3BHPA

Crystal structure of upf0291 protein ynzc from bacillus subtilis at resolution 2.0 a. northeast structural genomics consortium target sr384
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
52
structure length
52
Chain Sequence
b'MISNAKIARINELAAKAKAGVITEEEKAEQQKLRQEYLKGFRSSMKNTLKSV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0291 protein ynzC
publication title Crystal structure of the UPF0291 protein ynzC from Bacillus subtilis at the resolution 2.0 A.
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 18
structure length 52
sequence length 52
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3bhpA00
2PGGA 2ZNJA 2ZNIA 2Q7HA 4BW9A 4CH6A 3BHPA 3VQVA 2YI8A 2JVDA 1G6UA 3VQXA 4BWAA 2RQ6A 4CS4A 3DSQA 2YI9A 4Q6GA 4TQFA 3VQYA 1O9GA 4TQDA 2Q7GA 2ZINA 2RJZA 2YIBD 5K1PA 1O9HA 2ZIMA 3VQWA 4CS3A 2ZIOA 2ZCEA 2YIBA 2R70A 2PUSA 2QJ1A 4CS2A 2YIAA 4ZIBA 2Q7EA 4CH3A 2E3CA 2R72A 3QTCA 3ZEDA 5K1XA 4CH4A 4CH5A 2HEPA
chains in the Genus database with same CATH superfamily
4HYOA 3SYQA 1SC5B 2F93B 5L3EA 2A79B 3JARA 1SQVH 5KLVH 1HW7A 1K7DA 4PI0A 1MABG 4DV3B 1I5XA 5B66Z 3TXQA 2JGDA 5L3DA 2AZ0A 5EK0A 1R3LC 4YJ3B 1FXKA 3OMNB 1TA8A 2EZOA 2UUBB 3FD9A 3SJQC 3C90A 5H9CA 3N2KB 4X9QA 4JI5B 2EILC 1WP7A 2HR3A 2ZE7A 3CC2V 1XNRO 4O4JB 4RQFA 1FJGB 1IBMO 1S77D 2XAFA 2WSSG 4X1IA 1TVKA 2WLLA 2EBOA 2JJ1G 2X6BA 2QKSA 4I7ZB 3WG7C 2ZCEA 2CK3G 1EBOA 4DR1B 1AB3A 3CMAV 1GM7A 1XHZA 1IBKB 3TK1A 5A2QN 5LOVB 2UXDB 1Z2GA 4QIWF 4CH6A 3NR7A 4O4HB 3HKCA 1EN4A 1F4MA 4LF6B 1SS3A 2EINC 1YCIA 1VP7A 3NXSA 5CB4A 1SQGA 4KUMA 2Q7EA 5GTHZ 5IT9N 3JAKB 1VQ9V 1BGYH 1EM1A 3RVYA 5IE9A 1OCRB 4FJCC 4J7ZA 3K57A 4LWSA 2IU0A 4JAAA 3ZRWB 2NN4A 1IDSA 4DR4O 1BQ0A 2W6IG 3RGBA 1WN7A 4GUNA 4LF9O 3T2MA 5BXZA 2YIAA 4I5SA 3PN1A 2A9HA 3ZMVA 4YHHB 3E22B 5F2VO 1JJOA 5JJEB 1VQ6V 4GT1A 1ENVA 4X89A 4GX2A 4CS4A 1GKFA 1MG1A 2QWQB 1S5LZ 3CC4V 4UXNA 3F7VC 3FKSG 4WCEV 1VF7A 2LJ2A 1XOUA 1VF6A 2HEPA 3JASA 1I94B 4DV2O 2AHZA 3APQA 4J42A 4DV6B 3RYCA 4EB6A 2QGNA 5LA6A 