3BH6B

Crystal structure of the rp2-arl3 complex bound to gppnhp
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
314
structure length
314
Chain Sequence
PKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The retinitis pigmentosa 2 gene product is a GTPase-activating protein for Arf-like 3
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords ADP-ribosylation factor-like protein 3
total genus 105
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2007-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07986 TBCC Tubulin binding cofactor C
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 3bh6B01
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3bh6B02
1HHQA 1NDCA 4F36A 3EE3A 1ZS6A 2DXFA 2B8PA 1NPKA 4UOFA 1KDNA 2ZUAA 1U8WA 1WKLA 1BUXA 3FKBA 3FBBA 1NSQA 3ZTQA 3B54A 1BHNA 5CAAA 1MN9A 3ZTPA 3GP9A 3WX8A 3DKDA 2DY9A 4DI6A 3DDIA 3EICA 3ELHA 1B4SA 1NDLA 5BXIA 3Q86A 3BBBA 3VGTA 4ANEA 2HVEA 1S5ZA 1NB2A 3ZTOA 3EJMA 1NLKL 1BE4A 4FKYA 1NUEA 3MPDA 3VGVA 2AZ1A 2B8QA 1XIQA 2CWKA 3NGUA 3JS9A 1NSKL 3G2XA 4EK2A 1XQIA 3VGSA 3ENAA 1KQ5A 3BBCA 3NGSA 1EHWA 1LWXA 1NDKA 3FCWA 4WBFA 3PRVA 4CP5A 3NGTA 5C7PA 4V02C 3VGUA 3Q89A 2DXDA 3Q8YA 4HR2A 2HURA 4KPCA 1K8FA 1UCNA 3ETMA 3VVTA 4ANDA 4ANCA 1K44A 3Q8UA 2B0RA 2YUHA 1NDPA 3VVUA 2BX6A 1S57A 4UOHA 1K4ZA 1NHKL 1F3FA 1F6TA 3L7UA 4DZ6A 3PJ9A 1JXVA 1LEOA 1NCLA 1MN7A 2DYAA 1PKUA 3B6BA 4UOGA 1S59A 3EVWA 4S0MA 1HLWA 3EMTA 3FBEA 3EVOA 1NSPA 3BH6B 2VU5A 3EM1A 4W98A 3ZTRA 3Q83A 1HIYA 2BEFA 2AZ3A 2HVDA 5CABA 4FKXA 3BBFA 4O0NA 1WKKA 3FBCA 4DUTA 3R9LA 1PAEX 1WKJA 1B99A 3EVMA 3FC9A 3Q8VA 1VYAA 3GPAA 2DXEA 1HF2A 3NGRA 4F4AA 3BH7B 4C6AA 1W7WA 4ENOA 3FBFA 3FCVA 5IOLA 2NCKL 3ZTSA
chains in the Genus database with same CATH superfamily
1GMUA 3HD1A 2D1CA 2XB2D 2OPRA 3VSVA 3KDNA 3J7Z5 4HACB 1VCTA 3PACA 4H4MA 4DCOB 5K20B 2QO3A 1VQ4S 4WF9Q 2HNDB 4RBTA 2NTPA 2FPHX 5DS7A 4RNOA 1N0VC 1PYSB 4M63A 4NLTA 5LMNF 1CJKB 3LJYA 1TQLA 2J9CA 2N4CA 2ZUAA 4OHXA 1TL1B 1Z1ZA 5HJXA 3H2VE 4YFUA 1ITPA 1NSAA 4U4BA 4HHJA 2K3IA 1MMNA 2FB0A 3BGOP 4OI2A 1MROB 2HSEB 4J9OA 2Y8YA 2GO9A 2P9EA 4CIOA 1IN0A 3TA1A 3OFHA 4I2QA 3W64A 2GCFA 2F4VJ 4FDFA 3D3CJ 1JLFB 1XK8A 3QWUA 3WX8A 3KK2A 4DI6A 4LF6F 5KG4A 4AQYJ 4XK8C 4XDDA 2IC3B 3HSZA 2QFIA 1NDLA 2PN6A 1U2FA 2E1AA 2O17A 2PT0A 4ZLPA 1KHVA 2BJ3A 3M9MB 5LJ5Y 4QU7A 2VV5A 4ECSA 2HVEA 4HKQA 5C24B 2A6MA 3GB0A 2MKCA 4G1IA 1RBOB 2X3GA 2G0CA 4UUWA 3EJMA 1Y0HA 1VRTB 3MMCA 4FKYA 1IQZA 2G0IA 2CJAA 1FTRA 2VKRA 5A8RB 3C2PA 1M5SA 1REVA 3RAQA 2L08A 3MEEA 4F4XA 4H4KC 4WFAQ 2BQ3A 1AUSL 2CQPA 2OP5A 2HWIA 2O0WA 2KM8B 2FC8A 2Y3YA 4CLYA 2AJFE 3MR5A 2PFDA 3N0VA 2VQFJ 4CWBA 4WKYA 1S72S 1R0BG 3ADAC 5DZ6A 1WEXA 2KU7A 5KT7A 1YIJS 4NLOA 3MOJB 1HNIB 1OPIA 4LF9F 4IYQA 1EHWA 1U1RA 2VUGA 3VZHA 3KLGB 5AE2A 2JEFA 1RT3B 1RZMA 1VQ9S 2CIMA 2QSFA 3EGNA 1BWVA 4RBUA 2BKOA 3Q89A 4BWMA 3NNHA 2IM0A 2K06A 3W60A 5C2GA 1JLBB 3M7VA 3OJSA 1XNRJ 3HO1A 1WWHA 1TMMA 5K8OA 3IRWP 3CJSA 4KE5A 4ZPBA 3SCLE 2B4PA 3TAMA 5ETVA 4OZYA 3V6DB 1DZ5A 3DGVA 4F25A 2RSQA 3QNWB 3SQVA 1Q53A 2EFVA 1WEYA 2ZH1A 1GQ8A 1RT1A 2FJBB 3MD1A 1VI7A 4X64J 3CF5Q 1M5PC 1F6TA 2VJVA 4ECQA 3M8YA 5CZXA 1FF2A 3WWGA 1MN7A 4UZCA 2FJXA 1TL7A 4A47A 2M5YA 2VBWA 4MK7A 2HFUA 4JI3J 1JTAA 4CH1A 2W01A 4YZ0A 3D1HA 2ZHBA 3VSUA 2F5GA 3TI0A 2B4OA 4OZZA 2VU5A 3WBZA 4C8OA 1I51B 5ETPA 2H51B 1O51A 4WYLA 3GJSB 1VC0A 2HBZB 3OPKA 4W4MA 1WF1A 1XMQF 2NTBA 2MZ1A 1B0PA 1FVQA 3PNIA 2W2NP 3AXKA 3G8SA 4TVAB 4ECWA 4N56A 1W2BR 3OVAA 1BGXT 2NQPA 3ILJA 5FIIA 1KR4A 3M30A 3FDSA 2EBEA 4Y6IA 1QJHA 1VRUA 2HFVA 2Z2ZA 5IC4B 3W9HA 3QIPB 3KLGA 4RKUC 2OELA 3DCAA 2IFXA 5BYRA 4U7UD 2RDJA 1RWXB 1WHYA 2QMWA 5KFQA 3AQOA 3MI7X 3CCSS 1TL3B 4ZPAA 2G2YA 3G8QA 1R89A 3M9NB 1EJ7L 1WD6A 4TYAA 2IA6A 4WE1B 2HHUA 3OXGA 3TO8A 3LP1B 4DN9A 3FEZA 4Q45A 1URNA 1JLEA 3FSYA 3HJVA 2VZ9A 1YRUA 1HR0J 4IH6A 1FXDA 2JFKA 3CIMA 1QA2A 4C8ZA 1RT1B 2R8HA 4BC9A 4YY3F 4ID8A 3G86A 3T5KA 1OYEA 1LFPA 3U1LA 5EWGA 2FHJA 3MMBB 1K47A 1SUQA 3JTOA 1IQTA 2MB0B 3KK1B 1DJ0A 2NPIA 1IJFB 2V69A 5K8PA 4C8KA 5D8HB 4DV1F 3SI8A 4WTYA 1IDJA 2YKAA 4C97A 2I2YA 4KKOB 2GVZB 3MFHA 2LVWA 3SQGB 3DDKA 2ZM6F 4PG7A 2KHDA 2ZC4A 5DM6Q 3J7YU 4ZVOB 1XMQJ 1OYDA 2JLFA 1M1KT 3CDAA 3F73A 4YR3A 2WOMA 1SB6A 2VJUA 4IRKA 3DLJA 2CJXB 3O8WA 2AGQA 3J80Y 1C2PA 4ANEA 1LW0B 5F9NA 3BO3A 4K4UA 1S1UB 1HQEA 3HHLB 2AYMA 2R2TA 5F0UA 3T41A 2HG4A 2Y1JA 3LAKA 4X62F 2VFOA 3AA8A 3HFVA 1RP5A 2CPXA 4QYRA 1H98A 1WHWA 5CH7B 3Q24A 3VGVA 1S4FA 5F8HA 4I7FA 5JVGQ 4PWWA 1UEUA 4RW7B 2M70A 4DR2F 1JK9B 1S9FA 4DL0C 2CNOB 3GONA 3HFKA 2C2KB 1IBLJ 2QL7B 3IM9A 1UVKA 2JEIA 2YKQA 1VJQA 1GXUA 3CC2S 1VRQC 5DRKA 2BSPA 2IVYA 3CO9A 3OR2A 3SCKE 1SJFA 1B3TA 2CJKA 3C3LA 1FJGF 2ZC3A 2R3VA 2V8GA 4IG3A 1M0SA 2GVDA 2DXDA 3QO9B 2ZH3A 3DMJA 4I1TA 2XLJA 3MEDA 2CQIA 1Q78A 2XY5A 3RBZA 2OEKA 4YEJA 2VFMA 4N47A 4ELUA 1CBKA 2DHXA 3V2UC 2DNHA 1K5CA 4QWEA 2OAUA 3UD3P 1PBUA 2CQGA 1Q8BA 3W9IA 2CFXA 4CM2A 4I6WA 1NH7A 2OPSA 4KTQA 2X3DA 2JVRA 3CUNA 1K4ZA 2Z30B 1GK8A 1RAFB 4OJ6A 3I55S 3NAHA 1RYSA 4DZ6A 2K7JA 2XZTB 4ED3A 2ILZA 1BC6A 1O88A 1XG2A 1TUWA 4WPAA 3R5JB 3THVA 1SIZA 1ELOA 4DSKA 3VAMA 1NZAA 1PKUA 3TVKA 4ZCMA 1I6JA 1G1XA 4O44A 3EQNA 1A0OB 1U25A 2MPUA 4ZIVA 1AFJA 4LRCA 2N3OA 4EYHB 4ED5A 3KDOA 1IBMJ 2IA0A 3M4XA 5KAKA 2KB2A 3N6LA 4E98A 3K5PA 3OR1A 2NYIA 1RHQB 1NK9A 1C1BA 2BM0A 5KFJA 1DTQB 1MMLA 2HW3A 3IN5A 2KZZA 1KQSR 4ZLNA 4J9RA 2A1BA 4B3MF 2QLFB 3DGPB 3M32A 2JC0A 3UDEA 8AT1B 2ZJQQ 1S0OA 2M8DB 2J9DE 2XMJA 3JXOA 1GX5A 4PG6A 1MWZA 4GVLA 4WK1A 3M8ZA 1RABB 3HSDA 1XMBA 4TLRA 4YB6A 4EWTA 4URRA 3H59A 1VDHA 4L3KA 3P3DA 4BLGA 1VQLS 1AIRA 1FRMA 5B0CA 1I3OB 4AXJA 1FD8A 2E5JA 2ZZNA 3MEDB 3KJVA 1HWIA 5E41A 4M5JA 2KT5A 2Z0GA 3CXCR 4ZHRA 3EGZA 2HZAA 4I68A 4A8OA 2B43A 2VPYB 3SFUA 2C3UA 2DEJA 4DSFA 1WG4A 1F0XA 2W9CA 4GKJF 4XKWA 1DURA 4IRDA 4OYWA 4CNZA 5IV3A 4F36A 1N6QB 1ZA2B 1QVGR 1IWGA 3KHGA 2PA3A 3QMQA 5LXRA 3HP6A 1JKHB 3W7BA 5B0DA 4XPCA 4UW2A 3T19A 3OTOJ 3RBDA 1MW7A 1R0CB 2K7KA 3ZZOA 2AGOA 4FYVB 1UW4A 5J1PA 1LW2B 2LCWA 5DG9A 3K57A 4XKVA 4FXWA 4O44B 1NHVA 4LBIA 1S6PB 4PUOA 2DGOA 4I0WA 4J7CA 2PDAA 3NOGA 5K8MA 5KFRA 3P5TL 4CDIA 5B7WA 2IJRA 1MN9A 1OGMX 3PR5B 2XYGB 2LU2A 3D1QA 1VQYA 4USUA 4HI2A 4ZPCA 5HSPA 1TL7B 4AFFA 2WK4A 4WP3A 3A8KA 3D68A 3D28A 2W2PP 5E2QA 3QPIA 4EBEA 3J7YI 1UA0A 1DQAA 3GJTB 1TTHB 1T02A 3IR5B 1TUGB 3V6KA 3VMWA 4QR0A 3J7A1 3ETOA 1C0TB 2ZDOA 3CCZA 3DLKA 4NCGA 4USKA 3OL6A 4J9PA 4LFBJ 1T95A 5KFPA 1JJ4A 3R1HA 4IFVA 4LSLA 1JX4A 4WXWA 5B08A 1SI9A 2VD3A 2NSCA 1P8GA 2BJ8A 2LQ8A 5E33A 4CLLA 3NMAA 2OLWA 5EHHA 2XMAA 1PBAA 2QZ8A 3UD5A 4PQUB 5IM0A 1CJUA 4EK2A 5DLGA 3OL8A 5HP1A 1TL1A 3H4DA 3DLHA 2OI2A 4K8RA 2WHOA 4K4ZA 2E66A 2ZFHA 2W9CB 2V4JB 2IYGA 1RA7A 4XLCA 2L9DA 1HWLA 2VBKA 1TL3A 2EG2A 4ZVUB 2IVFB 5AJ3F 3DOMA 1R8BA 2VDHA 4OYIA 4HI1A 1FEHA 1J5EJ 2ZOFA 4JI1J 5L9NA 2AP6A 2VFSA 4OZ1A 2BRLA 4OQJA 2F40A 5HVGA 1K44A 4B9MA 3CDEA 4XOPA 1UWBA 2CQ1A 3DDNA 2B56A 1NDPA 3P6YC 4MXNA 1RWVB 4ICLA 5E3PA 2R7OA 2UVVA 2BX6A 4R25A 5JLVC 1S57A 4USIA 3Q0AA 2UXCF 4ERDA 1Q79A 4DV3F 1YJWS 1RHUB 5GAHI 3CCLS 3MMBA 3I9ZA 1PIEA 4XN3A 1HNVB 2JNJA 2FYXA 3MM6A 2GA7A 1RK8A 4QW9A 3G4SS 2MEWA 1HMVB 1NK5A 2B9XA 1QE1B 3KTQA 4NX9A 3K0JA 3H20A 4X4VA 3AJ1A 1SH0A 2HFZA 4A48A 5L1LA 4IQXA 1LXNA 4HWVA 5LT5A 3D4JA 3HMJG 4CO4A 3A3OB 3E2EA 3PRBA 3FK4A 2Z8GA 3KJQB 4DX5A 1TFYA 3EZUA 2HFOA 3KUHA 2DCLA 4DR6F 1TK5A 2GMJA 4MIAA 2DVIA 1CLWA 1R8PA 2X6YA 2ZE2B 3TUJC 2G2ZA 3GCXP 3X3UA 4MAKA 3OV7A 1KOOA 2NXUA 3BF4A 4QQBA 1HFEL 1IBMF 2BE9B 4J9UE 3T5HA 4MT1A 3AA9A 3M8PB 2MTLA 2HPUA 3DOLA 3IR7B 5KG0A 3QWPA 1NO8A 2V4JA 3EVMA 4OHZA 3GPAA 4A4JA 1GXTA 4YHHF 5J2QA 4JUZA 4DPYA 4C3LA 4ZPDA 4MIBA 3GV8B 2CNNB 2E1PA 4KGKA 5F8GA 2C3OA 3CWJA 3LPEA 5C1CA 2P6SA 4LRFA 2BM4A 1WHVA 3TRGA 4MTPA 4F4AA 3PFEA 4A8MP 5KT3A 2ZITA 1PJ5A 4I2QB 1XMOJ 4WP8A 2IRYA 3GFYA 5G0RA 2ZNYA 4DL6A 3W3SA 2RU3A 3CB4A 2W7AA 3GFHA 2LA6A 2YNHA 3P5BP 2FJDB 5F8NA 3ZFVA 2QYCA 4RR5A 2F63A 3AB2B 4OIXA 2GJ2A 1KOHA 1YWXA 2NUUG 4RUAA 1HNVA 4TXSA 4H4OA 2EK6A 1RTJA 3LPYA 4GMKA 4RBVA 4UOFA 3Q8QB 2DGTA 4DV5F 1YI2S 2E1CA 3BGRA 2IJNA 4DEZA 2EC0A 2FVPA 4KJIA 3SV3A 4NLUA 3P4GA 4RU9A 1X0CA 4ED8A 2ZH8A 3SIPB 4DZDA 1BHNA 1IBKF 2DH8A 3D3BJ 4I64A 1ACMB 2RS8A 2UUTA 2E9ZA 1N34F 1RBAA 3I96A 3H5XA 1PJ7A 3QIPA 2XS7A 2DHHA 3DDIA 4HVZA 5HVHA 3J81U 1RKIA 2E5LJ 2GC8A 4X2BA 5ETOA 2J6UA 4WIQA 3R6GB 2QA2A 1IUJA 3KJFB 4ZVEA 3E3XA 3AQPA 2C22A 4Q5VA 2XULA 3BYPA 1R0AB 4HH0A 3RRGA 1T9XA 4DR4F 2X1AA 1SJRA 3PG9A 2KXFA 4FF3A 2ASLA 2R7VA 3O44A 4KFBA 2CDRB 2MZTA 1B0TA 4YHHJ 1DHMA 2CAJA 2W2MP 4WCEQ 3KLFA 2L48A 2YBVA 1VFJA 2MLXA 1WC4A 1SJQA 2K2PA 2OPPB 3EXCX 4ZOSA 3KLEA 2OH2A 5IQQA 4DPUA 2XZDB 1NSKL 3BGFA 3S6EA 2FUG9 4FYXB 3WDOA 3SDEB 3QT6A 5HROB 1KBRA 2BM1A 4CLKA 4URGA 2BQUA 3J7AN 3R2DJ 3FSXA 2EVZA 3Q2TC 1HNZJ 1VS3A 1RGVA 3D0GE 3E51A 4X4SA 3EQOA 3MTKA 1RWPB 4ZVRB 5HLFA 2C3MA 1KCDA 6AT1B 1SL2A 2UP1A 4AVZA 4U8VA 2UUCF 2HS4A 3QQCD 4CZCA 2NZ4A 4DV2F 1TAUA 5H9EJ 1S1TA 1GMWA 4B17A 3BO4A 1ZM2A 1OQ3A 2FC9A 1GEHA 4TY8B 1JLCA 5A2QU 1B0VA 1FFSB 1VQMS 1FDNA 2QTWA 4DLGA 1CG2A 3IC1A 2PSZA 3LP0B 3OT9A 4NLXA 4NLQA 4YEAA 2KXHA 4KO0B 5ETSA 4ES3A 5H1SV 3KLVA 3TNVA 2KH9A 2QFJA 4OX9J 3VMVA 2EFOA 5CYMA 2MKYA 4I7FB 2WVEA 4ZCKA 5HANA 2FHJD 1H2VZ 2BW7A 2WAQD 1YQHA 1FFWB 3GR1A 4YZAA 1IWAA 4M5NA 4OI3A 4EGLA 5DDPC 5CXTA 4GKKJ 3CTRA 1A9NB 1JJ2R 4JBCA 3MZIA 5DGAA 2ADCA 3MCMA 3HVRA 2OD6A 3DU1X 2E1RA 3VZIA 2BMBA 2MQMA 2OEJA 3FJ2A 2J8SA 2RE1A 4WU2A 1P6TA 3GYXB 4J9SA 4MIWA 4OI1A 2YPZA 4J9MA 4DV7J 5AXLA 3QO9A 1VQKS 2GHWA 1JLEB 4N41A 4DX7A 2OPQB 4I56A 4LT6A 4ED4A 1JNZB 4OJ1A 4O3OA 5KG1A 1U47A 4B3MJ 3RR8A 2NR0A 4DR6J 1SIWB 1T9UA 4KH0B 4ZJOA 3U27A 3LO3A 1X9WA 3N90A 3LP2B 1SUQB 2H3EB 3HVWA 1B99A 3Q8VA 3G6YA 1VYAA 2MQNA 1TKXA 1AROP 4W90B 3BV8A 5K14B 2MQLA 4C6AA 5F3ZA 2EPIA 4C0HA 4YDXA 1HNWJ 2XNQA 3D0IE 2PIIA 2FZKB 4A8SA 1JLCB 3AHPA 1V5IB 2CG4A 2SXLA 1LM1A 3CDBA 3K8VA 2DISA 2CQHA 2QLWA 3C16B 3LQVA 4IFYB 2N82B 5I42B 4FN5A 2MXYA 3KHHA 2C2ZB 1WORA 3AOAA 3O6QA 3JB9k 1YJNS 4F2RA 2DRAA 4UUXA 3DXSX 1FDBA 2Z2LA 2XLIA 2FGOA 3Q22A 2DO0A 3PVXA 3H0PA 1L5UA 1HNXF 3C19A 4NLVA 2YNGB 2WSFC 3S1TA 4DG1B 5A0YB 1RLDA 1ZPVA 5CCLA 2VIHA 3VV2B 4PYAA 4EBDA 4W8TA 3IR6B 4RW4B 1EKSA 3PIPQ 2FLLA 2BA9A 2QJ3A 2YQ1A 3M2UB 2NSTA 3PSZA 1BUXA 3M32B 2ACMA 1KHWA 1WHXA 1EZZB 3TUIC 3G6VA 3LF0A 2ZBCA 2W7ZA 1NSQA 3THTA 4ZIWA 3B54A 2PMWA 5HN0A 2J8KA 3GILA 3MTJA 2OEMA 2H1YA 3OXLA 1SJ4P 1SCJB 1S1VA 1V6HA 1I94J 1RLCL 1YBAA 2R7RA 1QA1A 5EX0A 4PABA 5ETTA 2XI3A 1AW0A 3M2RA 4FYYB 4KR0B 5B0GA 4X4TA 4RJVA 3JYTA 3QT5A 2LQ9A 2YKNB 1UVIA 2LKZA 1Q86T 1G7CB 2XQCA 2WVCA 1VLOA 2MZRA 4QIWD 1FRIA 3T9GA 3TOQA 2GW8A 3C15A 4NLSA 4LF7J 5J2NA 4FF1A 2C3PA 3BKFA 3ZC4A 4IQMA 3T6BA 1K73T 3L4BC 2INVA 1T9TA 4HLBA 1IKYB 2R8GA 2J8IA 4M5DB 3DRRA 2V9WA 1VK3A 3QFHA 4XTTA 1F5CA 1QAJA 1NEEA 1XIQA 3DLBA 4OLOA 2UVFA 3JQKA 5EUHA 5AE3A 4NI2A 2ODLA 2MSTA 4WBFA 3GIJA 1HR0F 1IVZA 1MU2A 5I42A 3J81j 3H4BA 3NOCA 1TK8A 2B4UA 4RL1A 1HWUA 2B7BB 1GH8A 2OGUA 1E6VB 2JC1A 3SQOP 5E3AA 1N8RT 4KPYA 4OM9A 2X6XA 1HWKA 4KPCA 2XSFA 2UXDF 1AB8A 4LBHA 2LEAA 4JI1F 3MPUB 1SL1A 1CC7A 4QCLA 1T9WA 2F8HA 4AL5A 1T05A 1N54B 1FWPA 1N0UA 4CYUA 5GAGU 4CTAB 2E5IA 1BMQB 3Q8RB 1YVFA 2RQMA 3PFOA 3D9BA 1MWQA 2KYZA 3ZZZA 2GIFA 