3BHMA

Crystal structure of human carbonyl reductase 1 in complex with s-hydroxymethylglutathione
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
274
structure length
274
Chain Sequence
GIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human carbonyl reductase 1 is an s-nitrosoglutathione reductase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Carbonyl reductase [NADPH] 1
total genus 105
structure length 274
sequence length 274
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2007-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bhmA00
1M2WA 5C5IA 2P9GA 1UXHA 4GAEA 3G17A 4PVDA 1ZK0A 5G4KA 3E03A 3V8BA 3RJ5A 5TJ9A 1PIWA 1N7GA 3FBGA 3GFBA 3KHUA 4L4XA 3JD1A 3F5QA 4JGBA 4WNIA 4AJLA 4NFSA 3C85A 3ZV4A 2DUUA 2YYYA 4O1MA 2DFDA 3HZZA 3QVTA 2X86A 1CJCA 1LSJA 3QA9A 4QO7A 4J2OA 4ZQBA 5DOVA 1D1TA 3GMDA 5A06A 4YQZA 2J5RA 5KVVA 4D0SA 4GX1A 3K96A 1MLDA 2GGSA 1EEHA 3UCEA 2X9GA 3DBHB 1YJQA 1AE1A 4YRBA 1EVZA 1N9GA 1EQ2A 3CINA 3LLSA 3OJ0A 1N8KA 3H9QA 2AEJA 1TXGA 2Q1WA 3MOGA 2Y1EA 3Q11A 4EJ0A 5C3MA 1ZO8A 1LLCA 2CDBA 1VPDA 1ENPA 2G0TA 4JXKA 1HTBA 5TS3A 2VNSA 3MZ0A 2EWMA 5A9SB 3ZHBA 3H9EO 4EITA 2O4UX 2Y1DA 2AQKA 1DIRA 2DT5A 3OA2A 1R0SA 2X0IA 3QVXA 5DCUA 1D7OA 1T24A 4QFDA 3GG2A 3R1IA 3ZNNA 3HSKA 3I9LA 5A5FA 1LSOA 2HAEA 3PDUA 3OETA 3GC6A 1YH3A 3WGHA 2BLLA 1BDMA 1ULUA 2Q4EA 4IGFA 4UAGA 4MVJF 4NJOA 5HTOA 2ZTUA 1X15A 3PQEA 5ICMA 2BRUA 3SC4A 3ULKA 4LCJA 5B1YA 1F8FA 3E9NA 3GF4A 4TVOA 4UUMA 5IXYA 4RF2A 1E92A 2UVDA 2X0RA 5TQVA 3LZ6A 1D3AA 1ZW1A 2H9IA 3VPXA 4OIMA 2V6BA 5LDGA 4Y67A 3ENNA 4CQMD 3P5SA 1XLTA 1GCOA 4MVJH 1YJ8A 4MO2A 4DIOA 2QG4A 2BI7A 2JAHA 1U1IA 3IJRA 4CMBA 2F00A 4MVJE 4AICA 3EVTA 5FFFA 3SVTA 3ORFA 5JO9A 3GH3A 2IEDA 1V3TA 5ENVA 3UOGA 4CLOA 2PKRA 4CLXA 1ZXBA 4PGFA 3S2EA 3C7DB 3GFGA 4CLEA 4YYZA 4DYVA 5A1TA 1JTVA 1QV7A 1I2CA 1SOVA 4CM4B 5KOIA 2PZJA 1OOEA 1E77A 1KEUA 1I3NA 1ENZA 1U7HA 2J3IA 1HXHA 4ND5A 2NU8A 1IZ9A 4RVFA 1EDOA 2BI8A 2OUIA 4NK5A 1GEGA 4XRRA 2NACA 4QUKA 1P33A 1FK8A 4Q39A 1DOHA 3CE6A 4JCOA 4RPHA 2FP4A 4DA9A 5TLSA 4FFMA 1ENYA 5DBIA 4M89A 4WECA 4BNZA 4CQLA 4B4OA 1HE5A 1CETA 2VYVA 3UXYA 1HT0A 4B7CA 5IXSA 4W82A 5T57A 3NTOA 1BVUA 2X1HA 4XJSA 2BFPA 2DFVA 1IPFA 1QYVA 4DIFA 4BO7A 5JDIC 4IMRA 3IUPA 3I6QA 5A9RA 4AJHA 1FF9A 4XYGA 3DZJA 1ZNQO 1PQUA 5A9SA 3Q3CA 4CM8A 2IE0A 2NLOA 4YJDA 3WXBA 1M76A 5DCWA 3KEOA 2DBZA 1K3TA 4IY1A 4JJIA 2C82A 5K6AA 2FY8A 3GZ4A 3QY9A 4EUHA 5L9AA 1R15A 4PLYA 1KVUA 3K30A 2YUTA 4YB8A 1NR7A 4DMLA 2FR8A 3M1AA 3VH3A 2PH3A 4CM7A 4Y6PA 3HE3A 4Q3CA 5EQFA 1LQTA 2NQ8A 1SEVA 3DBLA 3GQVA 1C1XA 2XF8A 2PGDA 4AJ4A 4BO9A 4BGEA 9LDBA 2QRLA 4J2HA 3NDRA 1N7HA 4J6FA 2P2SA 4OXNA 4BKUA 5T6BA 2J5KA 1LQUA 2O4CA 5TX7A 3GNSA 4BOYA 2CY0A 5JY1A 2HDHA 1A71A 1YQGA 1HE3A 1KVTA 1ULSA 3PZBA 5MDHA 1PJLA 2I76A 3VH4A 1WLYA 1GY8A 4JBIA 5F1PA 3FD8A 5IG2A 4LVUA 4YCAA 3SXPA 2Y0DA 1ENOA 3FTNA 1UZNA 1CEQA 4YWJA 4FB5A 2V6GA 2JD2A 3IUSA 1G0OA 2JCVA 3BTOA 4XDYA 3ZDFA 2Q1TA 5JCJD 4MJLA 1TT7A 4I1IA 4MVJI 4AL4A 2V65A 1PWZA 4NDNE 3OSUA 1P74A 3LK7A 5F5LA 1BXKA 2HMUA 2B0JA 4DLBA 3S55A 1VSVA 4AG3A 4IDEA 2GRAA 4R41A 3HADA 4BMNA 1O89A 1I30A 4MKZA 1XEAA 3NTQA 4RZHA 4MDHA 4BO1A 3PIDA 4GMFA 2CF5A 3Q9NA 4TWRA 4Z9XA 2WYWA 3BMQB 3I9OA 5JMWA 4CV0A 1BDBA 2CDCA 2ZIZA 4A0SA 2Y1FA 5COBA 4CJXA 4Z6KA 2PK3A 4XQCA 5KVCA 1C1DB 3D4PA 3E6AA 5JDCC 4E2XA 2XOXA 2HMVA 2BMAA 2Z1MA 3RFXA 1EE9A 4P38A 5H83A 4WOJA 4BO6A 1C0IA 1GAEO 1E7SA 1B26A 4YAIA 4AJOA 1GL3A 1EBFA 1QORA 4A2CA 2FWMX 3EW7A 4E2ZA 1ID1A 2DPHA 5JW6A 4CMIA 1W73A 2VWPA 2NSDA 4XD2A 3BMNB 4YQYA 1D8AA 4JN6B 2GSDA 1NWHA 2DPGA 2V6MA 3QVOA 5KJCA 1E5LA 3CH6A 3VKVA 1N1GA 4W9NC 4CM9A 3I9NA 5I9NA 2X9NA 1B3BA 4NG5A 1XIVA 4CM1A 4J9UE 3PK0A 1HYHA 3NTRA 4KDEA 4NIMA 4BMVA 5TT1A 3D3EA 4R9RA 3INGA 2I3AA 4J4TA 1CQJA 3M6IA 2Q46A 3N74A 1LRJA 3WGOA 4E12A 2YJZA 2X8LA 1E7YA 3EUWA 4BQPA 1EUDA 1ZMTA 3LT0A 3U3XA 1YB1A 1Q7CA 2GD1O 4C4OA 5DP2A 4IDDA 4QFCA 3GUYA 1LJ8A 5JCXA 4WCFC 4F6CA 4MP8A 4HV4A 1I8TA 3KETA 1X7GA 5KKCA 3K6JA 4ONEA 1FMCA 1R12A 4FDAA 3AI1A 2VTEA 2IYOA 3OHSX 1E5QA 5CG1A 1EVIA 3QLJA 4E31A 2Z1NA 1A4UA 4DBZA 3M2TA 3VTFA 1U2DA 3UICA 5KJFA 2YHIB 1ZSNA 1LXCA 1RM4A 3BMQA 3IQDB 3D5TA 3ONFA 2VZ0A 1DIGA 1WAMA 3I9JA 3KYDA 3TPCA 1XCBA 4J4HA 4DQXA 3WIDA 4AFNA 2XXBA 2BGLA 3ZNQA 2HK8A 2GN9A 4DL9A 1FJHA 4G81A 5DCYA 5TGDA 2PNFA 4DXHA 4FFPA 1S7CA 1PZEA 3A9WA 1C14A 3F1LA 2VCYA 1J6UA 2D59A 3K31A 4EUEA 3QE3A 5CDGA 5THQA 3DXFA 1T4DA 1BW9B 4KTTE 2O3TA 2NTVA 3C8MA 4E5KA 1JVBA 3K92A 1NPTO 4NBWA 4ZHSA 1RM0A 3BTUA 4U8GA 4LK3A 1BSVA 1VE9A 3RU9A 3GA0A 3RUHA 2GCGA 3L77A 5GZ1A 5A3VA 4PLFA 4HKTA 4UVIA 4YVFA 1Z45A 3U0BA 1CQIA 4G5HA 1O6ZA 1BWSA 2OP1A 2FPGA 4NZ9A 2GNAA 3VZSA 5CDTA 3L4BA 4OSOA 3HHPA 2PD4A 3EY4A 1TVEA 4B3IA 1M66A 1VJTA 3NAQA 1MGOA 1P1IA 4UVGA 3MJTA 5LCXA 4XRGA 4NBVA 3TZKA 4GX0A 5EPOA 2AA3A 1C0PA 5JYEA 4PLPA 2VWGA 2X0NA 3GVXA 5KJEA 4TMFA 3TZ6A 1MC4A 3SLKA 2BH9A 5TNXA 3JQ7A 2OP0A 3E1KA 3ITDA 1Y5MA 4IPTA 1GYQA 1M75A 1Y7TA 4Y6RA 1F14A 5ADHA 3ZW9A 1MC5A 4KTVE 2O3RA 4DLAA 4K6CA 3CXRA 4XYMA 4IDFA 4A03A 1NPYA 1YXMA 5THKA 4PG5A 3S1LA 2DBRA 1T2AA 1SO8A 4OQZA 2FHSA 