3BHMA

Crystal structure of human carbonyl reductase 1 in complex with s-hydroxymethylglutathione
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
274
structure length
274
Chain Sequence
GIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human carbonyl reductase 1 is an s-nitrosoglutathione reductase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Carbonyl reductase [NADPH] 1
total genus 105
structure length 274
sequence length 274
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2007-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bhmA00
2EW2A 4UUPA 4AJNA 1JAYA 2UV8A 2YHUA 5A9SA 3A06A 3IJRA 4R41A 2BRUA 3O26A 3H9UA 3QVOA 2NACA 4NI5A 3KBOA 1SB8A 1ZEJA 2JFGA 2NLOA 1ZMOA 1U2DA 4WE3A 1GQQA 4IGEA 3FF4A 3QVXA 3CH6A 3FBGA 4W4TA 1P77A 2GRAA 5TC4A 2AEFA 3DL2A 4RVSA 4CM6A 4KQXA 4XRRA 1QG6A 2B69A 1L7EA 4YT5A 1UXGA 3KUXA 3IP3A 1KC3A 1QLHA 1YB5A 1HDZA 4LMRA 4BNYA 1LNQA 1FDWA 1KEWA 1JN0A 3F46A 4H15A 3EMKA 4OSOA 3PHHA 4J4BA 1NHGA 4L76A 3DBLA 2I9PA 4XKJA 1M6HA 2E4AA 4UVGA 4BMSA 3LU1A 1ENZA 1WXDA 4Q3BA 4YJDA 4ZVVA 4BS9A 3MJ4A 4E12A 1DFIA 1VL6A 2DVMA 1XGKA 4KP7A 4OAQA 4ND4A 4CR8A 1X15A 2UUOA 3PYXA 2DPHA 2X5OA 3TL2A 1MG0A 1YWGO 1VI2A 5F3RA 2GPTA 3TZQA 3DMTC 4OH1A 2NWQA 3IMFA 3QW2A 3H9GA 2GN4A 3EGOA 3W8FA 5K6AA 4MP3A 3W6ZA 4AJHA 1A9YA 3L6EA 2X9VA 2ZB4A 1EK5A 3WXBA 5A04A 1OMOA 2RCYA 3QWAA 2W8ZA 3AY3A 1XQ1A 2WDZA 1YBVA 3KXDA 2VRCD 1BW9B 2ZIZA 3WGZA 3HUDA 8LDHA 5EINA 3BMCB 3DZIA 3RU7A 1E1MA 1U8XX 4EUEA 4EYEA 4AVYA 1WP4A 1Y8RA 4ALKA 4UVEA 1GAEO 3L0DA 1R4MA 1ADCA 3GEDA 2X0JA 1EBFA 1WMBA 1K3TA 5T5QA 1GYQA 4L75A 4PLGA 1OFGA 2B36A 4AL4A 1GU7A 4O1MA 2CUKA 1GD1O 1DHTA 1LI4A 2BFOA 3JQ8B 3EVNA 4I5FA 3KETA 5GZ1A 3MCVA 1DAOA 1P9LA 5JAQA 4R3NA 3AU9A 4PG6A 1U28A 1GCOA 3IQDB 2PH3A 1M2WA 1A9ZA 4HX5A 4TZTA 3K96A 2HJRA 4RF3A 2B4TO 3ASVA 4IQGA 3VZPA 2CF6A 2DQ4A 1R66A 4JGBA 1ZMTA 4J9VA 3LF1A 2VTEA 3GRPA 2A94A 4FJ1A 5DP2A 1V3UA 3RUIA 3GAZA 2GSDA 3JYLA 3Q2IA 1Y9EA 5A9TA 1JU9A 5TSDA 5ICMA 5JCXA 5JAMA 5JAZA 2C07A 1ZFNA 5L4LA 3ITDA 5C7IO 1JWAB 3JQAB 3OIDA 3OQ1A 4QFDA 1VPDA 9LDTA 3DTYA 3QE3A 3ZH2A 1GZ6A 4C4OA 4DBVO 4E4YA 3L4SO 4LGVA 1RM5A 2EV9A 2B0JA 4RZIA 2SCUA 3JV7A 5I9LA 1ZNQO 4KTTE 3PQFA 5A3VA 3Q6IA 3LZ6A 5F1KA 2FY8A 3IUPA 5CAEA 3BHMA 4ZD6A 1PX0A 3NT5A 5IN4A 4FN4A 4ZQGA 3EUWA 4R9SA 4Z9YA 1XR3A 5BT9A 2IZ0A 5JYEA 2I5PO 5L4SA 1Q0HA 1LC3A 4B4WA 4TZKA 1YJ8A 1DAPA 1X7GA 4CMBA 3JSAA 4Q3DA 2PGDA 1NR1A 4YT2A 1A7AA 4LSMA 4OQYA 1YBMA 3KRTA 5C7LO 5B4VA 3WDSA 5COBA 4LK3A 3TFOA 2B4QA 4ND1A 3GVHA 4GWGA 3ZHXA 3FNHA 3ICPA 1JWBB 2R00A 4J6FA 3VZSA 3DB2A 4BUCA 4D79A 2Q46A 4A5OA 2EHDA 3WIEA 4B8WA 4NK5A 5G4KA 3DFUA 5AXCA 3E5RA 1CQIA 1PL6A 1Z45A 5U4QA 1NBOA 3TOXA 3ONDA 3PFFA 2W2LD 1LEHA 3H2SA 3RUHA 4BO6A 3X2EA 2OORA 3F6YA 4KUEA 1PTJA 1PJQA 4W82A 2IZ1A 1LQUA 2NU6A 4UEJA 4YTEA 5FFFA 1R37A 4QECA 3DOCA 3DAPA 4I5EA 4MKRA 2Z5LA 2VZ9A 2ZTUA 1PJLA 4AJJA 4B79A 3RVDA 4YAKA 1XG5A 2ET6A 3PGJA 1MLDA 2XPCA 3PYLA 3I5MA 3QY9A 4ZQHA 1AHHA 2O3TA 3OEWA 4MIOA 2ZYAA 2B5VA 1Z75A 1YVEI 2HK7A 5IFLA 1NFFA 1F8FA 4LRSB 5IZCA 4E5YA 2OZPA 2J6IA 1SNYA 3PIDA 4YXFA 3JQ9A 5L45A 2R6JA 3ZCXA 4E21A 2BFPA 4RQUA 1IHXA 2C2XA 3GT0A 4PLHA 3I6IA 5B4TA 5JMWA 2NU7A 4TWRA 3GG2A 1X13A 3I4FA 2OFPA 1A71A 4Z6KA 3CUKA 5HBRA 3VPFA 4PRKA 3SX2A 1K2WA 4XR9A 3R6DA 4PN3A 3INRA 3TZCA 1H94A 3UGKA 4I5DA 3WYBA 3DHNA 2J3KA 3ASUA 4G65A 1W4ZA 4NHEA 3CMCO 5T57A 5CDYA 4GX2A 3C1AA 4CODB 4B4UA 4AJ4A 3GGPA 3INGA 2Q1SA 1PIWA 4IM7A 1FF9A 3G79A 4XEHA 1H2HA 1QORA 2DBVO 3U4CA 1E7QA 3BTSA 3IJPA 4U0JA 4GX1A 2O3JA 3DBLB 5A03A 2CSUA 2WD7B 1U5CA 3UCEA 3KLPX 5HS4A 4TQGA 1N2SA 4IDGA 2VHZA 4NFHA 3RSHA 1EQUA 4F6CA 1SC6A 5DDIP 1IL0A 3VAZA 1ISJA 3AW9A 3ZZNA 3BHJA 5JDCA 5EQDA 1YL6A 4RPLA 5F5NA 1YE3A 2YV2A 1NQOA 2JJYA 2O4UX 4YACA 4BGIA 1VL8A 3ZNOA 2D4AA 2YJZA 3S2GA 1NP3A 2VOJA 4E5PA 4KOAA 1T2FA 3JTMA 1PQUA 2DBQA 3JYOA 3JQFC 3ZDFA 2GCGA 2GN6A 1N1EA 2Q1TA 5CDGA 4J16A 1E3EA 1R4NA 5A5FA 3K9QO 1X0VA 2G5CA 4QO7A 3P19A 4AJLA 1ISHA 3OEYA 3JQBC 1X7DA 4J7UA 3GEGA 4DQUA 4M89A 3ZWBA 3MJSA 3ANLA 5IXSA 5CPBA 4AJIA 5L40A 3OIFA 4EEXA 1PGPA 3OP4A 2XOXA 4E0BA 5BQFA 5K9ZA 4DPKA 4DTIA 2GD1O 1BMDA 4E5MA 3H5RA 4CM9A 4UUMA 2EG9A 1VKOA 1I2CA 3DC2A 2QRLA 4IINA 2X1HA 5KKCA 4D3SA 1QMGA 1L1FA 1O9BA 2QIOA 3T4XA 3ZU4A 1Z6ZA 3F47A 1H6BA 1P45A 1Z7EA 3U4HA 2ZB7A 4UVDA 3VC7A 4RPGA 3VPHA 3KSDO 2FSSA 4RL6A 3BTVA 4PGFA 1H6AA 5TX7A 4NZ9A 3P5SA 4W7HA 2EIHA 2X5KO 1QR6A 1ZSYA 5C7OO 1R0LA 3NEPX 2HLPA 3VPGA 4BO1A 2XAAA 4WK6A 5KVCA 2Y0EA 1OBFO 1N5DA 2OHXA 5DCYA 5COQA 5EERA 2P4HX 2I99A 4PRLA 4HBGA 3VPSA 2BHLA 1C0IA 3OJ0A 1E3JA 3TN7A 4D43A 1ULUA 3C7CB 2X5JO 1B15A 1DEHA 1YOVB 1UXIA 3NAQA 3C7DB 5L7YA 5TJ9A 5JCJD 2VRBA 1P44A 1JQBA 1RPNA 3ZWXA 4ITUA 2FR1A 2IXAA 4E2XA 4E2WA 3CKYA 2PD4A 3WICA 1PL8A 2ZATA 2B4RO 4CLOB 2WEKA 4J4HA 4CV3A 1Y8RB 5JO9A 3F1LA 2WYWA 4XGKA 2IODA 3RAJA 3WGOA 4GI2A 4AJPA 5IJZA 3K73O 3LDHA 4ZGWA 1NVGA 4IXTA 5CDTA 1JVBA 1DJQA 4F46A 3WLEA 4BKUA 2VHVA 2Q50A 1E0DA 1E1KA 1F06A 2HQ1A 1S6YA 2D5CA 5DN9A 4WCFA 1IE3A 3TL3A 3FSRA 3WGTA 3VH1A 3A1NA 5EMHA 1NAHA 3EW7A 4R51A 2Y0CA 3W8EA 4MVJA 3UCXA 3NKLA 