2AV5A 4PEOA 2AD9A 3TJAA 2V8VA 4MKYA 1MROA 2YQ3A 1B64A 5FLXY 4N5SA 1S1VB 1F60B 4DV3J 3L7UA 4JYAJ 3NCRA 2ATCB 1SKUB 5D15A 2R42A 3NAIA 1A7GE 1U1QA 2M52A 5LMUF 3KLIA 2CPEA 4ZVGA 4DV1J 2CWXA 3WX4A 1F9EB 5EWFA 5IQ6A 5KOWA 3EPIA 3O1LA 2YKNA 1RSCA 4S0MA 2VBMA 1RT6B 1OY8A 1U7LA 4U96A 2ROGA 5I3UB 3BM7A 2E7VA 4LF7F 1PYOB 3FY3A 3HHLC 3PX6A 1VLYA 3GMGA 3R27A 2W4CA 3OVSA 4XO0A 2IVMA 1RT4A 3PEHA 1J2VA 3UVJA 1FK9A 1LKZA 2OHDA 3BBFA 2DIVA 3Q2SC 4OHVA 3UCGA 2HYIB 4Q43A 2FZGB 1TYXA 2E1MC 2VB6A 2IRXA 3IGVA 4RW8A 4HYKA 3WZ0A 1RQ0A 4CT8A 4NI2B 3TJ9A 3QJLA 4M95A 2HIYA 1PAEX 4KT0C 1MU2B 2N7CA 3C46A 2AKWB 3FC9A 2F7VA 1QLNA 4P7TA 1RHKB 2IRUA 3I4PA 3PM9A 2EFNA 1X4GA 3OUYA 3V81B 1NNDA 2H4YB 2IDLA 2XMVA 1N56A 2VFRA 3BH7B 4OX7A 1H73A 3I0SA 3M8RA 4XLAA 2Q79A 3WIUA 4Y0FA 2I0XA 4O3SA 1HYSB 4GC7A 3R5GA 2IBOA 4DFMA 4Y2AA 2E9TA 1RWUA 3CJ0A 2ZVIA 1L3SA 1HHQA 2RAQA 4LUBA 4I84A 4NEYA 1MLAA 1HI8A 2IHR1 3SZ2A 2DRBA 3UO0A 3IS9B 2VFVA 3AD9C 2D7SA 1UA1A 5KG2A 3R3TA 3WHIA 2NSBA 3MF5A 1WKLA 3UN2A 5L9XA 3H2LA 4CO3A 2CPYA 2DHGA 2HQDA 2LFVA 2OKQA 3C6UA 3LW5C 4L6V3 4QR2A 2VC0A 3MM9A 4OX8A 4X4OA 3MEGA 1EB0A 3BO2A 2VG7A 3RUBL 3V4MA 1RDRA 2BUNA 4WP9A 4JI3F 2GIQA 1RT5B 1EX8A 2NXJA 2IBKA 4IOCQ 5I3QA 4JI5F 2J0WA 1PO6A 4UY85 2XCAA 3QZ8A 2CNKB 1RTZA 1NH8A 3KWMA 2ZH2A 1WXRA 1IR0A 1FWKA 3DRYA 5HMXA 1UETA 3T1YF 4BBYA 2ZKUA 3RR7A 1X5SA 4DR4J 2F9JA 2CNLB 2DNGA 3CCMS 5CHCB 1KFSA 2HBYB 4A8KA 1ZTWA 1WSRA 2VG6B 2O5DA 1DFDA 3V81A 5T14A 4FYWB 1R3NA 3SSRA 3GFXA 5KG5A 4N8OA 3MM8B 5BJRA 3A13A 3N5FA 2JSXA 4O3PA 2GNKA 2QA4S 4CQ1A 5GVQA 2CADA 2ZOMA 2VFPA 2PA8D 1UP1A 4C7QA 1XR6A 3FCWA 1UL3A 3MM5B 4TU9A 3CCRS 1HMVA 2BR0A 3KMQA 1QE1A 2XZWA 2KZMA 2APOA 3GV7B 2PMHA 3I56S 2VJJA 5C7PA 1Q7YT 1J5OB 3CJQA 1PYTA 4P10A 2MHEA 5C1EA 3GWCA 2OIHA 3L7PA 3DRSA 5F41A 1RKJA 2KFNA 1K8FA 1H74A 4QOTA 1M5HA 2ZJPQ 2ZHAA 1UVJA 1L3TA 2G9OA 3RAXA 1XJWB 4DXLA 4NL5A 2H54B 4Q0BA 2W9BA 3HKZD 3B90A 1UJ6A 1QQ1A 5EDWA 3DLEB 2LDIA 3K7RA 2YWKA 2HQGA 3CGIA 2BV3A 4LF2A 4N7TA 4RNMA 2YNGA 2VG7B 5A0YA 5D3GA 1EZGA 3TA0A 4Y00A 2MKHA 2XBPA 3AY0A 5A6WA 3US5A 4DSEA 4ED0A 4DQPA 1S7HA 2R7WA 3TX0A 5LXYA 3W63A 2V63A 1NCLA 1Y3KA 1JXEA 5D6GA 4P9SA 4RNNA 1CJTB 4UY8T 4B3SJ 3QRRA 4OZNA 1G3OA 3GLJA 3MECA 4Y3CA 4ZLJA 1I1GA 1TSPA 4O4GB 4DV0F 3U1NA 4P2MA 1QCXA 3X1LB 4YFOA 3D2WA 2KTQA 5DDQC 3RYLA 1VC6A 3LYCA 1SQFA 3VQSA 1O8KA 2E9RX 3W2VA 1R7IA 5BR8J 3TX8A 1WSVA 4W98A 2V8PA 3IBFB 1DTTB 5HLFB 2HHXA 4EEYA 1YZ6A 2OSRA 2ZHOA 2Y0BB 1KQFB 4MFBA 1S1TB 4QPTA 2HRTA 1E6YB 2V2QA 3F0NA 1S1XA 3C15B 4Z2XA 3DOKB 3HVTA 1O0PA 1CULA 4H4OB 3NLCA 3CMQA 4XLEA 1RCOB 2IM3A 4ZCLA 2J6SA 1CPZA 2FZCB 2HHSA 2XHCA 3RB3A 2ASDA 2FD2A 4AT1B 1DQ9A 3CCTA 1RAJA 4LVNP 3TUZC 3OHBA 5L1JA 2XG8A 3VAHA 4DU8A 4YC5A 2HLUA 1F9HA 1YBUA 2MZJA 1O8FA 3AOBA 1KQGB 3DRPA 4ENOA 2FVQA 2U1AA 1FO1A 3LGMA 4TQRA 4ITSA 2DPIA 2NSPA 2M2BA 4FXVA 4R8UA 4J9LA 2XT2A 3OBIA 4JI4F 1S1WB 2UVEA 1TR0A 2WONA 3DXBA 4KRWA 2V5HG 5J1EA 1APSA 1Q5YA 4OZ2A 2AX1A 1EARA 1HPZB 2GIRA 4Q2LA 4PXCA 4K0KJ 1H80A 1X4EA 4ILLA 3T1AA 9ATCB 5F8LA 3EUNA 3GJQB 3HZGA 3AJ2A 2BM5A 3QT7A 5DQIA 4B3SF 4U49A 2E5GA 2LQBA 2KKHA 4GC6A 1HD0A 2EFQA 1TU0B 3HT0A 4HL9A 2RVJA 4O4GA 1CVJA 2WVFA 2V50A 2XO6A 4DL5A 1URRA 1C1CB 2BANB 5IWAJ 3EYZA 2X3HA 4BDPA 3OJUA 2FVRA 1BQMA 1MG7A 1O8LA 3D0HE 4JI2F 5GMKa 4DPXA 4AQYF 1NJIT 2JWNA 2G1DA 3DKDA 2F9DA 3EGVA 4O3QA 2B5JA 2HFSA 4USVA 2VICA 4AXIA 4QZVB 2HNYA 3PY8A 1BLUA 2MDAA 3HDSA 1LLWA 1S9GB 1T0TV 1WELA 4GO5X 2PECA 2E7WA 1YRTA 1E6YA 4KAIA 1PE9A 3R7BB 3W66A 2LQ5A 4I2PB 2XM3A 4TY9A 2C2OB 2I5JB 3NMRA 2KHCA 1RTIB 4J5OA 4C98A 4IFYA 1NLKL 3ENVA 2AX0A 4OZ0A 2JLGA 5A8WB 2UUWA 4ECVA 3T1YJ 5L1IA 3UVJB 4Z7YA 5KG6A 1TZ0A 3EPGA 3HLUA 1HW8A 4DR5J 3LH2S 2R2SA 1QTMA 3TZWA 2RU9A 4IH7A 1O8IA 1X7VA 3UN5A 2CQ4A 4DCPB 3QIDA 4CO2A 2W8LA 4LF9J 4YOEA 1NKEA 1LWXA 3AFGA 4L3NA 4ZHRB 3CCVS 2JHEA 3VQTA 3K5NA 4ZP8A 1HBMA 1S0MA 2ZBIA 4XOTA 4RUBA 2BACA 1GT8A 4ZP6A 5HAOA 2YXLA 2XSJB 5L38A 5KT4A 1XNRF 1C4CA 1K1QA 2B3TB 2KVIA 2ZUGA 2MGZA 1FTCA 1K1SA 2AHOB 3DYAA 1IKVA 1JKHA 2G4BA 2KJVA 4CLPA 3OTOF 2JX2A 1CEZA 2EBGA 3WC0A 4PCQA 4RW9B 1N36J 1X5PA 1X0PA 2B0GA 3BQ0A 2FGCA 2BE2B 2I9SA 3JSBA 3H7HB 4ECZA 3T3FA 4H54A 2D3UA 2RHQB 2Y1LB 3LAMA 7FD1A 2AT1B 3M8QB 4JI2J 3ZPPA 4P2FA 2VC1A 3J80U 2YX1A 5CD4H 1RJJA 1UJ4A 2KRRA 4L73A 3Q23A 4KB7A 2D3OR 2YNFB 2UUAF 1UKUA 2D41A 4OJGA 4LRBA 2VA3A 3B6BA 2NZMA 3MM9B 4GVBB 2HKEA 1KTQA 2GMLA 3MEGB 3QYYA 3Q8PB 2RHSB 8ATCB 3NXZA 1ZM3A 2HVHA 3PHTA 3EVOA 5A6PA 2IY5B 2R2RA 2ZH7A 3T5LA 3RW7A 2YNIA 3KRGA 2NT9A 5KFWA 3HZEA 2AJ4A 2UUBF 1IM4A 1C0TA 3QGHA 1QD1A 4B9VA 1TK0A 1KN6A 3PW2A 4USHA 5BYSA 2DGWA 2LA4A 4DU7A 3R1LA 4CM0A 4P75A 4TNOA 4O0NA 3PW0A 1WKKA 1H72C 3GTYX 4EU0A 2UVWA 5T7LA 4YMEA 5DQHA 2ZBQA 1HNIA 5HJYA 2H48B 3R9LA 5HP1B 4CTAA 2QN6B 1O8EA 2AJQA 2CA9A 2F65A 4ALZA 4LFBF 4L76A 4WFNQ 3M1VB 4HT7A 1OOCA 1LWEB 2DXEA 4QWBA 5HATA 5HBMA 2QMUB 4F8RA 3GQAA 2LECA 2OFGX 1EAYC 3NGRA 2MKIA 2YWHA 5D0GA 3RB6A 4KY3A 4KGMA 2WCXA 3FBFA 3HD2A 3VTIA 2GMHA 2HRYA 3GG1A 4Y65A 3UW0A 2O1PA 4LSNA 5D4NA 4F0MA 4DLEA 1SC4B 3PO4A 1WI6A 4KBIA 5AMVA 5EWEA 5I3UA 4DN0A 2LEBA 4B02A 2UXCJ 4DUYJ 4PG4A 4NK6A 2QE5A 2W24A 3CCJS 2W9BB 4DL7A 4RUCA 2CVEA 9RUBA 3IWNC 1U6ZA 4YZXA 1ZM9A 2V6AA 2VFUA 4B9NA 2CPHA 3M6UA 4DSLA 1OS5A 5L8RC 3TEGA 2VPXB 2XMUA 1VQNS 3RBEA 4XNFA 2ASYA 2ZM6J 2VPZB 1LOUA 2RRNA 3W5YA 1F2GA 3DU5A 4NA3A 1KTWA 1QAYA 1CS4A 5H9FJ 5K9FA 3ZZTA 4R5PB 3MAQA 2OPRB 4YP3A 1SXLA 3BDEA 4HTIA 2BYCA 3R8YA 1N32J 3VALA 2WTFA 2XO7A 4B3TF 4C8YA 4Z03A 1NHCA 1P1TA 2MZQA 1YGYA 1CJKA 3SCIE 1UVMA 3BSCA 1WC1A 2EFPA 2IPOB 3PYDA 2DNLA 4UQTA 3GG0A 4WWSA 1OSDA 4F3OA 1LWEA 2HIQA 5HBMB 4DR2J 5J2QB 2V2ZA 1S1XB 2O6WA 1ZAVA 2JH3A 2JZ5A 1T05B 1FKAF 3ILIA 3AK5A 1IKWB 2BJ1A 3NGKA 1N48A 3R5DA 5K5MA 4LF5F 3OL9A 2NS1B 2L41A 2GO8A 3TEHB 2KG1A 4DR5F 2Z8QA 3LOUA 4M5IA 3NGTA 4ECYA 2W2QP 1U1NA 4V02C 1IDKA 5AXMA 3VF0B 4U8YA 1FNOA 5C25A 2X1FA 1VQPS 4RWXA 1UEVA 2Z4PA 5C5JA 5C24A 4DUYF 1M1HA 2FVSA 4YDDB 1PGZA 2P5VA 1IXKA 1P27B 2HWTA 2W2OP 3CE8A 1EA0A 4NLDA 3H98A 4JV0A 5J1EB 2CPFA 2N7YA 1EETB 1HPZA 1WDDA 4OI4A 2XWYA 1KS2A 2G13A 5DGBA 1NJXA 4UOHA 1SKSA 3R7SB 3QAUA 2GAHC 1NHKL 1PJ6A 4NMXA 2DTJA 2ZWPA 4RW8B 4YEIA 1RWKB 4CH7A 1IBKJ 1VQ5S 4FF4A 2C2NA 2HHTA 1Q4RA 1TVRA 4DS5A 3W61A 2JOQA 4LIRA 2PD1A 4FPIA 2VJIA 2EK1A 1H2TZ 3AAWB 3O5TB 4PR6A 1WOOA 3D6HB 3MD3A 1JWWA 1S59A 3EVWA 5HMYA 3NL0A 1ZM4A 2DNPA 3ZNJ1 3ZNUA 1RWWB 1FKOA 2CXEA 3HHLD 3QFWA 1RE1B 3I0SB 3EM1A 1OFEA 1YZ7A 4G1QA 3UWTA 1AA1B 2HNDA 4OYAA 4CNYA 1YDLA 5GAHU 1VBZA 2R4FA 4AUKA 1SC3B 2HNYB 2MHNA 3Q83A 4KFBB 2RQCA 2WSCC 3H40A 3PZPA 1J5OA 2PGCA 4Q8FA 2Z2MA 1KVKA 3GV5B 4LFCF 3DRSB 4LJMA 3A1YG 4RW7A 2KFYA 3G9CA 3I5BA 3MEKA 1WF0A 1H2UX 1PCAA 2HGLA 1Y5NB 2AEFA 3LTOA 4HTJA 3UDVA 3J7ZT 5I3PA 3SDEA 2B9WA 4QIFA 2HMIB 1Z4UA 2P8IA 4FBTA 1BHEA 3OR2B 1WNEA 3KK2B 4LR9A 3HKWA 3S7RA 3TA2A 2E5HA 2IC3A 1HF2A 1ZOTA 5M2PA 2MQQA 1Q95G 2UUCJ 4YCQA 3E8OA 1TFWA 5KT2A 1W7WA 1UMJA 2J0QD 2QEXS 1OFDA 4EI2A 5IFMA 5A8KB 4K4SA 3FCVA 2UU9F 2R7QA 2JDJA 1UEKA 4DR3J 1QA3A 2K8GA 2BKPA 4NLPA 1FRKA 4XAKA 5ETKA 1O5JA 2M3DA 3MMAB 6FDRA 3BS9A 2CZ9A 3UCUP 3BN4A 2QIFA 3UQSA 2V9KA 5D0RA 5GMDA 5HMWA 2QG9B 4CCHA 2PFFB 1VRUB 2D74B 4RUHA 1X9MA 3A3NB 4LQ3A 2KDOA 1HBOA 1LK7A 2ROPA 4ZVPB 3HHNB 2VG5A 4CO0A 1RHMB 3CNQP 3QLHB 3DOKA 3HVTB 4HT5A 4A8WA 2FLPA 2DNNA 2DBBA 1NM2A 3GP9A 2B4VA 3OR1B 2EFGA 2MJUA 4BWJA 1KC8T 4QR1A 3EICA 1LNQA 4UT4A 4J9NA 1S9EA 3W9JA 2FLOA 1AZSA 5BXIA 4NOHA 4X65J 3Q86A 2Q43A 4R0JA 2J7UA 5JMCB 3ZZRA 4QPXA 3KMSA 1BN8A 3PETA 4LRAA 2OPQA 4N8NA 2HQFA 4NE9C 4F50A 2RMLA 2E29A 2IAJB 2WSEC 3C6TB 1S5ZA 3HHEA 1NB2A 4D3HA 1FDDA 1U1OA 4IR1A 3ZZPA 2PYGA 3L95X 2XTWA 4LQ9A 4URQU 4XPEA 2VL1A 3DNCA 1N32F 4FBUA 1JJCB 2DGUA 4B3TJ 2GQ2A 2L3MA 3I87A 2DHAA 1FJGJ 2BXJA 3POTA 3RBXA 2QRRA 4C9DA 3CCUS 4F2SA 1R8AA 2CQBA 3K5OA 2UU9J 3BDPA 2RRBA 1X4CA 1KLMB 3KFWX 4DR3F 1VJWA 2HK2A 3WIVA 3CSKA 3PW5A 5KFBA 2ASJA 4B9LA 1SKWA 1VIOA 1S6QB 2FIUA 4LF1A 4ZKAA 3IAM9 3CVKA 3MFIA 3VAGA 5KFYA 1JLFA 4K4TA 3FZBA 2VPWB 4F26A 4LSZB 1X5OA 1T03B 2ALZA 2LYVA 2ADBA 4K7QA 3CCES 4M1KA 1KKHA 2B0RA 1V3ZA 3J81Y 3D54A 4ER8A 3CJRA 1TUVA 1F3VA 1FKPA 1Y10A 5ETRA 1QSSA 4XQFA 1UJ5A 3W5ZA 1PAUB 4K5SA 2X1GA 5A8RA 4ES1A 1XC9A 3JSYA 4GO7X 4MYUA 3H5YA 3MGJA 2J0SD 2DH7A 3DLGA 2CPJA 1JLGA 2U2FA 3CW2C 4FS2A 1U1LA 3BKTA 3I32A 3ONQA 1A6LA 3LP1A 3CC7S 1BWEA 5E5NA 5DQGA 2IAJA 3LGHA 3FCHA 1NZ8A 4K5RA 2D3ZA 4P6QA 4ES2A 1FHTA 4DFKA 4PPDA 1RT3A 1YTYA 1UPMB 2OO4A 4IRCA 4NYPA 5J2NB 3ZTRA 4XMYA 4OI0A 4HHUA 3UW1A 3KK1A 2PYHA 1GFWB 3RGIA 5KFUA 3W2WB 2W8KA 2A6OA 2VQFF 2DPJA 2UZAA 3G71S 3ML3A 1J27A 2HVIA 4C0OC 3HVAA 3BEGB 4A8YA 1RU1A 5KFTA 1LFWA 1QUPA 3BB5A 4KKOA 2V67A 2R8IA 4NXMJ 1RI7A 1S6OA 4QYZK 4OJLA 4RW9A 4CH0S 3N6MA 3P8BB 3UN3A 3SCJE 4Z7CA 3OL7A 1GMVA 1T3NA 2GHVC 2UV8G 1ZAWA 3NAWA 2XNRA 1FRHA 3DOMB 4QWAA 3R2CJ 1N33F 3M6XA 2JLEA 5F8IA 1IKWA 2INUA 3IBWA 4X84A 2HS3A 4AYBD 1U09A 3HM9A 2N3LA 1WF2A 1Z2LA 4DQSA 2OJ3A 2ZDPA 3FGVA 1WI8A 2EWEA 3BJYA 2B9YA 1S1UA 4TU8A 1NMEB 1DTQA 1TV6B 3SSQA 2HQCA 2M0GB 4ZITA 2XMTA 1JXLA 4NYZA 3G82B 2PI4A 4WZQA 1JNRB 4U7CA 2RQ4A 4OV6A 2A18A 2IM1A 2RH3A 2RUSA 4OZ3A 2DR5A 3OTCA 2B8PA 1M5OC 4DF8A 1ZTTA 5B0FA 1CJVA 3E01A 1Y7PA 2Z56B 4E0DA 2POKA 2P9GA 3B78A 3OVBA 1U24A 1UTAA 4RNFA 3I0RB 2XTJP 3BZQA 2DGSA 4N77A 3UPFA 4QYZJ 3TZXA 2I1RA 3UR0A 2RF2B 1Q0NA 1IBCB 3CDWA 5J2PB 2QV6A 4I6AA 4K50A 2YWFA 5AXNA 4MH8A 2OTLS 1Q16B 2ZBPA 4G65A 4QU6A 2VFNA 4XLHA 4URSA 5H9FK 4XIUA 3OW2R 1H38A 3LUYA 1PXZA 2QX0A 3CPWR 3BQ2A 1S4EA 3HK2A 3ZZYA 1G6BA 1X4FA 5ETQA 4CO1A 1NK6A 1RB0A 4B9UA 3OFGA 3V4IB 3M8PA 2VQEF 3VHQA 3MXHP 1IKVB 4O3RA 2VODA 4X65F 5AXKA 5HQLA 2LQJA 1FX2A 2HBQB 2HWHA 3M8WA 3V6DA 4NLGA 2ERRA 2V2VA 5E3QA 3B8YA 4ZPVR 1FT8A 1X31C 5IT9Y 4OYBA 1VHFA 3OUYB 5JVHQ 2M8HA 2NREA 2CQ3A 3C8YA 3V6JA 3PJXA 1XQIA 1S76D 2HMIA 2DT9A 1HNZF 3CJ2A 1VQ7S 5G0RB 3QRPA 3ITHB 5D4PA 1B7FA 4CLWA 5K8NA 3LANA 1D9FA 5KFVA 4R0EA 4K4XA 2P6TA 4DBQA 4GVBA 3OTBA 4M5MA 5IV4A 1FJ7A 4OJOA 1S48A 2ZJRQ 4X4UA 1ZPWX 4ILRA 1K8AT 1FE4A 2MMYA 2MLZA 3RB0A 3GR0A 3IS9A 5ADZA 3QZ7A 1VQ8S 1XN9A 2WOMB 2JJ4D 4F4ZA 4ETZA 3TAQA 4CO5A 5IXUA 4F02A 4K0KF 1O8JA 4K2XA 2XT4A 3LMWA 1UFLA 4UQGA 4HACA 1DBOA 4H4MB 5E3CA 4USTA 1GQEA 4ECXA 5BYQA 1D1UA 5IZHA 2B6AA 5DLFA 3HX9A 4WJBA 5E7OB 1K9MT 1D8ZA 4JI5J 2OUGA 3M1VA 3PR4A 1UFKA 3RRKA 3C66A 3HHDA 5GAEI 3TVYA 5KFSA 2GQCA 4U67Q 1XWLA 4ZCIA 1HKAA 1HQ2A 3F56A 4AE5A 1N6QA 1YBTA 4CLTA 4W8RA 2FHKA 4RWWA 4LREA 5THWA 2CQDA 1XR5A 1WEZA 2C2EA 2BEFA 2G0YA 4OJ5A 1PLUA 2P9CA 3OQ2A 4IG3B 3V5RA 1HI0P 2R7UA 1YHQS 1M5KC 4C8MA 2BW2A 5CQGA 2X6WA 1HBUA 3NCQA 1HQUB 1QTNB 4RPFA 4OZJA 1TL4A 2ABYA 1YITS 4IDKB 3EWGA 3GIRA 1Q8LA 4ZVFA 4M5HA 3R97A 4ZLLA 1WKJA 2AGPA 4F0HA 1KLNA 2RT3A 2RNEA 5HVFA 4JI0F 4CT9A 3KG1A 1UAWA 1VMBA 2CJ9A 4P74A 2R7XA 3I9V9 4MJKA 2BABA 2HZCA 3FRYA 1TKZA 3TJ8A 4E2FB 2V4RA 3CIZA 4ZJLA 1YK9A 1TYUA 2DGXA 2EI5A 2GVZA 2RDDA 4NZ7A 1U0HA 4ZS6A 3PKYA 4N76A 1P9YA 1BXNA 1XR7A 2CJBA 3TP2A 2FQQB 1NPPA 4K4YA 4FF2A 3ZTSA 3IP0A 2EKYA 1QRCA 1JQGA 4UTGA 4NXNF 4KO0A 2DCUB 5JUMA 3AXMA 4U6PA 1J5EF 1YJVA 4Z05A 4PQUA 1KONA 7FDRA 1N36F 2UVUA 1KDNA 1PILA 2G1HA 2XEXA 2RQKA 4YY3J 1NRKA 4BHQA 3N6NA 2NT6A 3QGPA 4PKDB 3MECB 1WTBA 3IMQJ 1CLFA 3TVZA 2WZ1A 3I5AA 2AQ4A 2F8EX 