3BH6B

Crystal structure of the rp2-arl3 complex bound to gppnhp
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
314
structure length
314
Chain Sequence
b'PKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor-like protein 3
molecule tags Signaling protein
source organism Mus musculus
publication title The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3
pubmed doi rcsb
total genus 105
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2007-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07986 TBCC Tubulin binding cofactor C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3bh6B01
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3bh6B02
1B4SA 4C6AA 2HURA 1K8FA 3Q83A 4F36A 3ELHA 4HR2A 3VVUA 1PKUA 1WKKA 4KPCA 2B8QA 3EE3A 3GPAA 1S57A 2DXFA 1HF2A 2HVEA 3L7UA 3JS9A 4CP5A 4DZ6A 5C7PA 3B6BA 2NCKL 5CABA 2DXDA 3EVOA 4ANEA 4V02C 3FCWA 5IOLA 2AZ3A 4FKYA 2VU5A 3Q86A 1PAEX 1NSPA 3FC9A 1BUXA 3WX8A 3ZTRA 3G2XA 1JXVA 4O0NA 3DKDA 3VGUA 1XQIA 1WKJA 3EVWA 2DXEA 1B99A 3Q89A 3BBBA 2CWKA 2B8PA 1MN7A 1BE4A 2BEFA 3ZTOA 3BH7B 1NCLA 1W7WA 4DI6A 1K44A 4FKXA 1NSQA 3FBCA 3NGSA 3NGUA 4UOFA 1KDNA 3BH6B 1U8WA 3Q8YA 1K4ZA 2BX6A 1ZS6A 1S5ZA 2ZUAA 1MN9A 3BBFA 1HLWA 4EK2A 3Q8VA 3ZTQA 2B0RA 2DYAA 1NHKL 3EJMA 1WKLA 3B54A 3FBEA 1NLKL 3ZTPA 3VGSA 1KQ5A 3ENAA 2DY9A 1HHQA 1UCNA 3EVMA 3EICA 4S0MA 3GP9A 1BHNA 5BXIA 3FBFA 3VGVA 1NB2A 1NSKL 3FCVA 3NGRA 1S59A 1NUEA 3R9LA 4ANDA 2YUHA 1VYAA 4UOGA 3BBCA 4DUTA 4UOHA 1HIYA 1NPKA 4ENOA 3PRVA 3VVTA 1XIQA 1NDLA 2AZ1A 1F3FA 3PJ9A 3MPDA 3NGTA 4W98A 3FKBA 1LEOA 3EM1A 1NDCA 3VGTA 3DDIA 3FBBA 1LWXA 1NDPA 1EHWA 3ZTSA 4F4AA 3Q8UA 4ANCA 3EMTA 3ETMA 5CAAA 1NDKA 2HVDA 1F6TA 4WBFA
chains in the Genus database with same CATH superfamily
1N36J 1B4SA 3FJ2A 2MHEA 5AXKA 1HD0A 4JI0J 1V3ZA 2W01A 3DDKA 1RAEB 1NK5A 3SQOP 1VS3A 2QLJB 5EGYA 4PWUA 3W60A 3DOMA 1OYDA 4PWDB 1TVRB 5D78A 4RWWA 2BOPA 1FDBA 2YKPA 1RA6A 2Y8WA 2DXFA 1IUJA 1HF2A 1O8EA 2LA4A 1ZA1B 3MMAA 2O1DA 4I4BA 2ZH6A 4AQYF 4ED0A 3W62A 3HCXA 3TX0A 2PMHA 4F4ZA 2BDPA 2HZCA 2MKSA 3AAWB 3KLHB 3SYZA 2DEIA 4JI1F 5KFIA 2HFZA 4ZPTR 5K9FA 2E7WA 5A0YB 5C24B 2XO7A 4Y28C 3T1YJ 1XMOJ 4LFCJ 1DTQB 4GMKA 5L1LA 1X4EA 2IRXA 5BR8F 4J9PA 3DMJA 1OGOX 3THVA 1IKYB 4FXWA 1RTHA 3TWZA 2EG1A 2JHEA 3FY3A 1X0PA 2NLWA 2J8KA 1AZSB 1NJZA 3ET6B 1U4BA 4NYPA 3KK3B 4DV1J 5DM7Q 2VF3A 2XBPA 3M32B 3C6TB 3G2XA 4OLPA 2G4BA 2R7QA 2DHAA 1HBUA 4M5KA 5E3PA 4ZCLA 6AT1B 3TA1A 2HAIA 3DKDA 3PCOB 4J9MA 4LF7F 1JJ4A 1B99A 4X66J 2XI3A 2MSTA 1CSJA 1UJ6A 5GAHI 5HANA 2NZCA 2R8IA 3W8GA 2ZJRQ 3OXLA 1Y7PA 1UJ5A 1Z2ZA 2BEFA 4MKAA 1UTAA 4MIWA 5C25B 1K44A 1L3UA 5KT5A 4Y34A 1WDTA 4WYLA 2J6TA 2VL1A 1JXEA 1I94F 1CVJA 2XT4A 4AVZA 1U1RA 1H3DA 2MKJA 3QQCD 2A1BA 2PI4A 3H20A 4F3OA 1ZAVA 3HXMA 3C6UA 3CE8A 3NWRA 2BX6A 5IT4A 2X1BA 1YRXA 3NCQA 2ZUAA 1EB0A 1VRTB 4MIBA 2QEXS 1S48A 1WC4A 4N8OA 2C3YA 4MFBB 4YR2A 1SI9A 5AXNA 1OOCA 3EJMA 3FBEA 5KFNA 4J9RA 4DL3A 1SV5A 2CQGA 3V6DA 2XMJA 4QJVA 3TOQA 4HWVA 1XNRF 3M8QA 1QE1A 3JYTB 1XC9A 1RYRA 2CNKB 2UXDJ 2KXFA 2M0GB 3SQGA 3J7AN 5BXIA 2YXLA 3CWJA 3WC0A 1DLOA 2GS8A 1WHXA 2YKMA 5THWA 3KLFB 4EO8A 4F26A 2VV5A 2VG6B 3JURA 3MM7B 4ANDA 3G9CA 4QR1A 3QMQA 1YGYA 4WFZA 4Y6IA 3OR2B 4OJ3A 4DPTA 1BC6A 4UOHA 2CQBA 1NSAA 1X4CA 2GGPA 1NPKA 4ED8A 1GEHA 3P96A 2EFGA 4JI4F 3VSVA 1DBGA 2BACA 2Z4PA 3KDOA 3VCDA 3MD3A 1KHWA 4WKRA 4WIIA 1YRUA 2GMLA 4RNFA 4NA3A 1DRZA 2IMWP 2O6WA 1R6VA 4ELUA 4Q5VA 5A8WB 1S9FA 3OD2A 4PCQA 1SJ1A 4B3RF 2J6UA 5AE3A 1U45A 4E0DA 4X2BA 1IBCB 2E5LJ 2W2OP 2D41A 3ZNJ1 2EBEA 2NPFA 3LGMA 1R0BG 5ETVA 2R8GA 4ECUA 1SC3B 3MM8A 1RMGA 5DDQC 2HBZB 2L9WA 1T9XA 2BQUA 4ZVQB 1HG8A 2BJ8A 1TUVA 1DTTB 1AROP 1KQFB 4ZCIA 2KG1A 3Q8PB 3VAJA 3VAGA 2K2PA 1SIWB 2J9EA 4J9OA 4C8LA 2FC9A 1VC6A 2GMHA 5B0GA 2WK4A 5DO2A 4H4KC 2ZM6F 1RBOB 2HBYB 2L9NA 4BWJA 1HNIB 1ICEB 1C4AA 3RZAA 2YNHB 4KO0B 2XS7A 4K2XA 4ED4A 3JSRA 3T9GA 2IJNA 3IM9A 2C1EB 1HA1A 2KDOA 1FRJA 5K8PA 4OX9F 1LLWA 2BXJA 4RPFA 5DGAA 5CA5A 1UVKA 2KHDA 2KXHA 2VQEJ 1RT2B 4IG3A 3MECB 3CCRS 1XR5A 4CYUA 1K8AT 2RRNA 3G87A 5B0BA 3KJFB 2RUSA 2WB4A 5CD4H 4DV2F 4IFVA 2DR5A 3CO0P 1IBKJ 3MMCB 2PYHA 1JMTA 2I9SA 2QN6B 4DF4A 2E1PA 4GVBA 2RRBA 2O67A 4JV2A 2KL8A 1MNEA 4DL4A 2BUNA 1CULB 2E1RA 3ICLA 5LJ5Y 3H90A 4N8NA 1RDRA 3HJFA 4KC5A 1J5EJ 4PXDA 4DXLA 3M30A 2VBMA 3T9NA 4ZIWA 4OL8A 4LR9A 3NOGA 5DDPC 4W92B 2BE2B 3FGVA 1WKJA 3KMQA 4F8RA 2VICA 2F3LA 3C8YA 3O44A 4DV7J 4MIAA 2BM6A 1EKRA 4LF9F 3W9HA 5GADI 5AE2A 5E3RA 1GH8A 1Z2LA 1VQYA 1T9WA 4XLCA 1A0OB 1W7WA 1KLMA 5CYMA 2QZAA 4NLSA 3FEXB 4USMA 5LT5A 2Y1JA 4WWSA 2OI2A 7AT1B 4EZ6A 4DSFA 1T9VA 4Q7AA 3QRRA 3BDEA 4LBIA 2N7CA 4U67Q 2VPYB 4X4TA 4KFBB 4H4KA 4HH1A 1SUQB 4X4RA 3EXCX 3M30B 4FF4A 3WDOA 2W4PA 3NBPA 3WIUA 1FX4A 1M5SA 1LLZA 3PHEA 4M5DB 1F5AA 2RS8A 1MN9A 2FHOB 3ZZTA 5DQHA 1L5UA 4F2SA 5F8NA 2E5LF 3ZTQA 1C2PA 3LP2A 3G86A 4H4OB 2PT0A 3NAWA 5KOWA 3OJSA 5KFTA 2V8PA 4CM2A 2R2TA 5K5MA 4UZBA 4QW9A 3QFWA 2P8IA 2ASDA 2Z2ZA 1TKZA 2FPHX 3GU0A 2KG0A 2E29A 3ZZOA 3D1OA 3LF0A 3N79A 2FLNA 3LO3A 1RHRB 3FBFA 4W4MA 4WTYA 3B4NA 4ID5A 1REGX 1S7IA 2H51B 5D4NA 4X4OA 2VQFJ 1SKWA 2FVQA 4M95A 1X5SA 2GIFA 2BJEA 2CZ4A 2CIMA 2HS4A 2QLBB 3P4UB 2KT3A 2ZNZA 2NSPA 4OJOA 4XR6A 5D4OA 4JI6F 4RUCA 5FLXY 2QYUA 3I31A 5JVGQ 1LM1A 3RAMA 3MUTP 3PNIA 1VK8A 2AYBA 3F0NA 2PFDA 1OS5A 1C1BA 1JLBA 3JSYA 2JVOA 2D3OR 2GHPA 2I0XA 1T11A 3BPDA 4RW8B 1HL6A 2CPIA 2CQHA 4WXWA 5GMKa 3DLLQ 3L09A 3R7NB 4B9TA 2YWHA 1PYOB 3LA0A 3ZO7A 2XC9A 4DU7A 2B51A 2HQIA 4WE1B 3M8SA 1VIXA 2ZKUA 2QL9B 1RB0A 3VWSA 4DR2F 3H09A 3DXSX 1NDKA 1RHJB 4DR3J 5KT3A 4WU2A 2BRKA 3A8EA 3U27A 4B08A 2BBEA 4EU0A 4J5OA 1B64A 2V4RA 3QSYB 1SKSA 1YX2A 4UUWA 3UDEA 3I87A 2HVIA 1GXTA 1YQHA 2AEJA 2BYCA 3AA8A 2GHWA 1JLCB 4JP8A 2F5GA 5LMNJ 1JLQA 1SL1A 2FGCA 2D3O1 3N5FA 2QSFA 3D0HE 2MDAA 2GZOA 2IM0A 1TUWA 3A8KA 5AXLA 1T8EA 4DR5F 2PE8A 4P2MA 2QJ3A 3R5DA 1JIHA 5F9NA 4R0JA 4IH6A 2UXCF 3AQPA 5K14A 2WONB 4K4XA 3T1YF 1DFDA 5GAEI 4Z05A 3D0IE 4I68A 1GTHA 3HDSA 4USWA 4CNZA 5CABA 1XG2A 3BSAA 2DGOA 3I5BA 4LSNA 1Y3JA 2J8IA 3GR0A 3HSDA 2J0WA 1S9GB 5KFRA 3FCWA 3HSGA 4ZA1A 2XYGB 3W63A 5KFWA 3MAHA 5KFZA 2RS2A 2XS2A 4MK7A 2DTJA 3FQKA 2LQ5A 4RL1A 2OELA 1HQEB 1EP4B 2RKIA 3KHLA 3GMGA 3R5AA 1R8CA 3S7RA 5ETSA 4CLKA 4P75A 5DETA 4XIUA 4DQSA 3T1HJ 4E8UA 4CWBA 2CPFA 3CC7S 4DPXA 4NE9C 2K3IA 4PWWA 1ZA2B 4RUAA 4DR5J 1Y5NB 1EARA 1LK5A 1NEEA 1VFJA 2CVEA 3HI9A 3QT5A 2RQ4A 4MH8A 2QA4S 1T03A 4O23A 1PC5A 2QYGA 4LREA 4DPUA 2W7PA 4OZLA 3O3LA 2FJVA 5HLFA 3Q89A 4CLFA 3NNHA 2V4JA 5GMEA 1SCJB 3I6PA 4KH0B 3DN9A 4TYBA 3W2WA 4EFAC 1PXZA 2Z8GA 1FVSA 2IVMA 5KFOA 1D0EA 1LWCB 5HATA 3VF0B 4WFBQ 5DQGA 4B3OB 3O1LA 3G71S 4Q0BA 1X4DA 3AB4B 4DL0C 1CJVA 3KG1A 2XMVA 1VQ8S 1VMBA 1VQ9S 2C3PA 4NK8A 3B82A 3G4SS 2ZDPA 4XORA 3QGGA 4R25A 4DR7F 4WF9Q 3CCMS 3KLGB 3OR2A 2EEYA 4LSLB 3J7Z5 1HNWF 1HNVB 2MKCA 2RF2A 3C15B 3PEJA 1QJHA 3TZXA 3KLVA 2OIHA 3A8JA 2CQ4A 1NB7A 2YNFA 5KFQA 2KM8C 1U1QA 3ADAC 3ETOA 1R89A 2MYFA 2BVZA 2XEXA 3M2RB 3MF5A 4NLDA 1S6PA 2XQCA 1RTDA 1UJ4A 3CJKB 3OXFA 2J76E 3CGIA 1UFKA 2VDIA 2L9DA 3DOKA 4IRCA 1OY6A 1LNQA 4CZCA 2Q6CA 3DLGB 4IOBA 3HSJA 2W2PP 1DTQA 2LECA 3GE9A 4NLOA 1HBMB 4GRSA 4P2SA 4R8UA 3D2WA 4YQWA 3CCQS 2M8DB 1WF0A 2HG4A 4ZPAA 2KT5A 4CLPA 2Q1LA 4OI6A 1UZHA 2L08A 4LFAF 3CCUS 4URRA 1WHYA 3SMZA 1IB4A 5DLFA 2HHHF 3OUYA 1H80A 4XQFA 2H48B 5D3GB 3KUGA 2P9EA 3KJQB 4IO1A 3VVTA 1YJNS 2Q66A 2UV8A 5HVFA 3V2UC 2FVSA 5HJXA 2EXUA 2RF2B 4W8RA 2HHWA 5B0DA 4I7FB 2NZMA 1UEVA 3M6XA 5FDLB 5AE1A 4YZAA 3C16A 1C0UB 3KTQA 1SKUB 4KV8A 5HBMA 2VKRA 1VQMS 2UXBJ 2NSBA 4K8RA 4AUKA 2EC0A 5GAHU 1HQ2A 2O04A 1CJTB 2ZFHA 4DLEA 2LU2A 4ED2A 1U6BA 1PGZA 4KIAA 5KG3A 4CH7A 4XKVA 3EMTA 3G82B 4M5IA 4Q43A 2ZH2A 4OZ1A 1SC6A 1C0TB 1LXNA 3DCAA 1RT3B 2YWKA 1RT7A 2HVDA 2MLXA 2MLZA 3DHWC 2CPHA 3NKYA 4U8VA 4QIWD 3SQVA 2R2UA 3CMAS 3QIPA 1NKBA 2GO8A 1HWLA 3W64A 5EWFA 4DX8H 4YFOA 3NMRA 2ZKTA 5LOQA 1RP5A 1X4GA 1S1WA 3UQSA 4Z37A 2B5JA 2M70A 4USTA 1L3VA 1K8FA 2DD8S 3ONQA 1TR0A 3VZHA 4DN9A 4CTAB 5C42B 2PEBA 2CYYA 1S49A 2FJEB 1X4BA 2X3HA 1RT1B 2HWTA 2PECA 2PO4A 4OFZA 1VBXA 2V50A 5I42B 2I38A 1YITS 3OTEA 4KV8B 1BXNA 1QTNB 1RTZA 1GFWB 1X5TA 4CP5A 2LMIA 4UZCA 3TNVA 4LJMA 4CIOA 5EX3A 3F73A 3FZ2A 3CC4S 5F0UA 1IXKA 2YNFB 3PY8A 2HW3A 4P10A 4C7QA 5DNSA 4I7FA 2V34A 3EDRB 3EZOA 4EI2A 3DRYA 2IQ7A 4UTGA 3PFEA 2JFDA 2EFPA 2QFIA 4FPIA 3UI3A 2I1RA 2OPRA 2GAHC 4UF4A 5C25A 1KTVA 2WSFC 3DXBA 3PTWA 2IJRA 1FTRA 2GVZA 3QFHA 2RMLA 3NOCA 1F1BB 2C28A 4C0HA 2QZ8A 3MR7A 5KFKA 3Q86A 2CXEA 4H4MB 3VR1A 5C1CA 4AFFA 1HWKA 3V81A 1MMLA 2ASYA 2M7SA 2UXBF 1ZM2A 4OX7A 4J91A 5A8KB 1D9DA 4DR4J 2DNYA 4LFBJ 3W9IA 1WMRA 3EVWA 4NLQA 3I0RA 4P7VA 4WZQA 1PJ7A 1HHSA 1WEYA 1K1SA 3R6GB 1T05A 2HYIB 4M63A 2W7OA 1AYEA 3ZTOA 2ADBA 3BH7B 3W3SA 2A6OA 2K8GA 3PYFA 5H9FK 1FXLA 1FA0A 1TKTB 2DRDA 1SL2A 2WBRA 2OEMA 4K5SA 2LKZA 1JB0C 3MEDB 4QR2A 4IO9Q 4JI4J 2EBGA 2OPPB 3FBCA 1S9GA 3AHPA 5J1NA 2EWEA 1RCOB 1JJ2R 1J27A 4ZKAA 1NMEB 4B3TJ 1RI7A 1T02A 5C5JA 4C2LA 1WELA 1AW0A 4ZVGA 5IC6B 3M2RA 2A10A 4NRTA 1M5HA 1HQUB 4QYZK 3QYYA 4HEA9 2W9BA 3EQNA 2VFOA 2BZ2A 2KN4A 2ZOMA 3D6MB 2DYAA 2Z57B 3FEZA 3AD9C 3TAMA 1BHEA 3OLBA 1V3SA 2OEKA 4XPCA 2IBOA 3TVKA 4OV1A 2MKHA 4I6AA 2M88A 3BGRB 1LFWA 3UD3P 1BHNA 5SUHA 3W5ZA 1SKRA 3BSOA 2ZZNA 2HQDA 3P45B 1R8PA 2AGQA 1IKVB 1XBWA 2KRBA 1S1VB 3R5CA 3IC1A 4AQYJ 1G2EA 3DRPA 1QJVA 1NJWA 3AXMA 5FLXU 4DR6F 3NEKA 1WC6A 2PD1A 2OAUA 2VG7A 4YB1P 2LDIA 3PVXA 2FZKB 1VLOA 5D77A 2FIUA 5J2NA 3UDLA 1HMVB 1LW0B 4ZJQA 4K4YA 4LUBA 4CLWA 1WOOA 4IG0A 4NPOA 4KY3A 1RT5B 3P3DA 3OPKA 5CZVA 3LP0A 3AODA 3QJJA 2NXEA 3GIMA 4LMZA 4U9RA 4ETXA 1H73A 2ZE2A 1FNXH 2GQQA 1VQKS 3J7YU 1M5KC 4DR4F 4AD6A 4B17A 4U6PA 3TZZA 3CDBA 1WTBA 1WACA 4LFBF 2GIRA 3TVZA 1FJGF 3DRPB 1H74A 1REVB 2CNOB 2ZOGA 3CDWA 4RU2A 2OPSB 1PJ5A 2HBRB 1VOMA 1Q78A 3SSQA 4ECXA 1PG5B 2MQNA 4O3QA 3EPIA 1WC5A 4PUOA 4ZP8A 1CG2A 1WHWA 1ZM3A 1QQ1A 3W9JA 4N7TA 4NLYA 2I2YA 1ULRA 4U4BA 1TAQA 3T6JA 4PR6A 3OTOJ 4JV5F 1IQZA 3BEGB 4YDDB 2DISA 1XMQJ 1Q5VA 3DYAA 1VBKA 5KFYA 1NNDA 2CZ9A 2E66A 3R7SB 4NZ0A 3WQPA 4M5DA 2RQMA 3QZ8A 3S1TA 4URGA 2J9DA 3HHLC 5C7PA 1TK5A 3KJVA 2OH2A 4PZVA 2JX2A 2AGOA 3IS9B 1U1LA 2BE9B 2LU1A 3PHTA 3ZNUA 4KHPJ 2YQ1A 5HP1B 2UUAJ 4I2QB 2XWYA 2V8HA 1U7LA 3ENWA 4XLHA 2K1RB 1RWWB 1V5IB 3GJTB 5KFHA 5KT2A 3T5KA 1KOHA 1OPIA 3IFEA 1SC1B 2RJZA 3SYJA 1C1BB 2AZ3A 2W25A 1YVFA 1RTJB 4K59A 4EYIB 2DRBA 3MM9B 2Q79A 2P2CB 3K8WA 1NSPA 1XNQJ 3P4GA 1S6PB 2X6YA 1D9AA 2HQCA 3BV8A 2MQPA 3K58A 4C4WA 1WF1A 3POTA 3MCNA 4M1KA 1DTTA 3W1YC 1RBAA 3NS7B 2EFNA 3I82A 4LRDA 2FUG9 4PXCA 4O3NA 3T1AA 5J2QA 3HF5A 4GKKF 2JJ4D 3PW0A 2MPUA 1N5QA 5E3AA 2JH3A 3KG0A 3QLHA 3PR4A 3NAHA 4MYTA 2FLLA 4I2PB 4NYOA 1MN7A 4L3KA 1CC7A 1PBAA 4FF3A 4DV7F 4YHHJ 4URSA 5DDOC 3C66A 4JV1A 4PABA 1SXLA 4XK8C 1FESA 1BWVA 1U09A 1X60A 2Z8QA 3H5XA 3GG1A 1MG7A 4KJIA 2N3LA 5J1EB 1VLYA 2YKQA 2OPRB 1YHQS 1IBMJ 2YWGA 2UVEA 3JTPA 3A3OB 1U02A 3P8BB 1RT2A 4IG3B 3D5MA 3MEEB 4IOCQ 3UCZP 1OWXA 3BH6B 1RQ0A 4K4VA 3KK2B 4DV3J 2BA9A 1F3VA 3CNQP 4OZYA 2HRUA 1WXRA 2YVSA 4G1QA 3M8WA 1ZPWX 1ZS6A 2C2RA 4OI3A 1LW2B 5F41A 1S4FA 3S01A 4NZ6A 9RUBA 2QRRA 2DH9A 5ETPA 4NOHA 4KHPF 3AY0A 1Q1KA 1S1UB 3GRHA 3OR1B 3DM2A 2YKMB 4DV4J 3QGIA 2AJ2A 3AFGA 5KT7A 2MEWA 1RADB 1RABB 1OFEA 2HFUA 2MJNA 2EK1A 