO B;  2MTL A;  2VBZ A;  5KT6 A;  2BEF A;  3RYL A;  2G1H A;  1JLB A;  1RAA B;  4J9U E;  4TXS A;  2VA2 A;  1U2R A;  1VDH A;  2XSJ A;  3LPE A;  3MM9 B;  3MTK A;  3QZ8 A;  3HKW A;  4EI2 A;  1P1L A;  2JNJ A;  3MMA A;  1RU4 A;  4L74 A;  4M94 A;  2MJN A;  1HNV A;  4UUW A;  4DV3 J;  3FEX B;  2PYG A;  2IJN A;  1VQO S;  3M6V A;  3V6K A;  2CPF A;  3BSC A;  2DGX A;  4W98 A;  4AND A;  5C25 B;  2V4J A;  2PYH A;  1SC3 B;  3NBP B;  4LBI A;  5DZ6 A;  5MAO A;  1R89 A;  1VC5 A;  4NCB A;  2E1C A;  3C46 A;  1KQF B;  3A1Y G;  2F3J A;  2E5J A;  3SI8 A;  3MUR P;  3BSN A;  1DJ0 A;  4NCG A;  3DCA A;  3IAS 9;  1HA1 A;  4YEJ A;  1MW7 A;  3SEO A;  4ZLN A;  2R7U A;  2IIH A;  1YJ9 S;  2QYG A;  2DEI A;  4DUZ J;  4PCQ A;  3TZZ A;  4PMH A;  1FEE A;  4MKB A;  3AOA A;  3OTO F;  2UUB F;  1O5J A;  1UVL A;  4X4N A;  2CQB A;  1WOO A;  2RJZ A;  1N5T A;  1UTA A;  4LBP A;  3Q22 A;  3PET A;  1L5U A;  2E66 A;  4DV6 J;  1CJV A;  3GV7 B;  4QIV A;  3T9Z A;  5D77 A;  3W2V B;  2NS1 B;  4LSN A;  4J9P A;  3EVM A;  1FKP B;  4LVO P;  5HP1 B;  2OPQ A;  4DQI A;  2VJI A;  5IT9 U;  4K5R A;  2ZOF A;  4M5D A;  4DX6 A;  2OTJ S;  5D15 A;  3R7S B;  1N0U A;  5E3P A;  4JI8 J;  1TMJ A;  1NLK L;  5K5M A;  1O8D A;  3NEK A;  3J7A 1;  2DO0 A;  4KPY A;  2IA6 A;  1NZ8 A;  4DQS A;  4ZIW A;  1M5P C;  2BE2 B;  4F3Q A;  3SQO P;  1T3N A;  2UV8 G;  1EKS A;  2OPP A;  3G87 A;  1S99 A;  4KKO B;  4U7C A;  1NM2 A;  2OML A;  3DI6 B;  5F3T A;  3FEZ A;  3SV3 A;  3U1M A;  4CM0 A;  4IG0 A;  3EQO A;  1CJT A;  2ZD1 B;  4ED2 A;  2YKM A;  1TK5 A;  4LSL B;  3C2P A;  1QLN A;  3KOA A;  1FXL A;  3RR8 A;  1KC8 T;  1CS4 A;  2Z2Y B;  3WBZ A;  2GVZ B;  3CJ0 A;  4DWI A;  1VFJ A;  4H4K A;  2ZUA A;  2LDY A;  4QPT A;  3SSS A;  1Q53 A;  1VR6 A;  1NZA A;  1S1T A;  1U0S A;  3CCW A;  2F3L A;  4RBV A;  4XN0 A;  1JLQ B;  1HI1 A;  2BM1 A;  2YX7 A;  4OZ1 A;  1LW0 A;  1HHQ A;  4PUO A;  4QR0 A;  1ZAV A;  2JLG A;  1FJG F;  2XWX A;  2CFX A;  4BC9 A;  5C24 A;  3MM5 B;  2BAB A;  3O8W A;  4KJI A;  2ZD1 A;  4DX8 H;  1KOH A;  2VAS A;  5RUB A;  2ZJR Q;  2N4D A;  3DGV A;  2B5J A;  1QAY A;  5ETO A;  2PC6 A;  4AD6 A;  3DLL Q;  4XKV A;  1TFY A;  2KYZ A;  2KXH A;  2QFI A;  2HYI B;  2CYY A;  4USU A;  1JXL A;  3CCJ S;  4Y6I A;  4Y2I A;  1HIY A;  4ZLJ A;  2XCA A;  1OFM A;  3AHP A;  3RBX A;  1CPZ A;  2QIF A;  4K4S A;  2DGV A;  3GCX P;  4DDF A;  1UVN A;  3LA0 A;  2J0W A;  3MGJ A;  2Z8Q A;  1NHU A;  2I8E A;  3MEE B;  1YJV A;  2KDO A;  4NE9 C;  2YNG B;  4OYM A;  4TVA B;  3ISN D;  4Q2M A;  1WF2 A;  5E2Q A;  4JUZ A;  3UR3 C;  5HVG A;  3OJS A;  2YQ3 A;  4ECV A;  2FY1 A;  4M1K A;  3HSZ A;  3KUE A;  3ZZO A;  3EMT A;  4QZV B;  3LWM A;  3F73 A;  2J0Q D;  1L3K A;  2ZHB A;  2NT9 A;  5C5J A;  4LF5 F;  4ELU A;  2E5H A;  1NK0 A;  2CPH A;  4X4P A;  3AOC A;  4OMF G;  3Q8S B;  2BA9 A;  4FDF A;  3GR1 A;  1D9A A;  4TYA A;  4OPW A;  5KFE A;  3KLE A;  3JSM A;  3BJY A;  2AEF A;  4KKO A;  2NXE A;  2DR5 A;  4B3S J;  1RLD A;  2C3U A;  3AB2 B;  4USW A;  3VGV A;  4DPY A;  3NCQ A;  3A3O B;  2HHH F;  1U25 A;  4KYZ A;  4V19 J;  2U2F A;  4DFP A;  5DQI A;  1T9T A;  4ZIV A;  1FDD A;  2DJW A;  3UDV A;  3V4M A;  3PW7 A;  1KQK A;  2HSE B;  3MEC B;  4YB5 A;  1CVJ A;  3EVO A;  3MMC A;  4RNO A;  2WCX A;  4OYO A;  3KLF A;  1B4S A;  1XK8 A;  2V5I A;  3QLH A;  1RHQ B;  2VIH A;  1DBO A;  3NGS A;  4ZKA A;  3QGI A;  3SFG A;  4P7T A;  4USV A;  2G2O A;  2YH0 A;  5KFN A;  1SJ3 P;  2KZM A;  3MR5 A;  2YKN B;  3FCH A;  4Y34 A;  4OYB A;  4XKW A;  5HP1 A;  3Q89 A;  2VOD A;  3U1N A;  2V8V A;  2GVD B;  3AA8 A;  1X4E A;  1RAH B;  5C2G A;  4WZM A;  2GQQ A;  1XMB A;  3FJ2 A;  2AYE A;  3PV8 A;  8AT1 B;  3EGZ A;  4YZ0 A;  1AXQ A;  2EBG A;  4L3N A;  4B3T F;  1CJT B;  4R5P B;  1WC4 A;  2FC9 A;  3HVR A;  2DKO B;  4OYW A;  1EJ7 L;  4EO8 A;  4TLR A;  4P52 A;  2UXC J;  4C8Z A;  4XO0 A;  2FPH X;  4NXN J;  3GIJ A;  3PHT A;  3E8O A;  2J9D A;  2E5G A;  2DNQ A;  2HGN A;  2BQU A;  1AIR A;  1X5O A;  3Q86 A;  4W4M A;  3DDN A;  2DPJ A;  1IXK A;  1T02 A;  2GC8 A;  5IQQ A;  2OSR A;  1LV5 A;  2WSE C;  3JYT A;  4EZ9 A;  3J81 j;  1B70 B;  1RZM A;  2RHQ B;  4N56 A;  2W2O P;  3PJW A;  4HH1 A;  1TAQ A;  1Q81 T;  3DLE A;  2E7V A;  1KN6 A;  1TYX A;  1T8E A;  2HIY A;  2K7J A;  5LSR A;  5F41 A;  4YEL A;  1NND A;  1RLC L;  1YJT A;  1OFL A;  1CJV B;  3UQS A;  2BM4 A;  2P8I A;  3AXK A;  2B43 A;  2QLX A;  2ZC3 A;  4QR1 A;  1O8L A;  3D68 A;  4TU8 A;  3KHH A;  5G0R A;  3WZ0 A;  1VQ5 S;  3R5D A;  3GMG A;  4NYO A;  1TKZ B;  1S1U B;  3LF0 A;  2X85 A;  5I3Q A;  2CPI A;  4EFA C;  1Q7Y T;  4LFB F;  3KK3 A;  3K17 A;  3LP1 A;  5DGA A;  4GKJ J;  2LQB A;  4F0H A;  5DLG A;  4KSE B;  3B54 A;  4A8Q A;  3ELH A;  2JEI A;  1QVF R;  2OEM A;  2BAN B;  1EZG A;  2QMX A;  4KR0 B;  1FXR A;  2AT1 B;  4XNF A;  5DO2 A;  3CJ5 A;  4OYP A;  4J9M A;  1HR0 F;  4DX5 A;  1UPP A;  2QA4 G;  2C3O A;  3H5Y A;  4ED8 A;  3MAH A;  3R7B B;  4NZ7 A;  3B82 A;  4ZN1 A;  5BXI A;  1M5O C;  4KO0 B;  1SL1 A;  1IDJ A;  1AFI A;  2UVF A;  1HAR A;  2VDI A;  1S6O A;  3AT1 B;  3HFK A;  1RT2 A;  3T9N A;  4V02 C;  1RWP B;  4J37 A;  4DHV A;  1Q5Y A;  2FVQ A;  1J27 A;  5EHH A;  1YBA A;  3VAI A;  2V9W A;  1AB8 A;  4MAK A;  2VBY A;  3CWJ A;  3EUN A;  5DDQ C;  3LW5 C;  4PAA A;  4GC7 A;  5KG0 A;  5KFJ A;  2AWZ A;  2WK4 A;  5IWA F;  2ZH9 A;  3DOK B;  4DR3 J;  1PYT A;  1WG4 A;  1MWQ A;  2ZBQ A;  2ZBP A;  3UW0 