4XR6A 2CDQA 2ZEJA 3AODA 5J2MB 4DV0J 4I4BA 2J76E 3VR1A 2CPIA 3L7OA 5I4MA 2MYFA 3L9ZA 1FJEB 2D3O1 2Y8WA 1DBDA 2AEMA 3HPOA 1TELA 4AL6A 4LF6J 4DMZA 5BR8F 2CJQA 3SXLA 4X4QA 2XY7A 1EQ0A 3CJ3A 3ZXWA 1HBUB 2GVDB 1QRBA 3I6PA 1RT2B 3DMJB 1FVSA 2EWHA 2HQIA 4MFBB 2W25A 2DD8S 5IT0A 1VOMA 1KNZA 1JLQA 1DQ8A 2RD5C 1ZA1B 5JJBA 2F1FA 3CD0A 3DN9A 2MQOA 4NCBA 1S0VA 1AXQA 2CZVC 5FDLA 3MR2A 3EDQB 4WYWA 2VOPA 2OTJS 1HBNA 1VK8A 4A8XA 2BJ9A 3PX4A 2V8DA 2YH0A 2ZBRA 3T5JA 3VGSA 2J9EA 4DV6F 3M30B 3GSIA 3NGSA 5GADU 4CP5A 3NKYA 2VDIA 3RIQA 1TMJA 4FXDA 5KOXA 2W4PA 1NJZA 1IB4A 4KQZA 3U7JA 5DG7A 2VA2A 3VGUA 5U47A 3RTVA 4OI6A 1H7WA 1WC3A 4HHHA 1DAXA 4DHVA 4QBUA 1HL6A 4KSEB 2UXDJ 3M2VB 2CJYB 3OTEA 3CULA 2HK3A 3N28A 1NU4A 1X4AA 2BOPA 1RAIB 2HURA 1FKOB 1RAEB 4P52A 2ZH9A 2NXNA 4RW4A 1R6VA 1OO0B 2DO4A 4ANCA 3LALA 4ELVA 3KLFB 2WW4A 3CJTA 1ZYQA 4DF4A 4PWUA 4OX9F 4FYDA 1XNQJ 3O2IA 1X9SA 3NNAA 2DR8A 2F4FA 1S6UA 4V1Ak 4A46A 4B3RJ 3UCZP 4NCGB 2BBEA 2KT3A 3JQJA 3PJWA 1BQMB 1VBKA 2OFHX 3T9ZA 2QSWA 4YB1P 3I0RA 3PYEA 1JXVA 1WACA 2YKOA 5KFEA 3FQLA 4JI6J 1S97A 3CD6S 1K0TA 4EBCA 3PSSA 3S01A 1LLZA 3AD8C 4P71A 3UE2A 3EZOA 3KLEB 3LWMA 3EX7B 1NK4A 1AUDA 2K1RA 3LGNA 4JI7F 1W25A 3PEJA 3BH6B 1ZAXA 1YJ9S 2WVBA 4TY8A 2GS8A 1N34J 2X51A 1RWNB 4C3KA 1SC1B 1JMTA 2O66A 4FZVA 2L9WA 2XI2A 5IC6B 4IG0B 4JI8F 4JV5F 1D8YA 3R5AA 1IKYA 3DRRB 1S7IA 2QMXA 4ZVTB 3CT9A 2H5EA 2CPZA 3MMAA 3MCNA 4L75A 4C3MA 3V4IA 4NCAA 4P2SA 2RDIA 3MPWA 4DX8H 1R6YA 3GIMA 2Q6BA 1LW0A 1HQEB 2AYGA 1OJ4A 2MQ8A 3QJJA 2HAFA 4U7UK 2MLYA 1TYWA 1KTVA 1OY6A 2AW0A 5D77A 1FRXA 1HNWF 1IA5A 3CO0P 3NEKA 3FZ2A 2KI2A 3GE9A 3OLBA 3NBPB 4KGVB 4G1PA 1L1IA 4V19J 2GZOA 2ZVSA 3MM6B 4XL9A 4XDCA 2RS2A 5KG7A 4LF4J 1VQ6S 3QJPA 4DR7F 3AB4B 1HNXJ 4EW9A 2J7WA 1X4HA 1AFIA 3ET6A 1R43A 4U95A 1RUSA 1JLAA 1NJYA 1AZSB 3CJ8A 4C48A 1RAGB 1ZS6A 3KJNB 2IOUG 3MR7A 1M1GA 3GJRB 3UI3A 5KT5A 3TARA 2BE2A 2DGQA 3BN7A 1FESA 1XERA 3EGWB 4DV2J 1MSWD 3CD5A 1P1LA 3M8QA 2G2OA 1R8HA 1N33J 4O3NA 1V9OA 3FRZA 2KN4A 5D0EA 2ZZTA 2WW8A 3FNNA 4ZMMA 1SKRA 1D9AA 1OIAA 1TP7A 2CKWA 2DNZA 2IDEA 2OPSB 2QGFB 2KO1A 4M8LA 4DX6A 1ZETA 3FBBA 3KXDA 3ZTQA 4RU2A 1T7PA 4JI7J 2OD4A 3DOLB 2ATLA 2K1RB 3UFCX 4IUFA 2CRLA 4RZRA 4DL4A 1IJEB 2EKNA 2MY8A 5IM0B 2ZH4A 2DR7A 2G0JA 2B51A 3AOCA 1FCAA 3FUYA 3AT1B 4WK3A 5AT1B 2B9EA 2XHWA 3C16A 3W1YC 4DUZF 3ELHA 1AYEA 5DDRC 1RACB 5KT6A 1F9FA 2UUBJ 4IR9A 1S6QA 1FWLA 1TAQA 1LK5A 2EEYA 2FTRA 1F2HA 4DQRA 2AWZA 1AT1B 3UNYA 2D9PA 1S49A 1KQKA 4XORA 4ZVHA 1P9QC 2ZWOA 2O04A 3B4MA 2VQEJ 5GMEA 2YKMA 2O3DA 1UWBB 4B08A 4PG8A 4OYMA 3JAMY 1N5YB 2BM7A 1SJ3P 3NBPA 4IH5A 4Q2MA 4YDTA 4TU7A 2AZ1A 4I67A 5EN1A 1EIYB 2PEHA 1FE0A 3NGUA 4USWA 2O01C 1FRLA 4IDKA 1X8DA 2GQQA 3MOZA 2MKJA 2IIHA 4BCAA 3BGRB 1U4BA 1KQ5A 1O8HA 2WVDA 1IBLF 1NDKA 1G4CA 5HMZA 3CEDA 7AT1B 5DJBA 5L46A 2C2DA 2HHQA 3I82A 4PAAA 3UDCA 1LWCB 3IRXB 2UVRA 1JLGB 5KFMA 1QDUB 5J1NA 1N5QA 1FNMA 2IYIA 3C14A 4NK8A 1RA6A 3ZZUA 3JYTB 3BSOA 1QAIA 2HEKA 2UXBF 1S12A 2DR6A 4OMFG 1F5BA 1T3OA 5LSRA 1FXRA 4XLFA 2LMIA 4ATNA 1LWFA 1YJTA 3AJDA 3CMAS 1BQNA 3O3LA 4KGXB 4NPOA 4ANDA 5CYJA 3T1HF 3GYNA 5DZ7A 4EFAC 4JYAF 1SH3A 5E0OA 2HGNA 4KGZB 4B3RF 4B3OA 1XBWA 1YJRA 3SUCA 2AF6A 2QA1A 3W2WA 1TKXB 1TL5A 4P7VA 4OYZA 1S99A 3T6JA 4FNHA 4ZJQA 5KTQA 1SL0A 4AD6A 4DCJB 4K2JA 2XS5A 2BQRA 4DUZJ 4OX6A 2F3JA 1Z2ZA 2V94A 2GFFA 1QAXA 3PCOB 4RX6A 4PMHA 2DK2A 2NXEA 2XYHB 4YN3B 2MKKA 3SY2A 1RAHB 4AL7A 1Y00A 4G3IA 1Y9OA 5HROA 4B9TA 1SVDA 2ACYA 2QYGA 4HDGA 3NCPA 1UW9A 3KNGA 1BQXA 2AJ2A 4Q8EA 4DG1A 5DDOC 5CA5A 2RILA 3D67A 3GCWP 4CYUB 3QRQA 1EQMA 3PKMA 1HIYA 1N5YA 2M9KA 1RU4A 3QBCA 4F7VA 3G82A 2DHSA 2YNHB 2W4DA 5HQ8A 2XY6A 4LF8F 3NS6A 3H5SA 1HA1A 3SEOA 1JLQB 3A8IA 4ZP7A 4JI8J 3MMCB 4JV5J 4TLQA 3QSYB 1REVB 2XLKA 2Y9HA 2XGPA 2BM6A 3GZ7A 1XTZA 3B8HA 1PSDA 3IWLA 2Z57B 5FDLB 5A76A 4IFVB 1HBNB 1RU2A 4LSLB 4USJC 4RNHA 4JI0J 3IM8A 3TANA 2FY1A 2IJFA 3K17A 4ED2A 4W92B 2CQCA 3NY0A 2B6AB 4NWBA 1WC6A 4DJBA 4JB8B 1KSPA 4CLUA 4PXEA 3SFGA 1BQNB 2GJFA 4JI4J 2WB1D 3NS7B 1M5VC 1UVNA 1GXLA 3JTNA 2HS0A 1D09B 3TR5A 3A8JA 5CCMA 2R7TA 1SQGA 3D6TB 4NA1A 3NWRA 4NMLA 4OZ5A 4LF4F 3H5UA 4DR7J 4MKVA 5FJ4A 1FEEA 4P2XA 4K59A 3V6HA 2J5AA 2Y0SD 3WQPA 3OFFA 4MYTA 2CG8A 2QX3A 4HH1A 3H8YA 3HULA 3TAMB 2PMZD 4CI0B 1SH2A 3SYZA 2BDPA 5CD4A 1TVRB 4YQWA 2I38A 2DNYA 4LFAF 3IO1A 3DRXA 2RKIA 1D3WA 3FSIA 2P2CB 3SBMA 3TW0A 3KHRA 4WZMA 3S8SA 1NKBA 4W8QA 1V3RA 1OFLA 1Y11A 1U26A 4WTOB 2HRUA 2HAIA 4YR0A 1FXLA 2JFDA 2JVOA 2QZAA 3THPA 3ITHA 4ECRA 4Y34A 1OFMA 4M5GA 4DV7F 4EZ9A 1U6BA 1X60A 2PI5A 1B4SA 3KUEA 4NZ0A 1EE6A 3ZZ0A 1EKRA 2HZVA 5K14A 1W26A 4ZVQB 1C0UA 3VSTA 1ICEB 5M2UA 4ED1A 2YTCA 3K5MA 2HHHJ 2LXFA 4LMZA 3ILOA 1JJHA 3P45B 3CCWA 2OMOA 5D4OA 4IG0A 1HHTP 5KFNA 4X4NA 1VQSA 6FD1A 1MMDA 3D5MA 2HHVA 2X7IA 2ZE2A 3GIIA 1T94A 2A2DA 1U49A 1M90T 1FNXH 3JSMB 2B8QA 4CLSA 1YG0A 3JS9A 1YX2A 3TH0A 4OPWA 1QJVA 2CQ0A 2HVZA 4KH3A 4A8FA 5LM7E 1W2IA 4CLZA 5LSLA 1L3UA 3NNCA 5JMNA 2A10A 4DV6J 3I31A 2ILYA 5CYMB 3ULHA 2LU1A 2YWGA 2E44A 3QT8A 3R6LB 3GQCA 3K58A 2V2KA 3PRDA 3GYGA 3TUPA 1U45A 2EXUA 1K0VA 1RTDB 1RT4B 1RYRA 3Q8YA 3MM7A 3KOAA 5SUHA 2DRDA 1FK9B 4CLFA 2GAGC 2O67A 3ETMA 1T8EA 3M2RB 1ZZNA 1RTHA 3CCQS 2UXBJ 3F44A 3RU0A 4IO1A 2MQPA 2NTQA 2RKIB 2FJWA 4IOBA 4KHPF 4OJPA 1HBOB 2LEPA 3H2UB 3DLLQ 3MM8A 1EP4B 3K2YA 1C1CA 2BANA 3IAS9 2GHPA 3PTWA 2VG5B 1HW9A 4WFZA 3NGDA 1LV5A 4QIVA 1I94F 2J6TA 3HT3A 2EC2A 1Y5IB 2C3YA 1GTHA 3R7NB 2E7XA 1LEOA 2KYXA 4LIWA 4M5DA 4U9RA 2HGMA 5HL7Q 2Q1LA 4ELTA 3KNAA 2M4MA 1C0UB 2QL9B 2VKZG 1HLWA 4YS2A 3EMTA 2HHHF 1TKZB 2YVSA 4KHPJ 1NSPA 2UV8A 3MDFA 4GRSA 1U0SA 4I6YA 3UNGC 4ETXA 1NJWA 5FD1A 3M8SA 1UVLA 1FJCA 3TQEA 4Q0BB 5A8WA 4GKKF 3ISNC 4WFYA 4FPRA 4LR8A 2HQ3A 3HI9A 4NRTA 3BR8A 1E6VA 2HVDA 4ZPWR 3KK3A 3LA0A 1NAQA 2LXUA 1GNKA 1XEZA 2H5JB 1CQMA 1PG5B 4DPTA 4F04B 1R0AA 3PYFA 5KFIA 4FVMA 2FDNA 4RO0A 2OMLA 1NXIA 3IFEA 3R5CA 5GAGI 2J0XA 2PC6A 2YKMB 2Q3PA 3BQ1A 4B9SA 1OSCA 1CQNA 3QSIA 2XMKA 3MHYA 3QGIA 3MR3A 4CRJA 1KLMA 1QSYA 3M2UA 2ZD1B 1L3KA 1ULRA 5J2PA 2XSJA 4PQAA 1GMWD 4LBPA 2AYEA 3MUTP 1HD1A 2ROEA 3DYAB 5C2CA 5HO4A 2R9LA 1IM6A 5J2MA 1L3VA 3JTPA 4C0BA 4C4WA 3KLIB 2DNRA 3VAKA 4ZK7M 4O0IA 3IRXA 3GQ7A 1IKXA 2QXZA 1TYVA 1DTTA 1FFGB 2DNKA 4NEZA 2NCKL 1U1PA 4M94A 4MK8A 4TKTA 1U1KA 4ILMA 3EE3A 1FRJA 1EP4A 1Q1KA 1RBLA 5DETA 5HQMA 4J9VA 1V3SA 2DXFA 4F67A 1LWFB 2RIJA 5CYQA 3JURA 4EYIB 3HXMA 3DI6B 3MWBA 5LMUJ 4JP8A 5D78A 2YNFA 3EXYA 1KCCA 2NUHA 2K3KA 3M6WA 1SBRA 4NZ6A 5LMNJ 2C28A 4JRAC 2LDYA 3BSAA 4ZN1A 4DV5J 1YJ7A 3LP0A 4XN0A 1SV5B 1VGYA 2RUGA 3MPYA 4PRFA 1RXOB 5F8JA 3KG0A 4WIIA 3IXQA 3M05A 3N5BA 4DOZA 2V34A 4X4RA 3I5CA 4MMOA 4MKAA 4QWDA 3MURP 1PC5A 4DFPA 1H0HB 2DY9A 4R8UB 1U6FA 1YSJA 3G6ES 1WUUA 2H5IB 3JX8A 4XONA 2DNOA 4IKAA 3TQ1A 4O4RA 3EZ5A 2FY8A 4DR1F 3PO5A 3ZSCA 2VONA 4NLYA 1SQEA 2A0FB 3M2VA 5T7LB 2WBMA 5D3GB 3G87A 4JOUA 1DARA 3N9UC 5B0BA 3VWSA 5DG8A 1WC5A 4NXMF 2LP4A 3MPDA 2X1BA 1UZHA 4DWIA 2DNMA 1GAOA 2ZD1A 3SMZA 2JRSA 3BPDA 4ECTA 5MAOA 2W7OA 5CZVA 3BKUA 2CWKA 3QAEA 4MK9A 3KHLA 3TAPA 2FJVA 3G2XA 3A4TA 4UF4A 4KYZA 2BKNA 1HARA 1UZDA 3MR6A 2KT2A 2H4WB 4W8SA 3PYGA 5C42A 2XCPA 4ECUA 1HI1A 4LSNB 4PXDA 5B09A 3CJKA 5LJ3Y 1FA0A 1S0NA 4YR2A 4KIAA 1ZBTA 1RT5A 2VHGA 1RT6A 4I2PA 1OGOX 2C2MB 2J9DA 5CYQB 3UR3C 1RTIA 1H7XA 1VR6A 3IGNA 5EGYA 1Q81T 1SC6A 2NLWA 2GV1A 3I4HX 3Q8SB 3G96A 1CJVB 3E01B 1DBGA 2HBRB 3DFEA 3MEEB 3NP5A 2YWEA 2MKSA 4NLRA 4Q7AA 4QJVA 2VBEA 3TZZA 1QUVA 2QLJB 4O23A 3W65A 4PXBA 2UUAJ 4EZ6A 1F1BB 3ISND 3H09A 1REGX 3CDUA 2AMCB 3M9OB 2RF2A 3IA0A 3NS5A 1X5TA 2ZOGA 4M5KA 2FHOB 4DDFA 3PDNA 5L1KA 3OTDA 4LF8J 3GU0A 3KUGA 1SJ1A 1YJUA 4XM3A 1LW2A 1RWMB 2AU0A 1WG1A 3BYRA 2XTYA 5D4LA 2F3LA 4C8NA 5F8MA 1D9DA 2DYAA 1S6PA 4L72B 4WXOA 4PUOB 4DR1J 2BZ2A 4UOGA 1TKTA 3MAAA 4OYPA 3H25A 4DPOA 4OLPA 4Q44A 1TKDA 1N5TA 4J9KA 3IWXA 4E8UA 3MM5A 5D0HA 1KWMA 5ETMA 1UPPA 2ZNZA 3P96A 4FS1A 1CSJA 1LWCA 2ZH6A 2R8KA 4Y2CA 5KG3A 2VOOA 1HYSA 3ET6B 3RAMA 2KVQE 4YELA 4ZA1A 2VASA 3QGGA 3U1MA 3MMJA 5GAEU 4LFCJ 2XS2A 3GQ8A 1JLAB 2MJNA 1B7YB 2PE8A 4F4WA 5G4DA 2N4DA 3RZAA 2IMWP 4OHYA 2ZZMA 1OY9A 2GX8A 2V5IA 2YQ0A 3CD7A 1ROFA 4OFZA 3BGLA 4F3MA 4Y2MA 4C8LA 2QY1A 1BD6A 2DNQA 2R7SA 2LLZA 3K8WA 3FQKA 3N6ZA 2BRKA 3HHKA 4ZVSB 3JSMA 3L3CA 4PPZA 4K4VA 4USMA 1ZH5A 1S9GA 2VFTA 4Z06A 3EDRB 2E5LF 1CZFA 4MR0A 3TWZA 4HEA9 4OV1A 1VBYA 5LSOA 1KP6A 4P73A 5KFDA 5AJ3J 1OPZA 2W9AA 1VRTA 2IMOA 2YPYA 4DPWA 3DHXA 2GJIA 4OZLA 4EO8A 1VBLA 5ETNA 2YY3A 2QLXA 3D6FB 1RHRB 1N4LA 3P4UB 2CZ4A 3KLHA 4HDHA 1X4BA 4WFBQ 3BSNA 1S10A 4RW6B 2JEGA 1QSLA 2A2CA 1U8WA 2DH9A 4J37A 1VHIA 1O6XA 4ICLB 1VQOS 3OFEA 2VG6A 2WBRA 3FEYB 3FFIA 1TKTB 2VBZA 3FKBA 3H90A 1HBMB 3HCXA 3HFZB 3MAAB 4LFAJ 4X66J 5RUBA 1BY9A 2I8EA 1KVJA 1DLOB 3IG1A 5DO2A 4F3QA 3TZYA 5A2QY 2L9NA 2MZSA 3NWGA 4G6VB 2NPFA 4I69A 4G1QB 3ZTPA 4K4WA 3OSNA 3VAIA 4EO6A 2C2RA 2YKPA 1WC0A 2DB1A 3JSRA 1U2RA 2V8HA 4ZP9A 4J9QA 1T11A 1RISA 4YB5A 1Q8IA 2JL9A 2V0NA 2C42A 3BBBA 5IS2A 3RRHA 1MNEA 2KFZA 1JIHA 1HQUA 3ZTOA 3RB4A 1DRZA 5KFXA 2XWXA 1NHUA 3GSDA 4QIGA 1OQ6A 1WTFA 4ZN3A 1YKWA 1NUEA 3M6VA 4BC7A 1VBXA 1JB0C 2ALYB 2OSQA 2IM2A 4DFJA 3MPVA 1QY7A 4J90A 2A3JA 3CJ4A 3JAMU 1NBEB 4B3OB 5HK4A 5KFCA 3U02A 5LL6d 4F4YA 2HNZA 4ZDNA 4OJ3A 4ID5A 4C11A 1F5AA 1Q7LB 4DS4A 2JEJA 1WOSA 1RHJB 1RT7B 2Q6CA 5KFLA 2DR9A 4JV1A 1U0HB 3AH6A 3PRVA 1U8SA 2BJDA 1G2EA 1S77D 5EX3A 3DU6A 1NK0A 1CJTA 1OWXA 2RRAA 2AEJA 3PHEA 3K59A 1RADB 4IO9Q 1IR1A 5H9EK 1U48A 3SZEA 1WG5A 4P72A 1XMOF 4IOAQ 1GX6A 3OHAA 2HLTA 3HHLA 4NXNJ 1Q8KA 1UCNA 1RAAB 3PV8A 2KXNB 4M5LA 4ZPTR 1N5VA 3H42A 4RW6A 3VCDA 5DNSA 2AJ0A 2LXIA 4KHRA 2YUHA 3FFIB 3N01A 4Y2KA 2CYYA 4QWCA 1IR2A 4ED6A 2XMWA 1D0EA 2ZKTA 3QLHA 3R5BA 4X64F 1DLOA 3IG1B 5KFGA 3SSSA 1RTJB 3DI6A 4UZBA 5ITHA 3UDLA 2VH7A 1NK8A 2FJEB 2IQ7A 1WOPA 4NA2A 4RLEA 4LRDA 3PJ9A 3FVYA 1Y4ZB 4DQQA 2EG1A 1SV5A 4FNIA 2BJEA 2RJZA 2KRBA 4TN2A 1LXJA 1R8CA 3C6UB 5KFFA 5DM7Q 3LWLA 3ENWA 1LQ9A 1GTEA 2COLA 1U02A 4OYXA 4BS2A 5M2RA 1RMGA 2Y1IA 2YH1A 2I6WA 2D9OA 1RT2A 3DRPB 2FLNA 1I5OB 2AIRB 4WU3A 3DC2A 3W8GA 1QVFR 5KFOA 1NKCA 3MCSA 2VF3A 1KVIA 3T9NA 3GRHA 2DKOB 2WONB 3ZO7A 2XC1A 2MGZB 4DL2A 3POTB 2HNZB 1QM9A 5MLCV 1YRXA 2O1DA 2ZH5A 2GGPB 1RTHB 2VFQA 3MUVP 3FBCA 2QA4G 1RT7A 2HHPA 1HWJA 4KC5A 1R31A 2BJ7A 3DHWC 2HFNA 3SQGA 2Q66A 3QATA 5FLXU 2OPPA 1WDTA 1O8BA 2AJ1A 3AD7C 5KFZA 3TYTA 3NRBA 2KM8C 2AYBA 3OLAA 3BGUA 3BREA 3ENQA 3A12A 1X0FA 4DQIA 3D6MB 4YZQA 2PEBA 2J7KA 3NG8A 4NYOA 5B0EA 2R8JA 2YX7A 1JLBA 5C42B 4EUVA 3BR9A 1T03A 1MWYA 2YX4A 2BOAA 3CJKB 1C1BB 2WRMA 4J91A 3ILLA 2Z58B 1NDCA 4X4PA 1NK7A 2F8MA 3DM2B 3W62A 3PX0A 3D7SB 4KHMA 1DABA 4Z37A 1XNQF 1NPKA 3IBCB 4PG5A 3T1HJ 3CJ5A 3JQMA 5JXSA 2DIUA 4C2MA 2CQ2A 1KD1T 1N5SA 1RCXB 2CVIA 5IT4A 1WMRA 3DLGB 2WB4A 1JRGA 2RB7A 2DEIA 3ICLA 3DLEA 2D69A 3FEXB 2QC3A 4PZVA 4KH1B 2BE7D 4JI6F 1HHSA 5CAAA 2MY7A 2QT7A 2XC9A 1S79A 3G6XA 5A8KA 4NLWA 1HG8A 4PYDA 1RAOA 3MAHA 3FMBA 4LVOP 1UWAA 5IWAF 2NZCA 4X66F 2KG0A 3RG6A 3RJMB 4QW8A 3RW6A 5ETLA 4TQSA 1O8MA 2FVCA 1Q82T 3VGTA 4YUDA 1RTDA 2CPDA 1CC8A 1FERA 2XYPB 2DJWA 3HSGA 2PO4A 3B4DA 3MM7B 5F0WA 2GGPA 3F41A 4OYOA 4X62J 1WJ9A 2HHWA 4OJHA 1BE4A 3W2VB 1FD2A 1RWOB 4F4KA 4LR7A 1Y5LB 4H4KA 3D1OA 5AE1A 1KFDA 4PWDA 1NPRA 1O8DA 1N88A 3WC2A 2Y1RI 3KKFA 2R2UA 2Z2YB 2QL5B 5IT9U 1RWRA 1H6KX 3LP2A 1C4AA 3N79A 3ENAA 1N52B 1YLXA 3ISZA 3BBCA 1CULB 1TV6A 2XTXA 3B4NA 4WE1A 2B7CB 1ZZFA 1H3DA 5LOQA 2QYUA 1FX4A 3DM2A 1T9VA 2NYHA 4TYBA 5T41A 4DV4J 4QIEA 1Q5VA 3C6TA 3DGPA 4HR2A 2W1BA 3D66A 2MSSA 4KV8B 1O8GA 4NASA 2V4QA 4A8QA 3PW7A 2QLBB 1U1MA 5GADI 1CS4B 2X85A 1FDAA 1R27B 2YNIB 3VVTA 3Q8UA 4R5PA 4OL8A 1X4DA 3PXGa 2VBYA 2J8AA 2NXCA 2XMMA 1S1WA 4D3GA 5F3TA 5SZTA 1FI4A 1NB7A 2O0VA 2EW9A 1DY3A 2KL8A 3GFZA 3VVUA 3W5XA 3N4WA 4Y2IA 4EMDA 3KK3B 1UFWA 2H9ZA 2KJWA 1CJUB 3KLHB 1F3FA 2YWWA 1T9YA 3KJVB 5KFKA 1VIXA 4UOCA 1VISA 4MKBA 5E3RA 3K5LA 3CC4S 4F0KA 2V68A 4ED7A 3A3PB 2M7SA 1VC5A 3BPSP 4WFXA 1KRPA 4DSJA 5KFAA 3FMWA 2M88A 3GQ9A 3FBEA 3OD2A 4FVCA 4C2LA 4V19X 5HI7A 4WKRA 3HSJA 4FP9A 2CUYA 3L09A 2W7PA 3PW4A 3P49B 3G8TA 1IKXB 2DGVA 3K89A 2AZ3A 2B5JB 5B0AA 3HF5A 5CABA 5C25B 3UD4P 3HJFA 4PWDB 1FKPB 3OXFA 4FKXA 3CMES 3GIKA 2VBXA 3PIOQ 2XGQA 3W8PA 4JV2A 4LF5J 3A8EA 3KG4A 4YB7A 2I5JA 5KFHA 3NB2A 3SV4A 3OSPA 4DUTA 4OHWA 3KYLA 1EETA 4L74A 8RUCA 5L39A 1Y3JA 4NRUA 1B70B 3VAFA 4DV4F 5F9LA 1S9EB 4ID5B 4C11B 3SYJA 2DY1A 3C14B 3MUMP 1V5VA 3B82A 2FHMA 1OMSA 4Y28C 3MCOA 1U2CA 2DITA 2H65B 2C1EB 2FJAB 4KV8A 1KEKA 3VAJA 4DL3A 2F4VF 4DSIA 4GKJJ 1SPBP 5IOLA 2BVZA 3DLKB 1PC4A
