3BHMA

Crystal structure of human carbonyl reductase 1 in complex with s-hydroxymethylglutathione
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
274
structure length
274
Chain Sequence
b'GIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbonyl reductase [NADPH] 1
publication title Human carbonyl reductase 1 is an s-nitrosoglutathione reductase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 105
structure length 274
sequence length 274
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2007-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bhmA00
1EDOA 4HFMA 3WSWA 5FFFA 4CM5A 4IZHA 5I7SA 1VJTA 3Q2IA 1I33A 3AM5A 4YDRA 4LVUA 2P9EA 3GHYA 4NBUA 3FCOA 4KP7A 1JDJA 3OFSA 4IQGA 3EAGA 1EE2A 1OAAA 3N74A 2DUWA 4HWKA 2C07A 2HDHA 4IUYA 4IY1A 4R69A 3LC7O 2Z5LA 4YJGA 2O50A 3JD0A 1Q7GA 3DB2A 1XSEA 2HK9A 3F1KA 3O8QA 3VPGA 1I5RA 4BNTA 3WBBA 5JYEA 1BRMA 1M76A 2BF7A 3QVXA 1F14A 4F46A 4K9DA 4Z6KA 5L7TA 5EMHA 5AYVA 1Y81A 2QRKA 5KJ6A 4ZVVA 5IN4A 4W6ZA 4NBTA 3L4BC 1PJ4A 1NVGA 1T26A 1NHWA 4Q3EA 2VUUA 1VLLA 3ADPA 1ONOA 4FCCA 2GSDA 1U3TA 4A7PA 4BKUA 1DEHA 1F8GA 3T7CA 4NBVA 3CZRA 4A27A 3CEAA 3ROMA 3DONA 4GX5A 2J5RA 1GPDG 2VN8A 4P8RA 1M2WA 3RU7A 3INGA 3UCXA 4J4TA 2SCUA 2XOXA 3E18A 4OYRA 4R01A 1KERA 4ZU3A 4CMGA 3N58A 1CYDA 5H83A 1BDMA 2YDYA 4BNNA 2VTDA 1JAYA 4TZKA 2Q1WA 3OICA 3QVOA 2Y93A 1XWFA 3IUSA 3RBVA 1M75A 4RPGA 5JW6A 4Z3KA 4BNYA 2PNFA 4UUPA 3EY4A 4Y6RA 4CM8B 4BO6A 2PKQO 3GZ4A 1NPYA 1UP4A 4WKGA 2Q2VA 4XQEA 1B16A 5KNLA 1ZXLA 1YDWA 3LC2O 4KOAA 4IIUA 4XRGA 1P1FA 2VCYA 1JTVA 3RC7A 4PN3A 3EYWA 4RZHA 1D3AA 2RAFA 2EEZA 1Q0QA 4YQZA 2CNBA 4FFPA 1HDOA 1PZFA 4ALIA 1TLTA 2ILTA 4XGKA 1WP4A 2VHXA 4MINA 4BNMA 3L9WA 1LDYA 2EKLA 1SEVA 1TVEA 1BXKA 3KBOA 4M86A 4M49A 3WLEA 1YBVA 4E32A 4J7XA 1DO8A 5ER9A 3ZHYA 3AI1A 4ZRNA 4CM4A 1E1MA 1KY4A 3WYBA 4FSHA 4CV0A 1WVGA 1QV6A 3Q2KA 1MX3A 4IQ8A 1ID1A 4XWYA 3K73O 3HN2A 5ITWA 2JJYA 3AUSA 4AFNA 4DYDA 2VZ9A 3ZWOA 1K0UA 3QQPA 4CM9A 3M1AA 1HTBA 1C3VA 2ZB3A 2CMDA 3L0DA 3KZVA 2JCXA 3KSUA 4JP2A 1Z6ZA 4UVHA 3VPHA 2A92A 4FD3A 4M54A 2CF6A 3U9LA 1HKUA 5TGDA 2FR8A 2OBYA 1DSSG 3JQGB 5DOVA 2FSSA 2PGJA 4DIOA 2Y0EA 1P1IA 4RPLA 3TPCA 1WDLA 1U8XX 1F06A 3KETA 3JQEA 3ZW8A 1EQUA 4UREA 1BDBA 2UUOA 4DC1A 1JA9A 1H2BA 1M6WA 3AK4A 3GPDG 5HTOA 1SAYA 3BMQB 2P4QA 2JCYA 3QWFA 4D3FA 4OJNA 4GLLA 5TRTA 4FN4A 4YT4A 1T1SA 1MGOA 2GN4A 2Q46A 3RWBA 3OJEA 1QLJA 3PK0A 3MTGA 4CMJA 4CR6A 4CMKA 3EUWA 1TT5A 1R6DA 1R4NB 5IDQA 3GEGA 4NFSA 3O03A 4JGBA 3WWYA 4GH5A 1PJBA 5AXAA 1P1JA 1OFGA 1ZMOA 2Z95A 2Q4EA 4ZA2A 2OFPA 3EMKA 4JBIA 1U3UA 4KWIA 3D5TA 3PP8A 3SXPA 4WLFA 1LLCA 1J6UA 1WNTA 1ZMTA 1XA0A 2ZATA 3TZ6A 3JQ6A 1V8BA 1LLUA 3K96A 4FFOA 3PHHA 3RASA 3ST7A 2X5JO 3DO5A 3AY3A 4E13A 4GWGA 3ICCA 1O8CA 1U1IA 5JC8A 2WYVA 3SX2A 4PLPA 1P77A 5LC1A 5TF4A 4B7CA 2O3RA 3Q9NA 1LDGA 3QW2A 4MVJG 3I3OA 2B4QA 2GZ1A 2IODA 2Y0DA 1AXGA 3PYXA 3ZCXA 4ZJUA 5BSHA 4AJOA 1YJ8A 4DUPA 4FB5A 4A10A 3WJ7A 3WTBA 4IPTA 4GX0A 4K1LA 1MUUA 4YT2A 3BTSA 3QHAA 1S7CA 4IJKA 3ZN2A 2NV6A 4XJSA 4MVJI 4U0JA 2B36A 3NJ8A 1P1HA 1HYEA 1P0FA 2HRBA 1DIRA 2BRUA 5HRUA 1DJQA 1NFQA 3PHIA 2WMDA 4QO8A 1Z82A 4KWHA 4J49A 1I2ZA 1JVBA 4WUVA 4EJ0A 2V6GA 3OJ0A 4RPHA 2AW5A 4OGWA 5DCUA 3VHRA 4OSOA 1BVRA 3OEYA 5EERA 1VE9A 4ZQBA 3AM3A 3WNVA 3W6UA 1I01A 1BW9B 1D4FA 5L40A 5HM8A 1H2HA 4IINA 3U0BA 1PJQA 4E30A 3GHHA 3BTOA 4DMMA 2C2YA 1DIGA 1EDZA 3AUUA 4NFHA 4QFDA 2QW8A 4YVFA 3RJ5A 2BI8A 4NU6A 4PG4A 4BKRA 2B69A 1B8VA 3ZWXA 1AHHA 1YB1A 3HUDA 1Y5MA 4RVUA 4YAEA 4BV9A 1EBUA 2Q1TA 3NKLA 3AM4A 2IDZA 4ZD6A 3HE3A 4K26A 3NTQA 3VKUA 1HF3A 1OBFO 3RJ9A 3VZPA 2FN7A 2I3AA 3DWFA 3BMOA 2C20A 3V2HA 2HSDA 3GR6A 4J0EA 4ROSA 4FIZA 3PWSA 3NGLA 1E7WA 1D1TA 2HRZA 4H7PA 4BO4A 4HFRA 4EBFA 1LJ8A 4WNCA 3C3XA 1E1KA 4JCOA 2Q45A 3ZU3A 4PLZA 4NBWA 4RF2A 3UICA 3IJPA 3PGXA 4GQAA 4CMEA 3GDGA 3M6IA 5TX7A 3P7MA 1PL7A 5A9SA 1Y7TA 5JYDA 5A5EA 4DQVA 2CY0A 2DC1A 2OO5A 3CIFA 3E9NA 4DQXA 1NQTA 4Y6PA 4YEDA 1JW9B 4TRJA 4I5DA 1Q2XA 3BA1A 1YQDA 4YRDA 4E2YA 5BSEA 2FR0A 2X0RA 2Y67A 5IDXA 4Y6SA 1PJ3A 3BZUA 3LF1A 3DC2A 1E3WB 4W82A 2UVDA 4YCAA 4B4UA 3D1LA 3GAFA 3C7AA 1W0CA 3PHLA 4P22A 2O3TA 4XB1A 1IYZA 2G76A 7ADHA 4BNJA 1HYGA 5K6AA 1DC3A 2NLOA 2DBQA 4II2A 1X1EA 1IUKA 1KC1A 4U6SA 3S1LA 4EZBA 2X7HA 5JLAA 2PZKA 4AJHA 1YL5A 3JD1A 4UVDA 1IOLA 3AFNA 1NX6A 3O4RA 1AGNA 2PTGA 4IBOA 5BQFA 3OMLA 1R0SA 4EJMA 2D4AA 3BYZA 5HA5A 3GG2A 2GCGA 4O1MA 4DMLA 3ZU4A 3K8ZA 2WJPA 4BGIA 2BGKA 2ZCUA 4QO7A 2DUUA 2VUSA 3PLNA 3LT0A 5B4TA 3PWKA 2OUIA 2WWRA 1B2LA 4R51A 4XJTA 4Z9FA 2YV3A 4YWJA 5HS6A 1JVSA 8ADHA 4PLTA 3MWDB 1I36A 3EHEA 4I8XA 4R16A 2NTNA 3EK2A 3W8DA 4AJKA 2FOIA 2J8ZA 4JXKA 4D79A 3DTYA 3ZWYA 3L6OO 1IL0A 1ZK4A 1F17A 4UVEA 4FDAA 2WE7A 3LU1A 3DMTA 4FGWA 3ONFA 1H6BA 5EL0A 4YYZA 4WCFC 1D7OA 2NQ8A 3U4IA 1DDOA 3Q1LA 2VYND 3Q9UA 1YONA 3GVHA 2NACA 4RVDA 2GN9A 3FRJA 3DDNA 5ICMA 1GQQA 2G0TA 1PTJA 3JQCA 2FSVA 4QT0A 2TMGA 5JAIA 3GOHA 1GUFA 2J5KA 3HJAA 1ZIDA 3QVTA 1KIFA 1U2GA 4OXKA 4GI2A 4CLDA 5ENDA 3JTMA 3KEQA 4YJFA 3EC7A 4OXYA 2VOEA 4GVXA 1TEHA 5CDUA 4QXMA 3JQAB 4DREA 2R6JA 4TKLA 2GN8A 4WJZA 1XU7A 2EP5A 3NX4A 4XYLA 1GTMA 