3BHIA

Crystal structure of human carbonyl reductase 1 in complex with nadp
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
275
structure length
275
Chain Sequence
SGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human carbonyl reductase 1 is an s-nitrosoglutathione reductase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Carbonyl reductase [NADPH] 1
total genus 107
structure length 275
sequence length 275
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2007-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bhiA00
3GNQA 3PVZA 2C5AA 4FB5A 5JE8A 1NNUA 2PZMA 4PG7A 1XU7A 4O1MA 5BR7A 1U3WA 3I52A 4N5LA 1DPGA 1EFLA 1UZLA 1SC6A 1ARZA 1SAYA 2DTDA 3MJ4A 3SLGA 5IDXA 1PEDA 4U8GA 3CINA 2CZCA 1X7GA 2FHSA 4HY3A 5IAAA 1VE9A 2BD0A 1HDYA 4UEKA 4DLAA 3AY3A 3OH8A 3NJ4A 4NFSA 3JQ9C 3ABIA 1ONPA 1Y8QA 3BHIA 4GX5A 1YJ8A 4KTVE 1ZEJA 1WXDA 1KYQA 2ZJ0A 4R54A 1IPEA 4R51A 1JA9A 2FP4A 2G17A 2J6IA 3WQRA 3MJEA 3WGIA 2YDXA 3NTRA 3RC2A 2VYVD 3FTNA 3K31A 1LSJA 4NNJA 4KZPA 4NBVA 3PJEA 3I1JA 4ND4A 4EBFA 3AI2A 3GRKA 1QORA 3WXBA 1LQUA 4CMJA 1I2BA 4BV8A 4CLHA 3VTFA 4D3FA 2V65A 4LW8A 3HDJA 1EBUA 1O5IA 2HMSA 4L4XA 5C37A 1DIHA 5AXCA 3LZ6A 4ROSA 4A03A 4I8XA 3TF5A 4Y9DA 3PP8A 4IPTA 4M49A 4CLRA 3AUTA 1E7SA 1ADBA 2DTXA 1C14A 2I66A 1NQOA 1PS9A 1Z45A 4A7PA 3GT0A 1T1SA 3O26A 3CUKA 3VH1A 2DTEA 4RVDA 4YJDA 2WDZA 4AJNA 4CM5A 2Y99A 3OETA 3SEFA 2NUAA 5FI5A 3UOGA 1N7HA 3FR8A 1IY8A 3PQFA 4IDAA 1KBZA 4XD2A 3LK7A 3GPDG 3OECA 3PDUA 4B4WA 1MB4A 1MFZA 3LQFA 3GLQA 1PR9A 5F21A 5KNLA 1UDBA 1MC5A 1VC2A 1N5DA 3GN1A 1B16A 1HLPA 1TEHA 3ASVA 4BO5A 1GEGA 3ONDA 3MJTA 1W4ZA 3QWAA 3D64A 5CFZA 1SEVA 2CVOA 3RUCA 1K89A 5GZ6A 3TZKA 4XYMA 1P1IA 1PJTA 1Q7BA 4NR0A 1DLJA 1Y9AA 5IG2A 5IZ4A 2FPPA 4JN6B 2QW8A 1YOVA 1XEAA 1XYGA 3WFIA 3ENNA 4YQZA 5L7YA 5H82A 1FXSA 5CAEA 2NSDA 4PG6A 2GDZA 2V6FA 4HXYA 4AJJA 1ZW1A 2PKQP 1KEPA 1QKIA 4RPKA 2DPGA 4B3HA 2UUOA 4BIIA 3ICCA 5A3VA 4P38A 1KC1A 4P4NA 1QRRA 2B5WA 3CZRA 3GFGA 1B3RA 2J3HA 3R6DA 4FGWA 2EW8A 5TJHA 1P31A 3D4OA 1BSVA 2DUUA 3KRTA 4CM3A 3RROA 3NYWA 5ILOA 1B3BA 5C3MA 1C0LA 2A35A 3O4RA 4CM8B 1DDOA 3U62A 1JW9B 1VL6A 4CM6A 5JDIA 3L07A 4JIGA 1E1MA 3NT5A 2W98A 1M2WA 4I9UA 3DAGA 1VJ0A 3Q6IA 2EJWA 1RM3A 1N9GA 4MOWA 2HRZA 2P5UA 5JSFA 1NPTO 3NTOA 3CH6A 4PRKA 1EDOA 2AE1A 4CODB 1LDYA 5T8KA 1ADCA 1DHRA 5TRTA 2HUNA 5IZCA 2YV2A 3P19A 3LVFO 4WEQA 4CLOA 1SZJG 1DO8A 3E9NA 1ZXBA 2A92A 3RU7A 4ZD6A 4E2WA 5T6BA 1ZEMA 3RKRA 3FPLA 4UVGA 1NWHA 2HMTA 1BW9B 1R12A 2CFCA 3I6IA 4UREA 5F1PA 3A4VA 1VLLA 2QYTA 2GD1O 2VTDA 2NADA 3JQ8A 3ZWCA 4DBZA 2Q46A 2IZ1A 4ZQHA 1JKFA 1KETA 4DMLA 2FSVA 3ROKA 5HM8A 4RV9A 4PFJA 3BYZA 5TT1A 4IZIA 1HWYA 1YH3A 2DBQA 3B70A 1C0IA 2ILTA 1OI7A 1DOHA 5DCWA 1MX3A 1HDCA 4ND1A 4Z0HO 5B37A 3Q2KA 4EUEA 1MGOA 2NNLD 1YVEI 4IS3A 1X7DA 4XQ9A 4RF2A 4XCVA 4AJ4A 1LC3A 3EGOA 4BNTA 2Z1NA 2AW5A 5F1KA 4GMGA 3FWNA 4KMSA 4RQTA 1KVRA 3E9MA 4MINA 3DL2A 3V2GA 5BSGA 4R9RA 3TDKA 3BTOA 4MJLA 4R1UA 3ZCXA 4E12A 4GGPA 1KEVA 3JQ9A 1LRKA 3ROPA 4DIBA 1ZMOA 2NVWA 1GEEA 2VRBA 8ADHA 1HE2A 3I3OA 3JYNA 3H9JA 3PJDA 4TMFA 4ALLA 1ISIA 4YJFB 3AUSA 4C4OA 1LTHR 6LDHA 1NTOA 3Q0EA 5DCUA 4PLFA 3WGZA 1O6ZA 4ZN6A 4XDZA 4J0EA 4IMPA 4MVJA 3C3XA 4XEHA 4JJGA 1DRWA 2HQ1A 1B0AA 1Z7BA 4Z0PA 5T64A 2YJZA 4XKJA 4OGWA 3WQQA 3OA0A 1H2BA 3ZW8A 2FPGA 1MC4A 2XAAA 3ZNPA 4IQ0A 5B4TA 1GPDG 1MXFA 1ISFA 3DWFA 3VPGA 1IHYA 2WTBA 3HDHA 3JQ8B 4TRMA 4WUVA 1ULUA 5CDUA 4CV0A 3D3WA 3JQGA 4BO8A 4QT0A 3UFXA 2UV8A 3GMDA 3A28A 3GFBA 4IUYA 3ADOA 5L3ZA 4JGBA 3GH3A 4J43A 3SC6A 2OORA 1PQPA 4J0FA 2HU2A 4Y98A 5TC4A 3ZU4A 2JAHA 3PIDA 1U28A 3PYMA 4WCDA 3RAJA 4DYVA 3P7MA 2PZJA 2P9EA 2ZCVA 4JJFA 7ADHA 2VWPA 4ZA2A 1NPYA 2OGUA 4M87A 1CEQA 4Q3EA 2IDZA 4AJ2A 3C1TA 2E82A 3MEQA 4CQLB 3QWBA 4XIYA 1IUKA 5CDYA 4BO6A 3P5SA 2RH4A 2OP1A 1JU9A 3WTCA 3PWSA 1LU9A 1NAHA 2V7PA 1CQIA 2A4KA 3QWHA 2CUKA 4YAEA 1JWBB 1T1RA 2VQ3A 3Q2IA 1YB4A 3JD1A 3EC7A 1NFQA 2GR9A 1MFPA 3C8MA 3F47A 3GUCA 4N7RA 1P33A 1KOLA 1HETA 3I9OA 1ZUD1 3PQDA 5JYEA 4U7WA 3FHLA 4Z9FA 5DOVA 4RGBA 5T57A 1E5LA 3SLKA 3TPCA 4XA8A 4DC1A 1IYZA 1AUPA 1DRUA 3DQPA 4XX0A 3CZMA 4I5GA 3RUIA 4J7UA 2JAPA 3HWRA 1ADGA 1PJBA 2G5CA 3BMCB 4O6VA 4BNXA 3NDRA 4R1TA 1CRWG 1S6YA 1MUUA 4YDRA 2WJPA 3PIIA 4FFOA 1E3EA 3MWEB 1NBOA 4LSMA 1ZZEA 5A9RA 3VPFA 1PQWA 4IY1A 3R3JA 5JDCC 4C7KA 4R5MA 3I9LA 4D44A 2JHFA 2NQTA 5GZ3A 1VPDA 1U5CA 2O3TA 3RIHA 2EERA 1H93A 1KS9A 3NUGA 4BGEA 2IE0A 4YJHA 3JQBA 3TFOA 2D5CA 4QECA 3TQHA 2O4UX 3INRA 3OJOA 4R69A 3DZIA 4WEOA 5C7IO 2VWGA 2UYYA 2O23A 1V8BA 3ZW9A 4CM9D 4GSLA 4UAGA 3HDQA 4E5MA 1LI4A 3ZHZA 5GZ1A 1QSGA 3RJ9A 3VZQA 2VT2A 3I9JA 3H7AA 1QYCA 2A9FA 4II3A 4ALMA 4Y8VA 4P4LA 3PHHA 1YDEA 2HK7A 2WYWA 5HS6A 3IMFA 5COAA 2FZEA 2VUUA 3D3WB 3JQGB 1DFGA 3F9IA 3IQDB 4FJ0A 4NJMB 1ZVMA 3F5QA 3MJCA 4RF4A 4WOKA 5DULA 2QG4A 4E4YA 4D42A 4RVGA 2NU8A 2X23A 5F3RA 1ISMA 3PHJA 1U4OA 1ZIDA 4INAA 3HADA 2AQ8A 1GCUA 1O94A 1N9GB 2Q1TA 1HDRA 2AQIA 4KTTE 2EW2A 2X22A 4S1VA 1KVTA 5L95A 5JLAA 4GLOA 5B1YA 2PD6A 1LXCA 3C7DB 3D4NA 3PWZA 1M6HA 4ALNA 4BVAA 3PPIA 2ZK7A 3GNTA 2C20A 1WLYA 2OBYA 3LC2O 4GGOA 4DUPA 1HDXA 1FMCA 1GYRA 