1SERA 3B8MA 2W0XA 2NLJC 1XUQA 2IW5A 1PL4A 2CH7B 3STZC 1COWG 5CA3A 2QM4A 3WB1A 3HKEA 4LH7A 3K5LA 1AI6A 4PELA 3LUTB 1PD3A 4CC6A 3AEIA 4DRXB 1ZSPA 5BZBA 4YJ2A 4N21A 2DJVA 4YY3B 4Z1MG 1KB9F 2QEXV 1FFXA 3AG2C 2XTAA 3ZN0A 4JYAO 2LO1A 3CE2A 4WFGA 4UCRA 3G6EV 2IH3C 2ATKC 5KX5A 2WLHA 1HR0B 1YJWV 1QHTA 2YXHA 2OIEA 4CC5A 3HKBB 3HKDB 3JALA 2JRIA 3HB3B 2CTRA 4K35A 4X66B 1B6QA 4LCUC 4B3TO 5LMUO 1SA0A 2B1GA 2HVKC 3JD3A 3M8AA 3JARB 3VQYA 3OTFA 4IYIA 1AI7A 1VQ8V 1Y76A 1WNSA 4LBEC 2QDOA 1XNQO 5KHHA 2UXXA 2JGDB 5D5PA 4MW8A 2F66C 1FXKB 1IVSA 4DW1A 4MVRA 1AROP 1XL6A 3T1YO 4JI0O 4U3FH 1H2NA 3APOA 1NZ6A 3C3SA 3RYFA 3LNNA 2ZM6B 3E8GA 4X1IB 1TVKB 2WLLB 1AR4A 4LF4O 1SF9A 2B5UA 3IFXA 5CA1A 5LMNB 4H37A 4DV1O 4OXSA 1LUWA 3A0RA 3L72H 3S3WA 4LFBB 2BSKB 1X4TA 1SETA 3HKCB 3FAVA 3L70H 3O65A 1S5JA 3E8FA 4PDRA 1JCHA 2X6CA 3Q4HA 1NH2D 4L8JA 2HLDG 4LFCB 2UUAO 2ITCC 5CB4B 3L9DA 4J80A 4H33A 4GKKB 5GTIZ 5H2FZ 2AGAA 2FB5A 3FB8C 3ZHRA 1WJZA 4IIJA 4LWSB 1K92A 4DUYB 1YVWA 1YTFB 4LF7O 4QNHB 1F4NA 3SPIA 4X65B 2ZIOA 5BMVB 5IY5C 3X2QB 4FM1A 1MMMA 1H8HG 3QG5A 1KYOF 3W7XA 4LH6A 2Z5UA 1WPBA 3G71V 2JEUA 1PNKA 4JI7B 2EJ7A 3W7TA 4K3AA 4GX5A 3W7UA 5H5NA 3ETGA 3HR0A 4PA4A 3CJHA 1NS1A 4BWAA 4JV5O 1L0LH 1N8RW 4PDVA 2F4VB 2ZDIC 4UUJC 5FL7G 3ETEA 5H6QA 2V7QG 4WFBV 1XILA 4NXMO 1K33A 3BEHA 3JASB 4F6RA 1B3QA 1NBMG 1XMQB 4JASA 2W6JG 3RYCB 2YUAA 4EB6B 5LA6B 5J9PC 5IYDO 2ZINA 4KP4A 4ZHQA 4O2BA 3CCJV 3OM3B 1Q43A 4FZ0A 2OWOA 3FYEB 3K5MA 4LR3A 4I0XA 4UCVA 3HKEB 1V55B 3K0DA 4CH5A 5LGUA 4JPRA 1OCZC 2A06H 4OX9O 4YJ2B 5B1AB 3SJAC 1N36B 4QE9A 4KFMA 3WU2Z 5IJ0A 1ROPA 4UVAA 3GB7C 1FFXB 3SGIA 1ZTEA 4BIUA 3UO2A 4JZ2A 5KX5B 4JI4O 2HP8A 1R6KA 4DV0O 1JOYA 2F1MA 2ZE5A 3CWBH 3JALB 2OCCB 3F7YC 2BTQA 4ZKIA 2HVJC 2F95B 3MHHC 4QPKA 1VQKV 2OCHA 3MAQA 1WB8A 1SA0B 2N04A 2P5OA 5EBWC 3BPZA 1Y76B 4CS3A 3OR6C 1GRJA 3ASOC 1L1FA 2GV9A 1A32A 4D6TH 1XNRB 5BR8O 1BZKA 3K5NA 1NTMH 1IBMB 3CHXA 3ETDA 3J81N 2CTWA 2Q7HA 2GDSA 5CA0A 4ZBMA 3OGCC 4DV7O 4C7UA 3DTUB 3RYFB 2JGUA 4EFEA 4DUZO 1I5YA 