5H81A 1LTHR 3O03A 3AM5A 4JLWA 3VPXA 2IDZA 4O5OA 4BQPA 3ST7A 1VM6A 3ONFA 3LVFO 1RKXA 2OXIA 3HFSA 4EI2A 4CMAA 1DC6A 4NMHA 4D0SA 2UYYA 1E1LA 1PSDA 1KEPA 4D3FA 5AYVA 4JBHA 1NWHA 4RF5A 2EP7A 1TT5B 4IPTA 1ISGA 3MEQA 4J1SA 2WSBA 1TA4A 1BXKA 4J9UE 2GN9A 2E49A 2P5YA 1QYDA 1K6IA 1K5HA 1UAYA 2YW9A 2A35A 4E13A 2BGMA 4ND3A 3UFXA 1GUFA 3O8QA 5EPOA 5AVOA 2PY6A 3GPIA 5FI3A 3UHAA 3GUCA 2BD0A 4P38A 3ZU2A 1IZ0A 3S55A 3DQPA 1U3TA 3FI9A 4FC7A 4CMIB 1YRLA 4LN1A 4CV2A 3PJDA 3EDMA 4RDHA 4XZ3A 4GLLA 1ZK0A 2D1YA 4Q3EA 1Q0QA 1IUKA 5LCXA 2YV3A 3ZWCA 2POQX 2EKLA 2P91A 2LDXA 3KSUA 4RVHA 4ALLA 4HUJA 2P9CA 4XIJA 4R54A 4DIOA 3JQ9C 2FP4A 2ZQZA 3VZQA 2G82A 2LDBA 3D0OA 4MVJH 1BG6A 4YJHB 5A06A 4I1IA 5ENDA 3HHPA 1J5PA 4Z9XA 1LLUA 3ENKA 4RV9A 1DDOA 3WGHA 3DHEA 2Q1UA 3AY6A 1Q7GA 4JXKA 4AFNA 4BO2A 3G3EA 1QKIA 1UH5A 1HYEA 2HU2A 1GZ3A 3V2GA 3VDRA 1HF3A 3ROPA 3N74A 4J0FA 3H65A 2DTXA 4Q3NA 3RBXA 4R68A 1N7HA 4B3HA 3MZ0A 4LW8A 3V1TC 2VWQA 1E6UA 1DBVO 4BKPA 3RC1A 2HAEA 1G0NA 4A73A 4Z9FA 4MP8A 3AK4A 4FCCA 1QYVA 1ZIDA 4QTZA 1U4SA 4RVDA 1UP4A 1X7HA 4NG5A 2EGHA 1MGOA 1UZLA 3BMCA 1U3UA 1JKJA 1UP6A 3DOJA 5JO0A 5G0VA 4RF2A 1QV7A 1TT7A 4GL4A 4DA9A 2EGGA 1EBUA 4NQZA 1H9BA 2FWMX 1DFHA 4I5GA 1HXHA 2YDXA 5TQVA 1LDBA 3LLVA 3WS7A 3ZW9A 2CVZA 1ONOA 4BNUA 3D3WA 4O63O 2RHCA 1QV6A 4NBWA 1VSVA 4HFMA 4YAEA 4WGGA 4PLZA 4BO9A 4ZHSA 3ADOA 2NNLD 3QWBA 5JAIA 3QQPA 1WDMA 1CETA 1HEUA 1AE1A 3KO8A 5ILGA 2JCVA 2BI8A 1WWKA 2OGUA 3H5NA 1BTOA 1M75A 3AI3A 3G1TA 3GRKA 1W6UA 4IZHA 1HDYA 3C1OA 5ES3A 4R69A 3RASA 1ZUD1 3AOGA 2J3HA 3LC1O 3OJEA 1KIFA 4FC6A 4GWKA 4RGBA 4X54A 5G0TA 5I8ZA 1EE9A 1P33A 2P9GA 4NR0A 1Y81A 1YKFA 1MV8A 5L4NA 4QQRA 1QSGA 2H5LA 1U7HA 5B12A 5KWEA 4YT8A 4GBJA 2O3UA 4FDAA 4K6FA 1YONA 5GY7A 3AJRA 1AN9A 2ZCUA 7ADHA 4BNMA 1LDMA 3GOHA 4I9UA 1YQXA 3NTRA 3JQBA 3F4LA 3VH4A 4C7JA 4BO5A 1UUFA 4ALJA 3OJOA 4NU5A 4XYMA 3OMLA 4J2OA 1IY8A 5CFZA 1IHYA 3JYNA 4FD3A 4OXYA 1YGYA 1U5AA 1E6WA 4TRRA 2WE8A 3OJFA 4OKIA 3B70A 4HFRA 3AUTA 4CM4A 4E33A 3QWHA 3ZV5A 1ZW1A 4RVUA 2HRZA 4PVCA 3DMTA 4J1NA 5DOZA 3DFZA 3AI2A 5CPFA 4FBGA 1HZJA 3FTNA 4IJKA 1SO8A 4IDCA 1VL0A 3DEYX 1C0KA 2ZK7A 3CIFA 3LYLA 4NU6A 1U7TA 5HRUA 2Y1GA 4XJTA 2JD0A 1WLYA 2EWMA 3U09A 1MXHA 4KUHA 1OC2A 3U0BA 4CQMB 1V6AA 4UAGA 1HDRA 1PJTA 3AFNA 4ALIA 1G1AA 3PZRA 5I7VA 2QX7A 1B26A 3CZRA 4CLOA 1CRWG 3QVSA 1RYDA 4K26A 2WD7A 4XYEA 4R5HA 3TZHA 4CM1A 3KZVA 3H9JA 1NX6A 1R6DA 3V1YA 2PWZA 4CM5A 1GL3A 1UDCA 2H6EA 4PLPA 5JLAA 1IOLA 3TRIA 3VH2A 5JYDA 3KYCA 3O38A 2D2IA 1SCUA 1UXJA 2AG8A 2HUNA 3HN2A 4JJFA 1Y1PA 1YDEA 3I9KA 2EF1A 3L6DA 1GV0A 4J91A 5G4LA 2AQ8A 4M49A 5IDXA 4EITA 4CLDA 1CERA 4WLEA 3RUEA 3MWEB 4DIFA 1LRKA 4NFYA 3N7UA 1T2AA 2DUUA 3JQ7B 1FDTA 3I9JA 3W8DA 3NUGA 3B1FA 1EQ2A 2DBRA 1R0SA 1V35A 4BNIA 1HDGO 3HFGA 1NNUA 4D42A 3AUSA 3Q3CA 3DDNA 1ZJYA 5F1PA 3G1UA 2NTJA 4Z0HO 4PLYA 4CMEA 3KOUA 4KDFA 4XCVA 3K2EA 2DT5A 3H9EO 5HTOA 4GSKA 5C5IA 5IG2A 3SVTA 4MDHA 4MVJG 4RLHA 3W4IA 3IKVA 2D5AA 5FI5A 5L53A 1P1IA 5U1PA 4HNHA 5CEJA 1MX3A 2NM0A 3IOYA 1PR3A 5JS6A 1PZGA 1FMCA 4DMLA 3PXXA 4Y6RA 1R15A 4XQEA 2X8LA 2QYTA 3Q11A 4HKTA 5DBIA 4TROA 3I9LA 4PZEA 1GY8A 1NQ5A 3R3SA 1Q7CA 4JQCA 4WJZA 1D7OA 1BDBA 1YBAA 3M1LA 4RF4A 4E30A 1B16A 5L9AA 5G0UA 3PWSA 4CL8A 3PP8A 4DPLA 2EKPA 3ANMA 2XF8A 3KYDB 3RIHA 2DLDA 2G17A 3OHSX 4YAJA 1UXKA 1IPFA 4GKVA 3PJEA 2EJVA 3E5MA 3CPSA 1DIHA 3HDJA 4GGPA 3NGXA 3ZW8A 1R4NB 4ZQBA 1QYWA 3SLKA 5KNLA 4U6QA 3ROQA 4HWKA 5TLSA 5DBFA 4YRBA 2A92A 2GN8A 1T4BA 3ETDA 4NDNE 1D1TA 3LLSA 4LMPA 3OBBA 2VWGA 1P1FA 4XR4A 4FFOA 4ZQEA 1KVSA 2DFDA 1ORRA 3PI7A 1U3WA 1T2EA 3GH3A 1DIBA 5B37A 2C7VA 2UDPA 2VTDA 4YA6A 1W8DA 1HT0A 2WYUA 4TVOA 3BMOB 1V8BA 4ZN6A 3NYWA 1YQDA 4GPD1 3U49A 3ROMA 3M2PA 3UICA 4IDBA 3D4NA 3GVCA 4AJEA 4DVJA 2Y68A 1FDVA 3KM0A 3IC5A 2BF7A 2C0CA 4B3JA 2F00A 2GNAA 1XSEA 3HSKA 4J7CA 2DPGA 4INAA 1YO6A 4RVGA 5IDWA 2ZTLA 2Q2WA 4AJKA 1DO8A 2PV7A 4L0QA 1G0OA 2X58A 4R5MA 4XGIA 3VKVA 4BGUA 1A7KA 2HJSA 3OFSA 3WBBA 1YJQA 4L73A 3G49A 2VYVA 3OICA 4R3WA 2C54A 1ZSVA 3KEOA 2PNFA 1ONNA 4XJSA 3LC2O 3VOSA 5A1TA 3NT2A 3PVZA 4IIUA 4E6PA 4YR9A 1JKIA 2IE0A 4DREA 2VUSA 3E9QA 3DZJA 3ULKA 4J49A 2A4KA 2C20A 2EKQA 3PQEA 4YQZA 1VLLA 2GZ3A 1PGJA 2QHXA 1NWCA 3GY0A 4FSHA 2Q45A 5GMOA 3MJCA 4QT0A 3TNLA 4CV0A 1PJ4A 1C1XB 1HDXA 1GYRA 1Y6JA 1DFGA 1GADO 1NPDA 5TS3A 2GYYA 1DC3A 3PLRA 2EW8A 2V6GA 1U4OA 1OI7A 3EY4A 2O2SA 2G1UA 2I65A 2W2KA 1DPGA 2FZWA 3GR6A 4HXYA 3W4KA 3S2FA 3DOOA 2C5AA 3MJVA 2DC1A 4OKNA 4DBZA 4JJGA 1ZCJA 1O5IA 3WTBA 2WTBA 1UDBA 2BFAA 4RPHA 2H1SA 1PJCA 2HMWA 4AICA 3PQDA 3E48A 4AJ1A 2Q3EA 2YDYA 4BKOA 2CMDA 3BAZA 3BYZA 1H2BA 1UDAA 2WWRA 4CLEA 5AXDA 4LVCA 4E2ZA 3C7AA 3H8VA 1VJ0A 2DTDA 3PHJA 5TT1A 4XYGA 1J4AA 5A4DA 1EUDA 2Y1CA 2PZJA 1XQ6A 5JCJA 3LT4A 1EFLA 1ZSNA 3G0OA 2QZZA 4IY1A 4CMEC 5ADHA 2XXJA 1YXMA 3D3WB 4XDZA 5KVSA 1BW9A 4KWIA 2O2YA 1LSJA 2W98A 3I83A 4FW8A 1BWSA 1I2BA 4WLUA 3RC2A 1R4MB 4WNIA 4OMUA 1I30A 3E6AA 1LDEA 3Q1LA 4E32A 2VT2A 1BXGB 1DXYA 1F14A 1JTVA 2FHSA 2NVBA 2AEJA 3BMNB 4J90A 5KKAA 3U62A 1Z82A 2P4QA 4ZA2A 3C8MA 1QYCA 4WOJA 2B35A 1MFPA 2HDHA 1T2DA 1QRRA 4TVBA 4QFCA 4Y9DA 5EN4A 2C82A 3KV3O 3QHAA 