1XHLA 3AFMA 4W99A 4ESOA 1XDWA 3DO5A 4K28A 3BHJA 3HG7A 3ZWOA 3IC5A 3KBOA 1A71A 1I8TA 4ZVVA 2BFAA 1PS0A 4BB5A 2DBRA 2P9CA 2EF1A 1RM0A 3RD5A 2PH3A 2UUPA 4RZIA 4R16A 3U9LA 5TGDA 1QMGA 4LVCA 2VUTA 1AHIA 3MZ0A 4EJ6A 4BNYA 3SX2A 4PLYA 5B4UA 1LDBA 3OEYA 4AVYA 3UCEA 4YT5A 1NQAO 2OBNA 1JLLA 2OMEA 4PRLA 5KOIA 1HYEA 3GEDA 3WTBA 5J23A 3L4BC 2GERA 4BKRA 3W6ZA 4CV2A 1E3LA 5CPFA 4E5NA 2D5AA 3K5PA 3S2EA 1DHTA 4J7CA 3OBBA 4IBOA 3WS7A 3HZZA 3GVPA 1YL5A 3WLEA 1PS8A 1VJ1A 3RUEA 4XGKA 3ROQA 1BHSA 1XLTA 4H3VA 4GWGA 2X86A 3DFUA 3GDGA 2C29D 1P74A 4GLLA 4KUHA 1F17A 2EV9A 2Q1WA 2PZLA 3T4XA 4E0BA 4K1LA 1E1KA 4QX6A 2VHYA 3ETGA 2EKQA 4CPDA 2GN9A 2VRCA 1Q0QA 2JCXA 1B15A 3W8FA 4OMUA 1GYPA 3A1NA 2OFPA 4HV4A 2CF6A 4M89A 1C1XA 4YT4A 3ZZNA 3QVTA 2O2SA 3DBLA 1EVJA 4BMSA 4N5NA 4DIOA 1HSZA 2I99A 4NDNE 5ADHA 2ZTMA 3DMTC 1VI2A 4JNKA 4OXKA 4R5HA 1I3LA 3DZHA 5U1PA 2CVQA 1BDBA 1IZ0A 2ZTUA 4CR8A 1ZSNA 3BTUA 1HE4A 5G0WA 4HFNA 3VHRA 1ISHA 3HB4X 4BNMA 5TS3A 1O89A 2VN8A 4CM4B 4CMHA 1T4BA 1PZFA 2FOIA 2NWQA 3GZ4A 2E37A 4NJOA 4TSKA 4CQLA 1L7EA 3E8XA 4BNVA 3DAPA 2G76A 4M1QA 4MIOA 5CDSA 2X9VA 3PJFA 2B83A 4TZKA 3E03A 2DVMA 1H0KA 4EDFA 2PA3A 3FWZA 4IJVA 3A06A 2BI8A 4ZRNA 1NWCA 3EYWA 3D7LA 2RHCA 4JJIA 4EUFA 3BHMA 2WWRA 5ER9A 5HTOA 3PGJA 4PLHA 3WNQA 1SOWA 2BKAA 3DBRA 4A73A 3LT1A 4J1SA 1U7HA 2DLDA 4B4VA 3JYLA 4BMNA 1JVBA 4XDYA 2WE7A 1HF3A 2X9NA 1RPNA 3LYLA 2YHIA 3Q3CA 1U3VA 3AM3A 1ML3A 1IPFA 4YYZA 4D3DA 4NHEA 1D7OA 1YO6A 1EQUA 3PDJA 4U6QA 3CTMA 4B7XA 2CF5A 1P45A 1Y7TA 3WWYA 4AFNA 3QQPA 3M1AA 3W1VA 4CQMA 4YPOA 2FPIA 2EXXA 3JD4A 4WLOA 1K3TA 2TMDA 4M86A 1DIAA 5TT0A 4CLDA 1ENOA 1QLJA 1P44A 2C2YA 1NX6A 3AFNA 3OSUA 5JCJA 1U2GA 4D0RA 1D3AA 1BGVA 2GYYA 2Y1OA 3AM4A 4CUJA 2ET6A 4Z9YA 1V9LA 1A72A 2X0NA 3L4SO 4YJHB 5HRUA 1PZEA 5AYVA 3DBRB 4DL9A 1TT7A 3PEFA 1F8FA 1R4MB 4E21A 1GV0A 4G2NA 4B4OA 4RO0A 1V3TA 1I0ZA 1LLUA 3V1UA 3EK2A 1EQ2A 4J16A 2Y0DA 2QIOA 4Q3BA 3VAZA 3T4EA 5EJ2A 1FDWA 4MP8A 4JX8A 1X0VA 1UJMA 1C0KA 4OL9A 3H9GA 1GUFA 1I3KA 4PG8A 5HWSA 4ONEA 2NU6A 3QHAA 4CLRB 1YBAA 5I8ZA 2GZ2A 2I67A 2W4QA 4AICA 1AGNA 1JAYA 2IXBA 1PJ2A 1GQ2A 3FNHA 5U9CA 3LC1O 4LRTB 4CJXA 2C5EA 4QXMA 4TQGA 4F6LA 4UUPA 5A9TA 4LMRA 1P1HA 3V2UA 2H1SA 4NPCA 1GPJA 1V0JA 4J90A 2IZZA 3P2OA 1Q0HA 2Y68A 4CL8A 2VCYA 3O9ZA 4Z0TA 5EQDA 1M67A 3DOCA 3HHPA 3AUAA 3E82A 2GCGA 1EK6A 3KEOA 5JO0A 3QW2A 4IZHA 3BTSA 4GX2A 3RUDA 4OXNA 4BL5A 4IS2A 2FR1A 1GQQA 4ITUA 4XR9A 5JMWA 1TT5A 5L9AA 4K6CA 4N54A 5L40A 4AJ1A 1B8VA 3QJ5A 3WYBA 1OAAA 1H6AA 4CUKA 1HDZA 5I7VA 3KHUA 4J2HA 4CR7A 2PH5A 4FN4A 3DZFA 1BDMA 3G0OA 4TRRA 1ONOA 4LCEA 3WQSB 1R0KA 5L45A 4NZ9A 3JSAA 4WCFC 1Z6ZA 1NHWA 3RU9A 2HK8A 2O48X 3AY6A 3H9QA 1NFFA 2YV3A 2JFFA 1PGQA 4J4TA 2QRLA 2AA3A 4ALJA 4U0KA 3AI3A 2HKIA 1YRLA 1DBVO 2VNSA 4HKTA 3H3JA 3JYQA 3RCBA 4XYEA 1Z7EA 3DMTA 3L6OO 5BSFA 3WJAA 1HRDA 1YL6A 5F1OA 1WPQA 4KWIA 4MVJM 4EJMA 3ITDA 1PU2A 3BIOA 1E6EA 3D3EA 1WDMA 1E7QA 4DLBA 3ULKA 5DP2A 4GH5A 1XQ6A 3NKLA 4O59O 1BVRA 3HN2A 1I30A 2GN4A 4MKXA 2B4TO 4PLZA 2IRWA 1LSOA 4A27A 4I5DA 5A1TA 1I5RA 1GZ4A 3VZRA 5FWNA 4PLVA 1YQXA 2C54A 2DC1A 1I32A 3UAGA 3AM5A 1A7KA 1O9BA 3NT2A 1O95A 3DBHB 4OXYA 2ZTVA 4A10A 1I33A 1DC3A 3L6EA 4UEJA 2WYVA 3CIFA 1GV1A 2JD2A 3MTJA 1EUDA 5JC1A 3JTMA 5HA5A 1J0XO 3F1LA 3K2EA 3RVDA 1UDAA 1HE5A 1XKQA 5CEFA 2HMVA 4Q3NA 1D1TA 3QP9A 1GZ6A 5EMHA 1B8PA 1DJNA 4FFRA 3H9UA 1UUFA 3STHA 1DRVA 3AI1A 1DJQA 1LNQA 3KXDA 4ND3A 4YAKA 3KYBA 2NU9A 4BGVA 4IM7A 2NTVA 5G0TA 1GCOA 4OOFA 4GKBA 2DBZA 4IDEA 1YQGA 4R41A 3I6QA 2WE8A 2X0RA 2YQ4A 3WGHA 2OHXA 1XCBA 2I65A 5T67A 4OSPA 4DGSA 1X15A 3ETDA 3RBXA 4W7HA 4BQRA 5DCYA 3JYPA 1Q0LA 5A04A 3JQBC 3KTDA 1OBFO 1JKJA 4PCVA 3IUPA 5DZSA 3RSHA 1YQDA 5JCXA 1NXQA 2NVUB 2RIRA 1YB1A 4CLXA 5A5EA 5ER6A 5BT9A 5LDGA 4KDEA 4IXTA 1YONA 2CMDA 4CR6A 4YRAA 3ZDFA 5L4NA 3I9MA 3AOGA 2VUSA 4HADA 3RBZA 3CMMA 1I2ZA 1G6KA 5JW6A 1YXMA 3NX4A 4L8VA 4DPKA 1A9YA 1QYDA 5G0VA 1R15A 5A03A 4IDCA 2J3KA 4ZJUA 1GAEO 4CUZA 4CV1A 1BMDA 1NR7A 1ZSVA 2GGSA 5G0UA 2XPCA 2YDYA 3D0OA 4Z9XA 3VC7A 4PVCA 3LU1A 2OXIA 1UXJA 1VKNA 1ENZA 2IODA 3L9WA 1E1NA 3TRIA 2GO1A 1QYWA 2PLAA 3NJ8A 3OJFA 4WNIA 1K6XA 2B5VA 4WOJA 2DKNA 1P0CA 1R4MA 1PX0A 1E7MA 3GY0A 3IKVA 5T8KC 4B7UA 1UXIA 1VL8A 4UUMA 1WDKA 1ENYA 3FTPA 4W6ZA 5JCJD 5A4DA 5IN5A 1A5ZA 2DU8A 3WWZA 4HFRA 4E5PA 4J3FA 1IB6A 4FJ1A 4JQCA 4CMIB 5COBA 5BNFA 4WJZA 3PYXA 4R3NA 5LC1A 1J5PA 4OHUA 2RBEA 1CDOA 3Q1LA 2OUIA 5KVSA 2BF7A 3A14A 3GVIA 4YQYA 3ASUA 1KVUA 2W2LD 3ITKA 1A4IA 1XQ1A 4Y6SA 1QV6A 3TNLA 2PNFA 3K96A 2QQ5A 4NU6A 2HDHA 1B7GO 3WDSA 4FSHA 2ZIZA 3WIDA 5JDIC 3LF2A 2O4CA 1LUAA 4TWRA 1MG0A 3EW7A 4Q3AA 5BSHA 1SB8A 3M1LA 3NAQA 3GF4A 5F5NA 4B4UA 1ZK0A 2HJRA 5B12A 4NK4A 3OIDA 4NBTA 5JY1A 2H5LA 4DYDA 2G0TA 3GG9A 3RJ5A 3WX0A 4NG5A 4D7AA 3PHGA 1XA0A 4Z3DA 3PLNA 2Q4BA 4NBUA 3UN1A 1Z75A 4YVFA 4YT8A 4I9HA 1PZHA 3EZLA 3GPIA 1DC4A 3TN7A 5IFLA 2D0IA 2X58A 4E31A 4W9NA 4OIMA 4E6PA 2Y1FA 2DBVO 2P9GA 3NRCA 4YCAA 4UUOA 2Y05A 4CMKA 5KVQA 1F12A 2F1KA 4GPD1 5IZCC 2CDAA 5C7OO 4WECA 2D4AA 3JQEA 3TFQA 2X6TA 3VPXA 3IL2A 3UICA 2O3JA 1ONNA 2CDCA 2Y1DA 4E30A 2PKQO 4L74A 4R68A 1YOVB 3RI3A 1KIFA 2CVZA 