4WK6A 1Z74A 1ZBQA 5AXBA 4R1SA 1H9AA 4BKOA 1GYRA 1Y8QB 4WLEA 2DVMA 1M6WA 2VWQA 2PR2A 2P91A 2CD9A 2I3GA 1EVJA 4R5HA 3WG9A 4BO4A 4IBOA 4NFYA 3H6KA 1D4FA 2E82A 3NJ4A 1B15A 4JBHA 4UVDA 3WGIA 3IP3A 3ONDA 3OJOA 2DQ4A 2W8ZA 4OH1A 3WGZA 3NT4A 2D1YA 5CDSA 4OKIA 3U49A 3PHLA 2JCYA 3KBOA 1MX3A 4I9HA 1NQ5A 4HX5A 4MVJM 1QYDA 4YR9A 3HQ4O 4Z3KA 2VYVD 1RKXA 4BS9A 2J5QA 3CMMA 3U4IA 3PWKA 1LU9A 4CUKA 2VT2A 2W2LD 2AEMA 2PTGA 3BIOA 3BMCA 1E7RA 1DC6A 1GV1A 3NDJA 3FNHA 1UXGA 2I5PO 2OL4A 3EZLA 4UULA 1TLTA 3NGLA 1I01A 5G0SA 1I32A 1E1MA 1I2ZA 5L7TA 1FDWA 3TF5A 1F8GA 1DHRA 2VOEA 2O7SA 3EYWA 4DC1A 5F21A 3LQFA 4L4RA 3TZQA 3DBHA 3ZWYA 4Q3AA 5IN5A 4Z0TA 3GNTA 3H9GA 2FZEA 1KS9A 2Y0CA 2NVBA 3DBRB 3IKVA 3O8QB 4MVJA 5T5QA 2RIRA 1PR3A 3COSA 4DREA 1LDYA 3ROKA 1A7AA 3CZMA 1C1DA 3QVSA 1U28A 1LRKA 3QIVA 3DBLB 1WP4A 3GDOA 1XYGA 1HSOA 3RAJA 1B16A 1ZUD1 4DTIA 5FF9A 2WMDA 3G3EA 4PZEA 3ZV5A 2RAFA 3LSYA 1T2FA 4LISA 1WDLA 5A02A 8LDHA 2ZK7A 3NGXA 4B4WA 4E21A 3IAHA 5HS4A 5JLAA 1PQWA 2EG9A 1DRUA 1DBVO 1GDHA 3BMNA 5ILGA 2A94A 4CLHA 4E5PA 1YONA 3AFNA 2O23A 3KZVA 3V2GA 3U5TA 3DOJA 3FSRA 3RUDA 5IFLA 1DFGA 2Q1SA 4D45A 2WSBA 5TIIA 5DNAA 2HMTA 2O48X 4GGOA 3EMKA 1XWFA 1P1HA 1KBZA 3GEDA 2AE2A 4A27A 1G0NA 2GDZA 3K2BA 1NPDA 2ZJ1A 3HDQA 4DGSA 5A3JA 2PKQO 4TSKA 4YBZA 5L4LA 1VL0A 1ZCJA 4JLWA 1U7TA 3PJFA 4QX6A 3PI7A 4I9NA 2EGHA 4YJFA 3HB5X 1YL7A 4HFJA 3WB9A 1C1XB 5IF3A 3QRWA 1CRWG 5KKAA 3I4FA 3NDIA 3NT5A 2JHFA 3PQFA 4HADA 4TRJA 1LRLA 4XR4A 3ZU2A 1JLLA 3TOXA 1YOVB 2R00A 3U9LA 3ANMA 3ZWNA 3AI3A 5H81A 1QKIA 2X58A 2YV2A 2EKPA 1DJNA 4PLWA 3ROPA 2WD7B 3DAFA 3FPLA 1VL6A 3GVPA 4OKNA 4OOEA 3AOGA 4IJKA 1XA0A 3L0DA 1Z73A 2VQ3A 1NQAO 1R66A 4M54A 2QRJA 4CMHA 5BNIA 4K28A 5HS6A 1PGPA 1UAYA 3CPSA 3MWEB 3VPGA 2YHIA 3WWZA 4E5YA 1R0LA 1MFZA 1HLDA 2Y1GA 2P9CA 4YA6A 4K9DA 5F3RA 4B8WA 5I9LA 1IL0A 3DTTA 4IQ0A 4ZA2A 1V6AA 2E6UX 4IGEA 3IKTA 4BGUA 4IS2A 3ICPA 3UUWA 3ZCXA 3OIFA 5F5NA 2SCUA 2OFPA 4JROA 4ZQHA 3TN7A 3AWDA 1HRDA 1GUYA 1XU7A 2ZJ0A 3TFOA 3Q6IA 3PTZA 4ZJUA 1HE2A 3AOEA 5FI5A 4HP8A 2IEBA 3P2YA 4HFRA 1YB5A 4R9SA 2B4QA 1NVTA 4II2A 4FN4A 1WDKA 1R4NA 3D7LA 3KM0A 4UREA 1I3MA 2NVUB 4E5MA 3JD0A 3FWZA 4IXTA 3L07A 4XGNA 4F45A 1ZJZA 3PWZA 2Y66A 1ISHA 3E9MA 5CAEA 3K2EA 1RWBA 2Q2VA 3GRPA 4W9NA 2VHZA 3WR5A 2EV9A 3EK2A 1I0ZA 3UVEA 4K6FA 4R16A 4CLOB 5ILOA 2AG5A 3RWBA 3BMCB 3WTCA 3ZWBA 3WWYA 1W6UA 1V3UA 2DTDA 3H5NA 5ER6A 2PGLA 2GN8A 4OQYA 4M86A 5A5EA 3JQGA 3WQSB 4OXKA 1P1JA 1JAYA 3FNEA 3OIGA 3JQ8A 1U5AA 5JAQA 3PYLA 4W99A 4NH4A 5CEJA 4FJ2A 1YOVA 2WE8A 4WEOA 3RKUA 1KVSA 1Q1NA 2IRWA 1VC2A 2I99A 4YEDA 4J1TA 4GLLA 1X7DA 3ZU3A 4CUZA 1U3VA 2AMFA 3HB4X 1E6WA 1ARZA 1HDXA 3H2SA 1PL6A 1QMGA 4DPLA 3AU9A 4R69A 1GADO 1ADFA 5F1OA 3DBVO 1NNUA 4N5MA 3GRKA 4UEJA 2QYTA 4RVHA 2WM3A 4XX0A 2VZ8A 4ILKA 3OECA 5A4DA 4ZQGA 2FMUA 1WMAA 4BNYA 2H63A 4WJZA 1BW9A 3D3WB 3TSCA 1Y5RA 2NVUA 2HK7A 1Y6JA 2P4QA 2VRCA 2VOJA 4ALLA 4BNMA 4DPKA 5TT0A 5L7YA 3OBBA 3ZHYA 1LC3A 4FCCA 3JQFC 1NASA 1OI7A 4ZICA 1ADCA 1YL5A 3IS3A 4NR0A 4BNVA 3AU8A 4BNUA 4N54A 2I6TA 4J1NA 1LX6A 1NYTA 5I7EA 5JC1A 3OMLA 2VHXA 1X14A 3V1UA 3I23A 2DLDA 1U3WA 3PVZA 4FQ8A 3DMTA 1WZEA 5DP1A 3ZGYA 4BO0A 5JE8A 4I5DA 2VZ9A 2EW8A 3VH1A 3JQBA 3A28A 4Q9NA 3U4DA 1GZ3A 4EI2A 2Q99A 4S1VA 5DOZA 3TL3A 3NX4A 3IJPA 1SZJG 1JKJA 4CR6A 4GWGA 3WBBA 3WGTA 3B1FA 3F9IA 2AQIA 4ALNA 4AJPA 2OGUA 1IUKA 2V7PA 1IPEA 1F17A 4D46A 4FIZA 1P3DA 3GEGA 1EVYA 2VHWA 3DAPA 5KWEA 3TDKA 2GZ1A 5CPBA 4CM4A 4CMKA 4GWKA 3ON5A 3EGOA 5A9TA 1P1RA 2WD8A 1FDVA 2HSDA 4GVXA 1GZ4A 4LRTB 2Q50A 1HDGO 2W90A 3OA0A 4NI5A 4PN3A 4BKPA 4DQUA 5BSGA 2CDAA 3JTMA 3AY7A 4HWKA 1UXIA 1DLJA 4J9VA 3GGGA 4JP2A 3GG9A 3ZNOA 1OC2A 3OEWA 4WASA 1AUPA 1RYDA 2VRBA 4MPDA 1EBUA 4B8ZA 5L3ZA 1TA4A 3RBXA 1GV0A 5TSDA 5IZ4A 1GCUA 5ES3A 4FR5A 4Z3DA 4DYDA 3AUTA 1UP6A 4YT8A 3BHJA 2EGGA 3KYDB 4L74A 5H82A 1DFHA 4JJGA 4CQLB 3KYCA 1Y1PA 4L9RA 1HZZA 2HRBA 1KC1A 4P4NA 5BSEA 4UVHA 3FBTA 2P68A 4CUJA 3E48A 4L4SA 4PLZA 3DMYA 4UUOA 5B4VA 3C24A 3IOYA 3JQGB 4TKMA 1LDGA 1E1LA 1PU2A 3VDQA 3NT2A 4W7HA 4J90A 2NU6A 3TZHA 3UHAA 2G76A 1A72A 1LDEA 4K1LA 3GR6A 1KOLA 1JKIA 4H3VA 1EQUA 2LDXA 3L6DA 3JQAB 2UYYA 1NQOA 2WYVA 1Y9EA 4X54A 1DC4A 3RFTA 2P5UA 3T7EA 1UR5A 4AJ2A 1KETA 4RDIA 1AXEA 4ZQFA 2Y05A 2I67A 3H4VA 3LU1A 4J3FA 5DN9A 1ZEMA 2AQ8A 4BV9A 4CQMB 3MTGA 3OJFA 2B4TO 4W7IA 1AGNA 1VJ0A 1HDCA 4PLHA 2QRKA 1EMDA 2B4RO 1IY8A 3WYBA 2YY7A 1E0DA 4UEOA 3PQDA 2NTNA 3PHJA 3UAGA 4AJIA 3DONA 2HJSA 3HFGA 3ANNA 1NQTA 1I33A 5JPIA 2C7GA 2J3JA 4XIJA 3OIDA 2W98A 4CLDA 5BR7A 4RVSA 2CMDA 3CKYA 4R51A 4XEHA 4D42A 5HA5A 1PJTA 1E7MA 3EDMA 5JDCA 4CMAA 5L4SA 2A35A 1QG6A 5JY6A 4PVCA 4QEDA 4A73A 4ZVVA 4R54A 3HDJA 4N5LA 1YS4A 2VNAA 5BSFA 4U0KA 1TB4A 3VPHA 2X0JA 4Z0HO 1Z82A 1GQ2A 4RPJA 3OEYA 4KP7A 4LW8A 1G1AA 3IC5A 3ZWWA 4PRKA 5G0UA 3AJRA 3PJEA 3VPSA 4L75A 5JYDA 1ZVMA 2AE1A 1UZLA 2FR0A 4OO3A 1B3RA 2UDPA 3JQ7B 3HWRA 4GKVA 3VAZA 3ZZNA 1IHXA 4PG6A 4F46A 1YB4A 1TT5A 2EHDA 4J7UA 3QWHA 3JD2A 1AXGA 4ZD6A 5AVOA 4EJMA 3W4IA 5KNLA 3DO5A 4ZRNA 4CR7A 2HCTA 3WMWA 1EUCA 2UV8A 4MVJP 5U1PA 4H16A 4RVDA 3S2FA 1K6JA 4R68A 2NTJA 4FGSA 1PTJA 4LRSB 2QHXA 3TWOA 1LA2A 