2QYCA 1JLAA 3EVMA 4HI2A 3ZXWA 3A13A 3EICA 5HQLA 5KT6A 4LIRA 1UVLA 3P49B 3JX8A 2RB7A 1HNZJ 1ZH5A 3IS9A 2QG9B 4PG7A 3SDEB 1XERA 1XK8A 2B4VA 2FTRA 1YG0A 4OYZA 4X84A 3G6ES 3Q23A 2OSRA 2V5IA 1HIYA 2XY5A 4P74A 4LIWA 5CD4A 2XS5A 1Y9OA 4LRAA 2FDNA 5KG7A 3H98A 3LGNA 1J2VA 2HPUA 4CYUB 1B3TA 3H5SA 3MECA 2AZ1A 2NSTA 3QJPA 2C2EA 2ASLA 1V3RA 2R2SA 3RBEA 3TZWA 5FJ4A 4C11B 4YEIA 2PYGA 3NP5A 4FYVB 3FSYA 4N41A 2N4DA 3HVTA 5CYQB 2JLFA 5JVHQ 4GO5X 1H38A 1LWXA 5A6PA 3OFFA 3GSIA 4LF4J 2EFVA 1FEHA 1Q0NA 1FCAA 3SDEA 3ZTSA 2ZZTA 3QGPA 3D4JA 3ETMA 2INVA 1QSSA 3NS5A 4JYAF 3AXKA 2A6MA 4B9MA 5IXUA 3KUEA 1LKZA 3NB2A 1O0PA 2CG8A 2HGLA 4NLTA 2DCLA 5LSLA 2HURA 3C14B 3N90A 1EZZB 3CCLS 6FD1A 2E9RX 5HSPA 2P6SA 2K7KA 3F41A 4OJ5A 1V9OA 1CC8A 3U1LA 4AE5A 1FE4A 3PW5A 3UW1A 1K47A 1NM2A 1O88A 2CUYA 3AJDA 1I94J 4FBUA 1PKUA 3H4BA 2HQGA 1QVFR 1IJFB 1RSCA 2XTWA 2B4PA 2QTWA 3GPAA 3Q8QB 1FFSB 2HGNA 3EGVA 3UFCX 1Y3KA 3HVTB 2FVCA 5CYQA 3MEEA 1O8LA 2QA4G 3LW5C 3M1VB 4LVOP 5E0OA 1QLNA 4K50A 1R0CB 1U0SA 2J0QD 1OFLA 4IDKB 1Q53A 1K9MT 3MPWA 4LF5F 2WTFA 1KHVA 1JLFB 3EVOA 3HHKA 1N5TA 5J2MA 4DX6A 1VQ7S 2XYHB 2AD9A 3HKZD 4LVNP 3CC2S 4M5JA 1REVA 3J80U 4OMFG 2MXYA 2O5DA 1YJWS 4FVCA 1C1CA 2GW8A 2Z0GA 3T5LA 4OZJA 1Q79A 5J2QB 3H42A 1HI1A 3RIQA 3AOCA 3KYLA 3AT1B 3KKFA 4P52A 1TK0A 4B3MF 4O0NA 4DSKA 2YX4A 1JX4A 2IYGA 4JI7J 2HWIA 4LQ3A 3B78A 2W9CB 2V2VA 3OVSA 2M52A 4R0EA 2HS0A 2OMOA 2DHXA 3L7OA 3MWBA 5KG6A 1H2VZ 4BHQA 2BKNA 3KLFA 2VQEF 2UU9J 2IVFB 1VQNS 2DGUA 4JBCA 5B0AA 2GJIA 3GIKA 4JI5F 1BWEA 2CZVC 3BYPA 4F4XA 1HQEA 2DBBA 3B4MA 4FKXA 3AD8C 4B3TF 1DJ0A 2NPIA 2J5AA 2OFGX 4RKUC 5IT9U 4TKTA 2F65A 3I4PA 3N01A 3KK2A 5DG7A 4ITSA 3I0RB 1CLFA 3ZZZA 1EIYB 1RLCL 3VSTA 1Z4UA 1PYSB 2I8EA 4CO2A 3TEHB 4F04B 5HVGA 2YH1A 1HR0F 4C0OC 2EPIA 5JXSA 4PG5A 2LQJA 3CD5A 4A8KA 3BBFA 4K4WA 1KQSR 1Y0HA 3KMSA 2NXUA 3LP1A 4PG8A 4ECYA 3BR9A 2VFNA 4LRBA 3V6JA 2WSEC 3VV2B 2ZDOA 3D6FB 4KH3A 3NXZA 3EZ5A 5F3TA 2J9CA 1RWPB 4ZCMA 1UCNA 3OT9A 3OL8A 1MLAA 3SCIE 1VC0A 1NZ8A 3PX0A 2ROGA 3MTKA 4P72A 2BKPA 3L3CA 4K0KJ 4I84A 4DEZA 1JNRB 3H2VE 3PYEA 3PR5B 2EW9A 4JV0A 3DLEA 5F9LA 4JI3F 2B3TB 2LXFA 3IR5B 1L3TA 3ET6A 1HNXF 2DR7A 4IRDA 1AIRA 2RUGA 3PZPA 1MU2B 1U47A 3GONA 3W2VA 1BGXT 2O01C 3IWXA 1QCXA 3PO5A 2CQDA 4ID8A 2X1FA 4ECVA 4ENOA 2VJUA 3IG1A 3M8RA 1SPBP 3RB3A 7FD1A 1WF2A 2MQMA 4NLVA 3BREA 1SL0A 2BM4A 4XTTA 4U8YA 2OUGA 2PMZD 3BQ1A 4DR1F 3I0SB 4BLGA 5A2QY 4DN0A 4FP9A 3MDFA 2KTQA 2IC3A 1SB6A 1M1GA 4K2JA 5A76A 1FJGJ 1ZAXA 4IR9A 2YWWA 2VPZB 3MR5A 5E3CA 2B43A 1O8GA 4UY85 4NWBA 1OYEA 3UCUP 1ELOA 2O1PA 1P1TA 1DBOA 1R7IA 1MU2A 2KO1A 3UO0A 3CUNA 1HR0J 4XN0A 5L38A 3W8PA 1F2GA 1WTFA 2CPYA 2GO9A 3U7JA 3OJUA 4HHHA 2ODLA 2VODA 2X51A 3ISZA 4USUA 5A8WA 2DO0A 2ZC3A 2N82B 3KG4A 2PC6A 1EAYC 2EFOA 4QQBA 5CQGA 3WZ0A 3HMJG 4OYWA 4ECZA 4B9UA 2MTLA 3D0GE 2GQCA 3SZEA 2FZCB 1LWCA 3NGKA 2W4CA 2P9GA 5AXMA 4X65F 1QSLA 1DARA 1DQ8A 3VVUA 2V4JB 2IDEA 3LOUA 5CHCB 1VHFA 1X7VA 2BKOA 2LQ9A 5BYQA 3IMQJ 2KYXA 3VMWA 3M2UB 1QA2A 2KYZA 4ICLB 3JS9A 5GMDA 3UD5A 5E5NA 4DPWA 5ETNA 3ZZPA 3H25A 2NCKL 1RT6A 3KUHA 4ZVPB 5CZXA 2E1MC 4X64F 1FI4A 3KLEB 3GIIA 2KFNA 4R8UB 3IA0A 3GYXB 4ZVTB 3SXLA 2F4VF 3GQ7A 2XYPB 3PW7A 3GFXA 5DQIA 1FRHA 2ATCB 1OSCA 2VG5B 3DOKB 2XZWA 3LPEA 4KB7A 1RTIB 4ZCKA 5C2CA 5EHHA 5IV3A 4OI0A 3MM6A 3HPOA 1FWKA 4DFKA 5H9EJ 5FD1A 3CJKA 5HL7Q 2UUBJ 4ILMA 3N9UC 1TAUA 2DCUB 1FK9A 1TTHB 2LDYA 4ZN3A 3QIPB 4J9NA 4DV0J 3TH0A 3TJ8A 1HKAA 1JLGB 3K5PA 3UR0A 1N34F 2DXEA 1J5OB 2BM5A 2DNLA 2MJUA 1DHMA 4HACB 3MR3A 2UXCJ 2AJ1A 5KG4A 4JOUA 4OIXA 2ATLA 2HHHJ 1WNEA 2H3EB 4MK9A 2LYVA 2ZWOA 2DHHA 3MM5B 4TQRA 2NTPA 5DM6Q 2DGWA 2R8KA 3MOJB 4RUHA 1G1XA 1S6QA 5LXYA 3HM9A 3N0VA 3MMCA 1IKWB 1CJUA 3GWCA 5EX0A 4Q8EA 4UUXA 4EGLA 3V4IA 1I3OB 3R6LB 4O4GB 3UCGA 5IM0A 5KFMA 1FO1A 2C2MB 2O66A 3T1HF 2ZZMA 3QT6A 4JRAC 1E6VA 1GMWD 3FRYA 5HMYA 2HLTA 1EZGA 4OYIA 1YJUA 4ZK7M 5IQ6A 4LF6J 2YWFA 2YQ3A 2YX1A 2Y3YA 1TKDA 2DHSA 2HHVA 4DPYA 3ZZRA 1HBMA 4W8QA 4PMHA 1JKHB 3MM6B 3BGUA 1NHKL 1TYWA 3KHGA 4CO3A 4CLSA 4IYQA 2AJ0A 4QCLA 3UW0A 3GSDA 3A3NB 1XMBA 3D68A 3ENAA 4WPAA 4ETZA 1UMJA 4DX7A 3CD7A 2AU0A 3JQMA 3DLKA 4A47A 5DG9A 1XNRJ 1HNXJ 2FD2A 3LALA 1HI8A 3M8PA 1URNA 1ZETA 4KTQA 2GJ2A 1QSYA 4MKBA 1TQLA 5KFXA 5I3QA 3KFWX 4D3GA 3F56A 1NSKL 3FCVA 1YIJS 3UN5A 2BM1A 3D6TB 2O17A 1F0XA 3EQOA 4KBIA 4MYUA 1N8RT 2ZH8A 3DLEB 2A0FB 1HW8A 4YUDA 4WCEQ 1N48A 3PRVA 5KFBA 2HSEB 3I56S 2CKWA 3DDNA 4NMLA 5H9FJ 3PKMA 3FQLA 4B3OA 1TKXA 2AJFE 3ZZUA 2DGTA 4KYZA 2JLEA 5L39A 1BQMB 1IR0A 2Z2YB 3GTYX 5G4DA 3I4HX 3W2WB 3W61A 1YJ7A 3D67A 4MKVA 4PG4A 1HPZA 4DR7J 5BYSA 2FJBB 4B02A 3CVKA 2BANA 2KB2A 1VI7A 3JSMB 3C2PA 1KSPA 3BR8A 1JLFA 5J2MB 4WYWA 3JXOA 4DL6A 3UR3C 2DNPA 1KP6A 3CW2C 1WC0A 1Z1ZA 2BJ3A 1F60B 3LAKA 3MAAA 5A8RA 4XOTA 2WVEA 4YY3F 3QJLA 4XDDA 3W65A 4CT8A 1XTZA 2IC3B 3CCZA 1CEZA 4LRFA 2FJWA 3HHDA 2UUCJ 5FIIA 3CJQA 1GXUA 5L46A 5MLCV 3H8YA 2NT6A 1S6UA 2CPEA 2MQLA 3BM7A 2KHCA 5KFUA 2AWZA 3CB4A 1RT4A 3WBZA 4C48A 1XJWB 1S76D 2OHDA 4OZ3A 2VQFF 3R1LA 1GMUA 3AJ2A 5EWGA 1VHIA 1WDDA 3M8YA 5DJBA 4C0BA 2XSJB 4KPCA 5K8OA 3Q8SB 1S4EA 1TL1A 2AKWB 3EE3A 3E3XA 2P5VA 1AXQA 1GXLA 4QWDA 2HMIA 2F40A 2I6WA 1E6VB 1O51A 1YSJA 3QPIA 4MK8A 4RX6A 2VFUA 4OJ6A 3ULHA 3CO9A 5KFJA 4QWAA 2YNGB 2UUTA 2HBQB 3BGOP 3TARA 1Q7YT 3RAXA 3FMBA 4G3IA 2QL7B 1RWRA 3DRSB 1JXLA 2WRMA 4ANEA 5ETKA 4BCAA 2NTBA 2CPDA 2Y1LB 1KS2A 4CH0S 1TKZB 1WSRA 2CQ1A 2ZH9A 4J7CA 1KFDA 2UVVA 2R8JA 3MHYA 3P5TL 2D3ZA 1JTAA 3QGHA 3SFUA 4HLBA 1T9YA 2VKZG 4RW6A 4QIEA 2DNHA 1PAEX 1RWKB 3L95X 4RBTA 2AF6A 3AOAA 3DHXA 4OYOA 4YY3J 2N7YA 2V4QA 3ILLA 1N34J 4LF9J 2DHGA 5LMUF 1FDDA 2PN6A 1JXVA 2Z2LA 4KT0C 4RW7B 2KFYA 2H1YA 3B4DA 3HSZA 5J2PA 4CH1A 4PKDB 3SFGA 2EG2A 3NCRA 4DZDA 1IN0A 1T7PA 1FVQA 3ZSCA 2YNHA 3V6KA 1EE6A 1EP4A 4LT6A 1W26A 2C2DA 4NASA 1Q7LB 3CCSS 4ZPBA 1FFGB 2ZBQA 1JLBB 2R2RA 4C8NA 5CYMB 2WAQD 2ALZA 1KLMB 4DS4A 1A6LA 1SC4B 4WP3A 2XTXA 4RW8A 4A8MP 3CIMA 3MMJA 2RAQA 2HVZA 5ETRA 1LW0A 3IGVA 2W4DA 3V6HA 4K5RA 2GMJA 3HZEA 4YOEA 1TL4A 2SXLA 3F44A 5F8HA 2C22A 3NAIA 4B9LA 3MCMA 2VUGA 1H2UX 2VBKA 2J7KA 3A12A 3MTJA 3TZYA 2L3MA 3HVRA 3OQ2A 4DV6J 2LP4A 2CFXA 2B0RA 4KRWA 3BSNA 2GCFA 1UPMB 2YPZA 1O8HA 1WKLA 2G0JA 2K7JA 3PJWA 1R8HA 4WKYA 2H5IB 3IXQA 1WG4A 2GAGC 5KG0A 2G2ZA 4OHXA 3MMBA 2MKKA 2DK2A 3VSUA 5CXTA 4ZDNA 4GC7A 1OJ4A 2AIRB 2CNNB 4J9SA 3RBDA 3GP9A 1WEXA 2VPXB 3MCSA 3UNGC 1S97A 1NJYA 4C8ZA 1FRIA 1MMDA 1FKOA 1WC1A 3HJVA 3QLHB 1KCDA 4PQAA 5DZ7A 2LEBA 4DL2A 3R9LA 4F7VA 4FYWB 4FNIA 4KKOB 4M5LA 2OMLA 1F9FA 4NLUA 3EPGA 1LFPA 2F3JA 5ETOA 1NH8A 4DUTA 4EW9A 1W25A 1RLDA 2BJ1A 5E2QA 2B9YA 5EWEA 1HBOA 4DDFA 3ENVA 4RU9A 2RQCA 1SUQA 2DGSA 1ITPA 2V8VA 3BN4A 3BQ0A 5H1SV 1KWMA 5HP1A 1XWLA 4OJ1A 5J1PA 3JB9k 4FF1A 3PRDA 3PJ9A 1X5OA 3RR7A 4LFCF 2OO4A 3MPDA 1DBDA 1S9EB 1RUSA 4F0MA 4ILLA 1XNQF 1TL3A 2IPOB 3RBZA 1LW2A 3MM8B 4RR5A 1HBNB 4DR2J 1JNZB 2E5HA 1MWQA 3C6UB 2RHQB 4DUYF 1ZZFA 5BJRA 2BR0A 4PWDA 1JLCA 1UAWA 1SJFA 1K73T 3PACA 3CMQA 5F0WA 4HTIA 1U2RA 2UUAF 4GVBB 2F8HA 1KVKA 1VRUB 1RHQB 2VA3A 2KU7A 1FEEA 1HWJA 3MCOA 3MPVA 1FXDA 4YFUA 1NHCA 2IVYA 2OP5A 4WFXA 4PXBA 3CMES 4YP3A 2KXNB 4EMDA 3ML3A 2FJDB 2EC2A 1NU4A 4XL9A 1Q8LA 4OHVA 3UNYA 5LXRA 4PUOB 2L48A 4LRCA 2CADA 4YMEA 3EX7B 4Q8FA 4OM9A 2Z58B 1M5OC 2VB6A 3GJSB 2V9KA 2AYMA 3BKUA 4CLYA 4KO0A 4CT9A 2NTQA 5A2QU 5U47A 2XSJA 2DO4A 1DLOB 2C2ZB 4JB8B 1U8SA 4EO6A 3FFIB 2MHNA 4YS2A 1RTJA 4QIGA 4ZITA 1JLAB 1L3SA 1TL3B 1UVNA 2H5EA 1RU4A 3THPA 5I42A 3DRXA 3PW4A 2CA9A 3J7A1 2A2CA 2XG8A 4FS1A 3DM2B 3GQAA 3LWLA 4O3SA 4OQJA 3BF4A 3R2CJ 3R2DJ 4I2QA 2ZJQQ 4HHUA 4KKOA 4EWTA 4E98A 2XB2D 3N6ZA 2VBXA 3FC9A 2ZBCA 2ZOFA 1TV6A 4KSEB 2CJQA 3MAQA 1N5YB 5HMXA 4QYRA 4ZJLA 4JI3J 3CJRA 1NBEB 2DIUA 3Q8RB 4ECRA 1D8YA 4NL5A 3WIVA 2AGPA 3G82A 3BS9A 2CWKA 4USJC 2XTYA 1VJWA 2CJAA 1T3NA 1TMMA 4AL5A 4EBDA 4FBTA 1S72S 1DAXA 3K8VA 2H54B 2ACMA 4ZVEA 2VBZA 2HQ3A 3Q24A 3M6WA 2W7ZA 1BQXA 2GGPB 2CPZA 2IRYA 4I2PA 4B3RJ 4JI2J 1EQMA 2YX7A 2V5HG 2FJXA 2ZWPA 2CDQA 3ITHA 3BGFA 2ZH1A 5GAGU 1T3OA 2CQ3A 2ZH3A 5EDWA 2J6SA 2E1AA 2FY8A 3B8YA 2XGQA 1TFYA 1Y5IB 2VJIA 3R5BA 3KHRA 3TUZC 1KQGB 4XO0A 3HP6A 3K89A 1FWPA 3MEDA 2X85A 2YPYA 4EK2A 3VZIA 1U1PA 3BDPA 2G2OA 2IMOA 2KRRA 3KWMA 1RU1A 4IH7A 2CQCA 2LVWA 3OXGA 2VBEA 2Q6BA 4MT1A 4YDTA 4V1Ak 1WUUA 2AEMA 3I0SA 2R42A 3MPUB 3QT7A 4DCJB 5C42A 2LXIA 4JI8F 4DV2J 4DV1F 3H59A 2W2NP 2YTCA 2RDIA 1ZPVA 1D9FA 4RW7A 3CPWR 3KLHA 4HVZA 2ILZA 1NO8A 3ZC4A 1QAIA 1VQ4S 5D6GA 3GB0A 5HK4A 1JKHA 4B3MJ 1PAUB 2M5YA 4DV3F 4JI7F 3MMAB 2QXZA 2INUA 1CQMA 2FHKA 5K8NA 2FVPA 3OBIA 1P6TA 4LFAJ 5A8KA 2W9AA 1M5VC 4JI1J 3L7PA 5IQQA 2NR0A 3MXHP 3SCLE 5E33A 3IWNC 2RDDA 4ZVHA 2XCPA 2WSCC 3GILA 4ZVSB 2M4MA 1KBRA 3V81B 2ZD1A 3IBWA 1NDLA 1U0HB 3VAMA 2WW8A 3EWGA 5FDLA 2LEAA 5IFMA 2EWHA 1GK8A 2YWEA 4JI5J 4JI8J 2E44A 1EQ0A 3TAMB 4IFYA 3WWGA 3RU0A 3W5YA 4PAAA 3HULA 4X4UA 2OD6A 1S7HA 4TXSA 4ZPWR 2P9CA 3MM5A 4KHMA 4HDGA 3VGTA 2FHJA 2W9CA 2K3KA 1NDPA 1TL1B 2HFOA 1Y10A 3NS6A 5B0EA 3C6TA 4C8OA 4HACA 4Y65A 3FVYA 3DLJA 2KI2A 3NCPA 3UVJB 3VTIA 2AYEA 1SJRA 4QPXA 1FDNA 1OSDA 3QWPA 3KRGA 4Y00A 3MFIA 1BQNB 3D66A 1YTYA 4LF8J 4IG0B 2BRLA 3SZ2A 3I5CA 2H5JB 1LK7A 4IH5A 4OHZA 4F2RA 5EN1A 3GV7B 4L74A 2XTJP 1MWZA 4CTAA 4NEYA 4NZ7A 5K8MA 2F1FA 2NXJA 2XMUA 4WTOB 4ED6A 2JEFA 4AL7A 5DLGA 3MAAB 1TMJA 4QOTA 5A8RB 1M90T 1B70B 1SH3A 1VBYA 2OJ3A 3KNAA 1IR1A 2X6WA 3N28A 1CJTA 2JEIA 1EJ7L 4XONA 2X1GA 1SIZA 4LSNB 5SZTA 2JEGA 3EUNA 2FLOA 2HNDB 4USVA 2VD3A 2D1CA 1ZZNA 1VQLS 1XMOF 4YC5A 3GCWP 2JWNA 2HLUA 3MOZA 2ZUGA 4NXMJ 1FKPA 8ATCB 4K4TA 2ZVSA 4F02A 2QA1A 4NRUA 4XMYA 2GVZB 2RU9A 4KQZA 4MTPA 2J0XA 3KLGA 1UWBB 3LAMA 4DV4F 2JEJA 3KK1B 4IR1A 2J7WA 4OZZA 1IDJA 3ZPPA 5AMVA 1QY7A 2L41A 2AX0A 1ZAWA 2JOQA 3GFYA 3PFOA 2KM8B 1HBUB 4M5GA 2JNJA 4EEYA 1HYSA 4LF1A 1N52B 4A4JA 3DGPB 1SBRA 1DZ5A 1CZFA 2D9OA 3ISND 1AZSA 1XQIA 1T03B 3CJ5A 4USHA 2VFQA 3IBCB 2FQQB 4OHWA 1TV6B 4ECQA 2OTLS 4EZ9A 3LJYA 2XSFA 2ZM6J 1KC8T 2BMBA 1BE4A 4WFYA 4JV5J 4A46A 1NCLA 3HHLA 3TUIC 4Q45A 1KRPA 1SH2A 3NMAA 4X62F 1SQGA 1VDHA 2ZVIA 4AXJA 2MQ8A 2ALYB 4O3PA 4DUZF 3VAIA 2MMYA 1X31C 1VCTA 3LH2S 4K0KF 1HWUA 2CQIA 1RT6B 1TK8A 2CQPA 3VMVA 4UOFA 2IFXA 2JLGA 5LL6d 4BS2A 1AUDA 3DNCA 3MUVP 4CO5A 4ERDA 5B7WA 3C15A 2BABA 4HTJA 2QO3A 1R0AA 3QAUA 3JAMU 2WONA 4I6YA 3BPSP 1HYSB 3ZZ0A 4RUBA 4XM3A 2OKQA 2FC8A 2UZAA 2BE7D 2XI2A 1F9HA 3VQTA 5F8JA 3C16B 5MAOA 1X0CA 3G6VA 2J0SD 4DU8A 2B6AA 3R7BB 4C98A 1U24A 2ZEJA 3HHLD 2WVFA 1CJUB 4ZMMA 2XM3A 1O8FA 3LP1B 1Q8BA 4ER8A 2D69A 2ZH4A 3PX6A 4PYAA 2RILA 3TP2A 1FRKA 5IWAJ 2D9PA 1RAOA 3R97A 5D3GA 4ES3A 1WG5A 1S1TB 2CQ2A 2M9KA 2V2KA 4DOZA 4O0IA 1R0AB 3IM8A 1OGMX 4XLEA 2QMWA 3HKWA 3BBCA 1S99A 1VJQA 3LP0B 2B9XA 5D0HA 3GFZA 4UOGA 4Z2XA 3NBPB 1UZDA 4NLRA 3HFVA 4F4WA 5L9NA 3EZUA 1HMVA 1TU0B 1UETA 2HFVA 5J2NB 1AFJA 2DEJA 3D9BA 2G2YA 3OSNA 4DLGA 5T7LB 1RAJA 3KLIA 1KVIA 5CCLA 4Z03A 2V2ZA 1UVIA 4ZP9A 2WBMA 1R3NA 1QRCA 2BM0A 2QT7A 3EXYA 2HKEA 1KNZA 1N54B 3FKBA 1PILA 2NZ4A 3ILJA 2V94A 1RT3A 1OO0B 3KLEA 2X1AA 1HNWJ 2WCXA 2AJQA 4D3HA 4CLUA 1HBOB 3J81j 3LMWA 1VC5A 2BV3A 5F3ZA 3I32A 1TL7B 4NLWA 5K14B 4JUZA 2BM7A 2DNZA 2WOMB 2XMMA 5T41A 3UN3A 4OPWA 4BC7A 3C46A 4NCBA 2BE2A 1HNVA 2VFRA 2UUWA 1LWEB 1RWNB 1F6TA 3D28A 4TLRA 5HVHA 4U49A 1V6HA 5LMUJ 2PI5A 4A8XA 5D15A 3S8SA 