1V3VA 5CDSA 3OQ6A 4BGEA 1VL6A 5L51A 3MOGA 4F45A 5ES3A 1IE3A 1YXMA 1UJMA 1RYEA 3GRKA 3BIOA 5B4UA 3QV1A 3ITKA 3QJ5A 3EW7A 2E49A 3U4HA 2DTEA 3IC5A 4KTTE 3MJEA 3NEPX 4IDGA 1ML3A 5TIIA 4B3JA 3E9QA 3DBRA 1EBFA 1V3TA 3PI7A 3GNTA 3DZHA 5C5IA 1KY5A 3FBGA 1P45A 2AEFA 5JBIA 2O3UA 2DBVO 4ZICA 5KVQA 4LK3A 1CF2O 5DCWA 2Q4BA 5THQA 3WGQA 3UF0A 1P31A 3C7CB 3HZZA 4CQLA 2Y0CA 3VPXA 1L7DA 2VWPA 3UVEA 5MDHA 5JS6A 2IZ0A 2CVZA 2FZWA 1NP3A 2X0JA 1EVYA 3HDYA 1FDWA 4FFMA 3IDSA 2D0IA 5AVOA 3GVIA 4MP3A 4U7WA 4FOOA 4IQ0A 3HQ4O 4GKVA 1UDCA 4JBHA 5BSFA 2I67A 3O8QB 3D4PA 4CR8A 3DQPA 2ZTMA 2FR1A 4PG8A 2XXBA 4JN6B 4N7RA 2O3JA 2VZ0A 4DLBA 4PLFA 5CHEA 1KEPA 1X15A 3UN1A 2UDPA 1VJ0A 1LSUA 1CWUA 4HNHA 1PJSA 2PZMA 3LVFO 3RUEA 2Y05A 1EVZA 2X4GA 3UHAA 1ZK1A 1KVRA 1IHYA 3ICPA 1QYVA 4OO3A 3FNFA 3PWZA 3WLFA 3LYLA 4CUJA 3LZ6A 3RFXA 3FPLA 4BGUA 1NQOA 1QLHA 3DAPA 4Z0HO 3EDMA 2YW9A 5JY1A 4J7UA 4OKIA 1X7DA 4RL6A 2E82A 3JQ7B 4J3FA 1P33A 2LDXA 2YFQA 5DBFA 5TLSA 4WOJA 2YQ4A 3VH2A 3MJ4A 5DP2A 2YV1A 3JD2A 3NDRA 1CQIA 4MVJH 2YV2A 3LF2A 2VRBA 1LI4A 3LT1A 4HUJA 5B1YA 1DLIA 5JXWA 4GVLA 2GERA 3JCZA 2EW2A 1KYQA 3H9UA 4CMBA 5L4LA 5J23A 2Y1EA 2JHFA 4I1IA 1PQPA 4RO0A 2EERA 2J3KA 1LC3A 1TB4A 5DULA 2NNLD 5EQDA 4BB6A 5C3MA 4ZQFA 3ROQA 2JD0A 1T1RA 4AJ1A 4MDHA 5COBA 3U62A 3L6DA 4IMRA 5A3VA 3SEFA 3D4NA 1G0OA 1HXHA 2BFPA 4YTEA 3HHPA 4XR4A 1ZCJA 3U49A 1FMCA 2VWQA 5JAZA 2EG9A 4DBVO 4BGVA 1N92A 3B70A 4ZQGA 1ZNQO 5L53A 4EW6A 3GVPA 4BHTA 2VZ8A 1KEWA 1D1SA 3OH8A 1GDHA 2DTDA 3S55A 5EESA 3RUIA 5U4QA 4ZHSA 3NGXA 4CM4B 4RF3A 4YJHA 5FI5A 1NR1A 4WK6A 2H63A 4JLWA 1HDGO 3F4BA 2V6FA 2D1YA 4LISA 1P74A 1LLDA 4WLEA 1I30A 4EI2A 4Z0TA 5JMWA 3K9QO 3WGHA 3GZNB 3MCVA 3TFOA 4PLYA 4Y67A 1QORA 3EVTA 2YFHA 1UZMA 4MKZA 4CQMA 3ZV5A 5DZSA 3U5TA 1E3JA 4AG3A 5A02A 1EEHA 1UDAA 3KYCA 4FFRA 3TF5A 5EPOA 1SMKA 5I9LA 5I9MA 2FPIA 3AWDA 3FI9A 3KSZO 2J5QA 1SC6A 1Y8RB 1LQUA 1E7YA 2CZCA 4FS3A 4FJ2A 1A7KA 1Y5RA 1R4MA 1M66A 1LQTA 3IMFA 5C7IO 5B4VA 1PZEA 4E31A 3S2FA 3ZU2A 1KEVA 1UXHA 1YBMA 1I2CA 2OP0A 4EGFA 2PGDA 1OMOA 2OBNA 3WGOA 3TOZA 1WDMA 1I8TA 5A5FA 4NU5A 3WGGA 5KJ1A 1O6ZA 2BFOA 4Q3BA 4B7UA 1LEHA 1T24A 1KVTA 2AMFA 2WD8A 1DJNA 1O94A 2FPPA 2RIRA 5JMPA 4IDFA 5TJHA 2VNAA 3JYOA 1DPGA 4FC6A 4KMSA 3ORFA 5IJZA 2DT5A 1YQGA 2GRAA 4NJMB 1C1XA 1HE2A 1X13A 1HSZA 4HFNA 3KRTA 4ALLA 1A5ZA 1U3WA 4R5MA 4BKQA 3I5MA 5HWSA 5HBRA 1AXEA 4XB2A 3LSYA 3ZU5A 4O5OA 1NR7A 3BTVA 5CPBA 3I9OA 3AI2A 4W4TA 4CMIA 4CM7A 4KUGA 3DFUA 1X14A 1QKIA 3U09A 4MOWA 4AJ4A 1LRLA 3HSKA 3KTDA 4M55A 4RORA 4UUMA 1TI7A 4WGGA 5H81A 1H6AA 1GQYA 5DT9A 3BMNB 5ILGA 1JWAB 1ZJZA 3KVOA 1XCBA 1I3MA 3GNQA 4AL4A 3WR5A 2CUKA 4ALNA 5G4LA 5CEFA 1ENZA 4F6LA 2HLPA 3IOYA 3NRCA 4MVJM 5L3ZA 1AHIA 4XQGA 4GKBA 1UXJA 4UUOA 1I2BA 3QVSA 2QYSA 4B4WA 1LDMA 4PGFA 4DYVA 4IS2A 2A9FA 1LNQA 3NT5A 4FJ0A 2HO5A 2W2KA 3KO8A 5TT1A 2WM3A 4PLHA 1XQ1A 5JCJD 3DFZA 4KDEA 4IJUA 3D3WA 1MLDA 1O0SA 1M6HA 3GH3A 5TNXA 4HP8A 3PGJA 4R1TA 1E3LA 1WXDA 1YQXA 2IZ1A 3ASUA 3GGGA 2OORA 3CMMA 3UCFA 3F3SA 4MKXA 1P3DA 4BNUA 4D7AA 1L1FA 1U28A 3VOSA 4B3HA 4B3IA 1RM3A 2I6TA 2OP1A 4LRSB 4IS3A 4HY3A 1ORRA 3ANNA 3OEWA 3GN1A 1PZGA 3GVCA 3IUPA 3Q6IA 5L9AA 5I7VA 3TZQA 1UXIA 1GYPA 1D8AA 2EIHA 2Q49A 3D4OA 3TWOA 3DBHA 1Z45A 3UCEA 3C7DB 4GX1A 1NAIA 4J0FA 1K6XA 2RH8A 4XQCA 4R1UA 2J6IA 4N5NA 1KVQA 4IXWA 3QWBA 2NM0A 4R5HA 3INRA 4RJTA 3RUAA 3ETDA 1K6JA 1QP8A 4J6FA 2PV7A 3E5RA 1QR6A 1UP7A 3PJFA 4RPJA 3I9MA 3GQVA 4CLOA 1E0DA 3WYCA 1HE5A 2EGHA 2C7VA 4L4XA 2ZJ1A 3MJCA 4ND4A 3M2PA 3RU9A 2E48A 3E9MA 2ZTLA 3SJ7A 3GF4A 4E5MA 3UW3A 1MC5A 3KB6A 2V6MA 4HFJA 1E3EA 3DOOA 1UR5A 1Z7BA 4M89A 4O59O 2O4UX 4E5NA 4KTVE 1ZFNA 2Y1GA 1ISIA 5AXDA 1H0KA 1EFKA 4UVIA 4L4RA 5CDYA 3GFGA 2H5LA 4INAA 4NK5A 3RKRA 2P5UA 1XR3A 4IZIA 3C1TA 3QRWA 3HNPA 2CF5A 3CPSA 4R1SA 4RVGA 4BKPA 2CFCA 3OM9A 3MJSA 5COAA 4BNZA 4NH4A 4Q9NA 4M87A 3UAGA 4I9HA 2GO1A 5KTKA 4IJVA 2GYYA 4R1NA 1XIVA 4X54A 2JFGA 1CDOA 1L7EA 3H5RA 4R68A 2NVWA 1Y6JA 4FR5A 4DGSA 1ISMA 1P0CA 3S8MA 1HSOA 3BAZA 2EV9A 2VT2A 1ZZEA 2ZTUA 2JCVA 4YA6A 1BHSA 4KZPA 4WPGA 1VM6A 3A4VA 4Y9DA 2RBEA 2EF1A 4R54A 3QA9A 3F1LA 1VI2A 3VPSA 3WDSA 5U9CA 1KEUA 1BVUA 1I3NA 1ONPA 3GGPA 4BO2A 5DCYA 4BQPA 4GMGA 4Q3AA 3HB5X 1PX0A 5HS4A 2FPGA 3PJDA 5F21A 2QRLA 1B26A 1GV1A 3P5SA 4UAGA 3U3XA 5IZ4A 4DLLA 1BGVA 5JDCA 5JO9A 5K9ZA 1IPEA 4CLRA 3I52A 4GLOA 2PZLA 1Y8QA 3PLRA 4BNKA 3GNSA 5F5NA 4TWRA 1PSDA 2JAHA 2BELA 1YL6A 2O7QA 2NTJA 2FZEA 4WCFB 3TRIA 2VRCD 3ZWWA 1X0XA 3LT2A 3I4FA 1LLQA 3WGYA 3ANLA 4AJIA 1DIHA 4XGNA 1NHGA 2ZB7A 3EGOA 5GZ1A 2B4RO 4YJFB 5JCJA 1HLDA 4DLAA 2ZQYA 4L74A 4LRTB 1PR9A 5AXCA 4DXHA 5CEEA 4RPKA 4P4GA 1C14A 2DU8A 2YHIB 3I9JA 3INTA 4OOEA 2VHZA 3OF2A 3CZMA 1DIAA 3HB4X 3H2ZA 4FC7A 2X23A 1SEPA 2AQKA 3PJGA 4E4YA 1T2EA 5EJ2A 2PZJA 5AOVA 1IB6A 3SLKA 5KWEA 1B15A 1GADO 2C82A 1YKFA 3NYWA 5G0SA 4XYBA 4DBZA 1B3BA 1Q7CA 4WASA 2B37A 2V6BA 2Y1OA 4HXYA 4ID9A 3T7EA 4OM8A 2JL1A 1PEDA 1NFFA 1UXGA 4EUHA 2JFHA 4HV4A 4ONEA 2Y1FA 4OAQA 2Q3EA 3S2IA 3IS3A 4B4VA 3S2EA 4W9NA 5KKAA 4NBRA 5BNFA 3BMCB 1E3IA 2EP7A 5DBIA 5IDWA 5GY7A 2EKPA 3H9QA 1PJ2A 3IL2A 1I3LA 1PQUA 4CQLB 2WD7A 1PGNA 2P9CA 1HT0A 