1E6EA 1P0FA 1T1SA 4KWHA 4KUEA 2NU9A 1H6CA 4Y9DA 3UCXA 1V0JA 2VUSA 2B37A 3CTMA 4DIBA 4BGIA 3WLEA 3AM5A 2PFGA 4CODB 4XA8A 3ST7A 3KB6A 4GSKA 1MUUA 2G5CA 2QX7A 3K5PA 4F6LA 4XYLA 1TT5B 4TQGA 1OC4A 1P31A 1KERA 3DR3A 3MJ4A 2B35A 1HYGA 4E33A 3A1NA 4AJJA 4P22A 4YPOA 1VSUA 4EGFA 3G1TA 1UDCA 3HUDA 1SEPA 3OFSA 3RC9A 3SEFA 3LT4A 4O0LA 1GZ6A 3P19A 1IE3A 4XR9A 3Q9UA 3D0OA 1NVGA 2GF2A 4UVEA 1Z7BA 1OZAA 2W4QA 5GZ6A 2Q45A 2ZYGA 1NX6A 1A4IA 5JSFA 1I2BA 3RUAA 2HLPA 4YRAA 3GAZA 1KC3A 1RYEA 3BAZA 3UF0A 5B4TA 2EP7A 4IINA 5CEEA 5EQDA 3HNPA 2NQTA 2PZMA 2PGJA 4TKLA 1H6AA 3BHMA 3BA1A 2BFOA 1WNTA 1T1RA 1DLIA 3GK3A 1RM3A 2WE7A 4GI2A 3V5NA 4QT0A 3D64A 1T4BA 4C7KA 4CMIB 2OOSA 2VRCD 3PFWO 4YJHA 4R4JA 3WFJA 5AXAA 5JFOA 2C5EA 3ETEA 2GZ3A 4PIVA 3S2IA 1EDZA 1YBAA 1YL6A 2BHLA 4GSLA 3MTJA 2X6TA 5BSHA 1XQ1A 3KRTA 4FS3A 2C5AA 2DKNA 4C7JA 4U6QA 1B7GO 4Q3DA 2DC1A 4BNHA 3JCZA 2O2SA 2CFCA 3DEYX 1MXHA 1U9JA 1GTMA 1FDSA 1GFSA 1HDZA 1ZK2A 2PD6A 3HDHA 3LVFO 4N5NA 2IZ1A 3WFIA 3ZWMA 3RC1A 1IYZA 4ZU3A 2D4AA 4D3FA 3MWDB 4L73A 1C3VA 1HLPA 2C2YA 2ZATA 4RZIA 1GR0A 1EFLA 2AEFA 4JX8A 4L0QA 4EUFA 2NM0A 5AYVA 3ZWOA 2IYPA 3GZNB 3Q0EA 2JD0A 1EK5A 2JAPA 3FWNA 3PJDA 2HK9A 1QP8A 2EKQA 2CVZA 2ZB8A 1BG6A 3D4OA 4GMGA 3VDRA 3OH8A 2WDZA 4MOWA 2Y0EA 5JAIA 4UUNA 5JS6A 1VRWA 1T2CA 5JMPA 3H65A 4ZN6A 1NHGA 2PD3A 5A05A 1WZIA 3RKRA 1UUFA 2AXQA 2C20A 4PFJA 1CWUA 4IZIA 8ADHA 3NV9A 3RI3A 1UXJA 3UCFA 3U4HA 4B4UA 3AM4A 3LF1A 3BZUA 4KZPA 3ZI0A 3I52A 4GLOA 4EEXA 1FXSA 1H94A 4JNKA 3LYLA 3GUCA 1XR3A 2VWHA 2B83A 4I9UA 4KQXA 3ABIA 4GVLA 1YO6A 1LEHA 1QYWA 4IQ8A 4RDHA 1HSZA 3JQFA 1YWGO 3PHIA 5B12A 5AXDA 3ADPA 1X7HA 4J1QA 2ZB3A 2E37A 1F12A 2IODA 2ZCUA 1E1KA 4YAGA 3OICA 3FNGA 5C7OO 4CM5A 1NFFA 2XPCA 1DSSG 4IIVA 4B7UA 1P9LA 3C1OA 3A14A 4IJVA 2C07A 5A03A 2EEZA 1GPJA 2Y67A 5AQ1A 4TRNA 3WLFA 1ZEJA 4RF3A 1RPNA 1GQQA 1VJ1A 1IULA 1U8FO 1ZJYA 3M1LA 3GGPA 2D5AA 4KMSA 5G4KB 3RIHA 1KVQA 1GQYA 3W4KA 2GN6A 3QWIA 5T8KC 3W4JA 1MG0A 3JYLA 4S3MA 1ZK3A 3H9UA 5L95A 3C7CB 4YDRA 4FFNA 4HFMA 5U4QA 3JQ8B 3HJAA 4ZGWA 1BMDA 2YDYA 2H1SA 2AHRA 2Z95A 3F4LA 3Q2IA 5ER9A 1LTHR 1O95A 1Y9AA 1QR6A 4CL8A 5ENDA 3OJEA 4R1TA 1M67A 3S2GA 4RORA 1W8DA 4E4YA 3PGXA 4JIGA 3SC6A 3N7UA 3V2HA 1TI7A 3FHLA 3RUFA 4Z0PA 2ZYAA 1PWXA 3KSDO 3L4BC 2UUOA 5F1KA 1NAHA 3B1JA 3BXXA 1LLDA 4BHTA 1PR9A 4CV2A 5JO0A 4XCVA 4IUYA 3B6ZA 3WYEA 4BO5A 3GHHA 1XHLA 3B20A 4II3A 4RPKA 5IZCC 5J23A 4DRYA 3JD4A 2DTEA 4NHEA 3NJ8A 1RJWA 1PSDA 5L51A 3VPFA 5K6AC 4ND3A 1Q0LA 4TZKA 3FR7A 3BTVA 1P45A 1JA9A 1PGJA 3KXDA 2HJRA 4G65A 3VH2A 5JBIA 2Y1CA 2G17A 7ADHA 5U9CA 4HNHA 4EBFA 2DUWA 1OFGA 2Q1UA 1CF2O 4J1SA 1NTOA 1V35A 2O7QA 1KEVA 4DQVA 3WNQA 4NPCA 2A4KA 3FF4A 4XQEA 3WJ7A 3ITKA 4ALJA 2D8AA 3DZHA 4RO0A 5GZ3A 3B70A 1WPQA 3JYQA 4I5FA 1JW9B 1H6BA 3PIIA 1NHWA 3G79A 3I9MA 4WE3A 1I36A 4D41A 2BFMA 4JQCA 3SLGA 1ZMOA 4ALKA 5BNTA 2JHGA 4M49A 1NFQA 4DMMA 4RGBA 2GYYA 1JVSA 2X5JO 5T64A 3PRJA 5KJ6A 3DHNA 4HUJA 1LDMA 3E8XA 3KTDA 3RROA 3VZPA 2O3QA 4D43A 3DB2A 4NBTA 3H5RA 4GPD1 1UH5A 3OP4A 4LGVA 1N1EA 1W0CA 1UAGA 4CMEA 3WQQA 3GAFA 1DB3A 3R3JA 1BXZA 1T2DA 4PCVA 3WSVA 4NMHA 1ADGA 3DFUA 4ND4A 4OM8A 1PGQA 3O38A 1UP7A 5DBFA 3W1VA 1DIBA 2WD7A 4ZRMA 1WW8A 4A10A 4DPMA 5IAAA 3IL2A 4E5NA 1EK6A 5FYDA 3SJUA 4FJ1A 1PJQA 4CV3A 2JFFA 1UDAA 2NU7A 1OBFO 2YFHA 4JJFA 2FR1A 1GYPA 1FDTA 1NFRA 1LDBA 4FFRA 4E2WA 4CPDA 3BYZA 3O9ZA 2JJYA 1ZIDA 2EJVA 2GERA 2X23A 3JQ6A 5JCJA 1R4MB 4GX2A 4JK3A 1WWKA 3PFFA 4LMRA 3ICCA 4YT4A 3QVWA 3GMSA 2WEKA 4RPGA 3UFXA 4BL5A 4IZHA 2GO1A 4ROSA 5DDIP 5IDWA 4CV1A 2FSSA 3GN1A 2X22A 1QLHA 3ZHZA 4BB5A 3F6YA 2ZTMA 3AW9A 5K0ZA 3ROQA 1K0UA 4CLRB 3PWSA 3DTYA 2TMGA 5KIAA 2Q2WA 2HKIA 4NU6A 4J49A 3WNVA 4GQAA 5G0VA 1B2LA 2OBYA 4R3WA 3SBOA 3VVCA 3OQ1A 3O03A 3DHYA 5KJ1A 5GY7A 1H2HA 1MP0A 3EVNA 1KYQA 4M87A 2IXBA 1O5IA 4PZCA 4JP3A 4WCFA 1UDBA 4CQMA 1QYCA 4Z9YA 5IDQA 2PA3A 1J5PA 2ILTA 3WJAA 1K2WA 3WTBA 4O6VA 4U5QA 1V3VA 4YT2A 3C1TA 1ONPA 3I83A 3O4RA 3PEFA 4RPLA 1QYXA 4WKGA 1GEEA 3VKUA 2Q49A 4WGGA 3LF2A 4WLOA 3H7AA 1LC0A 3ZWXA 3PPIA 4XQ9A 3O26A 3TRIA 1DFIA 1VI2A 3DWFA 4BUCA 2HMWA 2FOIA 3PDJA 3ZN2A 3L9WA 3OJLA 5FWNA 2BF7A 3AY6A 2NWQA 5BNFA 5HRUA 3AUSA 4AJKA 3CSDA 5EERA 1NP3A 5I7SA 1MG5A 4YTEA 3QWBA 1LLUA 1NAIA 2HU2A 4LMPA 2I66A 3E82A 1XU9A 5KCZA 1D1SA 4NJMB 4QXMA 1DRVA 1F0YA 2RHCA 4HFNA 3UGKA 4WOKA 3ZU5A 4IS3A 3I4CA 1QV6A 1VKOA 3R6DA 4OAQA 1BHSA 1PS9A 3IP1A 2BGMA 1JWBB 1U3TA 2NV6A 3C3XA 2WJPA 3PP8A 1QXSA 3WGGA 2VTDA 1ZKMA 3HFSA 1ISMA 2YQ5A 1DXYA 5L53A 2J3HA 5B4UA 1H9BA 5BT9A 5GMOA 3MJCA 1T26A 4WPGA 2PLAA 1JWAB 4E30A 1U3UA 3GT0A 4IXWA 3WGQA 4BVAA 4EJ6A 3JD3A 1HEUA 3QQPA 1YVEI 1HWYA 3F47A 3FNFA 4LCEA 1EFKA 1ORRA 3GN2A 3ROMA 1VM6A 5L4NA 4R3NA 4PG4A 1XQ6A 1K5HA 1V8BA 3TNLA 3JYPA 1LNQA 1G6KA 2C2XA 4IMPA 5COQA 3AUUA 3R3SA 1HE4A 3WGYA 1Y8RB 1IHYA 4IDGA 1Q0HA 5FI3A 1CERA 1YRLA 3LC2O 2X7HA 1ZH8A 3CIFA 1WXDA 2A9FA 5T67A 1J49A 3OM9A 2A92A 2B69A 3PJGA 3VZRA 1AN9A 1LDNA 4ALIA 1DAPA 1MXFA 1R6DA 4BNTA 4CM6A 4MIEA 3WS7A 2B5VA 4FC7A 2P5YA 2CSUA 4WUVA 4Q3EA 1O94A 2D3TA 3GEMA 3RUIA 4OXYA 1DRWA 4XWYA 3K9QO 3U62A 4N7RA 4JBGA 2ZTLA 4D0RA 2FPIA 4OYRA 3ZV6A 