4NA1A 2KFZA 1RXOB 2XMWA 4PYDA 4C6AA 2XGPA 4HI1A 1BMQB 1JRGA 1BLUA 1MMNA 2NYHA 3Q83A 4CCHA 2E7VA 3J7ZT 1B7YB 1F9EB 1RJJA 1CS4A 4L75A 3OLAA 2DJWA 3PRBA 4O44B 4Q44A 1N5SA 2G13A 3IAS9 2Y1RI 1FF2A 4HDHA 4L76A 4WJBA 3CCES 3OW2R 1FJCA 3PSSA 3CXCR 1TYVA 3B90A 4ED5A 2FHJD 2BJ9A 2ZHBA 5ETLA 4OZ5A 4I67A 1RK8A 5T14A 4JYAJ 3HHNB 4DL7A 1LQ9A 2D7SA 3D6HB 5H9EK 5K20B 3UDVA 2B4UA 4BC9A 1GQEA 4N76A 1N0UA 5HQ8A 5IOLA 2QE5A 2UV8G 1U49A 2VOPA 2HVHA 2H4WB 5G0RB 5IC4B 4DG1A 2CWXA 4A8QA 4USKA 3D3BJ 2BJ7A 3FRZA 4AT1B 1GNKA 3DGPA 1R8BA 3SSRA 2CRLA 4NA2A 4OZ0A 2KH9A 2RDJA 3EGWB 1B7FA 3CD0A 1QM9A 1EA0A 4PPDA 2RE1A 3NNCA 4LSZB 2HHQA 1UKUA 3SCKE 1KCCA 4FZVA 1HI0P 3C19A 4B9NA 2QV6A 4C11A 4EBEA 2OPQA 3SY2A 1JLQB 6FDRA 2DH7A 4K7QA 4PQUA 4ES1A 1RU2A 2E5IA 5B0CA 2R7TA 3NG8A 4F0HA 2B56A 4CNYA 4XOPA 3H5UA 2IJFA 1D1UA 1S77D 5LSRA 4W8TA 1FKPB 3ISNC 4KGKA 2XY7A 1S0NA 3GFHA 3O6QA 1VRUA 3AH6A 3M2VB 3P5BP 4F3MA 4RWXA 2F8MA 3CF5Q 2MZTA 4YR3A 1OY9A 1TP7A 2V8DA 1X5PA 3DRSA 3KJNB 2DPIA 3T3FA 1U8WA 2DH8A 3IR7B 4WE1A 3SI8A 1ACMB 4A8OA 4Q2MA 1RT1A 2VASA 1B0PA 4U7CA 2Y0SD 3MFHA 2CAJA 3DOLA 3VQSA 4KFBA 2C3OA 1RT5A 2MY8A 5LM7E 3R8YA 4F0KA 2QMXA 5L1KA 3B54A 5HI7A 1HFEL 4RNNA 1YZ7A 2VFSA 2XZTB 5KFAA 4DPOA 2ZHAA 1AT1B 1G4CA 3PIOQ 1GX5A 4DJBA 4F50A 1KQ5A 4FNHA 3WX4A 1U1MA 4FXDA 1HHQA 5D0EA 2QLXA 3DI6B 3QSIA 2PGCA 5LSOA 3RB4A 4A8SA 4JI0F 2H65B 1NPRA 2QGFB 3ILOA 4LF4F 3OL9A 2AT1B 3E51A 3G6YA 2G1DA 4G6VB 1C1CB 1NB2A 3CDEA 2LXUA 4TQSA 3GLJA 4TY8A 5D0RA 2ZH7A 1UVJA 4YN3B 3M9NB 2QLFB 3HK2A 4LF6F 1S1VA 3UE2A 4ES2A 3OTBA 3GYGA 4ZN1A 3VAKA 3K0JA 1K0TA 4R5PB 2XC1A 1X4HA 1WWHA 2RVJA 4DR1J 2J8AA 1RAIB 4ELVA 2DPJA 1D8ZA 3MMBB 3K57A 4J9QA 4PPZA 2ZD1B 1F3FA 1U1KA 2HHSA 4N56A 3I5AA 1Y5LB 1NK9A 2B9EA 3HHEA 3TA0A 4USIA 4C8KA 1MW7A 3G96A 1RHMB 3LP2B 1P27B 3RGIA 4DSIA 5HMZA 5KFDA 1O8DA 1NDCA 2W7AA 1N5YA 3QRQA 1KKHA 4OX6A 3FDSA 4CM0A 1NK8A 2IM1A 3I9V9 4QYZJ 4O4RA 5GADU 4KGXB 1T9TA 1KONA 1YBAA 3FUYA 2VBYA 4L6V3 1YKWA 4M5HA 4TY8B 3BO3A 1N6QA 4NXNF 2R7UA 4L3NA 3C14A 3H2LA 1ZM4A 2KVQE 2DNQA 3BB5A 4Y2AA 4ZP7A 4PEOA 3K5LA 4DFMA 1NKCA 2XMKA 1NK7A 3DLKB 2OTJS 2XZDB 4ZVRB 3FFIA 1WI6A 1Q16B 2F63A 4CO0A 1F2HA 2EKYA 2VC0A 1FNMA 1T05B 5JMCB 2V8GA 3TI0A 2B0GA 1RTDB 2B8QA 2LCWA 5ETTA 2O3DA 4Y2CA 5DGBA 2IHR1 1KQKA 4FXVA 1ZYQA 4GO7X 2HMIB 3DOLB 4M5NA 2HVEA 2YNIA 2ZITA 2ZHOA 4OI1A 3DYAB 5B09A 3QZ7A 1P9YA 2ILYA 5LJ3Y 3FSIA 3TANA 1I6JA 3NL0A 1BD6A 3Q22A 1OPZA 4I1TA 4OZNA 3TYTA 5J1EA 4A8WA 1DQ9A 1UA1A 3GQ9A 3JSMA 1FXRA 4V02C 4DV6F 2EK6A 2N3OA 4YB5A 5HROB 1H7XA 5I3UB 4P2FA 2MQOA 3OHAA 1H6KX 3TVYA 1IBLJ 1UPPA 3SUCA 3RG6A 1RAHB 2APOA 2DNRA 4FKYA 5IT0A 4OYAA 4DQRA 2FY1A 4L73A 1QA3A 3SBMA 2KJWA 2HWHA 2R7OA 3M8ZA 1TL7A 1ZM9A 1A7GE 1KFSA 2ROEA 2RIJA 1KD1T 2YKNB 3R5GA 4C3MA 4N5SA 4ZOSA 2C2KB 3O5TB 2U1AA 2IY5B 2RSQA 2IAJB 3CDAA 3UPFA 4YELA 2VJJA 2WHOA 4P6QA 5JLVC 1CQNA 3BGLA 4DF8A 4DR6J 2ZE2B 3OL6A 1SV5B 2AW0A 3CJ8A 3AJ1A 4TLQA 2QFJA 1DQAA 4DMZA 5LMNF 3B8HA 4HYKA 2NUHA 1RT4B 2XHWA 2GNKA 4TN2A 3UD4P 2RT3A 4C3LA 1VRTA 4FYDA 1A9NB 4ZJOA 3BSCA 2C2OB 1QAJA 4UW2A 3MD1A 1WSVA 2M2BA 3CDUA 4KAIA 3OTOF 3NGSA 3KOAA 5KAKA 1ROFA 1RT7B 1VBZA 4WZMA 2BW7A 1C0TA 2AJ4A 1N0VC 2HK3A 3BKFA 4O3OA 2WB1D 3SCJE 3T41A 2KZMA 2WZ1A 2QA2A 2DR9A 2Y9HA 1FX2A 5M2PA 3J80Y 3CCTA 2W2QP 4QBUA 1RISA 3Q8VA 1WG1A 1TYXA 8AT1B 4UOCA 3MR2A 5KFSA 3PEHA 1WJ9A 3GG0A 3FZBA 1GMVA 1NLKL 3DOMB 4U95A 4F3QA 1FD2A 2RHSB 3OSPA 1X9MA 3QRPA 3K7RA 4I69A 1S12A 1TKXB 2MSSA 1KR4A 1S6QB 1IA5A 3DU5A 3LGHA 3ZFVA 2HZAA 5ITHA 1LWFB 4XLAA 2HNYB 1R43A 3POTB 2QMUB 4IRKA 1XR7A 2MB0B 3UDCA 4J9UE 2DR6A 4KR0B 2COLA 3A8IA 3MM9A 2YNIB 1RACB 4IQMA 1JQGA 3PJXA 1R8AA 4YB7A 2GVDA 5KG5A 2ZBIA 4MR0A 4RNMA 3M6VA 4CRJA 3E2EA 4LF2A 2YKOA 3CEDA 2JSXA 3O2IA 5E41A 4OX9J 1QE1B 4LF5J 3LWMA 1RTIA 1QRBA 2DT9A 2XO6A 3T9ZA 3VAHA 3TQEA 1U2CA 3FEYB 4BDPA 2ABYA 5T7LA 3V5RA 2HAFA 2HGMA 2C42A 3AD7C 4ECWA 1R6YA 3CCJS 1SJ4P 4DS5A 4FF2A 2R4FA 3TUPA 1DABA 1IKVA 2VFTA 2YQ0A 3T5HA 1X0FA 1ZTWA 5M2UA 3RRGA 3BO4A 4MAKA 4P7TA 4ZVUB 2XHCA 1KEKA 1FFWB 4ZPDA 2ZNYA 1HPZB 2MZSA 1UW4A 3N6LA 3OTCA 2QIFA 3V4IB 2XLJA 2GJFA 1LWFA 1RWVB 2HNYA 3CJ0A 1UWBA 4OJGA 5L9XA 1NPPA 1G7CB 3MZIA 4X66F 4NEZA 4ZHRB 1IBKF 4FN5A 2OLWA 3CCVS 3I9ZA 3HVAA 2E5GA 5JMNA 2WOMA 3RR8A 3EGZA 3CJ3A 2V67A 2W9BB 2B6AB 1OQ3A 1HQUA 3THTA 1MSWD 2FB0A 5HLFB 2GC8A 2GFFA 2IYIA 3PXGa 2UVFA 1O8JA 1LWEA 1S57A 4RW9B 3ZZYA 3QAEA 3TA2A 1YJTA 2MGZB 4QWCA 1W2BR 4Y3CA 4MJKA 4XKWA 4PG6A 4G65A 2HNZB 2F4VJ 1SQFA 1U48A 1FRXA 1RAFB 2RNEA 3TQ1A 1N33J 5BYRA 2HRYA 2V9WA 2MZRA 4E2FB 3W7BA 2V69A 3H4DA 2VG5A 5CYJA 2J7UA 2QSWA 5DRKA 2G0IA 1WORA 2ROPA 2WVBA 4TU9A 5A0YA 5C24A 2XULA 4X4PA 5GVQA 3SV3A 1S1TA 5L8RC 4AXIA 1BUXA 3HO1A 1PYTA 1Q86T 3WX8A 2OGUA 3E01B 2VG7B 3K5NA 1H7WA 2D3UA 2IAJA 4KH1B 2C2NA 1OIAA 2HQFA 1G3OA 5D4LA 2M3DA 3VGUA 4RW9A 2MGZA 2C3UA 2ZC4A 4H4MA 2ZH5A 4PRFA 1NH7A 1M5PC 3FCHA 4OX8A 1TVRA 4KPYA 4ZVOB 1N33F 4RNHA 2IIHA 1Y4ZB 2MZ1A 1V5VA 4P9SA 4TU7A 4IFVB 1RA7A 1IKWA 3T19A 3HFZB 4C2MA 2XLIA 5C2GA 1RKJA 1QUPA 1U0HA 5IT9Y 4OLOA 4J37A 4DI6A 2BQ3A 4J90A 3X1LB 2BSPA 2AHOB 1IM6A 2EI5A 3N5BA 3QNWB 2OD4A 3CJ2A 5JJBA 1FNOA 3M4XA 4TY9A 3NGUA 5HMWA 2XMAA 1RHKB 3IN5A 4QZVB 1KVJA 1S0OA 2DNOA 1U26A 3BZQA 3HFKA 2NSCA 2VFVA 1YLXA 3CJ4A 3D1QA 4FVMA 1QA1A 4OJHA 3CSKA 1GMWA 4IOAQ 1UFWA 2LFVA 4I64A 2OPPA 5KOXA 3PM9A 1P9QC 2V2QA 4ZS6A 5KFVA 2DKOB 3M8PB 4F25A 3MR6A 1U6ZA 3OUYB 1D09B 2PA8D 4OI2A 4ZPCA 1N5VA 4N47A 3J81Y 4DFJA 1KN6A 1VK3A 3HHLB 3KXDA 4XPEA 1IBLF 2UVWA 1K1QA 1S79A 1IKYA 2W1BA 2Z2MA 3DMJB 3ZTPA 2EKNA 4F67A 3VGSA 3G8SA 1OFDA 3PIPQ 2DNKA 2IM2A 2ZJPQ 5B08A 4K4SA 2BOAA 1CBKA 4GVLA 2VBWA 1WOSA 3VAFA 1H72C 1QUVA 4H54A 3X3UA 3RB0A 2FLPA 1CLWA 1BQNA 1SVDA 2QL5B 5HN0A 2OFHX 1UW9A 4L72B 1C4CA 2CPJA 3NGRA 5B0FA 3TJ9A 1FWLA 1YWXA 4XAKA 4OYMA 1Q8IA 2C3MA 4O4GA 5IM0B 1JJHA 1JK9B 2V68A 1FERA 3HD2A 5EUHA 1RWXB 1RBLA 2E9ZA 1O8IA 4NCGB 4UQGA 2UU9F 3PX4A 3C3LA 1PO6A 1N88A 1BQMA 3IRWP 2XLKA 1IVZA 3QO9A 4DCPB 3AB2B 1S1XA 1VISA 2GA7A 4TYAA 4J9LA 1W2IA 2VFPA 4WK3A 2PIIA 2BJDA 2RQKA 2FZGB 2CNLB 1Q81T 3G8QA 2GQ2A 3A3PB 2GV1A 2JVRA 3K5OA 4NYZA 4C9DA 1PE9A 7FDRA 2E7XA 4R5PA 4Y2IA 2DVIA 1M0SA 2PFFB 3E01A 4IDKA 2R7XA 3RYLA 2RU3A 3LANA 2AX1A 3QBCA 4WIQA 2O0WA 3MI7X 4B3SJ 2CG4A 3CJTA 5A6WA 1X4AA 2CJKA 4UQTA 4IKAA 1E6YA 1ZOTA 4O3RA 5IWAF 2UXDF 4Q2LA 1R31A 1N56A 1HW9A 4CLZA 2R7VA 3A4TA 4MFBA 4BBYA 2RKIB 2B5JB 5GAGI 4WFAQ 3LYCA 2F8EX 2YH0A 4HR2A 4JI2F 1FHTA 4ALZA 1WKKA 2FYXA 5DZ6A 5ETMA 1UP1A 3J7YI 1VR6A 4X65J 3R1HA 1FD8A 1I5OB 3DLBA 4TNOA 4DFPA 3L7UA 3FSXA 3G6XA 2ERRA 2EVZA 1Q82T 3SEOA 4QU6A 4MKYA 2HNZA 5KFFA 4NK6A 4Y0FA 2X6XA 1O6XA 3G8TA 3PW2A 4OI4A 2MLYA 4XNFA 1RKIA 2BW2A 2KT2A 2X3DA 3BKTA 3D7SB 4N77A 3BQ2A 1EETB 4LF8F 4Q0BB 3R5JB 1QVGR 2MQQA 3DRRA 4YCQA 1YBTA 3D3CJ 3EGNA 4IFYB 4OYBA 2B9WA 3GQCA 3D54A 5HROA 3AOBA 5D8HB 1K0VA 1H2TZ 3IR6B 1KTWA 3MPYA 1JLGA 4KE5A 1J5OA 4M5MA 2D74B 2VHGA 4ECSA 3GJRB 1URRA 3CCWA 4URQU 4CQ1A 4GKKJ 2HHUA 1T9UA 3PV8A 2NXCA 2WVCA 3R3TA 3JTOA 5HO4A 2JDJA 2VDHA 2R9LA 4CLLA 1OFMA 3HD1A 4KGVB 4X4VA 2NYIA 3VALA 1XEZA 1U25A 3DLHA 1SJ3P 2Y1IA 1M1HA 3WC2A 3U1MA 3OVAA 1SJQA 1HARA 2JRSA 5DDRC 4DR3F 1AB8A 4NXMF 1U6FA 1S0VA 3RRHA 5HAOA 4C8MA 2DRAA 2NUUG 2F7VA 1TUGB 2CJXB 2J9DE 1YJRA 2Q43A 5BR8J 4F4YA 5F8LA 1CPZA 1UL3A 4MMOA 1APSA 1KOOA 3GIRA 4P2XA 3JAMY 4Y2MA 4OJLA 3HVWA 3SSSA 2P6TA 3GQ8A 3FNNA 3CT9A 1KDNA 3T6BA 1PCAA 3HZGA 4ZLLA 5E7OB 4ZLNA 3NRBA 5J2PB 4HL9A 4G1QB 2Z30B 4X64J 3RRKA 1OQ6A 4NI2A 3TUJC 4OHYA 3SIPB 3H40A 2ZBPA 1KTQA 3K2YA 5IV4A 1NHUA 1RZMA 1GQ8A 3P6YC 5GAEU 3PETA 2YKAA 3EYZA 1GX6A 4OV6A 4WP9A 4DCOB 2UVRA 1RHUB 2DGXA 3OVBA 1NKEA 1HWIA 1NRKA 3HLUA 4FYYB 1IBMF 1DY3A 4LF7J 3KNGA 8RUCA 3IWLA 1JLEB 3IAM9 3KDNA 4J9VA 4Z06A 4LR8A 1TZ0A 4ATNA 4P73A 2G0CA 4HHJA 1TYUA 1IKXA 1NUEA 1S59A 2W2MP 3IRXB 2I5JB 2CJ9A 1MROB 2CJBA 1FE0A 1VYAA 3MEGB 3GV5B 1UFLA 1Y11A 2XMTA 3MGJA 2WVDA 4YEJA 4DL5A 3PG9A 2OSQA 1HBNA 5HQMA 3FK4A 1FT8A 4W90B 1D3WA 2HFNA 1PLUA 4M94A 2V6AA 1YI2S 4DQPA 1CJKA 3V6DB 2NXNA 4MXNA 2B7BB 2EFQA 2PA3A 4WU3A 4UT4A 3FMWA 2NQPA 2GVDB 4KGMA 4W98A 5F8IA 2VPWB 3K5MA 1LEOA 3EM1A 1H0HB 1WI8A 3ENQA 4LBHA 2JL9A 4C97A 2YKNA 4RBVA 3FBBA 2W8LA 1X9SA 4V19J 1N32F 5CCMA 4F4AA 2XY6A 5KFEA 2RRAA 3MEKA 3L9ZA 5CH7B 4RLEA 2I5JA 3QIDA 3RBXA 2XT2A 1CULA 1IKXB 2DNNA 2E5JA 3IRXA 4TVAB 1I1GA 1X9WA 1DURA 2AEFA 2VIHA 5DG8A 2N4CA 2FJAB 3E8OA 3M6UA 4X4SA 1Q8KA 3VHQA 5I3UA 1O8KA 2IA0A 3PO4A 1GTEA 3IBFB 1YDLA 3JQKA 2HEKA 2AYGA 4HT7A 2IM3A 4B3SF 4DSLA 2LLZA 3H0PA 2X7IA 4ZLJA 4LQ9A 2R8HA 2HS3A 2ASJA 4HKQA 1ZTTA 2CPXA 2LA6A 3DU1X 5D0GA 5AJ3J 2OPSA 3DC2A 1O8BA 1PJ6A 1IJEB 2R3VA 4OZ2A 1SH0A 4YB6A 4NLXA 3RW7A 4CO4A 1S9EA 4M8LA 3S6EA 1RWOB 2IDLA 4C8YA 3B6BA 3IGNA 4GKJJ 1XN9A 3KK3A 1CJKB 1PSDA 5KT4A 1YJ9S 1M1KT 2DGVA 2DR8A 1GT8A 2MKYA 4RBUA 4YZ0A 4OJPA 4HH0A 2A18A 1U1NA 2G1HA 5L1JA 1EKSA 1L1IA 2M8HA 3OFHA 5IS2A 3H7HB 3MURP 3T5JA 1NK4A 1MROA 3LUYA 1H98A 1TL5A 4ICLA 2A3JA 2G9OA 4QIFA 3UN2A 4NLGA 2GHVC 1L3KA 5AJ3F 3SV4A 4A8YA 4QU7A 1TELA 1JLEA 2GX8A 2HZVA 4F4KA 1AFIA 1T94A 4C3KA 1P8GA 1UVMA 2CQ0A 4YZQA 2RH3A 3MEGA 4PXEA 5ETQA 1NK6A 1FJ7A 1NJIT 3ITHB 4NXNJ 4ID5B 1O8MA 1WD6A 2POKA 2B8PA 4WXOA 3RJMB 1LV5A 4ILRA 3LTOA 4AYBD 9ATCB 1VQ6S 2PDAA 1YBUA 4H4OA 2F9JA 1FTCA 3NNAA 1NZAA 1IDKA 1LOUA 1Q95G 1U1OA 5F8GA 3D1HA 4YDXA 1UA0A 3BN7A 3N6NA 3KK1A 4DSJA 3GR1A 1RAGB 3M7VA 3U1NA 2UVUA 4PQUB 1PIEA 2F4FA 1G6BA 2VJVA 2AQ4A 1EETA 3M05A 1PBUA 4NMXA 3TX8A 3M1VA 4DBQA 1GAOA 3Q8YA 3RUBL 1MWYA 3NGDA 1K4ZA 3WHIA 2JC0A 5AT1B 2ACYA 5C1EA 1XR6A 2JC1A 2HNDA 2J8SA 1S5ZA 2QLWA 3CJSA 3DU6A 1HLWA 1T95A 2F9DA 2CVIA 1S0MA 3DI6A 2OEJA 2VG6A 3M9MB 3BJYA 5L1IA 2Y8YA 3BYRA 5KFPA 3NWGA 1IM4A 4U7UD 3US5A 4DV5F 1NAQA 1S1UA 3IP0A 3OR1A 5I4MA 4X62J 4DSEA 2QC3A 2K1RA 3SQGB 4QW8A 2CDRB 4YR0A 1S1WB 2W24A 4CLTA 2IBKA 3PYDA 2HIYA 1FRLA 1RWUA 3PYGA 1YZ6A 4XN3A 2VZ9A 3QT8A 1S10A 1NXIA 1B0VA 3CTRA 3OFGA 3VGVA 1RGVA 2DY1A 4RNOA 3CULA 4RW6B 1O5JA 2DNMA 3V4MA 4ZIVA 4Z7YA 4FPRA 5KG1A 1WHVA 1WEZA 2KZZA 2DNGA 2DGQA 2HIQA 4O44A 3Q2TC 4QR0A 3OFEA 1WC3A 4ZLPA 3HT3A 2VOOA 1TFWA 4WP8A 3LQVA 1C0UA 1Y00A 2LQ8A 4WFNQ 4KGZB 1VIOA 1JWWA 4OYXA 3M2VA 1Q5YA 2OPQB 1N32J 1QTMA 1QDUB 1VQSA 1X4FA 3NGTA 2LQBA 4ZP6A 3J81U 2R7RA 4UY8T 3I55S 2XNQA 1RCXB 1XMQF 3QATA 2GIQA 4LBPA 1NJXA 2HHTA 4ZPVR 4NCGA 4NI2B 3GCXP 1EHWA 3GIJA 3H2UB 3Q8UA 3N4WA 2E9TA 1LXJA 2YNGA 4B9VA 5KFGA 1VBLA 1HNIA 3GZ7A 5CAAA 4NCAA 4DG1B 1U2FA 4CI0B 5ADZA 5KG2A 3KHHA 2HHXA 1NHVA 1RTHB 1AUSL 2PMWA 2VC1A 2WW4A 4WBFA 4XLFA 1RE1B 3RB6A 4K4UA 2BQRA 1BY9A 1FDAA 2JZ5A 3ILIA 5I3PA 3W5XA 2PSZA 2KJVA 4ED7A 1N6QB 1R27B 2FGOA 3ELHA 3I96A 4G1PA 1IR2A 4F36A 2XCAA 1IWGA 5HJYA 2QX0A 4AL6A 1VQOS 4RJVA 2Z56B 4NLPA 1VQ5S 5E3QA 4A8FA 5KFCA 4GKJF 1VGYA 1AA1B 2BANB 3TW0A 1HHTP 3O8WA 3AA9A 2DB1A 2V63A 2ZBRA 1PC4A 4KHRA 4DZ6A 4DQIA 2VH7A 4ELTA 1RAAB 2DITA 1FKOB 3L4BC 3M9OB 3GV8B 1HNZF 2FVRA 3RW6A 2DXDA 2RD5C 3M2UA 1VQPS 3K17A 4I0WA 2JFKA 1OMSA 4DV5J 3IO1A 2V0NA 5KTQA 1FKAF 3DRRB 2UUBF 3QWUA 3GJQB 4U7UK 1N4LA 1BN8A 1S1XB 2B7CB 3RAQA 4YZXA 1EX8A 4NX9A 2XNRA 2VU5A 1TSPA 3K59A 3QO9B 3BO2A 2PEHA 4WK1A 2HK2A 1F5BA 1YK9A 4Z7CA 4OYPA 1QAXA 3ZTRA 4RZRA 3H5YA 4GC6A 4QWBA 3TR5A 2H9ZA 1Q4RA 3DFEA 3M32A 3CIZA 3Q0AA 3AQOA 2R7WA 1UWAA 3MM7A 5KFLA 1QAYA 3JYTA 3M8QB 2H4YB 3BBBA 3R27A 5G0RA 1FK9B 4XDCA 1IQTA 2X3GA 3JQJA 3PDNA 3LPYA 4EUVA 1NK0A 3W66A 5F8MA 1IWAA 1VRQC 2KVIA 2Y0BB 5M2RA 3DLGA 4RW4A 4ECTA 1NSQA 2DIVA 3PKYA 1E6YB 3NY0A 3KJVB 4FDFA 3MUMP 4DUZJ 2QY1A 4DQQA 3TO8A 1YJVA 3HX9A 1K5CA 1T0TV 1ZBTA 3TAPA 4K4ZA 2LEPA 3CD6S 3DGVA 3GYNA 2MY7A 4J9KA 4CDIA 2W8KA 4ZVFA 3W2VB 5HBMB 2QX3A 3JSBA 2UUCF 5RUBA 2VFMA 2CJYB 3OL7A 2MZQA 2AMCB 4LSLA 4EYHB 2AP6A 1UEUA 2B4OA 4QPTA 4DHVA 3OV7A 4ED3A 2U2FA 3Q2SC 2XWXA 1X8DA 4RO0A 1OY8A 2IOUG 2DY9A 4W8SA 2A2DA 1CJVB 4A48A 4DWIA 4P71A 4EBCA 4BWMA 4ZHRA 4DV0F 4S0MA 2YBVA 2IA6A 1F5CA 1JJCB 1P1LA 2O0VA 4LR7A 4G1IA 3AK5A 1RWMB 2FHMA 3JTNA 4ED1A 4JI6J 2R7SA 2YY3A 3UWTA 5JUMA 4DUYJ 3TEGA 2YUHA 4FS2A 5IZHA 1RYSA 2IRUA 3TJAA 4X4QA 2Q3PA 3NLCA 4RW4B 2ADCA 1N36F 4U96A 3A1YG 1TKTA 4FYXB 1XIQA 3KLIB 2VONA 1FJEB 4IQXA 4QIVA 1HD1A 2NT9A 4HT5A 4DX5A 4YHHF 2NS1B 3TAQA 2VA2A 3RTVA 4YEAA 1UEKA 4X4NA 1S6OA 4I56A 3PSZA 3N6MA 3TRGA 2MKIA 4Y2KA 4TU8A 2NREA 1FRMA 2G0YA 2MZJA 4I6WA 3UVJA 2HRTA 3IG1B 4IUFA 3DDIA 1YRTA 3EDQB 3HT0A 2UP1A 1KLNA 2AV5A 2HFSA 1B0TA 4QWEA 2KKHA 1CS4B 3OTDA 4ANCA 4CO1A 1QD1A 1WOPA 4V19X 1SQEA 3U02A 3BGRA 2E1CA 1I51B 4B9SA 1J5EF 2HHPA 5DS7A 2K06A 3OHBA 5D4PA