A;  3G8Q A;  2PII A;  5KFZ A;  1KOO A;  5KFO A;  4QWA A;  1RHU B;  2AEJ A;  3PAC A;  3K5M A;  4X66 J;  1XC9 A;  4FBU A;  1I5O B;  1YBU A;  4UOC A;  3VZI A;  2W8K A;  2B0G A;  3OVB A;  2OJ3 A;  1DBG A;  1IBC B;  4ILR A;  4JV5 J;  3PDN A;  3QGH A;  3W2W B;  1HNW J;  2VBX A;  4JI3 J;  3CB4 A;  2HVE A;  3ZZR A;  3TVZ A;  1IUJ A;  4FYY B;  2WBM A;  2CWK A;  2PMZ D;  5KFL A;  3H0P A;  2IVF B;  2XT2 A;  4DUY J;  4PG7 A;  1T9U A;  4C97 A;  2DHH A;  4RW8 A;  1UA0 A;  1FEH A;  1H2V Z;  3CCZ A;  5F9L A;  3OVS A;  2E9T A;  7FD1 A;  2HAI A;  2VG5 A;  2HAF A;  3R6L B;  4ZP9 A;  1G3O A;  2VPX B;  2OO4 A;  3R97 A;  1SB6 A;  1DAB A;  2IMO A;  2UUA F;  2IM0 A;  3UDE A;  3CD5 A;  1RJJ A;  4Z37 A;  3W7B A;  1RWK B;  2QX3 A;  1BXN A;  1ZM2 A;  2QT7 A;  1Y00 A;  4ZPT R;  1H98 A;  1IR1 A;  3ISZ A;  1A6L A;  1RT1 A;  2R8H A;  2OKQ A;  1X9M A;  2VFR A;  4R5P A;  3GR0 A;  1S57 A;  4OX7 A;  2FHM A;  3OHB A;  2Q43 A;  4CLZ A;  4L76 A;  3VST A;  2ZJP Q;  1GNK A;  1U2F A;  1V5V A;  2C2M B;  2KXN B;  3M8P B;  1FWK A;  2C3M A;  2P9C A;  1FO1 A;  4OYX A;  4DQQ A;  1BN8 A;  2B4O A;  2GNK A;  2W2N P;  3OL6 A;  3LWL A;  1VQ6 S;  3Q8U A;  3OJU A;  2PEC A;  3GII A;  2V6A A;  1LNQ A;  1YJN S;  1TKX A;  2W25 A;  3GYG A;  1LK7 A;  3ILJ A;  4JOU A;  1X60 A;  3VR1 A;  1N0V C;  3VCD A;  1VBK A;  3AK5 A;  5A6W A;  2W4D A;  3MF5 A;  4RUA A;  3QLH B;  2HVI A;  2GHP A;  1VK3 A;  5I3P A;  3SYZ A;  1VQK S;  2GV1 A;  2XMV A;  4NLY A;  6AT1 B;  2ZEJ A;  5GAD I;  2FLN A;  2MKC A;  3DXS X;  3T5J A;  4O3S A;  1VMB A;  1Y10 A;  2BYC A;  3CJ3 A;  3KHR A;  1C4A A;  3AOD A;  4ZCL A;  2UUB J;  4HWV A;  2DB1 A;  3CUL A;  5D4L A;  5IOL A;  4WE1 B;  2VFP A;  3I9Z A;  3R3T A;  3CJ4 A;  1VQY A;  3MR6 A;  3T1A A;  3Q2T C;  1RTI A;  3CC4 S;  3H98 A;  3RAM A;  3FQK A;  3SQG A;  2HVH A;  3DFE A;  3NLC A;  1S1T B;  3A13 A;  3ITH B;  2I0X A;  2J8I A;  4HAC B;  5ITH A;  1OPZ A;  2KXF A;  4GVL A;  4DSE A;  2R7S A;  1S9E A;  3OVA A;  4MK8 A;  2VUG A;  4NLW A;  3QAU A;  4PAB A;  4CRJ A;  1R8A A;  2MST A;  2G0I A;  3GJS B;  5KFA A;  4C0O C;  3UI3 A;  1AUD A;  1LOU A;  4URQ U;  5HRO B;  2YKM B;  4Y65 A;  3UCZ P;  2H5E A;  5HJX A;  3MI7 X;  1GFW B;  4DUT A;  2O01 C;  2H4W B;  3OLB A;  3IM9 A;  1XN9 A;  5J2M B;  2DIS A;  4O3O A;  2HWT A;  2NST A;  3AA9 A;  1RHR B;  3N5F A;  4URG A;  1HBM A;  4C11 B;  1W25 A;  2X1B A;  3CCQ S;  3BBB A;  1HQE A;  2AF6 A;  2L3M A;  1RAC B;  3HHL C;  4KV8 A;  1TQL A;  4CLP A;  3K5P A;  3J7Z T;  3HXM A;  1N32 F;  1ZAW A;  1RT3 B;  2WW8 A;  1F9E B;  1KP6 A;  3QBC A;  4QIG A;  2XLJ A;  2D3O R;  4A8F A;  1S5Z A;  3LO3 A;  4JI2 J;  4QYZ K;  3KG0 A;  3CJ2 A;  5F0U A;  2RML A;  3DHW C;  3RIQ A;  2G13 A;  4ATN A;  1UMJ A;  1JLG B;  3JUR A;  2VB6 A;  3CDE A;  3IBC B;  4CM2 A;  1CQN A;  4CI0 B;  2DO4 A;  1AZS A;  2HRT A;  2QXZ A;  2Y0S D;  3BGR B;  4OL8 A;  1TSP A;  4I2P A;  4LJM A;  3Q8V A;  1NKB A;  3KK3 B;  2CUY A;  3NP5 A;  3GTY X;  2DK2 A;  4RW9 B;  1H6K X;  5DS7 A;  4MH8 A;  3BO4 A;  1Y0H A;  4PG5 A;  4LF4 F;  2D74 B;  1TVR B;  2LYV A;  2QLF B;  2AJ4 A;  2Y0B B;  3E01 A;  4BBY A;  4WTO B;  4ED3 A;  2UXC F;  5BYS A;  4K0K F;  5B7W A;  2IC3 A;  5HBM A;  3J7Y U;  4WU3 A;  1VK8 A;  1K0V A;  2UXB J;  1NSP A;  1RWU A;  5KG4 A;  1N52 B;  3MOZ A;  2PMW A;  3GFH A;  2MKI A;  3C66 A;  3Q8Q B;  4OYZ A;  4PG6 A;  5CAB A;  2I5J A;  1I94 J;  2XB2 D;  1ZPV A;  1SC6 A;  4FZV A;  4IH6 A;  3ZPP A;  2KRB A;  4JI2 F;  4FF2 A;  4IYQ A;  2QO3 A;  3PG9 A;  3TAN A;  5LL6 d;  1U1P A;  2CVI A;  3QWU A;  1YDL A;  5KAK A;  3MAQ A;  2VQF J;  4DLG A;  1T05 A;  2VA3 A;  3UVJ B;  3HO1 A;  5IT4 A;  4YHH F;  3P4G A;  1IBM J;  3OTD A;  2FZC B;  4LR9 A;  3P5B P;  4ZMM A;  1UKU A;  2UU9 J;  3D54 A;  3DLH A;  2MLX A;  2ZH3 A;  1YLX A;  3US5 A;  5H9F J;  2X6Y A;  3WDO A;  3ZTQ A;  2M70 A;  4WTY A;  4YEA A;  2MZS A;  4MFB B;  5HK4 A;  1K4Z A;  1FX4 A;  1WSR A;  3BKT A;  3GG1 A;  1QAI A;  4NLP A;  2CPJ A;  2N4C A;  4ZHR A;  4LF4 J;  1E6Y B;  4DR1 J;  4ENO A;  3ZXW A;  4DF8 A;  2GAG C;  1RGV A;  2DCU B;  4GVB B;  1JJC B;  4M5J A;  3RRG A;  1U7L A;  2YX1 A;  4J91 A;  3LAK A;  2UUW A;  3WQP A;  2N7C A;  2KM8 C;  2R9L A;  3FVY A;  2GJI A;  1RUS A;  2A10 A;  2CKW A;  3N4W A;  1TR0 A;  2GQC A;  4YR2 A;  1RCO B;  4NA2 A;  2YKA A;  2O0V A;  4Y28 C;  4ZK7 M;  4OJP A;  2LQ9 A;  4C9D A;  3RU0 A;  2RD5 C;  3VGT A;  2JSX A;  3M8Z A;  3MAA A;  3W64 A;  2KZZ A;  1KVI A;  3CJ8 A;  3EZO A;  5H9F K;  1LW2 B;  3NMR A;  4Z7Y A;  2CQD A;  3DRP B;  5HJY A;  5LMU J;  4ED0 A;  1PE9 A;  5H9E K;  2FTR A;  1Q8L A;  2ZWO A;  2HNY A;  1S72 S;  2BRK A;  1SC4 B;  2HQD A;  2YNH A;  1SKR A;  4YCQ A;  2YKP A;  5BR8 F;  2JOQ A;  5F8J A;  1BC6 A;  4KQZ A;  1TV6 B;  4B17 A;  2NZ4 A;  1EET A;  2E1R A;  1F3V A;  2M88 A;  2C42 A;  5HAN A;  2ZM6 F;  2YNF A;  3ILL A;  2YWE A;  2WVD A;  2AQ4 A;  2ZOM A;  1YWX A;  3VMW A;  2PI5 A;  3E3X A;  4CO5 A;  3BSO A;  4U49 A;  2DGT A;  4F50 A;  1URN A;  1AW0 A;  1H72 C;  4HHJ A;  3I55 S;  2JZ5 A;  3BPD A;  3SYJ A;  3I87 A;  3K59 A;  4PQA A;  4JI7 F;  1MLA A;  2L9W A;  3T5H A;  2EW9 A;  4NCA A;  1S1X B;  4W8Q A;  1VRU B;  1R7I A;  4ECZ A;  2LXU A;  2HWH A;  1RCX B;  2FYX A;  1U0H B;  1FK9 A;  1H7X A;  2I2Y A;  4MFB A;  4H4O A;  2XWY A;  2WBR A;  1Y5I B;  2NPF A;  3T5L A;  1HBM B;  2MKH A;  3W8P A;  4C11 A;  1UAW A;  2AKW B;  