3WMWA 3B6ZA 2VWHA 3TZ6A 1JN0A 4GVLA 4D41A 1W6UA 2FWMX 2H63A 4U0JA 2VOEA 1E5QA 3F1KA 4EEZA 4TKMA 4BNIA 1UP6A 4YACA 1HL3A 4GI2A 3ZWWA 4UVEA 1PJ3A 1ORRA 4QSMA 1UR5A 3FN4A 4ND2A 1Y1PA 3W8DA 3O8QA 4O63O 3H4VA 3PFWO 3EZYA 3R1IA 3WLFA 3O03A 3CXRA 4ID9A 3R3SA 2YY7A 3H5NA 1E3WB 2Z5LA 1IULA 3ZHXA 3V8BA 3KLMX 4IXWA 3G79A 2YUTA 1LLCA 2NM0A 1R4NB 3DHYA 5AXDA 3DFZA 4ALKA 1P1RA 3VVCA 4JLWA 4WLFA 2P4QA 3HN7A 2ZATA 1DEHA 2Q2WA 1P0FA 2CSUA 1T2FA 4HP8A 1YKFA 3COSA 3GC6A 4GMFA 1IE3A 4A26A 4D3SA 1X14A 2D3TA 2AQHA 3PWKA 2C59A 5AXAA 2P2SA 3PHIA 1W73A 4BO3A 1NYTA 4TKLA 3ZWXA 2OO5A 1UXKA 1H6BA 3JQAB 3VTZA 3U09A 4FFLA 3UUWA 2Z1MA 1NVGA 1J6UA 3UH1A 3ST7A 1G0NA 2LDXA 1F0YA 3N74A 1LJ8A 2J5QA 2XF8A 4MIYA 4UULA 1TI7A 4CV3A 3KM0A 3ZHYA 1NQTA 1Y8RB 5JC8A 4BNFA 1RJWA 5I9MA 3E48A 5ITVA 1J4AA 4NU5A 3IKTA 3RFXA 3H6KA 4FFNA 3WSWA 3GN2A 3AJRA 3WG9A 3SC4A 1R37A 5KVVA 2PKRA 4OQZA 5K6AC 2SCUA 2X7HA 4R1NA 2C2XA 3ZHBA 4E13A 4PN3A 1HYGA 4WPGA 3VH2A 4WLVA 2E48A 1ZH8A 3U3XA 1PR3A 3GVXA 3GVCA 4BKOA 1U9JA 4YRBA 1WZEA 4G5HA 1I3NA 1IHXA 2EIHA 1RM5A 4XRGA 3GDOA 4GWKA 1JAXA 1VSVA 5C7LO 3DBLB 3GUYA 5L53A 4DXHA 4YR9A 2VT3A 3VKVA 1C1DB 2WD7B 3ZWMA 2Q4EA 4B3IA 3B1FA 1NR1A 2D8AA 2GZ1A 3LC7O 1QR6A 4OKIA 1DIRA 1VM6A 3ETEA 4RZHA 1RWBA 4DTIA 1FDTA 3I9NA 3DB2A 3JQDA 1N1EA 1RKXA 3EMKA 5ES3A 4DPMA 4J91A 4P4GA 3O38A 5L7TA 4WCFB 4W4TA 2DT5A 1WMBA 3G1UA 2GRAA 1E3WA 1DFIA 1U3UA 3PYLA 3NDIA 1YBVA 4DVJA 4FR5A 3DAFA 1FDUA 3OEWA 4ND5A 4I5FA 4LVUA 5TQVA 3BA1A 5EN4A 2QZZA 4EGFA 1EE9A 2RHRA 3MJSA 4BKPA 1MXHA 1E3IA 5AQ1A 2DM6A 1DAPA 4RCVA 1K5HA 1C3VA 4IGEA 4D43A 2O3QA 4Q9NA 3V2HA 4CM7A 1NQ5A 5ICSA 2GASA 2PD3A 1PJQA 1K6JA 5JYDA 2X5OA 4YJGA 5BNIA 2BFMA 1TXGA 3OHSX 2GUGA 1Q7GA 5EIOA 1YDWA 1RYEA 3KSZO 3ZV5A 3F3SA 1PWZA 3KUXA 1F06A 5DP1A 4TZTA 5ITWA 2HSDA 2DUWA 3L4BA 1ZKMA 2B37A 3RC7A 4XYBA 3PXXA 3WGYA 4JBGA 2UAGA 3OQBA 3IDSA 1AN9A 1KC3A 3BMOA 5KJFA 1BG6A 1GTMA 2OZPA 1RYDA 3D1LA 4GAEA 3TOXA 4BB6A 1E0DA 2BLLA 1LBEA 2D59A 5A02A 9LDTA 1E77A 1PIWA 4OOEA 1JWAB 1N8KA 1ZCJA 2Q50A 3S1LA 1GFSA 4OSOA 3M2TA 3ZU3A 2R00C 1WNTA 3BMQB 1ZNQO 3CE6A 1I01A 4BGIA 4J1TA 1FK8A 2WMDA 2X1HA 4ZU3A 2HMUA 2NLOA 2OL4A 5CPBA 1AHHA 2PZKA 4AJHA 4XGNA 1KERA 3ADPA 1N92A 3I4CA 2Q2QA 1C1DA 3I83A 4S3MA 4B79A 2GNAA 3VOSA 3JD3A 4RORA 4B3JA 4EYEA 4FCCA 4XZ3A 1CJCA 5TNXA 5B4VA 5L51A 1E6WA 4LK3A 3GDFA 1GQYA 4F46A 2PGJA 5KJCA 4IIVA 5G4KB 2J3IA 3BMOB 5ICMA 2B4RO 4Y67A 1T2AA 1Y81A 3E1KA 4OYRA 4YJGB 2VTEA 1Y5MA 2C82A 2RAFA 4CMAA 5IDWA 3LF1A 2NACA 2Y1CA 3QWIA 3EAGA 1H2HA 1OC4A 3B1JA 4D45A 3OQ1A 3GHYA 2AQKA 1P77A 4I1IA 3ZI0A 2BRUA 4BUCA 5JAMA 2QRKA 5DN9A 4TRNA 2GF2A 1Z82A 2BFOA 2VZ9A 3TZHA 1JVSA 4D46A 2GN6A 5BNTA 2JCYA 4GSKA 5F5LA 1ISJA 3HFGA 4HWKA 1H9BA 4IDGA 1C0PA 4XQCA 3HQ4O 3T7EA 1YBMA 3LDHA 4RVHA 3RWBA 1HLDA 3HNPA 4G65A 3DC2A 4WLUA 5CP8A 3GRPA 1L1FA 1ZMTA 4BNGA 2DAPA 4RLSA 3H65A 3DHNA 3RFVA 3IAHA 2P91A 3C85A 2W2KA 1EUZA 4II2A 1RM4A 2X5JO 4LMPA 4XQGA 1ISGA 4BGUA 5CG1A 3OJLA 5EINA 5K0ZA 4RF3A 4KWHA 4J7XA 5LCXA 3BZUA 3TOZA 3HFSA 1V3UA 3F6YA 1U2DA 4CL3A 4RLHA 2AEJA 3GNSA 4RPLA 5LDHA 1X7HA 3K92A 3PZBA 4DIFA 3FBTA 1DAOA 4FOSA 4XR4A 3KETA 4YEDA 4DWVA 3HSKA 5JAIA 5TIIA 4BO0A 4CLOB 1ZJYA 2NU7A 5FYDA 1LQTA 1U3TA 3A9WA 5CDGA 2NTJA 3WMXA 1H94A 1UZNA 3DDNA 4UVDA 1ZK4A 2EGHA 3QRWA 1TT5B 3MCVA 4HFMA 2ZYGA 2BI7A 1DFHA 1P1KA 2PR2A 4F6CA 3NGLA 4OJNA 4BNJA 2F00A 4FFPA 3WBFA 1LDNA 3ANNA 3RC9A 1B2LA 5MGBA 3CMCO 3H2SA 5ENVA 5IN4A 2DFVA 4AJIA 3DMYA 4KQXA 2WM3A 4ZQGA 3K2BA 5TLSA 4BQPA 1O0SA 1C1XB 1OOEA 3WSVA 1XSEA 3IJRA 4G81A 3GGGA 1ENPA 3EUWA 4ZQFA 1X13A 4IINA 3OIFA 5DNAA 3WR5A 4L75A 5JFOA 1F14A 1PWXA 4N5MA 3ZU2A 3AU8A 2CNBA 1LSUA 2GN8A 2W2KB 1I3MA 4MVJG 1Y8QB 2FMUA 2EKLA 4YT2A 1YWGO 2D2IA 3FCOA 1Q1NA 3NDJA 3Q11A 3K6JA 4R9SA 3RUHA 4CQMB 1EDZA 4PZDA 5CDTA 1P9LA 2JFGA 4CM9A 1PSDA 3QIVA 2GSDA 3RBVA 5L7WA 1X1TA 4U5QA 4BNWA 5AXBA 2E6UX 2EEZA 2H9IA 3E9QA 3ZV3A 3H2ZA 3FI9A 2I3AA 3D5QA 4B8ZA 1EBFA 4YTEA 1PJSA 4WE3A 3DZJA 4ZGWA 2ZYDA 1EK5A 2WSBA 3UF0A 3G3EA 3VPHA 4BNKA 4L4SA 3WOHA 4IJUA 2O3RA 4YAIA 1N2SA 5EESA 3OF2A 4FPXA 2BGMA 3IUSA 4FFMA 2ZB3A 4XIJA 1IOLA 5EQFA 2A94A 2QRJA 2NTNA 4BNHA 4FC6A 3GK3A 1E1LA 4MVJP 1GADO 3X2FA 1VRWA 1EMDA 1PJ4A 3E5MA 4BNLA 3GGOA 5KCZA 2NVBA 5THQA 4CMEC 2O7QA 5IXYA 1R66A 3MOGA 2W2LA 3KYDB 2AXQA 4R1SA 4I5EA 4ZICA 4IDFA 1QXSA 3EY4A 4PG5A 2YW9A 2EHDA 3LT2A 1BXZA 1NPDA 4J6FA 2I6TA 3D5TA 1O8CA 4J9VA 3M2PA 3TL3A 1GL3A 4N18A 3KSUA 3WNVA 1LRJA 4L73A 3OICA 3FD8A 4EITA 3H3FA 4FIZA 4MP6A 5IDYA 5G0SA 3ONFA 2X5KO 4BKUA 3ZWVA 1H6DA 2OP0A 2NQ8A 1SB9A 1UP4A 2BH9A 1HE3A 1F8GA 3D4PA 5I8WA 1XG5A 3JV7A 5IXSA 1DXYA 3QE3A 3IP3A 4M8SA 3WB9A 4HFJA 1E7WA 1EVIA 2NVUA 3I23A 3OJ0A 3JQCA 4R01A 5JAZA 3WGGA 4NQZA 1DC6A 3V5NA 3IOYA 4QO8A 4LRSB 3FNFA 1JQBA 2G82A 1GUYA 4L4RA 3DOOA 2VHVA 4JROA 3G1TA 4ZRMA 5KTKA 1AE1A 2X0IA 3K8ZA 4K9DA 5HBRA 4DMMA 2VHWA 3KO8A 4M54A 5TJ9A 3JQFA 2B69A 4NH4A 4PLTA 1YB5A 5TF4A 4CM8A 1QG6A 4Y6RA 4CMGA 3E18A 4NMHA 3ZNOA 3FBGA 3V1TC 4GX1A 4ZQEA 1CF2O 4B7CA 5KJEA 3L6DA 3S8MA 4RDHA 1GY8A 3IS3A 2QYSA 4GBJA 2C0CA 3PLRA 3ZWPA 5ILGA 3W6UA 3C7CB 3SJ7A 3WGTA 5CG2A 1IL0A 3JD2A 