chains in the Genus database with same CATH topology
1B4SA 4C6AA 2HURA 3N90A 1QQ1A 4OJ5A 1K8FA 3Q83A 3SZEA 3ML3A 4F36A 3ELHA 3LYCA 4HR2A 3VVUA 1PKUA 5JMCB 1WKKA 4KPCA 2B8QA 3EE3A 3GPAA 4OM9A 1S57A 2DXFA 1HF2A 1QA2A 2HVEA 3L7UA 1TYVA 3JS9A 4CP5A 4OJ6A 4DZ6A 5C7PA 3B6BA 2NCKL 5CABA 2DXDA 3EVOA 4ANEA 2J8IA 4OJPA 4V02C 3FCWA 5IOLA 3SYJA 2AZ3A 4FKYA 2VU5A 1TSPA 3Q86A 1PAEX 3N6ZA 1QA3A 1NSPA 3P4GA 3FC9A 1BUXA 3WX8A 3ZTRA 3G2XA 3RIQA 1JXVA 3TH0A 4O0NA 3DKDA 3VGUA 1XQIA 1WKJA 3EVWA 2DXEA 1B99A 2F3LA 2BM5A 2VFQA 3Q89A 3BBBA 2CWKA 2BM6A 5JLVC 3LJYA 2B8PA 1MN7A 1BE4A 2BEFA 3ZTOA 3BH7B 1NCLA 1W7WA 4DI6A 1K44A 4FKXA 2W7ZA 1NSQA 3FBCA 3NGSA 3NGUA 4UOFA 4OJLA 4JRAC 1KDNA 3BH6B 1U8WA 1QA1A 3Q8YA 1K4ZA 1WXRA 2BX6A 1ZS6A 1S5ZA 2ZUAA 2VFOA 1MN9A 1HLWA 3BBFA 3Q8VA 4EK2A 3ZTQA 1TYXA 2B0RA 2VFMA 2VFNA 2DYAA 1NHKL 1TYWA 1WKLA 3B54A 3EJMA 3FBEA 3PETA 1NLKL 4KH3A 3ZTPA 3VGSA 1KQ5A 2IOUG 2DY9A 3ENAA 1HHQA 1UCNA 3EVMA 3EICA 4S0MA 3GP9A 1BHNA 3JX8A 5BXIA 1CLWA 3FBFA 3AK5A 3VGVA 1NB2A 1NSKL 3FCVA 3NGRA 1TYUA 1NUEA 1S59A 3R9LA 4ANDA 2YUHA 1VYAA 4UOGA 3BBCA 4OJOA 4DUTA 4UOHA 2XC1A 2V5IA 1HIYA 1NPKA 4ENOA 3PRVA 3VVTA 1XIQA 1NDLA 2BM4A 2AZ1A 1F3FA 1QRBA 3PJ9A 2VFPA 1QRCA 3MPDA 3NGTA 4W98A 3FKBA 1LEOA 3EM1A 2G0YA 1NDCA 3VGTA 3DDIA 3FBBA 1LWXA 1NDPA 1EHWA 3ZTSA 4F4AA 3Q8UA 1DABA 4ANCA 3EMTA 2BM7A 3ETMA 5CAAA 4OPWA 3H09A 1NDKA 2HVDA 1F6TA 4WBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B4S A;  4C6A A;  2HUR A;  1K8F A;  3Q83 A;  4F36 A;  3ELH A;  4HR2 A;  3VVU A;  1PKU A;  1WKK A;  4KPC A;  2B8Q A;  3EE3 A;  3GPA A;  1S57 A;  2DXF A;  1HF2 A;  2HVE A;  3L7U A;  3JS9 A;  4CP5 A;  4DZ6 A;  5C7P A;  3B6B A;  2NCK L;  5CAB A;  2DXD A;  3EVO A;  4ANE A;  4V02 C;  3FCW A;  5IOL A;  2AZ3 A;  4FKY A;  2VU5 A;  3Q86 A;  1PAE X;  1NSP A;  3FC9 A;  1BUX A;  3WX8 A;  3ZTR A;  3G2X A;  1JXV A;  4O0N A;  3DKD A;  3VGU A;  1XQI A;  1WKJ A;  3EVW A;  2DXE A;  1B99 A;  3Q89 A;  3BBB A;  2CWK A;  2B8P A;  1MN7 A;  1BE4 A;  2BEF A;  3ZTO A;  3BH7 B;  1NCL A;  1W7W A;  4DI6 A;  1K44 A;  4FKX A;  1NSQ A;  3FBC A;  3NGS A;  3NGU A;  4UOF A;  1KDN A;  3BH6 B;  1U8W A;  3Q8Y A;  1K4Z A;  2BX6 A;  1ZS6 A;  1S5Z A;  2ZUA A;  1MN9 A;  3BBF A;  1HLW A;  4EK2 A;  3Q8V A;  3ZTQ A;  2B0R A;  2DYA A;  1NHK L;  3EJM A;  1WKL A;  3B54 A;  3FBE A;  1NLK L;  3ZTP A;  3VGS A;  1KQ5 A;  3ENA A;  2DY9 A;  1HHQ A;  1UCN A;  3EVM A;  3EIC A;  4S0M A;  3GP9 A;  1BHN A;  5BXI A;  3FBF A;  3VGV A;  1NB2 A;  1NSK L;  3FCV A;  3NGR A;  1S59 A;  1NUE A;  3R9L A;  4AND A;  2YUH A;  1VYA A;  4UOG A;  3BBC A;  4DUT A;  4UOH A;  1HIY A;  1NPK A;  4ENO A;  3PRV A;  3VVT A;  1XIQ A;  1NDL A;  2AZ1 A;  1F3F A;  3PJ9 A;  3MPD A;  3NGT A;  4W98 A;  3FKB A;  1LEO A;  3EM1 A;  1NDC A;  3VGT A;  3DDI A;  3FBB A;  1LWX A;  1NDP A;  1EHW A;  3ZTS A;  4F4A A;  3Q8U A;  4ANC A;  3EMT A;  3ETM A;  5CAA A;  1NDK A;  2HVD A;  1F6T A;  4WBF A; 
#chains in the Genus database with same CATH topology
 1N36 J;  1B4S A;  3FJ2 A;  2MHE A;  5AXK A;  1HD0 A;  4JI0 J;  1V3Z A;  2W01 A;  3DDK A;  1RAE B;  1NK5 A;  3SQO P;  1VS3 A;  2QLJ B;  5EGY A;  4PWU A;  3W60 A;  3DOM A;  1OYD A;  4PWD B;  1TVR B;  5D78 A;  4RWW A;  2BOP A;  1FDB A;  2YKP A;  1RA6 A;  2Y8W A;  2DXF A;  1IUJ A;  1HF2 A;  1O8E A;  2LA4 A;  1ZA1 B;  3MMA A;  2O1D A;  4I4B A;  2ZH6 A;  4AQY F;  4ED0 A;  3W62 A;  3HCX A;  3TX0 A;  2PMH A;  4F4Z A;  2BDP A;  2HZC A;  2MKS A;  3AAW B;  3KLH B;  3SYZ A;  2DEI A;  4JI1 F;  5KFI A;  2HFZ A;  4ZPT R;  5K9F A;  2E7W A;  5A0Y B;  5C24 B;  2XO7 A;  4Y28 C;  3T1Y J;  1XMO J;  4LFC J;  1DTQ B;  4GMK A;  5L1L A;  1X4E A;  2IRX A;  5BR8 F;  4J9P A;  3DMJ A;  1OGO X;  3THV A;  1IKY B;  4FXW A;  1RTH A;  3TWZ A;  2EG1 A;  2JHE A;  3FY3 A;  1X0P A;  2NLW A;  2J8K A;  1AZS B;  1NJZ A;  3ET6 B;  1U4B A;  4NYP A;  3KK3 B;  4DV1 J;  5DM7 Q;  2VF3 A;  2XBP A;  3M32 B;  3C6T B;  3G2X A;  4OLP A;  2G4B A;  2R7Q A;  2DHA A;  1HBU A;  4M5K A;  5E3P A;  4ZCL A;  6AT1 B;  3TA1 A;  2HAI A;  3DKD A;  3PCO B;  4J9M A;  4LF7 F;  1JJ4 A;  1B99 A;  4X66 J;  2XI3 A;  2MST A;  1CSJ A;  1UJ6 A;  5GAH I;  5HAN A;  2NZC A;  2R8I A;  3W8G A;  2ZJR Q;  3OXL A;  1Y7P A;  1UJ5 A;  1Z2Z A;  2BEF A;  4MKA A;  1UTA A;  4MIW A;  5C25 B;  1K44 A;  1L3U A;  5KT5 A;  4Y34 A;  1WDT A;  4WYL A;  2J6T A;  2VL1 A;  1JXE A;  1I94 F;  1CVJ A;  2XT4 A;  4AVZ A;  1U1R A;  1H3D A;  2MKJ A;  3QQC D;  2A1B A;  2PI4 A;  3H20 A;  4F3O A;  1ZAV A;  3HXM A;  3C6U A;  3CE8 A;  3NWR A;  2BX6 A;  5IT4 A;  2X1B A;  1YRX A;  3NCQ A;  2ZUA A;  1EB0 A;  1VRT B;  4MIB A;  2QEX S;  1S48 A;  1WC4 A;  4N8O A;  2C3Y A;  4MFB B;  4YR2 A;  1SI9 A;  5AXN A;  1OOC A;  3EJM A;  3FBE A;  5KFN A;  4J9R A;  4DL3 A;  1SV5 A;  2CQG A;  3V6D A;  2XMJ A;  4QJV A;  3TOQ A;  4HWV A;  1XNR F;  3M8Q A;  1QE1 A;  3JYT B;  1XC9 A;  1RYR A;  2CNK B;  2UXD J;  2KXF A;  2M0G B;  3SQG A;  3J7A N;  5BXI A;  2YXL A;  3CWJ A;  3WC0 A;  1DLO A;  2GS8 A;  1WHX A;  2YKM A;  5THW A;  3KLF B;  4EO8 A;  4F26 A;  2VV5 A;  2VG6 B;  3JUR A;  3MM7 B;  4AND A;  3G9C A;  4QR1 A;  3QMQ A;  1YGY A;  4WFZ A;  4Y6I A;  3OR2 B;  4OJ3 A;  4DPT A;  1BC6 A;  4UOH A;  2CQB A;  1NSA A;  1X4C A;  2GGP A;  1NPK A;  4ED8 A;  1GEH A;  3P96 A;  2EFG A;  4JI4 F;  3VSV A;  1DBG A;  2BAC A;  2Z4P A;  3KDO A;  3VCD A;  3MD3 A;  1KHW A;  4WKR A;  4WII A;  1YRU A;  2GML A;  4RNF A;  4NA3 A;  1DRZ A;  2IMW P;  2O6W A;  1R6V A;  4ELU A;  4Q5V A;  5A8W B;  1S9F A;  3OD2 A;  4PCQ A;  1SJ1 A;  4B3R F;  2J6U A;  5AE3 A;  1U45 A;  4E0D A;  4X2B A;  1IBC B;  2E5L J;  2W2O P;  2D41 A;  3ZNJ 1;  2EBE A;  2NPF A;  3LGM A;  1R0B G;  5ETV A;  2R8G A;  4ECU A;  1SC3 B;  3MM8 A;  1RMG A;  5DDQ C;  2HBZ B;  2L9W A;  1T9X A;  2BQU A;  4ZVQ B;  1HG8 A;  2BJ8 A;  1TUV A;  1DTT B;  1ARO P;  1KQF B;  4ZCI A;  2KG1 A;  3Q8P B;  3VAJ A;  3VAG A;  2K2P A;  1SIW B;  2J9E A;  4J9O A;  4C8L A;  2FC9 A;  1VC6 A;  2GMH A;  5B0G A;  2WK4 A;  5DO2 A;  4H4K C;  2ZM6 F;  1RBO B;  2HBY B;  2L9N A;  4BWJ A;  1HNI B;  1ICE B;  1C4A A;  3RZA A;  2YNH B;  4KO0 B;  2XS7 A;  4K2X A;  4ED4 A;  3JSR A;  3T9G A;  2IJN A;  3IM9 A;  2C1E B;  1HA1 A;  2KDO A;  1FRJ A;  5K8P A;  4OX9 F;  1LLW A;  2BXJ A;  4RPF A;  5DGA A;  5CA5 A;  1UVK A;  2KHD A;  2KXH A;  2VQE J;  1RT2 B;  4IG3 A;  3MEC B;  3CCR S;  1XR5 A;  4CYU A;  1K8A T;  2RRN A;  3G87 A;  5B0B A;  3KJF B;  2RUS A;  2WB4 A;  5CD4 H;  4DV2 F;  4IFV A;  2DR5 A;  3CO0 P;  1IBK J;  3MMC B;  2PYH A;  1JMT A;  2I9S A;  2QN6 B;  4DF4 A;  2E1P A;  4GVB A;  2RRB A;  2O67 A;  4JV2 A;  2KL8 A;  1MNE A;  4DL4 A;  2BUN A;  1CUL B;  2E1R A;  3ICL A;  5LJ5 Y;  3H90 A;  4N8N A;  1RDR A;  3HJF A;  4KC5 A;  1J5E J;  4PXD A;  4DXL A;  3M30 A;  2VBM A;  3T9N A;  4ZIW A;  4OL8 A;  4LR9 A;  3NOG A;  5DDP C;  4W92 B;  2BE2 B;  3FGV A;  1WKJ A;  3KMQ A;  4F8R A;  2VIC A;  2F3L A;  3C8Y A;  3O44 A;  4DV7 J;  4MIA A;  2BM6 A;  1EKR A;  4LF9 F;  3W9H A;  5GAD I;  5AE2 A;  5E3R A;  1GH8 A;  1Z2L A;  1VQY A;  1T9W A;  4XLC A;  1A0O B;  1W7W A;  1KLM A;  5CYM A;  2QZA A;  4NLS A;  3FEX B;  4USM A;  5LT5 A;  2Y1J A;  4WWS A;  2OI2 A;  7AT1 B;  4EZ6 A;  4DSF A;  1T9V A;  4Q7A A;  3QRR A;  3BDE A;  4LBI A;  2N7C A;  4U67 Q;  2VPY B;  4X4T A;  4KFB B;  4H4K A;  4HH1 A;  1SUQ B;  4X4R A;  3EXC X;  3M30 B;  4FF4 A;  3WDO A;  2W4P A;  3NBP A;  3WIU A;  1FX4 A;  1M5S A;  1LLZ A;  3PHE A;  4M5D B;  1F5A A;  2RS8 A;  1MN9 A;  2FHO B;  3ZZT A;  5DQH A;  1L5U A;  4F2S A;  5F8N A;  2E5L F;  3ZTQ A;  1C2P A;  3LP2 A;  3G86 A;  4H4O B;  2PT0 A;  3NAW A;  5KOW A;  3OJS A;  5KFT A;  2V8P A;  4CM2 A;  2R2T A;  5K5M A;  4UZB A;  4QW9 A;  3QFW A;  2P8I A;  2ASD A;  2Z2Z A;  1TKZ A;  2FPH X;  3GU0 A;  2KG0 A;  2E29 A;  3ZZO A;  3D1O A;  3LF0 A;  3N79 A;  2FLN A;  3LO3 A;  1RHR B;  3FBF A;  4W4M A;  4WTY A;  3B4N A;  4ID5 A;  1REG X;  1S7I A;  2H51 B;  5D4N A;  4X4O A;  2VQF J;  1SKW A;  2FVQ A;  4M95 A;  1X5S A;  2GIF A;  2BJE A;  2CZ4 A;  2CIM A;  2HS4 A;  2QLB B;  3P4U B;  2KT3 A;  2ZNZ A;  2NSP A;  4OJO A;  4XR6 A;  5D4O A;  4JI6 F;  4RUC A;  5FLX Y;  2QYU A;  3I31 A;  5JVG Q;  1LM1 A;  3RAM A;  3MUT P;  3PNI A;  1VK8 A;  2AYB A;  3F0N A;  2PFD A;  1OS5 A;  1C1B A;  1JLB A;  3JSY A;  2JVO A;  2D3O R;  2GHP A;  2I0X A;  1T11 A;  3BPD A;  4RW8 B;  1HL6 A;  2CPI A;  2CQH A;  4WXW A;  5GMK a;  3DLL Q;  3L09 A;  3R7N B;  4B9T A;  2YWH A;  1PYO B;  3LA0 A;  3ZO7 A;  2XC9 A;  4DU7 A;  2B51 A;  2HQI A;  4WE1 B;  3M8S A;  1VIX A;  2ZKU A;  2QL9 B;  1RB0 A;  3VWS A;  4DR2 F;  3H09 A;  3DXS X;  1NDK A;  1RHJ B;  4DR3 J;  5KT3 A;  4WU2 A;  2BRK A;  3A8E A;  3U27 A;  4B08 A;  2BBE A;  4EU0 A;  4J5O A;  1B64 A;  2V4R A;  3QSY B;  1SKS A;  1YX2 A;  4UUW A;  3UDE A;  3I87 A;  2HVI A;  1GXT A;  1YQH A;  2AEJ A;  2BYC A;  3AA8 A;  2GHW A;  1JLC B;  4JP8 A;  2F5G A;  5LMN J;  1JLQ A;  1SL1 A;  2FGC A;  2D3O 1;  3N5F A;  2QSF A;  3D0H E;  2MDA A;  2GZO A;  2IM0 A;  1TUW A;  3A8K A;  5AXL A;  1T8E A;  4DR5 F;  2PE8 A;  4P2M A;  2QJ3 A;  3R5D A;  1JIH A;  5F9N A;  4R0J A;  4IH6 A;  2UXC F;  3AQP A;  5K14 A;  2WON B;  4K4X A;  3T1Y F;  1DFD A;  5GAE I;  4Z05 A;  3D0I E;  4I68 A;  1GTH A;  3HDS A;  4USW A;  4CNZ A;  5CAB A;  1XG2 A;  3BSA A;  2DGO A;  3I5B A;  4LSN A;  1Y3J A;  2J8I A;  3GR0 A;  3HSD A;  2J0W A;  1S9G B;  5KFR A;  3FCW A;  3HSG A;  4ZA1 A;  2XYG B;  3W63 A;  5KFW A;  3MAH A;  5KFZ A;  2RS2 A;  2XS2 A;  4MK7 A;  2DTJ A;  3FQK A;  2LQ5 A;  4RL1 A;  2OEL A;  1HQE B;  1EP4 B;  2RKI A;  3KHL A;  3GMG A;  3R5A A;  1R8C A;  3S7R A;  5ETS A;  4CLK A;  4P75 A;  5DET A;  4XIU A;  4DQS A;  3T1H J;  4E8U A;  4CWB A;  2CPF A;  3CC7 S;  4DPX A;  4NE9 C;  2K3I A;  4PWW A;  1ZA2 B;  4RUA A;  4DR5 J;  1Y5N B;  1EAR A;  1LK5 A;  1NEE A;  1VFJ A;  2CVE A;  3HI9 A;  3QT5 A;  2RQ4 A;  4MH8 A;  2QA4 S;  1T03 