1TK0 A;  5LMU F;  2DH7 A;  3FCV A;  1QM9 A;  2CNL B;  2X51 A;  4QR2 A;  2CZ9 A;  4ED4 A;  1YTY A;  3PO5 A;  4N76 A;  3S6E A;  4K4U A;  1TEL A;  1NK6 A;  1NRK A;  2HMI A;  4OX9 F;  5EGY A;  4MT1 A;  2BKO A;  3ULH A;  4K4X A;  2C1E B;  4YB6 A;  5DDP C;  2D1C A;  2OHD A;  1OSC A;  1N36 J;  1M0S A;  1GK8 A;  3CO0 P;  2K3K A;  5LXR A;  4NX9 A;  3D4J A;  2HFV A;  1WWH A;  2QSW A;  1YSJ A;  3NGU A;  1HHS A;  1WDT A;  2BKN A;  3IGV A;  4YY3 F;  3LGM A;  3N01 A;  2JRS A;  1CQM A;  3DKD A;  2APO A;  2HNZ A;  2F9D A;  4H4M B;  5CZX A;  4NI2 A;  3MPU B;  4IG0 B;  3MUM P;  3M7V A;  4OLO A;  4UZB A;  2JH3 A;  5A76 A;  4MJK A;  2HNZ B;  2A0F B;  2CDR B;  2ZKU A;  4H4M A;  1X4G A;  2OPS A;  2CJA A;  4OI1 A;  5L38 A;  2EFG A;  3NXZ A;  3G6X A;  4J9R A;  5I4M A;  1WF1 A;  1VBX A;  4DU8 A;  4HKQ A;  2HHS A;  1RTZ A;  4DSK A;  1KQS R;  2AJQ A;  3GYX B;  3V5R A;  1FNO A;  5DQH A;  2HZV A;  2M2B A;  1F1B B;  2QL5 B;  4BDP A;  4O3R A;  2FJW A;  2MGZ B;  1HMV B;  2VF3 A;  4QWC A;  4XR6 A;  1TP7 A;  3PTW A;  1BQM A;  5KT4 A;  1CC8 A;  4DV2 J;  2AX0 A;  2HQF A;  4OYI A;  3WIV A;  3GQC A;  1TKD A;  5DG8 A;  4URR A;  1KR4 A;  3PEH A;  5C42 B;  4B3M J;  3T1H F;  4NML A;  1HMV A;  1VQS A;  2RKI A;  3JQM A;  3KNG A;  1N5Y B;  4DSL A;  3SSR A;  4J9V A;  5IM0 B;  4L72 B;  2EFQ A;  4KBI A;  1EZZ B;  2LDI A;  3POT B;  3LUY A;  3W62 A;  1CG2 A;  3FNN A;  1R43 A;  1UET A;  3ZTS A;  4Q8F A;  4B9M A;  1P1T A;  1G1X A;  3EE3 A;  4F4Y A;  2FIU A;  4CT8 A;  3LP0 A;  4KGK A;  2XLI A;  1JWW A;  2UUA J;  2AJ1 A;  2CXE A;  2ZFH A;  2XMM A;  2DVI A;  4C2M A;  4X4S A;  3E2E A;  1HL6 A;  3GRH A;  2EKN A;  5KOX A;  2AJF E;  3M8S A;  3GV5 B;  1TL3 A;  3TJ8 A;  5AJ3 F;  3EVW A;  3JB9 k;  2NQP A;  2Q6B A;  4UZC A;  4L6V 3;  3BDE A;  3BF4 A;  1P27 B;  4M5K A;  4AE5 A;  1VLO A;  3WX4 A;  4DQP A;  1VLY A;  1G6B A;  2QJ3 A;  3MWB A;  4UW2 A;  4LF7 J;  4LF9 J;  3VF0 B;  2MSS A;  2DHG A;  3MMB B;  4WK3 A;  1S6P A;  3CCM S;  1FD8 A;  1B0P A;  2DR6 A;  1FHT A;  3IAM 9;  4DL2 A;  1TKT A;  2FHJ D;  2YNH B;  5E7O B;  3I56 S;  1GQE A;  4C7Q A;  3HD1 A;  5L1I A;  1SUQ B;  3PYD A;  4IG3 B;  2DH9 A;  3DI6 A;  1TV6 A;  2HHW A;  4WWS A;  4K50 A;  1EE6 A;  2F65 A;  2NTB A;  2B51 A;  4LUB A;  4MYU A;  1ZZN A;  1VQN S;  5HI7 A;  1DQ8 A;  4HTI A;  2VL1 A;  1S48 A;  5CYQ A;  3GIK A;  4ERD A;  4GKK F;  4WXO A;  4QW9 A;  1BWE A;  1KWM A;  2KYX A;  3JXO A;  2AX1 A;  4TU9 A;  2KFZ A;  1FJ7 A;  2DT9 A;  2V34 A;  4DL3 A;  1IR0 A;  2DEJ A;  2VHG A;  1IVZ A;  3TAQ A;  4QU6 A;  2E1M C;  3I31 A;  1JKH A;  2P9E A;  3RRK A;  2FJA B;  4CCH A;  2UXD F;  5MLC V;  3HJV A;  3EQN A;  1F5B A;  1KQ5 A;  1UW9 A;  2GMJ A;  4O0I A;  2XC1 A;  1OIA A;  1VIX A;  2IFX A;  2RDD A;  3K5O A;  4U4B A;  3QGG A;  5AXL A;  2LEC A;  2VIC A;  3T5K A;  2ATC B;  4ZHR B;  4IR9 A;  1K5C A;  2IRY A;  2QE5 A;  3UD5 A;  1SQF A;  2QL9 B;  3FGV A;  4DR6 F;  1RHJ B;  4GVB A;  2DRA A;  2MZQ A;  2B0R A;  1RKJ A;  2X3G A;  3BS9 A;  3AJD A;  4I6Y A;  2MJU A;  1AA1 B;  2ZBR A;  2DYA A;  3HPO A;  1IQZ A;  3WHI A;  2L9D A;  2YWG A;  4DJB A;  3H2L A;  3MM8 B;  5IV3 A;  5JJB A;  3CO9 A;  1C0U A;  1XR5 A;  2R2R A;  4DV7 F;  1RA7 A;  4ZP7 A;  4K4W A;  4C0H A;  1YJW S;  2RRB A;  4K59 A;  2OIH A;  3FQL A;  4DXL A;  1PSD A;  1I1G A;  2XG8 A;  1ZS6 A;  3D1O A;  1X4B A;  2QMU B;  1FKA F;  3QNW B;  4P71 A;  1OGO X;  3QWP A;  1FNM A;  2LEB A;  3RAQ A;  2VFU A;  3N90 A;  5F8L A;  1XNQ F;  3OFG A;  4Y00 A;  3OFH A;  1QTM A;  1IKW A;  3QIP B;  6FD1 A;  2ZOG A;  3KLF B;  1RTH B;  1DRZ A;  4CLY A;  1G2E A;  2DGU A;  1SVD A;  3N6L A;  1C1C B;  5GAD U;  5A8W B;  2IC3 B;  9ATC B;  4XM3 A;  5HBM B;  4EYI B;  1NJY A;  3CC2 S;  4XDD A;  1D1U A;  2ZBC A;  1S0N A;  1NDL A;  2UV8 A;  1TVR A;  3E01 B;  3KG1 A;  2YBV A;  3RAX A;  1YZ7 A;  2B4P A;  1JNZ B;  3QSI A;  5ETK A;  1HBN A;  2ASY A;  3TJ9 A;  3CXC R;  4I67 A;  2NZM A;  2QTW A;  1HFE L;  1Y3J A;  4K4Y A;  3SCK E;  3TAP A;  4LF9 F;  3S1T A;  4R25 A;  4XTT A;  2AJ2 A;  4ZPD A;  5KFF A;  2B7C B;  5M2P A;  4DV4 J;  1XMO J;  1JJ2 R;  1FRM A;  1S6Q A;  1QQ1 A;  1RWR A;  2ZVS A;  3DLK B;  3G8T A;  4Q0B B;  4OJO A;  1RDR A;  1HBO A;  1UWB B;  4C3M A;  2VFM A;  2K8G A;  3MCN A;  1APS A;  4Q44 A;  4IFY B;  5B0A A;  4ZPB A;  2X6X A;  3FSI A;  4H54 A;  2ALY B;  4M5H A;  1S9F A;  5KT5 A;  1VIO A;  2PDA A;  1TL3 B;  2ZNZ A;  1X4H A;  1D9F A;  2WW4 A;  3NWR A;  1DAX A;  2IYI A;  2DGW A;  3OTE A;  1ZBT A;  2I38 A;  2IAJ B;  2QL7 B;  2D3O 1;  2NRE A;  4LF6 J;  3DU1 X;  2V2Z A;  2RS2 A;  4IRC A;  2AD9 A;  1ZOT A;  1TYV A;  2GQ2 A;  3C6U B;  1ZPW X;  1B0V A;  1OYE A;  2VD3 A;  1SPB P;  4PWU A;  5K20 B;  3J7Y I;  3A3P B;  3D5M A;  5JXS A;  5D4P A;  1TYW A;  2PA3 A;  4NLR A;  2KG1 A;  3CCE S;  1VQ8 S;  5IFM A;  4K8R A;  2PE8 A;  4I68 A;  3IWN C;  3OXG A;  4ZPV R;  1QE1 B;  3MHY A;  1IKV B;  2HLU A;  1NUE A;  2ILY A;  3G6E S;  4DV2 F;  2UZA A;  1NK9 A;  2Z2M A;  4OHZ A;  5JMC B;  3GG0 A;  3PW4 A;  3MR7 A;  1F60 B;  3BGR A;  1RBL A;  3AB4 B;  1NU4 A;  4ZVG A;  3JSB A;  3GE9 A;  1U6Z A;  4CWB A;  5KT3 A;  5F8G A;  1OY6 A;  1XBW A;  2O66 A;  1PJ7 A;  1MN9 A;  4ID5 B;  2AEM A;  4W92 B;  2Z4P A;  3RRH A;  4P72 A;  5CH7 B;  1VQ7 S;  4ELV A;  1WI8 A;  2KFY A;  1JLA A;  4M95 A;  3ZSC A;  1WXR A;  1WUU A;  3MPY A;  3NS6 A;  4AYB D;  4UY8 T;  1UP1 A;  4Z7C