2E49A 3TJRA 2VT3A 4B3HA 5C7LO 2RH8A 1HETA 3KYBA 5TF4A 3T7CA 2QZ9A 1UP4A 2OHXA 4TZTA 2PZKA 2OBNA 4WLUA 3CMCO 2ZQZA 1N92A 2RHRA 1T25A 1I5RA 2NADA 3W6ZA 5KVQA 3Q1LA 1DPGA 4O63O 1LLQA 3HN2A 2OXIA 3RJ9A 1ZSYA 2X4GA 3MJSA 2W2KB 3CZRA 5ITVA 3FTPA 4D3SA 4BKQA 2GASA 3TQHA 5C37A 1A9YA 4BO8A 1ONNA 4IM7A 5AXCA 3EZYA 2EXXA 4O59O 3TFQA 1HDOA 1XSEA 1MA0A 3DFZA 3QWAA 3PYXA 1HYEA 1PGOA 2ZKLA 1R16A 1VLLA 3INRA 4MINA 3WIEA 1IZ0A 3WX0A 1Q7GA 2D5CA 2ZQYA 1ADBA 1MV8A 3DBRA 5CP8A 4ITUA 4OMUA 5IJZA 2WYUA 2X5KO 4OL9A 5G0WA 4PZDA 4B4VA 4BNXA 3FN4A 1R4MA 2FSVA 3H9JA 2Q2QA 4U6SA 2PKQP 3DZBA 2D2IA 4FPXA 3TZCA 2JFHA 3HG7A 9LDTA 1E3SA 2NNLD 4RQTA 3SJ7A 4J16A 2P4HX 4P8RA 5HM8A 1SMKA 3GDGA 3JQ9C 2F1KA 1YBVA 3VVBA 1BTOA 1X1TA 4YJGB 2QZZA 1EZ4A 2NVWA 3T4EA 3RASA 2CUKA 1O8CA 4BNWA 3ASVA 5JC8A 4H15A 2ZTVA 4AJEA 4BGVA 4MKXA 1O0SA 3E5MA 4CR8A 4OSPA 3RFVA 3WICA 2G82A 1U2GA 4OJNA 3KV3O 2QQ5A 3ZU4A 4YAEA 4ALMA 5EESA 3JQAD 1PJ2A 4KOAA 1DDOA 4QSMA 5TJHA 4M1QA 2JL1A 4P4GA 4RF5A 1PJ3A 2Z5LA 3ANLA 3ZW8A 3QV1A 3VC7A 1MFPA 4XYEA 3I5MA 4E3ZA 3G49A 3RBZA 1ISJA 4XZ3A 6LDHA 1SPXA 3MCVA 2Y1OA 1VKNA 2HUNA 5G2OA 4EZBA 1X1EA 2VUTA 4PLTA 1Y8QA 5JNLA 3TL2A 1OMOA 3HN7A 1X13A 2Q3EA 4E32A 1U8XX 2CNBA 1U4SA 4R1NA 2AW5A 2JCXA 3RC7A 1PGNA 1CYDA 3RC2A 4BV8A 3JQDA 4CMCA 1E3LA 3UN1A 4MVJG 4NJMA 4DVJA 5JAMA 3GNQA 1P44A 3NRCA 1PJBA 2X5OA 1E3WA 1PS0A 4AJ1A 3QJ5A 4FSHA 4KQWA 3UH1A 4ESOA 3MJVA 4M55A 2R6JA 1P1KA 2PZLA 3EAGA 4OOFA 3DZFA 1N9GB 2Y93A 3PLRA 4J91A 1ZXLA 4D44A 5L7WA 4KUGA 2HO5A 2YW9A 3U4CA 3H8VA 1SCUA 4ID9A 2E48A 1F06A 2E4AA 2DBVO 4NFHA 2CVQA 2DAPA 2YFQA 1N5DA 3DZGA 4CMJA 1ZFNA 2XAAA 4RJTA 1MB4A 5ICSA 4PLVA 4A26A 2R00C 4TRMA 4AJNA 2C54A 1SOWA 1K6XA 4RLHA 2YQ4A 1GUFA 3LLVA 3N58A 1R0KA 5LC1A 1VL8A 5G4LA 5ITWA 3F5SA 3PHGA 4F3YA 5KTKA 1HZJA 1AHIA 2EW2A 4RF4A 3C1AA 1A5ZA 1V9LA 3O8QA 2GR9A 2VYND 5I8ZA 2CVOA 5I8WA 1PX0A 3ETGA 1U4OA 1HL3A 3VHRA 5MGBA 1KEPA 3GPIA 3FRJA 2YV1A 4RV9A 3QHAA 4WLFA 1I10A 4RLSA 4XKJA 1ZK4A 3KEQA 3PYMA 4DWVA 1BXGA 5AOVA 5C7IO 1SC6A 2FZWA 3NKLA 5I7VA 3U09A 1PL7A 2NUAA 4W6ZA 4FBGA 1ISGA 1UXKA 4XGIA 1IB6A 1A27A 4MP6A 4EYEA 1A7KA 2ZB7A 1XG5A 4XYBA 4PLCA 4WNCA 5EJ2A 1Z6ZA 2BFAA 2O3JA 3KSZO 3FCOA 4NK4A 1LUAA 3FR8A 4KUHA 1B8UA 1GPDG 4TROA 1NWCA 4TRRA 1BRMA 1H2BA 3AOEC 3DOOA 4HXYA 3AUAA 3Q2KA 3TOZA 1HDYA 1DEHA 2EJWA 3IMFA 4J43A 3RQSA 1I3LA 3LT2A 3NYWA 1B8PA 4CLRA 1BXGB 2ZCVA 2AG8A 2ZB4A 2FPPA 4TVBA 3I9KA 2EP5A 1LBEA 2VHYA 3F3SA 3VZQA 5KVSA 1JAXA 1Q7BA 3AY3A 3OQ6A 1L1FA 3DAGA 4NU5A 4QO8A 2JKVA 4EW6A 3WDSA 3HDYA 1PEDA 3ETDA 4MP3A 2YZ7A 3RCBA 1L7DA 5LDHA 4BNKA 3JYNA 3ONEA 3DHEA 5DZSA 2POQX 1PJ4A 2GN4A 4CM3A 3KOUA 1DC3A 1UJMA 1XKQA 3KLMX 1E7QA 3KO8A 3MJEA 4FD3A 3H3FA 1PZFA 2IZ0A 3RBVA 4Y98A 3RVDA 3B1KA 4DBVO 1I24A 2AQHA 4L8VA 4YAKA 2O50A 3BMOA 3JV7A 1I3KA 1DC5A 3JYOA 4Y6SA 1YQXA 3W8EA 2QIOA 1NBOA 4XGKA 5BQFA 4IQGA 1HF3A 2EERA 2B5WA 4J7XA 1W4ZA 4QQRA 4XB1A 2YV3A 5JAZA 1EUZA 1YKFA 4B7XA 4CMGA 2BGKA 1B8VA 2PWZA 4YAJA 3STHA 2DU8A 3OF2A 4N18A 5EN4A 3L9XA 1UZMA 2O3SA 3H5AA 1P77A 3WSWA 3P7MA 3ZWAA 5IDYA 1XELA 1M6HA 1KY5A 1WVGA 1DIAA 1JDJA 4ND1A 4WLNA 4BO2A 1HKUA 4YXFA 1H93A 2BD0A 4RQUA 1L7EA 1ML3A 5EL0A 3AI2A 3X2EA 2FRDA 1CDOA 1LSSA 4BB6A 2C7VA 1XGKA 2VYNA 1DHTA 1XDWA 2V6FA 3A06A 1E3WB 3JQAA 3DMTC 4B3JA 5T8KA 3JQ9A 4UEKA 2C29D 3GVHA 3JQBC 3F1KA 4LN1A 4PRLA 2G1UA 1KY4A 1Y81A 3GDFA 2J3KA 4PLGA 2C0CA 1YE3A 3GHYA 2IDZA 1N2SA 1SBYA 1E3IA 4BNFA 1PQPA 4FFOA 1P1FA 4Y8VA 1FDUA 3ADOA 1QRRA 3NUGA 2WTBA 2I9PA 3LC1O 4IIUA 4WEQA 5CDYA 4FFLA 1ZK1A 2W2LA 4IDAA 3KLPX 4OGWA 3RUCA 3D4NA 4WCFB 5L45A 3I3OA 2PY6A 2GLXA 3C7AA 6ADHA 3KYCB 1RM5A 3P2OA 4WLVA 2Q4BA 4BO3A 2R2GA 1AHHA 3G0OA 5TC4A 3V1TC 5I7FA 3EHEA 1TEHA 4YJFB 5EMHA 3K8ZA 2PV7A 3AM3A 4R5MA 5CHEA 3ZWVA 5JDIA 4O5OA 3WQRA 2J8ZA 4E6PA 1H6DA 3RU7A 1PS8A 3BMOB 1DJQA 3LC7O 1E6UA 2VHVA 4I5GA 2B36A 2OO5A 4BMSA 2O3UA 5CPFA 5CG2A 2WWRA 4NBRA 5IZCA 1DIHA 1PJCA 3ENKA 2BKAA 4I5EA 4HBGA 2C59A 4BKRA 5IDXA 1K89A 4YRDA 2W2KA 4FJ0A 4G2NA 4K26A 1O9BA 4KDFA 1X0VA 1DAOA 3D3WA 4DUPA 2LDBA 1ISIA 5HWSA 5K9ZA 2EIHA 3PHHA 2ET6A 3FI9A 2BELA 4E13A 2DTXA 4DLLA 4YJHB 1QLJA 1GD1O 4GKBA 4GX5A 3VOSA 3AFMA 2IXAA 3GPDG 2X9VA 1K6IA 1YBMA 1C0KA 3GVCA 4U0JA 4RL6A 4FOOA 4W4TA 1QSGA 4PG7A 4IDCA 3MEQA 3GGOA 4J7CA 3EC7A 3GY0A 3R0IA 4QECA 2P9EA 2GPTA 3ZWCA 5B37A 2FN7A 2IZZA 5EIOA 1PZHA 3ZWPA 2CF6A 3INTA 5DF1A 3IIEA 3E18A 3G1UA 2O2YA 1OAAA 3T4XA 4LSWA 3W8FA 4PG8A 3DZIA 1R4NB 3ZHXA 5DULA 1BVRA 4WCDA 1JN0A 1S6YA 1ZSVA 5HBRA 2RH4A 1H0KA 1KVRA 4MIYA 2PH5A 3RD5A 4RVUA 3JQEA 2RBEA 4OHUA 3AK4A 3S8MA 1P0CA 2I65A 3L4SO 2DM6A 4R01A 1E3JA 1CIVA 1NM5A 1GU7A 4E2YA 4FW8A 3LT1A 4I8XA 4BIIA 3UW3A 4UUPA 1R37A 4B79A 4CMEC 1HDRA 4XB2A 4FOSA 1LSUA 4BNIA 3SX2A 4R1UA 4BQRA 1SB9A 4CM9D 4ZQEA 3OQBA 1E3EA 1JQBA 3QW2A 4QTZA 3JSAA 2H5LA 5CEFA 3F4BA 5IN4A 4LSMA 1J0XO 4NNJA 5EINA 3DQPA 3DDNA 4YACA 3CUKA 1B14A 4AVYA 4J0EA 2HRZA 4YJGA 3W8DA 3W6UA 3GZNA 1ZZEA 4J0FA 2DBQA 5G0TA 3QWFA 3ASUA 4Q3BA 2CZCA 4HY3A 1A9ZA 4Q3NA 1WMBA 3D5QA 5I9MA 1JU9A 4INAA 3ZV3A 4A5OA 4M8SA 4BNJA 4J4BA 4P4LA 4BNNA 1YDEA 2OZPA 3PXXA 1ISFA 3X2FA 2QW8A 1YDWA 2JFGA 