A;  4O23 A;  1PC5 A;  2QYG A;  4LRE A;  4DPU A;  2W7P A;  4OZL A;  3O3L A;  2FJV A;  5HLF A;  3Q89 A;  4CLF A;  3NNH A;  2V4J A;  5GME A;  1SCJ B;  3I6P A;  4KH0 B;  3DN9 A;  4TYB A;  3W2W A;  4EFA C;  1PXZ A;  2Z8G A;  1FVS A;  2IVM A;  5KFO A;  1D0E A;  1LWC B;  5HAT A;  3VF0 B;  4WFB Q;  5DQG A;  4B3O B;  3O1L A;  3G71 S;  4Q0B A;  1X4D A;  3AB4 B;  4DL0 C;  1CJV A;  3KG1 A;  2XMV A;  1VQ8 S;  1VMB A;  1VQ9 S;  2C3P A;  4NK8 A;  3B82 A;  3G4S S;  2ZDP A;  4XOR A;  3QGG A;  4R25 A;  4DR7 F;  4WF9 Q;  3CCM S;  3KLG B;  3OR2 A;  2EEY A;  4LSL B;  3J7Z 5;  1HNW F;  1HNV B;  2MKC A;  2RF2 A;  3C15 B;  3PEJ A;  1QJH A;  3TZX A;  3KLV A;  2OIH A;  3A8J A;  2CQ4 A;  1NB7 A;  2YNF A;  5KFQ A;  2KM8 C;  1U1Q A;  3ADA C;  3ETO A;  1R89 A;  2MYF A;  2BVZ A;  2XEX A;  3M2R B;  3MF5 A;  4NLD A;  1S6P A;  2XQC A;  1RTD A;  1UJ4 A;  3CJK B;  3OXF A;  2J76 E;  3CGI A;  1UFK A;  2VDI A;  2L9D A;  3DOK A;  4IRC A;  1OY6 A;  1LNQ A;  4CZC A;  2Q6C A;  3DLG B;  4IOB A;  3HSJ A;  2W2P P;  1DTQ A;  2LEC A;  3GE9 A;  4NLO A;  1HBM B;  4GRS A;  4P2S A;  4R8U A;  3D2W A;  4YQW A;  3CCQ S;  2M8D B;  1WF0 A;  2HG4 A;  4ZPA A;  2KT5 A;  4CLP A;  2Q1L A;  4OI6 A;  1UZH A;  2L08 A;  4LFA F;  3CCU S;  4URR A;  1WHY A;  3SMZ A;  1IB4 A;  5DLF A;  2HHH F;  3OUY A;  1H80 A;  4XQF A;  2H48 B;  5D3G B;  3KUG A;  2P9E A;  3KJQ B;  4IO1 A;  3VVT A;  1YJN S;  2Q66 A;  2UV8 A;  5HVF A;  3V2U C;  2FVS A;  5HJX A;  2EXU A;  2RF2 B;  4W8R A;  2HHW A;  5B0D A;  4I7F B;  2NZM A;  1UEV A;  3M6X A;  5FDL B;  5AE1 A;  4YZA A;  3C16 A;  1C0U B;  3KTQ A;  1SKU B;  4KV8 A;  5HBM A;  2VKR A;  1VQM S;  2UXB J;  2NSB A;  4K8R A;  4AUK A;  2EC0 A;  5GAH U;  1HQ2 A;  2O04 A;  1CJT B;  2ZFH A;  4DLE A;  2LU2 A;  4ED2 A;  1U6B A;  1PGZ A;  4KIA A;  5KG3 A;  4CH7 A;  4XKV A;  3EMT A;  3G82 B;  4M5I A;  4Q43 A;  2ZH2 A;  4OZ1 A;  1SC6 A;  1C0T B;  1LXN A;  3DCA A;  1RT3 B;  2YWK A;  1RT7 A;  2HVD A;  2MLX A;  2MLZ A;  3DHW C;  2CPH A;  3NKY A;  4U8V A;  4QIW D;  3SQV A;  2R2U A;  3CMA S;  3QIP A;  1NKB A;  2GO8 A;  1HWL A;  3W64 A;  5EWF A;  4DX8 H;  4YFO A;  3NMR A;  2ZKT A;  5LOQ A;  1RP5 A;  1X4G A;  1S1W A;  3UQS A;  4Z37 A;  2B5J A;  2M70 A;  4UST A;  1L3V A;  1K8F A;  2DD8 S;  3ONQ A;  1TR0 A;  3VZH A;  4DN9 A;  4CTA B;  5C42 B;  2PEB A;  2CYY A;  1S49 A;  2FJE B;  1X4B A;  2X3H A;  1RT1 B;  2HWT A;  2PEC A;  2PO4 A;  4OFZ A;  1VBX A;  2V50 A;  5I42 B;  2I38 A;  1YIT S;  3OTE A;  4KV8 B;  1BXN A;  1QTN B;  1RTZ A;  1GFW B;  1X5T A;  4CP5 A;  2LMI A;  4UZC A;  3TNV A;  4LJM A;  4CIO A;  5EX3 A;  3F73 A;  3FZ2 A;  3CC4 S;  5F0U A;  1IXK A;  2YNF B;  3PY8 A;  2HW3 A;  4P10 A;  4C7Q A;  5DNS A;  4I7F A;  2V34 A;  3EDR B;  3EZO A;  4EI2 A;  3DRY A;  2IQ7 A;  4UTG A;  3PFE A;  2JFD A;  2EFP A;  2QFI A;  4FPI A;  3UI3 A;  2I1R A;  2OPR A;  2GAH C;  4UF4 A;  5C25 A;  1KTV A;  2WSF C;  3DXB A;  3PTW A;  2IJR A;  1FTR A;  2GVZ A;  3QFH A;  2RML A;  3NOC A;  1F1B B;  2C28 A;  4C0H A;  2QZ8 A;  3MR7 A;  5KFK A;  3Q86 A;  2CXE A;  4H4M B;  3VR1 A;  5C1C A;  4AFF A;  1HWK A;  3V81 A;  1MML A;  2ASY A;  2M7S A;  2UXB F;  1ZM2 A;  4OX7 A;  4J91 A;  5A8K B;  1D9D A;  4DR4 J;  2DNY A;  4LFB J;  3W9I A;  1WMR A;  3EVW A;  4NLQ A;  3I0R A;  4P7V A;  4WZQ A;  1PJ7 A;  1HHS A;  1WEY A;  1K1S A;  3R6G B;  1T05 A;  2HYI B;  4M63 A;  2W7O A;  1AYE A;  3ZTO A;  2ADB A;  3BH7 B;  3W3S A;  2A6O A;  2K8G A;  3PYF A;  5H9F K;  1FXL A;  1FA0 A;  1TKT B;  2DRD A;  1SL2 A;  2WBR A;  2OEM A;  4K5S A;  2LKZ A;  1JB0 C;  3MED B;  4QR2 A;  4IO9 Q;  4JI4 J;  2EBG A;  2OPP B;  3FBC A;  1S9G A;  3AHP A;  5J1N A;  2EWE A;  1RCO B;  1JJ2 R;  1J27 A;  4ZKA A;  1NME B;  4B3T J;  1RI7 A;  1T02 A;  5C5J A;  4C2L A;  1WEL A;  1AW0 A;  4ZVG A;  5IC6 B;  3M2R A;  2A10 A;  4NRT A;  1M5H A;  1HQU B;  4QYZ K;  3QYY A;  4HEA 9;  2W9B A;  3EQN A;  2VFO A;  2BZ2 A;  2KN4 A;  2ZOM A;  3D6M B;  2DYA A;  2Z57 B;  3FEZ A;  3AD9 C;  3TAM A;  1BHE A;  3OLB A;  1V3S A;  2OEK A;  4XPC A;  2IBO A;  3TVK A;  4OV1 A;  2MKH A;  4I6A A;  2M88 A;  3BGR B;  1LFW A;  3UD3 P;  1BHN A;  5SUH A;  3W5Z A;  1SKR A;  3BSO A;  2ZZN A;  2HQD A;  3P45 B;  1R8P A;  2AGQ A;  1IKV B;  1XBW A;  2KRB A;  1S1V B;  3R5C A;  3IC1 A;  4AQY J;  1G2E A;  3DRP A;  1QJV A;  1NJW A;  3AXM A;  5FLX U;  4DR6 F;  3NEK A;  1WC6 A;  2PD1 A;  2OAU A;  2VG7 A;  4YB1 P;  2LDI A;  3PVX A;  2FZK B;  1VLO A;  5D77 A;  2FIU A;  5J2N A;  3UDL A;  1HMV B;  1LW0 B;  4ZJQ A;  4K4Y A;  4LUB A;  4CLW A;  1WOO A;  4IG0 A;  4NPO A;  4KY3 A;  1RT5 B;  3P3D A;  3OPK A;  5CZV A;  3LP0 A;  3AOD A;  3QJJ A;  2NXE A;  3GIM A;  4LMZ A;  4U9R A;  4ETX A;  1H73 A;  2ZE2 A;  1FNX H;  2GQQ A;  1VQK S;  3J7Y U;  1M5K C;  4DR4 F;  4AD6 A;  4B17 A;  4U6P A;  3TZZ A;  3CDB A;  1WTB A;  1WAC A;  4LFB F;  2GIR A;  3TVZ A;  1FJG F;  3DRP B;  1H74 A;  1REV B;  2CNO B;  2ZOG A;  3CDW A;  4RU2 A;  2OPS B;  1PJ5 A;  2HBR B;  1VOM A;  1Q78 A;  3SSQ A;  4ECX A;  1PG5 B;  2MQN A;  4O3Q A;  3EPI A;  1WC5 A;  4PUO A;  4ZP8 A;  1CG2 A;  1WHW A;  1ZM3 A;  1QQ1 A;  3W9J A;  4N7T A;  4NLY A;  2I2Y A;  1ULR A;  4U4B A;  1TAQ A;  3T6J A;  4PR6 A;  3OTO J;  4JV5 F;  1IQZ A;  3BEG B;  4YDD B;  2DIS A;  1XMQ J;  1Q5V A;  3DYA A;  1VBK A;  5KFY A;  1NND A;  2CZ9 A;  2E66 A;  3R7S B;  4NZ0 A;  3WQP A;  4M5D A;  2RQM A;  3QZ8 A;  3S1T A;  4URG A;  2J9D A;  3HHL C;  5C7P A;  1TK5 A;  3KJV A;  2OH2 A;  4PZV A;  2JX2 A;  2AGO A;  3IS9 B;  1U1L A;  2BE9 B;  2LU1 A;  3PHT A;  3ZNU A;  4KHP J;  2YQ1 A;  5HP1 B;  2UUA J;  4I2Q B;  2XWY A;  2V8H A;  1U7L A;  3ENW A;  4XLH A;  2K1R B;  1RWW B;  1V5I B;  3GJT B;  5KFH A;  5KT2 A;  3T5K A;  1KOH A;  1OPI A;  3IFE A;  1SC1 B;  2RJZ A;  3SYJ A;  1C1B B;  2AZ3 A;  2W25 A;  1YVF A;  1RTJ B;  4K59 A;  4EYI B;  2DRB A;  3MM9 B;  2Q79 A;  2P2C B;  3K8W A;  1NSP A;  1XNQ J;  3P4G A;  1S6P B;  2X6Y A;  1D9A A;  2HQC A;  3BV8 A;  2MQP A;  3K58 A;  4C4W A;  1WF1 A;  3POT A;  3MCN A;  4M1K A;  1DTT A;  3W1Y C;  1RBA A;  3NS7 B;  2EFN A;  3I82 A;  4LRD A;  2FUG 9;  4PXC A;  4O3N A;  3T1A A;  5J2Q A;  3HF5 A;  4GKK F;  2JJ4 D;  3PW0 A;  2MPU A;  1N5Q A;  5E3A A;  2JH3 A;  3KG0 A;  3QLH A;  3PR4 A;  3NAH A;  4MYT A;  2FLL A;  4I2P B;  4NYO A;  1MN7 A;  4L3K A;  1CC7 A;  1PBA A;  4FF3 A;  4DV7 F;  4YHH J;  4URS A;  5DDO C;  3C66 A;  4JV1 A;  4PAB A;  1SXL A;  4XK8 C;  1FES A;  1BWV A;  1U09 A;  1X60 A;  2Z8Q A;  3H5X A;  3GG1 A;  1MG7 A;  4KJI A;  2N3L A;  5J1E B;  1VLY A;  2YKQ A;  2OPR B;  1YHQ S;  1IBM J;  2YWG A;  2UVE A;  3JTP A;  3A3O B;  1U02 A;  3P8B B;  1RT2 A;  4IG3 B;  3D5M A;  3MEE B;  4IOC Q;  3UCZ P;  1OWX A;  3BH6 B;  1RQ0 A;  4K4V A;  3KK2 B;  4DV3 J;  2BA9 A;  1F3V A;  3CNQ P;  4OZY A;  2HRU A;  1WXR A;  2YVS A;  4G1Q A;  3M8W A;  1ZPW X;  1ZS6 A;  2C2R A;  4OI3 A;  1LW2 B;  5F41 A;  1S4F A;  3S01 A;  4NZ6 A;  9RUB A;  2QRR A;  2DH9 A;  5ETP A;  4NOH A;  4KHP F;  3AY0 A;  1Q1K A;  1S1U B;  3GRH A;  3OR1 B;  3DM2 A;  2YKM B;  4DV4 J;  3QGI A;  2AJ2 A;  3AFG A;  5KT7 A;  2MEW A;  1RAD B;  1RAB B;  1OFE A;  2HFU A;  2MJN A;  2EK1 A;  2QYC A;  1JLA A;  3EVM A;  4HI2 A;  3ZXW A;  3A13 A;  3EIC A;  5HQL A;  5KT6 A;  4LIR A;  1UVL A;  3P49 B;  3JX8 A;  2RB7 A;  1HNZ J;  1ZH5 A;  3IS9 A;  2QG9 B;  4PG7 A;  3SDE B;  1XER A;  1XK8 A;  2B4V A;  2FTR A;  1YG0 A;  4OYZ A;  4X84 A;  3G6E S;  3Q23 A;  2OSR A;  2V5I A;  1HIY A;  2XY5 A;  4P74 A;  4LIW A;  5CD4 A;  2XS5 A;  1Y9O A;  4LRA A;  2FDN A;  5KG7 A;  3H98 A;  3LGN A;  1J2V A;  2HPU A;  4CYU B;  1B3T A;  3H5S A;  3MEC A;  2AZ1 A;  2NST A;  3QJP A;  2C2E A;  2ASL A;  1V3R A;  2R2S A;  3RBE A;  3TZW A;  5FJ4 A;  4C11 B;  4YEI A;  2PYG A;  3NP5 A;  4FYV B;  3FSY A;  4N41 A;  2N4D A;  3HVT A;  5CYQ B;  2JLF A;  5JVH Q;  4GO5 X;  1H38 A;  1LWX A;  5A6P A;  3OFF A;  3GSI A;  4LF4 J;  2EFV A;  1FEH A;  1Q0N A;  1FCA A;  3SDE A;  3ZTS A;  2ZZT A;  3QGP A;  3D4J A;  3ETM A;  2INV A;  1QSS A;  3NS5 A;  4JYA F;  3AXK A;  2A6M A;  4B9M A;  5IXU A;  3KUE A;  1LKZ A;  3NB2 A;  1O0P A;  2CG8 A;  2HGL A;  4NLT A;  2DCL A;  5LSL A;  2HUR A;  3C14 B;  3N90 A;  1EZZ B;  3CCL S;  6FD1 A;  2E9R X;  5HSP A;  2P6S A;  2K7K A;  3F41 A;  4OJ5 A;  1V9O A;  1CC8 A;  3U1L A;  4AE5 A;  1FE4 A;  3PW5 A;  3UW1 A;  1K47 A;  1NM2 A;  1O88 A;  2CUY A;  3AJD A;  1I94 J;  4FBU A;  1PKU A;  3H4B A;  2HQG A;  1QVF R;  1IJF B;  1RSC A;  2XTW A;  2B4P A;  2QTW A;  3GPA A;  3Q8Q B;  1FFS B;  2HGN A;  3EGV A;  3UFC X;  1Y3K A;  3HVT B;  2FVC A;  5CYQ A;  3MEE A;  1O8L A;  2QA4 G;  3LW5 C;  3M1V B;  4LVO P;  5E0O A;  1QLN A;  4K50 A;  1R0C B;  1U0S A;  2J0Q D;  1OFL A;  4IDK B;  1Q53 A;  1K9M T;  3MPW A;  4LF5 F;  2WTF A;  1KHV A;  1JLF B;  3EVO A;  3HHK A;  1N5T A;  5J2M A;  4DX6 A;  1VQ7 S;  2XYH B;  2AD9 A;  3HKZ D;  4LVN P;  3CC2 S;  4M5J A;  1REV A;  3J80 U;  4OMF G;  2MXY A;  2O5D A;  1YJW S;  4FVC A;  1C1C A;  2GW8 A;  2Z0G A;  3T5L A;  4OZJ A;  1Q79 A;  5J2Q B;  3H42 A;  1HI1 A;  3RIQ A;  3AOC A;  3KYL A;  3AT1 B;  3KKF A;  4P52 A;  1TK0 A;  4B3M F;  4O0N A;  4DSK A;  2YX4 A;  1JX4 A;  2IYG A;  4JI7 J;  2HWI A;  4LQ3 A;  3B78 A;  2W9C B;  2V2V A;  3OVS A;  2M52 A;  4R0E A;  2HS0 A;  2OMO A;  2DHX A;  3L7O A;  3MWB A;  5KG6 A;  1H2V Z;  4BHQ A;  2BKN A;  3KLF A;  2VQE F;  2UU9 J;  2IVF B;  1VQN S;  2DGU A;  4JBC A;  5B0A A;  2GJI A;  3GIK A;  4JI5 F;  1BWE A;  2CZV C;  3BYP A;  4F4X A;  1HQE A;  2DBB A;  3B4M A;  4FKX A;  3AD8 C;  4B3T F;  1DJ0 A;  2NPI A;  2J5A A;  2OFG X;  4RKU C;  5IT9 U;  4TKT A;  2F65 A;  3I4P A;  3N01 A;  3KK2 A;  5DG7 A;  4ITS A;  3I0R B;  1CLF A;  3ZZZ A;  1EIY B;  1RLC L;  3VST A;  1Z4U A;  1PYS B;  2I8E A;  4CO2 A;  3TEH B;  4F04 B;  5HVG A;  2YH1 A;  1HR0 F;  4C0O C;  2EPI A;  5JXS A;  4PG5 A;  2LQJ A;  3CD5 A;  4A8K A;  3BBF A;  4K4W A;  1KQS R;  1Y0H A;  3KMS A;  2NXU A;  3LP1 A;  4PG8 A;  4ECY A;  3BR9 A;  2VFN A;  4LRB A;  3V6J A;  2WSE C;  3VV2 B;  2ZDO A;  3D6F B;  4KH3 A;  3NXZ A;  3EZ5 A;  5F3T A;  2J9C A;  1RWP B;  4ZCM A;  1UCN A;  3OT9 A;  3OL8 A;  1MLA A;  3SCI E;  1VC0 A;  1NZ8 A;  3PX0 A;  2ROG A;  3MTK A;  4P72 A;  2BKP A;  3L3C A;  4K0K J;  4I84 A;  4DEZ A;  1JNR B;  3H2V E;  3PYE A;  3PR5 B;  2EW9 A;  4JV0 A;  3DLE A;  5F9L A;  4JI3 F;  2B3T B;  2LXF A;  3IR5 B;  1L3T A;  3ET6 A;  1HNX F;  2DR7 A;  4IRD A;  1AIR A;  2RUG A;  3PZP A;  1MU2 B;  1U47 A;  3GON A;  3W2V A;  1BGX T;  2O01 C;  3IWX A;  1QCX A;  3PO5 A;  2CQD A;  4ID8 A;  2X1F A;  4ECV A;  4ENO A;  2VJU A;  3IG1 A;  3M8R A;  1SPB P;  3RB3 A;  7FD1 A;  1WF2 A;  2MQM A;  4NLV A;  3BRE A;  1SL0 A;  2BM4 A;  4XTT A;  4U8Y A;  2OUG A;  2PMZ D;  3BQ1 A;  4DR1 F;  3I0S B;  4BLG A;  5A2Q Y;  4DN0 A;  4FP9 A;  3MDF A;  2KTQ A;  2IC3 A;  1SB6 A;  1M1G A;  4K2J A;  5A76 A;  1FJG J;  1ZAX A;  4IR9 A;  2YWW A;  2VPZ B;  3MR5 A;  5E3C A;  2B43 A;  1O8G A;  4UY8 5;  4NWB A;  1OYE A;  3UCU P;  1ELO A;  2O1P A;  1P1T A;  1DBO A;  1R7I A;  1MU2 A;  2KO1 A;  3UO0 A;  3CUN A;  1HR0 J;  4XN0 A;  5L38 A;  3W8P A;  1F2G A;  1WTF A;  2CPY A;  2GO9 A;  