A;  2CJK A;  2BJ1 A;  4X84 A;  2VOP A;  3SDE A;  4RKU C;  3WWG A;  1RAE B;  1LK5 A;  3DLJ A;  5THW A;  4WFN Q;  2VG6 B;  3HSD A;  4DL5 A;  1XNQ J;  3H5X A;  3QRP A;  2MZT A;  1FD2 A;  2J7U A;  3DOM A;  4DI6 A;  4FVM A;  4X4V A;  5F0W A;  2O04 A;  4YC5 A;  1RWW B;  3TEG A;  4OZ3 A;  1GMW A;  3D0H E;  4OFZ A;  4PWD A;  4FYW B;  4KTQ A;  1MML A;  2DNZ A;  2DRD A;  1FFS B;  3IXQ A;  2Y1I A;  1UZH A;  2BJ9 A;  3J81 U;  3MM5 A;  2ZZN A;  2HS3 A;  2P6T A;  1SBR A;  5K8P A;  2ZM6 J;  1ZYQ A;  3NB2 A;  1VC0 A;  1R0C B;  2NR0 A;  3VHQ A;  4ID8 A;  2QY1 A;  2RKI B;  3W66 A;  4RW6 B;  4X64 F;  1HHT P;  5FII A;  1U1O A;  2CPZ A;  1SQG A;  4RW4 A;  4F4K A;  2ATL A;  1Q0N A;  1Q95 G;  1PJ5 A;  4ZVS B;  3GCW P;  1S59 A;  4I7F B;  5E3C A;  4QWD A;  4DR2 J;  3C15 A;  1NDP A;  2PFD A;  3SCJ E;  3KDO A;  2P6S A;  1RP5 A;  2ACY A;  2RHS B;  3CT9 A;  3FBC A;  4O23 A;  1RTJ B;  3IN5 A;  2ROE A;  5CD4 H;  3G71 S;  3R2D J;  2G2Z A;  8RUC A;  4QJV A;  3HJF A;  4P2X A;  2R2U A;  1YKW A;  2ZHO A;  2C22 A;  1JJH A;  1NK5 A;  1JIH A;  4PWW A;  3BO2 A;  1X9S A;  5D4O A;  4X62 J;  1SIZ A;  3JSM B;  4EO6 A;  2E5L F;  1RHK B;  2CVE A;  2B9E A;  3CDW A;  4EK2 A;  4WFB Q;  2V4Q A;  4OYA A;  2AYM A;  4WK1 A;  3MOJ B;  5EX0 A;  4C8N A;  3CD7 A;  1M1H A;  4ZVU B;  3LMW A;  2WTF A;  2KL8 A;  5L46 A;  3V81 A;  1XR6 A;  4OJ5 A;  1MWZ A;  4KHM A;  2BZ2 A;  3MM9 A;  1HNZ F;  2H5I B;  3GQA A;  2KI2 A;  5D6G A;  1NHK L;  1FKP A;  1QSY A;  2RUS A;  1X0C A;  3NAW A;  5ETL A;  5AXK A;  1NSA A;  3O5T B;  3JAM Y;  1T03 A;  5AMV A;  1O0P A;  5KG3 A;  4J9S A;  5DDR C;  1K73 T;  3DRR B;  5T41 A;  4C2L A;  2X3H A;  4ZCI A;  3P45 B;  4NK6 A;  1K47 A;  2HNY B;  2OPS B;  4KAI A;  4C98 A;  2AGP A;  3KLH A;  1PO6 A;  1WAC A;  2YWF A;  6FDR A;  4FXD A;  1S1W A;  1Z2Z A;  3ET6 B;  4FP9 A;  5CCL A;  4B3R F;  3ZFV A;  2ADB A;  1DLO A;  1OY8 A;  4ILM A;  2IAJ A;  2YX4 A;  3IR6 B;  4TKT A;  3UD3 P;  3EXC X;  5L39 A;  3GV8 B;  2UVV A;  1WNE A;  5HL7 Q;  2ASJ A;  5KFI A;  2W2Q P;  3NCR A;  5C1E A;  2BR0 A;  3KMQ A;  3DYA B;  1F3F A;  1JTA A;  4TN2 A;  1FDN A;  3U27 A;  3OTC A;  3C16 A;  3UDL A;  1FER A;  4DBQ A;  4AL7 A;  4NLQ A;  4CT9 A;  1CJK A;  1NAQ A;  3DGP A;  1OQ6 A;  3HUL A;  1LWF A;  4ZVF A;  3P8B B;  3D6M B;  3T1H J;  2H5J B;  1CJU B;  3UD4 P;  1X0P A;  3RB6 A;  4NYP A;  4YUD A;  4LSL A;  1IWA A;  3L09 A;  3ZO7 A;  3MR2 A;  1H80 A;  2WOM A;  2VU5 A;  1FX2 A;  2RQ4 A;  2GHV C;  5I42 A;  3OFF A;  5EDW A;  1GH8 A;  1B7Y B;  1HNX F;  2VOO A;  1WKK A;  4QU7 A;  3MEK A;  3F0N A;  3PEJ A;  2BE2 A;  4P73 A;  1CUL A;  4ITS A;  1SV5 A;  2R2S A;  2V4R A;  3H59 A;  1GXL A;  3IRW P;  4IRK A;  1N33 F;  4YFO A;  4P7V A;  2JC1 A;  2XYG B;  4RUH A;  4NA3 A;  2YKQ A;  1U1K A;  1IKW B;  1NXI A;  3O3L A;  3M6X A;  3I0S B;  4ICL B;  3IMQ J;  3R7N B;  2DNM A;  2ZBI A;  2XT4 A;  2B3T B;  3K8V A;  4ES3 A;  4LFC J;  5KTQ A;  4MKY A;  2DNN A;  4ZA1 A;  1N4L A;  2J9C A;  3CDB A;  4KE5 A;  4LFA J;  2XTJ P;  1M5H A;  4U95 A;  3FDS A;  3CUN A;  4IOA Q;  3QGP A;  1F5C A;  4I2Q B;  4DMZ A;  5FDL B;  2YNF B;  4O3N A;  4QIE A;  1PIE A;  1J5O A;  1VBY A;  3OSN A;  3LP1 B;  2F8H A;  4J9O A;  1U09 A;  1LLZ A;  3R6G B;  4N8O A;  4ED6 A;  3NGT A;  1LM1 A;  3M2V A;  3MM7 B;  1E6Y A;  3AQO A;  1S6Q B;  2K2P A;  3DLK A;  2B4V A;  2HBY B;  2HUR A;  4IOB A;  3NNH A;  1SJR A;  3DNC A;  4OM9 A;  5L8R C;  4OQJ A;  4RWX A;  4CO1 A;  2CWX A;  2RIL A;  4M5N A;  1NCL A;  2PA8 D;  4PXD A;  1DQA A;  2JDJ A;  2RQM A;  3UW1 A;  4LF5 J;  1CEZ A;  3LOU A;  3QIP A;  4I2Q A;  4U9R A;  2WZ1 A;  3N5B A;  1FRI A;  4BWJ A;  4JV5 F;  4HDH A;  4KHP J;  4LR8 A;  2EWH A;  1NHC A;  2OEL A;  3NOG A;  5A8W A;  4WP3 A;  3C14 B;  1RXO B;  3BB5 A;  1Q82 T;  5KFC A;  1K1S A;  2CJ9 A;  2HGM A;  2QMW A;  2GJ2 A;  4NWB A;  3W9H A;  3KMS A;  4ZCM A;  3VAJ A;  1X4D A;  2VFT A;  3OL9 A;  4YDX A;  3PX6 A;  2HEK A;  1M5K C;  4ETX A;  4S0M A;  3JSR A;  3KUG A;  4RU2 A;  9RUB A;  2KVI A;  2J8K A;  1QA3 A;  2HND B;  2Y1L B;  4JV0 A;  4MIB A;  5GVQ A;  1RT4 A;  2BE9 B;  2C28 A;  1YHQ S;  2LMI A;  1IQT A;  4K4T A;  3THV A;  4CH7 A;  2ZH1 A;  3R5J B;  5AT1 B;  1DBD A;  1TUV A;  2OFH X;  2HIQ A;  4XON A;  2EI5 A;  2X7I A;  1L3V A;  2DNY A;  2Q79 A;  4MTP A;  2NTQ A;  2H3E B;  4NAS A;  1IWG A;  1FES A;  3ENW A;  4I7F A;  1SQE A;  2Z57 B;  3UWT A;  3WC0 A;  4DV1 J;  4DSI A;  2CIM A;  4LVN P;  2BM7 A;  1R8C A;  3T41 A;  4NLT A;  1R3N A;  1XQI A;  4DV6 F;  4RPF A;  4XOP A;  3GFY A;  1RMG A;  1VHF A;  2FHJ A;  5KFH A;  3G6V A;  4IQX A;  3CCS S;  2GMH A;  1NHV A;  3HHL A;  4LMZ A;  1RTD B;  1OY9 A;  1FT8 A;  1NH7 A;  4KV8 B;  1FKO B;  3OL7 A;  2HBQ B;  1Q8I A;  1WC1 A;  3TNV A;  7FDR A;  5B08 A;  1WDD A;  2CNN B;  2BJ8 A;  2OEK A;  3MEE A;  3MUV P;  4P2M A;  3HT3 A;  2IOU G;  1RT5 A;  4JBC A;  2ZHA A;  2M8H A;  4FS2 A;  3FSX A;  3OR2 B;  1OMS A;  1EB0 A;  1I3O B;  2E5L J;  2ZKT A;  1KHW A;  1HWL A;  3LJY A;  2LXF A;  2R42 A;  3M1V B;  1PBU A;  4J7C A;  3TWZ A;  4DU7 A;  3W63 A;  4E8U A;  2BAC A;  4LQ3 A;  1ZAX A;  4L73 A;  1FWL A;  4OJ6 A;  2WVE A;  3I4P A;  4RNH A;  2BQR A;  1NSQ A;  4RBT A;  1H7W A;  2BBE A;  3ZZZ A;  1LFW A;  2LU2 A;  2DCL A;  1JK9 B;  2VFQ A;  3IWX A;  1D8Z A;  2VFV A;  4Y3C A;  1YJU A;  4NL5 A;  1F6T A;  1RQ0 A;  2KM8 B;  1XIQ A;  1PAU B;  3NOC A;  3K7R A;  