chains in the Genus database with same CATH topology
1HHQA 1NDCA 4F36A 3EE3A 1QRCA 1ZS6A 2IOUG 1QA2A 2DXFA 1DABA 2B8PA 1NPKA 3LJYA 1KDNA 4UOFA 2ZUAA 2BM5A 1U8WA 1WKLA 4JRAC 1BUXA 3P4GA 3FKBA 2W7ZA 3FBBA 1NSQA 3ZTQA 3B54A 1BHNA 5CAAA 1MN9A 3ZTPA 3GP9A 2VFNA 3WX8A 1QA1A 3DKDA 2DY9A 4DI6A 3DDIA 3EICA 3ELHA 3JX8A 1B4SA 1NDLA 1WXRA 5BXIA 3Q86A 5JMCB 3BBBA 3VGTA 3PETA 1QRBA 4ANEA 2HVEA 1S5ZA 1NB2A 3ZTOA 3EJMA 1NLKL 1BE4A 4FKYA 2VFOA 1NUEA 3MPDA 3VGVA 2BM7A 2J8IA 2AZ1A 2B8QA 1XIQA 2CWKA 3NGUA 3JS9A 3AK5A 1NSKL 3TH0A 3G2XA 4EK2A 4OPWA 1XQIA 3VGSA 3ENAA 4KH3A 2VFPA 1KQ5A 3BBCA 3NGSA 1EHWA 1LWXA 1NDKA 3FCWA 4WBFA 3PRVA 4CP5A 3RIQA 3NGTA 5C7PA 4V02C 3VGUA 3Q89A 4OJOA 2DXDA 3Q8YA 3SZEA 4HR2A 4OM9A 2VFMA 2HURA 4KPCA 1K8FA 1UCNA 3ETMA 3VVTA 4ANDA 4ANCA 1K44A 3Q8UA 1QQ1A 2B0RA 2YUHA 1NDPA 4OJPA 3VVUA 2BX6A 5JLVC 3H09A 1S57A 1K4ZA 4UOHA 1NHKL 4OJ6A 1F3FA 1F6TA 3L7UA 4DZ6A 3PJ9A 1JXVA 1LEOA 1NCLA 2F3LA 1MN7A 2DYAA 1PKUA 3B6BA 4UOGA 1TSPA 1S59A 3EVWA 4S0MA 1HLWA 3EMTA 3FBEA 3EVOA 1NSPA 3BH6B 3LYCA 2VU5A 3EM1A 4W98A 3ZTRA 1CLWA 3Q83A 1HIYA 2BEFA 2G0YA 4OJ5A 2AZ3A 2HVDA 5CABA 4FKXA 2XC1A 3BBFA 4O0NA 3ML3A 1WKKA 1TYXA 2VFQA 2V5IA 3FBCA 3N90A 4DUTA 4OJLA 1PAEX 3R9LA 1WKJA 1TYWA 2BM6A 1B99A 3EVMA 3FC9A 3Q8VA 1VYAA 3GPAA 3N6ZA 2DXEA 1HF2A 3SYJA 3NGRA 4F4AA 2BM4A 3BH7B 1TYUA 4C6AA 1W7WA 4ENOA 3FBFA 3FCVA 5IOLA 1TYVA 1QA3A 2NCKL 3ZTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HHQ A;  1NDC A;  4F36 A;  3EE3 A;  1ZS6 A;  2DXF A;  2B8P A;  1NPK A;  4UOF A;  1KDN A;  2ZUA A;  1U8W A;  1WKL A;  1BUX A;  3FKB A;  3FBB A;  1NSQ A;  3ZTQ A;  3B54 A;  1BHN A;  5CAA A;  1MN9 A;  3ZTP A;  3GP9 A;  3WX8 A;  3DKD A;  2DY9 A;  4DI6 A;  3DDI A;  3EIC A;  3ELH A;  1B4S A;  1NDL A;  5BXI A;  3Q86 A;  3BBB A;  3VGT A;  4ANE A;  2HVE A;  1S5Z A;  1NB2 A;  3ZTO A;  3EJM A;  1NLK L;  1BE4 A;  4FKY A;  1NUE A;  3MPD A;  3VGV A;  2AZ1 A;  2B8Q A;  1XIQ A;  2CWK A;  3NGU A;  3JS9 A;  1NSK L;  3G2X A;  4EK2 A;  1XQI A;  3VGS A;  3ENA A;  1KQ5 A;  3BBC A;  3NGS A;  1EHW A;  1LWX A;  1NDK A;  3FCW A;  4WBF A;  3PRV A;  4CP5 A;  3NGT A;  5C7P A;  4V02 C;  3VGU A;  3Q89 A;  2DXD A;  3Q8Y A;  4HR2 A;  2HUR A;  4KPC A;  1K8F A;  1UCN A;  3ETM A;  3VVT A;  4AND A;  4ANC A;  1K44 A;  3Q8U A;  2B0R A;  2YUH A;  1NDP A;  3VVU A;  2BX6 A;  1S57 A;  4UOH A;  1K4Z A;  1NHK L;  1F3F A;  1F6T A;  3L7U A;  4DZ6 A;  3PJ9 A;  1JXV A;  1LEO A;  1NCL A;  1MN7 A;  2DYA A;  1PKU A;  3B6B A;  4UOG A;  1S59 A;  3EVW A;  4S0M A;  1HLW A;  3EMT A;  3FBE A;  3EVO A;  1NSP A;  3BH6 B;  2VU5 A;  3EM1 A;  4W98 A;  3ZTR A;  3Q83 A;  1HIY A;  2BEF A;  2AZ3 A;  2HVD A;  5CAB A;  4FKX A;  3BBF A;  4O0N A;  1WKK A;  3FBC A;  4DUT A;  3R9L A;  1PAE X;  1WKJ A;  1B99 A;  3EVM A;  3FC9 A;  3Q8V A;  1VYA A;  3GPA A;  2DXE A;  1HF2 A;  3NGR A;  4F4A A;  3BH7 B;  4C6A A;  1W7W A;  4ENO A;  3FBF A;  3FCV A;  5IOL A;  2NCK L;  3ZTS A; 
#chains in the Genus database with same CATH topology
 1GMU A;  3HD1 A;  2D1C A;  2XB2 D;  2OPR A;  3VSV A;  3KDN A;  3J7Z 5;  4HAC B;  1VCT A;  3PAC A;  4H4M A;  4DCO B;  5K20 B;  2QO3 A;  1VQ4 S;  4WF9 Q;  2HND B;  4RBT A;  2NTP A;  2FPH X;  5DS7 A;  4RNO A;  1N0V C;  1PYS B;  4M63 A;  4NLT A;  5LMN F;  1CJK B;  3LJY A;  1TQL A;  2J9C A;  2N4C A;  2ZUA A;  4OHX A;  1TL1 B;  1Z1Z A;  5HJX A;  3H2V E;  4YFU A;  1ITP A;  1NSA A;  4U4B A;  4HHJ A;  2K3I A;  1MMN A;  2FB0 A;  3BGO P;  4OI2 A;  1MRO B;  2HSE B;  4J9O A;  2Y8Y A;  2GO9 A;  2P9E A;  4CIO A;  1IN0 A;  3TA1 A;  3OFH A;  4I2Q A;  3W64 A;  2GCF A;  2F4V J;  4FDF A;  3D3C J;  1JLF B;  1XK8 A;  3QWU A;  3WX8 A;  3KK2 A;  4DI6 A;  4LF6 F;  5KG4 A;  4AQY J;  4XK8 C;  4XDD A;  2IC3 B;  3HSZ A;  2QFI A;  1NDL A;  2PN6 A;  1U2F A;  2E1A A;  2O17 A;  2PT0 A;  4ZLP A;  1KHV A;  2BJ3 A;  3M9M B;  5LJ5 Y;  4QU7 A;  2VV5 A;  4ECS A;  2HVE A;  4HKQ A;  5C24 B;  2A6M A;  3GB0 A;  2MKC A;  4G1I A;  1RBO B;  2X3G A;  2G0C A;  4UUW A;  3EJM A;  1Y0H A;  1VRT B;  3MMC A;  4FKY A;  1IQZ A;  2G0I A;  2CJA A;  1FTR A;  2VKR A;  5A8R B;  3C2P A;  1M5S A;  1REV A;  3RAQ A;  2L08 A;  3MEE A;  4F4X A;  4H4K C;  4WFA Q;  2BQ3 A;  1AUS L;  2CQP A;  2OP5 A;  2HWI A;  2O0W A;  2KM8 B;  2FC8 A;  2Y3Y A;  4CLY A;  2AJF E;  3MR5 A;  2PFD A;  3N0V A;  2VQF J;  4CWB A;  4WKY A;  1S72 S;  1R0B G;  3ADA C;  5DZ6 A;  1WEX A;  2KU7 A;  5KT7 A;  1YIJ S;  4NLO A;  3MOJ B;  1HNI B;  1OPI A;  4LF9 F;  4IYQ A;  1EHW A;  1U1R A;  2VUG A;  3VZH A;  3KLG B;  5AE2 A;  2JEF A;  1RT3 B;  1RZM A;  1VQ9 S;  2CIM A;  2QSF A;  3EGN A;  1BWV A;  4RBU A;  2BKO A;  3Q89 A;  4BWM A;  3NNH A;  2IM0 A;  2K06 A;  3W60 A;  5C2G A;  1JLB B;  3M7V A;  3OJS A;  1XNR J;  3HO1 A;  1WWH A;  1TMM A;  5K8O A;  3IRW P;  3CJS A;  4KE5 A;  4ZPB A;  3SCL E;  2B4P A;  3TAM A;  5ETV A;  4OZY A;  3V6D B;  1DZ5 A;  3DGV A;  4F25 A;  2RSQ A;  3QNW B;  3SQV A;  1Q53 A;  2EFV A;  1WEY A;  2ZH1 A;  1GQ8 A;  1RT1 A;  2FJB B;  3MD1 A;  1VI7 A;  4X64 J;  3CF5 Q;  1M5P C;  1F6T A;  2VJV A;  4ECQ A;  3M8Y A;  5CZX A;  1FF2 A;  3WWG A;  1MN7 A;  4UZC A;  2FJX A;  1TL7 A;  4A47 A;  2M5Y A;  2VBW A;  4MK7 A;  2HFU A;  4JI3 J;  1JTA A;  4CH1 A;  2W01 A;  4YZ0 A;  3D1H A;  2ZHB A;  3VSU A;  2F5G A;  3TI0 A;  2B4O A;  4OZZ A;  2VU5 A;  3WBZ A;  4C8O A;  1I51 B;  5ETP A;  2H51 B;  1O51 A;  4WYL A;  3GJS B;  1VC0 A;  2HBZ B;  3OPK A;  4W4M A;  1WF1 A;  1XMQ F;  2NTB A;  2MZ1 A;  1B0P A;  1FVQ A;  3PNI A;  2W2N P;  3AXK A;  3G8S A;  4TVA B;  4ECW A;  4N56 A;  1W2B R;  3OVA A;  1BGX T;  2NQP A;  3ILJ A;  5FII A;  1KR4 A;  3M30 A;  3FDS A;  2EBE A;  4Y6I A;  1QJH A;  1VRU A;  2HFV A;  2Z2Z A;  5IC4 B;  3W9H A;  3QIP B;  3KLG A;  4RKU C;  2OEL A;  3DCA A;  2IFX A;  5BYR A;  4U7U D;  2RDJ A;  1RWX B;  1WHY A;  2QMW A;  5KFQ A;  3AQO A;  3MI7 X;  3CCS S;  1TL3 B;  4ZPA A;  2G2Y A;  3G8Q A;  1R89 A;  3M9N B;  1EJ7 L;  1WD6 A;  4TYA A;  2IA6 A;  4WE1 B;  2HHU A;  3OXG A;  3TO8 A;  3LP1 B;  4DN9 A;  3FEZ A;  4Q45 A;  1URN A;  1JLE A;  3FSY A;  3HJV A;  2VZ9 A;  1YRU A;  1HR0 J;  4IH6 A;  1FXD A;  2JFK A;  3CIM A;  1QA2 A;  4C8Z A;  1RT1 B;  2R8H A;  4BC9 A;  4YY3 F;  4ID8 A;  3G86 A;  3T5K A;  1OYE A;  1LFP A;  3U1L A;  5EWG A;  2FHJ A;  3MMB B;  1K47 A;  1SUQ A;  3JTO A;  1IQT A;  2MB0 B;  3KK1 B;  1DJ0 A;  2NPI A;  1IJF B;  2V69 A;  5K8P A;  4C8K A;  5D8H B;  4DV1 F;  3SI8 A;  4WTY A;  1IDJ A;  2YKA A;  4C97 A;  2I2Y A;  4KKO B;  2GVZ B;  3MFH A;  2LVW A;  3SQG B;  3DDK A;  2ZM6 F;  4PG7 A;  2KHD A;  2ZC4 A;  5DM6 Q;  3J7Y U;  4ZVO B;  1XMQ J;  1OYD A;  2JLF A;  1M1K T;  3CDA A;  3F73 A;  4YR3 A;  2WOM A;  1SB6 A;  2VJU A;  4IRK A;  3DLJ A;  2CJX B;  3O8W A;  2AGQ A;  3J80 Y;  1C2P A;  4ANE A;  1LW0 B;  5F9N A;  3BO3 A;  4K4U A;  1S1U B;  1HQE A;  3HHL B;  2AYM A;  2R2T A;  5F0U A;  3T41 A;  2HG4 A;  2Y1J A;  3LAK A;  4X62 F;  2VFO A;  3AA8 A;  3HFV A;  1RP5 A;  2CPX A;  4QYR A;  1H98 A;  1WHW A;  5CH7 B;  3Q24 A;  3VGV A;  1S4F A;  5F8H A;  4I7F A;  5JVG Q;  4PWW A;  1UEU A;  4RW7 B;  2M70 A;  4DR2 F;  1JK9 B;  1S9F A;  4DL0 C;  2CNO B;  3GON A;  3HFK A;  2C2K B;  1IBL J;  2QL7 B;  3IM9 A;  1UVK A;  2JEI A;  2YKQ A;  1VJQ A;  1GXU A;  3CC2 S;  1VRQ C;  5DRK A;  2BSP A;  2IVY A;  3CO9 A;  3OR2 A;  3SCK E;  1SJF A;  1B3T A;  2CJK A;  3C3L A;  1FJG F;  2ZC3 A;  2R3V A;  2V8G A;  4IG3 A;  1M0S A;  2GVD A;  2DXD A;  3QO9 B;  2ZH3 A;  3DMJ A;  4I1T A;  2XLJ A;  3MED A;  2CQI A;  1Q78 A;  2XY5 A;  3RBZ A;  2OEK A;  4YEJ A;  2VFM A;  4N47 A;  4ELU A;  1CBK A;  2DHX A;  3V2U C;  2DNH A;  1K5C A;  4QWE A;  2OAU A;  3UD3 P;  1PBU A;  2CQG A;  1Q8B A;  3W9I A;  2CFX A;  4CM2 A;  4I6W A;  1NH7 A;  2OPS A;  4KTQ A;  2X3D A;  2JVR A;  3CUN A;  1K4Z A;  2Z30 B;  1GK8 A;  1RAF B;  4OJ6 A;  3I55 S;  3NAH A;  1RYS A;  4DZ6 A;  2K7J A;  2XZT B;  4ED3 A;  2ILZ A;  1BC6 A;  1O88 A;  1XG2 A;  1TUW A;  4WPA A;  3R5J B;  3THV A;  1SIZ A;  1ELO A;  4DSK A;  3VAM A;  1NZA A;  1PKU A;  3TVK A;  4ZCM A;  1I6J A;  1G1X A;  4O44 A;  3EQN A;  1A0O B;  1U25 A;  2MPU A;  4ZIV A;  1AFJ A;  4LRC A;  2N3O A;  4EYH B;  4ED5 A;  3KDO A;  1IBM J;  2IA0 A;  3M4X A;  5KAK A;  2KB2 A;  3N6L A;  4E98 A;  3K5P A;  3OR1 A;  2NYI A;  1RHQ B;  1NK9 A;  1C1B A;  2BM0 A;  5KFJ A;  1DTQ B;  1MML A;  2HW3 A;  3IN5 A;  2KZZ A;  1KQS R;  4ZLN A;  4J9R A;  2A1B A;  4B3M F;  2QLF B;  3DGP B;  3M32 A;  2JC0 A;  3UDE A;  8AT1 B;  2ZJQ Q;  1S0O A;  2M8D B;  2J9D E;  2XMJ A;  3JXO A;  1GX5 A;  4PG6 A;  1MWZ A;  4GVL A;  4WK1 A;  3M8Z A;  1RAB B;  3HSD A;  1XMB A;  4TLR A;  4YB6 A;  4EWT A;  4URR A;  3H59 A;  1VDH A;  4L3K A;  3P3D A;  4BLG A;  1VQL S;  1AIR A;  1FRM A;  5B0C A;  1I3O B;  4AXJ A;  1FD8 A;  2E5J A;  2ZZN A;  3MED B;  3KJV A;  1HWI A;  5E41 A;  4M5J A;  2KT5 A;  2Z0G A;  3CXC R;  4ZHR A;  3EGZ A;  2HZA A;  4I68 A;  4A8O A;  2B43 A;  2VPY B;  3SFU A;  2C3U A;  2DEJ A;  4DSF A;  1WG4 A;  1F0X A;  2W9C A;  4GKJ F;  4XKW A;  1DUR A;  4IRD A;  4OYW A;  4CNZ A;  5IV3 A;  4F36 A;  1N6Q B;  1ZA2 B;  1QVG R;  1IWG A;  3KHG A;  2PA3 A;  3QMQ A;  5LXR A;  3HP6 A;  1JKH B;  3W7B A;  5B0D A;  4XPC A;  4UW2 A;  3T19 A;  3OTO J;  3RBD A;  1MW7 A;  1R0C B;  2K7K A;  3ZZO A;  2AGO A;  4FYV B;  1UW4 A;  5J1P A;  1LW2 B;  2LCW A;  5DG9 A;  3K57 A;  4XKV A;  4FXW A;  4O44 B;  1NHV A;  4LBI A;  1S6P B;  4PUO A;  2DGO A;  4I0W A;  4J7C A;  2PDA A;  3NOG A;  5K8M A;  5KFR A;  3P5T L;  4CDI A;  5B7W A;  2IJR A;  1MN9 A;  1OGM X;  3PR5 B;  2XYG B;  2LU2 A;  3D1Q A;  1VQY A;  4USU A;  4HI2 A;  4ZPC A;  5HSP A;  1TL7 B;  4AFF A;  2WK4 A;  4WP3 A;  3A8K A;  3D68 A;  3D28 A;  2W2P P;  5E2Q A;  3QPI A;  4EBE A;  3J7Y I;  1UA0 A;  1DQA A;  3GJT B;  1TTH B;  1T02 A;  3IR5 B;  1TUG B;  3V6K A;  3VMW A;  4QR0 A;  3J7A 1;  3ETO A;  1C0T B;  2ZDO A;  3CCZ A;  3DLK A;  4NCG A;  4USK A;  3OL6 A;  