3U7J A;  3OJU A;  4HHH A;  2ODL A;  2VOD A;  2X51 A;  3ISZ A;  4USU A;  5A8W A;  2DO0 A;  2ZC3 A;  2N82 B;  3KG4 A;  2PC6 A;  1EAY C;  2EFO A;  4QQB A;  5CQG A;  3WZ0 A;  3HMJ G;  4OYW A;  4ECZ A;  4B9U A;  2MTL A;  3D0G E;  2GQC A;  3SZE A;  2FZC B;  1LWC A;  3NGK A;  2W4C A;  2P9G A;  5AXM A;  4X65 F;  1QSL A;  1DAR A;  1DQ8 A;  3VVU A;  2V4J B;  2IDE A;  3LOU A;  5CHC B;  1VHF A;  1X7V A;  2BKO A;  2LQ9 A;  5BYQ A;  3IMQ J;  2KYX A;  3VMW A;  3M2U B;  1QA2 A;  2KYZ A;  4ICL B;  3JS9 A;  5GMD A;  3UD5 A;  5E5N A;  4DPW A;  5ETN A;  3ZZP A;  3H25 A;  2NCK L;  1RT6 A;  3KUH A;  4ZVP B;  5CZX A;  2E1M C;  4X64 F;  1FI4 A;  3KLE B;  3GII A;  2KFN A;  4R8U B;  3IA0 A;  3GYX B;  4ZVT B;  3SXL A;  2F4V F;  3GQ7 A;  2XYP B;  3PW7 A;  3GFX A;  5DQI A;  1FRH A;  2ATC B;  1OSC A;  2VG5 B;  3DOK B;  2XZW A;  3LPE A;  4KB7 A;  1RTI B;  4ZCK A;  5C2C A;  5EHH A;  5IV3 A;  4OI0 A;  3MM6 A;  3HPO A;  1FWK A;  4DFK A;  5H9E J;  5FD1 A;  3CJK A;  5HL7 Q;  2UUB J;  4ILM A;  3N9U C;  1TAU A;  2DCU B;  1FK9 A;  1TTH B;  2LDY A;  4ZN3 A;  3QIP B;  4J9N A;  4DV0 J;  3TH0 A;  3TJ8 A;  1HKA A;  1JLG B;  3K5P A;  3UR0 A;  1N34 F;  2DXE A;  1J5O B;  2BM5 A;  2DNL A;  2MJU A;  1DHM A;  4HAC B;  3MR3 A;  2UXC J;  2AJ1 A;  5KG4 A;  4JOU A;  4OIX A;  2ATL A;  2HHH J;  1WNE A;  2H3E B;  4MK9 A;  2LYV A;  2ZWO A;  2DHH A;  3MM5 B;  4TQR A;  2NTP A;  5DM6 Q;  2DGW A;  2R8K A;  3MOJ B;  4RUH A;  1G1X A;  1S6Q A;  5LXY A;  3HM9 A;  3N0V A;  3MMC A;  1IKW B;  1CJU A;  3GWC A;  5EX0 A;  4Q8E A;  4UUX A;  4EGL A;  3V4I A;  1I3O B;  3R6L B;  4O4G B;  3UCG A;  5IM0 A;  5KFM A;  1FO1 A;  2C2M B;  2O66 A;  3T1H F;  2ZZM A;  3QT6 A;  4JRA C;  1E6V A;  1GMW D;  3FRY A;  5HMY A;  2HLT A;  1EZG A;  4OYI A;  1YJU A;  4ZK7 M;  5IQ6 A;  4LF6 J;  2YWF A;  2YQ3 A;  2YX1 A;  2Y3Y A;  1TKD A;  2DHS A;  2HHV A;  4DPY A;  3ZZR A;  1HBM A;  4W8Q A;  4PMH A;  1JKH B;  3MM6 B;  3BGU A;  1NHK L;  1TYW A;  3KHG A;  4CO3 A;  4CLS A;  4IYQ A;  2AJ0 A;  4QCL A;  3UW0 A;  3GSD A;  3A3N B;  1XMB A;  3D68 A;  3ENA A;  4WPA A;  4ETZ A;  1UMJ A;  4DX7 A;  3CD7 A;  2AU0 A;  3JQM A;  3DLK A;  4A47 A;  5DG9 A;  1XNR J;  1HNX J;  2FD2 A;  3LAL A;  1HI8 A;  3M8P A;  1URN A;  1ZET A;  4KTQ A;  2GJ2 A;  1QSY A;  4MKB A;  1TQL A;  5KFX A;  5I3Q A;  3KFW X;  4D3G A;  3F56 A;  1NSK L;  3FCV A;  1YIJ S;  3UN5 A;  2BM1 A;  3D6T B;  2O17 A;  1F0X A;  3EQO A;  4KBI A;  4MYU A;  1N8R T;  2ZH8 A;  3DLE B;  2A0F B;  1HW8 A;  4YUD A;  4WCE Q;  1N48 A;  3PRV A;  5KFB A;  2HSE B;  3I56 S;  2CKW A;  3DDN A;  4NML A;  5H9F J;  3PKM A;  3FQL A;  4B3O A;  1TKX A;  2AJF E;  3ZZU A;  2DGT A;  4KYZ A;  2JLE A;  5L39 A;  1BQM B;  1IR0 A;  2Z2Y B;  3GTY X;  5G4D A;  3I4H X;  3W2W B;  3W61 A;  1YJ7 A;  3D67 A;  4MKV A;  4PG4 A;  1HPZ A;  4DR7 J;  5BYS A;  2FJB B;  4B02 A;  3CVK A;  2BAN A;  2KB2 A;  1VI7 A;  3JSM B;  3C2P A;  1KSP A;  3BR8 A;  1JLF A;  5J2M B;  4WYW A;  3JXO A;  4DL6 A;  3UR3 C;  2DNP A;  1KP6 A;  3CW2 C;  1WC0 A;  1Z1Z A;  2BJ3 A;  1F60 B;  3LAK A;  3MAA A;  5A8R A;  4XOT A;  2WVE A;  4YY3 F;  3QJL A;  4XDD A;  3W65 A;  4CT8 A;  1XTZ A;  2IC3 B;  3CCZ A;  1CEZ A;  4LRF A;  2FJW A;  3HHD A;  2UUC J;  5FII A;  3CJQ A;  1GXU A;  5L46 A;  5MLC V;  3H8Y A;  2NT6 A;  1S6U A;  2CPE A;  2MQL A;  3BM7 A;  2KHC A;  5KFU A;  2AWZ A;  3CB4 A;  1RT4 A;  3WBZ A;  4C48 A;  1XJW B;  1S76 D;  2OHD A;  4OZ3 A;  2VQF F;  3R1L A;  1GMU A;  3AJ2 A;  5EWG A;  1VHI A;  1WDD A;  3M8Y A;  5DJB A;  4C0B A;  2XSJ B;  4KPC A;  5K8O A;  3Q8S B;  1S4E A;  1TL1 A;  2AKW B;  3EE3 A;  3E3X A;  2P5V A;  1AXQ A;  1GXL A;  4QWD A;  2HMI A;  2F40 A;  2I6W A;  1E6V B;  1O51 A;  1YSJ A;  3QPI A;  4MK8 A;  4RX6 A;  2VFU A;  4OJ6 A;  3ULH A;  3CO9 A;  5KFJ A;  4QWA A;  2YNG B;  2UUT A;  2HBQ B;  3BGO P;  3TAR A;  1Q7Y T;  3RAX A;  3FMB A;  4G3I A;  2QL7 B;  1RWR A;  3DRS B;  1JXL A;  2WRM A;  4ANE A;  5ETK A;  4BCA A;  2NTB A;  2CPD A;  2Y1L B;  1KS2 A;  4CH0 S;  1TKZ B;  1WSR A;  2CQ1 A;  2ZH9 A;  4J7C A;  1KFD A;  2UVV A;  2R8J A;  3MHY A;  3P5T L;  2D3Z A;  1JTA A;  3QGH A;  3SFU A;  4HLB A;  1T9Y A;  2VKZ G;  4RW6 A;  4QIE A;  2DNH A;  1PAE X;  1RWK B;  3L95 X;  4RBT A;  2AF6 A;  3AOA A;  3DHX A;  4OYO A;  4YY3 J;  2N7Y A;  2V4Q A;  3ILL A;  1N34 J;  4LF9 J;  2DHG A;  5LMU F;  1FDD A;  2PN6 A;  1JXV A;  2Z2L A;  4KT0 C;  4RW7 B;  2KFY A;  2H1Y A;  3B4D A;  3HSZ A;  5J2P A;  4CH1 A;  4PKD B;  3SFG A;  2EG2 A;  3NCR A;  4DZD A;  1IN0 A;  1T7P A;  1FVQ A;  3ZSC A;  2YNH A;  3V6K A;  1EE6 A;  1EP4 A;  4LT6 A;  1W26 A;  2C2D A;  4NAS A;  1Q7L B;  3CCS S;  4ZPB A;  1FFG B;  2ZBQ A;  1JLB B;  2R2R A;  4C8N A;  5CYM B;  2WAQ D;  2ALZ A;  1KLM B;  4DS4 A;  1A6L A;  1SC4 B;  4WP3 A;  2XTX A;  4RW8 A;  4A8M P;  3CIM A;  3MMJ A;  2RAQ A;  2HVZ A;  5ETR A;  1LW0 A;  3IGV A;  2W4D A;  3V6H A;  4K5R A;  2GMJ A;  3HZE A;  4YOE A;  1TL4 A;  2SXL A;  3F44 A;  5F8H A;  2C22 A;  3NAI A;  4B9L A;  3MCM A;  2VUG A;  1H2U X;  2VBK A;  2J7K A;  3A12 A;  3MTJ A;  3TZY A;  2L3M A;  3HVR A;  3OQ2 A;  4DV6 J;  2LP4 A;  2CFX A;  2B0R A;  4KRW A;  3BSN A;  2GCF A;  1UPM B;  2YPZ A;  1O8H A;  1WKL A;  2G0J A;  2K7J A;  3PJW A;  1R8H A;  4WKY A;  2H5I B;  3IXQ A;  1WG4 A;  2GAG C;  5KG0 A;  2G2Z A;  4OHX A;  3MMB A;  2MKK A;  2DK2 A;  3VSU A;  5CXT A;  4ZDN A;  4GC7 A;  1OJ4 A;  2AIR B;  2CNN B;  4J9S A;  3RBD A;  3GP9 A;  1WEX A;  2VPX B;  3MCS A;  3UNG C;  1S97 A;  1NJY A;  4C8Z A;  1FRI A;  1MMD A;  1FKO A;  1WC1 A;  3HJV A;  3QLH B;  1KCD A;  4PQA A;  5DZ7 A;  2LEB A;  4DL2 A;  3R9L A;  4F7V A;  4FYW B;  4FNI A;  4KKO B;  4M5L A;  2OML A;  1F9F A;  4NLU A;  3EPG A;  1LFP A;  2F3J A;  5ETO A;  1NH8 A;  4DUT A;  4EW9 A;  1W25 A;  1RLD A;  2BJ1 A;  5E2Q A;  2B9Y A;  5EWE A;  1HBO A;  4DDF A;  3ENV A;  4RU9 A;  2RQC A;  1SUQ A;  2DGS A;  1ITP A;  2V8V A;  3BN4 A;  3BQ0 A;  5H1S V;  1KWM A;  5HP1 A;  1XWL A;  4OJ1 A;  5J1P A;  3JB9 k;  4FF1 A;  3PRD A;  3PJ9 A;  1X5O A;  3RR7 A;  4LFC F;  2OO4 A;  3MPD A;  1DBD A;  1S9E B;  1RUS A;  4F0M A;  4ILL A;  1XNQ F;  1TL3 A;  2IPO B;  3RBZ A;  1LW2 A;  3MM8 B;  4RR5 A;  1HBN B;  4DR2 J;  1JNZ B;  2E5H A;  1MWQ A;  3C6U B;  2RHQ B;  4DUY F;  1ZZF A;  5BJR A;  2BR0 A;  4PWD A;  1JLC A;  1UAW A;  1SJF A;  1K73 T;  3PAC A;  3CMQ A;  5F0W A;  4HTI A;  1U2R A;  2UUA F;  4GVB B;  2F8H A;  1KVK A;  1VRU B;  1RHQ B;  2VA3 A;  2KU7 A;  1FEE A;  1HWJ A;  3MCO A;  3MPV A;  1FXD A;  4YFU A;  1NHC A;  2IVY A;  2OP5 A;  4WFX A;  4PXB A;  3CME S;  4YP3 A;  2KXN B;  4EMD A;  3ML3 A;  2FJD B;  2EC2 A;  1NU4 A;  4XL9 A;  1Q8L A;  4OHV A;  3UNY A;  5LXR A;  4PUO B;  2L48 A;  4LRC A;  2CAD A;  4YME A;  3EX7 B;  4Q8F A;  4OM9 A;  2Z58 B;  1M5O C;  2VB6 A;  3GJS B;  2V9K A;  2AYM A;  3BKU A;  4CLY A;  4KO0 A;  4CT9 A;  2NTQ A;  5A2Q U;  5U47 A;  2XSJ A;  2DO4 A;  1DLO B;  2C2Z B;  4JB8 B;  1U8S A;  4EO6 A;  3FFI B;  2MHN A;  4YS2 A;  1RTJ A;  4QIG A;  4ZIT A;  1JLA B;  1L3S A;  1TL3 B;  1UVN A;  2H5E A;  1RU4 A;  3THP A;  5I42 A;  3DRX A;  3PW4 A;  2CA9 A;  3J7A 1;  2A2C A;  2XG8 A;  4FS1 A;  3DM2 B;  3GQA A;  3LWL A;  4O3S A;  4OQJ A;  3BF4 A;  3R2C J;  3R2D J;  4I2Q A;  2ZJQ Q;  4HHU A;  4KKO A;  4EWT A;  4E98 A;  2XB2 D;  3N6Z A;  2VBX A;  3FC9 A;  2ZBC A;  2ZOF A;  1TV6 A;  4KSE B;  2CJQ A;  3MAQ A;  1N5Y B;  5HMX A;  4QYR A;  4ZJL A;  4JI3 J;  3CJR A;  1NBE B;  2DIU A;  3Q8R B;  4ECR A;  1D8Y A;  4NL5 A;  3WIV A;  2AGP A;  3G82 A;  3BS9 A;  2CWK A;  4USJ C;  2XTY A;  1VJW A;  2CJA A;  1T3N A;  1TMM A;  4AL5 A;  4EBD A;  4FBT A;  1S72 S;  1DAX A;  3K8V A;  2H54 B;  2ACM A;  4ZVE A;  2VBZ A;  2HQ3 A;  3Q24 A;  3M6W A;  2W7Z A;  1BQX A;  2GGP B;  2CPZ A;  2IRY A;  4I2P A;  4B3R J;  4JI2 J;  1EQM A;  2YX7 A;  2V5H G;  2FJX A;  2ZWP A;  2CDQ A;  3ITH A;  3BGF A;  2ZH1 A;  5GAG U;  1T3O A;  2CQ3 A;  2ZH3 A;  5EDW A;  2J6S A;  2E1A A;  2FY8 A;  3B8Y A;  2XGQ A;  1TFY A;  1Y5I B;  2VJI A;  3R5B A;  3KHR A;  3TUZ C;  1KQG B;  4XO0 A;  3HP6 A;  3K89 A;  1FWP A;  3MED A;  2X85 A;  2YPY A;  4EK2 A;  3VZI A;  1U1P A;  3BDP A;  2G2O A;  2IMO A;  2KRR A;  3KWM A;  1RU1 A;  4IH7 A;  2CQC A;  2LVW A;  3OXG A;  2VBE A;  2Q6B A;  4MT1 A;  4YDT A;  4V1A k;  1WUU A;  2AEM A;  3I0S A;  2R42 A;  3MPU B;  3QT7 A;  4DCJ B;  5C42 A;  2LXI A;  4JI8 F;  4DV2 J;  4DV1 F;  3H59 A;  2W2N P;  2YTC A;  2RDI A;  1ZPV A;  1D9F A;  4RW7 A;  3CPW R;  3KLH A;  4HVZ A;  2ILZ A;  1NO8 A;  3ZC4 A;  1QAI A;  1VQ4 S;  5D6G A;  3GB0 A;  5HK4 A;  1JKH A;  4B3M J;  1PAU B;  2M5Y A;  4DV3 F;  4JI7 F;  3MMA B;  2QXZ A;  2INU A;  1CQM A;  2FHK A;  5K8N A;  2FVP A;  3OBI A;  1P6T A;  4LFA J;  5A8K A;  2W9A A;  1M5V C;  4JI1 J;  3L7P A;  5IQQ A;  2NR0 A;  3MXH P;  3SCL E;  5E33 A;  3IWN C;  2RDD A;  4ZVH A;  2XCP A;  2WSC C;  3GIL A;  4ZVS B;  2M4M A;  1KBR A;  3V81 B;  2ZD1 A;  3IBW A;  1NDL A;  1U0H B;  3VAM A;  2WW8 A;  3EWG A;  5FDL A;  2LEA A;  5IFM A;  2EWH A;  1GK8 A;  2YWE A;  4JI5 J;  4JI8 J;  2E44 A;  1EQ0 A;  3TAM B;  4IFY A;  3WWG A;  3RU0 A;  3W5Y A;  4PAA A;  3HUL A;  4X4U A;  2OD6 A;  1S7H A;  4TXS A;  4ZPW R;  2P9C A;  3MM5 A;  4KHM A;  4HDG A;  3VGT A;  2FHJ A;  2W9C A;  2K3K A;  1NDP A;  1TL1 B;  2HFO A;  1Y10 A;  3NS6 A;  5B0E A;  3C6T A;  4C8O A;  4HAC A;  4Y65 A;  3FVY A;  3DLJ A;  2KI2 A;  3NCP A;  3UVJ B;  3VTI A;  2AYE A;  1SJR A;  4QPX A;  1FDN A;  1OSD A;  3QWP A;  3KRG A;  4Y00 A;  3MFI A;  1BQN B;  3D66 A;  1YTY A;  4LF8 J;  4IG0 B;  2BRL A;  3SZ2 A;  3I5C A;  2H5J B;  1LK7 A;  4IH5 A;  4OHZ A;  4F2R A;  5EN1 A;  3GV7 B;  4L74 A;  2XTJ P;  1MWZ A;  4CTA A;  4NEY A;  4NZ7 A;  5K8M A;  2F1F A;  2NXJ A;  2XMU A;  4WTO B;  4ED6 A;  2JEF A;  4AL7 A;  5DLG A;  3MAA B;  1TMJ A;  4QOT A;  5A8R B;  1M90 T;  1B70 B;  1SH3 A;  1VBY A;  2OJ3 A;  3KNA A;  1IR1 A;  2X6W A;  3N28 A;  1CJT A;  2JEI A;  1EJ7 L;  4XON A;  2X1G A;  1SIZ A;  4LSN B;  5SZT A;  2JEG A;  3EUN A;  2FLO A;  2HND B;  4USV A;  2VD3 A;  2D1C A;  1ZZN A;  1VQL S;  1XMO F;  4YC5 A;  3GCW P;  2JWN A;  2HLU A;  3MOZ A;  2ZUG A;  4NXM J;  1FKP A;  8ATC B;  4K4T A;  2ZVS A;  4F02 A;  2QA1 A;  4NRU A;  4XMY A;  2GVZ B;  2RU9 A;  4KQZ A;  4MTP A;  2J0X A;  3KLG A;  1UWB B;  3LAM A;  4DV4 F;  2JEJ A;  3KK1 B;  4IR1 A;  2J7W A;  4OZZ A;  1IDJ A;  3ZPP A;  5AMV A;  1QY7 A;  2L41 A;  2AX0 A;  1ZAW A;  2JOQ A;  3GFY A;  3PFO A;  2KM8 B;  1HBU B;  4M5G A;  2JNJ A;  4EEY A;  1HYS A;  4LF1 A;  1N52 B;  4A4J A;  3DGP B;  1SBR A;  1DZ5 A;  1CZF A;  2D9O A;  3ISN D;  1AZS A;  1XQI A;  1T03 B;  3CJ5 A;  4USH A;  2VFQ A;  3IBC B;  2FQQ B;  4OHW A;  1TV6 B;  4ECQ A;  2OTL S;  4EZ9 A;  3LJY A;  2XSF A;  2ZM6 J;  1KC8 T;  2BMB A;  1BE4 A;  4WFY A;  4JV5 J;  4A46 A;  1NCL A;  3HHL A;  3TUI C;  4Q45 A;  1KRP A;  1SH2 A;  3NMA A;  4X62 F;  1SQG A;  1VDH A;  2ZVI A;  4AXJ A;  2MQ8 A;  2ALY B;  4O3P A;  4DUZ F;  3VAI A;  2MMY A;  1X31 C;  1VCT A;  3LH2 S;  4K0K F;  1HWU A;  2CQI A;  1RT6 B;  1TK8 A;  2CQP A;  3VMV A;  4UOF A;  2IFX A;  2JLG A;  5LL6 d;  4BS2 A;  1AUD A;  3DNC A;  3MUV P;  