2AQKA 1HLDA 3QVTA 1MUUA 4Z0PA 2Z1NA 1NPTO 1YQGA 3ETGA 1LRLA 2PZLA 3QVWA 4MVJD 4BO0A 3DAFA 4R1NA 2NVUB 3ZWWA 3EZYA 4YBZA 1ISIA 1E3WB 4J1TA 1ULSA 4XDYA 4ILKA 5BSHA 3VVCA 1SB9A 4H16A 1JAXA 4EZBA 4WASA 3U3XA 1A4UA 4EW6A 2FPPA 1EUZA 4IQ8A 1B3RA 3JYQA 3ORFA 4OM8A 4DC1A 5JXWA 2RBEA 5KJ6A 4RJTA 3DBVO 3PHLA 2BGLA 4FJ2A 1WVGA 2PGLA 2BI7A 5TGDA 4B8ZA 3WYCA 3JD1A 4K1LA 3AWDA 4BMVA 4ID9A 1JKFA 1LSSA 4N54A 4B4OA 3JQ7A 4IDDA 4DMMA 1HL3A 1LLDA 5HM8A 1MB4A 1PWZA 5K0ZA 3UW3A 4N5MA 2O7QA 1GDHA 2PH5A 1PQWA 4PZDA 2JHGA 3H5AA 1PGOA 3UXYA 2X0NA 4N7RA 4DQVA 1A4IA 1BSVA 1EEHA 1I8TA 3FN4A 3GNQA 3RCBA 1U9JA 1AUPA 4IMRA 2O48X 5CDSA 3AOEC 4CL3A 4MJLA 4PLFA 4U6SA 1N8KA 4XIYA 3TOZA 3RUFA 2V6MA 3NRCA 2ZJ1A 4GGOA 1PZHA 3CINA 2C29D 1CDOA 3NT4A 1ZJZA 1N9GB 4HV4A 4CMKA 2X0RA 2E82A 2VHXA 3VHRA 3VH3A 4M55A 3V5NA 5TF4A 3WNQA 2AMFA 4IS3A 3IP1A 2PZMA 3VVBA 3GG9A 1P0CA 4MKXA 3WIDA 1B8PA 4MPDA 4J3FA 4WECA 4UUNA 1R12A 3LF2A 1HYGA 1I10A 2G76A 3FPLA 3WFIA 1SEPA 3FR7A 2I3AA 4BQRA 5G0SA 4S1VA 4QXMA 3WJ7A 3E8XA 5AOVA 1K6JA 4O0LA 4J2HA 2OBNA 3JQCA 3GDGA 3ZWMA 4IMPA 1UXHA 1E6EA 4P8RA 1I5RA 3I3OA 1B3BA 5JDIC 2HMTA 5DOVA 3I23A 3JCZA 1O95A 5EL0A 1P31A 1ZH8A 2IZZA 3O4RA 4KQWA 4MVJF 1KVRA 2I6TA 4XQ9A 1ZKMA 3X2FA 3KEQA 4I9NA 2O23A 3NJ4A 3HNPA 3D64A 1U3VA 4PG4A 3WGGA 1I3LA 3PFWO 3PYMA 4R01A 4RZHA 1H6CA 3GEMA 3WQRA 1Z73A 2FOIA 1P0FA 4UVIA 1GPDG 4BV8A 3SEFA 1XU9A 4BVAA 3ZWOA 4YJFA 3TWOA 5LC1A 1DHRA 1GV1A 1UZMA 3T7CA 4GMGA 5BR7A 4FB5A 2AEMA 1KEVA 2Q49A 1ML3A 3WSVA 2GO1A 2BELA 4HADA 1T1SA 4NBUA 2FRDA 4YDRA 4RORA 3SXPA 4A26A 4B4VA 2ILTA 4LVUA 3GK3A 3T7EA 4JNKA 2P5UA 3ITKA 2VZ8A 4IJVA 1N9GA 1SOWA 2EP5A 4QEDA 2NTVA 4ZRMA 5IDYA 1ADGA 3R0IA 4PCVA 2DTEA 4RDIA 1RJWA 3IDSA 2Y99A 1BHSA 1GPJA 1Y8QB 2FPGA 3QIVA 4BNJA 1EE2A 3JQFA 4CMIA 2DKNA 1RWBA 2R00C 3AFMA 3LSYA 4GLOA 4O59O 4XB1A 3DBHB 3UH1A 1MC4A 1XIVA 5L3ZA 1EDOA 1S7CA 3D4PA 3WWYA 5L51A 1ZEMA 3PIIA 3OQ6A 4K9DA 4L4RA 1JW9B 3C24A 3PGXA 4E2YA 3I9MA 3FNFA 4WLOA 2J8ZA 4URFA 3C85A 2PK3A 2NVUA 4OXKA 3ZHYA 3U9LA 4RPJA 3GLQA 4YAIA 2HKIA 4D0RA 3LT2A 5JW6A 3FWZA 2IYPA 4KZPA 4EBFA 2CZCA 3EAGA 4EGFA 1HZZA 4RCVA 1VSUA 5A05A 2ZTVA 2GZ1A 3ZN2A 4WOKA 4DRYA 2VQ3A 1ENPA 3FNEA 4QX6A 3ABIA 3E9MA 4CMJA 5ICSA 1NFRA 1E3IA 4CQMD 3JQ8A 4DWVA 2CF5A 2P68A 4KWHA 2YQ4A 1X1EA 4BKQA 2PD6A 3MOGA 1V0JA 4XA8A 3E82A 4BB5A 2X9NA 1ISFA 5BSGA 3M1AA 1XDWA 1C3VA 3DMYA 5THQA 3A4VA 1LX6A 3GN2A 2X6TA 3PEFA 1SBYA 4A0SA 2A9FA 2GERA 2YY7A 4YQYA 1Z74A 1L7DA 4LISA 1AHIA 2HK8A 2TMDA 2VN8A 2AHRA 3A14A 3LK7A 3Q9UA 4NJOA 3TZ6A 4E3ZA 3JQGA 3VZRA 4YJHA 1T24A 2DFVA 3V1UA 4BNFA 2BLLA 4JX8A 3BTUA 3FCOA 4YYZA 5BNIA 4BNVA 3Q0EA 4M86A 4FFLA 2NADA 4ND5A 2VUUA 1W73A 1NYTA 4MIEA 1IPEA 2C7GA 4M1QA 1J6UA 2J3JA 4QUKA 2VWPA 1IYZA 4YRDA 2VYVD 2AA3A 1XCBA 2I67A 2C5EA 4ROSA 3F1KA 3QJ5A 1HWYA 3PDUA 3IS3A 4EUHA 6LDHA 2GZ2A 3BMQA 3AUUA 1K6XA 4PLCA 1HSZA 2J3IA 3GUYA 4CLRA 4DYVA 4F3YA 1M66A 2PKRA 1DRWA 1PQPA 1PEDA 5MGBA 3GPDG 3DTTA 2W2KB 4JBGA 5ER6A 2UAGA 3U4DA 3CSDA 4CMGA 2DUWA 3W4JA 2AQIA 2CFCA 4JP2A 1SOVA 4MINA 5IN5A 2Q4BA 2NTNA 2QQ5A 2GGSA 1MA0A 3FTPA 3BXXA 2FPIA 1D1SA 4W9NC 2J5KA 1LBEA 1DLJA 2G0TA 1NR7A 2GDZA 1C1DA 4I8XA 4R16A 4WLNA 1VC2A 1YL5A 3BZUA 5JPIA 1T26A 5C3MA 3GMSA 2ZB3A 4ZICA 3JQDA 2Y05A 4P4LA 1NM5A 2QW8A 5JY6A 3GN1A 1DIGA 3B1JA 3VTFA 3D5TA 2H63A 2Y0DA 1PGNA 2PR2A 1LC0A 4FJ0A 4BV9A 4WKGA 4RQTA 3K31A 4D3DA 2VT3A 5MDHA 5EQFA 4JIGA 3BTOA 5FYDA 5FWNA 3WJAA 4YEDA 3GAFA 3HADA 3DWFA 3JD4A 1Q2XA 1VRWA 5CEFA 4NBVA 4B7XA 3DZHA 1DC5A 4G2NA 1HE5A 4LCEA 3HN7A 1Q1NA 1VJ1A 3F5SA 1EK6A 4BL5A 3IKTA 1O0SA 4BO8A 1O6ZA 4FR5A 1JDJA 1N92A 4MKZA 4DUPA 2IEDA 4A2CA 3PRJA 2UVDA 1E3LA 2YFHA 1PU2A 5EJ2A 2X86A 4MVJM 1ZVMA 2FMUA 3FRJA 4G5HA 5KTKA 4BO4A 3S1LA 4XB2A 3PZBA 1ZK4A 2VZ0A 3F9IA 1F8GA 1ADFA 1MXFA 3G17A 4PG5A 4CQMA 4CUKA 4BKRA 1ARZA 4XX0A 4NPCA 2VWHA 1DIAA 1PZEA 1XWFA 2NU9A 4KDEA 1C1DB 3B20A 4WCDA 1HDOA 4IJUA 3LQFA 4BNWA 5B4UA 3PWZA 5JFOA 4N18A 3GHHA 1DRUA 3V2UA 2YHIB 1R16A 4UREA 3R1IA 1W0CA 3GDFA 5TJHA 4DIBA 1P74A 4F6LA 4OJNA 1Y7TA 9LDBA 4EJMA 2BGKA 1FXSA 3RWBA 3PDJA 5EIOA 2FR0A 1JLLA 4YJGA 1ZK2A 2JAPA 1J0XO 3LC7O 4HP8A 1QLJA 3IUSA 4XYBA 3I9OA 4MOWA 5BSEA 3GZNB 3RUAA 3L9WA 1B14A 1HYHA 4ONEA 5T8KA 1AGNA 3GHYA 3RJ9A 3DZKA 1PJ3A 3FBTA 5JSFA 4OHUA 1MP0A 2EJWA 4KTVE 1LQTA 5L7WA 4D44A 1YS4A 4ZRNA 1E3SA 2QYSA 2IXBA 4FGSA 1KBZA 5GZ6A 4A27A 3GC6A 4J4TA 2BFMA 3ZHZA 4PG8A 3FNGA 4M87A 4RLSA 3UKOA 5A3JA 3NDRA 2OP0A 2X22A 2HCTA 4U8GA 5U9CA 4LCJA 1UP7A 3CZMA 4Y98A 3VDQA 5I9MA 3WB9A 1NASA 3UCFA 5TT0A 3PHIA 3DR3A 1GQYA 2PZKA 4IIVA 4OXNA 1DC4A 3SBOA 3RUDA 5DBGA 4DPMA 4RVFA 3HDQA 3OETA 4AG3A 4BNHA 3KYDA 3GFGA 1KC1A 1LSUA 1O89A 1WW8A 1KVUA 4D41A 5CDUA 4WEQA 3DXFA 3RFTA 1LSOA 3TJRA 1NVMB 1ONPA 4P22A 4YAGA 2F1KA 2X4GA 5A5EA 2DM6A 3TF5A 1EVZA 2FSVA 4MVJE 4YRAA 2HMSA 4J0EA 1TB4A 3W6UA 4LSWA 3TSCA 1TI7A 4OO3A 5LDGA 3I9NA 4EJ6A 3DHYA 5H83A 4UVHA 4OL9A 3E1KA 3AU8A 1E92A 3HG7A 4EUFA 5COAA 2ZTMA 3GVIA 4R1TA 4CJXA 4CQLB 2JCXA 1PJBA 5JC1A 2B5WA 4F45A 1B8VA 3S2EA 4IXWA 4ESOA 1MG5A 2DAPA 3HJAA 4FFMA 4IGFA 1HSOA 5JY1A 3ZWYA 2P9EA 4BGEA 1GUYA 5CP8A 2X23A 4FFNA 