4J9P A;  4LFB J;  1T95 A;  5KFP A;  1JJ4 A;  3R1H A;  4IFV A;  4LSL A;  1JX4 A;  4WXW A;  5B08 A;  1SI9 A;  2VD3 A;  2NSC A;  1P8G A;  2BJ8 A;  2LQ8 A;  5E33 A;  4CLL A;  3NMA A;  2OLW A;  5EHH A;  2XMA A;  1PBA A;  2QZ8 A;  3UD5 A;  4PQU B;  5IM0 A;  1CJU A;  4EK2 A;  5DLG A;  3OL8 A;  5HP1 A;  1TL1 A;  3H4D A;  3DLH A;  2OI2 A;  4K8R A;  2WHO A;  4K4Z A;  2E66 A;  2ZFH A;  2W9C B;  2V4J B;  2IYG A;  1RA7 A;  4XLC A;  2L9D A;  1HWL A;  2VBK A;  1TL3 A;  2EG2 A;  4ZVU B;  2IVF B;  5AJ3 F;  3DOM A;  1R8B A;  2VDH A;  4OYI A;  4HI1 A;  1FEH A;  1J5E J;  2ZOF A;  4JI1 J;  5L9N A;  2AP6 A;  2VFS A;  4OZ1 A;  2BRL A;  4OQJ A;  2F40 A;  5HVG A;  1K44 A;  4B9M A;  3CDE A;  4XOP A;  1UWB A;  2CQ1 A;  3DDN A;  2B56 A;  1NDP A;  3P6Y C;  4MXN A;  1RWV B;  4ICL A;  5E3P A;  2R7O A;  2UVV A;  2BX6 A;  4R25 A;  5JLV C;  1S57 A;  4USI A;  3Q0A A;  2UXC F;  4ERD A;  1Q79 A;  4DV3 F;  1YJW S;  1RHU B;  5GAH I;  3CCL S;  3MMB A;  3I9Z A;  1PIE A;  4XN3 A;  1HNV B;  2JNJ A;  2FYX A;  3MM6 A;  2GA7 A;  1RK8 A;  4QW9 A;  3G4S S;  2MEW A;  1HMV B;  1NK5 A;  2B9X A;  1QE1 B;  3KTQ A;  4NX9 A;  3K0J A;  3H20 A;  4X4V A;  3AJ1 A;  1SH0 A;  2HFZ A;  4A48 A;  5L1L A;  4IQX A;  1LXN A;  4HWV A;  5LT5 A;  3D4J A;  3HMJ G;  4CO4 A;  3A3O B;  3E2E A;  3PRB A;  3FK4 A;  2Z8G A;  3KJQ B;  4DX5 A;  1TFY A;  3EZU A;  2HFO A;  3KUH A;  2DCL A;  4DR6 F;  1TK5 A;  2GMJ A;  4MIA A;  2DVI A;  1CLW A;  1R8P A;  2X6Y A;  2ZE2 B;  3TUJ C;  2G2Z A;  3GCX P;  3X3U A;  4MAK A;  3OV7 A;  1KOO A;  2NXU A;  3BF4 A;  4QQB A;  1HFE L;  1IBM F;  2BE9 B;  4J9U E;  3T5H A;  4MT1 A;  3AA9 A;  3M8P B;  2MTL A;  2HPU A;  3DOL A;  3IR7 B;  5KG0 A;  3QWP A;  1NO8 A;  2V4J A;  3EVM A;  4OHZ A;  3GPA A;  4A4J A;  1GXT A;  4YHH F;  5J2Q A;  4JUZ A;  4DPY A;  4C3L A;  4ZPD A;  4MIB A;  3GV8 B;  2CNN B;  2E1P A;  4KGK A;  5F8G A;  2C3O A;  3CWJ A;  3LPE A;  5C1C A;  2P6S A;  4LRF A;  2BM4 A;  1WHV A;  3TRG A;  4MTP A;  4F4A A;  3PFE A;  4A8M P;  5KT3 A;  2ZIT A;  1PJ5 A;  4I2Q B;  1XMO J;  4WP8 A;  2IRY A;  3GFY A;  5G0R A;  2ZNY A;  4DL6 A;  3W3S A;  2RU3 A;  3CB4 A;  2W7A A;  3GFH A;  2LA6 A;  2YNH A;  3P5B P;  2FJD B;  5F8N A;  3ZFV A;  2QYC A;  4RR5 A;  2F63 A;  3AB2 B;  4OIX A;  2GJ2 A;  1KOH A;  1YWX A;  2NUU G;  4RUA A;  1HNV A;  4TXS A;  4H4O A;  2EK6 A;  1RTJ A;  3LPY A;  4GMK A;  4RBV A;  4UOF A;  3Q8Q B;  2DGT A;  4DV5 F;  1YI2 S;  2E1C A;  3BGR A;  2IJN A;  4DEZ A;  2EC0 A;  2FVP A;  4KJI A;  3SV3 A;  4NLU A;  3P4G A;  4RU9 A;  1X0C A;  4ED8 A;  2ZH8 A;  3SIP B;  4DZD A;  1BHN A;  1IBK F;  2DH8 A;  3D3B J;  4I64 A;  1ACM B;  2RS8 A;  2UUT A;  2E9Z A;  1N34 F;  1RBA A;  3I96 A;  3H5X A;  1PJ7 A;  3QIP A;  2XS7 A;  2DHH A;  3DDI A;  4HVZ A;  5HVH A;  3J81 U;  1RKI A;  2E5L J;  2GC8 A;  4X2B A;  5ETO A;  2J6U A;  4WIQ A;  3R6G B;  2QA2 A;  1IUJ A;  3KJF B;  4ZVE A;  3E3X A;  3AQP A;  2C22 A;  4Q5V A;  2XUL A;  3BYP A;  1R0A B;  4HH0 A;  3RRG A;  1T9X A;  4DR4 F;  2X1A A;  1SJR A;  3PG9 A;  2KXF A;  4FF3 A;  2ASL A;  2R7V A;  3O44 A;  4KFB A;  2CDR B;  2MZT A;  1B0T A;  4YHH J;  1DHM A;  2CAJ A;  2W2M P;  4WCE Q;  3KLF A;  2L48 A;  2YBV A;  1VFJ A;  2MLX A;  1WC4 A;  1SJQ A;  2K2P A;  2OPP B;  3EXC X;  4ZOS A;  3KLE A;  2OH2 A;  5IQQ A;  4DPU A;  2XZD B;  1NSK L;  3BGF A;  3S6E A;  2FUG 9;  4FYX B;  3WDO A;  3SDE B;  3QT6 A;  5HRO B;  1KBR A;  2BM1 A;  4CLK A;  4URG A;  2BQU A;  3J7A N;  3R2D J;  3FSX A;  2EVZ A;  3Q2T C;  1HNZ J;  1VS3 A;  1RGV A;  3D0G E;  3E51 A;  4X4S A;  3EQO A;  3MTK A;  1RWP B;  4ZVR B;  5HLF A;  2C3M A;  1KCD A;  6AT1 B;  1SL2 A;  2UP1 A;  4AVZ A;  4U8V A;  2UUC F;  2HS4 A;  3QQC D;  4CZC A;  2NZ4 A;  4DV2 F;  1TAU A;  5H9E J;  1S1T A;  1GMW A;  4B17 A;  3BO4 A;  1ZM2 A;  1OQ3 A;  2FC9 A;  1GEH A;  4TY8 B;  1JLC A;  5A2Q U;  1B0V A;  1FFS B;  1VQM S;  1FDN A;  2QTW A;  4DLG A;  1CG2 A;  3IC1 A;  2PSZ A;  3LP0 B;  3OT9 A;  4NLX A;  4NLQ A;  4YEA A;  2KXH A;  4KO0 B;  5ETS A;  4ES3 A;  5H1S V;  3KLV A;  3TNV A;  2KH9 A;  2QFJ A;  4OX9 J;  3VMV A;  2EFO A;  5CYM A;  2MKY A;  4I7F B;  2WVE A;  4ZCK A;  5HAN A;  2FHJ D;  1H2V Z;  2BW7 A;  2WAQ D;  1YQH A;  1FFW B;  3GR1 A;  4YZA A;  1IWA A;  4M5N A;  4OI3 A;  4EGL A;  5DDP C;  5CXT A;  4GKK J;  3CTR A;  1A9N B;  1JJ2 R;  4JBC A;  3MZI A;  5DGA A;  2ADC A;  3MCM A;  3HVR A;  2OD6 A;  3DU1 X;  2E1R A;  3VZI A;  2BMB A;  2MQM A;  2OEJ A;  3FJ2 A;  2J8S A;  2RE1 A;  4WU2 A;  1P6T A;  3GYX B;  4J9S A;  4MIW A;  4OI1 A;  2YPZ A;  4J9M A;  4DV7 J;  5AXL A;  3QO9 A;  1VQK S;  2GHW A;  1JLE B;  4N41 A;  4DX7 A;  2OPQ B;  4I56 A;  4LT6 A;  4ED4 A;  1JNZ B;  4OJ1 A;  4O3O A;  5KG1 A;  1U47 A;  4B3M J;  3RR8 A;  2NR0 A;  4DR6 J;  1SIW B;  1T9U A;  4KH0 B;  4ZJO A;  3U27 A;  3LO3 A;  1X9W A;  3N90 A;  3LP2 B;  1SUQ B;  2H3E B;  3HVW A;  1B99 A;  3Q8V A;  3G6Y A;  1VYA A;  2MQN A;  1TKX A;  1ARO P;  4W90 B;  3BV8 A;  5K14 B;  2MQL A;  4C6A A;  5F3Z A;  2EPI A;  4C0H A;  4YDX A;  1HNW J;  2XNQ A;  3D0I E;  2PII A;  2FZK B;  4A8S A;  1JLC B;  3AHP A;  1V5I B;  2CG4 A;  2SXL A;  1LM1 A;  3CDB A;  3K8V A;  2DIS A;  2CQH A;  2QLW A;  3C16 B;  3LQV A;  4IFY B;  2N82 B;  5I42 B;  4FN5 A;  2MXY A;  3KHH A;  2C2Z B;  1WOR A;  3AOA A;  3O6Q A;  3JB9 k;  1YJN S;  4F2R A;  2DRA A;  4UUX A;  3DXS X;  1FDB A;  2Z2L A;  2XLI A;  2FGO A;  3Q22 A;  2DO0 A;  3PVX A;  3H0P A;  1L5U A;  1HNX F;  3C19 A;  4NLV A;  2YNG B;  2WSF C;  3S1T A;  4DG1 B;  5A0Y B;  1RLD A;  1ZPV A;  5CCL A;  2VIH A;  3VV2 B;  4PYA A;  4EBD A;  4W8T A;  3IR6 B;  4RW4 B;  1EKS A;  3PIP Q;  2FLL A;  2BA9 A;  2QJ3 A;  2YQ1 A;  3M2U B;  2NST A;  3PSZ A;  1BUX A;  3M32 B;  2ACM A;  1KHW A;  1WHX A;  1EZZ B;  3TUI C;  3G6V A;  3LF0 A;  2ZBC A;  2W7Z A;  1NSQ A;  3THT A;  4ZIW A;  3B54 A;  2PMW A;  5HN0 A;  2J8K A;  3GIL A;  3MTJ A;  2OEM A;  2H1Y A;  3OXL A;  1SJ4 P;  1SCJ B;  1S1V A;  1V6H A;  1I94 J;  1RLC L;  1YBA A;  2R7R A;  1QA1 A;  5EX0 A;  4PAB A;  5ETT A;  2XI3 A;  1AW0 A;  3M2R A;  4FYY B;  4KR0 B;  5B0G A;  4X4T A;  4RJV A;  3JYT A;  3QT5 A;  2LQ9 A;  2YKN B;  1UVI A;  2LKZ A;  1Q86 T;  1G7C B;  2XQC A;  2WVC A;  1VLO A;  2MZR A;  4QIW D;  1FRI A;  3T9G A;  3TOQ A;  2GW8 A;  3C15 A;  4NLS A;  4LF7 J;  5J2N A;  4FF1 A;  2C3P A;  3BKF A;  3ZC4 A;  4IQM A;  3T6B A;  1K73 T;  3L4B C;  2INV A;  1T9T A;  4HLB A;  1IKY B;  2R8G A;  2J8I A;  4M5D B;  3DRR A;  2V9W A;  1VK3 A;  3QFH A;  4XTT A;  1F5C A;  1QAJ A;  1NEE A;  1XIQ A;  3DLB A;  4OLO A;  2UVF A;  3JQK A;  5EUH A;  5AE3 A;  4NI2 A;  2ODL A;  2MST A;  4WBF A;  3GIJ A;  1HR0 F;  1IVZ A;  1MU2 A;  5I42 A;  3J81 j;  3H4B A;  3NOC A;  1TK8 A;  2B4U A;  4RL1 A;  1HWU A;  2B7B B;  1GH8 A;  2OGU A;  1E6V B;  2JC1 A;  3SQO P;  5E3A A;  1N8R T;  4KPY A;  4OM9 A;  2X6X A;  1HWK A;  4KPC A;  2XSF A;  2UXD F;  1AB8 A;  4LBH A;  2LEA A;  4JI1 F;  3MPU B;  1SL1 A;  1CC7 A;  4QCL A;  1T9W A;  2F8H A;  4AL5 A;  1T05 A;  1N54 B;  1FWP A;  1N0U A;  4CYU A;  5GAG U;  4CTA B;  2E5I A;  1BMQ B;  3Q8R B;  1YVF A;  2RQM A;  3PFO A;  3D9B A;  1MWQ A;  2KYZ A;  3ZZZ A;  2GIF A;  2AV5 A;  4PEO A;  2AD9 A;  3TJA A;  2V8V A;  4MKY A;  1MRO A;  2YQ3 A;  1B64 A;  5FLX Y;  4N5S A;  1S1V B;  1F60 B;  4DV3 J;  3L7U A;  4JYA J;  3NCR A;  2ATC B;  1SKU B;  5D15 A;  2R42 A;  3NAI A;  1A7G E;  1U1Q A;  2M52 A;  5LMU F;  3KLI A;  2CPE A;  4ZVG A;  4DV1 J;  2CWX A;  3WX4 A;  1F9E B;  5EWF A;  5IQ6 A;  5KOW A;  3EPI A;  3O1L A;  2YKN A;  1RSC A;  4S0M A;  2VBM A;  1RT6 B;  1OY8 A;  1U7L A;  4U96 A;  2ROG A;  5I3U B;  3BM7 A;  2E7V A;  4LF7 F;  1PYO B;  3FY3 A;  3HHL C;  3PX6 A;  1VLY A;  3GMG A;  3R27 A;  2W4C A;  3OVS A;  4XO0 A;  2IVM A;  1RT4 A;  3PEH A;  1J2V A;  3UVJ A;  1FK9 A;  1LKZ A;  2OHD A;  3BBF A;  2DIV A;  3Q2S C;  4OHV A;  3UCG A;  2HYI B;  4Q43 A;  2FZG B;  1TYX A;  2E1M C;  2VB6 A;  2IRX A;  3IGV A;  4RW8 A;  4HYK A;  3WZ0 A;  1RQ0 A;  4CT8 A;  4NI2 B;  3TJ9 A;  3QJL A;  4M95 A;  2HIY A;  1PAE X;  4KT0 C;  1MU2 B;  2N7C A;  3C46 A;  2AKW B;  3FC9 A;  2F7V A;  1QLN A;  4P7T A;  1RHK B;  2IRU A;  3I4P A;  3PM9 A;  2EFN A;  1X4G A;  3OUY A;  3V81 B;  1NND A;  2H4Y B;  2IDL A;  2XMV A;  1N56 A;  2VFR A;  3BH7 B;  4OX7 A;  1H73 A;  3I0S A;  3M8R A;  4XLA A;  2Q79 A;  3WIU A;  4Y0F A;  2I0X A;  4O3S A;  1HYS B;  4GC7 A;  3R5G A;  2IBO A;  4DFM A;  4Y2A A;  2E9T A;  1RWU A;  3CJ0 A;  2ZVI A;  1L3S A;  1HHQ A;  2RAQ A;  4LUB A;  4I84 A;  4NEY A;  1MLA A;  1HI8 A;  2IHR 1;  3SZ2 A;  2DRB A;  3UO0 A;  3IS9 B;  2VFV A;  3AD9 C;  2D7S A;  1UA1 A;  5KG2 A;  3R3T A;  3WHI A;  2NSB A;  3MF5 A;  1WKL A;  3UN2 A;  5L9X A;  3H2L A;  4CO3 A;  2CPY A;  2DHG A;  2HQD A;  2LFV A;  2OKQ A;  3C6U A;  3LW5 C;  4L6V 3;  4QR2 A;  2VC0 A;  3MM9 A;  4OX8 A;  4X4O A;  3MEG A;  1EB0 A;  3BO2 A;  2VG7 A;  3RUB L;  3V4M A;  1RDR A;  2BUN A;  4WP9 A;  4JI3 F;  2GIQ A;  1RT5 B;  1EX8 A;  2NXJ A;  2IBK A;  4IOC Q;  5I3Q A;  4JI5 F;  2J0W A;  1PO6 A;  4UY8 5;  2XCA A;  3QZ8 A;  2CNK B;  1RTZ A;  1NH8 A;  3KWM A;  2ZH2 A;  1WXR A;  1IR0 A;  1FWK A;  3DRY A;  5HMX A;  1UET A;  3T1Y F;  4BBY A;  2ZKU A;  3RR7 A;  1X5S A;  4DR4 J;  2F9J A;  2CNL B;  2DNG A;  3CCM S;  5CHC B;  1KFS A;  2HBY B;  4A8K A;  1ZTW A;  1WSR A;  2VG6 B;  2O5D A;  1DFD A;  3V81 A;  5T14 A;  4FYW B;  1R3N A;  3SSR A;  3GFX A;  5KG5 A;  4N8O A;  3MM8 B;  5BJR A;  3A13 A;  3N5F A;  2JSX A;  4O3P A;  2GNK A;  2QA4 S;  4CQ1 A;  5GVQ A;  2CAD A;  2ZOM A;  2VFP A;  2PA8 D;  1UP1 A;  4C7Q A;  1XR6 A;  3FCW A;  1UL3 A;  3MM5 B;  4TU9 A;  3CCR S;  1HMV A;  2BR0 A;  3KMQ A;  1QE1 A;  2XZW A;  2KZM A;  2APO A;  3GV7 B;  2PMH A;  3I56 S;  2VJJ A;  5C7P A;  1Q7Y T;  1J5O B;  3CJQ A;  1PYT A;  4P10 A;  2MHE A;  5C1E A;  3GWC A;  2OIH A;  3L7P A;  3DRS A;  5F41 A;  1RKJ A;  2KFN A;  1K8F A;  1H74 A;  4QOT A;  1M5H A;  2ZJP Q;  2ZHA A;  1UVJ A;  1L3T A;  2G9O A;  3RAX A;  1XJW B;  4DXL A;  4NL5 A;  2H54 B;  4Q0B A;  2W9B A;  3HKZ D;  3B90 A;  1UJ6 A;  1QQ1 A;  5EDW A;  3DLE B;  2LDI A;  3K7R A;  2YWK A;  2HQG A;  3CGI A;  2BV3 A;  4LF2 A;  4N7T A;  4RNM A;  2YNG A;  2VG7 B;  5A0Y A;  5D3G A;  1EZG A;  3TA0 A;  4Y00 A;  2MKH A;  2XBP A;  3AY0 A;  5A6W A;  3US5 A;  4DSE A;  4ED0 A;  4DQP A;  1S7H A;  2R7W A;  3TX0 A;  5LXY A;  3W63 A;  2V63 A;  1NCL A;  1Y3K A;  1JXE A;  5D6G A;  4P9S A;  4RNN A;  1CJT B;  4UY8 T;  4B3S J;  3QRR A;  4OZN A;  1G3O A;  3GLJ A;  3MEC A;  4Y3C A;  4ZLJ A;  1I1G A;  1TSP A;  4O4G B;  4DV0 F;  3U1N A;  4P2M A;  1QCX A;  3X1L B;  4YFO A;  3D2W A;  2KTQ A;  5DDQ C;  3RYL A;  1VC6 A;  3LYC A;  1SQF A;  3VQS A;  1O8K A;  2E9R X;  3W2V A;  1R7I A;  5BR8 J;  3TX8 A;  1WSV A;  4W98 A;  2V8P A;  3IBF B;  1DTT B;  5HLF B;  2HHX A;  4EEY A;  1YZ6 A;  2OSR A;  2ZHO A;  2Y0B B;  1KQF B;  4MFB A;  1S1T B;  4QPT A;  2HRT A;  1E6Y B;  2V2Q A;  3F0N A;  1S1X A;  3C15 B;  4Z2X A;  3DOK B;  3HVT A;  1O0P A;  1CUL A;  4H4O B;  3NLC A;  3CMQ A;  4XLE A;  1RCO B;  2IM3 A;  4ZCL A;  2J6S A;  1CPZ A;  2FZC B;  2HHS A;  2XHC A;  3RB3 A;  2ASD A;  2FD2 A;  4AT1 B;  1DQ9 