2BXJ A;  2A6M A;  1TMM A;  3TQE A;  4JI1 J;  4W8R A;  4DQR A;  3CJT A;  1RTI B;  2F4F A;  4EBC A;  4JI6 F;  1XNR J;  1T3O A;  4PQU A;  4DZD A;  4FVC A;  2IDL A;  1RAD B;  4L3K A;  3UNG C;  1LLW A;  4RL1 A;  3N6Z A;  1VJQ A;  2J0X A;  1LXJ A;  3BSA A;  2IQ7 A;  4G1Q A;  4F7V A;  1KLN A;  4HLB A;  2F5G A;  4FYX B;  4YR3 A;  4GRS A;  4RW8 B;  4PYA A;  2XY7 A;  3HD2 A;  4AVZ A;  2ZDO A;  3VAG A;  2UU9 F;  4FBT A;  4CLS A;  2HK2 A;  1KLM B;  2WB1 D;  4RX6 A;  3UR0 A;  3HDS A;  3LAN A;  1NB2 A;  1FKO A;  1T03 B;  1XWL A;  4M5D B;  4K4Z A;  4O4G B;  5IM0 A;  1NKE A;  1TL7 B;  3B4D A;  1YX2 A;  3FRY A;  3NAH A;  1YJR A;  3HSJ A;  5IWA J;  1V6H A;  3UN2 A;  4I6W A;  4IO1 A;  4UTG A;  1O8M A;  1RAJ A;  3FSY A;  3NNA A;  4LBH A;  4WU2 A;  4XMY A;  4HT5 A;  3B78 A;  4NMX A;  3TRG A;  3TVY A;  2N3O A;  3AAW B;  4WE1 A;  2R8G A;  2G1D A;  4B3S F;  2VFO A;  4PXB A;  3TYT A;  1SCJ B;  4OV6 A;  4A8M P;  4B3O A;  1HNW F;  4DV7 J;  4J90 A;  4DCO B;  1E6V A;  3T1Y J;  1BQN B;  2NXU A;  1X4F A;  4CYU B;  2KH9 A;  1QUV A;  2IRX A;  5DQG A;  4DR5 F;  4CQ1 A;  4LRF A;  2COL A;  2KT3 A;  2LP4 A;  1FRH A;  2KJV A;  4PR6 A;  2YQ0 A;  4KO0 A;  3PKY A;  2HHU A;  2BM6 A;  4X4U A;  2FC8 A;  4ECS A;  2FDN A;  2I9S A;  3EPG A;  5K8N A;  1V3Z A;  2EEY A;  2DY9 A;  2KHC A;  1R0B G;  2MMY A;  2XMJ A;  4FPI A;  4KFB A;  1N48 A;  3NWG A;  1UVM A;  5B0F A;  2KFN A;  4WZQ A;  1T11 A;  3C6T B;  1OPI A;  3MFH A;  2JVO A;  2HMI B;  2BKP A;  3AOB A;  2VQF F;  4B9L A;  4LF7 F;  3R5G A;  1NJI T;  1EET B;  1OYD A;  4RW7 B;  3IWL A;  1IM4 A;  4XAK A;  2H51 B;  3MZI A;  4WYW A;  4Y2C A;  5BYR A;  2DXF A;  5LT5 A;  5F8M A;  1TKZ A;  4DZ6 A;  2DGO A;  1Q8B A;  5HVH A;  3PCO B;  5B0C A;  5HN0 A;  3KHG A;  1JXV A;  2OH2 A;  5HMX A;  1S1V B;  2YNI B;  2K7K A;  3DOK A;  2I6W A;  2XLK A;  3B90 A;  1NJZ A;  3W3S A;  1Q86 T;  1LW2 A;  1XNR F;  4H4O B;  2A3J A;  2F8M A;  1SH0 A;  3PYF A;  3J81 Y;  2LKZ A;  2LQ5 A;  3OLA A;  3D67 A;  1RTD A;  1KFD A;  3PVX A;  3H20 A;  1RWO B;  2LFV A;  4A47 A;  4X4Q A;  3H25 A;  1B99 A;  1U49 A;  2HHV A;  1QD1 A;  3FMW A;  1H0H B;  1RAB B;  2VPY B;  2IDE A;  3P5T L;  2QLB B;  2QV6 A;  4U6P A;  4YHH J;  4DS5 A;  1A9N B;  1N54 B;  2BJE A;  4I0W A;  1HBO B;  1QY7 A;  3A8I A;  1IJE B;  2IVM A;  2WAQ D;  3O1L A;  4OZ2 A;  3Q24 A;  1X5T A;  4MMO A;  3PRV A;  2JX2 A;  1YG0 A;  3A8E A;  4KGM A;  3T9G A;  1CUL B;  4IQM A;  3IRX A;  2XI2 A;  1YGY A;  3JS9 A;  1MU2 B;  5A8R B;  1JJ4 A;  2WSF C;  2H1Y A;  4USH A;  2GFF A;  3PYG A;  3QJP A;  3HFV A;  2MHN A;  4DS4 A;  4WBF A;  2ASL A;  2A2D A;  4YZX A;  1F5A A;  1JLC B;  4DF4 A;  5CHC B;  2AYB A;  3C6T A;  3ILI A;  5IC4 B;  1P6T A;  5G4D A;  4WCE Q;  2IYG A;  1D0E A;  2QX0 A;  1Z1Z A;  4AT1 B;  3SQV A;  4PXE A;  4YZQ A;  2NCK L;  4GMK A;  4C3L A;  2MKK A;  2YKN A;  3PM9 A;  2QA2 A;  3DRY A;  1YRX A;  2MEW A;  2LQJ A;  3HM9 A;  3KTQ A;  4FN5 A;  3L3C A;  3WC2 A;  1PIL A;  1BLU A;  2V69 A;  2B9Y A;  3H2V E;  2FLL A;  4DR5 J;  5AJ3 J;  3DDI A;  4WII A;  2U1A A;  4CTA A;  3HHL D;  4JB8 B;  3D6T B;  4DX7 A;  2Q6C A;  4C8Y A;  3NNC A;  4K4V A;  1YI2 S;  1ZZF A;  5KFD A;  1H38 A;  3PRB A;  1S1W B;  2WVC A;  3PW0 A;  2R3V A;  1S1V A;  2YNI A;  3LGH A;  5BR8 J;  4TU7 A;  3Q8R B;  4NA1 A;  4P2F A;  1UFL A;  1JXE A;  1N34 F;  1O8F A;  4X4O A;  1ULR A;  3PXG a;  1UEU A;  2AHO B;  1UFK A;  4OI4 A;  3SFU A;  5A8K B;  3PIO Q;  1FTC A;  3CE8 A;  2RRA A;  4CO0 A;  3G96 A;  2XMA A;  2JEJ A;  4ED1 A;  2Z8G A;  5J1N A;  2XHC A;  2CQ1 A;  3B8H A;  5FDL A;  3VZH A;  4ZLP A;  1D9D A;  4B08 A;  5CA5 A;  5GMD A;  4RZR A;  2KN4 A;  3D6H B;  4NZ6 A;  2HWI A;  2CQ0 A;  3V4I B;  5EWF A;  5J2P A;  4YB7 A;  3I6P A;  4XLC A;  2H4Y B;  3B8Y A;  2YY3 A;  4A8S A;  2B6A A;  1YRU A;  3DU6 A;  2RAQ A;  3PR5 B;  1P9Q C;  4LR7 A;  5LMN F;  2V9K A;  1KNZ A;  2BJD A;  3BH6 B;  1NKC A;  1M5V C;  5FD1 A;  3D7S B;  1FE4 A;  1OGM X;  2R7R A;  3BGO P;  2IMW P;  1HG8 A;  3MM6 A;  3CD0 A;  2VZ9 A;  2DH8 A;  3S8S A;  4F0K A;  2UVU A;  4KHR A;  4FPR A;  3K58 A;  2QSF A;  3A8J A;  3HFZ B;  4CH0 S;  1Y7P A;  3VGU A;  4ZIT A;  5DDO C;  1SKW A;  5L9X A;  4DN9 A;  4FS1 A;  4F67 A;  1E6V B;  1RWX B;  2ZDP A;  1SUQ A;  2WVF A;  3ZZP A;  3DRS A;  3MCM A;  3T6B A;  2MPU A;  1FRJ A;  1S9G B;  5A6P A;  4X2B A;  3RZA A;  5KFP A;  4EW9 A;  3TJA A;  4OI3 A;  3W9J A;  4LRE A;  4FF4 A;  2FZG B;  2RU3 A;  2WB4 A;  4RW4 B;  1IB4 A;  1U8W A;  3D0G E;  5KFW A;  4QIF A;  3BR9 A;  5HSP A;  4RNF A;  4KH3 A;  4P75 A;  1L1I A;  1TUW A;  1MMD A;  1QE1 A;  1WC5 A;  3MED B;  4TQS A;  3GIL A;  2W2M P;  3Q8Y A;  3CNQ P;  3Q0A A;  4IOC Q;  1N56 A;  5HMY A;  4A8O A;  1WEX A;  3DRS B;  2MY7 A;  3TA1 A;  2VBE A;  3U1L A;  5GAE U;  2DTJ A;  4G6V B;  4RWW A;  2GIR A;  1U24 A;  3G82 B;  3BH7 B;  2O5D A;  4M5M A;  2NPI A;  3OR2 A;  1RAO A;  4C0B A;  3LAL A;  1ICE B;  5CXT A;  2D41 A;  3OD2 A;  4U8V A;  4ZVT B;  5HRO A;  3SDE B;  1NDC A;  5LJ3 Y;  1X0F A;  2HHX A;  3CDU A;  2LEP A;  1OSD A;  1U1N A;  1FJE B;  3CIZ A;  4Q5V A;  5CD4 A;  2BDP A;  1N5Y A;  1BGX T;  3ISN C;  1LW0 B;  4IG3 A;  2VJJ A;  1PBA A;  2OEJ A;  3H42 A;  1U02 A;  3KJF B;  4A4J A;  4IKA A;  5E41 A;  1NK4 A;  4JI5 J;  1Q5V A;  4ECY A;  1SJ1 A;  1SIW B;  2INV A;  3M8P A;  2QC3 A;  3HHL B;  4KB7 A;  4CLL A;  4BS2 A;  4O44 A;  4Q45 A;  1YZ6 