3VKUA 3EYWA 3RBVA 1KY5A 4U0KA 1XLTA 3IAHA 1LLCA 4GX5A 4UULA 4OOFA 5KJCA 1TEHA 1CF2O 1I33A 2OP1A 3ZNNA 4N5NA 1WPQA 3RJ5A 5KVVA 1CJCA 3UVEA 2VNSA 3DONA 3Q9NA 4A7PA 2Y1DA 4OIMA 1IZ9A 3E9NA 3BHIA 3DAGA 3KYCB 1LDGA 3GGGA 4PZCA 2CDBA 4BNNA 4KUGA 2EERA 3JD2A 3RC7A 3EC7A 4M54A 1FDSA 1T25A 1GTMA 2VHWA 4FGWA 3AUAA 1GYPA 3I1JA 3S8MA 4XGNA 2PLAA 1FJHA 1NPYA 1PS9A 1HE4A 2OMEA 3DZFA 1ZBQA 2D0IA 2JD1A 1XKQA 1ZXBA 2JL1A 2Q1WA 4WUVA 4P4NA 3WNVA 3AI1A 1D3AA 1EMDA 2W4QA 2XXBA 4Q9NA 2AXQA 2VYND 2DBZA 3COSA 2ZQYA 3WOHA 4II3A 3OA0A 4M8SA 2Y67A 3AM3A 1X1TA 5IZCC 3OF2A 4R4JA 1EZ4A 1TLTA 2Z1MA 3KB6A 3EZLA 4CV1A 4DQXA 3ANNA 4GMFA 4YPOA 3GVPA 3WFJA 1GCUA 4XYLA 1YB4A 1MC5A 4UEKA 1EUCA 2QRKA 3UF0A 4A03A 3ZGYA 2E48A 1KVTA 2VRCA 4K6CA 5TRTA 1KVQA 4AJ2A 3ZV3A 5K6AC 1T2CA 3UAGA 1GQ2A 3GF4A 3WGYA 3NJ8A 4W9NA 5I7SA 3RFXA 2X9GA 3H2ZA 1A72A 3AM4A 2JHFA 3OQBA 2GR9A 5T64A 2VCYA 3WX0A 2BKAA 3QWIA 3HDHA 2WMDA 5DCWA 3D3EA 5HS6A 2VOEA 4CUZA 2O50A 4ALMA 3K6JA 1OAAA 1M67A 4H7PA 2RAFA 1YOVA 3ZWAA 1PJSA 3KYBA 1H5QA 3CTMA 1YDWA 2D59A 2IEBA 4EJ0A 4NIMA 4JP3A 4I08A 1SMKA 3HDYA 4Q39A 4YCAA 5JNLA 1B7GO 5ILOA 1D4FA 1DOHA 4H3VA 3A28A 2I66A 1KYQA 4DC0A 3OIGA 3U4IA 1ISMA 4FFRA 4NBTA 1E7SA 1P3DA 1O8CA 5HWSA 4JBIA 4PLTA 4G81A 2JKVA 4CLRB 2RIRA 1I3NA 3WSWA 1YB1A 1DJNA 2X7HA 4W6ZA 1B8UA 1KS9A 3MTJA 3PK0A 4W99A 4AJOA 3KSZO 4FS3A 3HZZA 5HA5A 1I32A 4DLBA 1NTOA 3B6ZA 4B7CA 3BA1A 2JCYA 2ZKLA 3GQVA 5I9NA 3VTZA 3RKUA 1C14A 2GF2A 1NVTA 2YFQA 4Z3DA 5BSFA 3GNSA 5G2OA 3INTA 8ADHA 4IUYA 3P2YA 3E18A 3MTGA 4GH5A 5THKA 4YT4A 4MIYA 1D8AA 1SZJG 4IJWA 1PL7A 2AW5A 2TMGA 3JYPA 2RH8A 1C0PA 3ZU3A 3H3FA 4J1QA 3UOGA 2H9IA 4D45A 4L4SA 4NNJA 3SC6A 3JQ6A 5B1YA 1JVSA 1WDKA 3TZKA 3I4CA 3TFQA 1LDYA 2VNAA 4YJFB 1OOEA 2Y1OA 1NQTA 2YYYA 3FD8A 1ZZEA 3NGLA 1EDZA 1LRJA 1GUZA 4B3IA 1H0KA 3BMQB 1E77A 4II2A 3WQSB 5KJFA 1I0ZA 4HY3A 3UUWA 2FZEA 2OO5A 3WTCA 1I2ZA 2NU8A 4XWYA 1E7RA 1CIVA 3OH8A 2WJPA 3MJTA 1VJTA 3QP9A 1HKUA 4XRGA 2ZYGA 2CNBA 3E03A 1Q0LA 4Z0TA 1E3WA 1GEEA 3H3JA 2YZ7A 3GVXA 1HTBA 3QSGA 1LXCA 2C59A 1LU9A 2OL4A 4YJGB 1XELA 4U7WA 5AXBA 3B1KA 5CEEA 5CHEA 1H6DA 1BVRA 1BXZA 1F12A 4FOOA 1C1XA 1PGQA 1N7GA 2WYVA 1P1RA 1EVJA 4OQZA 4Q3AA 2FR8A 2RH4A 2Z95A 3FR8A 1PS8A 4W7IA 2AE2A 2V7PA 4E5KA 1V9LA 1UJMA 5F5LA 3K8ZA 4S3MA 2CDCA 2Y66A 3DBRB 3EVTA 4MP6A 4BNTA 4XD2A 3ETEA 2IYOA 5G4KB 4JK3A 5BNTA 3WBFA 3NV9A 3TPCA 1OC4A 5IXYA 4BHTA 1WAMA 3K2BA 1PWXA 1QP8A 2YUTA 4BNGA 1E1NA 3D1LA 4CM8B 1NAIA 1HLPA 3QLJA 4TKMA 3MWDB 5JC8A 5JDIA 4BO7A 2Y1EA 3P2OA 4Y6SA 5TNXA 4PG7A 3C3XA 4CM8A 3N58A 1U1IA 1UAGA 1RM4A 2BMAA 3HE3A 1DB3A 5FF9A 2Q2QA 2B83A 1K89A 3H6KA 3PJFA 3L6OO 1P1HA 4BMNA 1NXQA 3CE6A 4CM9D 3U5TA 4CQLA 1RM0A 3GZNA 5KCZA 5AXAA 3D4OA 3JD0A 1F0YA 1X0XA 1YH3A 5KIAA 1TT5A 3NDIA 3SJUA 3QV1A 3DO5A 1UR5A 3JQAD 3PHGA 3Q2KA 3RKRA 3WWZA 5I7FA 1P1JA 1RM3A 2BH9A 4Z3KA 3ZV6A 4OGWA 4HNGA 1WZEA 3FHLA 4K28A 3WLFA 3BIOA 2CVOA 1HE3A 2Q99A 4L9RA 3ZHBA 1BXGA 5IZ4A 1XA0A 3K92A 5CG1A 2AE1A 5KOIA 2NSDA 4WCFC 1MFZA 1WDLA 4NH4A 2W90A 1XYGA 3PTZA 3FPCA 3ZI0A 3ZV4A 1HRDA 4C7KA 2W2LA 3PWKA 3HB4X 3WR5A 2O3RA 2ZB8A 2E6UX 1LUAA 1Q7BA 2PA3A 1H93A 3GDOA 4YVFA 4D46A 1SAYA 3ADPA 3A9WA 5JBIA 2YQ5A 4NJMA 2JAHA 3T4EA 3F3SA 1CWUA 2OUIA 4TSKA 2AQHA 3WG9A 3RUCA 2HO5A 5ITWA 4IS2A 4JJIA 4PLVA 3UN1A 3L07A 1KETA 1WZIA 1LA2A 2J5RA 2ZYDA 1LDNA 2QG4A 1ZXLA 1R0KA 4DYDA 5DCUA 2I3GA 3D7LA 2OBYA 3ENNA 4IZIA 3M2TA 1TVEA 1V3TA 1PZFA 4Q3CA 4Y67A 4CMCA 4IBOA 4EEZA 2HSDA 2PTGA 3GNTA 4MO2A 4JN6B 4D7AA 1VKNA 2JFHA 4QSMA 1Y5RA 2VUTA 1QYXA 3GA0A 5F21A 1T1RA 4FFPA 1E7WA 2YV1A 5A9SB 3MOIA 4CMHA 1GFSA 4GVLA 4YWJA 3BMOA 1BRMA 1ZO8A 4GVXA 2J5QA 5L95A 1K0UA 1XHLA 4IQ0A 2HK9A 3ICCA 1AXGA 1G6KA 4BGVA 3C1TA 4DL9A 5I8WA 3OJLA 3RC9A 4N5LA 3JQAA 4BO3A 4BNXA 4BIIA 4JCOA 2CVQA 2ZCVA 3AOEA 5DULA 4PFJA 3GZ4A 3RBZA 5F1OA 4UEOA 2R2GA 3MJEA 4R1SA 3CMMA 1V3VA 3IIEA 3M6IA 3NX4A 4L74A 4DLLA 3EHEA 2ZJ0A 3W1VA 1E5QA 2WE7A 5LDHA 1Z7BA 3KHUA 1N1GA 2WD8A 2HMUA 4WLVA 3RD5A 3ZWNA 1VE9A 2EXXA 2Y93A 5KJ1A 1DRVA 5A9RA 2O7SA 1T4DA 2JFFA 4IDAA 3L77A 1U2GA 1GR0A 3OM9A 4FQ8A 3D5QA 3ZNPA 1HDCA 1PS0A 1RYEA 3DZGA 1NHWA 1B0AA 2I76A 3NDJA 5DNAA 1E7YA 3DBRA 3ONEA 5TIIA 1ZK1A 1JA9A 2GASA 4E5NA 3ZU5A 4KMSA 4R9RA 1X14A 1I01A 3KLMX 2FN7A 4IDEA 1DIRA 5H82A 2PKQO 1DSSG 2QRJA 2V6BA 1P1KA 1NFQA 4ZJUA 2NUAA 1BGVA 4UUOA 2Y1FA 1ENOA 1WNTA 2B37A 4R1UA 2DU8A 4NK4A 5FEUA 1DLIA 1SPXA 3L4BC 1Y5MA 3PLNA 5T67A 1PJ2A 4CR6A 1J49A 4P4GA 3ZNQA 1M6WA 1HETA 3JQEA 3KVOA 4J43A 4OSPA 4PIVA 1YL7A 1GEGA 2O3SA 4TRMA 2HRBA 1IB6A 2EEZA 3QWFA 5ENVA 4B7UA 4BOYA 4LRTB 4WLFA 4E31A 5ITVA 1FK8A 3RQSA 3CXRA 4TMFA 2D8AA 1UZNA 2AG5A 4OYRA 3CEAA 6ADHA 5J23A 1EVIA 3GMDA 1LJ8A 2C2YA 1LLQA 3QA9A 2RHRA 4ALNA 1F17A 1CEQA 1I3MA 4L8VA 5EESA 1Y8QA 3I6QA 3AY7A 2P2SA 5IAAA 4WPGA 4NFSA 4DXHA 4Y8VA 3DBHA 3HWRA 3EK2A 1KOLA 4Y6PA 1GZ4A 1HE2A 4NBRA 3R3JA 4ZU3A 3WYEA 5GZ3A 1CQJA 4TKLA 3ZWVA 1KERA 2PKQP 4HFNA 1ENYA 3KTDA 2Q2VA 4OOEA 5DZSA 1OZAA 5KJEA 4I9HA 3SLGA 1AXEA 4FIZA 1ID1A 5G0WA 2CY0A 1TXGA 1I3KA 3O8QB 3ROKA 3WQQA 4A10A 3DZBA 3WGQA 3SJ7A 1M76A 2NQ8A 2JD2A 2D3TA 2PGJA 3WMXA 1B2LA 3S2IA 5CG2A 1BVUA 