A;  3CCT A;  1RAJ A;  4LVN P;  3TUZ C;  3OHB A;  5L1J A;  2XG8 A;  3VAH A;  4DU8 A;  4YC5 A;  2HLU A;  1F9H A;  1YBU A;  2MZJ A;  1O8F A;  3AOB A;  1KQG B;  3DRP A;  4ENO A;  2FVQ A;  2U1A A;  1FO1 A;  3LGM A;  4TQR A;  4ITS A;  2DPI A;  2NSP A;  2M2B A;  4FXV A;  4R8U A;  4J9L A;  2XT2 A;  3OBI A;  4JI4 F;  1S1W B;  2UVE A;  1TR0 A;  2WON A;  3DXB A;  4KRW A;  2V5H G;  5J1E A;  1APS A;  1Q5Y A;  4OZ2 A;  2AX1 A;  1EAR A;  1HPZ B;  2GIR A;  4Q2L A;  4PXC A;  4K0K J;  1H80 A;  1X4E A;  4ILL A;  3T1A A;  9ATC B;  5F8L A;  3EUN A;  3GJQ B;  3HZG A;  3AJ2 A;  2BM5 A;  3QT7 A;  5DQI A;  4B3S F;  4U49 A;  2E5G A;  2LQB A;  2KKH A;  4GC6 A;  1HD0 A;  2EFQ A;  1TU0 B;  3HT0 A;  4HL9 A;  2RVJ A;  4O4G A;  1CVJ A;  2WVF A;  2V50 A;  2XO6 A;  4DL5 A;  1URR A;  1C1C B;  2BAN B;  5IWA J;  3EYZ A;  2X3H A;  4BDP A;  3OJU A;  2FVR A;  1BQM A;  1MG7 A;  1O8L A;  3D0H E;  4JI2 F;  5GMK a;  4DPX A;  4AQY F;  1NJI T;  2JWN A;  2G1D A;  3DKD A;  2F9D A;  3EGV A;  4O3Q A;  2B5J A;  2HFS A;  4USV A;  2VIC A;  4AXI A;  4QZV B;  2HNY A;  3PY8 A;  1BLU A;  2MDA A;  3HDS A;  1LLW A;  1S9G B;  1T0T V;  1WEL A;  4GO5 X;  2PEC A;  2E7W A;  1YRT A;  1E6Y A;  4KAI A;  1PE9 A;  3R7B B;  3W66 A;  2LQ5 A;  4I2P B;  2XM3 A;  4TY9 A;  2C2O B;  2I5J B;  3NMR A;  2KHC A;  1RTI B;  4J5O A;  4C98 A;  4IFY A;  1NLK L;  3ENV A;  2AX0 A;  4OZ0 A;  2JLG A;  5A8W B;  2UUW A;  4ECV A;  3T1Y J;  5L1I A;  3UVJ B;  4Z7Y A;  5KG6 A;  1TZ0 A;  3EPG A;  3HLU A;  1HW8 A;  4DR5 J;  3LH2 S;  2R2S A;  1QTM A;  3TZW A;  2RU9 A;  4IH7 A;  1O8I A;  1X7V A;  3UN5 A;  2CQ4 A;  4DCP B;  3QID A;  4CO2 A;  2W8L A;  4LF9 J;  4YOE A;  1NKE A;  1LWX A;  3AFG A;  4L3N A;  4ZHR B;  3CCV S;  2JHE A;  3VQT A;  3K5N A;  4ZP8 A;  1HBM A;  1S0M A;  2ZBI A;  4XOT A;  4RUB A;  2BAC A;  1GT8 A;  4ZP6 A;  5HAO A;  2YXL A;  2XSJ B;  5L38 A;  5KT4 A;  1XNR F;  1C4C A;  1K1Q A;  2B3T B;  2KVI A;  2ZUG A;  2MGZ A;  1FTC A;  1K1S A;  2AHO B;  3DYA A;  1IKV A;  1JKH A;  2G4B A;  2KJV A;  4CLP A;  3OTO F;  2JX2 A;  1CEZ A;  2EBG A;  3WC0 A;  4PCQ A;  4RW9 B;  1N36 J;  1X5P A;  1X0P A;  2B0G A;  3BQ0 A;  2FGC A;  2BE2 B;  2I9S A;  3JSB A;  3H7H B;  4ECZ A;  3T3F A;  4H54 A;  2D3U A;  2RHQ B;  2Y1L B;  3LAM A;  7FD1 A;  2AT1 B;  3M8Q B;  4JI2 J;  3ZPP A;  4P2F A;  2VC1 A;  3J80 U;  2YX1 A;  5CD4 H;  1RJJ A;  1UJ4 A;  2KRR A;  4L73 A;  3Q23 A;  4KB7 A;  2D3O R;  2YNF B;  2UUA F;  1UKU A;  2D41 A;  4OJG A;  4LRB A;  2VA3 A;  3B6B A;  2NZM A;  3MM9 B;  4GVB B;  2HKE A;  1KTQ A;  2GML A;  3MEG B;  3QYY A;  3Q8P B;  2RHS B;  8ATC B;  3NXZ A;  1ZM3 A;  2HVH A;  3PHT A;  3EVO A;  5A6P A;  2IY5 B;  2R2R A;  2ZH7 A;  3T5L A;  3RW7 A;  2YNI A;  3KRG A;  2NT9 A;  5KFW A;  3HZE A;  2AJ4 A;  2UUB F;  1IM4 A;  1C0T A;  3QGH A;  1QD1 A;  4B9V A;  1TK0 A;  1KN6 A;  3PW2 A;  4USH A;  5BYS A;  2DGW A;  2LA4 A;  4DU7 A;  3R1L A;  4CM0 A;  4P75 A;  4TNO A;  4O0N A;  3PW0 A;  1WKK A;  1H72 C;  3GTY X;  4EU0 A;  2UVW A;  5T7L A;  4YME A;  5DQH A;  2ZBQ A;  1HNI A;  5HJY A;  2H48 B;  3R9L A;  5HP1 B;  4CTA A;  2QN6 B;  1O8E A;  2AJQ A;  2CA9 A;  2F65 A;  4ALZ A;  4LFB F;  4L76 A;  4WFN Q;  3M1V B;  4HT7 A;  1OOC A;  1LWE B;  2DXE A;  4QWB A;  5HAT A;  5HBM A;  2QMU B;  4F8R A;  3GQA A;  2LEC A;  2OFG X;  1EAY C;  3NGR A;  2MKI A;  2YWH A;  5D0G A;  3RB6 A;  4KY3 A;  4KGM A;  2WCX A;  3FBF A;  3HD2 A;  3VTI A;  2GMH A;  2HRY A;  3GG1 A;  4Y65 A;  3UW0 A;  2O1P A;  4LSN A;  5D4N A;  4F0M A;  4DLE A;  1SC4 B;  3PO4 A;  1WI6 A;  4KBI A;  5AMV A;  5EWE A;  5I3U A;  4DN0 A;  2LEB A;  4B02 A;  2UXC J;  4DUY J;  4PG4 A;  4NK6 A;  2QE5 A;  2W24 A;  3CCJ S;  2W9B B;  4DL7 A;  4RUC A;  2CVE A;  9RUB A;  3IWN C;  1U6Z A;  4YZX A;  1ZM9 A;  2V6A A;  2VFU A;  4B9N A;  2CPH A;  3M6U A;  4DSL A;  1OS5 A;  5L8R C;  3TEG A;  2VPX B;  2XMU A;  1VQN S;  3RBE A;  4XNF A;  2ASY A;  2ZM6 J;  2VPZ B;  1LOU A;  2RRN A;  3W5Y A;  1F2G A;  3DU5 A;  4NA3 A;  1KTW A;  1QAY A;  1CS4 A;  5H9F J;  5K9F A;  3ZZT A;  4R5P B;  3MAQ A;  2OPR B;  4YP3 A;  1SXL A;  3BDE A;  4HTI A;  2BYC A;  3R8Y A;  1N32 J;  3VAL A;  2WTF A;  2XO7 A;  4B3T F;  4C8Y A;  4Z03 A;  1NHC A;  1P1T A;  2MZQ A;  1YGY A;  1CJK A;  3SCI E;  1UVM A;  3BSC A;  1WC1 A;  2EFP A;  2IPO B;  3PYD A;  2DNL A;  4UQT A;  3GG0 A;  4WWS A;  1OSD A;  4F3O A;  1LWE A;  2HIQ A;  5HBM B;  4DR2 J;  5J2Q B;  2V2Z A;  1S1X B;  2O6W A;  1ZAV A;  2JH3 A;  2JZ5 A;  1T05 B;  1FKA F;  3ILI A;  3AK5 A;  1IKW B;  2BJ1 A;  3NGK A;  1N48 A;  3R5D A;  5K5M A;  4LF5 F;  3OL9 A;  2NS1 B;  2L41 A;  2GO8 A;  3TEH B;  2KG1 A;  4DR5 F;  2Z8Q A;  3LOU A;  4M5I A;  3NGT A;  4ECY A;  2W2Q P;  1U1N A;  4V02 C;  1IDK A;  5AXM A;  3VF0 B;  4U8Y A;  1FNO A;  5C25 A;  2X1F A;  1VQP S;  4RWX A;  1UEV A;  2Z4P A;  5C5J A;  5C24 A;  4DUY F;  1M1H A;  2FVS A;  4YDD B;  1PGZ A;  2P5V A;  1IXK A;  1P27 B;  2HWT A;  2W2O P;  3CE8 A;  1EA0 A;  4NLD A;  3H98 A;  4JV0 A;  5J1E B;  2CPF A;  2N7Y A;  1EET B;  1HPZ A;  1WDD A;  4OI4 A;  2XWY A;  1KS2 A;  2G13 A;  5DGB A;  1NJX A;  4UOH A;  1SKS A;  3R7S B;  3QAU A;  2GAH C;  1NHK L;  1PJ6 A;  4NMX A;  2DTJ A;  2ZWP A;  4RW8 B;  4YEI A;  1RWK B;  4CH7 A;  1IBK J;  1VQ5 S;  4FF4 A;  2C2N A;  2HHT A;  1Q4R A;  1TVR A;  4DS5 A;  3W61 A;  2JOQ A;  4LIR A;  2PD1 A;  4FPI A;  2VJI A;  2EK1 A;  1H2T Z;  3AAW B;  3O5T B;  4PR6 A;  1WOO A;  3D6H B;  3MD3 A;  1JWW A;  1S59 A;  3EVW A;  5HMY A;  3NL0 A;  1ZM4 A;  2DNP A;  3ZNJ 1;  3ZNU A;  1RWW B;  1FKO A;  2CXE A;  3HHL D;  3QFW A;  1RE1 B;  3I0S B;  3EM1 A;  1OFE A;  1YZ7 A;  4G1Q A;  3UWT A;  1AA1 B;  2HND A;  4OYA A;  4CNY A;  1YDL A;  5GAH U;  1VBZ A;  2R4F A;  4AUK A;  1SC3 B;  2HNY B;  2MHN A;  3Q83 A;  4KFB B;  2RQC A;  2WSC C;  3H40 A;  3PZP A;  1J5O A;  2PGC A;  4Q8F A;  2Z2M A;  1KVK A;  3GV5 B;  4LFC F;  3DRS B;  4LJM A;  3A1Y G;  4RW7 A;  2KFY A;  3G9C A;  3I5B A;  3MEK A;  1WF0 A;  1H2U X;  1PCA A;  2HGL A;  1Y5N B;  2AEF A;  3LTO A;  4HTJ A;  3UDV A;  3J7Z T;  5I3P A;  3SDE A;  2B9W A;  4QIF A;  2HMI B;  1Z4U A;  2P8I A;  4FBT A;  1BHE A;  3OR2 B;  1WNE A;  3KK2 B;  4LR9 A;  3HKW A;  3S7R A;  3TA2 A;  2E5H A;  2IC3 A;  1HF2 A;  1ZOT A;  5M2P A;  2MQQ A;  1Q95 G;  2UUC J;  4YCQ A;  3E8O A;  1TFW A;  5KT2 A;  1W7W A;  1UMJ A;  2J0Q D;  2QEX S;  1OFD A;  4EI2 A;  5IFM A;  5A8K B;  4K4S A;  3FCV A;  2UU9 F;  2R7Q A;  2JDJ A;  1UEK A;  4DR3 J;  1QA3 A;  2K8G A;  2BKP A;  4NLP A;  1FRK A;  4XAK A;  5ETK A;  1O5J A;  2M3D A;  3MMA B;  6FDR A;  3BS9 A;  2CZ9 A;  3UCU P;  3BN4 A;  2QIF A;  3UQS A;  2V9K A;  5D0R A;  5GMD A;  5HMW A;  2QG9 B;  4CCH A;  2PFF B;  1VRU B;  2D74 B;  4RUH A;  1X9M A;  3A3N B;  4LQ3 A;  2KDO A;  1HBO A;  1LK7 A;  2ROP A;  4ZVP B;  3HHN B;  2VG5 A;  4CO0 A;  1RHM B;  3CNQ P;  3QLH B;  3DOK A;  3HVT B;  4HT5 A;  4A8W A;  2FLP A;  2DNN A;  2DBB A;  1NM2 A;  3GP9 A;  2B4V A;  3OR1 B;  2EFG A;  2MJU A;  4BWJ A;  1KC8 T;  4QR1 A;  3EIC A;  1LNQ A;  4UT4 A;  4J9N A;  1S9E A;  3W9J A;  2FLO A;  1AZS A;  5BXI A;  4NOH A;  4X65 J;  3Q86 A;  2Q43 A;  4R0J A;  2J7U A;  5JMC B;  3ZZR A;  4QPX A;  3KMS A;  1BN8 A;  3PET A;  4LRA A;  2OPQ A;  4N8N A;  2HQF A;  4NE9 C;  4F50 A;  2RML A;  2E29 A;  2IAJ B;  2WSE C;  3C6T B;  1S5Z A;  3HHE A;  1NB2 A;  4D3H A;  1FDD A;  1U1O A;  4IR1 A;  3ZZP A;  2PYG A;  3L95 X;  2XTW A;  4LQ9 A;  4URQ U;  4XPE A;  2VL1 A;  3DNC A;  1N32 F;  4FBU A;  1JJC B;  2DGU A;  4B3T J;  2GQ2 A;  2L3M A;  3I87 A;  2DHA A;  1FJG J;  2BXJ A;  3POT A;  3RBX A;  2QRR A;  4C9D A;  3CCU S;  4F2S A;  1R8A A;  2CQB A;  3K5O A;  2UU9 J;  3BDP A;  2RRB A;  1X4C A;  1KLM B;  3KFW X;  4DR3 F;  1VJW A;  2HK2 A;  3WIV A;  3CSK A;  3PW5 A;  5KFB A;  2ASJ A;  4B9L A;  1SKW A;  1VIO A;  1S6Q B;  2FIU A;  4LF1 A;  4ZKA A;  3IAM 9;  3CVK A;  3MFI A;  3VAG A;  5KFY A;  1JLF A;  4K4T A;  3FZB A;  2VPW B;  4F26 A;  4LSZ B;  1X5O A;  1T03 B;  2ALZ A;  2LYV A;  2ADB A;  4K7Q A;  3CCE S;  4M1K A;  1KKH A;  2B0R A;  1V3Z A;  3J81 Y;  3D54 A;  4ER8 A;  3CJR A;  1TUV A;  1F3V A;  1FKP A;  1Y10 A;  5ETR A;  1QSS A;  4XQF A;  1UJ5 A;  3W5Z A;  1PAU B;  4K5S A;  2X1G A;  5A8R A;  4ES1 A;  1XC9 A;  3JSY A;  4GO7 X;  4MYU A;  3H5Y A;  3MGJ A;  2J0S D;  2DH7 A;  3DLG A;  2CPJ A;  1JLG A;  2U2F A;  3CW2 C;  4FS2 A;  1U1L A;  3BKT A;  3I32 A;  3ONQ A;  1A6L A;  3LP1 A;  3CC7 S;  1BWE A;  5E5N A;  5DQG A;  2IAJ A;  3LGH A;  3FCH A;  1NZ8 A;  4K5R A;  2D3Z A;  4P6Q A;  4ES2 A;  1FHT A;  4DFK A;  4PPD A;  1RT3 A;  1YTY A;  1UPM B;  2OO4 A;  4IRC A;  4NYP A;  5J2N B;  3ZTR A;  4XMY A;  4OI0 A;  4HHU A;  3UW1 A;  3KK1 A;  2PYH A;  1GFW B;  3RGI A;  5KFU A;  3W2W B;  2W8K A;  2A6O A;  2VQF F;  2DPJ A;  2UZA A;  3G71 S;  3ML3 A;  1J27 A;  2HVI A;  4C0O C;  3HVA A;  3BEG B;  4A8Y A;  1RU1 A;  5KFT A;  1LFW A;  1QUP A;  3BB5 A;  4KKO A;  2V67 A;  2R8I A;  4NXM J;  1RI7 A;  1S6O A;  4QYZ K;  4OJL A;  4RW9 A;  4CH0 S;  3N6M A;  3P8B B;  3UN3 A;  3SCJ E;  4Z7C A;  3OL7 A;  1GMV A;  1T3N A;  2GHV C;  2UV8 G;  1ZAW A;  3NAW A;  2XNR A;  1FRH A;  3DOM B;  4QWA A;  3R2C J;  1N33 F;  3M6X A;  2JLE A;  5F8I A;  1IKW A;  2INU A;  3IBW A;  4X84 A;  2HS3 A;  4AYB D;  1U09 A;  3HM9 A;  2N3L A;  1WF2 A;  1Z2L A;  4DQS A;  2OJ3 A;  2ZDP A;  3FGV A;  1WI8 A;  2EWE A;  3BJY A;  2B9Y A;  1S1U A;  4TU8 A;  1NME B;  1DTQ A;  1TV6 B;  3SSQ A;  2HQC A;  2M0G B;  4ZIT A;  2XMT A;  1JXL A;  4NYZ A;  3G82 B;  2PI4 A;  4WZQ A;  1JNR B;  4U7C A;  2RQ4 A;  4OV6 A;  2A18 A;  2IM1 A;  2RH3 A;  2RUS A;  4OZ3 A;  2DR5 A;  3OTC A;  2B8P A;  1M5O C;  4DF8 A;  1ZTT A;  5B0F A;  1CJV A;  3E01 A;  1Y7P A;  2Z56 B;  4E0D A;  2POK A;  2P9G A;  3B78 A;  3OVB A;  1U24 A;  1UTA A;  4RNF A;  3I0R B;  2XTJ P;  3BZQ A;  2DGS A;  4N77 A;  3UPF A;  4QYZ J;  3TZX A;  2I1R A;  3UR0 A;  2RF2 B;  1Q0N A;  1IBC B;  3CDW A;  5J2P B;  2QV6 A;  4I6A A;  4K50 A;  2YWF A;  5AXN A;  4MH8 A;  2OTL S;  1Q16 B;  2ZBP A;  4G65 A;  4QU6 A;  2VFN A;  4XLH A;  4URS A;  5H9F K;  4XIU A;  3OW2 R;  1H38 A;  3LUY A;  1PXZ A;  2QX0 A;  3CPW R;  3BQ2 A;  1S4E A;  3HK2 A;  3ZZY A;  1G6B A;  1X4F A;  5ETQ A;  4CO1 A;  1NK6 A;  1RB0 A;  4B9U A;  3OFG A;  3V4I B;  3M8P A;  2VQE F;  3VHQ A;  3MXH P;  1IKV B;  4O3R A;  2VOD A;  4X65 F;  5AXK A;  5HQL A;  2LQJ A;  1FX2 A;  2HBQ B;  2HWH A;  3M8W A;  3V6D A;  4NLG A;  2ERR A;  2V2V A;  5E3Q A;  3B8Y A;  4ZPV R;  1FT8 A;  1X31 C;  5IT9 Y;  4OYB A;  1VHF A;  3OUY B;  5JVH Q;  2M8H A;  2NRE A;  2CQ3 A;  3C8Y A;  3V6J A;  3PJX A;  1XQI A;  1S76 D;  2HMI A;  2DT9 A;  1HNZ F;  3CJ2 A;  1VQ7 S;  5G0R B;  3QRP A;  3ITH B;  5D4P A;  1B7F A;  4CLW A;  5K8N A;  3LAN A;  1D9F A;  5KFV A;  4R0E A;  4K4X A;  2P6T A;  4DBQ A;  4GVB A;  3OTB A;  4M5M A;  5IV4 A;  1FJ7 A;  4OJO A;  1S48 A;  2ZJR Q;  4X4U A;  1ZPW X;  4ILR A;  1K8A T;  1FE4 A;  2MMY A;  2MLZ A;  3RB0 A;  3GR0 A;  3IS9 A;  5ADZ A;  3QZ7 A;  1VQ8 S;  1XN9 A;  2WOM B;  2JJ4 D;  4F4Z A;  4ETZ A;  3TAQ A;  4CO5 A;  5IXU A;  4F02 A;  4K0K F;  1O8J A;  4K2X A;  2XT4 A;  3LMW A;  1UFL A;  4UQG A;  4HAC A;  