4GL4A 3MOIA 2UUPA 3WOHA 2Y68A 1Q2XA 3FPCA 3JQCA 3PGJA 1E7WA 4GBJA 4MKRA 3PLNA 2OMEA 2TMDA 3IDSA 4NQZA 3WMXA 4IDBA 5DBGA 4GGPA 1SNYA 3NEPX 3RSHA 2H6EA 1YGYA 3I1JA 4A7PA 1SAYA 2ZYDA 3V1YA 3KUXA 1J4AA 4IJUA 1PZGA 1IOLA 2YDXA 4ND2A 1LI4A 1T2EA 3F46A 4HNGA 3ZNPA 4IJWA 1SB8A 3QSGA 1NXQA 4XDZA 3WYCA 1B0AA 4CM8B 4RCVA 3WBFA 1KEWA 4MIOA 4NBUA 1C0LA 5TRTA 3DOCA 1BGVA 3PZRA 5L40A 1H5QA 4EDFA 5FEUA 1PL8A 4D79A 2EKLA 1WDMA 2JD1A 4KWIA 4D3DA 5COAA 3KVOA 3VTZA 4XIYA 1E1NA 1PJSA 4XJTA 1KIFA 4U7WA 2J6IA 7MDHA 4D7AA 4H7PA 3L6OO 2VUUA 3DZKA 4LVCA 4BNGA 2OORA 3D1LA 3A4VA 3I6IA 3LDHA 3V2UA 2HQ1A 5CFZA 2QYSA 3L6EA 5CDUA 3BTSA 3K73O 3QP9A 1YQDA 3E9QA 3BHIA 3H3JA 2EF1A 3RUEA 1JKFA 3GVIA 3GOHA 5JXWA 5DT9A 4CL3A 1ONOA 4L76A 4MVJD 4E0BA 1Q0QA 2HMSA 3CEAA 3DC2A 4YT5A 3GLQA 4I08A 2XXJA 1Y8RA 3M2PA 1Z7EA 1U5CA 3H2ZA 2Y99A 2RCYA 1NR1A 4XQGA 1GUZA 2YHUA 4GH5A 4URFA 2D0IA 3ZH2A 4EEZA 2GUGA 1X0XA 3KSUA 3E5RA 4BNLA 5A04A 4Z9FA 2VN8A 2UAGA 1NVMB 1Z75A 4FGWA 1DO8A 4RVGA 3UKOA 3DL2A 4FC6A 1EE2A 2GZ2A 4DC0A
chains in the Genus database with same CATH superfamily
3DDHA 4FKZA 5E8RA 3EVEA 1BX3A 2C4UA 3F2VA 5DGDA 4AUMA 5CDHA 1H1LA 3OCUA 4WKOA 5K45A 3PTAA 1UXHA 4TMXA 5DX1A 4ZCSA 4PVDA 1JDZA 2I2AA 4KX5A 3V8BA 3RJ5A 5TJ9A 1M2OA 5K0CA 3PKJA 4L4XA 1D2NA 3JD1A 4JA0A 1KMIY 3AHIA 5HMMA 5G02A 2GH1A 4X45A 2HYIC 4WNIA 3JWGA 2ZBPA 4I9FA 2K7FA 3ER8A 5IHPA 1BFUA 3QVTA 3L8FA 3SNKA 2X86A 3LP6A 5DOVA 4BVEA 4QO7A 4ZQBA 4EF5A 4ND6A 2J5RA 3HUEA 2HR1A 2OZEA 2BN4A 3UCEA 4G36A 1JF8A 4LBZA 2I3BA 1AE1A 2QT1A 3KUUA 5H59A 3FB4A 4FFBB 5INTA 1HNWB 1Q15A 3ESDA 3OJ0A 4TL9A 2DETA 3Q11A 3OZTA 1TM7E 2OK8A 4JXKA 5C3MA 1RYMA 1DADA 4K05A 1L5HB 2QX9A 2VBCA 3NEAA 4KFTA 3DV0A 4NOMA 4M1KA 4V3CA 4EITA 1M0TA 2GD0A 3HDVA 2GT1A 2Y1DA 4YI5A 1W0JD 2A9OA 3OA2A 1M0SA 1NW7A 1T5IA 2QKYA 1SCJA 3K1AA 4QFDA 5KCMA 3QMWA 4RIFA 3C6BA 2XX3A 3PDUA 4C05A 3GC6A 3V46A 4I81A 5DEOA 3AVWA 1YH3A 2CHVA 2WJZB 3L8YA 5CM8B 1MJFA 1BDMA 1QHGA 1ULUA 3F6SA 1Y1SA 1H2ZA 2DCUA 2D54A 5A4AA 2QDXA 1G60A 1TPYA 1U0JA 3PQEA 4IOMA 2GBLC 2BRUA 3ULKA 4LCJA 1I6MA 4EYSA 4X8LA 2CEKA 2BSQA 2B1QA 2ZJOA 3IVXA 4UUMA 1TM1E 3B60A 3FUUA 1ND5A 1YS2X 4QDOA 1GRRA 4LYDA 2MINA 4DY6A 4JP8A 4GOOD 1NXOA 5LDGA 4AY5A 3E7XA 2AOWA 3L7KA 3QMVA 1EJ6A 3EXIB 1NZDA 1VMIA 1NP6A 1HFJA 3BL6A 2HBYA 2KYRA 2QTMA 5K8UA 1GCOA 4MVJH 2CMGA 4K7JA 1AQJA 3T3OA 1LBTA 2JAHA 1U1IA 2F3SA 2JGEA 3LLMA 3R74A 4MVJE 4S1WA 4AICA 1PJZA 3EVTA 1CUFA 2B8WA 3QF4A 3TGWA 3TOSA 3BFXA 2AIRA 4CKYA 2RHDA 4PNHA 4TLDA 4YCLA 1G63A 3BEDA 3GFGA 1E6MA 1TJ4A 3A70A 4UTXA 4F04A 4DYVA 3CXUA 3ELDA 2JS7A 4K87A 1OOEA 5EJ4A 1DAKA 4CIXA 4NCIA 4MW0A 3E0XA 2PYDA 2V3WA 2VT7A 2NU8A 4C01A 1QMPA 1IHPA 4Q1AA 3HBNA 2XNKA 2JIBA 3I01M 1IXRC 2HT1A 1PW5A 3FOBA 4R0NA 1DWOA 3TBFA 3CCBA 4Q39A 1QE0A 4KQMA 4DA9A 4HR7A 1IOWA 2XT9A 4GYJA 1ENYA 1H0SA 1XZLA 5DBIA 1QOPB 2QRZA 3M89A 4BNZA 5HNKA 1M1NB 2ZSAA 1U31A 4MUFA 4A2WA 5D1NA 1GKKA 3GDWA 3K1YA 2PKWA 5FHQA 3P0FA 1OA1A 4JQSA 3UENA 4B7CA 1RAHA 4W82A 5HFJA 3HBFA 3NHYA 3NTOA 1BVUA 3KOZA 3EFBA 4R98A 1IPFA 1CUIA 2E4VA 4ZAYA 3L7BA 5HCIA 5CB4F 3A1DA 2JBAB 4PRYA 4DIFA 3VX4A 5JDIC 5CLHA 1E96A 3I6QA 5A9RA 1JQ3A 3DP7A 1OI2A 1PTKA 3UJ6A 1ZNQO 1W88B 4MULA 2NLOA 3RIEA 3WXBA 4HWTA 4IGAA 1M76A 2GZMA 4Q9HA 3BPSA 3NU1A 4JQOA 4O2AF 2IHYA 2C82A 1U7ZA 4DQLA 4K0KB 3C8DA 3GZ4A 3L84A 4OP2A 2AJ8A 3U3MA 1R15A 1KVUA 1OWNA 3B9RA 1LF5A 2GAJA 2C7QA 1JBQA 1TRHA 1MO6A 3M1AA 3VH3A 1E8MA 2PH3A 5E4FA 4CM7A 3ZLJA 1PR1A 4PTZA 1LQTA 3NOQA 3ZHTA 1V25A 2BEUA 3DBLA 3GX1A 3HMQA 4MI3A 4BVJA 5A2GA 2XF8A 2BEVB 1NMEA 1OR8A 1SZDA 4X7RA 4N9QA 2QRLA 2WVGA 2WJAA 3FHTA 3SM9A 2BMWA 4B2YA 1RQ2A 4P5DA 4OXNA 4BKUA 3D6FA 1G5IA 3KTAA 4FYIA 1LQUA 2BCEA 5TB5A 3GNSA 4BOYA 1S96A 4B35A 4YAOA 3IIIA 1S2DA 3QU2A 2V1UA 1ULSA 2BBWA 1ZOIA 2I76A 4KHZA 1WLYA 4HH4A 2PT6A 3WB2A 4RJJA 1ZQ1A 3SS9X 5I7HA 4PSCA 3THSA 1GNRA 1NV8A 1CJBA 1G16A 2QL6A 1AQIA 2Y0DA 3D81A 4AZ3A 4Z4FA 2R2AA 3FOCA 3R3YA 1KJYA 4IIDA 4YWJA 2MTBA 5BSVA 1A2KC 2JD2A 4M2LA 2ZJ8A 3BTOA 4XDYA 4OXRA 5JI2E 4DT1B 1ORWA 1Y4AE 2WF6A 5FBRB 4MJLA 3VA7A 5FUBA 1FNDA 1CS0A 1FEZA 4AL4A 1VPEA 1PWZA 1II0A 2WC1A 1U3FA 5FPKA 3VKHA 2ZRAA 3RVLA 3J7AC 5F5LA 4RKEA 2HMUA 3UA4A 1AY0A 1Z5VA 2OWEA 1LFDB 3CH4B 1MHPA 3IESA 4XFJA 3VXKA 1JP7A 4K9QA 3B36A 4OQEA 3UK2A 3AYXB 2W71A 4G86A 4OQFA 5BUSA 3PR3A 1W29A 2F1RA 3N2YA 1R5OA 4PHFA 4G0YA 4RZHA 1QK5A 2VZLA 4BO1A 3RSOA 1Z16A 2IPMA 4O2AA 3W4KA 3GLUA 4TWRA 1IN4A 4IYRA 3BMQB 4IF4A 4CV0A 1BDBA 5COBA 1RJEA 5AO9A 3AF6A 4JVSB 1NBMD 2YXEA 5DLYA 2BMVA 3DBIA 5KBYA 1M2GA 1DT3A 1P0IA 2BMAA 3ANSA 1EE9A 3H0EA 4MKGA 4IO0A 4XAQA 5ALQA 5KYUB 4AN1A 5KSZA 1C0IA 5AR1A 1OSNA 1JLRA 2Z08A 3ZDQA 4YCJA 4AG6A 5H3HA 5B3AA 4UFOA 3V1KA 3EXHA 3HCAA 1ID1A 2WM9B 3HSSA 3K20A 4QNNA 5KNBH 3HA7A 4E7OA 1E0AA 1ZJ4A 3GI1A 1KKUA 3HMKA 2VWPA 5HKKA 2D2XA 4XD2A 3I2FA 4AUKA 4PICA 4E7PA 1GAWA 3E9DA 3OUTA 3QVOA 2Y8EA 4D3ZA 5KJCA 1W47A 1SVOA 1N1GA 4W9NC 2ISCA 2XCTB 3VKFA 4EFMA 1DXQA 2HU5A 4B81A 4P31A 4CM1A 4WDQA 4IUCS 4DIDA 1XVUA 4KXNA 3PK0A 1HYHA 1K7YA 2QLMA 3RRZA 4LOAA 3LFUA 4B7ZA 4C3UA 3TCNA 2YCLA 5JTUA 2HRRA 2I3AA 1Z56C 4BUZA 4M4SA 