A;  1JLQ A;  2CQI A;  4PUO B;  1OFD A;  2CPD A;  2V2Q A;  4XPE A;  2QG9 B;  3ENQ A;  3QJJ A;  2MQM A;  3GJQ B;  3M8W A;  2A2C A;  3RTV A;  2KVQ E;  1SKS A;  2XMW A;  1YK9 A;  1M90 T;  4LQ9 A;  4ZVP B;  1HNI B;  3EXY A;  3LP2 A;  4ZJQ A;  2EC0 A;  1EX8 A;  1FVQ A;  2GIQ A;  2O67 A;  4I56 A;  2NXJ A;  4IDK B;  4KGX B;  3W9I A;  3CCL S;  5JMN A;  5CAA A;  4JI1 F;  3C6U A;  4TLQ A;  3FK4 A;  2NSP A;  5EN1 A;  5U47 A;  3DXB A;  3H4D A;  5H9E J;  4QYZ J;  1GT8 A;  1ITP A;  2EXU A;  2KT2 A;  2J6T A;  1X9W A;  3I5C A;  1W26 A;  4LFC F;  5AE3 A;  4MXN A;  3DC2 A;  4DUZ F;  2GAH C;  3N6N A;  2O0W A;  3PJ9 A;  4DPX A;  4IR1 A;  2XNR A;  1YBT A;  2JLE A;  3M6W A;  3ENA A;  4CO3 A;  1WHX A;  4CLF A;  1KTQ A;  1R0A B;  3OL8 A;  3HCX A;  3PY8 A;  2QLW A;  3FZB A;  3N0V A;  3QO9 B;  4Y2M A;  1JLB B;  1ZM9 A;  3MXH P;  1WI6 A;  4LIW A;  1VBZ A;  2UVR A;  2UVW A;  5J2Q A;  5F8I A;  3H5U A;  1IBK F;  1NPP A;  3TI0 A;  5CQG A;  1ZM4 A;  4YN3 B;  3JTP A;  3MM7 A;  3NS7 B;  3Q23 A;  1N8R T;  3MPD A;  4NCG B;  2VG5 B;  1RT1 B;  4ZJO A;  1WC0 A;  3ZTO A;  4CNZ A;  4D3G A;  4K0K J;  4WPA A;  3PO4 A;  2OPP B;  3CCT A;  3PFE A;  1GAO A;  2HFZ A;  1AYE A;  5E3R A;  4TQR A;  5IQ6 A;  4XQF A;  3TX0 A;  2JEG A;  3NMA A;  1JMT A;  1VRU A;  1HPZ B;  2MQL A;  2HRU A;  3L4B C;  1JLE B;  2R7O A;  1X5S A;  3CMA S;  1VRQ C;  4HR2 A;  4I1T A;  4N47 A;  5AXN A;  4HDG A;  1SI9 A;  2F7V A;  3DU5 A;  2FD2 A;  3CTR A;  5FLX Y;  4ZPC A;  4MK9 A;  5H1S V;  1URR A;  2QGF B;  4WFY A;  2YPZ A;  3DMJ B;  1N88 A;  1RT7 A;  2C2N A;  4OZN A;  2BOP A;  1TU0 B;  1RK8 A;  5KFU A;  3UDC A;  2FVC A;  3EM1 A;  5JUM A;  2E9Z A;  4DCJ B;  1N5Q A;  2LU1 A;  5ETT A;  2EFP A;  2DGQ A;  3THT A;  1NK7 A;  3OQ2 A;  3GWC A;  1PYO B;  3IR7 B;  2XZD B;  4MKV A;  4ZCK A;  4CLT A;  4NXM J;  2RH3 A;  2VJU A;  1HWJ A;  1Y5L B;  3DDK A;  2NT6 A;  1S6P B;  2W1B A;  3DRP A;  4DV3 F;  1TFW A;  4N77 A;  2A18 A;  4DPT A;  3PSZ A;  1C0T B;  1HQ2 A;  3CCV S;  3DLB A;  1WEY A;  3PKM A;  3TA0 A;  2V5H G;  1HI8 A;  4IH5 A;  4JYA J;  2W9B B;  1HWK A;  1U0H A;  2HFU A;  1TAU A;  2ZE2 B;  4YY3 J;  4P6Q A;  3HKZ D;  1JLG A;  2ASD A;  2BAN A;  3JYT B;  2W9B A;  5D0G A;  1VRT A;  3GLJ A;  4ER8 A;  1HF2 A;  3TOQ A;  3CCU S;  2DNG A;  4YEI A;  1UWB A;  1QJV A;  1BE4 A;  1CLW A;  3L7O A;  4CH1 A;  1U1L A;  2D69 A;  4IUF A;  2OUG A;  1VIS A;  3BKF A;  3MEG B;  4JP8 A;  2H65 B;  1R27 B;  4KC5 A;  1RT6 A;  1MSW D;  1BQN A;  3IFE A;  2N82 B;  3EDR B;  3KYL A;  2FB0 A;  1DHM A;  2E5I A;  3BYR A;  1UZD A;  3QQC D;  4HHH A;  2HHT A;  5K8O A;  1V3S A;  4UY8 5;  1RHM B;  1CBK A;  3I82 A;  4A8K A;  2C2K B;  3QAT A;  2W24 A;  2CA9 A;  3OTB A;  2CQH A;  5BYQ A;  2OD4 A;  1O51 A;  4E98 A;  1TL5 A;  2VPZ B;  3JTN A;  1A0O B;  1IKY A;  4ZS6 A;  1ELO A;  1KHV A;  2FHO B;  2WON B;  4QWB A;  1R31 A;  3RB4 A;  1SJ4 P;  2Y8W A;  1N36 F;  3AD7 C;  4OZ0 A;  5SZT A;  3GQ7 A;  3W8G A;  1GMU A;  2HFN A;  2P5V A;  5AXM A;  3C16 B;  2MGZ A;  4ECU A;  3KNA A;  1ZA1 B;  4DEZ A;  3D9B A;  3ITH A;  4HAC A;  1UA1 A;  1S7I A;  1N33 J;  1KVJ A;  1KON A;  4A8Y A;  3DLE B;  3QPI A;  4FKX A;  1S7H A;  4ZVR B;  3TR5 A;  4AXI A;  5ADZ A;  1FRK A;  8ATC B;  3G4S S;  3EIC A;  4ZP6 A;  4GKK J;  1XG2 A;  3GP9 A;  3QFH A;  4JI6 J;  1DFD A;  2PFF B;  2ZH2 A;  2POK A;  4P9S A;  2OI2 A;  3RBD A;  1SH2 A;  3RG6 A;  3GYN A;  2ZUG A;  3JX8 A;  3ONQ A;  3BV8 A;  4DR4 J;  5ETR A;  1Q16 B;  3KDN A;  3IP0 A;  4B3O B;  1EHW A;  2CG8 A;  4ZVE A;  4OV1 A;  1RAF B;  2ABY A;  2B4U A;  3VSU A;  5KG2 A;  5HQL A;  3MDF A;  1J2V A;  4OJL A;  2L9N A;  4UOH A;  4DPO A;  5K14 A;  4AUK A;  1UJ6 A;  2BMB A;  4TY8 B;  5SUH A;  5LM7 E;  4AL6 A;  4EBD A;  1YJ7 A;  4Y2K A;  2UUC J;  3TO8 A;  4NYZ A;  1S97 A;  3G6Y A;  3FZ2 A;  1AZS B;  3EPI A;  3ILO A;  5IXU A;  4O4G A;  2IRU A;  2MQP A;  1N34 J;  3QT6 A;  3QO9 A;  1KSP A;  4WP8 A;  4U8Y A;  2INU A;  3SIP B;  3UVJ A;  2LA6 A;  3M30 B;  2ZH6 A;  2XZT B;  3V81 B;  2EFV A;  4QYR A;  4DV0 F;  4B3R J;  1QSS A;  4NRU A;  4K5S A;  2AZ3 A;  5B0G A;  4ZJL A;  3M9O B;  4CLK A;  3GFZ A;  3FBF A;  3RW7 A;  3D1H A;  1Q4R A;  4DN0 A;  4DOZ A;  3M9N B;  1I51 B;  4TY8 A;  2CRL A;  2MQ8 A;  4CO4 A;  2QA4 S;  1WMR A;  4DR1 F;  2MLZ A;  4OHW A;  4B9U A;  3T6J A;  5CYM B;  2BSP A;  4LFA F;  2L48 A;  4CO2 A;  4ED5 A;  3H2U B;  4CYU A;  2DY1 A;  5GAG I;  3QAE A;  2BE7 D;  2XS7 A;  1VQ9 S;  1RT5 B;  3HF5 A;  1U4B A;  1D3W A;  1H2T Z;  2F63 A;  1TK8 A;  3BO3 A;  4EU0 A;  1QA2 A;  2MZR A;  3FC9 A;  3J80 U;  5JVH Q;  4Z2X A;  2ROG A;  4H4K C;  4TY9 A;  2RQK A;  4LT6 A;  3P6Y C;  2D3Z A;  1GXU A;  2R7W A;  4J9Q A;  1F9H A;  4B9T A;  4R8U A;  2QLJ B;  4Z03 A;  2V67 A;  2NZC A;  2QRR A;  3W61 A;  4JV2 A;  2HBR B;  5ETN A;  1HNX J;  1S79 A;  2GCF A;  2D9P A;  2YNG A;  3THP A;  3FEY B;  4A48 A;  4RU9 A;  4QWE A;  2J8A A;  2A6O A;  1ACM B;  3FKB A;  3CJS A;  1IKV A;  1W2B R;  4YDT A;  1X7V A;  2HVD A;  1FTR A;  3CJQ A;  3TW0 A;  4DV4 F;  1XMO F;  1R8B A;  2ODL A;  2RDI A;  3KHL A;  5M2U A;  3NL0 A;  1NEE A;  2QZ8 A;  1RU2 A;  2RB7 A;  3LQV A;  2Q1L A;  4GO7 X;  4Y2A A;  1F2G A;  3H40 A;  2FJE B;  2NXC A;  2Z2Z A;  2HLT A;  1YVF A;  2W2P P;  4EEY A;  5D8H B;  1VOM A;  5KFM A;  2E9R X;  1DUR A;  4URS A;  4MIW A;  2VFS A;  3CJK B;  3CSK A;  2OPQ B;  3M4X A;  2QZA A;  5E3A A;  