3K5PA 2NV6A 3P7MA 1KEUA 3RFVA 3H9QA 4CM4B 1Y9AA 1IULA 3NTQA 1E7MA 3RU9A 3SC4A 1U8FO 4GKBA 1C0LA 4RO0A 4J7XA 3LT0A 3OA2A 3TDKA 3WMWA 1EFKA 3ZWPA 4TRJA 4CR7A 3TQHA 1ZK3A 2NVWA 4RPKA 2UUPA 5IF3A 1E5LA 3IL2A 3V8BA 4CM3A 2Q4EA 2WM3A 4O6VA 4DGSA 4DLAA 3L9XA 1KY4A 2GUGA 2E37A 3BMNA 3GGOA 4CM7A 3HQ4O 1CYDA 1WMAA 3K30A 4EDFA 1O94A 3V2HA 5IDQA 3RROA 3STHA 3JQGB 4XQCA 1PR9A 3QRWA 1FDUA 5I7EA 4MVJP 2GLXA 4BNKA 3LT1A 1ADBA 4CPDA 5T6BA 4CLXA 3WGIA 2OOSA 4TRNA 4CLHA 3NTOA 4WCFB 2YHIA 2CD9A 4HFJA 4XQGA 5L7TA 2HMVA 5KVQA 1XU7A 5BNFA 4BNZA 2V65A 1I36A 3H4VA 2CDAA 3F4BA 4PLWA 5DT9A 1XEAA 5T8KC 4GQAA 1H9AA 1A27A 4FPXA 3L4BA 4PVDA 3ON5A 5ER9A 4NJMB 4YB8A 4WNCA 2NQTA 3F5QA 5C37A 3OSUA 4ND2A 3GFBA 4IDFA 4U5QA 5JE8A 3I52A 1A5ZA 4CUJA 2VYNA 3RI3A 4WEOA 7MDHA 1QXSA 4BB6A 3HB5X 3FWNA 4GAEA 2PD3A 3O9ZA 4MVJI 2O4CA 5A02A 3H7AA 1BDMA 3PJGA 2V6FA 4BNLA 5AQ1A 4FOSA 1I24A 1SEVA 1NQAO 4JROA 5JDCC 3JD3A 2VHYA 5DF1A 4ZQFA 4GX0A 2QZ9A 2PFGA 2O3QA 3OECA 3PPIA 4L4XA 2X0IA 5DP1A 5JMPA 2IRWA 4GSLA 1EVYA 4QO8A
chains in the Genus database with same CATH superfamily
5KYXB 3HGMA 4FSDA 1JLHA 2C3YA 13PKA 4F38A 3GD5A 1ITZA 4W9RA 4CN8A 3PS9A 5ALIA 4JASB 2Z6UA 5AKHA 2IOYA 3EGWA 2OM2A 2X2OA 1BJKA 3BCUA 3QVOA 4NI5A 2YOHA 3KBOA 3OY2A 1EDEA 3P9RA 1N78A 1U2DA 3B6EA 1SQ0A 3CH6A 4FX2A 2YJ4A 5IFKA 2RHOA 3L8DA 2AEFA 3NRJA 4KE6A 3F5FA 1FLAA 1Y34E 2AC7A 2YCLA 5ALYA 3NC4A 3R7WB 1GSHA 3D7NA 1UPTA 3IAXA 1L7EA 5HGJA 2NYAA 4JA0A 1YB5A 1OZHA 3WRXA 5DASA 4EUKA 1SQSA 1UIMA 5CVTA 2C5LA 5AI5A 4H15A 2CEKA 4PINA 1G6Q1 1KZ1A 4KRXA 4NYIQ 5JSKA 1MIHA 3SSMA 3PHHA 1XZJA 5K3BA 4J4BA 1O7JA 3DBLA 3Q7QA 5DGDA 1XMOB 2LD4A 2R8YA 3BIWA 4YY3B 3BJMA 1YVRA 2A88A 2I4NA 4ESHA 1PT6A 2RBKA 4U4AA 2RGCA 3NAMA 2V9PA 4BS9A 2DVMA 1P3Y1 2V9ZA 2ID8A 3FSEA 2JLUA 2HI0A 1Z83A 4OAQA 4ND4A 2PTHA 4KFSA 2P27A 3C0KA 1QK3A 2GUWA 4B76A 1GARA 3PYXA 5I6DA 1OH5A 1VA5A 2BZ0A 1Q57A 1MG0A 4HS4A 3BDIA 2GPTA 1VGQA 3DMTC 3I04M 3L7KA 1IDOA 3AINA 4GI5A 2C57A 3Q1KA 4YUVA 1KMHB 3BF7A 1LPAB 5FO1A 1K86A 2GN4A 2ZYHA 1G2QA 3RRYA 5K6AA 4AJHA 3L6EA 4OQ4A 2X9VA 2QENA 3HZHA 4LPKA 1E0KA 2ZB4A 5E6UB 4Y2JA 1Q95A 5LDDC 1QQ5A 5HJEA 1Q16A 4JOCA 1PTJC 1XQ1A 2FAXA 3P27A 1GN9A 1OAOC 1PP4A 3WGZA 3N5CA 4BKMA 5CXSA 1D6MA 3BMCB 4EUEA 3ORHA 4PYRA 1R6TA 2HADA 4NL4H 1DCTA 4AVYA 2AR9A 1UBGA 1WP4A 1U0LA 1Y8RA 2C5BA 2WSIA 3L0DA 4O1HA 4X00A 2L18A 2LV8A 1ADCA 1RQRA 3ENQA 5AJUA 1UDXA 3MMPA 3HBAA 1F6WA 4AYTA 4DWWA 1OFGA 1Y4UA 3GCZA 1C3EA 2ZKIA 4AL4A 2GK4A 3JQ8B 1HH4A 2BFOA 1JHZA 2W6JA 4Y1RA 2FN8A 3JZMA 3LX8A 3WB0A 4GFDA 1P9LA 4P4SB 4CIDA 1C9DB 1VA4A 3PX2A 1AKUA 4DY6A 3IO5A 3MLAA 4M1YA 4JYPA 5EXTA 4RXUA 1V47A 3WQBA 3Q41A 3WRVA 3M83A 1RZVA 2PH3A 5IEBA 4EHJA 2H07A 1JU4A 1M2WA 1CVRA 4EG8A 1FU7A 4K9OA 3HB9A 4M0LA 2PUDA 1YC2A 5D3MA 4TZTA 5C3UA 4D9KA 3EY9A 2H4XA 1L4FA 3ASVA 4M38A 1QTNA 4QU9A 4MK4A 3B9BA 3ZKWA 1Y7LA 3Q3JB 4Q9KA 2C0PA 3V33A 4YWHA 4K87A 4JB0A 5JSYA 2PYIA 1QH9A 2I87A 3GRPA 1G7TA 3L46A 3PWTA 2Z83A 3KX2A 4WW0A 5DP2A 3RUIA 5JAUA 1VP3A 1FP6A 1QIIA 5KB3A 1JIKA 5TSDA 4JLUA 1Y9EA 2IOFA 3HVIA 3F8TA 4DDKA 4DMKA 3IUJA 5JCXA 4MS1A 1AX9A 3TQOA 1QG2A 1A9XA 3ITDA 4TT3A 2G06A 5DU2A 2SNIE 2ETVA 3T7KA 3OIDA 4QFDA 5AJTA 4F3RA 3ZH9B 9LDTA 4IIJB 3MHPA 3ZH2A 4E4YA 3UBMA 3OTGA 4MR7B 4EELA 4C4YA 2EV9A 4YCNA 2B0JA 4GLFA 1RFLA 2SCUA 3EISA 1HNXB 4PSVA 1ZNQO 4JYZA 5JD4A 3PQFA 3V3TA 2FSVC 3B38A 4G9GA 3S4YA 1I4LD 4B34A 1PUJA 2XZPA 1JIUA 2FMXA 4H4DA 3AJ9A 5F1KA 4JJZA 3QM1A 2FY8A 4B47A 4IKEA 1ZN8A 3BHMA 2AZTA 3IYLW 4MRMB 1PX0A 3WYGA 1SQGA 4LOLA 3CLUC 1QX3A 4DNQA 2KHZA 4R2JA 3KWFA 3EUWA 4HN9A 1WCXA 4Z9YA 1EWTA 2I5PO 1QTRA 5JYEA 1LC3A 1T4MA 2Q0XA 1AA6A 4B4WA 2CV0A 1S2IA 1FFWA 2BC9A 2ERCA 4MKHA 3VKWA 3JSAA 4LG1A 1NR1A 3WJ1A 2D0DA 3FF1A 4MWOA 4A16A 5HJ5A 4UBMA 1USKA 5CVCA 3UOAB 3ZTWA 1I1QB 5C7LO 2J48A 5HXAA 1ZC3A 1HBJA 2DGDA 1DINA 2VXCA 1UJCA 4C21A 3T8YA 4Q24A 2KW5A 2ZIFA 2Y9PB 3FNHA 3ICPA 3ITEA 3OE7D 3QFHA 1M2OA 2O1EA 2H2WA 5I7OA 3VZSA 3VX3A 3N2YA 1VG9B 2YYZA 3C5EA 3X1XA 5DW0A 4ARAA 4D79A 4A5OA 1AQ6A 3SPXA 3COJA 2ZR0A 4KVGA 4OSEA 3BF8A 1AKMA 4EX6A 5FLYA 1PK7A 3VISA 2R4UA 1JA1A 4KBYA 4JD5A 4RHFA 1KI6B 1CQIA 5U4QA 4HDMB 1NBOA 4IGKA 4C0WA 3K6RA 3PFFA 1DAMA 5KMGA 2BEWB 3PC2A 3X2EA 4ZMBA 2J5BA 4V0ME 5HM6A 3AKDA 3PQ4A 2IZ1A 4W82A 1DDGA 3E2PA 2J59A 4UEJA 5IAGA 5FFFA 2BDEA 3DM9B 4JI2B 1M54A 5NULA 4PBRA 4MKRA 3VPDA 2ZR8A 4BBJA 2Z5LA 4B79A 3AYZB 3BWMA 4FLMA 4Q4AB 1GAQA 1UINA 3AEQB 1G7CA 1RYHA 4RNCA 3IBYA 5EMJA 4YAKA 1RYBA 1XYYA 1QHYA 4WXRA 1MLDA 1QOZA 3RKSA 4F5DA 3LA6A 2XPCA 2WYIA 3G0BA 4DIUA 1B76A 5JOQA 3OEWA 1OBCA 3TCKA 4NXMB 1E20A 3K6SB 1USIA 2ZYAA 2QGFA 3FNRA 1YR6A 4XJSA 1G2OA 2HK7A 4IF4A 5TGZA 1MHTA 1L4YA 3A7DA 2R5NA 1WUYA 4ZOCA 2P5SA 4NH0A 4CIBA 1H2FA 1NFFA 5CDFE 1U28C 3R20A 3HJFA 1P5JA 5IZCA 2HR1A 1DJLA 3AETA 2D6FA 1FFHA 2OZPA 2ZRNA 3PIDA 4NVRA 1GT91 3KUCA 1N77A 2PPLA 3JQ9A 1HEIA 4B43A 5GQSA 4GYYA 1D04A 2WJZB 4E21A 5EP4A 4RQUA 1COWD 2Q29A 3GT0A 3I05A 4PZUA 1UC5B 3I6IA 1DCKA 2YWDA 1WXFA 4I4IA 5A4FS 4DHEA 5B4TA 2PXXA 3GG2A 1NBHA 3AJ8A 2QT9A 1W85A 1K8ZB 1FNDA 1MEOA 2L2QA 3GGDA 4OHCA 1A71A 3KV1A 4QTTB 5CYFA 5DX1A 