1EVYA 1NP3A 1Y8RA 3C1AA 5I9NA 2CDBA 3OM9A 2EWMA 3DTYA 2AG5A 3UVEA 1M66A 4YA6A 2C7GA 4JXKA 1NAIA 4BS9A 3VPSA 1VSUA 1KVSA 4W7IA 1LLDA 3M6IA 2HO5A 3ORFA 3TJRA 4YBZA 1FJHA 1M6WA 1U4SA 3DONA 4L0QA 2Y93A 2AG8A 1ID1A 3TZQA 5FEUA 2C7VA 3OFSA 2VZ8A 2PGDA 4MPDA 3FNEA 4IDDA 3RUAA 1LRLA 1EFKA 2AMFA 1UXHA 5TX7A 4BV9A 3UHAA 1UH5A 1PQUA 4FW8A 5MDHA 1AXEA 1Y6JA 3RASA 5JY6A 4E3ZA 1QYVA 3OA2A 3KYDA 2FR8A 1I36A 1YE3A 3FNGA 3FRJA 1P1FA 3L9XA 4U6SA 4D0SA 3HJAA 3E6AA 4A0SA 2XXJA 3ZGYA 4EJ0A 1GDHA 3ONEA 3S2FA 2YHIB 5HS4A 3QVSA 3ZH2A 4WASA 1LLQA 2Q1UA 3QVOA 7MDHA 3FR7A 2QZ9A 1PJLA 3W4IA 3DXFA 1WWKA 5KKCA 2EP5A 3RQSA 2V6MA 2R00A 2VYNA 3K9QO 1K6IA 1SCUA 3PTZA 5TSDA 3L0DA 2Y1GA 5CEEA 3S55A 5GMOA 1SEPA 1U7TA 4RDIA 2JD0A 4J4BA 4PLPA 3PZRA 4OKNA 4WLEA 2XXBA 4YAJA 1LC0A 2FRDA 3EVNA 4RF5A 4HBGA 1WMAA 4C7JA 3PHLA 4AL4A 4XRRA 2YFQA 3HUDA 3RUFA 4BNUA 3E5RA 4MKZA 2IEDA 5EPOA 3UGKA 3GR6A 2FR0A 4O0LA 4RL6A 1PL8A 3P2YA 3QVXA 3VZSA 5CHEA 3AY7A 4R4JA 1ZK3A 3PJGA 4RPHA 2JL1A 2YFHA 3U49A 4AJEA 1CYDA 3MTGA 1ZK2A 5GY7A 4E5KA 4LCJA 3KYCB 5H81A 3MWDB 2ZTLA 3LLSA 4H7PA 3HB5X 2FZWA 3NV9A 4BNZA 2R2GA 1VJTA 2VRCD 3ROMA 2UVDA 1QV7A 3BTVA 3L77A 2PTGA 2PWZA 3GAZA 3VKUA 4BO7A 1HTBA 2AE2A 3BMNA 4RVSA 1HDOA 1A4UA 4JBIA 4DBVO 2AHRA 3I4FA 3O8QB 3VZPA 4NK5A 2JKVA 3PGXA 1M76A 1TA4A 3G17A 4FQ8A 4ZQBA 1MP0A 4GL4A 1OFGA 3BMQA 3INTA 3N7UA 4FD3A 3BAZA 4LGVA 1XWFA 4QO7A 4YWJA 2O3UA 2XOXA 2VHZA 1X1EA 1KEWA 3KEQA 4LSWA 3NEPX 3ZWAA 4IDBA 4MP3A 1T25A 4WNCA 4TROA 4IQGA 1N1GA 5IJZA 3U4DA 1M75A 3KYCA 2X0JA 1X0XA 1HSOA 3OJEA 2BGKA 2PV7A 1DC5A 3C24A 2X8LA 4NFYA 2J5RA 4YRDA 5A06A 4P22A 1KEUA 1A27A 2RCYA 2BGLA 4FDAA 3DZBA 5DBGA 3ZU5A 4IGFA 3GHHA 5EL0A 4I08A 3BMNB 1R0SA 3CPSA 3LLVA 4XYGA 1TLTA 4J1NA 1V6AA 4O5OA 3VH3A 3GGPA 2O3SA 2IEBA 4B8WA 3AW9A 2AEMA 1LDEA 3ZN2A 3DOJA 3JQAA 1WW8A 1LDMA 4J4HA 5BSEA 4PZEA 5I7EA 1B14A 1U1IA 1HZZA 2E49A 9LDBA 5G4LA 1LX6A 2EJVA 1I10A 1XGKA 2ZYAA 4FGSA 3IJPA 3JQ7A 1K2WA 3UKOA 2Q1SA 4Q3DA 4BNNA 2J5KA 3ZWNA 1CERA 4MDHA 1P3DA 4HX5A 2JD1A 2VYND 3CSDA 3DR3A 3K73O 3QLJA 1Q7CA 1S7CA 4Z3KA 1SNYA 3F5SA 4F3YA 5JPIA 4ALIA 5EERA 1E92A 1MA0A 2DQ4A 3ZV4A 2ZJ1A 1GUZA 1EEHA 4MVJH 5JBIA 4EEXA 4NBWA 1E7YA 5KVCA 5FFFA 4FOOA 2YQ5A 2VWQA 1HKUA 1BTOA 3GQVA 4MVJI 4KOAA 1WVGA 3S2GA 1OC2A 5IDQA 4MVJF 2WYUA 1ZK1A 4PZCA 1SPXA 1NVTA 1QYXA 4K26A 1QP8A 4RQUA 4MVJE 2VHXA 1VL0A 3VH4A 2GPTA 4JCOA 1MLDA 1PTJA 2BFPA 3ZV6A 3JCZA 2ZCUA 1YJQA 3GZNA 3JYOA 3FPCA 2J8ZA 2IXAA 1D4FA 1UDCA 5BQFA 3DZGA 3NGXA 2OOSA 4HUJA 2ZQYA 4LISA 2VOJA 3WFJA 3X2EA 4BHTA 8LDHA 4DC0A 1ZJZA 3H9EO 2HK9A 2PD4A 3H5RA 1R6DA 1T24A 3C1OA 1R16A 3OIGA 1HT0A 2J3JA 2BELA 4TVBA 1XU9A 3UCXA 3QA9A 3WBBA 4DLLA 4DQUA 1GU7A 2QX7A 4JP2A 2QHXA 4RPGA 2Q3EA 1ZBQA 4DRYA 4QFDA 4H16A 2P4HX 4QQRA 2V6GA 2TMGA 1UZMA 3EHEA 4BKQA 2FN7A 2YHUA 1OMOA 3GAFA 4GQAA 3W4JA 1BXGA 4RVUA 1T2EA 4QEDA 1W8DA 3W8EA 1Y5RA 1V35A 4L76A 2WD8A 4RPJA 5KJ1A 4QTZA 4WK6A 5JAQA 3PI7A 2HMWA 2EP7A 3JQAD 4E32A 5A5FA 1T2CA 1K0UA 2PY6A 2G1UA 2Y0CA 1MG5A 4IQ8A 1A7AA 4DREA 4AJKA 4XGIA 4CLEA 3PRJA 4CQMD 2IZ0A 2EG9A 1XELA 1BVUA 2P5YA 3ANMA 4ZHSA 2GZ3A 3FSRA 5A05A 3W4KA 2Z95A 3Q9UA 5G4KA 3B1KA 4DA9A 1PGNA 3WJ7A 3ENKA 3AUUA 4UUNA 4BO9A 1T4DA 4OO3A 1IZ9A 1DIBA 1Z74A 3QWFA 3NTQA 2O7SA 3DBVO 5L4LA 5K9ZA 1SO8A 2Q2VA 3DZKA 2Y0EA 3T7CA 2POQX 1D8AA 1FF9A 5DT9A 3GZNB 3U4HA 2X9GA 2EKPA 4IJKA 5CEJA 1FDVA 3AOEC 4J1QA 4PLCA 1VKOA 4KDFA 1WAMA 3WGQA 1DLIA 4URFA 3WYEA 1J49A 1H9AA 2DPHA 4A5OA 2V6BA 3GEMA 1ULSA 2NV6A 3DHEA 5U4QA 1NVMB 3TWOA 4OH1A 1GD1O 2PGLA 2B35A 2Q49A 4KP7A 4UEOA 1P1JA 4MVJD 3U0BA 2JCVA 3R0IA 4Y6PA 1B26A 1R4NA 1HDGO 1BW9A 5I9LA 3FF4A 4I9NA 1BWSA 3H8VA 1PL6A 4HNGA 3BXXA 1HXHA 4L9RA 4BO2A 4CMEA 1V3VA 4UVHA 4KUGA 4EZBA 2BHLA 3F4LA 3IP1A 4Z6KA 2ZKLA 5DBIA 1KY5A 4GKVA 3SXPA 4XYLA 4WKGA 4NJMA 4J49A 2ZB7A 1G1AA 4FBGA 4Q39A 2IYPA 1ADFA 3GEGA 4M55A 3SVTA 4CMBA 3EDMA 5JMPA 4EI2A 1PGPA 4BOYA 5IF3A 4OM8A 1LSSA 1DIGA 1I2CA 2GLXA 2IYOA 3K30A 5L4SA 1JKIA 4XJTA 2JJYA 4BO1A 4PVDA 1PJCA 1KVQA 2HLPA 3Q9NA 4NFHA 5DDIP 1MV8A 1XR3A 3U5TA 3DTTA 1ZO8A 4YXFA 1YL7A 1Z73A 3F46A 3GMSA 4IMRA 3TSCA 3KB6A 4GX0A 4H15A 2O2YA 3WICA 4YJFA 4MO2A 3B20A 3MJVA 4KUEA 2W90A 1CIVA 2Q45A 4P8RA 3UW3A 1NM5A 2I9PA 4JK3A 3SJUA 2YYYA 4RVFA 4HNHA 3LT0A 1TVEA 4FS3A 1NFRA 3QV1A 4E2XA 4E2YA 1H5QA 2CD9A 4NBRA 3QVWA 1WP4A 1T26A 1E7RA 3JD0A 3DBHA 1EE2A 1PL7A 2P68A 4QFCA 3RFTA 1WDLA 4IJWA 1FDSA 4F45A 3KLPX 2I5PO 3OMLA 2R6JA 1E3JA 1GZ3A 4TVOA 4AJOA 2O50A 2WEKA 3AOEA 4MIEA 3JQ7B 1R0LA 5C5IA 3F4BA 1QLHA 1HEUA 5KIAA 2HRBA 4NIMA 5A9SB 3AWDA 3VDRA 1U5AA 4E5YA 1D1SA 4EUHA 4W9NC 4XQEA 5ENDA 3ZWYA 3OP4A 1T2DA 4E33A 1GR0A 3HE3A 2I3GA 5I7SA 1WZIA 2H6EA 4K6FA 1XIVA 4EW6A 2W8ZA 3CEAA 5COQA 2Y67A 5DBFA 3H5AA 4E2ZA 1BRMA 3LSYA 4CM1A 5KWEA 3VVBA 1UP7A 2ZB4A 4MKRA 1Q2XA 3AK4A 5DF1A 1CETA 4KQWA 3IIEA 3UCFA 6ADHA 2B4QA 5KKAA 4YB8A 4AJPA 3PQEA 3NT4A 3ZWBA 2YZ7A 5JXWA 2Y66A 3VDQA 2B36A 3GA0A 4CMCA 4OQYA 5FF9A 4YAGA 2C07A 3MOIA 5JS6A 2I76A 4GVXA 4LN1A 2UDPA 5AVOA 2JHGA 1NHGA 3TL2A 4OAQA 1U8XX 1JDJA 3G49A 3JQFC 1DB3A 3KOUA 2LDBA 1ZXLA 4UVIA 1AXGA 3INGA 3BMCA 4WGGA 3ON5A 5DOZA 