5IS2 A;  4N41 A;  3IA0 A;  1S0M A;  5A0Y A;  1X31 C;  3QFW A;  2AU0 A;  1NJW A;  1K8A T;  3OXL A;  2F40 A;  2JLF A;  1XR7 A;  3TUP A;  2XUL A;  1X5P A;  3SSQ A;  4DR4 F;  1RSC A;  2ZH7 A;  3RB3 A;  2DBB A;  1FF2 A;  2WSC C;  1KS2 A;  4QQB A;  3QSY B;  3P49 B;  2VFN A;  2B8Q A;  2C2D A;  2H9Z A;  4XPC A;  1R6Y A;  2J7K A;  3MED A;  5C2C A;  4PKD B;  2PEB A;  1S9E B;  1Q7L B;  1RYR A;  2AW0 A;  1QAX A;  4I69 A;  4LSZ B;  3OUY B;  3KLG A;  4PZV A;  4AFF A;  1MWY A;  1ZTW A;  4V19 X;  3I32 A;  3M2R A;  3EGV A;  5LOQ A;  2E7X A;  5B0B A;  3K89 A;  5IV4 A;  1RAI B;  1T9X A;  3L7U A;  5KFQ A;  1IR2 A;  5EWG A;  1VQL S;  2W8L A;  1WG5 A;  1OO0 B;  4BLG A;  2R7V A;  1WJ9 A;  2DHA A;  2NLW A;  3HSG A;  1T9V A;  3G2X A;  4JI4 J;  1RT7 B;  4UOG A;  3SV4 A;  2V4J B;  4DCP B;  1R8H A;  2XO7 A;  3FUY A;  2XC9 A;  4NLU A;  5KFV A;  4XLF A;  3EGN A;  2HG4 A;  2RU9 A;  1UPM B;  1V9O A;  4ANE A;  1UFW A;  3PNI A;  4DR7 J;  3W2W A;  3DM2 B;  2B6A B;  1GTH A;  2PT0 A;  3CMQ A;  3IG1 B;  2RIJ A;  3IS9 A;  4M63 A;  5KFS A;  5B0D A;  1G7C B;  1H74 A;  2K3I A;  2VG7 B;  3NAI A;  1KRP A;  4NLV A;  2VQE J;  5KG7 A;  4DFK A;  4NLO A;  2M9K A;  2MKS A;  4DPW A;  4B9V A;  5GME A;  2EK1 A;  5T14 A;  1D8Y A;  1O8I A;  4RW9 A;  4DL7 A;  4KGZ B;  3HP6 A;  4XLE A;  2XQC A;  1DY3 A;  4JI0 F;  3BEG B;  3I4H X;  3QJL A;  1T0T V;  1RT4 B;  2EVZ A;  2GX8 A;  2V8D A;  3IGN A;  4MKA A;  3BQ1 A;  1JLF B;  2LQ8 A;  3B6B A;  4CDI A;  5FLX U;  2CJY B;  3UCG A;  4ES2 A;  4F8R A;  2H48 B;  5B0E A;  2KG0 A;  1WKJ A;  3TZW A;  4HYK A;  2FHK A;  2EG1 A;  2VG7 A;  2G4B A;  2XEX A;  2YWK A;  2E44 A;  3BYP A;  3HI9 A;  2R8K A;  1HBU A;  1CC7 A;  1JKH B;  3FBB A;  3KWM A;  2YQ1 A;  3PFO A;  3NBP A;  3R5C A;  5D0E A;  2W7A A;  5GAE I;  4F4W A;  2MQN A;  3AXM A;  2VJV A;  5LMN J;  1B3T A;  2QEX S;  4ECT A;  2HRY A;  2OGU A;  1MN7 A;  2IJF A;  2DNR A;  2XSJ B;  3GON A;  3HK2 A;  2HGL A;  1LEO A;  3A3N B;  1JQG A;  1SV5 B;  3KLI B;  3MPW A;  2ZH5 A;  2J0S D;  2DD8 S;  1EKR A;  3IBF B;  1WD6 A;  1R6V A;  2J9E A;  2O1D A;  1CLF A;  1S49 A;  1FVS A;  3UFC X;  3M2U B;  2FQQ B;  3U7J A;  4IDK A;  2IY5 B;  1HNZ J;  1NPK A;  1J5E F;  1DTT A;  1WSV A;  2XI3 A;  4C4W A;  4DV1 F;  1FDB A;  3MM8 A;  2CNO B;  3EZU A;  4K7Q A;  5HLF B;  5D0H A;  3M2U A;  4AQY F;  1LWF B;  4X64 J;  5KFK A;  2BRL A;  2AP6 A;  2JC0 A;  3AFG A;  2EPI A;  2CNK B;  3LTO A;  1B7F A;  1UJ4 A;  3H5S A;  5F3Z A;  2O17 A;  4DFM A;  3KLI A;  1YIT S;  2Y3Y A;  3PSS A;  1M5S A;  4UQT A;  1RU1 A;  4WIQ A;  4N5S A;  1L3T A;  3SY2 A;  3KXD A;  3BM7 A;  3HZE A;  3PHE A;  4P10 A;  4PYD A;  2CDQ A;  2RDJ A;  4HHU A;  3BGL A;  2NUU G;  4HT7 A;  2Z30 B;  3SXL A;  4XLA A;  2CZ4 A;  2OSQ A;  1PAE X;  2G0J A;  2V94 A;  3HVT B;  2F1F A;  3GJT B;  1UW4 A;  3OBI A;  4OZZ A;  1TL4 A;  4JI8 F;  4A46 A;  4OJH A;  3UCU P;  3AH6 A;  1O8G A;  3TAR A;  2PN6 A;  3QRQ A;  2FUG 9;  2JVR A;  2K1R A;  2XGP A;  2KTQ A;  4OZL A;  2FJD B;  2KU7 A;  1Y3K A;  4YOE A;  1GX6 A;  1BD6 A;  2EFN A;  1KVK A;  3HHK A;  1LFP A;  4NRT A;  3ZC4 A;  3SZ2 A;  5J1E B;  3QRR A;  2HQI A;  2WOM B;  2Z0G A;  4X4R A;  2VQE F;  1HWU A;  3I0R B;  3R1L A;  1ZH5 A;  1GEH A;  3NG8 A;  3UNY A;  2XCP A;  4DPU A;  1WEZ A;  3X1L B;  3MMB A;  4RW6 A;  4C8L A;  2CAD A;  3KK2 A;  2JL9 A;  3W5X A;  4F3M A;  2GW8 A;  2RF2 A;  1NJX A;  4W8T A;  3R27 A;  3PX0 A;  2BOA A;  4UST A;  2GVZ A;  3V6D B;  3ADA C;  3VVT A;  3VWS A;  4F04 B;  3HLU A;  4WKY A;  3UPF A;  2EBE A;  3TAM B;  1RBA A;  1DLO B;  3KK1 A;  1QAJ A;  2CPE A;  2EFO A;  1KKH A;  3R5B A;  2HKE A;  3DOM B;  4OJ1 A;  4EYH B;  2BJ3 A;  4F3O A;  2C2O B;  1CSJ A;  2XZW A;  3M8R A;  3TAM A;  3TEH B;  4LF6 F;  2AJ0 A;  4LF1 A;  3KLV A;  1N6Q B;  3I9V 9;  2XGQ A;  3NGK A;  4B9N A;  2AV5 A;  3PYE A;  3HVA A;  3VGS A;  1Y5N B;  1Q8K A;  3GSI A;  4LF8 F;  4KRW A;  2RF2 B;  4F2S A;  2UXD J;  4G1P A;  2QYU A;  3L7P A;  1B64 A;  1FCA A;  4QOT A;  3B4N A;  3QMQ A;  4LF8 J;  1PC4 A;  3QZ7 A;  4K2X A;  4USI A;  1VHI A;  2B8P A;  5C42 A;  1WEL A;  1RB0 A;  4X65 J;  5EUH A;  3M6U A;  4BC7 A;  2G9O A;  2KO1 A;  4IFV B;  3ZZU A;  1FJG J;  1BQM B;  4GC6 A;  4KIA A;  2DR9 A;  2DXD A;  1O8H A;  4XDC A;  4FNH A;  4GKJ F;  4FYD A;  2VV5 A;  5T7L B;  3C3L A;  4LFB J;  2K06 A;  3R2C J;  4UUX A;  1RWV B;  3NKY A;  4NXM F;  1M1K T;  5A0Y B;  3CCR S;  1KLM A;  5DM6 Q;  2VKR A;  1REG X;  4YDD B;  1FFG B;  1FI4 A;  2RUG A;  1IKX A;  4KPC A;  2MQO A;  5C1C A;  3IO1 A;  4DL0 C;  3G82 A;  2RS8 A;  5E0O A;  5J1P A;  3J80 Y;  2QYC A;  4LRB A;  1QRB A;  4WP9 A;  1EQM A;  3K57 A;  2IM2 A;  2FJB B;  1NSK L;  3JTO A;  2W4P A;  3LP2 B;  3S01 A;  3P3D A;  3X3U A;  4CLW A;  4JV1 A;  2Y8Y A;  3OT9 A;  5C24 B;  2QFJ A;  1OOC A;  1UJ5 A;  1UVK A;  4PXC A;  4PQU B;  5C25 A;  1LXN A;  5KFR A;  2VC1 A;  4X62 F;  2V8H A;  3DN9 A;  4F02 A;  2Y1R I;  3NS5 A;  3HZG A;  2FVS A;  4ZN3 A;  3G9C A;  1HNV B;  5IC6 B;  4U7U K;  3FFI A;  4M5L A;  3PW2 A;  3B4M A;  4O0N A;  1REV B;  3P96 A;  4OHV A;  2JEF A;  2HW3 A;  3D28 A;  2GIF A;  1WKL A;  3G8S A;  2L08 A;  4X66 F;  4EBE A;  1L3S A;  2CQ4 A;  4JI0 J;  1D09 B;  4FXW A;  5HMW A;  1C4C A;  1RI7 A;  4XOT A;  1VQM S;  1AT1 B;  1HBN B;  4JI7 J;  3WX8 A;  2DNK A;  2HVZ A;  2V68 A;  4M5I A;  4G65 A;  3MPV A;  5DG7 A;  3CIM A;  1UL3 A;  2GZO A;  