3A1NA 2OMEA 3RD5A 1WLYA 5BT9A 5GZ6A 1GV0A 1J5PA 1ADFA 3KYDB 2Y66A 2C2XA 1YO6A 1GPJA 3IQDB 4RGBA 3PYMA 1YGYA 1FJHA 1PL6A 4CL8A 3OECA 1AN9A 4RV9A 1K5HA 1R37A 4AICA 4DVJA 5AQ1A 1UZNA 1Q1NA 2AEMA 3H9JA 2PH3A 5JSFA 2WEKA 2BFMA 2CSUA 4AJLA 1XU9A 2PWZA 2W4QA 1O95A 2DKNA 1HEUA 5T8KA 2H1SA 5C37A 4W7HA 3W1VA 4CLHA 5DBGA 3GRPA 4PLCA 3H5NA 4OH1A 3ZNPA 2DFVA 4U5QA 1NPTO 3K31A 4H16A 1I0ZA 4CMEC 1QRRA 1YBAA 1XYGA 3QE3A 1YS4A 3QWIA 5CG1A 3HDHA 2QRJA 4LCJA 3WFJA 2JD1A 4BOYA 5G4KA 1E3SA 3CMCO 2D59A 5TS3A 1I3KA 4E6PA 4RF5A 3AY7A 4OXNA 1SB9A 1JAXA 4OHUA 5EIOA 3C1OA 3JQBA 3DZJA 3WG9A 4AJPA 4XCVA 3WJAA 3KV3O 4BO0A 3CINA 4BL5A 2G82A 1BXZA 2C29D 1IZ9A 3G49A 3B6ZA 3GG9A 4MP6A 3ROKA 5K6AC 2OGUA 3O38A 4KQXA 1ZEMA 3WICA 1YH3A 4I5FA 1NVTA 5LDHA 1DB3A 3H7AA 3RQSA 3WMXA 4JJFA 4H15A 2VHYA 1LDBA 2E6UX 5CP8A 1PGPA 3GUYA 1R0KA 3FPCA 2PKQP 3R0IA 2H9IA 1AE1A 3RAJA 1P9LA 2H6EA 3I6IA 3V1YA 3GY0A 2VUTA 5A05A 4JX8A 1ZO8A 2IXBA 3JYPA 4IGEA 5IN5A 5L4NA 4MVJF 3R6DA 1MG0A 3PQFA 3K2BA 3NV9A 4YT5A 5TQVA 4BMNA 1ULUA 3MTJA 3L4SO 5EN4A 5KJCA 3ZNOA 3W6ZA 2VRCA 1T2CA 1NXQA 3DZGA 2WYWA 3WGZA 2VT3A 2BKAA 3WGTA 1I10A 3WQQA 4R3WA 3G1UA 1S6YA 4BIIA 3D3EA 4CV3A 1C0KA 5JFOA 4Q39A 1BG6A 1JWBB 1KETA 5LDGA 3D0OA 1NBOA 1FXSA 3H8VA 4YJHB 1H94A 3B1JA 4HBGA 4YT8A 5IZCA 2Y68A 3DZKA 4GSKA 1LX6A 1V0JA 1PGJA 4QEDA 4BS9A 1YDEA 1JN0A 3C85A 1BXGB 4HADA 4AVYA 4CLXA 3DMTC 4MO2A 1M67A 3SJUA 1XDWA 4ESOA 1CEQA 1ZJYA 4D46A 3BHJA 4BMSA 2ZYAA 3JQFA 5F1PA 4B8ZA 1LBEA 1DOHA 1U4SA 3DL2A 3R3JA 1TT7A 3JQGA 4KQWA 3STHA 4NZ9A 1GYRA 5BNTA 2EXXA 1FDUA 4RCVA 1PJLA 3P2YA 4JP3A 4XZ3A 5L4SA 2B4TO 1ZW1A 4YAIA 1E7MA 5FEUA 4RQUA 1E7QA 5ADHA 1CQJA 3GK3A 4EDFA 2EHDA 3H6KA 1UDBA 4WEOA 1H6DA 2G1UA 4MVJP 1H93A 1J0XO 4NI5A 3ROPA 2PD3A 1LC0A 3AU8A 1TXGA 1ZEJA 3LDHA 3P19A 1R0LA 1HDYA 4YAJA 4BO3A 1E6WA 1SZJG 3LLSA 2X22A 1B8PA 1R4NA 3UUWA 2PR2A 3G1TA 3V8BA 4A2CA 1E5QA 2X1HA 2X5KO 1SO8A 4K6CA 3ZWPA 1EUZA 1VSVA 1QV7A 1ZBQA 1W6UA 2ZB4A 5EINA 3RUCA 1LA2A 3H65A 4MIEA 3VVCA 4CQMD 5KCZA 1C1XB 1SNYA 3JYLA 3JQ8A 1XLTA 2X0NA 4XKJA 5TJ9A 4TRNA 4PVDA 3GGOA 4BNIA 4E12A 5A04A 3FTNA 1VKNA 3GDFA 4I5EA 4IJWA 3SLGA 4L8VA 3PDJA 3OA2A 1A4UA 4DTIA 1WMBA 2XAAA 4CM3A 1XQ6A 2PA3A 1E7SA 1DLJA 2PY6A 4XDYA 1YJQA 5U1PA 4WECA 3RC1A 2GLXA 3G0OA 3M1LA 1MC4A 3H2SA 5JDIA 1ENOA 3RUDA 4H3VA 1N5DA 2QZZA 4OQZA 4E33A 1T4DA 3COSA 3T4EA 2AEJA 2ZJ0A 1LRKA 1FF9A 2NWQA 4OSPA 1KOLA 1QYWA 4N18A 3CUKA 1HRDA 3DHYA 4U0KA 3JYNA 3UOGA 1VKOA 3ENKA 5FI3A 2JFFA 5KIAA 4EITA 3AY6A 1WZEA 5I7EA 2I5PO 4NIMA 4YJGB 2X0IA 3UFXA 3KOUA 1JLLA 5KJEA 1WAMA 4JK3A 4L9RA 4NJOA 3ZW9A 4ND2A 1E5LA 1Z75A 3K2EA 5JC1A 4BV8A 1UH5A 3JQAD 4MKRA 2HMSA 1BW9A 3GVXA 1R15A 4MIYA 3WBFA 4G65A 1HDXA 4LSMA 4GPD1 1K2WA 4J1SA 3PJEA 2X9NA 3TN7A 3NT4A 4A26A 4ITUA 1LDNA 1PS9A 2IZZA 2GZ2A 2O2YA 1XEAA 3F46A 4NMHA 4JJGA 3RSHA 3L77A 4E2WA 4XYEA 2D5CA 1DAOA 2HAEA 1U2DA 3LK7A 4PZCA 4BO5A 9LDTA 1LRJA 3IJRA 4R4JA 3RC9A 4HX5A 3ZV3A 3UGKA 2VYVA 1T25A 1RM4A 1YWGO 2NQTA 3DBHB 3G79A 5AXBA 3PHJA 1RKXA 4D43A 3OSUA 3GAZA 2PKRA 3RFVA 3ZV4A 3F6YA 3GLQA 1ZK0A 4FGSA 3W4JA 3DZBA 1U3VA 3EZYA 1MFPA 1Q7BA 3HDQA 5CEJA 4MJLA 3I1JA 4P38A 4GX2A 1GEEA 3E82A 2GUGA 2O2SA 3DBLA 3WYEA 3TQHA 4FJ1A 1NPDA 2IE0A 2NU7A 2B35A 4NHEA 3UKOA 1E3WA 3WS7A 1R66A 4O0LA 4E5KA 4BB5A 1XG5A 9LDBA 1EFLA 1YVEI 1OC2A 3TNLA 4I08A 2TMDA 3HFSA 3WIEA 3JQ9A 1SPXA 4CV2A 1E6UA 1Z74A 1XHLA 2GNAA 3IIEA 2D3TA 3ZHXA 3VZSA 2P4HX 3ZWNA 1GZ3A 3TZCA 2QZ9A 4DPMA 5A03A 3NJ4A 2ZCVA 4NR0A 1DC4A 4MVJD 5IG2A 4YXFA 1NWHA 1WDKA 1NAHA 3V1TC 1Y1PA 4NG5A 1MXHA 2I99A 2FMUA 3NDJA 3MZ0A 1ENPA 1WPQA 2EKQA 4BNLA 4II3A 3HG7A 3UXYA 1H9AA 2Q2WA 1C0IA 1GY8A 3GA0A 4WLUA 3QIVA 2B5VA 4BUCA 4NPCA 4I9NA 2UYYA 3DZFA 1MFZA 3A28A 2IEDA 1V35A 3BHMA 1PGQA 5KVCA 4YAGA 4F6CA 2X9GA 4LN1A 4RVHA 2V7PA 2GGSA 1FK8A 4C7JA 4J43A 3RVDA 1ADCA 1PS8A 2ZIZA 3GC6A 4YB8A 1JQBA 3SC4A 4TMFA 5IXYA 3DBVO 5GZ3A 2GDZA 4RDHA 2PK3A 4RZIA 4CR7A 3KLPX 3ZV6A 4J4BA 1WZIA 3NTRA 3ZWMA 4CLRB 1TT5B 1GYQA 3FBTA 4Q3CA 3WOHA 3KYBA 1R16A 3H3FA 3V2UA 1NTOA 1T2DA 1YL7A 4GWKA 4PG7A 1SB8A 3PHGA 5TC4A 3H4VA 4XYMA 5MGBA 3QVWA 3OQBA 3FNEA 3GDOA 1E1NA 1P44A 4ZQHA 4MPDA 4AJNA 3VVBA 1A71A 2FY8A 3GN2A 4OOFA 2NVUA 1DFHA 1EK5A 3FR7A 3SVTA 2P68A 1ZUD1 3JQAA 4HNGA 2RCYA 1NFRA 2B5WA 3OBBA 1AUPA 1DRUA 2R00A 5ER6A 1IULA 4MIOA 4C7KA 3ENNA 2DBRA 4F3YA 1HLPA 2O3SA 1LSOA 4J91A 4J1QA 3R1IA 4PVCA 3I9LA 5F3RA 1PS0A 4J1TA 3TZHA 3ZGYA 4OMUA 4E5PA 2G17A 4YBZA 1IPFA 5TT0A 3CKYA 4CLEA 1HYHA 3QSGA 3ANMA 3PXXA 1DBVO 3ASVA 3WIDA 1YRLA 1J4AA 4BKOA 4NFYA 3RCBA 3ITDA 2PD6A 1VL0A 3JSAA 1K89A 3AOEA 4J90A 3WB9A 1P1RA 1X7GA 4LMPA 3KLMX 2YHUA 1PJTA 3OETA 3NTOA 1LXCA 3C8MA 1U9JA 4DC0A 1N7HA 2IYPA 3IP1A 5CFZA 1EUCA 5BNIA 3JYQA 3F47A 1GUYA 2JAPA 1HETA 2WD7B 3RBZA 4M1QA 4QFCA 3PTZA 4PLVA 1UP6A 2DTXA 4WNIA 3CH6A 1GL3A 3IP3A 4DL9A 3ZWCA 3OHSX 3PFFA 4GBJA 5COQA 1BWSA 2F00A 1XKQA 1VRWA 5IXSA 2WYUA 2ZB8A 1PJCA 3RBXA 2BGLA 4WLOA 1VSUA 3BMOB 1MB4A 2P91A 3B1FA 3F5SA 3E6AA 4Q3DA 3VAZA 3IKTA 3WNQA 5IF3A 4MVJA 4E2XA 3MOIA 2QQ5A 2DFDA 3AI3A 1QYXA 3DR3A 3CTMA 1ADBA 4EYEA 1X7HA 5FWNA 2WE8A 3L4BA 4G5HA 3KXDA 1CJCA 