4CO5 A;  4ERD A;  5B7W A;  3C15 A;  2BAB A;  4HTJ A;  2QO3 A;  1R0A A;  3QAU A;  3JAM U;  2WON A;  4I6Y A;  3BPS P;  1HYS B;  3ZZ0 A;  4RUB A;  4XM3 A;  2OKQ A;  2FC8 A;  2UZA A;  2BE7 D;  2XI2 A;  1F9H A;  3VQT A;  5F8J A;  3C16 B;  5MAO A;  1X0C A;  3G6V A;  2J0S D;  4DU8 A;  2B6A A;  3R7B B;  4C98 A;  1U24 A;  2ZEJ A;  3HHL D;  2WVF A;  1CJU B;  4ZMM A;  2XM3 A;  1O8F A;  3LP1 B;  1Q8B A;  4ER8 A;  2D69 A;  2ZH4 A;  3PX6 A;  4PYA A;  2RIL A;  3TP2 A;  1FRK A;  5IWA J;  2D9P A;  1RAO A;  3R97 A;  5D3G A;  4ES3 A;  1WG5 A;  1S1T B;  2CQ2 A;  2M9K A;  2V2K A;  4DOZ A;  4O0I A;  1R0A B;  3IM8 A;  1OGM X;  4XLE A;  2QMW A;  3HKW A;  3BBC A;  1S99 A;  1VJQ A;  3LP0 B;  2B9X A;  5D0H A;  3GFZ A;  4UOG A;  4Z2X A;  3NBP B;  1UZD A;  4NLR A;  3HFV A;  4F4W A;  5L9N A;  3EZU A;  1HMV A;  1TU0 B;  1UET A;  2HFV A;  5J2N B;  1AFJ A;  2DEJ A;  3D9B A;  2G2Y A;  3OSN A;  4DLG A;  5T7L B;  1RAJ A;  3KLI A;  1KVI A;  5CCL A;  4Z03 A;  2V2Z A;  1UVI A;  4ZP9 A;  2WBM A;  1R3N A;  1QRC A;  2BM0 A;  2QT7 A;  3EXY A;  2HKE A;  1KNZ A;  1N54 B;  3FKB A;  1PIL A;  2NZ4 A;  3ILJ A;  2V94 A;  1RT3 A;  1OO0 B;  3KLE A;  2X1A A;  1HNW J;  2WCX A;  2AJQ A;  4D3H A;  4CLU A;  1HBO B;  3J81 j;  3LMW A;  1VC5 A;  2BV3 A;  5F3Z A;  3I32 A;  1TL7 B;  4NLW A;  5K14 B;  4JUZ A;  2BM7 A;  2DNZ A;  2WOM B;  2XMM A;  5T41 A;  3UN3 A;  4OPW A;  4BC7 A;  3C46 A;  4NCB A;  2BE2 A;  1HNV A;  2VFR A;  2UUW A;  1LWE B;  1RWN B;  1F6T A;  3D28 A;  4TLR A;  5HVH A;  4U49 A;  1V6H A;  5LMU J;  2PI5 A;  4A8X A;  5D15 A;  3S8S A;  4NA1 A;  2KFZ A;  1RXO B;  2XMW A;  4PYD A;  4C6A A;  2XGP A;  4HI1 A;  1BMQ B;  1JRG A;  1BLU A;  1MMN A;  2NYH A;  3Q83 A;  4CCH A;  2E7V A;  3J7Z T;  1B7Y B;  1F9E B;  1RJJ A;  1CS4 A;  4L75 A;  3OLA A;  2DJW A;  3PRB A;  4O44 B;  4Q44 A;  1N5S A;  2G13 A;  3IAS 9;  2Y1R I;  1FF2 A;  4HDH A;  4L76 A;  4WJB A;  3CCE S;  3OW2 R;  1FJC A;  3PSS A;  3CXC R;  1TYV A;  3B90 A;  4ED5 A;  2FHJ D;  2BJ9 A;  2ZHB A;  5ETL A;  4OZ5 A;  4I67 A;  1RK8 A;  5T14 A;  4JYA J;  3HHN B;  4DL7 A;  1LQ9 A;  2D7S A;  3D6H B;  5H9E K;  5K20 B;  3UDV A;  2B4U A;  4BC9 A;  1GQE A;  4N76 A;  1N0U A;  5HQ8 A;  5IOL A;  2QE5 A;  2UV8 G;  1U49 A;  2VOP A;  2HVH A;  2H4W B;  5G0R B;  5IC4 B;  4DG1 A;  2CWX A;  4A8Q A;  4USK A;  3D3B J;  2BJ7 A;  3FRZ A;  4AT1 B;  1GNK A;  3DGP A;  1R8B A;  3SSR A;  2CRL A;  4NA2 A;  4OZ0 A;  2KH9 A;  2RDJ A;  3EGW B;  1B7F A;  3CD0 A;  1QM9 A;  1EA0 A;  4PPD A;  2RE1 A;  3NNC A;  4LSZ B;  2HHQ A;  1UKU A;  3SCK E;  1KCC A;  4FZV A;  1HI0 P;  3C19 A;  4B9N A;  2QV6 A;  4C11 A;  4EBE A;  2OPQ A;  3SY2 A;  1JLQ B;  6FDR A;  2DH7 A;  4K7Q A;  4PQU A;  4ES1 A;  1RU2 A;  2E5I A;  5B0C A;  2R7T A;  3NG8 A;  4F0H A;  2B56 A;  4CNY A;  4XOP A;  3H5U A;  2IJF A;  1D1U A;  1S77 D;  5LSR A;  4W8T A;  1FKP B;  3ISN C;  4KGK A;  2XY7 A;  1S0N A;  3GFH A;  3O6Q A;  1VRU A;  3AH6 A;  3M2V B;  3P5B P;  4F3M A;  4RWX A;  2F8M A;  3CF5 Q;  2MZT A;  4YR3 A;  1OY9 A;  1TP7 A;  2V8D A;  1X5P A;  3DRS A;  3KJN B;  2DPI A;  3T3F A;  1U8W A;  2DH8 A;  3IR7 B;  4WE1 A;  3SI8 A;  1ACM B;  4A8O A;  4Q2M A;  1RT1 A;  2VAS A;  1B0P A;  4U7C A;  2Y0S D;  3MFH A;  2CAJ A;  3DOL A;  3VQS A;  4KFB A;  2C3O A;  1RT5 A;  2MY8 A;  5LM7 E;  3R8Y A;  4F0K A;  2QMX A;  5L1K A;  3B54 A;  5HI7 A;  1HFE L;  4RNN A;  1YZ7 A;  2VFS A;  2XZT B;  5KFA A;  4DPO A;  2ZHA A;  1AT1 B;  1G4C A;  3PIO Q;  1GX5 A;  4DJB A;  4F50 A;  1KQ5 A;  4FNH A;  3WX4 A;  1U1M A;  4FXD A;  1HHQ A;  5D0E A;  2QLX A;  3DI6 B;  3QSI A;  2PGC A;  5LSO A;  3RB4 A;  4A8S A;  4JI0 F;  2H65 B;  1NPR A;  2QGF B;  3ILO A;  4LF4 F;  3OL9 A;  2AT1 B;  3E51 A;  3G6Y A;  2G1D A;  4G6V B;  1C1C B;  1NB2 A;  3CDE A;  2LXU A;  4TQS A;  3GLJ A;  4TY8 A;  5D0R A;  2ZH7 A;  1UVJ A;  4YN3 B;  3M9N B;  2QLF B;  3HK2 A;  4LF6 F;  1S1V A;  3UE2 A;  4ES2 A;  3OTB A;  3GYG A;  4ZN1 A;  3VAK A;  3K0J A;  1K0T A;  4R5P B;  2XC1 A;  1X4H A;  1WWH A;  2RVJ A;  4DR1 J;  2J8A A;  1RAI B;  4ELV A;  2DPJ A;  1D8Z A;  3MMB B;  3K57 A;  4J9Q A;  4PPZ A;  2ZD1 B;  1F3F A;  1U1K A;  2HHS A;  4N56 A;  3I5A A;  1Y5L B;  1NK9 A;  2B9E A;  3HHE A;  3TA0 A;  4USI A;  4C8K A;  1MW7 A;  3G96 A;  1RHM B;  3LP2 B;  1P27 B;  3RGI A;  4DSI A;  5HMZ A;  5KFD A;  1O8D A;  1NDC A;  2W7A A;  1N5Y A;  3QRQ A;  1KKH A;  4OX6 A;  3FDS A;  4CM0 A;  1NK8 A;  2IM1 A;  3I9V 9;  4QYZ J;  4O4R A;  5GAD U;  4KGX B;  1T9T A;  1KON A;  1YBA A;  3FUY A;  2VBY A;  4L6V 3;  1YKW A;  4M5H A;  4TY8 B;  3BO3 A;  1N6Q A;  4NXN F;  2R7U A;  4L3N A;  3C14 A;  3H2L A;  1ZM4 A;  2KVQ E;  2DNQ A;  3BB5 A;  4Y2A A;  4ZP7 A;  4PEO A;  3K5L A;  4DFM A;  1NKC A;  2XMK A;  1NK7 A;  3DLK B;  2OTJ S;  2XZD B;  4ZVR B;  3FFI A;  1WI6 A;  1Q16 B;  2F63 A;  4CO0 A;  1F2H A;  2EKY A;  2VC0 A;  1FNM A;  1T05 B;  5JMC B;  2V8G A;  3TI0 A;  2B0G A;  1RTD B;  2B8Q A;  2LCW A;  5ETT A;  2O3D A;  4Y2C A;  5DGB A;  2IHR 1;  1KQK A;  4FXV A;  1ZYQ A;  4GO7 X;  2HMI B;  3DOL B;  4M5N A;  2HVE A;  2YNI A;  2ZIT A;  2ZHO A;  4OI1 A;  3DYA B;  5B09 A;  3QZ7 A;  1P9Y A;  2ILY A;  5LJ3 Y;  3FSI A;  3TAN A;  1I6J A;  3NL0 A;  1BD6 A;  3Q22 A;  1OPZ A;  4I1T A;  4OZN A;  3TYT A;  5J1E A;  4A8W A;  1DQ9 A;  1UA1 A;  3GQ9 A;  3JSM A;  1FXR A;  4V02 C;  4DV6 F;  2EK6 A;  2N3O A;  4YB5 A;  5HRO B;  1H7X A;  5I3U B;  4P2F A;  2MQO A;  3OHA A;  1H6K X;  3TVY A;  1IBL J;  1UPP A;  3SUC A;  3RG6 A;  1RAH B;  2APO A;  2DNR A;  4FKY A;  5IT0 A;  4OYA A;  4DQR A;  2FY1 A;  4L73 A;  1QA3 A;  3SBM A;  2KJW A;  2HWH A;  2R7O A;  3M8Z A;  1TL7 A;  1ZM9 A;  1A7G E;  1KFS A;  2ROE A;  2RIJ A;  1KD1 T;  2YKN B;  3R5G A;  4C3M A;  4N5S A;  4ZOS A;  2C2K B;  3O5T B;  2U1A A;  2IY5 B;  2RSQ A;  2IAJ B;  3CDA A;  3UPF A;  4YEL A;  2VJJ A;  2WHO A;  4P6Q A;  5JLV C;  1CQN A;  3BGL A;  4DF8 A;  4DR6 J;  2ZE2 B;  3OL6 A;  1SV5 B;  2AW0 A;  3CJ8 A;  3AJ1 A;  4TLQ A;  2QFJ A;  1DQA A;  4DMZ A;  5LMN F;  3B8H A;  4HYK A;  2NUH A;  1RT4 B;  2XHW A;  2GNK A;  4TN2 A;  3UD4 P;  2RT3 A;  4C3L A;  1VRT A;  4FYD A;  1A9N B;  4ZJO A;  3BSC A;  2C2O B;  1QAJ A;  4UW2 A;  3MD1 A;  1WSV A;  2M2B A;  3CDU A;  4KAI A;  3OTO F;  3NGS A;  3KOA A;  5KAK A;  1ROF A;  1RT7 B;  1VBZ A;  4WZM A;  2BW7 A;  1C0T A;  2AJ4 A;  1N0V C;  2HK3 A;  3BKF A;  4O3O A;  2WB1 D;  3SCJ E;  3T41 A;  2KZM A;  2WZ1 A;  2QA2 A;  2DR9 A;  2Y9H A;  1FX2 A;  5M2P A;  3J80 Y;  3CCT A;  2W2Q P;  4QBU A;  1RIS A;  3Q8V A;  1WG1 A;  1TYX A;  8AT1 B;  4UOC A;  3MR2 A;  5KFS A;  3PEH A;  1WJ9 A;  3GG0 A;  3FZB A;  1GMV A;  1NLK L;  3DOM B;  4U95 A;  4F3Q A;  1FD2 A;  2RHS B;  3OSP A;  1X9M A;  3QRP A;  3K7R A;  4I69 A;  1S12 A;  1TKX B;  2MSS A;  1KR4 A;  1S6Q B;  1IA5 A;  3DU5 A;  3LGH A;  3ZFV A;  2HZA A;  5ITH A;  1LWF B;  4XLA A;  2HNY B;  1R43 A;  3POT B;  2QMU B;  4IRK A;  1XR7 A;  2MB0 B;  3UDC A;  4J9U E;  2DR6 A;  4KR0 B;  2COL A;  3A8I A;  3MM9 A;  2YNI B;  1RAC B;  4IQM A;  1JQG A;  3PJX A;  1R8A A;  4YB7 A;  2GVD A;  5KG5 A;  2ZBI A;  4MR0 A;  4RNM A;  3M6V A;  4CRJ A;  3E2E A;  4LF2 A;  2YKO A;  3CED A;  2JSX A;  3O2I A;  5E41 A;  4OX9 J;  1QE1 B;  4LF5 J;  3LWM A;  1RTI A;  1QRB A;  2DT9 A;  2XO6 A;  3T9Z A;  3VAH A;  3TQE A;  1U2C A;  3FEY B;  4BDP A;  2ABY A;  5T7L A;  3V5R A;  2HAF A;  2HGM A;  2C42 A;  3AD7 C;  4ECW A;  1R6Y A;  3CCJ S;  1SJ4 P;  4DS5 A;  4FF2 A;  2R4F A;  3TUP A;  1DAB A;  1IKV A;  2VFT A;  2YQ0 A;  3T5H A;  1X0F A;  1ZTW A;  5M2U A;  3RRG A;  3BO4 A;  4MAK A;  4P7T A;  4ZVU B;  2XHC A;  1KEK A;  1FFW B;  4ZPD A;  2ZNY A;  1HPZ B;  2MZS A;  1UW4 A;  3N6L A;  3OTC A;  2QIF A;  3V4I B;  2XLJ A;  2GJF A;  1LWF A;  1RWV B;  2HNY A;  3CJ0 A;  1UWB A;  4OJG A;  5L9X A;  1NPP A;  1G7C B;  3MZI A;  4X66 F;  4NEZ A;  4ZHR B;  1IBK F;  4FN5 A;  2OLW A;  3CCV S;  3I9Z A;  3HVA A;  2E5G A;  5JMN A;  2WOM A;  3RR8 A;  3EGZ A;  3CJ3 A;  2V67 A;  2W9B B;  2B6A B;  1OQ3 A;  1HQU A;  3THT A;  1MSW D;  2FB0 A;  5HLF B;  2GC8 A;  2GFF A;  2IYI A;  3PXG a;  2UVF A;  1O8J A;  1LWE A;  1S57 A;  4RW9 B;  3ZZY A;  3QAE A;  3TA2 A;  1YJT A;  2MGZ B;  4QWC A;  1W2B R;  4Y3C A;  4MJK A;  4XKW A;  4PG6 A;  4G65 A;  2HNZ B;  2F4V J;  1SQF A;  1U48 A;  1FRX A;  1RAF B;  2RNE A;  3TQ1 A;  1N33 J;  5BYR A;  2HRY A;  2V9W A;  2MZR A;  4E2F B;  3W7B A;  2V69 A;  3H4D A;  2VG5 A;  5CYJ A;  2J7U A;  2QSW A;  5DRK A;  2G0I A;  1WOR A;  2ROP A;  2WVB A;  4TU9 A;  5A0Y A;  5C24 A;  2XUL A;  4X4P A;  5GVQ A;  3SV3 A;  1S1T A;  5L8R C;  4AXI A;  1BUX A;  3HO1 A;  1PYT A;  1Q86 T;  3WX8 A;  2OGU A;  3E01 B;  2VG7 B;  3K5N A;  1H7W A;  2D3U A;  2IAJ A;  4KH1 B;  2C2N A;  1OIA A;  2HQF A;  1G3O A;  5D4L A;  2M3D A;  3VGU A;  4RW9 A;  2MGZ A;  2C3U A;  2ZC4 A;  4H4M A;  2ZH5 A;  4PRF A;  1NH7 A;  1M5P C;  3FCH A;  4OX8 A;  1TVR A;  4KPY A;  4ZVO B;  1N33 F;  4RNH A;  2IIH A;  1Y4Z B;  2MZ1 A;  1V5V A;  4P9S A;  4TU7 A;  4IFV B;  1RA7 A;  1IKW A;  3T19 A;  3HFZ B;  4C2M A;  2XLI A;  5C2G A;  1RKJ A;  1QUP A;  1U0H A;  5IT9 Y;  4OLO A;  4J37 A;  4DI6 A;  2BQ3 A;  4J90 A;  3X1L B;  2BSP A;  2AHO B;  1IM6 A;  2EI5 A;  3N5B A;  3QNW B;  2OD4 A;  3CJ2 A;  5JJB A;  1FNO A;  3M4X A;  4TY9 A;  3NGU A;  5HMW A;  2XMA A;  1RHK B;  3IN5 A;  4QZV B;  1KVJ A;  1S0O A;  2DNO A;  1U26 A;  3BZQ A;  3HFK A;  2NSC A;  2VFV A;  1YLX A;  3CJ4 A;  3D1Q A;  4FVM A;  1QA1 A;  4OJH A;  3CSK A;  1GMW A;  4IOA Q;  1UFW A;  2LFV A;  4I64 A;  2OPP A;  5KOX A;  3PM9 A;  1P9Q C;  2V2Q A;  4ZS6 A;  5KFV A;  2DKO B;  3M8P B;  4F25 A;  3MR6 A;  1U6Z A;  3OUY B;  1D09 B;  2PA8 D;  4OI2 A;  4ZPC A;  1N5V A;  4N47 A;  3J81 Y;  4DFJ A;  1KN6 A;  1VK3 A;  3HHL B;  3KXD A;  4XPE A;  1IBL F;  2UVW A;  1K1Q A;  1S79 A;  1IKY A;  2W1B A;  2Z2M A;  3DMJ B;  3ZTP A;  2EKN A;  4F67 A;  3VGS A;  3G8S A;  1OFD A;  3PIP Q;  2DNK A;  2IM2 A;  2ZJP Q;  5B08 A;  4K4S A;  2BOA A;  1CBK A;  4GVL A;  2VBW A;  1WOS A;  3VAF A;  1H72 C;  1QUV A;  4H54 A;  3X3U A;  3RB0 A;  2FLP A;  1CLW A;  1BQN A;  1SVD A;  2QL5 B;  5HN0 A;  2OFH X;  1UW9 A;  4L72 B;  1C4C A;  2CPJ A;  3NGR A;  5B0F A;  3TJ9 A;  1FWL A;  1YWX A;  4XAK A;  4OYM A;  1Q8I A;  2C3M A;  4O4G A;  5IM0 B;  1JJH A;  1JK9 B;  2V68 A;  1FER A;  3HD2 A;  5EUH A;  1RWX B;  1RBL A;  2E9Z A;  1O8I A;  4NCG B;  4UQG A;  2UU9 F;  3PX4 A;  3C3L A;  1PO6 A;  1N88 A;  1BQM A;  3IRW P;  2XLK A;  1IVZ A;  3QO9 A;  4DCP B;  3AB2 B;  1S1X A;  1VIS A;  2GA7 A;  4TYA A;  4J9L A;  1W2I A;  2VFP A;  4WK3 A;  2PII A;  2BJD A;  2RQK A;  2FZG B;  2CNL B;  1Q81 T;  3G8Q A;  2GQ2 A;  3A3P B;  2GV1 A;  2JVR A;  3K5O A;  4NYZ A;  4C9D A;  1PE9 A;  7FDR A;  2E7X A;  4R5P A;  4Y2I A;  2DVI A;  1M0S A;  2PFF B;  3E01 A;  4IDK A;  2R7X A;  3RYL A;  2RU3 A;  3LAN A;  2AX1 A;  3QBC A;  4WIQ A;  2O0W A;  3MI7 X;  4B3S J;  2CG4 A;  3CJT A;  5A6W A;  1X4A A;  2CJK A;  4UQT A;  4IKA A;  1E6Y A;  1ZOT A;  4O3R A;  5IWA F;  2UXD F;  4Q2L A;  1R31 A;  1N56 A;  1HW9 A;  4CLZ A;  2R7V A;  3A4T A;  4MFB A;  4BBY A;  2RKI B;  2B5J B;  5GAG I;  4WFA Q;  3LYC A;  2F8E X;  2YH0 