4EFLA 5LQRA 3ILYA 1L4EA 3KWFA 4GC5A 3TCKA 4C4TA 3WWPA 2Q46A 1WP9A 3KJNA 4L8YA 2WF7A 5CA0F 2VDOB 1E1QD 4FZVA 1GT6A 2Z9BA 1KFEB 1GCIA 4F9GA 1ZMTA 3LT0A 2NO9A 2YXDA 3MIZA 4RXUA 5A1JA 4YUAA 2XGOA 3HB1A 1Q7CA 4KJZA 4YPVA 1OWMA 2A58A 1CW2B 2JFXA 3B6EA 1JQAA 3V7UA 2IHJA 4ZDJA 1KQGA 1LJ8A 2CXTA 3TLJA 4RY2A 2FJ0A 2M98A 1ZGAA 3HRHA 4JYBA 3WMGA 1FA9A 5JTTA 4J0QA 5CNKA 8ABPA 2NUPA 4A8PA 4DNQA 4WCFC 3KQQA 4F6CA 4BAGA 3A9VA 1JRLA 5EJGA 2YS6A 3KETA 2IH5A 3K6JA 3ZUPA 4GEKA 3B1XA 2XYQA 4FDAA 4F7DA 5CNIA 5CG1A 3RH0A 4OBBA 3O7MA 5C7YA 1U2DA 1UKVY 1ZXXA 1E1CB 1YR7A 3CF4G 4HQFA 2GJSA 3RG8A 3TW4A 5ADWA 3NJRA 3UPTA 3C6QA 1NBMA 1ZSNA 3D6AA 3DE5X 4UHBA 3W79A 5FAKA 3FCUB 1EK2A 4PPFA 2ZYVX 1WAMA 3I9JA 2Q8NA 3D4IA 3NH9A 4EK9A 4MS1A 4RZXA 4DQXA 4AFNA 4MCAA 4TTSA 4NH0A 4C87A 2BGLA 4PC6A 2HK8A 1C9DB 4DSOA 4ZP1A 4FQ5A 4X6UA 4LXTA 2NMVA 5L3QB 2PNFA 1UWVA 4EKNB 2NN3C 1BA3A 2QV0A 4DXHA 2OV2A 4YCSA 1PZEA 3IURA 3QMMA 1L7MA 3L3BA 5KDOA 3A9WA 3DEAA 4RFSB 5KYYB 1OKKD 1L8OA 4TS4A 2QTTA 3H4IA 2D59A 4UDNA 1R0WA 3QE3A 4DBLE 4CT4B 1R74A 2P9QA 1IM8A 3NVKI 3EWNA 1U0SY 1G8SA 4R2WA 2NTVA 2HA5A 2R87A 3KU4A 3LWDA 3DTVA 1E63A 4E5KA 1JVBA 3K92A 1C3OB 1NPTO 1N34B 4CI9A 1K8RA 2JANA 2Y9MB 1ZUIA 1NJSA 3BTUA 1G38A 1SXJD 4U8GA 1BSVA 1VE9A 3EF3A 3JZFA 3RUHA 2GCGA 1YS1X 3PSHA 4KAXA 1YTUA 5A3VA 4F5WA 5JEDA 5K3BA 5DGTA 1CY8A 1GTJ1 3I12A 1C30A 2JLVA 1W4BA 1QHHA 3KL4A 1Z45A 2W5UA 1WKBA 3K0FA 1EP1B 1EJ0A 3R7LA 2HNBA 3KZKA 1KBOA 3AVUA 1BX0A 3DTNA 2IXFA 1ETUA 2GEBA 3S7ZA 1EWQA 1G42A 2LP4Y 2PD4A 3I34X 1N5IA 1TVEA 2VHJA 1IZYA 1M66A 2GRUA 5LUBA 3NAQA 1MGOA 3T1VA 3TVTA 4HK4A 1C8VB 1XRQA 1GTSA 4B3TB 3S5UA 2AA3A 4F9EA 4B17A 2NAPA 1E4EB 1L8AA 1ZMBA 1MORA 2WV9A 4F6RB 3GRCA 5GTDA 3G7NA 4PLPA 1GNSA 5F7XA 3ZYCA 4BB9A 3R0JA 2XQIA 2CWDA 1KEZA 2H4HA 3HLKA 1Z2PX 3O1JC 5C1PA 1Y5MA 1M5UA 1IJFA 4G8DA 3VU9B 5G3ZA 4K9MA 3OTWA 4Y6RA 1NE2A 2EBHX 1D8TA 3AB3A 4NV0A 2C83A 1JIKA 1OPRA 1XZJA 1JIVA 2VP5A 2Z3VA 4NE7A 5EXPA 5BW6B 4KTVE 3CZQA 2WSSD 1EFUA 1A5BB 2QMZA 3VNUA 1KF0A 1U9YA 3JTEA 1RYBA 3UXEA 2JK0A 5JS2A 1FVFA 3IUYA 1DAHA 4PG5A 3S1LA 4BAUA 2DBRA 4N6OA 4M8IA 4C0LA 4LJSA 1UDXA 2XUKA 4JFAA 2XGJA 4NV1A 3LQ2A 1E1RA 3R77A 4IL5A 2CXUA 1EINA 4JEMA 4NZPA 4WK6A 3K9GA 5AXBA 4R1SA 4WLEA 3OEHA 5BYKA 2H7XA 3V48A 2P91A 3C3WA 2CD9A 2X41A 4NEHB 2Y4NA 4RNCA 3WG9A 3FVQA 2BFBA 4BO4A 3FYDA 3U17A 5BWNA 1QC5B 2WAOA 3KALA 5AH0A 3O8OB 4Q9LA 3WGIA 1S3FA 1NSYA 5FUWA 3OJOA 5HX7A 3E3LA 4HPWA 2HSWA 4OKIA 1O97C 5CK4A 4I9HA 1FFXB 1MX3A 1W34A 3O5AA 2BM8A 1SK8A 4BZPA 4RKYA 2ZS7A 3KCQA 4V1CI 3TSAA 4BS9A 3U4IA 1LU9A 1SVSA 2VT2A 2XKBA 1JJ7A 3ISTA 1F2DA 1MRNA 4ZT4A 3A7DA 3RK4A 3WADA 4H35A 1L7PA 3C98A 3NWJA 3D6VA 3FNHA 4BE4A 4OXXA 5D3KA 3OZIA 4OJMX 2FP3A 1LVUA 3DM9B 4HEA1 3LNTA 4EY6A 3ZQ4A 5IPFA 4JA2A 1ADJA 2I80A 1I01A 1YBFA 1MV5A 2QQEA 3FGZA 2O2EA 1VCOA 3OMXA 1FDWA 4KI7A 4C0SA 4D6PA 4R1PA 2FPIB 1BQ4A 2D5LA 2E4YA 2VAVA 4CTMA 4V0OA 3L1VA 3OCXA 4DC1A 4JLKA 3C3DA 3IEXA 3T9BA 3M5CA 1TW3A 3QLUC 3O2NA 3ZK9A 4BEBA 1EIZA 3PICA 4HDSB 5AVRA 2I7TA 2FZEA 2QJWA 3CLSC 2Y0CA 3W0LB 4ENWA 2WINI 1BCSA 2AJTA 3FMIA 3OM8A 3TB4A 2UUCB 5EKDA 5E4YA 3LLCA 4MVJA 4P83A 3COSA 1PR3A 5SY6A 5T5QA 1WCYA 3VDMA 1P8AA 3G5MA 3S40A 1UBTS 1XQYA 2QRVB 3ROKA 4I50B 1LW6E 1P80A 3LE8A 3OVMA 5LBUA 1LRKA 4RK7A 1UINA 4UASA 3U7IA 1VGRA 1WP4A 3L1IA 4QOFA 3GDOA 4HXGA 4KLZA 4UU7A 3RYCB 3QTTA 1M2NA 1RJ9A 1HQCA 4DTIA 1U94A 2JVKA 2ZJ3A 2WMDA 3G3EA 1DL5A 3ZV5A 1KH2A 3OZAA 1NRWA 1ZIYA 3FFWA 4NY1A 3R8CA 2NIPA 1TL7C 4AZSA 2NU7B 5JU6A 1QM5A 1T9ZA 4RY9A 4NYMQ 1WDLA 3NFRA 4J0HA 2PX6A 1TZJA 4TLAA 1FJGB 1R6VA 4XJXA 3NGXA 9GPBA 2RH5A 3IAHA 2F8MA 1XROA 4HO1X 4NX2A 1DBVO 2A94A 4CLHA 1ZH6A 5ECYA 4H3SA 3NETA 4IO1A 2QN9A 3Q6NA 3KT8A 5IJAA 2JIOA 3IOBA 3OX4A 2VPWA 3BAFA 5EI5A 5JNWA 1GPNA 4D6XA 5ISMA 5TIIA 1E2KA 2HMTA 4GGOA 5JZOA 3RF7A 1XWFA 1P1HA 5DK6A 2J7PD 3U1VA 3GT4A 2QLBA 3KAKA 1ZUNB 4OTZA 4IP0A 1T0JB 2AE2A 3EBPA 4YDQA 3LHKA 1QZTA 2ZJ1A 4H27A 3H5VA 2YN2A 2WSMA 1NXPA 5EJFA 3MWGA 3THRA 5A3JA 1E1DA 3FH0A 1T9GR 3KPJA 3PI7A 4I9NA 2ZXFA 4YJFA 5EMJA 2EZTA 4AUNA 4JKOA 3QBJA 3RANA 3B52X 4HFJA 1K1EA 4M1WA 4BFUA 3MJDA 2HHAA 3BSFA 1USVA 5AJUA 2YZGA 3I4FA 3ASYA 3V9AA 3PQFA 4P80A 1OYOA 2ZYIA 4R2IA 4TRJA 3ZU2A 3MS7A 1GG5A 2O2GA 4TSFA 3MWKA 1ZM4A 5JT1A 1FNBA 1ZH2A 5AKKA 1AQLA 3PUVA 1DJOA 1P5FA 2X58A 2YV2A 2V98A 3PD1A 2EKPA 2OO7A 2I8LA 2CYCA 1YIOA 2JNWA 3ROPA 5HP4A 4CEIB 1DKLA 3SHFA 4QPDA 5BXYA 5CLJA 1RW4A 4WBNB 4KK4A 2M32A 1N6OA 5ANRB 3V8MA 2YYSA 2NG1A 2P4UA 2QRGA 3B6KA 3CSUA 3I8XA 5D3QA 3ZBUA 4YV2A 4CETA 1W75A 4F5YA 1NVVR 2E55A 1UAYA 1T8YA 1Q77A 3OF3A 4K9DA 5I9LA 3EFOA 5TV2A 1AXRA 4RVNA 3GA5A 1IL0A 2ODQA 4TMVA 2BKVA 4NCKA 4ZA2A 4CCSA 1KZGB 4PR0A 3VR2D 1RCUA 3H2IA 3VR6H 1XRJA 2PO5A 3FDZB 4BGUA 1FUUA 2UU9B 1KGDA 2Q6KA 3SD7A 5AK6A 3AVXA 4DCJA 4XGQA 4EA8A 2ZT8A 3AWDA 3LBHA 3O73A 3Q0IA 1GUYA 3TE7A 1LWNA 1M8GA 4INJA 4RGVA 4IZ6A 4MXDA 5CJ2A 3T3EA 5J47A 3K7EA 1HE2A 2OHJA 1VLQA 1AGPA 2IEBA 3KKZA 1L5MA 1U8UA 1G8HA 1TCAA 1NATA 3GRYA 4QJ5A 4UREA 1R4NA 3D7LA 4AO6A 5EHZA 4IGIA 1EX9A 3B85A 3JD0A 4NPHA 4Q03A 1BFDA 1OAKA 2Y66A 1ISHA 4JD5A 4TN1A 2Q27A 1TEXA 