4XX0A 5G4KB 1O5IA 5A9SB 4BVAA 1KS9A 3JQ7A 3HFGA 3E5MA 4FFLA 1K6IA 2D2IA 4YQYA 3ULKA 2X6TA 2HU2A 3X2EA 1FDTA 2Q1SA 5B12A 1VC2A 3JV7A 5DDIP 1A9ZA 1EZ4A 1B3RA 1LTHR 1SCUA 2FWMX 4J2HA 2AG8A 2NU8A 1DIBA 2I65A 1NQAO 3RI3A 4TZTA 3VDRA 2RH4A 3ZI0A 3ZNQA 4XRRA 4Q3NA 1U5CA 3ZH2A 3VH1A 1F12A 1FDVA 1U8FO 4S1VA 2NADA 4ND1A 1YOVA 4XQ9A 3AU9A 5I9NA 3LT4A 4BO7A 3VKVA 4DIBA 2E4AA 1A9YA 3PIIA 5G0UA 4U6QA 1ISFA 3UH1A 4O6VA 2NSDA 3I23A 3ETEA 5B37A 1B7GO 3FD8A 4L76A 3PZRA 3ZHBA 1G6KA 3GUCA 4A03A 3MJTA 2E37A 5L7YA 2XXJA 5JO0A 2JHGA 2RHRA 4BNFA 4CPDA 2EJWA 3VTZA 4YPOA 1EVJA 2UV8A 3FR8A 4FQ8A 1ZSNA 1T4BA 5I8WA 1A72A 3M2TA 4C4OA 5IAAA 2GPTA 4FW8A 3DEYX 3BTUA 1B0AA 4HKTA 2AE2A 4QSMA 5T6BA 4LCEA 3WFIA 3DXFA 3AUAA 4NDNE 3MJVA 4JBGA 3TJRA 4R3NA 2Y1DA 4JIGA 5I8ZA 2EGGA 3BXXA 4EEXA 4AJ2A 3BHIA 1V9LA 2I76A 5JDCC 1F0YA 1H5QA 1N7GA 4OL9A 3GZNA 1EQ2A 4A73A 5BR7A 3FWNA 2C7GA 2F1KA 2J3HA 2PLAA 4J16A 4PIVA 1JKIA 5A9TA 1Y8RA 4XD2A 3ZDFA 3FNGA 4DWVA 3HDJA 1RM5A 2FRDA 3H9EO 3H9GA 5DP1A 4LMRA 3JD4A 5JPIA 4AJJA 4E5YA 1ONNA 5L45A 3EVNA 4TRRA 1CERA 1PR3A 1UUFA 5H82A 3WTCA 5ITVA 4D3SA 1HDCA 4XDZA 1GUZA 5JE8A 5C7LO 4G2NA 1LDEA 3I83A 3Q11A 4GGPA 4JROA 4KUEA 2BD0A 3G3EA 1N1GA 2J3JA 1C1DA 2VTEA 3GEDA 5KJFA 3OIDA 3I9NA 1U7HA 1ZVMA 1J49A 1I24A 3K30A 1T2AA 1ARZA 4FBGA 2X5OA 3LQFA 4YR9A 2PGLA 1MA0A 1GCOA 4NJMA 1N9GA 4FPXA 1B8UA 3DHNA 3TDKA 4A0SA 4Z9YA 3V2GA 2G5CA 3OJLA 2HUNA 3JQ8B 5CDTA 3G17A 4RLHA 1O9BA 1OC4A 2YYYA 1GEGA 4B7XA 2GN6A 4TSKA 4PZEA 5JCXA 3Q0EA 1EK6A 2X86A 2NUAA 3W4IA 1C0LA 1BMDA 2FHSA 4UEJA 2NU6A 3DBRB 4W9NC 1ZK2A 1NNUA 1W73A 3RIHA 3RUFA 4DA9A 2O48X 2Y1CA 2ZTVA 4RQTA 5CPFA 2BI7A 4CM1A 1U5AA 2X58A 4UEOA 2AG5A 1DC6A 5TSDA 4BO1A 3BMNA 1YB5A 5CDGA 4W7IA 1LSJA 3W8EA 4KUHA 3NT2A 4GL4A 4J4HA 3ZWVA 1V3UA 2OL4A 2WSBA 3TFQA 1OI7A 3VTFA 1DFIA 3D5QA 1N2SA 3R3SA 2VHWA 1NQ5A 4UUNA 2GD1O 4D0SA 2O7SA 3AFMA 3KSDO 4TQGA 3D7LA 6LDHA 4IDDA 4ALKA 2C5AA 2BFAA 1ISGA 3P2OA 4BNVA 5T8KC 1IZ0A 4E2ZA 1JKJA 1Q0LA 4L75A 2Q99A 3WQRA 3E8XA 1K3TA 1N8KA 1T2FA 2Z1NA 3RFTA 4D0RA 3OIFA 3AUTA 3E48A 2BMAA 3FNHA 1E7RA 1QG6A 4QTZA 3O26A 1Q0HA 1U7TA 4YRBA 1ZSVA 1C0PA 5DNAA 1GFSA 2HMUA 2POQX 5JNLA 2AQHA 1EE9A 4Y98A 4S3MA 1WWKA 2VHVA 3C1AA 2ZK7A 3AW9A 1LSSA 2GASA 3DAFA 3I9KA 1DHRA 3JQBC 1ZH8A 3K92A 4O63O 4UULA 1E92A 5F1KA 1ISHA 1XELA 1ADGA 2CD9A 2OOSA 3CE6A 2HMWA 1UAGA 1G1AA 2GR9A 1X1TA 4PLGA 3GPIA 2Q50A 2YDXA 1YE3A 4XEHA 2W8ZA 2EJVA 2ZQZA 4CMCA 2IEBA 5JAMA 4CM8A 2AQIA 1GR0A 4WLNA 2OXIA 4CMAA 4RLSA 2VQ3A 4IGFA 1MV8A 1R12A 5T67A 4FOSA 3NDIA 1JKFA 3NUGA 1HZZA 3DBLB 3OIGA 4ILKA 2YJZA 2Q1UA 3PVZA 2OHXA 3TZKA 1Y9AA 4NQZA 4RDIA 4OKNA 1A7AA 4J7CA 5IFLA 3QP9A 1V6AA 2X8LA 3Q3CA 4IMPA 2YQ5A 1JU9A 1QMGA 2BGMA 2HMTA 3V5NA 4URFA 3N7UA 3FWZA 3WWZA 4P4NA 3WQSB 3RC2A 2VNSA 5CAEA 2PH5A 2VYVD 5IZCC 2BH9A 1OZAA 1BSVA 4ND5A 2ZYDA 3WGIA 3D64A 1HWYA 2DM6A 3B1KA 4CMHA 4ZN6A 3U4DA 1UAYA 4IDEA 4NNJA 4UVGA 4YACA 5A1TA 3JQFC 4KDFA 3KM0A 4B8WA 3L6EA 1ULSA 2O3QA 1KVSA 3QWAA 3OQ1A 4DPKA 1CRWG 2CVOA 2HK7A 3VH4A 2P9GA 2A35A 3DZIA 1PU2A 5A9RA 1PIWA 3FF4A 3RUHA 1GU7A 1H6CA 4MVJE 2V65A 3DMYA 4CQMB 1E77A 3OA0A 3ETGA 4GMFA 3VC7A 3X2FA 5KOIA 4WCDA 4XYGA 3KYCB 2HCTA 3K6JA 3TL2A 1UXKA 2DPHA 4DRYA 1ENYA 3F4LA 2CDAA 2GF2A 3SBOA 4D44A 4G81A 5T5QA 1R4MB 2LDBA 3ZWBA 1N1EA 1DRWA 2A4KA 3BMQA 4TROA 2D8AA 4L0QA 5JAQA 3HWRA 1NM5A 1QSGA 2WTBA 2B83A 4OQYA 2C54A 2DLDA 2D5AA 4CJXA 5ILOA 3K5PA 2QHXA 4N54A 3RROA 4WLVA 4D42A 5GMOA 5T64A 3MEQA 3U4CA 3AJRA 1TA4A 2W2LD 3H5AA 1ZXBA 1EMDA 3QY9A 4BNWA 3PPIA 2UAGA 3WX0A 3CXRA 4WCFA 2XPCA 2CVQA 2HJRA 1DFGA 4I5GA 4EUEA 2C59A 2JKVA 1HL3A 2W90A 5KVVA 5DF1A 2NU9A 1NWCA 1DRVA 2A94A 2AE1A 3W4KA 3ZWAA 4K6FA 4LW8A 2NVUB 5JY6A 2FP4A 4BNGA 2YHIA 2OZPA 3E1KA 1Y9EA 1GCUA 1P1KA 1RPNA 4GSLA 4B79A 2HKIA 5JDIC 3I6QA 1Z73A 1SOWA 1RJWA 1B14A 4CMIB 4ALJA 4BQRA 1G0NA 3C24A 4J9VA 3OJOA 4I9UA 4Z3DA 2CDCA 2I66A 2EWMA 3GFBA 3WSVA 4CV1A 8LDHA 2R2GA 2DBZA 1PWZA 1OOEA 4QQRA 3FHLA 2X9VA 2YUTA 5A3JA 4IDBA 4LGVA 4P4LA 3VZQA 4LSWA 3PDUA 4LVCA 1RWBA 3BMCA 2Z1MA 5LCXA 2IYOA 2W2KB 1HDZA 5L7WA 1BTOA 3ZZNA 2IRWA 2B0JA 1NVMB 4PCVA 3PFWO 3D3WB 4J1NA 4QX6A 5A4DA 3E03A 2NVBA 3PZBA 3ON5A 3PRJA 3KYDA 4E3ZA 3VZRA 4CUKA 5G0VA 3A06A 3TL3A 4EJ6A 1X0VA 4NK4A 1HE3A 4BO8A 3ABIA 1GQ2A 3KHUA 2C5EA 3WMWA 1W8DA 4IM7A 4L73A 2Q2QA 4TVOA 4AJEA 4BMVA 1ZSYA 2AHRA 3SC6A 1A27A 3JD3A 5BSGA 2UUPA 2I3GA 3KUXA 2HK8A 3B20A 1XGKA 2VWHA 2CDBA 4ZRMA 1ISJA 3IKVA 4DPLA 4QECA 1MG5A 4XIYA 1DXYA 4MP8A 2QYTA 1O89A 1IHXA 2QIOA 1PQWA 4J9UE 1HZJA 1U4OA 1QYDA 1VL8A 4B4OA 4E0BA 5CG2A 3IAHA 3A9WA 3DTTA 1NASA 2I9PA 4CLOB 1DC5A 5L95A 2O4CA 4XR9A 1FDSA 1GZ6A 3L9XA 1E1LA 2ZKLA 4UEKA 4WE3A 1MP0A 1I32A 3V1UA 3FSRA 2JD2A 4PZDA 3VPFA 3EZLA 4L4SA 2RHCA 1ZKMA 5DN9A 3JQ9C 3W8FA 2HQ1A 2PFGA 2GZ3A 1KBZA 1UZLA 4PRKA 3RKUA 5G2OA 1E6EA 4D3DA 5KVSA 2HMVA 1VJ1A 2IXAA 2C0CA 2ET6A 4OIMA 4PG5A 5DOZA 2EW8A 5A06A 1GAEO 1KC3A 4WOKA 2HJSA 1YOVB 4IXTA 4ZQEA 4PG6A 5I7FA 1NYTA 4JNKA 2DVMA 4BO9A 3TSCA 4CUZA 4GAEA 3PQDA 6ADHA 4BNHA 1H9BA 2AA3A 2VYNA 2W2LA 3GEMA 4EEZA 3KEOA 4DQUA 4ZGWA 1GZ4A 4GGOA 2J3IA 2YZ7A 1SOVA 4FFNA 3FN4A 4Z0PA 4PFJA 