4EAAA 2RHHA 4G84A 4R40A 4U9HS 4DDTA 4NHOA 1LI5A 4TUYF 3WGVA 1K2WA 2J0SA 3IV6A 3G2JA 4OLHA 5D86A 5BYJA 4OTZA 3INRA 4TQ9A 3SZGA 3MBOA 4YMLA 4GU5A 4PAGA 1Q6ZA 1S4QA 2R4TA 3DHNA 1Z5NA 1AH2A 3ASUA 1AURA 4MV3A 4EB6B 2XW6A 5EP1A 1YIOA 5JH7A 2A0FA 5EC8A 2I80A 4C7BA 4LA4A 5B1EA 4BC0A 1M7HA 1MU0A 4UAUA 5JXGA 4C2UA 2HA0A 3CE9A 3CMCO 3K8OE 1Y82A 1P75A 4QGBA 1RU3A 3D8SA 3KE8A 5EJGA 3ZLTA 4YQFA 3EMDA 3HUFA 3VDNB 4IM7A 1J22A 4PPQA 4XEHA 4G0OA 3NIBA 4EKIA 2JLYA 1E96A 1E7QA 4Y2GA 3WL5A 4FS8A 4I99A 3NHKA 1ILEA 1RQLA 1TDJA 1Z28A 2PT6A 1TU4A 1UOEA 2C5SA 2CJXA 2XX3A 2PAAA 1QAMA 3H4IA 3WMEA 2ZI6A 1GRNA 3DBLB 1NBIA 5HRCA 3R3UA 2WD7B 2ZOSA 1NQXA 1U5CA 2FWBA 2OHVA 1MO2A 3JRXA 3KLPX 3KQQA 4IDGA 4RGQA 2FLKA 2O8BB 1TMOA 4GPIB 5DGIA 2ZPUA 1XZLA 5DDIP 2PMKA 1RWPA 1V41E 5JDCA 2XUDA 5EQDA 2O20A 3H2IA 1I5OA 3ADBA 2HPZA 4RPLA 1PK9A 2O4UX 1JT2A 3NM5A 2VPWA 4ITRC 2BISA 4GRAA 1NYQA 1UJ2A 2A5JA 2BN4A 1TA9A 2G9ZA 2F1RA 2P2GA 3NBZC 2WPNA 4PNPA 1YR9A 4F2WA 2D4AA 3S0JA 1JSCA 4P35A 1N25A 5LZ9A 1V1MA 3IPCA 1AM4D 3NG1A 5DVZA 4CCYB 1SVOA 1VGRA 4B3GA 2A78A 5KX5B 1NXSA 2FHPA 1IONA 3KJFA 4KSBA 2IHVA 3WLIA 4BYGA 1QP0A 2DBQA 3AF5A 3K5IA 2XBUA 2PSEA 5CNIA 1DO0A 4R2KA 3R41A 1VMAA 2IYSA 1PR0A 3AONB 3LX5A 4U02A 3VR5A 5CDGA 1Z17A 1KSJA 2WIKA 3D6TB 3UJAA 4ZI2A 3QE9Y 4QUBA 2XYGA 1SXJA 4WY2A 1ZA1A 2AVDA 4MRPA 5KYXA 4I1RA 3P19A 3GZTB 2JGNA 1PAUA 2P9QA 4KHZA 1ISHA 3DQQA 2ZRCA 3HO1A 1TGVA 2PQMA 2C8KA 2G5TA 3OEYA 4KL8S 2GNPA 4DLPA 4INZA 2JJMA 3AG6A 4M89A 3OVMA 2V58A 3ZWBA 5CBPB 2DY1A 1DBRA 1RMTA 2C1ZA 2Q9AA 2YZNA 3GJQA 2WMNB 3C4JA 3MJSA 3MWFA 5CPBA 4AJIA 4JI6B 3EXHC 1PGPA 2B8JA 4OYLA 3ECCA 3WYNA 4E0BA 5BQFA 2PSHA 4MUHA 4LS3A 4F8EA 1QRDA 1SRQA 3NGMA 3BJIC 1VPWA 1PTKA 2PU7A 2WC1A 4LXUA 3DTNA 1SG0A 3TX6A 2VJPA 3UJ9A 2C04A 3T9EA 5BSWA 5JQWA 1WE2A 3UHJA 5B3AA 1A5TA 1QDLB 4CKZA 3EF0A 1I2CA 3DC2A 1DKLA 2QRLA 2X1HA 1L7MA 5KKCA 5FA5A 4B6SA 2AZ4A 2DB3A 3PC6A 1KSHA 1ZGHA 1W1UA 3T4XA 5CM2Z 4EPRA 3NHBA 4RE6A 1J56A 4S04A 1Z7EA 3HWSA 3MWJA 4AI6A 1GA6A 1UBRS 2AYZA 2WFMA 4CI0B 4RIHA 3SQLA 4BN5A 3VC7A 3LUDA 3NYQA 1TF5A 1VRVA 2R25B 1GDTA 3A9VA 3KSDO 2ZS8A 4YRMA 2WM8A 5AJWA 2P30A 4PGFA 1ZL0A 4ZAYA 2CFOA 5EIWA 5TX7A 5EKTA 3UXEA 3OWOA 1JDBB 1OBHA 2XA9A 4MA5A 4BWFB 4C3ZA 4LF9B 4P0QB 4KQFA 1CSEE 1DGQA 3VSBA 4BATA 3DSRA 3E7XA 3HV2A 4Z4HA 3N9IA 2EEPA 3SE7A 1KYZA 1V43A 1XT6A 3R76A 1OAOA 2XAAA 3P26A 4NKRA 4HAOA 5FOVA 2ZWPA 3SIRA 3DF9A 3G6KA 1RHUA 4C04A 1OBFO 1XZPA 1UZUA 2E9SA 4LYAA 4S1OA 5DCYA 4YPFA 2JDIA 2P4HX 2W2TA 4P53A 1C4WA 2EKBA 4RVHA 4Q9HA 4DAEA 3SXUA 3PVCA 3VPSA 4ENPA 3OJ0A 1HOXA 1K88A 3FLAA 5DNWA 3TN7A 3KB2A 2VF8A 2OCBA 1VZ3A 1UDRA 1M2FA 2X5JO 3IDOA 3ME5A 5C1PA 1B15A 3WYDA 4S1WA 5TJ9A 1L5WA 5L7YA 1Q1BA 4MITA 2B3DA 3RG2A 1MPXA 1NQVA 1WSWA 3Q4GA 3T3MB 4DRXB 1EAYA 1QGYA 1VLVA 3L0PA 1DKQA 2BW0A 2GM5A 4D9FA 1RPZA 2CLKB 2ZXUA 3EGDA 1ZCBA 3S2YA 1EXMA 2WEKA 4J4HA 4Y6OA 3KLOA 4M0CA 3D8NA 3U44B 1J2EA 1XRMA 3E4DA 4RMHA 3ZX5A 1VMIA 1FTSA 2BFFB 3LLCA 3L92A 4CEJB 2PRKA 2Q41A 2QUAA 1R9NA 3IDAA 4R8RA 4GI2A 2P41A 4ZAFA 2XZLA 2JGKA 3LVBA 5KTMA 1DP4A 1NVGA 2FQ1A 2UU9B 4A15A 1MO4A 4H4CA 1FDIA 2PO7A 4L27A 2WUGA 3ODPA 5E4YA 2WU4A 5CW2A 4KRFA 4XD7D 1YS6A 4E7OA 2X4LA 4DUGD 1RCTE 2HQ1A 2LZ0A 1S6YA 4BVFA 5DN9A 3LHIA 4C08A 1VSTA 1XUOA 3O3OB 1I4DD 4GSYA 1WQ1R 2ZI7A 3LY5A 4OP3A 2IFTA 3A1NA 3OQHA 4XVHA 1LBIA 1NAHA 2BGJA 3QXGA 1S2MA 4H1TA 4R51A 1WU7A 2R8EA 5IF9A 3E7WA 4KWCA 2NZ8A 4MVJA 1JSZA 2IP1A 2XUAA 4JP1A 3WLHA 4DIMA 1X1CA 3C6KA 1N6PA 3GJ4A 1D6NA 1VJCA 2XZDA 3AG5A 4O5OA 4BQPA 3FSGD 5BP7A 4A36A 3L7NA 1C9MA 1ZGGA 1UFKA 2CMHA 4NMHA 4CT0A 4QT4A 1DWOA 3GPLA 2UYYA 1E1LA 1KEPA 2OO3A 1C1YA 5AYVA 3QW4B 3IPYA 3TTVA 5HDQA 4RF5A 1M2HA 1I0IA 2PBZA 1QFJA 1ISGA 2A9OA 2MIIA 2VK8A 3JPWA 3MEQA 5ALZA 5DRYA 1POWA 1P4JA 1JMYA 1RI4A 1T3HA 2MSEB 5FX2A 2YW9A 1TUIA 2C42A 4TWBA 2PMBA 3UFXA 5TE9A 3AR2A 1JV2B 3DXZA 3EXAA 5HOQA 3HYRA 1OU0A 2A0YA 3NFYA 4KODA 4DS3A 3IUEA 3WA7A 3GJ0A 4I5IA 2O52A 3EUEA 1U3TA 3NUZA 4G0ZA 4FC7A 2RBGA 3PPYA 5H0IA 3JVEA 3LUPA 4CMIB 4CV2A 3IQGX 1S7GA 1W2HA 3MT9A 2XECA 3QUBA 3EDMA 3OURA 4HVCA 1IVYA 1XCGB 4E2FA 1ZK0A 1T5SA 4MVWA 1QU2A 3EQ6A 2XVXA 4L8WB 1U8CB 4ZVRA 4EMBA 7AT1A 2R65A 3UHFA 2EKLA 3VSAA 1YNOA 5IMBA 2P9CA 4UMVA 5ECDA 4XIJA 3T3EA 3MINB 1JT9A 4DIOA 1YT5A 2FP4A 1C9JA 2LDBA 2NVOA 2VUHB 4FYXA 4MSUA 1DKRA 1CQPA 1GUDA 3P2JA 4P3PA 4Y30A 4ZJPA 3TI7A 4NZPA 2ISSD 3BE4A 2GPYA 1QUEA 2NX2A 3K9LA 4BY9E 3WGHA 5I47A 3AY6A 1Q7GA 4O33A 1PVVA 3T5TA 5M04A 1QKIA 1IPHA 2IHTA 2WJGA 1RWMA 2PYDA 2XMQA 4YO8A 5JTUA 4OLAA 1VIYA 2ZAOA 1SCBA 3L0ZA 4JVSB 5CVJA 1HF3A 2W6IA 3V2GA 4FI3C 3R7AA 1W93A 3P96A 3DLIA 4K3VA 1WX1A 5C81A 4PNZA 2JBAA 5ERXA 2Z04A 3H65A 1W5TA 2BOVA 3KLBA 1XJWA 3NM4A 5MHTA 3I32A 2AH5A 4WGFA 4Q00A 3LUKA 3AKCA 4LGMA 1YZHA 3CRVA 1YS1X 1DBVO 1RBQA 5GGYA 3KQHA 2CJPA 4I66A 3VHXA 3ZJTA 1F60A 2FX5A 4A73A 1G6OA 4K6OA 4W5OA 3KJEA 3IV7A 4GP6A 4LF7B 1GG5A 2IYZA 3GUUA 3IODA 2I78A 4P93A 4DQLA 3K6KA 1X7HA 4NOJA 4NG5A 2Q5HA 3BMCA 3EBOA 1UP6A 4MB2A 3T5MA 5JO0A 2BJWA 3ZCSA 1SFRA 4GL4A 3SOZA 5K4HA 3MWKA 1REQA 2EGGA 3BH0A 3G8CA 2ZVJA 2OHFA 1R6BX 1EBUA 2H85A 3LIPA 3LZCA 