4RJTA 4IIUA 4XWYA 1JTVA 5A3JA 3JQ6A 1EZ4A 1Y9EA 4XB1A 1SOVA 4PLWA 1ZSYA 2EGGA 4AJLA 1CQJA 4J9UE 1N7GA 3RC1A 4CM4A 5JNLA 4NI5A 4ILKA 4DPLA 2E4AA 1EVZA 3RKUA 4PIVA 3KSDO 2BMAA 4FJ2A 1I24A 2FSSA 4J2OA 4FC7A 2VYVA 1CWUA 4A2CA 1DSSG 1GYQA 3AU9A 4Q3CA 1BXGB 4D79A 4CMIA 5JDCA 3KVOA 1YGYA 2D1YA 4BO4A 5JO9A 1PZGA 2RH8A 1L7DA 1SBYA 3I5MA 1KY4A 3WIEA 3V1YA 2X4GA 2PFGA 2WD7A 4BMVA 4DQXA 1E3SA 2HCTA 1ZFNA 4XB2A 1UAGA 1H6CA 5H83A 5THKA 3WYCA 3CKYA 5AOVA 3LT4A 1PGJA 3U4IA 4JP3A 1LEHA 1TB4A 3S2IA 4QUKA 2AEFA 2VNAA 1OZAA 2ZB8A 3TZCA 3ZNNA 3C7AA 5FI3A 4WCFA 3U4CA 4TRJA 4PLGA 2B0JA 3ZNQA 3GOHA 4WLNA 4PGFA 1A9ZA 2JFHA 5KJ6A 1U8FO 3N58A 3PK0A 1PGOA 2PK3A 3WGOA 4JBHA 4DQVA 1HZJA 3EVTA 5A9SA 1G0OA 1LDGA 1SMKA 3QSGA 1E6UA 1NASA 2HAEA 3I9KA 3GVHA 3DEYX 3ICPA 5I7FA 4AG3A 1BXKA 1UAYA 3SBOA 1UXGA 1B8UA 2CY0A 3OQ6A 3PFFA 5K6AA 1YS4A 2YV1A 2Y1EA 2HJSA 4PG4A 4W82A 3HDYA 3ANLA 3QY9A 4R3WA 2DFDA 3GG2A 4X54A 3KZVA 5T5QA 1EUCA 1LA2A 3UXYA 1HYHA 2Q99A 3KV3O 4XJSA 1W0CA 2VZ0A 2FY8A 2ZQZA 5G2OA
chains in the Genus database with same CATH superfamily
1WTAA 3MLBA 2XUQA 1KPHA 4IRMA 1TD1A 5ICFA 3MGBA 4LBZA 2BY4A 4ITRC 4CIBA 4C3OB 2GPBA 4HI0E 5IJAA 3I52A 3NZEA 2XE7A 3PFNA 4O4IA 3TR5A 3MJ4A 2DTDA 3HYRA 2MOKA 1I7NA 4DR6B 1WP9A 2HX1A 3NBAA 4F2PA 1JB1A 5HGXA 2XODA 2FHSA 5FCDA 4HY3A 1VE9A 2HRCA 4E7PA 2IS6A 5TPWB 3QPWA 1O6BA 4NFSA 1P4GA 4TZ6A 2WLSA 4WXHA 3AVOA 5A5VA 1ONPA 1A8IA 2SICE 1UMBB 3EA4A 4ZOEA 1IM2A 2DJIA 4R54A 5DTMA 4H7DA 2G36A 2D0PB 1JPJA 2FP4A 2I2BA 3I0NA 2J6IA 1SA0B 1Y4AE 4R51A 4FD2A 4R83A 2W2PA 1XB2A 3NTRA 3QOFA 4A8HA 1O94C 2HYIC 2I22A 3RC2A 4YXWD 1WTCA 4V24A 5B3AA 1P7ZA 1QF6A 3WAGA 1I6WA 5L6LB 1HLGA 5G41A 4C89A 5B64A 1WXGA 1WOYA 4K6HA 5LZ2A 1V71A 4CHTA 1II9A 4CMJA 1C8LA 1L6IA 3OAAA 3M4ZA 4Q9HA 3STXA 4NC9A 5AVVA 1KZ9A 2QN3A 4YJ3B 3E9ZA 4CN9A 4RZUA 2PUEA 3HDJA 1EBUA 1O5IA 3X44A 3U4QA 3OIWA 4ROSA 4DLSA 1ST3A 4Y9DA 1RBYA 2AK2A 2DHEA 4IPTA 3EN0A 4MKGA 4CLRA 3OIUA 2AC7A 1E7SA 4OFXA 1PS9A 3JQPA 3SJAA 4HN2A 1XDZA 3GT0A 1N34B 3CUKA 3VH1A 5KOYA 2JBWA 4BP1A 1CYEA 4RVDA 4YDSA 4AJNA 3WGUA 2Y99A 3OETA 2VJPA 3SEFA 3LLCA 4A0QA 3UOGA 3ZE2B 4E3WA 1IY8A 3KWFA 5GJVC 1AMNA 4IDAA 2QUKA 1LV7A 3I5YA 3C6BA 1C7EA 3DDOA 1IRXA 1EK2A 3GPDG 1KYIA 1KXZA 3CKKA 4B4DA 4YX9A 5F21A 3VZCA 1UKAA 2ISQA 3QENA 4Z53A 1VC2A 2GNOA 1OSNA 3D5EA 3HBAA 4CTMA 1NXXA 3GJ7A 1TEHA 3ASVA 4JITA 1DG1G 1TK3A 1C7ZA 3M4XA 1AS0A 2RGRA 3X1WA 1FUEA 5C5EA 3FRIA 1I7QB 1O8BA 3AR7A 3RUCA 3DLHA 1CY8A 3CU5A 2IS1A 1Y9AA 3AF2A 5IZ4A 4O4LA 4EQ6A 4QODA 5CVDA 3WWOA 5TGTA 1TO1E 4ILEA 1ZVVA 4QHTA 1IBRA 2PUHA 3ENNA 3DCJA 3F6SA 3L0CA 4O5AA 5GV8A 2OQVA 5H82A 4Q02A 4Z7QB 1TK2A 2Q0SA 4QE3A 4BU0A 2JANA 3T95A 1O6CA 2PLNA 2SKEA 2GCEA 3FB1A 5IUNC 1UKYA 3M81A 1ZW1A 2B8TA 3R23A 5CTAA 1SXJE 4XSGA 2DPGA 4IIYA 5IJWA 3A05A 5CT9A 2VYCA 1SCIA 4DR1B 4MAAA 3CZRA 2B5WA 2FZKA 4FGWA 1B3RA 1JQJC 3VO1A 3FLMA 3U4QB 3U60B 1BYUA 3PDCA 3HTXA 2GZHA 1YU9A 4YROA 1RS0A 2R68A 4HDNA 1S01A 4RMIA 1JH9A 4ZOQI 3HNOA 3KRTA 1EFUA 4CM3A 5L3QB 5C3MA 4MYSA 2J9YB 1DDOA 1K3FA 1VJ5A 3U62A 3QJGA 1DKOA 2HCFA 3L07A 2FEAA 5B6PA 2CXTA 3S5UA 4XM0A 2H11A 3CURA 2J45A 1U6JA 3OUUA 3C45A 4HYTA 3CRQA 3L0YA 1JU3A 1J8QA 3IBSA 1A9XB 3NEYA 5B2ZA 1K8RA 3SZOA 3OZWA 1X8XA 2PT9A 4G0VA 1EU1A 1LTKA 1SBNE 2O20A 5JSFA 3IQHX 3EDYA 3NTOA 4BVJA 2HQBA 2QLLA 2AE1A 4CODB 4Q7KA 1AMOA 1LDYA 2CNNA 5T8KA 2XRZA 5A4JA 1F1BA 4FWTA 1CY1A 1Z5UA 1JU4A 3QI2A 4GBGA 5TRTA 1ZRNA 4XW2A 4DVGA 3Q8MA 1UFOA 1LFDB 4MW2A 4RM2A 5DM70 3P19A 1KKMA 2QYHA 3EOAI 1DO8A 3ETLA 1B74A 1NXOA 3GLGB 2Q3FA 4PHTA 3OPMA 2XADA 2XIJA 1M1XB 1G8HA 3RKRA 1RAEA 3EF1A 3TQQA 1XTIA 2Q8PA 1YZHA 4UREA 1BW9B 1MPTA 2C4NA 2HMTA 3MUEA 3N28A 4ZPJA 5F1PA 3A4VA 5BN1A 3BSSA 2MSLA 1FTGA 2GD1O 2VTDA 2A84A 2QZPA 4O4LB 2Q46A 4W8OA 3HNRA 3OY2A 2IZ1A 4AUNA 1KETA 3RSZA 3RU3A 3FHJA 3BX1A 1QZTA 4PZUA 1C29B 1NSYA 5HM8A 4RV9A 4PFJA 1AF4A 1KZ1A 1ESMA 1L8OA 1NF9A 4IZIA 1CNFA 4FOTA 1JIQA 4BVEA 3B70A 3S8EA 2DXIA 1C0IA 4XASA 1DOHA 1G5RA 1B0ZA 2ZITA 3I2GA 4KLCA 4UHCA 3ORRA 1PR5A 4BJHB 2EX4A 3LECA 4EUEA 2NNLD 2J0QA 5EFZA 1X7DA 4BC0A 4CHGA 3VU3A 5C4IA 1JQEA 2GYVA 1LC3A 2FWAA 4H7FA 4AJ4A 3QX3A 1JBQA 2R96A 2Z1NA 3CF4G 3EVDA 3SOPA 2HSEA 5E3HA 2ZIAA 4MHOA 4OHBA 4KMSA 4MYRA 4MINA 2FUKA 1XZEA 2X9LA 4RYDA 3WDLA 5BSGA 2V6JA 2X8JB 2XE4A 1IIBA 3MBOA 4LZLA 4Q4DA 4TGLA 4BLPA 3H1TA 1XKXA 3JQ9A 4GGPA 4OMDA 4DSAA 3ROPA 1RQ7A 4DIBA 3VR5A 5NLLA 2AOUA 3F78A 3TTUA 1SUAA 1T3TA 5KTMA 2ODPA 2F9LA 1Y82A 1WXHA 1A9PA 1BHQ1 2TS1A 4TMFA 3RTDA 2XNDD 3DZ8A 2YMQA 4YJFB 1KDYA 3T3MB 4C4OA 4AY6A 1JH8A 5EG5A 4GBED 2BCJQ 1NMEA 1C5KA 1R9NA 1LTHR 1VL1A 1F2VA 3AH8A 3WGZA 3ZZUA 2HCBA 4Y6LA 2MYNA 3H1BA 4B7AA 3RREA 5EFOA 3C3XA 4KSYA 2YZKA 3NHAA 2XY4A 3NHUA 4QWWA 2NSYA 3TMKA 4BFXA 2HA4A 3ZX5A 2E89A 1DRWA 2DETA 3THWB 3GLRA 3L8FA 2OM6A 3RG8A 5C1BA 3KP1A 3TLGA 3TYXA 1DT3A 1MOPA 4OGWA 4XKJA 2ZRBA 5FAXA 3OA0A 1ZL0A 2R2AA 2ZG6A 3ZW8A 1MC4A 2XAAA 3L3BA 1M10A 2MSKA 3LE8A 4IQ0A 3QG5A 3BZWA 1VL2A 7AT1A 5FLKA 1J56A 1MXFA 2R6HA 2CHVA 4YH1A 4F9GA 5CYGA 3QVLA 1EJ6A 2O2CA 1FZQA 1I5OA 2QRQA 3DFKA 3NIFB 2CUNA 2WJWA 5KYVA 1QGUA 2QTRA 1BKYA 