5JNSA 3H04A 1JU4A 2C77A 1THGA 3IB6A 3AYZB 2QRMA 4W9NA 3E2PA 1F2UB 3A32A 3WR5A 2KSQA 2EV9A 2F9FA 3EK2A 4K6FA 4M76B 4R05A 1G55A 5DX0A 4UNQA 2GEVA 3AQIA 5EP1A 3RQIA 3LPNA 3RWBA 3VAAA 3WWYA 3ZWBA 3EWIA 4DLWA 1S2NA 2BFFB 2ZJ4A 1B0UA 3Q2OA 4TV9A 5KQRA 4TM7A 1NLZA 3CR7A 2PGLA 2GILA 3VGJA 4PONA 1JHVA 3MGCA 4ZO9A 1VMDA 4OXKA 1P1JA 2BEWB 2IZ6A 3VJLA 3LX5A 2ADFA 4MIKA 4RLQA 4V3BA 4DT1A 3CX6A 4X8OA 1U5AA 2I78A 2NNWB 5JAQA 1Z4OA 3QXHA 1YKSA 1RWOA 4QEKA 3C3PA 4NH4A 3INNA 5CEJA 4MGHA 4J75A 4ZT5A 3RFCA 3RKUA 1RDFA 1GAJA 5ICEA 3U60B 1TAGA 4MKIA 4CE6A 1F0NA 1Q1NA 2C7RA 1VL2A 1G2OA 5CVEA 2JKZA 2AMFA 2G6TA 2HCRA 3HB4X 5KOJA 3WLSA 5AW8A 5E0KB 4R69A 4AQDA 4AMGA 4YCNA 2CE2X 3DBVO 1NNUA 3A0RB 4LSGA 4ZVLA 3TD6A 4UEJA 3GJ4A 1D4OA 4UC0A 3AGPA 4ZANA 2QMOA 4IHJB 4DSNA 2C9ZA 4U9HS 3Q8LA 2GBLA 2WM3A 4PTYA 4ILKA 3OECA 1WX1A 3ZJ5A 1GLVA 1Z35A 3ZCVA 5J2TF 5AW7A 2ZBUA 1WMAA 2A33A 4YLYA 2J67A 2H63A 4KXQA 2V7GA 3TSCA 3KKPA 5KNCD 5LKRA 3U61B 2VOJA 5E9WA 4ALLA 1VB5A 3V97A 2KB0A 1BE1A 4G5OA 2YJ3A 5TT0A 3WGVA 3RU3A 2P2CA 3EZFA 3I8OA 3K8OE 4FCCA 1NVXQ 1SIUA 4HGQA 1ADCA 1Q74A 4AYTA 5IXJA 3URMA 3MG9A 4DG9A 5PNTA 3WL7A 2XMPA 4Q7EA 1B2RA 1RAAA 1GPYA 2CFRA 2HN9A 2RHJA 2CDNA 3ITNA 3PCRB 4OHFA 5LKAA 3ZD6A 4TV8A 1K5PA 2BZ1A 4RPCA 2VHXA 1DBQA 4XWWA 4OYYA 3IDQA 2FVXA 3AP3A 3NHRA 3LC0A 2DLNA 3ZDXB 4EF4A 1CEYA 4I50F 2H0RA 2XB4A 2GDJA 5JE8A 4QTTB 4BTLA 4DR4B 1AHNA 1YZFA 3F5FA 4FGUA 4FOTA 3A6DA 1BXRA 3DS8A 4BU0A 1MC8A 1HKHA 1QCYA 4P0TA 4NP6A 2D00A 3U4DA 1GZ3A 4B4DA 2Q99A 4EI2A 3EZ6A 4LE2A 5DOZA 3NX4A 2RHOA 1WXEA 3DLPX 3OPYI 2HZBA 2XJ4A 3UAWA 4DLRA 3N8HA 3OZWA 2OYCA 3JARB 3R7SA 4RW0A 4MJ3A 3ZOKA 1ZNYA 3O1IC 4LHZA 1KHHA 3GFVA 1L4UA 2V7PA 2H5JA 4ECEA 3EWAA 4OX9Y 2C2GA 4IH9A 4F71A 3C39A 3BT7A 3V3KA 2QL9A 2WP8J 4H31A 5F4ZA 2JARA 4BN4A 3WRWA 3DLHA 3PQ6A 4RSGA 5ULLA 1W2HA 2GZ1A 5LDDC 4HX2A 4GWKA 3ON5A 3EGOA 5A9TA 5LQMA 3GD5A 1JEEA 1FDVA 2DZDA 2WD8A 2H2AA 3L0OA 4GVXA 2PAFA 5HXAA 1YK0A 2GF9A 2BWJA 3EVBA 3PGLA 4YLGA 3K9WA 4ZCLA 2CK3A 2JGRA 2UYGA 5CVTA 2J09A 4IAOA 1MDBA 2FZLA 2XRYA 4JLNA 2JH3A 2FSPA 2XCIA 3A10A 4JP2A 1L5FA 1AKYA 1P72A 3RRYA 4MYCA 1RYDA 2VRBA 1JPJA 1ZNZA 1VSBA 2E85A 3Q12A 3PT9A 4RA9A 1KKMA 3IEPA 1FXUA 1XWWA 4LI3X 1GCUA 5IZ4A 4PANA 5J58A 1S1CA 3BHJA 1ZIOA 1E79A 1QIEA 4QL3A 1ZQ9A 1U8YA 1DFHA 1MT0A 4CQLB 2NSJA 4Q66C 4L9RA 4P4NA 2YINC 4DCTA 5BRJA 3FBTA 3Q6MA 5F3WB 1AQYA 2EFDB 4PHCA 3L46A 4L4SA 1E1RD 3VTAA 1N7JA 3I37X 2TECE 2HJVA 3KB8A 4KG7A 5AICA 5FBLB 2O2HA 2QYOA 2SHKA 3OTGA 1I3OA 4UUOA 4LVOA 3WZLA 1T9AA 1V8ZA 5B4VA 5CFOA 3ZY2A 4TKMA 3B13B 1E1LA 4WBSA 5BO5A 1AURA 1NF9A 2HX1A 5F9HA 4O2LA 1XX6A 5EP3A 1G8MA 1U8TA 3L18A 1R0CA 2AG6A 1MENA 2VAMA 4H7KA 2NU6A 4DA7A 3RVRA 3IE1A 4FXPA 5K8TA 4A5SA 5C8XA 3LYUA 1OGJA 2GJAA 3KR9A 4OHXA 2QX8A 3QX3A 5JANA 4IHQA 3FZGA 1EQUA 2AN1A 2D4HA 2PN1A 3IR7A 4XE5A 4IIBA 2W6CX 1J70A 2YWXA 3JQAB 3I04M 1Y9EA 3WRVA 4X54A 1QHNA 1DC4A 4D4MA 1E5DA 2ORED 1UR5A 3LHDA 4M9ZA 2R8XA 3MRTA 4AJ2A 1XLWA 3ZE7A 4RDIA 1KI6B 3SZLA 4Q01A 4P58A 2Y05A 3T7KA 1REQB 2HV8A 1Z8NA 3LU1A 4J3FA 2IKSA 4NVRA 4F60A 1KO8A 4RHEA 3WJ1A 5AI0A 1U7XA 4YDHB 2ZM6B 2I4LA 3I64A 3OJFA 2B4TO 3UMCA 3HXKA 5H3LA 3ZLVA 4ZHQB 1L5QA 3W5AA 3EGDA 1KORA 3NM5A 1P5HA 3EVGA 3Q7QA 1IY8A 1EYZA 3MAGA 3PQ2A 4TOIA 1WOMA 2O52A 4UEOA 3PQDA 2P6MA 1RJ9B 1VFPA 4QQFA 1C50A 3UAGA 3HFGA 4RK6A 1I33A 5H70A 3WA6A 4AKSA 3CNBA 3L7AA 2PL1A 3N7AA 5KPJA 4BJ6A 2W98A 1NIJA 3A7EA 3VSDA 4CLDA 3GJQA 5CBKA 1U02A 2UYOA 5HA5A 1NZFA 1UBRS 1UJ6A 2F3TA 2CL5A 4PAGA 4C14A 5L4SA 1GO2A 1YCFA 1UPFA 2JA1A 1YJAA 1U2GC 2B7BA 1QG6A 2P1ZA 4UUAA 3T5CA 1TPZA 2J08A 4PVCA 4Y1GA 4NCJA 5JZMA 2VVTA 4A73A 4G1FA 5EKTA 1JSCA 4R54A 1DAEA 4YQEA 2VNAA 3V42A 3EQ9A 1POWA 2DWOA 2ZPAA 1Z82A 1L7RA 4IXNA 3TLKA 4CQNA 1JJBA 3ZIAA 3EWSA 1G1AA 4PRKA 2ZBFA 5ETJA 1X2BA 2VPYA 3AFOA 4L75A 1Q1EA 4WZZA 1XDBA 2VATA 1GGVA 1ZVMA 4WINA 1H3FA 3L79A 1UK7A 4QQNA 2XB8A 1B3RA 2UDPA 3L0IB 1K86A 2X76A 1IHXA 2IXEA 3WMEA 2QI9C 3AEKA 2PZ8A 1TT5A 4QHYA 2YNMA 4G5FA 1W5TA 4KR2A 4ZD6A 2V0NA 2YFYA 5AVOA 3N9IA 3TLGA 4QUAA 3MNFA 3SGLA 5REQB 3WMWA 1EUCA 1OFUA 3I9FA 3B5IA 3I0MA 4H16A 4RVDA 1YAHA 5U1PA 2IXGA 1K6JA 1MZVA 2NTJA 4FGSA 1PTJA 4JJAA 4Y9UA 3TWOA 4I1PA 5K8CA 5HQTA 3E3NA 1PK7A 4K0RA 1OWPA 4RH0A 2DQZA 2NU9A 1H6CA 1M7HA 2YXLA 2CV1A 5FPPA 4RELA 4TGLA 1PJRA 5JFGA 2BFNA 4ILEA 4PO8A 2B37A 1EFVB 4OB7A 4DIBA 2BZ0A 4H7HA 2ZXUA 4QYMA 3AM5A 3WLEA 2BF4A 4X62B 1N0HA 3HLYA 4CODB 1BS1A 4XA8A 1RYYA 3GELA 1VDMA 4AIRA 3ST7A 1RXWA 3MBIA 5IDVA 3TRKA 4YRFA 4F6LA 1GL7A 3NHWA 2QX7A 3JRNA 3IHKA 1LNSA 3K5PA 3F4KA 1DX9A 1K68A 3VVLA 2IEGA 1IHUA 5DI3A 3SIWA 4E4TA 3DAHA 1SWVA 3T9EA 3C4JA 4EGFA 4EHJA 1REQA 3QOFA 1L7BA 1UDCA 3RC9A 4EI9A 4C88A 4JKIA 3FLBA 5ITZB 4KR3A 2HYDA 3O8LA 3GFPA 3P19A 2QVZX 4PS0A 3BRWD 1WZ2A 2R11A 4XR9A 2FEAA 2GFHA 3BH6A 3D0OA 1NVGA 3OZRA 3Q9UA 1X9HA 4KYVA 3T3DA 3BEOA 3E4DA 4EB6B 3WK9A 1ILEA 3BWEA 3WYNA 1NX6A 1LK7A 1T5TA 3W78A 1OH7A 1EFCA 2UYQA 3M7IA 3GL9A 2PGAA 4L3OA 4TWZA 4PAOA 1K97A 2O06A 1K9SA 1W0JA 3VU1A 5B4TA 4IOJA 4WXHA 3LQ4A 4ZOBA 3NTVA 2D1TA 4L02A 3HNPA 5CEEA 1G7SA 4UBNA 4IQ4A 4U9IS 4GO1A 5HUJA 1N3YA 