1H9BA 3P4UA 1DFHA 4MRSA 4HTFB 4YCDA 5TQ2B 1HXHA 2YDXA 5TQVA 1CY2A 2WIBA 1UCFA 3LLVA 3R6TA 3M3PA 5AM0A 1QDUA 1MAAA 1WCV1 2H29A 3OC0A 2OLEA 2RHCA 2WU3A 1Z8DA 1VSVA 3MWEA 3OLZA 4HFMA 4O63O 4YAEA 4ZHSA 3DV0A 3QWBA 5JRZA 1WDMA 3KQLA 2GPBA 1CETA 1HEUA 4AXBA 3QVVA 3OCWA 4W63A 2DCMA 2OGUA 4JLOA 1M75A 2R66A 2X8WA 2P40A 3GRKA 2X19A 5BV0A 1CY6A 1HDYA 3N2EA 4R69A 4OK3A 2G0NA 2YVAA 3MVEA 5D8DA 5ARCA 3AOGA 2J3HA 2HUPA 3OJEA 4M1ZA 2WM9B 3ZDBA 4UOQA 5AHKA 4H6XA 4NTZA 2PT9A 1F2VA 2TMKA 2Y1XA 4EG0A 4QQRA 3OX1A 2HA6A 3SJBA 3ZUGA 4LXIA 2WG1A 2PKYX 2H1RA 3CVOA 5F2OA 4DR6B 2PX6A 3PDIA 3PTLA 4JCCA 1R4AA 5FWYB 4BP3A 2ZCUA 1CX9B 3OEHD 3VZDA 7ADHA 2WU0A 3KAKA 4B31A 4OFWA 3GOHA 4QPJC 4I9UA 1YQXA 4C5AA 4NE2A 2FGJA 4Z49A 1Q0RA 3VH4A 1U7UA 4X60A 1A9XB 4BO5A 1SHLA 1T6XA 3EODA 2E85A 1Z88A 5EVCA 3OJOA 1NXVA 2ZU0C 1JZTA 2B61A 1GTZA 2PBRA 1YQ9A 1IHYA 3H1PA 3OMLA 4J2OA 2H4ZA 3LUAA 4X6YA 1U5AA 3T0GA 1N9ZA 1E6WA 3OM8A 4H0CA 3IJ5A 1SUCA 2ZSIA 4CGYA 4HPXB 5FKJA 2PXCA 3H5LA 3HBJA 5BVHB 4JP8A 4ZOLA 4X64B 4YRPA 1ZVQA 3B70A 4CM4A 4D82A 3K7EA 4B7AA 1BD3A 4O4HF 1SHTX 1T2UA 3DMTA 2QN6A 2ILVA 4YLGA 5E7MA 3TIVA 3AW8A 5P8WA 2OAGA 4DR7B 2YC4C 2C2WA 2QS9A 3C48A 2ID9A 1VL0A 4G0QA 2HHHB 5CLGA 4NU6A 2ZK7A 3CIFA 3CCFA 1YQQA 3RS2A 4PC1A 4EHKA 3HCAA 4KJXA 2ORYA 4KLZA 5CLHA 2JFBA 2P9TA 1UDWA 4KUHA 3ZY5A 1OC2A 4CQMB 1PW7A 2AMJA 3FVTA 4RL4A 2J9YB 4A0HA 1HDRA 2AJCA 3QBDA 5KYUA 3TEJA 2MJLA 4D8XA 1JDVA 1G1AA 3NPAA 4QD3A 4TLCA 5I7VA 2R60A 4DJEC 3DGEC 1CRWG 4P9NA 2D1QA 3QVSA 1NOKA 2OWDA 4H1HA 4K26A 2WD7A 1PF7E 4KAAA 4I1SA 4CM1A 2E2WA 4ZJZA 3OZTA 3H9JA 5BURA 5KYWB 2ZSKA 1G59A 1T1EA 1R6DA 1SURA 1Z5UA 1ZGAA 2V55B 1OT5A 1VLZA 2PWZA 2BFDB 4RADA 1NXOA 4PX9A 3TUJC 5JLAA 4HEQA 2RMKA 3TRIA 1P9NA 4JJFA 1FFGA 1XVVA 1Q91A 4JGIA 1GGFA 3JARA 3ICQB 4G4GA 4OAPA 5KSYA 4KMMA 1F0PA 3GZJA 3U37A 1C2YA 3BBLA 5HK9A 1IQUA 3L6DA 1T0UA 4WY8A 2IYLD 3TTYA 2JAUA 5JYBA 1CERA 3RUEA 3MWEB 3NB0A 1J2TA 1LRKA 4D3YA 5BW5A 4KO3S 4E5UA 3W8DA 3BB4A 1V7PC 3I9JA 3D4IA 3S1AB 1EQ2A 1WKCA 3E7DA 1R0SA 1V35A 5TY0A 3HFGA 5HF6A 1NNUA 2C9YA 4D42A 3Q3CA 3SQWA 3DDNA 1DL5A 4Z0HO 4PLYA 2EBFX 3TAXA 4CMEA 5E2IA 3KOUA 3RTBA 1CK4A 2CNLA 2DT5A 3H9EO 3K2EA 4NYMQ 4C0HA 2VS1A 5JTTA 3S1SA 3KNZA 1MGPA 4MDHA 4MVJG 4YQEA 4RLHA 3U1TA 3HZOA 2HX1A 2NZJA 3OZDA 3W4IA 4C4PA 1RKQA 2D5AA 2IYYA 3FJYA 1KDOA 1P1IA 3I30X 4NICA 4HNHA 3PR2B 1Y42X 1QRTA 1MX3A 3TLCA 2NM0A 2AG0A 3FPHA 3IOYA 1HG0A 4HAVA 3ZD8A 1QVWA 3TMKA 3PXXA 1YVDA 1BU8A 2Q5JA 2X8LA 3UMRA 4R9VA 1RT9A 2QYTA 3Q11A 3TRFA 1FRQA 4HKTA 1IZYA 1YQUA 1GY8A 1NQ5A 4TS1A 2FMIA 2ZRKA 1Q7CA 1ZHOA 1N5MA 3KKKA 4M22A 2I6XA 3WSTA 2ATVA 2G1PA 3OE4A 2VK1A 3PF9A 3Q10A 4WFJA 3TBHA 1X74A 4AKSA 3ZHTA 4IL5A 3NBUA 4URWR 2I9KA 4E30A 1B16A 1DQYA 2HH9A 2FNAA 3L0OA 3OC6A 4HQ0A 4MQFB 4KFCA 2BMJA 3DV9A 1I6MA 3FB4A 2O14A 4JLPA 3K2QA 4FFBB 1G38A 3GP5A 4BMYA 1IPFA 4MWZA 5CVDA 2VPTA 2YC2C 4RTQA 1KOFA 3SX4A 3PJEA 4HDNA 2EJVA 2KM1A 4X95A 5LA6B 4BJ6A 2KPOA 3CPSA 4X93A 2BM0A 3O8RA 3E22A 2VP5A 3F9RA 4RZQA 4CM3A 5HS4A 5J4KA 4PSCA 4FZVA 3HB7A 1UBOS 1F6DA 1YUBA 5EXPA 5FORA 5HG0A 3ROQA 2FTKE 4F4DA 2GN8A 3DPUA 4LZLA 4W1SA 3SYTA 1BKSB 2X8BA 1WB5A 1F4VA 3ETDA 1M1NA 1D1TA 2G4LA 2X1MA 1UADA 4OJQA 4MDYA 3X44A 1JUDA 1P1FA 5FPSA 2OFOA 3EXG2 3EWAA 4FFOA 1KVSA 5EE1A 5KSZA 1KY3A 3PI7A 3H6GA 4GL2A 1O9HA 2PLFA 5D5QA 4RU1A 4BBPA 4WH0A 5DHPA 1N3BA 1T2EA 4ZOLF 1E5VA 3CLKA 3GH3A 1DIBA 3L1IA 2PUAA 4KCGA 7REQA 1KJQA 1EWKA 2GXAA 2NTYC 3LDFA 4PE5B 1W8DA 2PBLA 2WYUA 4MI1A 2ZVPX 1ACLA 4ZN6A 3LFUA 3BZWA 4V0MA 5KCMA 1RPJA 4GPD1 4BLQA 1HFJA 1JQ3A 2BMDA 1UKBA 2N42A 4QRHA 1O96B 2H4WA 4IDBA 1M9NA 3UB3A 1JPUA 3D4NA 2Y68A 4PBSA 3KPWA 3AI7A 3TB6A 3HBLA 1G98A 5LWHA 4IXMA 2Q7XA 4B3JA 4ZPJA 1XSEA 5HIIA 4XB6B 1E9CA 1ZVVA 2WG0A 3L02A 5IDWA 3KOOA 2Q2WA 1FRVA 1R18A 3U39A 1G0OA 1MNAA 2WUVA 3C2QA 3UV6A 5BV7A 2KBFA 1EK1A 3VKVA 1QFMA 2JFUA 1GU1A 4C1BA 5HW0A 1LW7A 5CTJA 1VIDA 2O57A 2SKCA 3GCDA 1IOWA 2JAXA 4L73A 3G49A 2OK7A 4GMKA 3CRMA 2VHUA 3M34A 3HN6A 3K1AA 2H5EA 2RHTA 3EDRA 1EI9A 3PVZA 3URKA 4E6PA 3L7IA 4EYSA 2JKZA 2R44A 1IEQA 4J49A 4GMHA 3PQEA 4YQZA 1ETHA 1M2JA 1VDZA 3QE4A 3UAVA 2VH2A 1N0WA 1WHSA 2WAAA 1NWCA 1GPLA 2YWFA 3AY0A 3NLLA 4FSHA 2ZRPA 4XPIA 3HY3A 3VYSB 4CHTA 1HMPA 3RVMA 1M6YA 2AF4C 5AT1A 2Q45A 2PWBA 2WT8A 5HJ7A 3SZMA 5DBOA 2P6RA 5FXMA 4CV0A 4PYOA 3LOUA 1CJTC 1RPAA 3A6DA 3FWKA 3HNOA 4IIHA 5DEIA 4BC1A 4RTOA 2P4EA 1P5HA 1Y6JA 1SUIA 4MRNA 1NPDA 2HL6A 4O2AF 2EW8A 3X2SA 2O2SA 2G1UA 1BA3A 1L5NA 1O95C 2FE4A 1TUEA 1DTEA 1PLJA 1W581 4YI3A 4YJ3A 2MWMA 2MMGA 1TIPA 1Q12A 3SHTA 2QMOA 1OLSA 1HLGA 4JJGA 4ENUA 3DDUA 2D8MA 1KDZA 1LPMA 2JJ1A 1JHYA 5FNVA 5LQDA 4PV7A 5SYAA 4X62B 4C4TA 2VSFA 3KTAB 1DQRA 1PJCA 1YQEA 2QJFA 3R7BA 1H1LB 5J9FA 3HNRA 3G82C 1M5UA 1UWCA 2YDYA 4BKOA 2CMDA 3BAZA 3N53A 3RVQA 3ZK9A 2Q3FA 1Y7HA 2D54A 3EG9B 1P2VA 3FZNA 1X8XA 4R9UC 4CLEA 1GPH1 2YNMA 4GXQA 5KZMB 5K0NA 4KIFA 1G5HA 3CY6A 3F67A 4B5LA 1JX6A 1VJ0A 3H8VA 1Y33E 2BM8A 3TTXA 2QGZA 3K09C 1J4AA 1D9ZA 3VO2A 4G0WA 5LU8A 2OAP1 3H8JA 3LT4A 1XNJA 1EFLA 2KS6A 4BEWA 1CUFA 1ZSNA 3G0OA 4A5SA 4HEJA 3W79A 3FHOA 5J2TB 4IY1A 4CMEC 2XXJA 1YXMA 