4YRAA 1QXSA 2NTVA 2O23A 2ZYGA 3GMSA 2YY7A 4J2OA 4Y8VA 3GMDA 5EQFA 2AQ8A 3VDQA 2DQ4A 5G0TA 2VOJA 1QYCA 4U8GA 4E21A 4K28A 4RVSA 4IDAA 4N5LA 3CSDA 1PWXA 1VPDA 1Z7EA 5F1OA 3F9IA 1LU9A 4PLWA 4XGIA 1BXGA 3LLVA 4ND3A 2BLLA 3OJFA 1RYDA 2XF8A 4BNXA 4XIJA 2WDZA 3QLJA 3OP4A 1WW8A 4IIVA 3PYLA 4CL3A 3AOGA 1CIVA 4TKMA 5ENVA 2P5YA 3PQEA 1IY8A 5IDYA 5K0ZA 1HDRA 4D41A 1EUDA 4RF4A 4DIFA 4WEQA 4M8SA 4JQCA 1LUAA 5T57A 4R41A 4RVFA 4CM6A 1Y8QB 3QWHA 1DHTA 5FF9A 1RM0A 3WXBA 1EVIA 4A5OA 4PRLA 3VH3A 2AXQA 1YB4A 3ONEA 2DPGA 4JJIA 4TVBA 3ZHZA 2W98A 4TRMA 4Z9XA 3LC1O 1PZHA 3DOJA 5C7OO 1SBYA 3DAGA 2R00C 4YJDA 3JQDA 3F5QA 1KVUA 1C1DB 1ZK3A 3S2GA 1WMAA 1GD1O 3L07A 2PD4A 3ADOA 4R9SA 3H3JA 3MWEB 3I4CA 4R9RA 4CM9D 3FTPA 5KKCA 2VWGA 1PL8A 3PEFA 2P2SA 4ALMA 3HADA 3NAQA 4N5MA 4D45A 2BHLA 3DHEA 1PGOA 3O9ZA 3T4XA 1N9GB 3TOXA 2Y99A 3DOCA 3ONDA 1W4ZA 3A14A 4CODB 3ZNNA 1HE4A 1F8FA 1MXFA 3AOEC 4QUKA 1DAPA 3GT0A 3HN7A 5THKA 7MDHA 4W99A 5FYDA 5ICSA 5F5LA 4YAKA 1CETA 5G0WA 3PIDA 2DAPA 4EUFA 1A4IA 4XA8A 2QG4A 2QX7A 4IDCA
chains in the Genus database with same CATH superfamily
1YBHA 5GIOE 1Y1TA 4IRMA 1RLMA 4FI3C 5FFFA 3ZKWA 4CM5A 3KQLA 3Q40A 5LR6A 4IZHA 2QTVA 2YMPA 1SOUA 3N05A 3VXKA 4CIAA 3AFGA 1THTA 2WIGA 4Q37A 4X62B 5LLDA 3Q2IA 1YA8A 4YDRA 3ML1A 2P9EA 3ZX5A 1EDBA 3FCOA 1VJRA 4KP7A 4ZAVA 2QD3A 2G1KA 2XVZA 3V6MA 2WBLC 1E2UA 3CH4B 1X92A 4UZSA 1EE2A 5ESWA 5JPDA 2Q6OA 3CW9A 3MLAA 1Z22A 1QF7A 4HNQA 4KK4A 4TV9A 4Z1MA 2HDHA 4GQIA 4IUYA 4B47A 1VDMA 4DZZA 4E5DA 1C2TA 4C4PA 1VE6A 1U98A 1Z2CA 2RI0A 4D9BA 1FVXA 1Q7GA 1YDHA 3PDIB 3D3KA 3E3OA 2GXSA 4W1QA 1EFVB 1QTNA 1XSEA 4PNEA 3O8QA 2NP7A 4UNRA 5E7JA 1SQSA 2GO7A 3FZQA 4PCAA 2RK4A 3IURA 2XNDA 1TZJA 5JYEA 2XYRA 3PD1A 3GJ0A 1BRMA 4WZ6A 1TF7A 3QVXA 4JGGA 2QAGB 4F46A 4Z6KA 1RRGA 2BGIA 4BFZA 1XTPA 2QRKA 4DSTA 5KJ6A 1ZD8A 4BPBA 4W6ZA 5E7QA 5KWVA 5EG5A 3V4SA 3L4BC 3E7PA 5LJIA 4WXYB 2M98A 1F6DA 5ALQA 1O5OA 4Q3EA 1KFEB 4A7PA 1VLLA 4G67A 1ONOA 4BKUA 1FDRA 5PGMA 1DEHA 2KE5A 2YW2A 3MGGA 4NBVA 2OV1A 4NE2A 4PHGA 4BVGA 3CEAA 3BIXA 3UK6A 1J90A 3DONA 4GX5A 1GIAA 3RU7A 2X15A 4DBVO 1M2WA 1RXWA 5AOBA 4J4TA 2GHIA 2Z6VA 4KC0A 1H2FA 4U1RA 4OYRA 1C3LA 3HCWA 1KERA 3BJMA 1CYDA 2JK0A 3N58A 5H83A 1BDMA 2CZQA 2YDYA 4AK9A 4D99A 4X65B 4QFMA 2Q1WA 3EGDB 3OICA 4MX8A 5EZYF 1QHNA 4ENQA 2A14A 3GRAA 3CVOA 4I3HA 4B5LA 3HJFA 2BPOA 4J0CA 2PNFA 2AZDA 3C7TA 1YCHA 2BOVA 2YHSA 3H8SA 4NYJR 4ZI7F 2VJKA 1XJQA 3N6VA 1NDQA 3NC1C 5AUOB 2A30A 2PKQO 3JRWA 2ORWA 1NPYA 3P0FA 1M2FA 3OLWA 3R6TA 2X2OA 3QELB 2IEIA 4QLAA 4DUZB 1BEEA 3Q7EA 4BV3A 4L2IB 5J4VA 3IVCA 5BSMA 3FDZB 3L7CA 3MSCA 4KOAA 4B3RB 4PX5A 2VCYA 3RC7A 3CZAA 4NSNA 5ED0A 2IYEA 3EIWA 3U1BA 2ZSDA 1U1EA 2ZUDA 4O4LB 5FUBA 3E4CA 4E4RA 6GPBA 2VPTA 3BCUA 2HLHA 4ALIA 2AKEA 3KB8A 4KRXA 1KI3A 3L82B 3B3QA 3M3DA 1WP4A 2VHXA 1BMFD 4MW2A 3SR4A 1DMSA 1IUNA 3ID6C 3JVEA 3NBKA 2ZBDA 3AZPA 3NHRA 3ORHA 1Q1GA 5H3LA 3KBOA 2FUCA 1U8EA 1AGXA 5EMJA 1K9VF 2OHGA 2R97A 2AJTA 1N0HA 2OVFA 3VR3A 4CZ2A 4E32A 5B7PA 5ER9A 1LK0A 1YDGA 4FM9A 1Y4ZA 1J24A 1G291 1CUWA 1W4AA 2IYZA 2VJCA 2YMQA 1KY4A 3FYDA 4G4GA 3DDWA 3PUYA 1VBNA 3DSRA 3TTTA 3ZY6A 3C8HA 3EFHA 5JNVA 1QPZA 2N1MA 1Y98A 3TW6A 1JDZA 4O2AB 5CTAA 3P52A 1TAGA 2Q3JA 4LZJA 1R5NA 1F8XA 4K81B 5HR5A 4Q48A 3Q8LA 2JIQA 3HNRA 2Y8EA 3ZWOA 1NY6A 5FBKA 3UHOA 3BCRA 1T3GA 1Z6YA 1T6BY 3KSUA 5MN5A 1TA0A 3VPHA 2V0CA 2G4CA 4MW5A 2CF6A 4X45A 3WRWA 2LE0A 1TZKA 3CLTD 3UPUA 2IP2A 4GWLA 2BBSA 1HKUA 2FRDC 2FR8A 2OBYA 4LJ6A 5DOVA 5BWCA 1KBQA 2ZDGA 1WDLA 4O8CA 2HHCA 3K1AA 4K9KA 1E2MA 1XDSA 4EKDA 3ZW8A 1C3JA 3PLAE 1HNXB 3AK4A 3WLAA 1CQJB 2C88A 1PWYE 1QZTA 2PGXA 5BYBA 1PJAA 3QWFA 1V1JA 3C4VA 1Y6GA 2FK8A 5LIRA 2H54A 3EPRA 3L02A 4FN4A 4FVTA 4MV3A 1T1SA 1MGOA 3LCUA 4NY1A 1KFBB 3WFIA 4P32A 3GJRA 3PK0A 5FQOA 3FF1A 4URUR 1R6DA 2XGMA 2PQ2A 3PGVA 3NCTA 4LY0A 1D09A 1WMFA 3BEDA 3O03A 4NFSA 1A50B 3WWYA 2PYZA 1HGXA 4GH5A 1XMQB 1GFIA 2WJ4A 1ZMOA 3NWEA 1NBIA 1T8WA 2Q4EA 3LDGA 2OFPA 2DX7A 4JBIA 4K46A 1OXSC 4Q3LA 2C4NA 3PP8A 2C84A 3VU1A 5DO9A 4ADSG 1LLCA 1ZMTA 2QG9A 4KO8A 3JQ6A 4JQSA 1LLUA 1Q77A 1UOEA 4FFOA 4Q66C 3O8NA 3ZHQA 1WXFA 3EARA 3ST7A 3MLEA 2NO5A 4Y18A 1UF9A 3TOVA 5IAJA 4E13A 4GWGA 1O8CA 4IVRA 4NE7A 4B82A 2NPOA 1DKLA 4ZJYA 3TUJC 4DWWA 3OQIB 4NH0A 3I34X 1A98A 1P77A 3CUSA 4PLPA 5TF4A 3ZLBA 4B7CA 4P58A 4ZTUB 3SC2A 2B25A 5C1PA 2VK1A 3LUFA 4TYMA 5DNWA 5AW5A 2NUTA 2YN0A 2GZ1A 3MWGA 3RFUA 2XYGA 1IQUA 3PYXA 2XCOA 3VBEA 4ARIA 2QNBA 4BZPA 3C6QA 4I0WB 2VSYA 1OLSB 4NBSA 1PK9A 4UDNA 2H2GA 4BLRA 2RKBA 1GPMA 2OXRA 4GX0A 2CXTA 3HEMA 3NHYA 2ZRNA 1VP3A 3AB8A 4V0OA 3ENWA 1BD3A 1WBJB 4U0JA 3NJ8A 4IVNA 2Y2UA 2WJ3A 4G63A 4H1WA 1I6WA 3GRCA 1YQEA 5DRYA 1TL7C 3VKGA 3JY6A 2G36A 1CQZA 3LX4A 3HPQA 2BRUA 1G5RA 3ZE0B 3MCZA 2ZRGA 4QSHA 4TTVA 2GHQA 3PHIA 4YRGA 3BRQA 3W5CA 3D02A 3SOZA 1L5FA 1HORA 4J49A 3RQIA 4U2KA 3I6MA 4MR9B 2V6GA 3OJ0A 5B7QA 2R3SA 2W22A 2I7DA 4ND6A 2XLCA 4OGWA 4EMUA 3KELA 1HQDA 4M6WA 3DF7A 3KT3A 1KO4A 2G72A 2H31A 4OQLA 2Q5QA 4Z9BA 1I51A 2I6SA 3AM3A 1BW9B 2R5NA 5HM8A 4N3CA 3VFDA 1F2DA 2QS9A 4E30A 3ZDDA 3EVEA 4KGVA 4HGRA 3T5AA 3BTOA 4YRNA 4RTNA 3H2YA 3ADCA 4J07A 4NU6A 