1J39A 3JWIA 5NLLA 4MSUA 2GK4A 5CA1F 3PNSA 4GPTA 1WNTA 2OV4A 3FG9A 1WEKA 4ZMSA 3RRBA 1XAJA 4UTZA 2MCFA 4OFXA 5FWXA 1FFXA 3L01A 2Q62A 1NT2A 2ZYSA 4G84A 4WAUA 5DBEX 1GPKA 3SBDA 3V5NA 4QAJA 4ZAWA 1UQRA 4I1SA 4QT0A 3D64A 1KZ6A 1W46A 4CMIB 4PCAA 1FW6A 3NATA 3ROGA 2VRCD 3DD1A 1ESNA 1XKTA 1JFLA 2QR2A 3P52A 5AJHA 5EXEA 1U2TA 4EL0A 5LZ7A 3G9XA 3A6FA 1W1WA 2A57A 5AVXA 3AR5A 5AXAA 2J9YB 2QSUA 2Y1KA 1Y0BA 4PIVA 1FTQA 1YBAA 5AI5A 2G7MC 2BHLA 1S3SA 3ITEA 4DABA 3MTJA 1ZI9A 4HYYA 2Z2KA 3RYCA 1XQ1A 3P4UA 5AKHA 3HI6A 1RQLA 4HH3C 1T9DA 4LYEA 4RVCA 3TB6A 2HHJA 4NYJQ 4HVTA 1B7GO 1ODIA 1W1IA 2DC1A 4NAHA 5IAKA 2QUBA 4N0MA 3QFSA 4BNHA 2CFCA 1F9AA 4UZSA 1TTTA 2CLLB 1KMHB 1R9NA 4P7JA 5BN4A 1Z4NA 4LG1A 2GK3A 4R8VA 1HDZA 1IEQA 1IB0A 4AS3A 1IQPA 1ZK2A 3VR0A 1BJRE 1T5HX 3LVFO 1Z2AA 2IZ1A 4RWEA 2Q5OA 3TSZA 1F8UA 4U2DA 3ZWMA 1FFGA 1T10A 1XI2A 1VZ2A 1YCDA 3UWKA 4GZ6A 3IILA 2PEYA 2ZATA 1DWUA 1Y9DA 4RZIA 4DWWA 2P6NA 2YVLA 1W9HA 1DUIA 2NM0A 1GN9A 4CNQA 1VYVA 3ZWOA 3K9BA 4NMLA 4WXMA 3I92A 3S2SA 4CTJA 3FWNA 1RJFA 1KZ1A 1N2ZA 3PXCX 5JAIA 1Z5WA 1T2CA 3PNBA 2YWDA 4ENPA 3RS2A 2F3RA 2VC2B 5C8ZA 5I8PA 5DHFA 1NHGA 1NXTA 1QZZA 3LRTA 2PD3A 2Y0PA 5FBWB 5FNZA 1BX1A 5A05A 4KR6A 4H7DA 1K5DA 4L6IA 5EVJA 5C8YF 1UUFA 1HNNA 4BASA 2VDVE 4B5KA 3NV9A 1K08A 3H1AA 3U4HA 5EPEA 1UBEA 3BZUA 5FOSA 3CCFA 4GLOA 3LUBA 1IVSA 3GUCA 3TQQA 5GONB 2VWHA 3BGVA 2W70A 3VC2A 3QHQA 2NUAB 1YO6A 3FVVA 5K3DA 5KNLA 3Q41A 2JFNA 4TXLA 4GIBA 1JAIA 4ANFA 5TQ2B 4TL6A 1A95A 1QVAA 4B46A 4V0QA 1X7HA 2BMDA 3O75A 4GI5A 3H5IA 4FDMA 3RABA 2E37A 2QRNA 2R84A 1E1KA 4XTRA 3PXUA 2I29A 2VP9A 3VO2A 1BN7A 4BZWA 5C7OO 1AA6A 3PUZA 3LXMA 5EJ5A 4YAUA 2NXCA 1LPPA 1K9VF 1K7FB 3KXIA 1QP7A 3C1OA 2AR0A 5IK2A 4IJVA 3U19A 3EDCA 4RIGA 2P2YA 4JELA 4B3DA 5A03A 1TYCA 4FN5A 3BB3A 3HKCA 1GPJA 2Y67A 3TDMA 4O3MA 1NTRA 2QMHA 2QQFA 1KTVA 4A15A 1ZEJA 4RF3A 1I6KA 1RPNA 2KW5A 4RD1A 2A0FA 5EZ5A 4EY8A 1KMMA 3T94A 3EGEA 1UANA 2VNHA 4PPNA 3RIHA 2AVDA 1OWLA 1V16A 1P3Y1 4F4JA 3UG7A 5BV2P 4X65B 1NKVA 4B6OA 3MQ4A 1Y1RA 4AMVA 1H8EA 1KFKB 2W6JA 1CIJA 4GI3A 1JDBB 2XDYA 3LO8A 4MARA 3HJAA 4ZGWA 4QDKA 2XW6A 2H1SA 4JB2A 4MMYB 2JGMA 4MQEB 1H2FA 1Y6ZA 4E15A 5ER9A 2UZ1B 5FJIA 5A4KA 1YZVA 1Q11A 4B3BA 4EG4A 5H02A 4B3XA 1QR6A 3FPAA 3QPAA 4DLTA 4AWAA 4TXMA 3PX2A 3OJEA 1J9EA 1QZUA 2I2CA 5DYYA 1JXOA 4F2HA 1EKXA 2Y71A 3T1QA 1M67A 3S2GA 1XZQA 3V7NA 1ODFA 1Z39A 1W8DA 3TSWA 4EHNA 3KYIB 1WE2A 4W9MC 3V2HA 3PF9A 1TI7A 3BE6A 3FHLA 1EAMA 3RUFA 1OTHA 2C9BA 4LSZA 2AZ4A 3CX3A 5F7OA 1R8YA 2ZE5A 3USES 1YC2A 3FZEA 3I1FA 4AT1A 4B76A 3B1JA 2PX3A 1L1RA 5GWXA 1RWNA 3RVJA 1YB2A 2H48A 3CUTA 1PR9A 2OFXA 3KCNA 3FOFC 1TAUA 3ZE1B 1E60A 3B6ZA 3TK1A 4BO5A 1XHLA 3G2PA 4RPKA 5IZCC 3J80A 2M1ZA 4G23A 5SYMA 5J23A 1QH9A 2HREA 3JD4A 2F1HA 2XUZA 1GU1A 2I22A 4ODIA 4W9RA 1C9KA 1WA5A 3VPFA 5L51A 4B3RB 4QGAA 2VJYA 4NATA 4EELA 3BTVA 3AWIA 2Q9BA 1FLNA 5CVUA 5JSHA 3ETCA 2RG7A 4G65A 1Q6ZA 5FWYB 5JBIA 4HVLA 1D5CA 3TW6A 3ZV7A 1XAGA 2X40A 1WW2A 3TX6A 1BO6A 4W99A 1GPAA 4DV5B 1WBBA 1NLYA 5CTAA 1OFGA 4MVYA 2G08A 2LKDA 1EG2A 2HADA 3SKVA 1WMDA 1JIJA 1FFCA 1IEWA 2HF9A 4WKCA 1LZLA 3WLRA 2L18A 4XQEA 2EGUA 3WJ7A 1QO7A 4ESVA 1G98A 4HWOA 4DG5A 1LJLA 3W3ZB 1NVBA 4LPSA 1B00A 1RP7A 4DMHA 5CLFA 1JR3E 3ORYA 4Q3OA 3O2JA 1VLMA 1JW9B 1WUIS 2XMSA 4MV9A 3LHSA 3T1TA 4OMCA 4V38A 4F4HA 1WQ1R 1NHWA 5T6MA 4MRAA 1J2EA 1KRWA 4D41A 3DEJA 4JQCA 2H4YA 4JL6A 3MMSA 4TT3D 4ZT2A 5J5VA 5BNTA 1H9CA 1U6IA 5FUVA 2EKZA 3C41J 1DKMA 1T35A 3TLEA 1D0VA 2E4UA 3QY0A 4Q3KA 2FN9A 3KWMA 2GYYA 3BMXA 2I7DA 5BOVA 1TUEA 4ETWA 2P11A 2ROQA 3PRJA 5SY9A 5T64A 4CQJA 5KJ6A 3V8NA 1W36B 3DHNA 3ROFA 2CKDA 3E8XA 3W7AA 4AZ0B 2NZYA 4CIBA 4D43A 1FRNA 1I2AA 2FWIA 1G8FA 1TK3A 2FSVC 2C2WA 1T9KA 1ZM3A 2CUNA 2H0QA 2XOEA 4KQGA 2ZRLA 2G36A 4RTJA 2KWIA 4YK7A 4PGGA 1UFOA 5JPIA 3ZEAA 2A9RA 1E2HA 1T2DA 1JVNA 1S8NA 2FWAA 2Q1YA 3KEMA 4LXYA 4NMHA 1P1CA 4ND4A 4OM8A 1DKRA 1PGQA 1YU6A 3O38A 3G89A 3EIHA 4LDAA 5DBFA 3W1VA 5BN3A 5H9WA 1XD8A 4OHOA 1T4CB 2I7XA 3SJUA 2F4NA 1U1GA 2I4RA 2RJ3A 3CRW1 1RADA 3ROZA 1H4VB 4DOMA 3CW8X 4M1EA 3CKMA 3OEED 2FDRA 4GVPA 3RWOA 1YA8A 1XVIA 2ZUCA 2YFHA 1B1AA 5ESDA 1CU1A 1TLLA 2RGGA 4FFRA 4OQXA 4X5OA 2ZAMA 1NOKA 3HI4A 3REQB 4CPDA 1FS4A 1UM8A 4ISBA 5DM4A 3WO1A 2EJVA 4B82A 5G41A 3T4PA 3JVVA 1C4KA 1YZHA 4A8JC 2C4VA 4JK3A 2Q6VA 2LCQA 1QH1B 4LMRA 4JSYA 4YT4A 2W2QA 2WEKA 1L5ZA 2QVCA 5FI0B 2VYQA 4RH3A 4BL5A 1JH9A 1TKAA 2BKLA 4Y1RA 2WICA 2ZBRA 5KYUA 1N5MA 1GDTA 1XRSB 1VJGA 1NBWB 1QLHA 3TSYA 3AF0A 4RPIA 4XW2A 1IY9A 3R76A 2GPNA 2ZTMA 4JGIA 1HMYA 2YC2C 1WHTA 1B42A 3HV0A 5G53C 4CLRB 4YMTA 3V2IA 3DTYA 3U1TA 2HKIA 1W8IA 2VO1A 1UXOA 4J49A 3SQWA 1AO3A 4IFEA 3N53A 5F23A 2PU7A 3VVCA 3SBOA 1GRCA 3DHYA 3GW8A 3ZCQA 1HV8A 4D98A 2E18A 2O8NA 3EVNA 2PSSA 1RLUA 2IXBA 3E1SA 5FB3A 4JP3A 1C9YA 1JQJC 1A8IA 5HF8A 1UDBA 2HCFA 1ZWKA 3MXOA 1OBOA 4Z9YA 2HSJA 2W2OA 1WKVA 3VOTA 4D8WA 1V3VA 1PV2A 3PEFA 5FLEX 1QYXA 1QIFA 1GEEA 2XD9A 3IAFA 2Q49A 4X3CA 3TFWA 4ZOQI 4B6QA 2Z43A 4XM1A 1ZL2A 1N32B 4S0ZA 1VE1A 3PPIA 4CZ2A 4BUCA 3PJRA 2G07A 2QE7A 3DDCA 3PDJA 1W44A 3L9WA 3QEOA 2PT5A 2PSHA 4XVUA 3OJLA 5EJEA 5FWNA 1X1CA 2WG1A 4OBEA