A;  4HR2 A;  4JI2 F;  1FHT A;  4ALZ A;  1WKK A;  2FYX A;  5DZ6 A;  5ETM A;  1UP1 A;  3J7Y I;  1VR6 A;  4X65 J;  3R1H A;  1FD8 A;  1I5O B;  3DLB A;  4TNO A;  4DFP A;  3L7U A;  3FSX A;  3G6X A;  2ERR A;  2EVZ A;  1Q82 T;  3SEO A;  4QU6 A;  4MKY A;  2HNZ A;  5KFF A;  4NK6 A;  4Y0F A;  2X6X A;  1O6X A;  3G8T A;  3PW2 A;  4OI4 A;  2MLY A;  4XNF A;  1RKI A;  2BW2 A;  2KT2 A;  2X3D A;  3BKT A;  3D7S B;  4N77 A;  3BQ2 A;  1EET B;  4LF8 F;  4Q0B B;  3R5J B;  1QVG R;  2MQQ A;  3DRR A;  4YCQ A;  1YBT A;  3D3C J;  3EGN A;  4IFY B;  4OYB A;  2B9W A;  3GQC A;  3D54 A;  5HRO A;  3AOB A;  5D8H B;  1K0V A;  1H2T Z;  3IR6 B;  1KTW A;  3MPY A;  1JLG A;  4KE5 A;  1J5O A;  4M5M A;  2D74 B;  2VHG A;  4ECS A;  3GJR B;  1URR A;  3CCW A;  4URQ U;  4CQ1 A;  4GKK J;  2HHU A;  1T9U A;  3PV8 A;  2NXC A;  2WVC A;  3R3T A;  3JTO A;  5HO4 A;  2JDJ A;  2VDH A;  2R9L A;  4CLL A;  1OFM A;  3HD1 A;  4KGV B;  4X4V A;  2NYI A;  3VAL A;  1XEZ A;  1U25 A;  3DLH A;  1SJ3 P;  2Y1I A;  1M1H A;  3WC2 A;  3U1M A;  3OVA A;  1SJQ A;  1HAR A;  2JRS A;  5DDR C;  4DR3 F;  1AB8 A;  4NXM F;  1U6F A;  1S0V A;  3RRH A;  5HAO A;  4C8M A;  2DRA A;  2NUU G;  2F7V A;  1TUG B;  2CJX B;  2J9D E;  1YJR A;  2Q43 A;  5BR8 J;  4F4Y A;  5F8L A;  1CPZ A;  1UL3 A;  4MMO A;  1APS A;  1KOO A;  3GIR A;  4P2X A;  3JAM Y;  4Y2M A;  4OJL A;  3HVW A;  3SSS A;  2P6T A;  3GQ8 A;  3FNN A;  3CT9 A;  1KDN A;  3T6B A;  1PCA A;  3HZG A;  4ZLL A;  5E7O B;  4ZLN A;  3NRB A;  5J2P B;  4HL9 A;  4G1Q B;  2Z30 B;  4X64 J;  3RRK A;  1OQ6 A;  4NI2 A;  3TUJ C;  4OHY A;  3SIP B;  3H40 A;  2ZBP A;  1KTQ A;  3K2Y A;  5IV4 A;  1NHU A;  1RZM A;  1GQ8 A;  3P6Y C;  5GAE U;  3PET A;  2YKA A;  3EYZ A;  1GX6 A;  4OV6 A;  4WP9 A;  4DCO B;  2UVR A;  1RHU B;  2DGX A;  3OVB A;  1NKE A;  1HWI A;  1NRK A;  3HLU A;  4FYY B;  1IBM F;  1DY3 A;  4LF7 J;  3KNG A;  8RUC A;  3IWL A;  1JLE B;  3IAM 9;  3KDN A;  4J9V A;  4Z06 A;  4LR8 A;  1TZ0 A;  4ATN A;  4P73 A;  2G0C A;  4HHJ A;  1TYU A;  1IKX A;  1NUE A;  1S59 A;  2W2M P;  3IRX B;  2I5J B;  2CJ9 A;  1MRO B;  2CJB A;  1FE0 A;  1VYA A;  3MEG B;  3GV5 B;  1UFL A;  1Y11 A;  2XMT A;  3MGJ A;  2WVD A;  4YEJ A;  4DL5 A;  3PG9 A;  2OSQ A;  1HBN A;  5HQM A;  3FK4 A;  1FT8 A;  4W90 B;  1D3W A;  2HFN A;  1PLU A;  4M94 A;  2V6A A;  1YI2 S;  4DQP A;  1CJK A;  3V6D B;  2NXN A;  4MXN A;  2B7B B;  2EFQ A;  2PA3 A;  4WU3 A;  4UT4 A;  3FMW A;  2NQP A;  2GVD B;  4KGM A;  4W98 A;  5F8I A;  2VPW B;  3K5M A;  1LEO A;  3EM1 A;  1H0H B;  1WI8 A;  3ENQ A;  4LBH A;  2JL9 A;  4C97 A;  2YKN A;  4RBV A;  3FBB A;  2W8L A;  1X9S A;  4V19 J;  1N32 F;  5CCM A;  4F4A A;  2XY6 A;  5KFE A;  2RRA A;  3MEK A;  3L9Z A;  5CH7 B;  4RLE A;  2I5J A;  3QID A;  3RBX A;  2XT2 A;  1CUL A;  1IKX B;  2DNN A;  2E5J A;  3IRX A;  4TVA B;  1I1G A;  1X9W A;  1DUR A;  2AEF A;  2VIH A;  5DG8 A;  2N4C A;  2FJA B;  3E8O A;  3M6U A;  4X4S A;  1Q8K A;  3VHQ A;  5I3U A;  1O8K A;  2IA0 A;  3PO4 A;  1GTE A;  3IBF B;  1YDL A;  3JQK A;  2HEK A;  2AYG A;  4HT7 A;  2IM3 A;  4B3S F;  4DSL A;  2LLZ A;  3H0P A;  2X7I A;  4ZLJ A;  4LQ9 A;  2R8H A;  2HS3 A;  2ASJ A;  4HKQ A;  1ZTT A;  2CPX A;  2LA6 A;  3DU1 X;  5D0G A;  5AJ3 J;  2OPS A;  3DC2 A;  1O8B A;  1PJ6 A;  1IJE B;  2R3V A;  4OZ2 A;  1SH0 A;  4YB6 A;  4NLX A;  3RW7 A;  4CO4 A;  1S9E A;  4M8L A;  3S6E A;  1RWO B;  2IDL A;  4C8Y A;  3B6B A;  3IGN A;  4GKJ J;  1XN9 A;  3KK3 A;  1CJK B;  1PSD A;  5KT4 A;  1YJ9 S;  1M1K T;  2DGV A;  2DR8 A;  1GT8 A;  2MKY A;  4RBU A;  4YZ0 A;  4OJP A;  4HH0 A;  2A18 A;  1U1N A;  2G1H A;  5L1J A;  1EKS A;  1L1I A;  2M8H A;  3OFH A;  5IS2 A;  3H7H B;  3MUR P;  3T5J A;  1NK4 A;  1MRO A;  3LUY A;  1H98 A;  1TL5 A;  4ICL A;  2A3J A;  2G9O A;  4QIF A;  3UN2 A;  4NLG A;  2GHV C;  1L3K A;  5AJ3 F;  3SV4 A;  4A8Y A;  4QU7 A;  1TEL A;  1JLE A;  2GX8 A;  2HZV A;  4F4K A;  1AFI A;  1T94 A;  4C3K A;  1P8G A;  1UVM A;  2CQ0 A;  4YZQ A;  2RH3 A;  3MEG A;  4PXE A;  5ETQ A;  1NK6 A;  1FJ7 A;  1NJI T;  3ITH B;  4NXN J;  4ID5 B;  1O8M A;  1WD6 A;  2POK A;  2B8P A;  4WXO A;  3RJM B;  1LV5 A;  4ILR A;  3LTO A;  4AYB D;  9ATC B;  1VQ6 S;  2PDA A;  1YBU A;  4H4O A;  2F9J A;  1FTC A;  3NNA A;  1NZA A;  1IDK A;  1LOU A;  1Q95 G;  1U1O A;  5F8G A;  3D1H A;  4YDX A;  1UA0 A;  3BN7 A;  3N6N A;  3KK1 A;  4DSJ A;  3GR1 A;  1RAG B;  3M7V A;  3U1N A;  2UVU A;  4PQU B;  1PIE A;  2F4F A;  1G6B A;  2VJV A;  2AQ4 A;  1EET A;  3M05 A;  1PBU A;  4NMX A;  3TX8 A;  3M1V A;  4DBQ A;  1GAO A;  3Q8Y A;  3RUB L;  1MWY A;  3NGD A;  1K4Z A;  3WHI A;  2JC0 A;  5AT1 B;  2ACY A;  5C1E A;  1XR6 A;  2JC1 A;  2HND A;  2J8S A;  1S5Z A;  2QLW A;  3CJS A;  3DU6 A;  1HLW A;  1T95 A;  2F9D A;  2CVI A;  1S0M A;  3DI6 A;  2OEJ A;  2VG6 A;  3M9M B;  3BJY A;  5L1I A;  2Y8Y A;  3BYR A;  5KFP A;  3NWG A;  1IM4 A;  4U7U D;  3US5 A;  4DV5 F;  1NAQ A;  1S1U A;  3IP0 A;  3OR1 A;  5I4M A;  4X62 J;  4DSE A;  2QC3 A;  2K1R A;  3SQG B;  4QW8 A;  2CDR B;  4YR0 A;  1S1W B;  2W24 A;  4CLT A;  2IBK A;  3PYD A;  2HIY A;  1FRL A;  1RWU A;  3PYG A;  1YZ6 A;  4XN3 A;  2VZ9 A;  3QT8 A;  1S10 A;  1NXI A;  1B0V A;  3CTR A;  3OFG A;  3VGV A;  1RGV A;  2DY1 A;  4RNO A;  3CUL A;  4RW6 B;  1O5J A;  2DNM A;  3V4M A;  4ZIV A;  4Z7Y A;  4FPR A;  5KG1 A;  1WHV A;  1WEZ A;  2KZZ A;  2DNG A;  2DGQ A;  2HIQ A;  4O44 A;  3Q2T C;  4QR0 A;  3OFE A;  1WC3 A;  4ZLP A;  3HT3 A;  2VOO A;  1TFW A;  4WP8 A;  3LQV A;  1C0U A;  1Y00 A;  2LQ8 A;  4WFN Q;  4KGZ B;  1VIO A;  1JWW A;  4OYX A;  3M2V A;  1Q5Y A;  2OPQ B;  1N32 J;  1QTM A;  1QDU B;  1VQS A;  1X4F A;  3NGT A;  2LQB A;  4ZP6 A;  3J81 U;  2R7R A;  4UY8 T;  3I55 S;  2XNQ A;  1RCX B;  1XMQ F;  3QAT A;  2GIQ A;  4LBP A;  1NJX A;  2HHT A;  4ZPV R;  4NCG A;  4NI2 B;  3GCX P;  1EHW A;  3GIJ A;  3H2U B;  3Q8U A;  3N4W A;  2E9T A;  1LXJ A;  2YNG A;  4B9V A;  5KFG A;  1VBL A;  1HNI A;  3GZ7 A;  5CAA A;  4NCA A;  4DG1 B;  1U2F A;  4CI0 B;  5ADZ A;  5KG2 A;  3KHH A;  2HHX A;  1NHV A;  1RTH B;  1AUS L;  2PMW A;  2VC1 A;  2WW4 A;  4WBF A;  4XLF A;  1RE1 B;  3RB6 A;  4K4U A;  2BQR A;  1BY9 A;  1FDA A;  2JZ5 A;  3ILI A;  5I3P A;  3W5X A;  2PSZ A;  2KJV A;  4ED7 A;  1N6Q B;  1R27 B;  2FGO A;  3ELH A;  3I96 A;  4G1P A;  1IR2 A;  4F36 A;  2XCA A;  1IWG A;  5HJY A;  2QX0 A;  4AL6 A;  1VQO S;  4RJV A;  2Z56 B;  4NLP A;  1VQ5 S;  5E3Q A;  4A8F A;  5KFC A;  4GKJ F;  1VGY A;  1AA1 B;  2BAN B;  3TW0 A;  1HHT P;  3O8W A;  3AA9 A;  2DB1 A;  2V63 A;  2ZBR A;  1PC4 A;  4KHR A;  4DZ6 A;  4DQI A;  2VH7 A;  4ELT A;  1RAA B;  2DIT A;  1FKO B;  3L4B C;  3M9O B;  3GV8 B;  1HNZ F;  2FVR A;  3RW6 A;  2DXD A;  2RD5 C;  3M2U A;  1VQP S;  3K17 A;  4I0W A;  2JFK A;  1OMS A;  4DV5 J;  3IO1 A;  2V0N A;  5KTQ A;  1FKA F;  3DRR B;  2UUB F;  3QWU A;  3GJQ B;  4U7U K;  1N4L A;  1BN8 A;  1S1X B;  2B7C B;  3RAQ A;  4YZX A;  1EX8 A;  4NX9 A;  2XNR A;  2VU5 A;  1TSP A;  3K59 A;  3QO9 B;  3BO2 A;  2PEH A;  4WK1 A;  2HK2 A;  1F5B A;  1YK9 A;  4Z7C A;  4OYP A;  1QAX A;  3ZTR A;  4RZR A;  3H5Y A;  4GC6 A;  4QWB A;  3TR5 A;  2H9Z A;  1Q4R A;  3DFE A;  3M32 A;  3CIZ A;  3Q0A A;  3AQO A;  2R7W A;  1UWA A;  3MM7 A;  5KFL A;  1QAY A;  3JYT A;  3M8Q B;  2H4Y B;  3BBB A;  3R27 A;  5G0R A;  1FK9 B;  4XDC A;  1IQT A;  2X3G A;  3JQJ A;  3PDN A;  3LPY A;  4EUV A;  1NK0 A;  3W66 A;  5F8M A;  1IWA A;  1VRQ C;  2KVI A;  2Y0B B;  5M2R A;  3DLG A;  4RW4 A;  4ECT A;  1NSQ A;  2DIV A;  3PKY A;  1E6Y B;  3NY0 A;  3KJV B;  4FDF A;  3MUM P;  4DUZ J;  2QY1 A;  4DQQ A;  3TO8 A;  1YJV A;  3HX9 A;  1K5C A;  1T0T V;  1ZBT A;  3TAP A;  4K4Z A;  2LEP A;  3CD6 S;  3DGV A;  3GYN A;  2MY7 A;  4J9K A;  4CDI A;  2W8K A;  4ZVF A;  3W2V B;  5HBM B;  2QX3 A;  3JSB A;  2UUC F;  5RUB A;  2VFM A;  2CJY B;  3OL7 A;  2MZQ A;  2AMC B;  4LSL A;  4EYH B;  2AP6 A;  1UEU A;  2B4O A;  4QPT A;  4DHV A;  3OV7 A;  4ED3 A;  2U2F A;  3Q2S C;  2XWX A;  1X8D A;  4RO0 A;  1OY8 A;  2IOU G;  2DY9 A;  4W8S A;  2A2D A;  1CJV B;  4A48 A;  4DWI A;  4P71 A;  4EBC A;  4BWM A;  4ZHR A;  4DV0 F;  4S0M A;  2YBV A;  2IA6 A;  1F5C A;  1JJC B;  1P1L A;  2O0V A;  4LR7 A;  4G1I A;  3AK5 A;  1RWM B;  2FHM A;  3JTN A;  4ED1 A;  4JI6 J;  2R7S A;  2YY3 A;  3UWT A;  5JUM A;  4DUY J;  3TEG A;  2YUH A;  4FS2 A;  5IZH A;  1RYS A;  2IRU A;  3TJA A;  4X4Q A;  2Q3P A;  3NLC A;  4RW4 B;  2ADC A;  1N36 F;  4U96 A;  3A1Y G;  1TKT A;  4FYX B;  1XIQ A;  3KLI B;  2VON A;  1FJE B;  4IQX A;  4QIV A;  1HD1 A;  2NT9 A;  4HT5 A;  4DX5 A;  4YHH F;  2NS1 B;  3TAQ A;  2VA2 A;  3RTV A;  4YEA A;  1UEK A;  4X4N A;  1S6O A;  4I56 A;  3PSZ A;  3N6M A;  3TRG A;  2MKI A;  4Y2K A;  4TU8 A;  2NRE A;  1FRM A;  2G0Y A;  2MZJ A;  4I6W A;  3UVJ A;  2HRT A;  3IG1 B;  4IUF A;  3DDI A;  1YRT A;  3EDQ B;  3HT0 A;  2UP1 A;  1KLN A;  2AV5 A;  2HFS A;  1B0T A;  4QWE A;  2KKH A;  1CS4 B;  3OTD A;  4ANC A;  4CO1 A;  1QD1 A;  1WOP A;  4V19 X;  1SQE A;  3U02 A;  3BGR A;  2E1C A;  1I51 B;  4B9S A;  1J5E F;  2HHP A;  5DS7 A;  2K06 A;  3OHB A;  5D4P A; 
#chains in the Genus database with same CATH homology
 1B4S A;  4C6A A;  2HUR A;  3N90 A;  1QQ1 A;  4OJ5 A;  1K8F A;  3Q83 A;  3SZE A;  3ML3 A;  4F36 A;  3ELH A;  3LYC A;  4HR2 A;  3VVU A;  1PKU A;  5JMC B;  1WKK A;  4KPC A;  2B8Q A;  3EE3 A;  3GPA A;  4OM9 A;  1S57 A;  2DXF A;  1HF2 A;  1QA2 A;  2HVE A;  3L7U A;  1TYV A;  3JS9 A;  4CP5 A;  4OJ6 A;  4DZ6 A;  5C7P A;  3B6B A;  2NCK L;  5CAB A;  2DXD A;  3EVO A;  4ANE A;  2J8I A;  4OJP A;  4V02 C;  3FCW A;  5IOL A;  3SYJ A;  2AZ3 A;  4FKY A;  2VU5 A;  1TSP A;  3Q86 A;  1PAE X;  3N6Z A;  1QA3 A;  1NSP A;  3P4G A;  3FC9 A;  1BUX A;  3WX8 A;  3ZTR A;  3G2X A;  3RIQ A;  1JXV A;  3TH0 A;  4O0N A;  3DKD A;  3VGU A;  1XQI A;  1WKJ A;  3EVW A;  2DXE A;  1B99 A;  2F3L A;  2BM5 A;  2VFQ A;  3Q89 A;  3BBB A;  2CWK A;  2BM6 A;  5JLV C;  3LJY A;  2B8P A;  1MN7 A;  1BE4 A;  2BEF A;  3ZTO A;  3BH7 B;  1NCL A;  1W7W A;  4DI6 A;  1K44 A;  4FKX A;  2W7Z A;  1NSQ A;  3FBC A;  3NGS A;  3NGU A;  4UOF A;  4OJL A;  4JRA C;  1KDN A;  3BH6 B;  1U8W A;  1QA1 A;  3Q8Y A;  1K4Z A;  1WXR A;  2BX6 A;  1ZS6 A;  1S5Z A;  2ZUA A;  2VFO A;  1MN9 A;  1HLW A;  3BBF A;  3Q8V A;  4EK2 A;  3ZTQ A;  1TYX A;  2B0R A;  2VFM A;  2VFN A;  2DYA A;  1NHK L;  1TYW A;  1WKL A;  3B54 A;  3EJM A;  3FBE A;  3PET A;  1NLK L;  4KH3 A;  3ZTP A;  3VGS A;  1KQ5 A;  2IOU G;  2DY9 A;  3ENA A;  1HHQ A;  1UCN A;  3EVM A;  3EIC A;  4S0M A;  3GP9 A;  1BHN A;  3JX8 A;  5BXI A;  1CLW A;  3FBF A;  3AK5 A;  3VGV A;  1NB2 A;  1NSK L;  3FCV A;  3NGR A;  1TYU A;  1NUE A;  1S59 A;  3R9L A;  4AND A;  2YUH A;  1VYA A;  4UOG A;  3BBC A;  4OJO A;  4DUT A;  4UOH A;  2XC1 A;  2V5I A;  1HIY A;  1NPK A;  4ENO A;  3PRV A;  3VVT A;  1XIQ A;  1NDL A;  2BM4 A;  2AZ1 A;  1F3F A;  1QRB A;  3PJ9 A;  2VFP A;  1QRC A;  3MPD A;  3NGT A;  4W98 A;  3FKB A;  1LEO A;  3EM1 A;  2G0Y A;  1NDC A;  3VGT A;  3DDI A;  3FBB A;  1LWX A;  1NDP A;  1EHW A;  3ZTS A;  4F4A A;  3Q8U A;  1DAB A;  4ANC A;  3EMT A;  2BM7 A;  3ETM A;  5CAA A;  4OPW A;  3H09 A;  1NDK A;  2HVD A;  1F6T A;  4WBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...