2FP4B 5CAEB 4V39A 3USES 2N47A 5BW4A 1NXXA 3EGCA 3MA0A 4BFVA 4GP7A 3GLIE 3ESQA 3RC2A 4TV9A 4L4YA 5IUKC 4BZWA 4DM3A 3RQIA 4OMUA 3ZUPA 1EESA 5ALTA 1R6AA 1LDEA 3BWCA 3COYA 3IQEA 2VT2A 3HM2A 4U1RA 4ZT7A 4D9IA 3DG9A 4PRZA 3GL9A 4HQRA 5LKRA 4LJRA 1WV1A 1HNWB 3LA8A 1UM9A 4ZA2A 4ZT5A 3C8MA 3RTAA 5T4HA 4EYQA 4MQMA 4U3JA 4MWCA 3W2FA 4BRWA 1IXZA 2Z0MA 5JH7F 1L3BA 2BEVA 1MFPA 2G8NA 2GK3A 5K2OA 3VR5H 2ZZNA 4XWAA 3UFXB 1THMA 4J0JA 4QFCA 4RH0A 1NQWA 2C82A 3R0QA 2IKQA 4GPZA 4HAIA 1ZIYA 3ORYA 3M6WA 3ZE6A 1ECJA 5FBLB 1Y4AE 1ZM4A 3ETGA 1O87A 5JS1A 2QM8A 1BHJA 1ZQ1A 3QVWA 4MVJD 4GXNA 3T7IA 1YZVA 2ZROA 2VQFB 4MVCA 4U63A 1KDYA 1XA3A 4A82A 4QBKA 1IOVA 4I50A 4ILKA 4TWIA 3NHYA 3NW9A 2GM3A 2VDJA 1LF5A 4PIPA 4DT1A 1BE6A 4WASA 3U3XA 1M0EA 4O2BA 4EW6A 1TCCA 5JXWA 2ZZMA 4L08A 3ORFA 3RVSA 2ZUWA 3HR8A 3CX3A 2VR1A 4QDXA 1U7WA 1Z2PX 4PEVA 2RBEA 5LP6B 5DWVA 2IW3A 4BFSA 4UBJA 1EX9A 3PHLA 1I4EB 1DPFA 3OKPA 1QGOA 2JH9A 2PX5A 2AD5A 4R7GA 2WJHA 3A6GA 4BMVA 3TGWA 1S2OA 3DCJA 4ID9A 1JKFA 3FDZA 3PGA1 3LL7A 3EVDA 4RQBA 1LLDA 2C3MA 3U56A 5BN5B 3W7BA 1THTA 3B8HA 1EFRA 4PZDA 4V3CA 5BVHA 3H5AA 3GLFA 2VQDA 4K8OA 4D8TA 2WWHA 3AILA 3W8NA 3QU4A 3TNFA 4AWAA 1A4IA 1EEHA 3DWGA 1I8TA 3GNQA 4DVGA 3GLGE 3M4JA 2A0XA 5BPHA 1T5TA 3ISTA 4WSOA 4BWVA 2QQ0A 3LBNA 5BVGA 4OHKA 2EG5A 5LXTA 2HFJA 1MN6A 1GFWA 2O8NA 4KH0A 3RUFA 4MEAA 3EVEA 4HMQA 1LFDB 2FZ4A 1E2NA 5AKEA 5IJ9B 2VATA 4FEAA 4B3MB 3NV7A 2X0RA 3HHEA 2XNKA 4M55A 4M1TA 2VF2A 1KJJA 1EJ0A 1F3LA 4TL8A 3LPCA 4NV3A 1FW6A 3SZ3A 3AESB 1ZCFA 3GJ7A 4IS3A 1UBUS 3IP1A 3DWIA 3GG9A 3VVBA 3WIDA 3ZIAD 3IEMA 1T15A 4J3FA 1Z4QA 1QPBA 1XEXB 3F2VA 4UUNA 1R12A 1WDWB 1YCFA 1W75A 1O94C 2WOJA 3IAFA 3AUKA 3LF2A 4DMFA 4DMRA 5BT8A 1R00A 2BMWA 1Q6YA 2A33A 3CG4A 2BMEA 2HMYB 3FPLA 5EQJB 3WFIA 1YK0A 4HF7A 3K09A 2CL7X 2I3AA 2QMEA 5G0SA 2HRRA 4BQRA 4X3CA 1WPRA 2Z9BA 4D4MA 4I4LA 4AUKA 4WZAA 4JB3A 4KQKA 1BS1A 1ONBA 1WXQA 2NPFA 3GDGA 5IU6A 2XTAA 2P2NA 1SKAA 4ETWA 2CLMB 3WLPA 5A3RA 4FKMA 2QM0A 5E2BA 4PGHA 4EYGA 1F4PA 2HMTA 2G6BA 1X2EA 2PCJA 3AGPA 3B8EA 5EXXA 1O95A 2J4CA 3NBFA 4EF6A 3EXIA 3QEBZ 3BE6A 3CSSA 1U2TA 1H8ED 2GEVA 3B1YA 3T7DA 3TMYA 2OGTA 3ZW7A 4MVJF 5AUPB 1XQYA 1H4SA 1TMGE 3WFZA 1MH1A 1RIIA 3CLTD 3T15A 3X2FA 1GKIA 2XOEA 2G77B 3NJ4A 2OZLA 5D3QA 3AIKA 4ENQA 3OTIA 4PG4A 4Q6BA 1YAJA 2Q28A 3K9BA 2YXNA 4QVGA 4DA8A 4RENA 4KMRA 4RZHA 4P54A 3GEMA 2OR3A 3B3AA 1TZ2A 1K7FB 1IM2A 1Z73A 1ZYUA 2A5DA 5IP5A 3SHVA 5BUZA 1JG4A 1UBCA 3O2NA 1Z2CA 2YQZA 3HLYA 4Y2YA 4AS3A 3G9TA 1GPDG 2OCDA 4BV8A 2FG6C 2QMQA 2NOAA 3TWOA 1D9XA 3HDTA 1G5FA 1QVVA 4LSGA 1T5LA 1DHRA 3DE6X 5LC1A 5LIRA 3L0SA 2Q5FA 2AJLI 5BR7A 2OTCA 2AEMA 1KEVA 5UKDA 2C94A 3OPYI 1SJ9A 2GO1A 4P7GA 1HY3A 4NBUA 4MKIA 2ZSDA 4RORA 2G07A 3SXPA 3R6LA 5EHIA 4A26A 4B4VA 1TIBA 4C0LA 3C41J 2P5UA 2ZUEA 4IJMA 1XFAA 2VZ8A 2R79A 4KRYA 1I2DA 2F17A 2VK2A 5IDYA 4MAMA 4LRWA 4A1FA 4RSGA 2B1JA 1FNSA 2YMQA 3LK6A 4QYXA 5A3SA 4BVBA 3OZWA 1GNPA 3DKIA 4IWYA 2DTEA 3BKWA 4RDIA 4LQCA 4NU0A 1ICIA 3I2GA 2YMPA 1CTQA 4F9GA 4BNJA 4EY7A 2JZNA 1RRPA 2DKNA 1RWBA 2HF9A 2R00C 4KSCA 1XXHA 3AFMA 3LSYA 2F3RA 3AEUB 3CM0A 3DBHB 4XB1A 3UH1A 5A4KA 3RYFB 3BWXA 2H5IA 4OHWA 2O1XA 1RC8A 1XWWA 4RAQA 3D4PA 3UUGA 5HE9A 1ZEMA 4K9DA 4KW7A 1JW9B 2ZIXB 5SZIA 5HCIA 3AF4A 4QBTA 3I9MA 2HLHA 2ZSAA 4WLOA 2EW1A 2J8ZA 2R8RA 1OD6A 3C85A 3HJBA 3L6BA 3PFNA 3RO7A 3ZHYA 2QTWB 5U4XA 1GFZA 1B6RA 4PW0A 2HKIA 2FUNB 2FPIB 5HQJA 1DE0A 3VDQA 4D0RA 1M1XB 1VYTA 2IYPA 4ND6A 5TV2A 2CZCA 3BIFA 3PC8A 4CG3A 5IJ0B 4ZHQF 4KQJA 4LDJA 4XQ0A 1MO3A 5GJBA 4J07A 2P7HA 2CXTA 4RCVA 3LDGA 2GZ1A 4K9SA 3ZN2A 1ACMA 2VQ3A 4KGDA 4DDUA 3DMHA 3DJYA 1IQ0A 4D97A 1A8PA 4G4JA 2R7NA 4GNRA 1JG6A 3PUWA 2BZ1A 4N0MA 3FCCA 3ROEA 3U3DA 3V4OA 1H2AS 1EFVA 1NFRA 2ZYVX 4CQMD 1F2TB 3P9QA 5A2QA 4KBGA 5C5CA 1FS4A 1KAEA 4YMIA 2YQ4A 1CNMA 3IR5A 1E2EA 3N5KA 5FLEX 1UMDA 3MOGA 4BKQA 1YNSA 4M53A 4PNHA 3KFVA 4PONA 4XA8A 3E82A 1YFLA 4WXHA 1KDRA 5BSGA 3NORA 3M1AA 1CR0A 3U7EB 1XDWA 3KXIA 3BK1A 4A0SA 2YY7A 3B7GA 3DKPA 1T8SA 3KK0A 3UIEA 1JHMA 2YINC 4FGKA 1L7DA 4LISA 3LK7A 2CMFA 4Z8XA 2AHRA 4DUGA 4QGSA 5AK4A 3TM4A 1SBTA 4NJOA 4PWYA 1P91A 4QRDA 5DJ5A 3A3YA 1PYGA 3VZRA 1ZG3A 4REQA 4YYZA 1U9IA 3I5XA 1X8JA 2ZZKA 3MGBA 2C2OA 3I1YA 3Q0EA 3UAYA 1WY5A 2VUUA 4BNVA 1WW3A 4C6HA 3QEAZ 1IPEA 2ZSJA 2C7GA 4O8ZA 2J3JA 2CLSA 3RJMA 3O83A 4B3SB 1IG0A 2EJCA 1C41A 3A0UA 3FPEA 3JWEA 1RJFA 2P9ZA 3O91A 4JBYA 2RK3A 3FFTA 4MW1A 4PPFA 3F1KA 3SJZA 4BFXA 1JHUA 2QTZA 3J80A 3IS3A 3BMQA 2WYOA 5AM2A 1T3TA 3RUPA 2ASEA 3AUUA 3N05A 3NHZA 4AX8A 1K6XA 4L85A 5LP6A 3G2MA 1LPSA 4MV0A 3GUYA 2R7LA 1M66A 2IPLA 4IEFB 1EVKA 1RMQA 1PQPA 3P2KA 1GDDA 4MW4A 5E4JA 5EJ8A 2OCYC 3DTTA 3GPDG 5ER6A 2UAGA 1ATZA 3WYFA 2C4KA 1P2UA 3MMNA 5AW8A 2CFCA 1GPAA 4JP2A 5BR4A 2WA2A 3MLEA 1VPEA 2Q4BA 4OAOA 3VNRA 3X0DA 1MA0A 2HIGA 3CZ4A 2MYNA 1IHUA 2QX8A 1KAGA 2BEWA 4KQ1A 5F9MA 2YWRA 2J5KA 1NYLA 3PBKA 2F7SA 3PGMA 1EA5A 1GLGA 4NECA 3HP7A 2CKMA 4WZBE 1ISRA 3QHQA 4R16A 5AJYA 4BMDA 4HDCA 4OHPA 3U61B 3HCNA 4N3NA 1T26A 5CJJA 3GMSA 1E2KA 4KFTA 5BWLA 3U19A 2X1LA 4B2IA 2B1RA 2Y05A 4G25A 3H8SA 5IULC 1CR1A 4B8YA 2YVUA 4E11A 1JQEA 1F2UA 3FGOA 5K09A