1PZMA 2E2WA 3OLQA 2QD5A 2QJRA 4HZGA 1XZAA 4WUVA 4XEUA 1AUVA 1EX6A 4MEJA 4BO8A 2AR9A 3GMDA 3OCZA 4IUYA 3UJHA 2H1CA 4BTLA 3JZMA 3OQPA 2DFTA 1PD0A 4IOKA 5BW6B 2WJHA 1MGPA 3HEMA 1PQPA 3SC6A 1W47A 1M6EX 1UM9B 5LYYA 5T41A 4BX0A 4JX9A 4LJSA 1LBTA 3LBHA 5DYYA 4CKBA 1IXRC 3RSOA 2R7NA 1KMHA 4JJFA 4YCBA 4OHZA 2OLEA 2PO5A 2VWPA 4N65A 1GFIA 2P69A 4IFEA 4RY0A 1NPYA 4ZA2A 4A0RA 4I14A 1QPBA 5C35A 1MNAA 4JEHA 5I9BA 1RVDA 3R7WB 4EG3A 1CFJA 1SU8A 2VNJA 4LJLA 5HF5A 1JHUA 2PJZA 4H3HB 2CV2A 4XIYA 1P72A 4U2DA 2HA6A 1IUKA 4ALMA 3HMKA 2BFWA 4AP6A 4AY4A 4I46A 3ZQJA 3AIMA 2Q0QA 5C1DA 4IDHA 1XPUA 1SURA 2ID8A 1U31A 1JU9A 3O73A 1G7CA 1NAHA 2A4KA 4Q00A 2OCXA 3UMSA 4DWOA 2GM4A 4M1YA 1SBIA 2NO1A 3CLSC 1JWBB 2VQ3A 2ZB2A 3G0GA 3PNBA 4EYOA 5LQUA 3EC7A 1NFQA 4FZVA 1YRWA 3BMXA 1SZDA 1YCFA 1HETA 3I9OA 4GE0A 5FT9A 5JH7F 1Z2PX 4WY8A 4U7WA 2FPUA 5DOVA 4RGBA 3TPCA 1N2CE 4Z1MA 3SFTA 2IA5A 2EYQA 4LJ4A 4XA8A 4DC1A 3HSSA 3ZEAA 1KJQA 3FJYA 1Y8AA 4RLFA 1PWYE 1KKLA 4I5GA 3QOXA 3RODA 1Y80A 2HLDA 4ZT6A 2CB0A 3B5EA 2JAPA 3RUIA 4AZWA 3BMCB 1WB6A 3ADCA 1K68A 1EX7A 2Q5CA 3BHNA 4IOJA 4FFOA 2PS3A 1E3EA 1KNXA 4H1UA 3UJ7A 3MWEB 4LSMA 4IR7A 4G85A 5KYKA 3OU6A 1FBTA 2VP6A 4Y2GA 4BBJA 1KH2A 4HDSA 1KZ4A 1NJ2A 4BWFB 1JLHA 1TIKA 2H1RA 3R3JA 4C7KA 4CG2A 2PANA 2CHFA 4EB0A 4EFKA 2NQTA 1NUSA 3AVYA 2COKA 4MW4A 1M2EA 1UPCA 3F3MA 3LWZA 2O3TA 1P39A 2Z09A 1QM5A 3RK4A 4H7KA 1H93A 1U7OA 3OFND 2G5TA 3T9FA 3SP1A 5FUWA 3V4VB 4AIRA 2IQIA 1AQ6A 1PW5A 3JQBA 2HB6A 1ZD4A 2D5CA 2QTAA 3V9AA 1OYOA 3PQ4A 1L7OA 3EY9A 1A8QA 3DZIA 4BQEA 4UQLA 4DV2B 4E09A 3QLUA 3AGPA 2XCSB 2VWGA 5JATA 2O23A 1S02A 1HT3A 2H9AA 3CEMA 1NUPA 3VX3A 3ZW9A 4CM9D 4PEVA 4KREA 2O2ZA 4BP8A 4E5MA 3HB1A 3RVOA 3R3WA 2H92A 3EIHA 1DCMA 1QSGA 1W1UA 1E2NA 2OGSA 3VPDA 2OCYC 2WBLC 2ZSBA 1PK7A 4NP6A 2A9FA 4G4SO 3FOWA 3PHHA 3MA0A 1D9ZA 2WYWA 1YACA 1SZPA 2NTYC 2W6CX 4ISBA 5FWXA 4YRZA 5COAA 2FZEA 4B81A 1V7CA 3GBVA 2HOQA 3MRTA 4D98A 3LH5A 1VHTA 5HMMA 1XRLA 4NJMB 2BMDA 3MJCA 4RF4A 3W2EA 4LE2A 4KQEA 1UKZA 2NU8A 2UXBB 3DEZA 4CU5A 1FS6A 2JIQA 4AM8A 3CRZA 3R6TA 5EYPA 3H6GA 4ZI7B 4B3RB 1HX7A 3GLFE 3G5TA 2AQ8A 3EAQA 1WKCA 5AUNB 1M7GA 1O94A 1ORWA 4JUDX 5DPMA 2MMCA 3M5PA 3HN6A 3NI2A 5KAPA 4BAGA 2AQIA 2Y8EA 4KTTE 4C4AA 1NKTA 2X22A 5L95A 4PANA 1E2LA 4URHA 3ZDCA 3E53A 2MCFA 3OM0A 4M9RA 4EG5A 4EHFA 3ZS8A 2PD6A 5CNIA 3AEKB 1OIXA 2YXPX 4TYMA 3LC2O 2NUTA 4F92B 3OOYA 1VCNA 1ZR4A 2I7DA 4ESOA 1X6VA 4M9UA 1XDWA 2CWWA 3DO5A 5HJ5A 3BHJA 2UUCB 4IKPA 2ZUVA 4ZOLA 3IC5A 5DSZA 1T0HB 3TVYA 4MCJA 4LGMA 3O0TA 3A4TA 3KWJA 4BB5A 2EF1A 1P3Y1 3WADA 2P40A 3T0GA 4LXYA 1RM0A 4TSFA 3GO4A 4G1MB 2UUPA 1UPFA 2BFCB 2GN2A 5EZQA 4YV0A 4R16A 1I14A 3F8TA 4LVCA 3TH5A 4M0EA 4JC5A 1AHIA 4TT8A 5AHRA 4EJ6A 2J7PA 1T0BA 2QI9C 2GZMA 1RJEA 1V11A 3QPBA 1IWPB 5ECWA 4BNYA 3EISA 3FCAA 3PIRA 1A97A 4IJ6A 1XRRA 2OBNA 1JLLA 3QIAA 5EJGA 1AG9A 5I48A 2FA9A 3GEDA 1EI9A 5EZYA 1QWSA 5DHQA 3VR6H 5K0SA 3I8OA 4CCWA 4BKRA 1U9IC 2QJWA 3B3JA 4UXIA 2AD5A 3FMIA 2XQVA 1OXUA 3I92A 4J7CA 4MV0A 1UMKA 3HZZA 4O4HA 1DX9A 3WS7A 1YL5A 2X8JA 3G88A 4IFTA 1PS8A 1T10A 1VJ1A 1ZXXA 1QLWA 2JI4A 4UZFA 3E05A 1XLTA 1V41E 3NOVA 4JB2A 1Q22A 3GDGA 5JNUA 2HDNB 4MUHA 2I29A 2NX2A 2G28A 4KUHA 4QDUA 4WKOA 3WB2A 5HKBA 1F17A 2EV9A 2FJ0A 2Q1WA 2VKQA 3OFNA 4LTNA 4YRLA 5E6UB 4LG1A 3T4XA 4Y9RA 3VU9A 3AF0A 5KQLA 2W2OA 3VQTA 1GPBA 2BCGY 3GJSA 2L82A 3HBLA 4R2HA 3ETGA 3V8EA 4HDRB 2WMYA 4CPDA 2C31A 1LQ2A 1ADJA 1QAMA 3W8FA 4OMUA 1ONBA 3OQVA 3W06A 2OFPA 4HV4A 4M89A 1XV5A 4MWSA 3ZZNA 2O2SA 3T1QA 3LBFA 2GFIA 1G5HA 4ZCLA 1GP2A 1NLZA 2WZQA 5HG0A 5HGJA 1J0DA 1XZMA 2I99A 1V8DA 1JSLA 4RK7A 3C5HA 3DLBA 1KI1A 4PCAA 3PDIA 1SG0A 4ZHQF 4W5NA 4MW9A 1GRNA 4JNKA 3SF8B 4TLCA 4DA6A 3KEMA 1WBDA 1YQWA 2ERXA 2QTZA 2YIDA 4B8YA 4NV0A 3IAS6 1BDBA 2CBXA 2GCIA 1Q5PA 4D80A 2HZBA 4MB2A 1VXOA 3PRKE 1WE2A 4CR8A 3S8YA 1UBSB 3SR4A 3FTQA 1ZMRA 2FFRA 1ISHA 3HB4X 1N8TA 1E1QD 1P0MA 1Q19A 3A6ZA 4V0KA 3UW1A 1LS1A 4PSVA 2IV2X 1YQEA 2VN8A 2HW8A 2ZBUA 3UOWA 1BFUA 2NWQA 4CMHA 1EDDA 1FUIA 3ZHSA 4O4JB 3GZ4A 2E37A 3WKDA 4X84A 1L7EA 1EEXB 2C3PA 1CRLA 4YMHA 1VPVA 1JR4A 2FRVA 2LKDA 1XOIA 1SXJD 1Y1TA 4GP9A 4IVNA 4P4UA 4LJ5A 4CIWA 3I05A 2FB9A 3PJFA 2CBGA 4J07A 2DVMA 1H0KA 2WT9A 4AUKA 4C29A 4IJVA 5BYBA 1CQPA 3EYWA 2X4LA 4UCQA 2AW3A 1M6VB 4JJIA 3BHMA 3DE3X 2WWRA 2XIQA 1W5SA 1KDTA 3DT8A 5ER9A 3PGJA 4PLHA 1ZVQA 1W88A 3AEQA 1EA5A 3HH8A 4A73A 4TWIA 2J0VA 1FBNA 1W2GA 4G0QA 4RQAA 1TUBA 4QVKA 2HJVA 4BGDA 4DV5B 4IW3B 3A4IA 4XDYA 1H3EA 3J7AC 3EDRA 3CPHA 4TLMB 4NWIA 2X9NA 2AN3A 1XTTA 3RYHA 3AXSA 4XE5A 3Q3CA 1Y3FE 4UTRA 4IL5A 5F77A 3AM3A 3LZCA 1Q50A 1HQKA 1IPFA 3DXXA 4JGGA 1PWEA 3B7PA 3CA8A 1AKUA 1VMEA 2YVKA 3K8YA 4XPIA 4YYZA 4NHEA 1Z2NX 3N76A 4G9GA 1OR8A 4V38A 4HEJA 3SDSA 1HQDA 3ESBA 1FFEA 4L85A 1ND5A 2VSFA 3CTMA 4HAYA 4MKHA 1NX9A 3UJCA 1NBHA 3ESRA 3ZK7A 2CF5A 1F2UB 4F72A 4PBTA 1Y7TA 1HZZC 4AFNA 3TPZA 3MUOA 1MC8A 4XDGA 3E22A 5DX0A 2Z2YA 3IAAA 1K3TA 2TMDA 5IJXA 5SY9A 3GJ0A 5A5GA 1ENOA 2I6UA 4GZ6A 1JQLB 1NX6A 2JI6A 1SC1A 2IH5A 1D3AA 2HNAA 1L5KA 1G7TA 4MQ6A 4F4JA 2B3DA 1UPBA 3R0VA 4MV7A 3NASA 2CNOA 1V9LA 2E1RA 3ESDA 4FX5A 2VP4A 4YJHB 3W5UA 3U16A 