1QANA 2B69A 3CPJB 2R11A 1L5HB 3IAS1 4R40A 1J42A 1LJLA 2PUVA 1ACLA 2Y1WA 3NPMA 3WSTA 1QP4A 2HJWA 4BV9A 3FJOA 1BMFA 2WG2A 1MBZA 2VBCA 2VHTA 2Q1TA 3LCMA 1YNOA 2C4WA 4C88A 5LOVA 1X74A 2NYVA 3NTQA 3O7WA 3D6AA 2GYVA 4TQUS 3MUOA 4A6DA 3RJ9A 3NHSA 4X95A 2G04A 4ZREA 3BMOA 4BMXA 3V2HA 1JT9A 1CD5A 2FW9A 2ZRFA 4EPRA 3A9UA 4D2IA 5AVXA 3NGLA 4FN5A 1O77A 4TV9F 4ECAA 4DLPA 3COVA 3C3XA 4KO1S 2O0MA 1B8NA 1PEKE 1O8BA 4LE2A 4PLZA 3UICA 3EEFA 2IPAB 4GQAA 3OC6A 2JGDA 5TX7A 3P7MA 4BRWA 1PLJA 4C4AA 1XNQB 1T0UA 1XUOA 1U04A 1O6BA 3KWMA 1CUHA 3DT6A 1Y1RA 4C5AA 4UBIA 3E9NA 4ZOLF 4Y6PA 1QS0A 1EPUA 1H85A 3EQ9A 1Q2XA 3BA1A 3GCDA 3OZ7A 3R44A 4I5DA 1XRPA 4I8DA 4UHEA 4I50B 4NG4A 4AB1A 5BSEA 4N7BA 2X0RA 4CF7A 1S2OA 1DAGA 2L18A 3GI1A 1KQ3A 1I3OA 3JATA 4L07A 4S0XA 4Y6SA 5BYAA 3MGKA 5K7SA 3TZBA 3U6BA 1KK2A 3I30X 4LHSA 1RAIA 3GAFA 4R0MA 3IHLA 1CTQA 1TCCA 2MYTA 4HN4B 4LAFA 1YJ5A 2JH8A 2V97A 3TLYA 2G76A 3QUQA 1S9HA 3EEYA 4P4UA 4YCBA 5D5HA 3E7XA 7ADHA 1N6HA 4IQ4A 3BRCA 1DP4A 1DUVG 1MVLA 1XP5A 3B38A 4G9EA 4JJEA 4II2A 4DTCA 2ZZKA 1IUKA 4M99A 1GG5A 1KC1A 1XCPA 4QVGA 4HJXA 2H85A 1AY0A 4Y6QA 4EZBA 1SHKA 1FYFA 1RHKA 1RLTA 2AGVA 4RSRA 1UPXA 1YL5A 2WAOA 2OV4A 4JJ8A 4S12A 5A71A 4AJHA 1TX4B 3DLTA 4L7VA 1XD9A 2PTGA 5BUQA 1YFKA 3KEGA 3FSJX 4UTVA 1JSXA 1PSZA 1QPBA 3FOZA 1GT6A 5IMBA 4K6OA 2IOFA 1W88B 2INGX 3D5EA 1KYWA 2HXYA 5HA5A 1CW2B 1FTWA 3BD7A 1IY1A 3HHEA 4DMLA 2H0RA 5AJWA 2FW7A 3IGFA 1PR0A 3K8ZA 3MMSA 5AHXA 3M3PA 2Q5CA 3WJ1A 3JWEA 5KYVA 4BRSA 4DBLE 3WV5A 1NZDA 2ZQ5A 4LEIA 5CYOA 2DUUA 4CG2A 3PLNA 1G9XA 4X7BA 4M1EA 2GAJA 1D0VA 3KEFA 2C31A 3B7WA 2AI3A 2OUIA 2WWRA 5HS6A 1S2NA 1AMOA 4MDFA 2YV3A 4PX9A 3M34A 3LA6A 5EFOA 2A0UA 8ADHA 1RZRA 2YJ6A 4PFKA 1TCVA 4IIGA 3RVNA 1JQ5A 1M74A 1MEEA 1UDXA 3JTEA 3IJ5A 1M8GA 3AHIA 3EK2A 3IDZA 2W2NA 3N0XA 4XCQA 3RU2A 3SFTA 3DTYA 4D79A 3AVXA 3N7AA 4PO3X 2YJGA 3OCXA 2G06A 5EHGA 1KQNA 3QA3E 4PYQA 4UVEA 4BLSA 4L5CA 1FTSA 4FDAA 1BJKA 2JFQA 1SWWA 3DMTA 1TTPB 3LU1A 4FGWA 1L7VC 5EL0A 4AZ3B 2CD7A 4M7WA 1MJGA 1ZVVA 2X8BA 4FBMA 2DFNA 2EX4A 5EUQB 2NQ8A 5AW7A 3Q1LA 4RMNA 4DJAA 2ZI5A 1T0BA 4MS4B 2BEWB 3CISA 1QF6A 2H48A 3A10A 4MDYA 3EPPA 3FPHA 4FOTA 3H7IA 2O2XA 1GQQA 2G0TA 4YJ2B 4GPEA 5HDQA 4B2PA 2W4IA 2XVMA 1L5YA 1NUPA 4J2TA 2O2JA 3DV0B 4LX0A 2B94A 1ZIDA 2EW1A 5BQ5A 4JLPA 3S1AA 3VNBA 4EJ2A 2O19A 1UBRS 2CJWA 3IP5A 3KEQA 3AEQB 1I7LA 2H08A 2VNJA 2DWUA 3EC7A 3JALB 3H6GA 4ZOEA 1ZUNA 1J23A 2A9KA 3QG1A 5K8LA 1FTGA 4QXMA 1CJVC 3JW8A 5LD2C 1S96A 5D3QA 3UC9A 5LUAA 5TF0A 3Q98A 3TX6A 3ELDA 3NX4A 5B36A 3V4OA 4NBLA 3KNZA 3MD0A 5FA5A 1B0ZA 1V3VA 1BCRA 1LJUA 2HCJB 5LL6P 1IY0A 4WA8A 1VL6A 4AZWA 3MOGA 2OLKA 1YXMA 1UJMA 1TEZA 3ZDEA 2VRNA 3QMVA 4FLMA 5D86A 3EW7A 2E49A 1R6UA 2B92A 1KJWA 3B36A 1SBHA 1Z56C 3ND8A 1FP4B 3AEYA 3MJEA 2ZWIA 5KTMA 1CBUA 1VA4A 5ILQA 1BHO1 2IEAA 4UATA 2PLRA 2DHRA 3FBGA 2FPWA 2O3UA 1U81A 4OPMA 1QGUA 3G0BA 2A58A 4ACBA 4EY7A 2Q4BA 3KJFA 3RWOA 1FU7A 5ELMA 4B0PA 4CQLA 1EUCB 3B5IA 4GDFA 3DE4X 3O2SB 2VWPA 4BJ3A 2XHEA 3B6KA 4LV8B 4LYGA 1AKTA 4NBNA 2GDJA 5JS6A 3NHZA 3MIIA 2FXVA 2FZWA 1NP3A 2ONZA 3BWEA 3R5TA 5EC8A 3KCNA 1QK5A 3KPWA 4E4TA 1QGDA 3TI9A 3W78A 3IDSA 3DDZX 1KWGA 5AVOA 4FFBB 3GVIA 3IIKA 3L1UA 3PKZA 4QNNA 4GKVA 4QBFA 3GWZA 4ITRC 5BSFA 1T8PA 3CNLA 4ZZ3A 5EXXA 2QUKA 3ZVKA 2VLIA 4B31A 8ATCA 5B2FA 2OV3A 3UXMA 1Q7RA 2HIMA 1NOKA 4OA8A 1T3HA 3VR6D 3WYFA 2XXBA 1YIDA 4PLFA 2Q7DA 3A6DA 2XZOA 2EFHB 4R1LA 2WLTA 3ACCA 3K70C 1V71A 3OMWA 2ZDQA 1CG6A 4OFWA 2BM8A 2PZMA 2QU8A 3KWJA 3TQSA 3MA0A 3RUEA 4K88A 5CB6A 2VBIA 1XHEA 1D1QA 2LUOA 4DJJA 3QF4A 3B1XA 1VJ5A 5CNJA 2OXCA 2BBTA 3HCPA 3DT9A 3FNFA 4M0PA 1P8AA 1U7UA 1VOTA 3CH7A 3FETA 2J5BA 3LZ6A 4HZUA 1BU8A 1SKYB 2GKOA 5DHTA 2OHVA 3DAPA 4XX0B 4TWZA 4NCBA 2HXGA 5CDFE 4J7UA 4OKIA 3TRJA 2E82A 5E0KB 1P33A 3B3AA 1CRLA 4WOJA 4EZIA 2YQ4A 4F97A 4MQEA 1ODCA 3MJ4A 1I80A 3JD2A 2FZ5A 5ALOA 4OB7A 2EFEB 1OXVA 5BV0A 3LF2A 5H70A 4BUZA 3A6ZA 2XGOA 5B1YA 2IYUA 3DLBA 3FMIA 1YRHA 4F4HA 1U3DA 2GERA 4GVLA 5IBPA 2X0FA 3ZG6A 4C0LA 1TU0A 1THZA 3BBLA 3H9UA 3T35A 2QM7A 4CMBA 4DQLA 4EI7A 2C2KA 2JHFA 3H75A 4I1IA 4UFNA 5DSZA 2J3KA 4BU0A 1LC3A 1PHPA 1SU8A 3CX8A 3CE9A 5K4HA 2Q9BA 3KQVA 1U31A 1WVIA 3RTEA 1TUEA 4A8HA 5IS2A 3LHKA 3QEMB 1D1PA 1QRDA 5HKKA 3PU6A 1O58A 2BJVA 2BM1A 2V8OA 2ZBFA 3OJCA 3KBBA 4B6SA 4NX2A 4MDHA 4LV6A 5COBA 3U62A 1G2QA 3HA2A 3AKZA 1GM5A 1OJ7A 1XRNA 2QD4A 3K5IA 3QKUA 3QLUA 4YTEA 4MCJA 1R4ZA 5B57C 4Y2JA 3U49A 2K5UA 3RH0A 3ZU6A 3EB9A 2HRRA 2D5BA 3HTXA 4BGVA 1KO1A 1N92A 3DFKA 3V00A 4MVCA 4NC9A 3M6AA 4HCJA 4YCJA 2O7RA 4EG4A 5L53A 1X9GA 1AKNA 1VIMA 1HFWA 4BHTA 1JIIA 4IV8A 1D1SA 3PNKA 1AOXA 4H4EA 4NNPA 5U4QA 3ETLA 4ZHSA 4YUYA 3U37A 1JJIA 2QTWB 1IOVA 4TMWA 3UB2A 1M1ZA 2P0EA 1WUYA 5FI5A 1DQNA 1GGKA 3SSNA 2JHAA 1X38A 5AKZA 2V6FA 4IIFA 1NUHA 4LISA 1C9KA 1P74A 2QTLA 2E0IA 1T6XA 2A8YA 1LD3A 4WLEA 1Z4NA 4Z0TA 4EI2A 1QVWA 3CBQA 2SKEA 2JKYA 2I4LA 2PX5A 4Y67A 3V4ZA 2GQ0A 4HMPA 4LI3X 4DR7B 4CQMA 1T3TA 3EJWA 3ZV5A 1CJKC 4OUDB 5DZSA 4C0JA 4AG3A 1TCUA 1EEHA 1UDAA 2FN8A 2REBA 5IJAA 5EPOA 1SMKA 2WVJA 3T52A 4AYWA 2AH5A 4MKIA 1IEWA 1L7BA 4EW3A 3AWDA 5IVPA 3T1YB 3RC8A 2J5QA 3A7EA 