2VDH A;  4WJB A;  1FE0 A;  5A8R A;  5HLF A;  1HLW A;  1NO8 A;  1EIY B;  5HVF A;  1RAG B;  1T9Y A;  2D7S A;  3EYZ A;  3K2Y A;  3TUJ C;  1RT2 B;  3BBF A;  4F26 A;  3AD8 C;  5HAO A;  4AL5 A;  4OZ5 A;  3I5A A;  3O6Q A;  1HKA A;  2HBZ B;  3HVT A;  4IH7 A;  4M5G A;  1BHE A;  4IFY A;  4OX8 A;  1VRT B;  3A4T A;  5E5N A;  5KT2 A;  4Q8E A;  2M4M A;  4OX6 A;  5J2N B;  3R9L A;  5E33 A;  1WOR A;  3FCW A;  4DFJ A;  1U48 A;  1P9Y A;  2X3D A;  4F25 A;  2X1G A;  2AIR B;  2CJB A;  3CF5 Q;  4AXJ A;  4DR3 F;  3SMZ A;  4ANC A;  3D0I E;  3GQ8 A;  3E51 A;  2BX6 A;  4OHX A;  2ZVI A;  4L75 A;  5K14 B;  1B0T A;  5M2R A;  3SCI E;  3W1Y C;  3ZTP A;  1JRG A;  1N5V A;  3FY3 A;  1H73 A;  1T94 A;  5C7P A;  4X4T A;  5HQ8 A;  1NPR A;  3OW2 R;  1X8D A;  3D3B J;  5K9F A;  1PG5 B;  1KCD A;  4X65 F;  2OPR A;  4YQW A;  4DL6 A;  4KH1 B;  1FNX H;  1EP4 B;  2CJX B;  1J5O B;  2SXL A;  2GVD A;  4RUC A;  1T05 B;  2YKO A;  4I4B A;  2ZH8 A;  4OIX A;  5D0R A;  3VAL A;  1NB7 A;  1TTH B;  1U26 A;  3Q8P B;  4F2R A;  3MCO A;  1KQG B;  5AE2 A;  2ZWP A;  3GFX A;  5KT7 A;  2FLP A;  5AE1 A;  1BWV A;  2E1P A;  4N8N A;  3D1Q A;  1QUP A;  3CGI A;  3OR1 A;  5HO4 A;  1G4C A;  3W5Y A;  3BDP A;  2MHE A;  3Q2S C;  4F4A A;  3IR5 B;  3MMC B;  4IRD A;  4OHY A;  4UT4 A;  1H3D A;  2A1B A;  2DNP A;  1XJW B;  2GO8 A;  2HQC A;  1HPZ A;  2MDA A;  2YUH A;  2XMT A;  3GB0 A;  3O44 A;  5HAT A;  4ZLL A;  3BKU A;  1DQ9 A;  4YB1 P;  2UP1 A;  4FF3 A;  5JLV C;  5L1J A;  1JLF A;  1S4E A;  3SUC A;  3A8K A;  3QYY A;  2BQ3 A;  3BN7 A;  4CP5 A;  1O88 A;  4W90 B;  3CDA A;  5GAH U;  4EZ6 A;  3DOL A;  1C0U B;  5GMK a;  4NPO A;  2F9J A;  1RT6 B;  5IT9 Y;  1KTV A;  4A8X A;  5J2Q B;  1CJU A;  4F36 A;  2FJV A;  4KGV B;  2HPU A;  1UVI A;  3SZE A;  3JQK A;  1BQX A;  2EG2 A;  2G2Y A;  2EC2 A;  2HQ3 A;  2QN6 B;  1UWA A;  4FNI A;  3QT8 A;  3RJM B;  3UE2 A;  3W60 A;  3H7H B;  4HL9 A;  4PEO A;  1R0A A;  2GML A;  3ZTR A;  2EWE A;  3DM2 A;  2FVR A;  1O6X A;  2C2E A;  3CVK A;  4HI2 A;  4HVZ A;  3ZNJ 1;  3MCS A;  2JFK A;  2LLZ A;  1WTB A;  2IM1 A;  4NK8 A;  1OQ3 A;  3ML3 A;  4QCL A;  2M3D A;  1N32 J;  1OFE A;  3R8Y A;  1U1R A;  3F56 A;  4NXN F;  3IC1 A;  2I5J B;  2Y9H A;  1WOS A;  1IBM F;  3LGN A;  2NUH A;  4ELT A;  4RR5 A;  4DV5 F;  2RQC A;  3V2U C;  4R0E A;  4XIU A;  1OS5 A;  3TX8 A;  3KJV A;  3KFW X;  2J7W A;  2DXE A;  3VQS A;  5CYQ B;  2HQG A;  2UUT A;  2E29 A;  2O3D A;  3DRR A;  1EAY C;  2C2Z B;  2LXI A;  2LEA A;  2Q3P A;  1RIS A;  2KRR A;  2Z58 B;  4FKY A;  4USK A;  1SXL A;  3BN4 A;  4XK8 C;  2R7T A;  1ZET A;  4E0D A;  1X4C A;  1U2C A;  4DG1 B;  1HYS A;  4KY3 A;  3FFI B;  1WF0 A;  3IRX B;  4ZVQ B;  3KUH A;  2HFO A;  2MLY A;  4ALZ A;  2RSQ A;  2FJX A;  4OX9 J;  1RWN B;  2M0G B;  4F4Z A;  4OJ3 A;  3LYC A;  1SKU B;  2R8I A;  3IBW A;  1CJK B;  2ZC4 A;  3DGP B;  1CS4 B;  3AY0 A;  2BVZ A;  2AYG A;  3VAH A;  2N3L A;  2ROP A;  2XYP B;  5KOW A;  1X4A A;  2AGQ A;  1VI7 A;  2UXB F;  2HHQ A;  2C3Y A;  2GA7 A;  4JRA C;  3M8Y A;  2R7Q A;  4PG8 A;  1KTW A;  3PR4 A;  3VAK A;  4WFX A;  1RT3 A;  1Y4Z B;  3GJR B;  3GIM A;  1PGZ A;  3KRG A;  5F8N A;  2MB0 B;  1IDK A;  2DIT A;  2RVJ A;  2CJQ A;  1NDK A;  3KG4 A;  2DIU A;  2RE1 A;  1VGY A;  2M7S A;  2AZ1 A;  1WG1 A; 
#chains in the Genus database with same CATH homology
 3BH6 B;  2VFO A;  2J8I A;  1TYX A;  3BBF A;  2HUR A;  4UOF A;  4OM9 A;  3FKB A;  2HVD A;  1NCL A;  3VGU A;  3EM1 A;  2BM4 A;  3SYJ A;  1K44 A;  1PAE X;  3R9L A;  1KQ5 A;  3FCW A;  2XC1 A;  4DUT A;  1PKU A;  2BM6 A;  4ANC A;  3H09 A;  3Q83 A;  1S59 A;  2B0R A;  2DY9 A;  2BX6 A;  1NDP A;  3B54 A;  2ZUA A;  3BBB A;  3ZTP A;  3ELH A;  3FBC A;  1U8W A;  2DYA A;  5C7P A;  2F3L A;  3FCV A;  1HHQ A;  4S0M A;  4KH3 A;  1QA3 A;  2VFN A;  3TH0 A;  1S5Z A;  2B8Q A;  3Q8Y A;  1HF2 A;  2DXF A;  3RIQ A;  3VVU A;  5BXI A;  1ZS6 A;  4DZ6 A;  1BE4 A;  1CLW A;  4EK2 A;  3BH7 B;  1TYU A;  4V02 C;  1JXV A;  1KDN A;  3N90 A;  1TSP A;  3Q8V A;  3NGU A;  4OJ5 A;  1HIY A;  3VVT A;  2BM7 A;  1NDC A;  3DKD A;  4F4A A;  2BM5 A;  1XQI A;  3L7U A;  2YUH A;  1NHK L;  3BBC A;  1K8F A;  1NDL A;  5JLV C;  1B99 A;  1W7W A;  1NSP A;  3G2X A;  4CP5 A;  3FBE A;  4UOG A;  3VGS A;  3EMT A;  5CAB A;  2IOU G;  1BUX A;  1VYA A;  2W7Z A;  2HVE A;  3ETM A;  3PRV A;  1QQ1 A;  4FKX A;  4F36 A;  2CWK A;  4OJO A;  4ANE A;  3LJY A;  3EIC A;  3SZE A;  3JS9 A;  2B8P A;  3GP9 A;  4OPW A;  2VFM A;  4OJ6 A;  4WBF A;  4C6A A;  3VGV A;  3P4G A;  3ZTR A;  1NSQ A;  3JX8 A;  2BEF A;  2DXD A;  1DAB A;  1EHW A;  3ML3 A;  5CAA A;  2VFQ A;  1QA1 A;  3EVO A;  3ZTQ A;  1F3F A;  1UCN A;  4OJL A;  4UOH A;  1B4S A;  3ZTS A;  2NCK L;  2V5I A;  1F6T A;  3EE3 A;  1XIQ A;  1K4Z A;  1TYV A;  1BHN A;  1S57 A;  3NGS A;  3B6B A;  3PJ9 A;  3EJM A;  4KPC A;  1LWX A;  1TYW A;  2DXE A;  3ENA A;  4W98 A;  2VU5 A;  1WKJ A;  4AND A;  1QRB A;  4ENO A;  3Q89 A;  4FKY A;  1NSK L;  3DDI A;  1WKK A;  3FBB A;  3N6Z A;  1NUE A;  3EVW A;  3Q8U A;  5JMC B;  2AZ3 A;  1MN7 A;  4OJP A;  3FBF A;  1LEO A;  3VGT A;  3LYC A;  3AK5 A;  3MPD A;  4O0N A;  1MN9 A;  3ZTO A;  3PET A;  1NB2 A;  1QRC A;  1WKL A;  3GPA A;  3EVM A;  1NPK A;  4JRA C;  3NGR A;  1WXR A;  3Q86 A;  1QA2 A;  3FC9 A;  3WX8 A;  2G0Y A;  5IOL A;  4HR2 A;  2VFP A;  1NDK A;  1NLK L;  1HLW A;  3NGT A;  2AZ1 A;  4DI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...