5EJ4A 1WCWA 3S40A 1ZI8A 3B8HA 3PEFA 5IC5A 4J0JA 1GN8A 1GV0A 5CYOA 5AKHA 5DWDA 3WK9A 3G2QA 1SQFA 1IN1A 2CLOB 2GEBA 3G8BA 4RO0A 2SCUB 3IQGX 3V1UA 1M1NB 1QQTA 3R4CA 1E5VA 2QIOA 4TV9B 3T6KA 1JXOA 2X0KA 3QOWA 1TZ2A 3ORHA 4J2TA 4NECA 3T4EA 4AYWA 5BRAA 4MP8A 4H17A 3I5AA 1BAPA 3CONA 1X0VA 1UJMA 3KJNA 4OL9A 1BS1A 5FNVF 1RHRA 3ZKAA 5HM6A 3H9GA 1NOIA 4PU0A 4ENVA 3NXSA 1PJAA 3FHTA 1I3KA 5FBQB 3K0KA 2G80A 4JA0A 2HQOA 4ZC1A 4ZGBA 5HJEA 1YBAA 5IW8A 1CY2A 4QGBA 5LP6C 1ML4A 5A71A 4JLMA 1NC1A 4MHSA 5EXEA 4B1FA 3LRPA 1OH5A 3OU7A 3B8EA 2QX8A 3K9BA 2HCJB 3TBHA 3WP1B 5U9CA 3G5LA 3BDIA 5ALHA 3LC1O 5F51A 1A69A 1NRWA 4MQEA 1MHTA 1LPAB 2DUNA 2J48A 1L9KA 2WSIA 2Y71A 4DMRA 3NBQA 4UUPA 4Z0NA 4F6LA 2ZJ3A 1IBLB 4LMRA 3V2UA 3QVJA 1GPJA 2EX1A 1V0JA 2V1XA 4J90A 5KO2A 3FGOA 1Q0HA 3MUNA 3PFHA 3CZCA 2Y68A 4L0DA 3N8DA 4MRVA 5D5QA 2J6BA 2RB4A 2IYTA 4PZ0A 1M67A 1W36C 2QTHA 3TMAA 3DOCA 1HKHA 3HHPA 4CF7A 4I6GA 3AUAA 3E82A 1XU4A 3N2GA 2HI0A 3JZIA 1EK6A 2B9EA 3QF4A 1WW3A 5JO0A 2DQKA 5LQRA 4K86A 4BMCA 4BMZA 3L1IA 4G0XA 4IZHA 3RUDA 4OXNA 2I4LA 4BP3A 4BL5A 1QHSA 3E35A 4OJKA 1H2FA 1IC6A 2FR1A 4WN3A 4A2WA 2ECPA 3NCTA 4JH0A 5JMWA 4GOOD 1D4AA 1PT5A 2D1FA 3LW7A 2FSHA 3ZVRA 4F4CA 1Q44A 3L46A 1JDTA 2OQRA 4AJ1A 3KKEA 4Z49A 1E8MA 1KK1A 1W25A 3QEAZ 2Q2NA 3G7SA 4KZKA 3V7YA 1VGQA 2PLWA 3OOEA 3MC1A 4J2HA 3G2HA 4Q24A 1NN0A 2PH5A 3FSGA 3T99A 4PYMA 2WA2A 3WQSB 1R0KA 3G2PA 4NZ9A 3JSAA 3WOVA 1NLYA 2KSQA 2NO4A 1Z6ZA 2QL9A 1NHWA 1OB2A 5FFMA 2HK8A 3MRVA 4MI1A 1NBAA 3H9QA 3P71T 4MV4A 2VJLA 4XD7A 2JFFA 3Q7EA 3H2KA 1Q6ZA 4RKYA 1G63A 1RACA 3AIOA 2AA3A 3DTVB 3KT0A 1DBVO 2AUMA 3JYQA 4XYEA 1Z7EA 4DLUA 4D9BA 3F71A 3L6OO 5BSFA 2LD4A 2CJYA 5F1OA 1VBNA 4KWIA 3OTWA 3ITDA 4U2EA 4YS6A 3BIOA 3CLKA 1CRPA 1E6EA 3KTFA 2PGNA 3D3EA 3EXEB 5ILQA 3R3ZA 4GPIB 5CA0A 1A9RA 1NATA 2RBKA 3LBNA 2OCKA 4K2HA 4V39A 3NKLA 1GSHA 4O59O 3PV0A 4KYIB 4Q9KA 5DBHX 3HWSA 5FUMA 2GN4A 1S3FA 4S0XA 4PLZA 2BJHA 4DOMA 1L9XA 3UMMA 3KUUA 4BE4A 5AI8A 1I5RA 5IHPA 4JJ7A 1YQXA 4X1IA 1QG0A 2D0OB 5MN6A 4B80A 5JZOA 4ZVPA 1WLSA 1U7PA 3RHSA 2RK6A 2I0FA 4MCHA 4OQDA 5AJVB 2ZTVA 1I1OA 4JQYA 1ZINA 4UEJA 3FSJX 3ZCQA 1UZUA 3CIFA 3NYQA 1JPVA 3VUFA 4X0EA 3ZE7A 3HO1A 1Z37A 1G4HA 4X44A 2ZRFA 5F4BA 5HA5A 4QHYA 2GEKA 3JVIA 3PT5A 2DQSA 1G59A 3O95A 4RD0A 4WERA 1XKQA 2VPWA 4YDHB 1OLXA 3A0RB 4NEHB 4QAJA 3QELB 4BASA 2N1BA 1DJNA 1Y42X 2AMLA 3ML1A 4PXSA 4J0IA 5FV4A 1I4DD 1Y7HA 2ZUBA 4R8MA 5JD6A 5FX2A 1QQ5A 2G6BA 2IHVA 2OZEA 4S2EA 2BW0A 2WWVD 1H3FA 1YZVA 2X15A 3L7AA 4EFMA 2JC3A 4YQFA 3ZG6A 1M34B 3KC2A 4OOFA 5H02A 5KNCD 4Q9AA 4MUGA 5TY0A 2J7KA 4QQNA 4BN0A 2DR3A 1APBA 2P3SA 2W4MA 2GXQA 2WE8A 1LBQA 2DWQA 3ES9A 4MITA 3WGHA 1XCBA 3PUKA 1Q1EA 1X15A 2OR3A 3ETDA 1E59A 2QTVA 5HUHA 3AUYA 2ACEA 4ZVQA 1KDZA 4EHKA 1F60A 5DCYA 4BE7B 4F9FA 5A04A 3ADBA 4JI5B 1SKUA 4E5DA 4C3ZA 1JKJA 3RYFA 4RTJA 5LZ9A 3U7FB 4M76B 3JALB 4RIGA 4YYEA 2Z43A 3GQBA 3RSHA 5IANA 5KOJA 4LF6B 3EWNA 1NXQA 3PLAE 1E61A 2RIRA 4TQAA 3NHLA 4C2TA 4Q4LA 5ER6A 2PKYX 5E1OA 3FMOB 2FEXA 5KAMA 2XZTA 2PXXA 4YRAA 3I9MA 1BWPA 2E5WA 5CLLA 1A8PA 5DBEX 2VUSA 4PGHA 3RBZA 3V4OA 1STOA 1WBBA 1G6KA 3Q3JB 1HNXB 3DVSX 2ZT6A 2QBYA 4DPKA 1AS2A 4MVCA 5K6TA 5LIPA 1QYDA 1G60A 1WDTA 4UM7A 5DNUA 4QA9A 5LKRA 5A03A 1VBMA 1WOMA 2J3KA 3I0MA 1DKQA 2G70A 1GAEO 3MPOA 5FTNA 1YVPA 4X90A 1KZGB 1RCFA 5DMXA 2B25A 1VZ2A 1ZSVA 5G0UA 4NEQA 1F7UA 4NZNA 1WV0A 4ZI7A 2PUJA 4QM6A 4LJ9A 4PVCA 1L7XA 1ELOA 4H6PA 2PU7A 3IP8A 1XTKA 1AK2A 2IODA 2PVCA 4PYKA 3GLUA 2GO1A 1QYWA 2QF7A 2XCQA 2PLAA 4C04A 3NJ8A 4WNIA 1DU4A 1KAEA 2R85A 4HWGA 1GRCA 2YXDA 3IUBA 2HPAA 3KXLA 1DADA 2B5VA 2F62A 4H08A 5TXGA 3GP5A 4BV3A 3BRCA 4WOJA 2DKNA 2O05A 1PX0A 1YZTA 1QKJA 5BQPA 4UUMA 3FZEA 4L4ZA 4TZ0A 1PFWA 2WSYB 3I76A 3UV3A 4L9AA 4W6ZA 3JWEA 2B99A 5IN5A 4R84A 2LP4Y 1Z0AA 2NO5A 3NWBA 4LHYA 4M9ZA 1JG1A 1IB6A 4H0FA 4IQ4A 5JCPA 4XUCA 4QGFA 3WL6A 2QRPA 5COBA 3JATB 3DLIA 3AEZA 3NWJA 3R6WA 1NZFA 2PGIA 1CU1A 4I36A 4E88A 5LQMA 4EG1A 1QHHA 3PL5A 5LC1A 1D2AA 2C9OA 2FWNA 3EAFA 4OBBA 2IHTA 4QXOA 3EC1A 1GPH1 3CWQA 5EXXA 1WR8A 2W2LD 3DO6A 1X1SA 4QLAA 4TLEA 4XX1A 2F67A 4P0TA 3J81A 3L7BA 3I72A 4C08A 3M49A 4RS4A 1WX1A 3G9XA 1B7GO 5LL6P 3VNUA 2WJ6A 4WFJA 2Q3CA 3K5HA 3IT3A 3O4VA 2ORWA 3WIDA 2UXCB 1LUAA 5JR3A 3H8JA 3LGAA 3DLAA 4Q3AA 1DBQA 2CK3A 5BURA 1AKTA 1PLKA 3M1LA 3NAQA 2XAUA 3WQHA 5AVTA 5EWMB 2B61A 2IBTA 3NVKI 4B4UA 4HLCA 4MV3A 2ZSEA 4C9BA 5JY1A 2APJA 3U3DA 4DYDA 2G0TA 3O4IA 1QFZA 5AW1A 3QVGB 3PHGA 4Q15A 1DQPA 1U9ZA 4LBWA 1KJZA 5F73A 3PLNA 3Q3IA 2X4DA 4FU0A 1GO2A 5JRZA 4B3DA 3GPIA 4OPMA 3LNCA 1XDSA 1K27A 5IFLA 4MDYA 1G38A 4BVLA 3M6VA 5BN3B 3B1ZA 2Z4TA 2ATXA 2XV1A 3QNWA 4L9WA 5F76A 2Y1FA 2IH4A 4KWCA 3FWYA 3LUFA 2YASA 3NRCA 4FYMA 3N75A 2IIVA 4CMKA 3OEEA 4HAVA 4Q9JA 9ABPA 2NP6A 4GPD1 2F1KA 1ZD8A 4AF7A 2CDAA 5IZCC 3HDTA 1UK7A 4FBMA 2UZ4A 1JZQA 3AZOA 3JAWB 4LZOA 3TFQA 1K7CA 1L4EA 3VPXA 3WLHA 3UPDA 5LU9A 4RV4A 3WLKX 3SZUA 2BHTA 2QTBA 2Y1DA 4E30A 2PKQO 3OKFA 4R68A 1EM8B 1YOVB 4L2IB 2IPAB 4EMUA 2GBLA 2BMEA 4GP7A 3ELWA 4G4JA 5FD8A 3PB3A 3FW1A 2EZTA 4D41A 1W6UA 4AQ7A 2B1JA 3OG9A 2VPTA 1J1ZA 2VOEA 2PXHA 1P5HA 1Z6YA 3LUHA 5AR1A 