3QFCA 4MTCA 4P35A 2HF7A 1OT5A 2GYWA 1M66A 1KPHA 2G08A 1UK8A 1N1MA 4M7OA 2YZNA 2R44A 3BRSA 3ZEAA 5M2QA 1UXHA 1YU6A 3HJHA 1DCFA 4RJJA 2C4UA 4XDHA 2VP3A 3GJQA 4DSOA 3ZE2B 3GJ5A 5EJAA 2NGRA 2PIAA 4XIGS 5KJ1A 1GDTA 1O6ZA 4OJQA 2EJTA 3A27A 2J3EA 1NW6A 3H1BA 5K8IA 1LEHA 3KKKA 2PSHA 4DMRA 5JTUA 1KVTA 2H5EA 2Z4TA 2ZULA 3GZTB 3LBNA 2PO7A 3QEAZ 4C4TA 2HTEA 1RHRA 5JMPA 5T3YA 4IDFA 2MSDB 4OFBA 3JYOA 2O2GA 5JJBA 1JQAA 2G1AA 4XARA 3ORFA 1FBNA 5IJZA 2DT5A 1YQGA 1RXCA 4ETMA 4DXAA 1ZKDA 5JWOA 4M0KA 1N57A 1CUDA 2AWNA 3GUZA 5EWLA 5H3HA 1A2OA 3DC7A 4HLNA 4Z53A 121PA 4F2WA 2J59A 2VDVE 2XQKA 4PCUA 4LY9A 3LSYA 1KPIA 1W49A 1IN4A 4JVMA 4QOSA 3S2ZA 1QJ4A 2YYZA 4KJZA 3I9OA 4W4TA 2RGGA 2AC2A 3COWA 4GYJA 3H42B 1Q1BA 1E1YA 1X14A 3CR7A 4ABTA 721PA 2ZZMA 3JWHA 3A26A 4XUCA 4AJ4A 4DRXB 2NZVG 1TI7A 4OQPA 3VU8A 1RWKA 2CYCA 4QQ8A 4Q9LA 4AUEA 1IPHA 1RAGA 3W8EA 1JEQB 3V4FA 3DEFA 4B17A 1R64A 3ZHVA 1LPSA 3KVOA 2Y1LA 1LBTA 3WR5A 1MENA 5G4LA 1RZUA 2ATCA 3O5AA 5AK3A 4AG5A 4F6LA 4W5RA 4MPRA 2GBFA 3RABA 2HLPA 2Z9DA 2F90A 3A7DA 5H68A 1G1MA 3EQ7A 1MW8X 4XQGA 4UUOA 1J20A 1UXJA 3I1FA 4UUAA 2IHNA 2YICA 2BSAA 3LBYA 1NG1A 4IS2A 4KXUA 2VBGA 2NG1A 2A9FA 3D6NB 1JKJB 3DUFB 4DR2B 3OE7A 2ZAMA 1RQXA 3OQHA 4TOIA 1QQAA 3C6ZA 2AOXA 4OQQA 5JCJD 4AP6A 1GCAA 4XLLA 2CJXA 4EFKA 4UOEA 3BREA 2PAAA 1NVVQ 2OGWA 2ODQA 3L0PA 2I71A 5EIFA 2WSMA 1FFXA 2IZ1A 4US1R 2LIVA 2OORA 2Y1XA 4MKXA 4GLBA 3UH0A 4XGRA 3EPKA 3RAEC 3K6RA 4PV7A 3VOSA 4N3NA 1RM3A 2OC9A 1YI1A 2OP1A 2Z2ZA 4IS3A 5E1OA 4EHDA 3IBCA 4QT4A 2Q7XA 3OEWA 5EJ6A 1WZUA 1SCKA 3GN1A 1NVVR 1N3IA 2QTNA 1FNCA 3OO1A 4IYRA 2CC2A 1UXIA 3M9WA 1FFHA 3G0CA 1XVUA 4FNOA 1JDSA 3TWOA 2AUTA 1Z45A 5DM60 5ERYA 1ESCA 5EI5A 5A6SA 4KLZA 5L3SA 1D07A 4DW8A 1TU3A 5FFNA 3ZD7A 3WE7A 3RRZA 4J0FA 1K6XA 2Q3LA 5IC6A 2XGJA 3OD5A 3IDAA 1C8KA 1E59A 1VZ2A 2GMWA 1OGIA 1LWOA 2WJYA 4ER6A 4HDRB 1QP8A 2CZGA 4INPA 1H2YA 2ACEA 2WWFA 3EBPA 3P97A 3RVQA 3PJFA 3R0QA 4B3MB 1RC8A 1L4FA 4UTNA 2PJZA 2O2HA 4WKPA 1TKBA 4WJLA 3NYRA 2ZJ1A 1Z16A 4QG7A 1D2RA 4ND4A 2ZW9A 1Y4AE 3OTWA 4INOA 3RU9A 3ZBQA 4AKHA 4D5EA 1DKUA 1FX0B 1K5DA 1ZOPA 2JIBA 2ZTLA 3FCXA 4H6VA 5LZ9A 1IBCA 2NO1A 3AEUB 3LBFA 5B7GA 4OFZA 1YAJA 3FMFA 3UW3A 2V6MA 1ZC3A 3VYWA 2G71A 1L7AA 2X6RA 1ZFNA 2Y1GA 4KTVE 5EE9A 4MKFA 5IVDA 4W5QA 4UVIA 1OYYA 4L4RA 3GFGA 5EVJA 5GWXA 3MWJA 4NK5A 2O7VA 4OGLA 2P5UA 4AYXA 1E9CA 1J8FA 3V33A 1DG9A 2ORVA 3F67A 3WHIA 3GLGE 2H2HA 2FWIA 3T9AA 1ETHA 4P4TA 5BP7A 3QRWA 1TMGE 3LG2A 2CF5A 5ALFA 4BKPA 3VTAA 2C9MA 4GOJA 4BN4A 3OM9A 5ALZA 1JG6A 3LDAA 2X77A 3MJSA 1P17A 1HC7A 5COAA 5DHQA 3RLIA 5KNBH 1WF3A 4NH4A 3EEIA 4M87A 4PRYA 2ZI9A 1PX2A 3FUUA 4Q9NA 2RGWA 3BFPA 4ZOBA 5BQOA 4WBNF 5KTKA 3PEWA 2PO5A 3WK7A 2JFGA 5FHRA 3VSBA 2CYBA 3DTNA 4Q9JA 3WZ2A 4R68A 3LL7A 3THYA 4WXPA 3HBMA 3QK7A 1WHTB 4PPQA 2GCIA 4U2DA 1ES9A 2ZTUA 1LVUA 2A86A 5LM3A 5DEOA 4AMZA 4KZPA 3FXAA 3L84A 5K8VA 1PBTA 3CF2A 5D51S 3EIUA 3T1HB 4RIGA 1N0WA 2ZUTA 4BZZA 3HZOA 2C4KA 2ZS7A 3F1LA 1CE8A 1X9IA 4V0MA 1W4RA 3R0JA 1XX6A 3EIOA 4J0KA 3TTXA 2HSEA 2QR5A 4C6RA 3EQZA 1P8JA 3IQGX 4O0MA 5C18A 4Q3AA 1LS6A 3OPVA 5F21A 2WI8A 1ZNZA 4BB9A 3GRRA 5FL7D 5IZ4A 1O97C 1RABA 1F38A 5JDCA 3AHEA 2MHCA 3S3TA 5TS2A 4EG5A 2AVNA 1Y42X 2F48A 4OXQA 5KYXB 1Q84A 1BD4A 4DA7A 3OZEA 1E2GA 1O4VA 3QKIA 2PZLA 4OL0A 2BCGY 3IA7A 2WWGA 1AN0A 3C98A 3PLRA 5K0BA 1T4MA 2JBWA 2RH5A 4JX9A 4TWRA 4UE6A 1EVLA 1P4RA 2JAHA 2BELA 3GIWA 2O7QA 3UMSA 3HKDA 4E88A 2QGNA 4IICA 3HCNA 3GLFE 4QOHA 1Z08A 5JISA 2H2WA 2EAUA 2VRCD 1REQA 3I4FA 1T8SA 1LLQA 4UHDA 4WN9A 2NU9B 1QG4A 1KH2A 3DE6X 4BQOA 1WZNA 8ABPA 5HNKA 4BP3A 5KHOC 2C57A 2ZB7A 4P9NA 2IYAA 2PUHA 5JCJA 1INLA 4LRTB 3O73A 3LYAA 4FXOA 4MGZR 3V1MA 4YRCA 4DXHA 4UOZA 2FP4B 2RGCA 1JVNA 3HUTA 5EPEA 4RH1A 1DQRA 1C9NA 3INTA 1IUPA 2D74A 4UU1A 4YRKA 2GM4A 3TXXA 3FSGA 4LZPA 3CZMA 4ZYWA 1EUQA 3AIIA 1KO5A 3IFSA 2Q5HA 4LA4A 3BD9A 2HPAA 2X23A 2AQKA 2WZQA 2XE8A 2ZRIA 1T2EA 5GGXA 3WGUA 4M9QA 5B1EA 5AW1A 5AOVA 2ZLBA 1IBLB 1KMNA 3R09A 5DTEA 4CKWB 1B15A 3SN6A 3T5CA 4EZEA 4YRSA 3O95A 3NYWA 5FI1B 1YFJA 4DBZA 3FOEC 1JBQA 4I2VA 5BN4A 1DKQA 3HUEA 1A1VA 2AXEA 5CLIA 2V6BA 2Y1OA 2FJUA 2UVPB 4BWFB 2Q3BA 4MQBA 2PKEA 5KAPA 4OM8A 2ENUA 1KOFA 1SM4A 2AOVA 4KLRA 2C9DA 2Q3EA 1YB7A 2XDQB 4OAQA 1OD6A 1WKCA 4HX9A 1VGQA 3HGMA 1RI3A 1XRLA 3IS3A 5DASA 3C3BA 3S2EA 4W9NA 3W8NA 5JI2E 4NBRA 1KXJA 2O54A 2OCBA 4EO4A 2A4MA 1A9TA 1OLOA 1P61B 2ODBA 5GM1A 4BGDA 1PJ2A 1FY2A 3CS3A 4IO1A 2VJPA 4AURA 2YC2C 1N2CA 5CK4A 3A1NA 4P7GA 4HG2A 1WLYA 3TEMA 5GZ6A 2A84A 3U1VA 4B35A 1ADFA 4EMTA 5FUQA 4WSOA 2Y66A 5EZYB 4PSDA 1JDBB 3BE5A 2VRWA 4Y7CA 1U0TA 3JWGA 1GPJA 3G68A 4RGBA 4ZYUA 5JS7A 2X2EA 1PL6A 3OECA 1PV1A 1RBYA 2VSXA 3R23A 4GO1A 4AICA 4F9EA 1CR6A 4ZI7B 3M33A 4DHWA 1UBHS 5AI6A 4RKEA 4MUYA 3U7EB 3VM6A 2QQ0A 3FDJA 2PSJA 1UINA 1DQPA 1RHJA 2XADA 4XH9B 3MRXA 1G20E 2DKNA 4PC6A 1Q95A 5CR9A 2Q3DA 2QM0A 3LC0A 1W9MA 1KYXA 3PEEA 3PUHA 4IZ6A 3GQBA 4UTXA 3QBJA 1TD9A 2BI4A 2QVLA 2XCIA 4PLCA 3U9SA 2F55A 1W5SA 2A0WA 1JEYB 2Y77A 1EGAA 3UA3A 1KAOA 3P9SA 1C3XA 4M1OA 2PX0A 1BKDR 3DMNA 4YY3B 3K4QA 1XYGA 3QE3A 2I7VA 3OTIA 3X43A 1EX6A 4RA6B 2OO5C 1K88A 3CZ5A 