1DBO A;  4H4M B;  5E3C A;  4UST A;  1GQE A;  4ECX A;  5BYQ A;  1D1U A;  5IZH A;  2B6A A;  5DLF A;  3HX9 A;  4WJB A;  5E7O B;  1K9M T;  1D8Z A;  4JI5 J;  2OUG A;  3M1V A;  3PR4 A;  1UFK A;  3RRK A;  3C66 A;  3HHD A;  5GAE I;  3TVY A;  5KFS A;  2GQC A;  4U67 Q;  1XWL A;  4ZCI A;  1HKA A;  1HQ2 A;  3F56 A;  4AE5 A;  1N6Q A;  1YBT A;  4CLT A;  4W8R A;  2FHK A;  4RWW A;  4LRE A;  5THW A;  2CQD A;  1XR5 A;  1WEZ A;  2C2E A;  2BEF A;  2G0Y A;  4OJ5 A;  1PLU A;  2P9C A;  3OQ2 A;  4IG3 B;  3V5R A;  1HI0 P;  2R7U A;  1YHQ S;  1M5K C;  4C8M A;  2BW2 A;  5CQG A;  2X6W A;  1HBU A;  3NCQ A;  1HQU B;  1QTN B;  4RPF A;  4OZJ A;  1TL4 A;  2ABY A;  1YIT S;  4IDK B;  3EWG A;  3GIR A;  1Q8L A;  4ZVF A;  4M5H A;  3R97 A;  4ZLL A;  1WKJ A;  2AGP A;  4F0H A;  1KLN A;  2RT3 A;  2RNE A;  5HVF A;  4JI0 F;  4CT9 A;  3KG1 A;  1UAW A;  1VMB A;  2CJ9 A;  4P74 A;  2R7X A;  3I9V 9;  4MJK A;  2BAB A;  2HZC A;  3FRY A;  1TKZ A;  3TJ8 A;  4E2F B;  2V4R A;  3CIZ A;  4ZJL A;  1YK9 A;  1TYU A;  2DGX A;  2EI5 A;  2GVZ A;  2RDD A;  4NZ7 A;  1U0H A;  4ZS6 A;  3PKY A;  4N76 A;  1P9Y A;  1BXN A;  1XR7 A;  2CJB A;  3TP2 A;  2FQQ B;  1NPP A;  4K4Y A;  4FF2 A;  3ZTS A;  3IP0 A;  2EKY A;  1QRC A;  1JQG A;  4UTG A;  4NXN F;  4KO0 A;  2DCU B;  5JUM A;  3AXM A;  4U6P A;  1J5E F;  1YJV A;  4Z05 A;  4PQU A;  1KON A;  7FDR A;  1N36 F;  2UVU A;  1KDN A;  1PIL A;  2G1H A;  2XEX A;  2RQK A;  4YY3 J;  1NRK A;  4BHQ A;  3N6N A;  2NT6 A;  3QGP A;  4PKD B;  3MEC B;  1WTB A;  3IMQ J;  1CLF A;  3TVZ A;  2WZ1 A;  3I5A A;  2AQ4 A;  2F8E X;  4XR6 A;  2CDQ A;  2ZEJ A;  3AOD A;  5J2M B;  4DV0 J;  4I4B A;  2J76 E;  3VR1 A;  2CPI A;  3L7O A;  5I4M A;  2MYF A;  3L9Z A;  1FJE B;  2D3O 1;  2Y8W A;  1DBD A;  2AEM A;  3HPO A;  1TEL A;  4AL6 A;  4LF6 J;  4DMZ A;  5BR8 F;  2CJQ A;  3SXL A;  4X4Q A;  2XY7 A;  1EQ0 A;  3CJ3 A;  3ZXW A;  1HBU B;  2GVD B;  1QRB A;  3I6P A;  1RT2 B;  3DMJ B;  1FVS A;  2EWH A;  2HQI A;  4MFB B;  2W25 A;  2DD8 S;  5IT0 A;  1VOM A;  1KNZ A;  1JLQ A;  1DQ8 A;  2RD5 C;  1ZA1 B;  5JJB A;  2F1F A;  3CD0 A;  3DN9 A;  2MQO A;  4NCB A;  1S0V A;  1AXQ A;  2CZV C;  5FDL A;  3MR2 A;  3EDQ B;  4WYW A;  2VOP A;  2OTJ S;  1HBN A;  1VK8 A;  4A8X A;  2BJ9 A;  3PX4 A;  2V8D A;  2YH0 A;  2ZBR A;  3T5J A;  3VGS A;  2J9E A;  4DV6 F;  3M30 B;  3GSI A;  3NGS A;  5GAD U;  4CP5 A;  3NKY A;  2VDI A;  3RIQ A;  1TMJ A;  4FXD A;  5KOX A;  2W4P A;  1NJZ A;  1IB4 A;  4KQZ A;  3U7J A;  5DG7 A;  2VA2 A;  3VGU A;  5U47 A;  3RTV A;  4OI6 A;  1H7W A;  1WC3 A;  4HHH A;  1DAX A;  4DHV A;  4QBU A;  1HL6 A;  4KSE B;  2UXD J;  3M2V B;  2CJY B;  3OTE A;  3CUL A;  2HK3 A;  3N28 A;  1NU4 A;  1X4A A;  2BOP A;  1RAI B;  2HUR A;  1FKO B;  1RAE B;  4P52 A;  2ZH9 A;  2NXN A;  4RW4 A;  1R6V A;  1OO0 B;  2DO4 A;  4ANC A;  3LAL A;  4ELV A;  3KLF B;  2WW4 A;  3CJT A;  1ZYQ A;  4DF4 A;  4PWU A;  4OX9 F;  4FYD A;  1XNQ J;  3O2I A;  1X9S A;  3NNA A;  2DR8 A;  2F4F A;  1S6U A;  4V1A k;  4A46 A;  4B3R J;  3UCZ P;  4NCG B;  2BBE A;  2KT3 A;  3JQJ A;  3PJW A;  1BQM B;  1VBK A;  2OFH X;  3T9Z A;  2QSW A;  4YB1 P;  3I0R A;  3PYE A;  1JXV A;  1WAC A;  2YKO A;  5KFE A;  3FQL A;  4JI6 J;  1S97 A;  3CD6 S;  1K0T A;  4EBC A;  3PSS A;  3S01 A;  1LLZ A;  3AD8 C;  4P71 A;  3UE2 A;  3EZO A;  3KLE B;  3LWM A;  3EX7 B;  1NK4 A;  1AUD A;  2K1R A;  3LGN A;  4JI7 F;  1W25 A;  3PEJ A;  3BH6 B;  1ZAX A;  1YJ9 S;  2WVB A;  4TY8 A;  2GS8 A;  1N34 J;  2X51 A;  1RWN B;  4C3K A;  1SC1 B;  1JMT A;  2O66 A;  4FZV A;  2L9W A;  2XI2 A;  5IC6 B;  4IG0 B;  4JI8 F;  4JV5 F;  1D8Y A;  3R5A A;  1IKY A;  3DRR B;  1S7I A;  2QMX A;  4ZVT B;  3CT9 A;  2H5E A;  2CPZ A;  3MMA A;  3MCN A;  4L75 A;  4C3M A;  3V4I A;  4NCA A;  4P2S A;  2RDI A;  3MPW A;  4DX8 H;  1R6Y A;  3GIM A;  2Q6B A;  1LW0 A;  1HQE B;  2AYG A;  1OJ4 A;  2MQ8 A;  3QJJ A;  2HAF A;  4U7U K;  2MLY A;  1TYW A;  1KTV A;  1OY6 A;  2AW0 A;  5D77 A;  1FRX A;  1HNW F;  1IA5 A;  3CO0 P;  3NEK A;  3FZ2 A;  2KI2 A;  3GE9 A;  3OLB A;  3NBP B;  4KGV B;  4G1P A;  1L1I A;  4V19 J;  2GZO A;  2ZVS A;  3MM6 B;  4XL9 A;  4XDC A;  2RS2 A;  5KG7 A;  4LF4 J;  1VQ6 S;  3QJP A;  4DR7 F;  3AB4 B;  1HNX J;  4EW9 A;  2J7W A;  1X4H A;  1AFI A;  3ET6 A;  1R43 A;  4U95 A;  1RUS A;  1JLA A;  1NJY A;  1AZS B;  3CJ8 A;  4C48 A;  1RAG B;  1ZS6 A;  3KJN B;  2IOU G;  3MR7 A;  1M1G A;  3GJR B;  3UI3 A;  5KT5 A;  3TAR A;  2BE2 A;  2DGQ A;  3BN7 A;  1FES A;  1XER A;  3EGW B;  4DV2 J;  1MSW D;  3CD5 A;  1P1L A;  3M8Q A;  2G2O A;  1R8H A;  1N33 J;  4O3N A;  1V9O A;  3FRZ A;  2KN4 A;  5D0E A;  2ZZT A;  2WW8 A;  3FNN A;  4ZMM A;  1SKR A;  1D9A A;  1OIA A;  1TP7 A;  2CKW A;  2DNZ A;  2IDE A;  2OPS B;  2QGF B;  2KO1 A;  4M8L A;  4DX6 A;  1ZET A;  3FBB A;  3KXD A;  3ZTQ A;  4RU2 A;  1T7P A;  4JI7 J;  2OD4 A;  3DOL B;  2ATL A;  2K1R B;  3UFC X;  4IUF A;  2CRL A;  4RZR A;  4DL4 A;  1IJE B;  2EKN A;  2MY8 A;  5IM0 B;  2ZH4 A;  2DR7 A;  2G0J A;  2B51 A;  3AOC A;  1FCA A;  3FUY A;  3AT1 B;  4WK3 A;  5AT1 B;  2B9E A;  2XHW A;  3C16 A;  3W1Y C;  4DUZ F;  3ELH A;  1AYE A;  5DDR C;  1RAC B;  5KT6 A;  1F9F A;  2UUB J;  4IR9 A;  1S6Q A;  1FWL A;  1TAQ A;  1LK5 A;  2EEY A;  2FTR A;  1F2H A;  4DQR A;  2AWZ A;  1AT1 B;  3UNY A;  2D9P A;  1S49 A;  1KQK A;  4XOR A;  4ZVH A;  1P9Q C;  2ZWO A;  2O04 A;  3B4M A;  2VQE J;  5GME A;  2YKM A;  2O3D A;  1UWB B;  4B08 A;  4PG8 A;  4OYM A;  3JAM Y;  1N5Y B;  2BM7 A;  1SJ3 P;  3NBP A;  4IH5 A;  4Q2M A;  4YDT A;  4TU7 A;  2AZ1 A;  4I67 A;  5EN1 A;  1EIY B;  2PEH A;  1FE0 A;  3NGU A;  4USW A;  2O01 C;  1FRL A;  4IDK A;  1X8D A;  2GQQ A;  3MOZ A;  2MKJ A;  2IIH A;  4BCA A;  3BGR B;  1U4B A;  1KQ5 A;  1O8H A;  2WVD A;  1IBL F;  1NDK A;  1G4C A;  5HMZ A;  3CED A;  7AT1 B;  5DJB A;  5L46 A;  2C2D A;  2HHQ A;  3I82 A;  4PAA A;  3UDC A;  1LWC B;  3IRX B;  2UVR A;  1JLG B;  5KFM A;  1QDU B;  5J1N A;  1N5Q A;  1FNM A;  2IYI A;  3C14 A;  4NK8 A;  1RA6 A;  3ZZU A;  3JYT B;  3BSO A;  1QAI A;  2HEK A;  2UXB F;  1S12 A;  2DR6 A;  4OMF G;  1F5B A;  1T3O A;  5LSR A;  1FXR A;  4XLF A;  2LMI A;  4ATN A;  1LWF A;  1YJT A;  3AJD A;  3CMA S;  1BQN A;  3O3L A;  4KGX B;  4NPO A;  4AND A;  5CYJ A;  3T1H F;  3GYN A;  5DZ7 A;  4EFA C;  4JYA F;  1SH3 A;  5E0O A;  2HGN A;  4KGZ B;  4B3R F;  4B3O A;  1XBW A;  1YJR A;  3SUC A;  2AF6 A;  2QA1 A;  3W2W A;  1TKX B;  1TL5 A;  4P7V A;  4OYZ A;  1S99 A;  3T6J A;  4FNH A;  4ZJQ A;  5KTQ A;  1SL0 A;  4AD6 A;  4DCJ B;  4K2J A;  2XS5 A;  2BQR A;  4DUZ J;  4OX6 A;  2F3J A;  1Z2Z A;  2V94 A;  2GFF A;  1QAX A;  3PCO B;  4RX6 A;  4PMH A;  2DK2 A;  2NXE A;  2XYH B;  4YN3 B;  2MKK A;  3SY2 A;  1RAH B;  4AL7 A;  1Y00 A;  4G3I A;  1Y9O A;  5HRO A;  4B9T A;  1SVD A;  2ACY A;  2QYG A;  4HDG A;  3NCP A;  1UW9 A;  3KNG A;  1BQX A;  2AJ2 A;  4Q8E A;  4DG1 A;  5DDO C;  5CA5 A;  2RIL A;  3D67 A;  3GCW P;  4CYU B;  3QRQ A;  1EQM A;  3PKM A;  1HIY A;  1N5Y A;  2M9K A;  1RU4 A;  3QBC A;  4F7V A;  3G82 A;  2DHS A;  2YNH B;  2W4D A;  5HQ8 A;  2XY6 A;  4LF8 F;  3NS6 A;  3H5S A;  1HA1 A;  3SEO A;  1JLQ B;  3A8I A;  4ZP7 A;  4JI8 J;  3MMC B;  4JV5 J;  4TLQ A;  3QSY B;  1REV B;  2XLK A;  2Y9H A;  2XGP A;  2BM6 A;  3GZ7 A;  1XTZ A;  3B8H A;  1PSD A;  3IWL A;  2Z57 B;  5FDL B;  5A76 A;  4IFV B;  1HBN B;  1RU2 A;  4LSL B;  4USJ C;  4RNH A;  4JI0 J;  3IM8 A;  3TAN A;  2FY1 A;  2IJF A;  3K17 A;  4ED2 A;  4W92 B;  2CQC A;  3NY0 A;  2B6A B;  4NWB A;  1WC6 A;  4DJB A;  4JB8 B;  1KSP A;  4CLU A;  4PXE A;  3SFG A;  1BQN B;  2GJF A;  4JI4 J;  2WB1 D;  3NS7 B;  1M5V C;  1UVN A;  1GXL A;  3JTN A;  2HS0 A;  1D09 B;  3TR5 A;  3A8J A;  5CCM A;  2R7T A;  1SQG A;  3D6T B;  4NA1 A;  3NWR A;  4NML A;  4OZ5 A;  4LF4 F;  3H5U A;  4DR7 J;  4MKV A;  5FJ4 A;  1FEE A;  4P2X A;  4K59 A;  3V6H A;  2J5A A;  2Y0S D;  3WQP A;  3OFF A;  4MYT A;  2CG8 A;  2QX3 A;  4HH1 A;  3H8Y A;  3HUL A;  3TAM B;  2PMZ D;  4CI0 B;  1SH2 A;  3SYZ A;  2BDP A;  5CD4 A;  1TVR B;  4YQW A;  2I38 A;  2DNY A;  4LFA F;  3IO1 A;  3DRX A;  2RKI A;  1D3W A;  3FSI A;  2P2C B;  3SBM A;  3TW0 A;  3KHR A;  4WZM A;  3S8S A;  1NKB A;  4W8Q A;  1V3R A;  1OFL A;  1Y11 A;  1U26 A;  4WTO B;  2HRU A;  2HAI A;  4YR0 A;  1FXL A;  2JFD A;  2JVO A;  2QZA A;  3THP A;  3ITH A;  4ECR A;  4Y34 A;  1OFM A;  4M5G A;  4DV7 F;  4EZ9 A;  1U6B A;  1X60 A;  2PI5 A;  1B4S A;  3KUE A;  4NZ0 A;  1EE6 A;  3ZZ0 A;  1EKR A;  2HZV A;  5K14 A;  1W26 A;  4ZVQ B;  1C0U A;  3VST A;  1ICE B;  5M2U A;  4ED1 A;  2YTC A;  3K5M A;  2HHH J;  2LXF A;  4LMZ A;  3ILO A;  1JJH A;  3P45 B;  3CCW A;  2OMO A;  5D4O A;  4IG0 A;  1HHT P;  5KFN A;  4X4N A;  1VQS A;  6FD1 A;  1MMD A;  3D5M A;  2HHV A;  2X7I A;  2ZE2 A;  3GII A;  1T94 A;  2A2D A;  1U49 A;  1M90 T;  1FNX H;  3JSM B;  2B8Q A;  4CLS A;  1YG0 A;  3JS9 A;  1YX2 A;  3TH0 A;  4OPW A;  1QJV A;  2CQ0 A;  2HVZ A;  4KH3 A;  4A8F A;  5LM7 E;  1W2I A;  4CLZ A;  5LSL A;  1L3U A;  3NNC A;  5JMN A;  2A10 A;  4DV6 J;  3I31 A;  2ILY A;  5CYM B;  3ULH A;  2LU1 A;  2YWG A;  2E44 A;  3QT8 A;  3R6L B;  3GQC A;  3K58 A;  2V2K A;  3PRD A;  3GYG A;  3TUP A;  1U45 A;  2EXU A;  1K0V A;  1RTD B;  1RT4 B;  1RYR A;  3Q8Y A;  3MM7 A;  3KOA A;  5SUH A;  2DRD A;  1FK9 B;  4CLF A;  2GAG C;  2O67 A;  3ETM A;  1T8E A;  3M2R B;  1ZZN A;  1RTH A;  3CCQ S;  2UXB J;  3F44 A;  3RU0 A;  4IO1 A;  2MQP A;  2NTQ A;  2RKI B;  2FJW A;  4IOB A;  4KHP F;  4OJP A;  1HBO B;  2LEP A;  3H2U B;  3DLL Q;  3MM8 A;  1EP4 B;  3K2Y A;  1C1C A;  2BAN A;  3IAS 9;  2GHP A;  3PTW A;  2VG5 B;  1HW9 A;  4WFZ A;  3NGD A;  1LV5 A;  4QIV A;  1I94 F;  2J6T A;  3HT3 A;  2EC2 A;  1Y5I B;  2C3Y A;  1GTH A;  3R7N B;  2E7X A;  1LEO A;  2KYX A;  4LIW A;  4M5D A;  4U9R A;  2HGM A;  5HL7 Q;  2Q1L A;  4ELT A;  3KNA A;  2M4M A;  1C0U B;  2QL9 B;  2VKZ G;  1HLW A;  4YS2 A;  3EMT A;  2HHH F;  1TKZ B;  2YVS A;  4KHP J;  1NSP A;  2UV8 A;  3MDF A;  4GRS A;  1U0S A;  4I6Y A;  3UNG C;  4ETX A;  1NJW A;  5FD1 A;  3M8S A;  1UVL A;  1FJC A;  3TQE A;  4Q0B B;  5A8W A;  4GKK F;  3ISN C;  4WFY A;  4FPR A;  4LR8 A;  2HQ3 A;  3HI9 A;  4NRT A;  3BR8 A;  1E6V A;  2HVD A;  4ZPW R;  3KK3 A;  3LA0 A;  1NAQ A;  2LXU A;  1GNK A;  1XEZ A;  2H5J B;  1CQM A;  1PG5 B;  4DPT A;  4F04 B;  1R0A A;  3PYF A;  5KFI A;  4FVM A;  2FDN A;  4RO0 A;  2OML A;  1NXI A;  3IFE A;  3R5C A;  5GAG I;  2J0X A;  2PC6 A;  2YKM B;  2Q3P A;  3BQ1 A;  4B9S A;  1OSC A;  1CQN A;  3QSI A;  2XMK A;  3MHY A;  3QGI A;  3MR3 A;  4CRJ A;  1KLM A;  1QSY A;  3M2U A;  2ZD1 B;  1L3K A;  1ULR A;  5J2P A;  2XSJ A;  4PQA A;  1GMW D;  4LBP A;  2AYE A;  3MUT P;  1HD1 A;  2ROE A;  3DYA B;  5C2C A;  5HO4 A;  2R9L A;  1IM6 A;  5J2M A;  1L3V A;  3JTP A;  4C0B A;  4C4W A;  3KLI B;  2DNR A;  3VAK A;  4ZK7 M;  4O0I A;  3IRX A;  3GQ7 A;  1IKX A;  2QXZ A;  1TYV A;  1DTT A;  1FFG B;  2DNK A;  4NEZ A;  2NCK L;  1U1P A;  4M94 A;  4MK8 A;  4TKT A;  1U1K A;  4ILM A;  3EE3 A;  1FRJ A;  1EP4 A;  1Q1K A;  1RBL A;  5DET A;  5HQM A;  4J9V A;  1V3S A;  2DXF A;  4F67 A;  1LWF B;  2RIJ A;  5CYQ A;  3JUR A;  4EYI B;  3HXM A;  3DI6 B;  3MWB A;  5LMU J;  4JP8 A;  5D78 A;  2YNF A;  3EXY A;  1KCC A;  