4TKMA 3ED5A 4YACA 3HKDA 3B5JA 5E4JA 1HL3A 2VNKA 1PJ3A 1Z8NA 2FZ4A 1XBTA 3FN4A 4HUQB 5ERXA 3JWGA 3UJ6A 3W8DA 5KYXA 2EZ9A 1K75A 3T0IA 2G4VA 3M5CA 3PFWO 3IIJA 5JV5A 3G13A 3RS3A 3TD9A 4ID9A 4QOJA 2QPLA 3O3MB 3P9CA 5JG7A 4AB1A 2FNAA 5LOVF 3FDIA 2NZXA 2VS1A 2WFLA 2Z5LA 1Z4OA 2ATCA 2Y3IA 1A4XA 3T06B 3KTOA 2HADA 1SQ6A 4IXWA 3G79A 3GH1A 2R62A 1IHPA 4DMUB 3OD5A 2NM0A 3TLJA 1PT7A 1YRQA 2FCRA 3LL7A 4DSZA 1I94B 2IDKA 3DFZA 3AR4A 1A9OA 3KFVA 3G0IA 4GM1A 4X6YA 2O52A 4G24A 1G8GA 1N1DA 1XTPA 2OB2A 5LMCA 5HF6A 2NP7A 2P4QA 4JUBA 2P9JA 4IIXA 3SKXA 3TOSA 4B3BA 4BJ1A 3MTQA 2I2AA 1YKFA 4HP8A 2TSYB 1XALA 1BJKA 1AKEA 2R9VA 2ZJFA 3DVAB 1JSRA 5DTRA 4RTKA 4QXRA 1TJPB 1IE3A 5MN5A 4R8SA 3Q3HA 3JWPA 4AO8A 4D3SA 1SG9A 4X63A 2AQHA 1II8A 2REBA 2F9MA 1F48A 1J07A 2P65A 3HB0A 5JNSA 4OHMA 3LQ1A 3PHIA 1W73A 4MXDA 1NYTA 3R5FA 1UXKA 1H6BA 1Z5PA 4X65B 4G0WA 1DQZA 1PDWA 1XMPA 1NG1A 3TTVA 5TMDA 2NGRA 3W8NA 1A2KC 1P2DA 4JL5A 4W9RA 3AKCA 4ZANA 5LZ4A 3LO5A 2AKYA 1OA0A 2Q3MA 3N74A 3O75A 1J2EA 4I3GA 4DCPA 3PEWA 4GOKA 4WK0B 1D8TA 1H4VB 1TI7A 2ZRGA 3VYRB 1U3CA 4RSHA 1Q0RA 5BVHA 2JK1A 3FVVA 4Z86A 3NHSA 1Y8RB 1J21A 1W9HA 4JXXA 3CZ9A 1ZI6A 1G8JA 1X7WA 3HRHA 2ACWA 4X1KB 2GXAA 1W30A 3LY8A 4XLTA 2OLKA 4E4TA 2CLSA 5ITVA 1R0WA 4YRCA 4BZXA 2YC4C 3E15A 3WLQA 3AJRA 4TQ9A 3FGNA 3C2QA 3C8UA 3II6X 5CAEB 1R37A 3NGMA 1SUFA 2PKRA 4OQZA 3ZWQA 2SCUA 4E13A 4PN3A 2GX6A 3KWLA 4DT1B 4FDLA 1CSEE 2E48A 2OV3A 1T5DX 1WMEA 1PR3A 3BXPA 3GVXA 3DKRA 3GVCA 4PZLA 5FFNA 2PCJA 1S3SA 2WW8A 5FPYA 2QLNA 3VISA 4BKOA 1H2ZA 3KSBC 1MF7A 1U9JA 4G5SA 3TKAA 4LZAA 1WZEA 2EIHA 1NOKA 1RJDA 3BB4A 4H6VA 3IEVA 1SRQA 3MCUA 3ZOZA 4KYVA 2HTFA 2QA5A 721PA 1EXDA 5C7LO 4FMBB 3LMKA 5L53A 4MW7A 5HTKA 4DEVA 1IK6A 4OHFA 4YR9A 5LBUA 2VT3A 1XD2A 5HK9A 5KTSA 2ETVA 4D02A 5J47A 1C1DB 1TO2E 3GARA 4ARSA 1UBTS 1KI6A 3RSLA 4WKPA 4GVPA 5CURA 1UWCA 3B1FA 1IQRA 3S2ZA 1U0BB 1JUDA 3BWBA 3LC7O 5HQ3B 3OCUA 4OKIA 5I01A 1VM6A 2R25B 5IWCA 4F9EA 4DTIA 1RPAA 3I9NA 3JQDA 1RKXA 3W5JA 3FPEA 4QLOA 3EIOA 1YASA 1L5YA 4YRNA 1QDEA 3O38A 4RA6A 1N2BA 2XGSA 4WCFB 5DI3A 1OY1A 1QFSA 2DT5A 3WZ2A 2GFQA 3TR0A 3N87A 3RHTA 1YZUA 4JLDA 1HEIA 3NDIA 4BB9A 2FP3A 1VBFA 4X61A 2BBWA 1Z0UA 3OEWA 1L1QA 4OJMX 3CSUA 4BQQA 3EX7C 3CVWA 2MT9A 4XXHA 2MDTA 1U3FA 5CITA 3F6BX 2DLNA 1G5QA 3UAXA 5EN4A 1EE9A 4O8CA 3E27A 1YR7A 4X85A 3ORSA 1MXHA 1J0AA 1FVOA 1XQVA 2DM6A 1TKAA 1YTLA 3HWX1 2HR1A 1DAPA 5KNDA 4RCVA 2YMMA 3NAGA 1UBRS 2ERCA 4US0R 3RR2A 4S05A 2BTEA 3ILYA 4JVNA 4CM7A 4UAJA 1NQ5A 4NYIR 2GASA 2PD3A 1PJQA 1T9DA 2DUJA 1RI2A 3GZTB 3BCHA 1E0KA 1EIZA 1MX9A 3WYAA 2YKGA 2ONJA 3HDGA 2BFMA 3ZY4A 5FEMA 2GUGA 3BGOS 1YCHA 4N39A 2NXWA 4MS3A 4HS4A 3H2BA 3KSZO 3TNFA 3ZV5A 4ZVMA 3F3SA 1PWZA 1DX4A 1YULA 2D2VA 2FQWA 2PUAA 1F06A 2OB1A 1GTG1 4MYDA 5FOQA 4K3UA 4LKRA 2DULA 4M7WA 2VI5A 2HSDA 1EJBA 3OE5A 5FA8A 1FP7A 3RC7A 2R8XA 1KI6B 1G7SA 4XYBA 3PXXA 4ABYA 2P75A 2C88A 4JBGA 3QM1A 2KQUA 2PKWA 3OQBA 3BCRA 1E5XA 3NH6A 1NC3A 1GQFA 1M34E 5KJFA 1K3UB 4PR0A 1RYDA 1RTKA 2WWHA 3L7LA 3TOXA 1AU9A 9LDTA 4F4HA 3EARA 1PIWA 4OOEA 5HSGA 4GKKB 1JWAB 2H5IA 2HF8A 1DAIA 1S2OA 3QPVA 4OJTA 2Q50A 1QV9A 1GFSA 1PZNA 1FFBA 3L84A 4KAJA 1XJQA 1ZY2A 3WL8A 2WIFA 5ICEA 1J42A 1HT1E 3OM1A 2ZBFA 3VTKA 3AYXB 3ZBTA 4M8NE 3TRDA 3L92A 1M8JA 1O95D 4BVKA 2BMWA 3AVVA 3AVUA 4IYRA 2UYQA 4DDKA 2OL4A 4F93B 4QNMA 3UKDA 1H85A 1OBVA 3FFWA 3D6NB 2PZKA 3GJTA 4H7JA 4FN5A 2HV8A 1XC7A 3NIBA 4JQZA 5IKOA 3RS4A 4D8VA 1N92A 4DCVA 4OVKA 4F06A 4BBPA 1OBCA 2KS6A 5EIBD 3EIQA 3I83A 3V1NA 2AJCA 2VDLB 4FSXA 3C5EA 3CW2A 4U7FA 2Q5JA 3LHDA 3GRUA 3B3AA 3GUZA 4R2IA 2ZM6B 1NVVR 1CCWA 1W6RA 3D1JA 1JFLA 3L0PA 3QK7A 3S5JA 5B4VA 1E6WA 2RGXA 3EEIA 1ZL2A 4ZDWA 1GQYA 1E1QA 4F46A 1SIWA 4RK6A 2PGJA 1Q21A 3TTXA 2ZJOA 1CEEA 3BMOB 3U2QA 1W94A 5E95A 1GA6A 3HXMA 4OYRA 5FIUA 5K3SA 4UE6A 3I9FA 4CMAA 5GV7A 3JVDA 4TL8A 1JA1A 3TINA 1CVLA 4D0GA 1OC4A 2XT6A 3C3EA 5TQ0B 5ARBA 1T1JA 2JIOA 2IGBA 1GJRA 4PZYA 3EZNA 4I1IA 3ZI0A 1Y0BA 2C5HA 3R7SA 1EAYA 1T3HA 3IV6A 5C34B 1A2OA 2QRKA 4BUCA 5JAMA 1QH1A 2ZUDA 3BGVA 3CEJA 2QTNA 2J3LA 2HF7A 2VJBA 4FEYA 5EWLA 3AHGA 3E3MA 2QAGA 5HFAA 4N01A 4N5HX 4TLLB 1BFKA 1PG0A 3A3PA 3LGSA 3IVMA 2PDAA 2VZ9A 3FIJA 2WJ4A 2GN6A 1RSZA 2H1LA 1R0CA 4PIMA 2P9TA 2PBFA 1NW7A 4EA8A 2IZ6A 2JCYA 4A16A 2ONYA 3B6EA 3IPCA 1UT6A 3IGFA 3MB8A 4GSKA 3KUDA 2FF7A 2BEWB 1TYZA 1C0PA 4PSUA 4ZVTA 1AZTA 1YBMA 3SJZA 5CFPA 5IYZB 2A1IA 1B43A 4WLUA 2V5AA 3OF5A 5CP8A 2UUBB 3L8ZA 3RVPA 4BBZA 2AIRA 2IYAA 5ECGC 4EPYA 4RLSA 2E18A 3AHFA 3ZE6A 2KJQA 2ATVA 4HDNB 1VLHA 3IAHA 4TKUA 1MO6A 3K53A 2WKWA 2DJ5A 1DKLA 1A5SB 2OMKA 3EVFA 3WSTA 3V1MA 1B6RA 1CZLA 4XQGA 2OZLA 1QMPA 1UBHS 3BH6A 1CUFA 3FHOA 3G2KA 3NAMA 3OZXA 5D3MB 5K0ZA 1P0PA 3CF2A 1NXPA 4HWRA 1L5ZA 4KWHA 4J7XA 1YVRA 3UANA 5LCXA 4DG9A 3LO8A 5JCOC 3HFSA 4YAOA 1U2DA 2ODWA 2EBUA 3ILHA 1D2MA 1IB0A 2H29A 3A6LA 4CL3A 2OAP1 4LECA 2HH9A 3E9DA 2H07A 4M2LA 3PXGA 3L8YA 2V0GA 2BFNA 2QUZA 3RHFA 3Q2OA 4E03A 2AX3A 2OCAA 1W34A 4EUNA 5L45A 4RW0A 1M0EA 4FOSA 4XR4A 4ZVKA 1UIRA 3WHKA 4YEDA 4IKEA 1M7HA 4Q01A 1QRDA 1YZYA 2AYYA 5TIIA 3ECCA 1GA1A 3TCKA 5DYIA 1QO0A 1UWLA 2NU7A 3A3NA 1DX6A 4X5OA