3HDHA 4EL0A 4FYKA 1PF7E 1XLVA 1MR3F 2JD1A 2QPLA 2GM5A 2IGBA 3W3AH 3WAKA 1KQOA 3MELA 4MGEA 5G4KA 3TO5A 3AP2A 3O75A 3MCWA 1I3KA 3PGLA 4RF5A 4LHXA 4OXNA 3SQDA 5IXJA 1XALA 1I4OA 4FI3F 4YH1A 3U3JA 1BVHA 5EIOA 3DZJA 2FZCA 3LO5A 1Y3AA 2JFUA 3WJAA 3EY9A 1EU1A 4HDMA 1BXZA 2C29D 3FMGA 2YIMA 1OWNA 5KQPA 4JJ4A 1GA1A 4NV0A 1U8UA 2OCXA 2A33A 2WSYB 3HDGA 4JD5A 4LJ9A 5GTDA 1SU4A 3KJZA 3H7AA 1JA1A 1R50A 5GP1A 1U9IC 3RQSA 2IP1A 3WMXA 1B0PA 4C6TA 2RCNA 4DARA 1IUOA 1PG2A 1PFUA 1F5SA 1C7JA 1E4OA 1LDBA 1XRMA 2VHYA 2WICA 1WG8A 1QU2A 1YK0A 4EPTA 1R0KA 1W5BA 5FL7A 2L42A 1AE1A 2FFAA 2X4LA 3BDAA 2H6EA 5LU9A 4HS9A 3JR7A 3I6IA 4MAFA 1WF6A 2HA7A 2J67A 2RGEA 4HL6A 1DTWB 2VUTA 1FUKA 2MSCB 2QRUA 3FLBA 1FU8A 1OKKA 3JYPA 3K0EA 1ICEA 3Q0TA 3VAAA 3TSZA 3IPXA 4MVJF 1EAYA 4YRQA 5IVKA 3PQFA 4AI6A 4G0WA 4YREA 1KSGA 1L0BA 4YT5A 4ZT3A 3EN0A 6REQB 3WAJA 1XZMA 3MTJA 3L4SO 2WWVD 1C1HA 3DR5A 5FFMA 2VRCA 2PL5A 2ZUUA 5THXA 3L4JA 2FMTA 2WYWA 1ZNYA 4B3BA 2BKAA 3WGTA 2VYQA 1TK9A 3WQQA 3Q3IA 4UBOA 1T36B 3D0QA 3AO0B 1LFAA 221PA 3RT9A 4CV3A 1C0KA 1EGMB 1U65A 1BG6A 4Q39A 2J30A 3TECE 2H9YA 3V8MA 1P7CA 3LIIA 3H8VA 1BVYF 4YJHB 4HBGA 5DT2A 3UOWA 2PT6A 5FAKA 4YDQA 4GP7A 1KP9A 1WHSA 3DZKA 3IR5A 4O2LA 1LX6A 1MB9A 3AILA 1FZQA 3OF3A 3R7BA 4BS9A 1A8SA 1M67A 2ZYHA 1LPOA 3SIPA 4ESOA 1CEQA 4C0KA 3N70A 2OWDA 4IDOA 5LWHA 3PEYA 1X3LA 2AFRA 2QSYA 3UTDA 4D46A 1NW5A 1TECE 2OCYC 2I2BA 3AJEA 3QU4A 4K9LA 5F1PA 2WPDD 3MCUA 3PQ4A 1LBEA 1QVAA 1CDDA 3HP1A 4BTEA 4FMBB 4BJ5A 1TT7A 4ZAWA 1EUDB 3AV0B 4D74A 2IUTA 4HAXA 1KARA 1FDUA 1PJLA 4HB0A 1C3OB 4I55A 1ZW1A 4E09A 1N0VC 2J0UA 1BCSA 4GRAA 5FEUA 4DA0A 3VYUB 1DU4A 1E7QA 5BQ3A 1U2GC 4CU2A 4DZRA 3LPCA 5ADHA 2ZBVA 4EDFA 2PE5A 4WEOA 3M81A 1TTQB 2G1UA 3H2HA 4YN3A 1E64A 1J0XO 4NZNA 1RADA 3H0CA 5F78A 3VU9A 3KXPA 3WP0A 3GLIE 4TXNA 3TIFA 3U4MA 4BO3A 2BMFA 1NLYA 1W44A 4QYXA 1MO3A 4V3BA 4X94A 4AN0A 5JVDA 5CJPA 3L6CA 2VA9A 5ICGA 1OASA 2YIJA 2RG1A 4R2LA 1PAUA 3UUWA 4CNBA 4A2CA 4C0XA 3HM9A 1ID8A 3G0HA 2VPPA 2X1HA 3NBXX 3FZNA 1SO8A 1DDIA 1HDIA 1EUZA 1KJQA 3BIWA 1F0KA 1GPUA 3VI4B 5LLTA 2BGGA 1GGVA 2ZUEA 5CLGA 2I4IA 2J85A 2CN1A 1M7BA 2B9EA 2A5GA 5FOSA 1EFRD 3TGLA 1SNYA 1V4NA 3JQ8A 3OZRA 2I2WA 5CA0A 4XVCA 1QHEA 3SHQA 1J06A 1FFCA 2C9YA 2GEFA 3GB9A 4B83A 4BMZA 4BNIA 2D4HA 2QRZA 3FTNA 1X94A 4RMGA 2C4TA 4I5EA 1ONBA 3SLGA 4TLMB 5IFKA 4KXVA 2R6HA 4KQMA 3S29A 2GX6A 1VPWA 2Z2KA 3ZDBA 3A4YA 4JH0A 2QP4A 4TXLA 2F43A 2JAXA 2G7MC 3FNBA 2XUAA 1YZGA 1DLJA 2PY6A 4JJ7A 4XDYA 4L08A 1L4KA 5AT1A 3VC3A 2E18A 4S24A 2QLMA 3JSXA 4IFIA 5DSTA 3ZXXA 3ZKWB 3QVKA 4R98A 1AGRA 2G1PA 2H65A 3LCVB 4H3VA 2BCJQ 2QTVB 3H97A 3UWSA 3X1KA 5BYKA 4TKZA 4OLBA 3T7AA 3COSA 3QNUA 1JX6A 1SZCA 3V80A 3ZE9A 2F8MA 1JR2A 1MJHA 2NWQA 3U5ZB 2OBXA 4N18A 2B9VA 3CUKA 2G88A 4HJRA 4JJZA 1MDBA 1A77A 5DPMA 5K3CA 1XZNA 3QG5A 4RZ2A 2C8VA 2JFFA 3PA8A 5DV9A 1MT0A 1U99A 3KDPA 4OATA 4TV9B 1A8QA 2BH2A 3NALA 2LNDA 4ZT5A 5FTMA 4NIMA 5A7GA 3TPFA 4DEYA 3PUKA 4PAOA 2ZVPX 4PSUA 1CY7A 4RHYA 2QJOA 1JLLA 3BFXA 4H0CA 2Z8YA 3SE7A 4L9RA 3S28A 5HGXA 5LP1A 5JC1A 5IMSA 3JQAD 1RC0A 2V45A 4DXDA 4ZOLB 4BZQA 1UT6A 2FOXA 3MBKA 2D62A 1ZGCA 4YP0A 4QUHA 5H02A 4EY6A 1L4LA 3A3NA 4GPD1 2DQZA 3VX4A 2IS2A 2ZUBA 5H5JA 4OX9B 5C4IA 2ANCA 5A4MS 3HWSA 4DF3A 3CRQA 1QIMA 1PS9A 2XUQA 4H6WA 1HG0A 2ZSFA 1M6VB 2WTAA 3FKQA 3QYPA 4PZCA 3UJAA 2FDRA 4JOBA 4WL0A 3ESYA 2XSZD 3LNTA 5E1BA 4OQ4A 5I5EA 3AM1A 4M8NE 5KYWB 3D31A 1M0TA 1JT2A 3H11A 5GV8A 2BFEB 1YWGO 2VYVA 3UGKA 5I7HA 2XWQA 1HNNA 3BXGA 3GRYA 2BTQA 4QGAA 1ZR4A 4JB3A 1WCIA 5FQNA 4MRVA 1RKXA 3EPJA 3FYUC 3WL6A 3CCFA 3TM5A 4D43A 4ZMRA 1E2PA 2OE2A 1KI7A 3I1IA 4ZTZB 2IYNA 4PCLA 3PA6A 1QPGA 2R86A 4BKMA 1ZK0A 1E2FA 4FGSA 1FSSA 5I6DA 3W4JA 3QPBA 5ES4B 5JXJA 2Q4DA 3B53X 2I3BA 3IIJA 5UKDA 4NCIA 4XVRA 4AQDA 3I1JA 2C1ZA 2PRIA 3AR4A 3N8IA 5AKYA 1ZDMA 5DX0A 3E82A 1SKAA 2O2SA 2GJ8A 3DE2X 3OLZA 2WPDA 1BS9A 1V8PA 4JBYA 4MNTA 1UZUA 5ECDA 4PTYA 2B35A 3HSYA 3F4KA 5CX1A 4FWTA 1KIMA 1UJ6A 1GQSA 2P9TA 4IHKA 4O0LA 4FFDA 1XG5A 4NEQA 3UWMA 3UIEA 5DI3B 3UAYA 5GOTA 1YVEI 2ONJA 1HE1C 2E7ZA 1OC2A 4GD3Q 3TR5A 1J1IA 4PBSA 3UBTA 2NXNA 3QU5A 2TMDA 3IMKA 3LECA 1QIGA 4CV2A 3JWJA 3R5HA 1XHLA 4OBEA 2C42A 4LYJA 1ZA2A 5KINB 3AF0A 1XPJA 4DPMA 5A03A 1OB5A 5F7XA 2ZCVA 4NR0A 1BROA 1NAHA 4WMLA 4RYLA 2VJNA 3Q85A 1Y1PA 5BPHA 4DCNA 3NDJA 1ENPA 1XZGA 2GBGA 1WPQA 2EKQA 1YQTA 4M60A 2QGZA 3KQNA 5G02A 2IZ7A 1MHTA 3NUZA 3HG7A 2Q2WA 1ZM2A 2P62A 3HVJA 4YRIA 1KJIA 4K3UA 4NOKA 3GA0A 5FEMA 3U26A 3GBPA 1MNAA 1EFRA 4X7PA 2NN3C 3L8DA 5CA1A 2BEUB 3R77A 2GAOA 1RI1A 4X61A 5HG0A 5TVKA 3A28A 5ALMA 2IEDA 4JEUA 3BHMA 3WHKA 1DKMA 1ZHHA 2OA0A 5I8PA 3KR2A 1FA9A 3VNAA 2EBFX 2QRQA 4I81A 4LUCA 2EKDA 2O8NA 3C6KA 3FCSB 3L8CA 3C3PA 1ECLA 4LN1A 5KNCH 3DFIA 1XWIA 1Z5GA 3IBTA 2IH2A 3DHVA 2GGSA 1D2AA 2UZAA 2XTNA 3A04A 2ZIZA 2AFVA 5DNUA 3MT0A 4G0PA 2IFTA 3GYGA 5IXYA 3DBVO 2H4YA 3BBPA 4X6UA 4PF1A 3A9CA 3AR7A 1KY3A 2PK3A 4RZIA 3OX1A 4XM2A 4JLJA 3AESA 4UHCA 5JADA 4J4BA 2H2AA 1TUIA 2GBPA 1YQQA 3KFVA 4R31A 3JU3A 3IUQA 3B85A 4C6SA 1X19A 3FBTA 3TTWA 1CNEA 3WOHA 4ESHA 1R16A 1V2GA 2M32A 1G7RA 1T2DA 3OZBA 4H4CA 3KFLA 3O3OB 3PHGA 4GPIB