2NUH A;  2K3K A;  3M6W A;  1SBR A;  4NZ6 A;  5LMN J;  2C28 A;  4JRA C;  2LDY A;  3BSA A;  4ZN1 A;  4DV5 J;  1YJ7 A;  3LP0 A;  4XN0 A;  1SV5 B;  1VGY A;  2RUG A;  3MPY A;  4PRF A;  1RXO B;  5F8J A;  3KG0 A;  4WII A;  3IXQ A;  3M05 A;  3N5B A;  4DOZ A;  2V34 A;  4X4R A;  3I5C A;  4MMO A;  4MKA A;  4QWD A;  3MUR P;  1PC5 A;  4DFP A;  1H0H B;  2DY9 A;  4R8U B;  1U6F A;  1YSJ A;  3G6E S;  1WUU A;  2H5I B;  3JX8 A;  4XON A;  2DNO A;  4IKA A;  3TQ1 A;  4O4R A;  3EZ5 A;  2FY8 A;  4DR1 F;  3PO5 A;  3ZSC A;  2VON A;  4NLY A;  1SQE A;  2A0F B;  3M2V A;  5T7L B;  2WBM A;  5D3G B;  3G87 A;  4JOU A;  1DAR A;  3N9U C;  5B0B A;  3VWS A;  5DG8 A;  1WC5 A;  4NXM F;  2LP4 A;  3MPD A;  2X1B A;  1UZH A;  4DWI A;  2DNM A;  1GAO A;  2ZD1 A;  3SMZ A;  2JRS A;  3BPD A;  4ECT A;  5MAO A;  2W7O A;  5CZV A;  3BKU A;  2CWK A;  3QAE A;  4MK9 A;  3KHL A;  3TAP A;  2FJV A;  3G2X A;  3A4T A;  4UF4 A;  4KYZ A;  2BKN A;  1HAR A;  1UZD A;  3MR6 A;  2KT2 A;  2H4W B;  4W8S A;  3PYG A;  5C42 A;  2XCP A;  4ECU A;  1HI1 A;  4LSN B;  4PXD A;  5B09 A;  3CJK A;  5LJ3 Y;  1FA0 A;  1S0N A;  4YR2 A;  4KIA A;  1ZBT A;  1RT5 A;  2VHG A;  1RT6 A;  4I2P A;  1OGO X;  2C2M B;  2J9D A;  5CYQ B;  3UR3 C;  1RTI A;  1H7X A;  1VR6 A;  3IGN A;  5EGY A;  1Q81 T;  1SC6 A;  2NLW A;  2GV1 A;  3I4H X;  3Q8S B;  3G96 A;  1CJV B;  3E01 B;  1DBG A;  2HBR B;  3DFE A;  3MEE B;  3NP5 A;  2YWE A;  2MKS A;  4NLR A;  4Q7A A;  4QJV A;  2VBE A;  3TZZ A;  1QUV A;  2QLJ B;  4O23 A;  3W65 A;  4PXB A;  2UUA J;  4EZ6 A;  1F1B B;  3ISN D;  3H09 A;  1REG X;  3CDU A;  2AMC B;  3M9O B;  2RF2 A;  3IA0 A;  3NS5 A;  1X5T A;  2ZOG A;  4M5K A;  2FHO B;  4DDF A;  3PDN A;  5L1K A;  3OTD A;  4LF8 J;  3GU0 A;  3KUG A;  1SJ1 A;  1YJU A;  4XM3 A;  1LW2 A;  1RWM B;  2AU0 A;  1WG1 A;  3BYR A;  2XTY A;  5D4L A;  2F3L A;  4C8N A;  5F8M A;  1D9D A;  2DYA A;  1S6P A;  4L72 B;  4WXO A;  4PUO B;  4DR1 J;  2BZ2 A;  4UOG A;  1TKT A;  3MAA A;  4OYP A;  3H25 A;  4DPO A;  4OLP A;  4Q44 A;  1TKD A;  1N5T A;  4J9K A;  3IWX A;  4E8U A;  3MM5 A;  5D0H A;  1KWM A;  5ETM A;  1UPP A;  2ZNZ A;  3P96 A;  4FS1 A;  1CSJ A;  1LWC A;  2ZH6 A;  2R8K A;  4Y2C A;  5KG3 A;  2VOO A;  1HYS A;  3ET6 B;  3RAM A;  2KVQ E;  4YEL A;  4ZA1 A;  2VAS A;  3QGG A;  3U1M A;  3MMJ A;  5GAE U;  4LFC J;  2XS2 A;  3GQ8 A;  1JLA B;  2MJN A;  1B7Y B;  2PE8 A;  4F4W A;  5G4D A;  2N4D A;  3RZA A;  2IMW P;  4OHY A;  2ZZM A;  1OY9 A;  2GX8 A;  2V5I A;  2YQ0 A;  3CD7 A;  1ROF A;  4OFZ A;  3BGL A;  4F3M A;  4Y2M A;  4C8L A;  2QY1 A;  1BD6 A;  2DNQ A;  2R7S A;  2LLZ A;  3K8W A;  3FQK A;  3N6Z A;  2BRK A;  3HHK A;  4ZVS B;  3JSM A;  3L3C A;  4PPZ A;  4K4V A;  4USM A;  1ZH5 A;  1S9G A;  2VFT A;  4Z06 A;  3EDR B;  2E5L F;  1CZF A;  4MR0 A;  3TWZ A;  4HEA 9;  4OV1 A;  1VBY A;  5LSO A;  1KP6 A;  4P73 A;  5KFD A;  5AJ3 J;  1OPZ A;  2W9A A;  1VRT A;  2IMO A;  2YPY A;  4DPW A;  3DHX A;  2GJI A;  4OZL A;  4EO8 A;  1VBL A;  5ETN A;  2YY3 A;  2QLX A;  3D6F B;  1RHR B;  1N4L A;  3P4U B;  2CZ4 A;  3KLH A;  4HDH A;  1X4B A;  4WFB Q;  3BSN A;  1S10 A;  4RW6 B;  2JEG A;  1QSL A;  2A2C A;  1U8W A;  2DH9 A;  4J37 A;  1VHI A;  1O6X A;  4ICL B;  1VQO S;  3OFE A;  2VG6 A;  2WBR A;  3FEY B;  3FFI A;  1TKT B;  2VBZ A;  3FKB A;  3H90 A;  1HBM B;  3HCX A;  3HFZ B;  3MAA B;  4LFA J;  4X66 J;  5RUB A;  1BY9 A;  2I8E A;  1KVJ A;  1DLO B;  3IG1 A;  5DO2 A;  4F3Q A;  3TZY A;  5A2Q Y;  2L9N A;  2MZS A;  3NWG A;  4G6V B;  2NPF A;  4I69 A;  4G1Q B;  3ZTP A;  4K4W A;  3OSN A;  3VAI A;  4EO6 A;  2C2R A;  2YKP A;  1WC0 A;  2DB1 A;  3JSR A;  1U2R A;  2V8H A;  4ZP9 A;  4J9Q A;  1T11 A;  1RIS A;  4YB5 A;  1Q8I A;  2JL9 A;  2V0N A;  2C42 A;  3BBB A;  5IS2 A;  3RRH A;  1MNE A;  2KFZ A;  1JIH A;  1HQU A;  3ZTO A;  3RB4 A;  1DRZ A;  5KFX A;  2XWX A;  1NHU A;  3GSD A;  4QIG A;  1OQ6 A;  1WTF A;  4ZN3 A;  1YKW A;  1NUE A;  3M6V A;  4BC7 A;  1VBX A;  1JB0 C;  2ALY B;  2OSQ A;  2IM2 A;  4DFJ A;  3MPV A;  1QY7 A;  4J90 A;  2A3J A;  3CJ4 A;  3JAM U;  1NBE B;  4B3O B;  5HK4 A;  5KFC A;  3U02 A;  5LL6 d;  4F4Y A;  2HNZ A;  4ZDN A;  4OJ3 A;  4ID5 A;  4C11 A;  1F5A A;  1Q7L B;  4DS4 A;  2JEJ A;  1WOS A;  1RHJ B;  1RT7 B;  2Q6C A;  5KFL A;  2DR9 A;  4JV1 A;  1U0H B;  3AH6 A;  3PRV A;  1U8S A;  2BJD A;  1G2E A;  1S77 D;  5EX3 A;  3DU6 A;  1NK0 A;  1CJT A;  1OWX A;  2RRA A;  2AEJ A;  3PHE A;  3K59 A;  1RAD B;  4IO9 Q;  1IR1 A;  5H9E K;  1U48 A;  3SZE A;  1WG5 A;  4P72 A;  1XMO F;  4IOA Q;  1GX6 A;  3OHA A;  2HLT A;  3HHL A;  4NXN J;  1Q8K A;  1UCN A;  1RAA B;  3PV8 A;  2KXN B;  4M5L A;  4ZPT R;  1N5V A;  3H42 A;  4RW6 A;  3VCD A;  5DNS A;  2AJ0 A;  2LXI A;  4KHR A;  2YUH A;  3FFI B;  3N01 A;  4Y2K A;  2CYY A;  4QWC A;  1IR2 A;  4ED6 A;  2XMW A;  1D0E A;  2ZKT A;  3QLH A;  3R5B A;  4X64 F;  1DLO A;  3IG1 B;  5KFG A;  3SSS A;  1RTJ B;  3DI6 A;  4UZB A;  5ITH A;  3UDL A;  2VH7 A;  1NK8 A;  2FJE B;  2IQ7 A;  1WOP A;  4NA2 A;  4RLE A;  4LRD A;  3PJ9 A;  3FVY A;  1Y4Z B;  4DQQ A;  2EG1 A;  1SV5 A;  4FNI A;  2BJE A;  2RJZ A;  2KRB A;  4TN2 A;  1LXJ A;  1R8C A;  3C6U B;  5KFF A;  5DM7 Q;  3LWL A;  3ENW A;  1LQ9 A;  1GTE A;  2COL A;  1U02 A;  4OYX A;  4BS2 A;  5M2R A;  1RMG A;  2Y1I A;  2YH1 A;  2I6W A;  2D9O A;  1RT2 A;  3DRP B;  2FLN A;  1I5O B;  2AIR B;  4WU3 A;  3DC2 A;  3W8G A;  1QVF R;  5KFO A;  1NKC A;  3MCS A;  2VF3 A;  1KVI A;  3T9N A;  3GRH A;  2DKO B;  2WON B;  3ZO7 A;  2XC1 A;  2MGZ B;  4DL2 A;  3POT B;  2HNZ B;  1QM9 A;  5MLC V;  1YRX A;  2O1D A;  2ZH5 A;  2GGP B;  1RTH B;  2VFQ A;  3MUV P;  3FBC A;  2QA4 G;  1RT7 A;  2HHP A;  1HWJ A;  4KC5 A;  1R31 A;  2BJ7 A;  3DHW C;  2HFN A;  3SQG A;  2Q66 A;  3QAT A;  5FLX U;  2OPP A;  1WDT A;  1O8B A;  2AJ1 A;  3AD7 C;  5KFZ A;  3TYT A;  3NRB A;  2KM8 C;  2AYB A;  3OLA A;  3BGU A;  3BRE A;  3ENQ A;  3A12 A;  1X0F A;  4DQI A;  3D6M B;  4YZQ A;  2PEB A;  2J7K A;  3NG8 A;  4NYO A;  5B0E A;  2R8J A;  2YX7 A;  1JLB A;  5C42 B;  4EUV A;  3BR9 A;  1T03 A;  1MWY A;  2YX4 A;  2BOA A;  3CJK B;  1C1B B;  2WRM A;  4J91 A;  3ILL A;  2Z58 B;  1NDC A;  4X4P A;  1NK7 A;  2F8M A;  3DM2 B;  3W62 A;  3PX0 A;  3D7S B;  4KHM A;  1DAB A;  4Z37 A;  1XNQ F;  1NPK A;  3IBC B;  4PG5 A;  3T1H J;  3CJ5 A;  3JQM A;  5JXS A;  2DIU A;  4C2M A;  2CQ2 A;  1KD1 T;  1N5S A;  1RCX B;  2CVI A;  5IT4 A;  1WMR A;  3DLG B;  2WB4 A;  1JRG A;  2RB7 A;  2DEI A;  3ICL A;  3DLE A;  2D69 A;  3FEX B;  2QC3 A;  4PZV A;  4KH1 B;  2BE7 D;  4JI6 F;  1HHS A;  5CAA A;  2MY7 A;  2QT7 A;  2XC9 A;  1S79 A;  3G6X A;  5A8K A;  4NLW A;  1HG8 A;  4PYD A;  1RAO A;  3MAH A;  3FMB A;  4LVO P;  1UWA A;  5IWA F;  2NZC A;  4X66 F;  2KG0 A;  3RG6 A;  3RJM B;  4QW8 A;  3RW6 A;  5ETL A;  4TQS A;  1O8M A;  2FVC A;  1Q82 T;  3VGT A;  4YUD A;  1RTD A;  2CPD A;  1CC8 A;  1FER A;  2XYP B;  2DJW A;  3HSG A;  2PO4 A;  3B4D A;  3MM7 B;  5F0W A;  2GGP A;  3F41 A;  4OYO A;  4X62 J;  1WJ9 A;  2HHW A;  4OJH A;  1BE4 A;  3W2V B;  1FD2 A;  1RWO B;  4F4K A;  4LR7 A;  1Y5L B;  4H4K A;  3D1O A;  5AE1 A;  1KFD A;  4PWD A;  1NPR A;  1O8D A;  1N88 A;  3WC2 A;  2Y1R I;  3KKF A;  2R2U A;  2Z2Y B;  2QL5 B;  5IT9 U;  1RWR A;  1H6K X;  3LP2 A;  1C4A A;  3N79 A;  3ENA A;  1N52 B;  1YLX A;  3ISZ A;  3BBC A;  1CUL B;  1TV6 A;  2XTX A;  3B4N A;  4WE1 A;  2B7C B;  1ZZF A;  1H3D A;  5LOQ A;  2QYU A;  1FX4 A;  3DM2 A;  1T9V A;  2NYH A;  4TYB A;  5T41 A;  4DV4 J;  4QIE A;  1Q5V A;  3C6T A;  3DGP A;  4HR2 A;  2W1B A;  3D66 A;  2MSS A;  4KV8 B;  1O8G A;  4NAS A;  2V4Q A;  4A8Q A;  3PW7 A;  2QLB B;  1U1M A;  5GAD I;  1CS4 B;  2X85 A;  1FDA A;  1R27 B;  2YNI B;  3VVT A;  3Q8U A;  4R5P A;  4OL8 A;  1X4D A;  3PXG a;  2VBY A;  2J8A A;  2NXC A;  2XMM A;  1S1W A;  4D3G A;  5F3T A;  5SZT A;  1FI4 A;  1NB7 A;  2O0V A;  2EW9 A;  1DY3 A;  2KL8 A;  3GFZ A;  3VVU A;  3W5X A;  3N4W A;  4Y2I A;  4EMD A;  3KK3 B;  1UFW A;  2H9Z A;  2KJW A;  1CJU B;  3KLH B;  1F3F A;  2YWW A;  1T9Y A;  3KJV B;  5KFK A;  1VIX A;  4UOC A;  1VIS A;  4MKB A;  5E3R A;  3K5L A;  3CC4 S;  4F0K A;  2V68 A;  4ED7 A;  3A3P B;  2M7S A;  1VC5 A;  3BPS P;  4WFX A;  1KRP A;  4DSJ A;  5KFA A;  3FMW A;  2M88 A;  3GQ9 A;  3FBE A;  3OD2 A;  4FVC A;  4C2L A;  4V19 X;  5HI7 A;  4WKR A;  3HSJ A;  4FP9 A;  2CUY A;  3L09 A;  2W7P A;  3PW4 A;  3P49 B;  3G8T A;  1IKX B;  2DGV A;  3K89 A;  2AZ3 A;  2B5J B;  5B0A A;  3HF5 A;  5CAB A;  5C25 B;  3UD4 P;  3HJF A;  4PWD B;  1FKP B;  3OXF A;  4FKX A;  3CME S;  3GIK A;  2VBX A;  3PIO Q;  2XGQ A;  3W8P A;  4JV2 A;  4LF5 J;  3A8E A;  3KG4 A;  4YB7 A;  2I5J A;  5KFH A;  3NB2 A;  3SV4 A;  3OSP A;  4DUT A;  4OHW A;  3KYL A;  1EET A;  4L74 A;  8RUC A;  5L39 A;  1Y3J A;  4NRU A;  1B70 B;  3VAF A;  4DV4 F;  5F9L A;  1S9E B;  4ID5 B;  4C11 B;  3SYJ A;  2DY1 A;  3C14 B;  3MUM P;  1V5V A;  3B82 A;  2FHM A;  1OMS A;  4Y28 C;  3MCO A;  1U2C A;  2DIT A;  2H65 B;  2C1E B;  2FJA B;  4KV8 A;  1KEK A;  3VAJ A;  4DL3 A;  2F4V F;  4DSI A;  4GKJ J;  1SPB P;  5IOL A;  2BVZ A;  3DLK B;  1PC4 A; 
#chains in the Genus database with same CATH homology
 1HHQ A;  1NDC A;  4F36 A;  3EE3 A;  1QRC A;  1ZS6 A;  2IOU G;  1QA2 A;  2DXF A;  1DAB A;  2B8P A;  1NPK A;  3LJY A;  1KDN A;  4UOF A;  2ZUA A;  2BM5 A;  1U8W A;  1WKL A;  4JRA C;  1BUX A;  3P4G A;  3FKB A;  2W7Z A;  3FBB A;  1NSQ A;  3ZTQ A;  3B54 A;  1BHN A;  5CAA A;  1MN9 A;  3ZTP A;  3GP9 A;  2VFN A;  3WX8 A;  1QA1 A;  3DKD A;  2DY9 A;  4DI6 A;  3DDI A;  3EIC A;  3ELH A;  3JX8 A;  1B4S A;  1NDL A;  1WXR A;  5BXI A;  3Q86 A;  5JMC B;  3BBB A;  3VGT A;  3PET A;  1QRB A;  4ANE A;  2HVE A;  1S5Z A;  1NB2 A;  3ZTO A;  3EJM A;  1NLK L;  1BE4 A;  4FKY A;  2VFO A;  1NUE A;  3MPD A;  3VGV A;  2BM7 A;  2J8I A;  2AZ1 A;  2B8Q A;  1XIQ A;  2CWK A;  3NGU A;  3JS9 A;  3AK5 A;  1NSK L;  3TH0 A;  3G2X A;  4EK2 A;  4OPW A;  1XQI A;  3VGS A;  3ENA A;  4KH3 A;  2VFP A;  1KQ5 A;  3BBC A;  3NGS A;  1EHW A;  1LWX A;  1NDK A;  3FCW A;  4WBF A;  3PRV A;  4CP5 A;  3RIQ A;  3NGT A;  5C7P A;  4V02 C;  3VGU A;  3Q89 A;  4OJO A;  2DXD A;  3Q8Y A;  3SZE A;  4HR2 A;  4OM9 A;  2VFM A;  2HUR A;  4KPC A;  1K8F A;  1UCN A;  3ETM A;  3VVT A;  4AND A;  4ANC A;  1K44 A;  3Q8U A;  1QQ1 A;  2B0R A;  2YUH A;  1NDP A;  4OJP A;  3VVU A;  2BX6 A;  5JLV C;  3H09 A;  1S57 A;  1K4Z A;  4UOH A;  1NHK L;  4OJ6 A;  1F3F A;  1F6T A;  3L7U A;  4DZ6 A;  3PJ9 A;  1JXV A;  1LEO A;  1NCL A;  2F3L A;  1MN7 A;  2DYA A;  1PKU A;  3B6B A;  4UOG A;  1TSP A;  1S59 A;  3EVW A;  4S0M A;  1HLW A;  3EMT A;  3FBE A;  3EVO A;  1NSP A;  3BH6 B;  3LYC A;  2VU5 A;  3EM1 A;  4W98 A;  3ZTR A;  1CLW A;  3Q83 A;  1HIY A;  2BEF A;  2G0Y A;  4OJ5 A;  2AZ3 A;  2HVD A;  5CAB A;  4FKX A;  2XC1 A;  3BBF A;  4O0N A;  3ML3 A;  1WKK A;  1TYX A;  2VFQ A;  2V5I A;  3FBC A;  3N90 A;  4DUT A;  4OJL A;  1PAE X;  3R9L A;  1WKJ A;  1TYW A;  2BM6 A;  1B99 A;  3EVM A;  3FC9 A;  3Q8V A;  1VYA A;  3GPA A;  3N6Z A;  2DXE A;  1HF2 A;  3SYJ A;  3NGR A;  4F4A A;  2BM4 A;  3BH7 B;  1TYU A;  4C6A A;  1W7W A;  4ENO A;  3FBF A;  3FCV A;  5IOL A;  1TYV A;  1QA3 A;  2NCK L;  3ZTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...