1VQNV 2QWNB 1FS0G 3B09A 5CA1B 2RDCA 1DGSA 2ZNIA 4JI3O 1K5SA 2UXNA 1YI2V 1MNGA 1W59A 3CRQA 1BMFG 2RJZA 4X62O 1AI4A 3FAVB 2HJDA 3A8TA 2R70A 3ICXA 2VRZA 3Q4HB 3K0GA 2BOBC 5LP6C 3EFFK 4DR4B 2GHYA 3OGIB 2GBOA 2HG5C 4DV4O 1SQPH 3T4DA 4LF9B 3H1HH 3P3PA 1MSDA 1ZUQA 4MTXA 2GSMB 3CCEV 1FPOA 2LQTA 4IIJB 2WPDG 3OTOO 3U11A 2XOKG 4QPJA 5IDJA 4ASUG 1HDJA 4DR6O 1WLEA 2Q5ZA 2Y69B 1YJNV 2CTQA 3AG4C 1BHAA 3CXHF 2P4VA 4LNUA 1HNWO 1H2GA 3IC9A 3L73H 1Q8IA 1D5NA 2DMXA 3CJHB 2RN9A 1RPOA 3E8BA 2P7TC 1PNMA 4DV2B 3JCUZ 4Z1VA 1W2BU 4P9PA 5EYPA 2ZT9B 1RPRA 2LGQA 1N34O 4PA9A 4EKWA 3E89A 4J7JA 3BHPA 4F6RB 1L8DA 4DW0A 1S72V 2UXBO 5JVDA 2UXCO 2XAQA 3AG3B 4ZHQB 4O2BB 3T4ZA 3OEEG 3OMIB 2FL4A 4JYAB 5K1XA 2VS0A 2AW9A 4I0XB 4WBNA 2A3QA 3ASNC 4B08A 4JI8O 2CE4A 4Z2WA 1URFA 4QE7A 2DYRC 2H94A 5IJ0B 3K9SA 1P7GA 1NTKH 4Q20A 3CRRA 3AG3C 4ICGA 3TGUH 5LGNA 4B3TB 1QLNA 5LMUB 1NTZH 2KKWA 2E3CA 3ETQA 3FFQA 2K1EA 2DYSC 3SPCA 3A0HZ 1ZL8A 3D8CA 2EIKC 2WLMA 4GZRB 1XL4A 3ABMC 1XNQB 1K34A 3RT3C 3BCCH 2BTQB 1R3JC 2EILB 2QM8A 1E1QG 1WP8A 1H2LA 4YIPA 5KHKA 1GMGA 3K06A 4YIOA 3T1YB 4WFEA 2GUZA 5LYJA 4JI0B 3WG7B 2PZSA 5J2UA 1K8AW 3OMAB 1CPYA 3BRCA 3G4SV 4LF4B 1KKDA 1QU7A 5CA0B 3B40A 1BE3H 2VQEO 1H2MA 1PKXA 4JI2O 4DV1B 2LFRA 3L74H 1J5EO 4DR2O 1GK9A 2EINB 4CH3A 4F6EA 4X8AA 1ZLZA 4JYYA 3FX7A 1QVGU 4FVMA 5JCOC 1Q90D 1RM1C 1JFFA 4JTDB 4XDJA 2BSKA 4MW3A 2WAMA 4DV5O 4YXWG 2PI5A 2UUAB 4W4KA 4TQDA 4MVOA 5GONA 2Q4PA 1VQLV 1AP6A 3TXSA 4FMTA 2VWJA 1CXZB 5HFLA 1VIBA 2OTJV 4IHJA 4LF7B 3BAAA 1Y66A 1XMOO 2M6YA 1K73W 4B3MO 1GN4A 3LSSA 4MVZA 1RP3B 4PJ0Z 3DC5A 3K04A 1Y4MA 5BMVA 2E75B 2ZDIA 4LFAO 3P32A 1WB7A 3QO8A 4JTAB 3B8NA 1SQQH 1KECA 4JV5B 3CYOA 4NYKA 4UVBA 4NVPA 3DGEA 3AG1C 4LNUB 4MTOA 1M57C 2A7WA 4NXMB 3M99B 4FFKA 3WB0A 5EBMC 1CEZA 2P22C 1T5EA 1TAEA 2YSUB 1OHHG 4KL1A 2B9ZA 2QKCA 3H1IH 3H9VA 1PV0A 4D7SA 5LL6Y 1D2DA 3A0BZ 5EYPB 5H6RA 5GW7A 5JWPA 3H1JH 2Y0PA 4J10A 5BY1A 1US6A 2ILMA 4K0KO 2C2AA 5DECA 3ZX6A 4TQFA 3AG2B 1VMGA 4X1YA 4OX9B 4FLYA 5JVDB 4TT3G 2VQFO 2ZD9A 4KXRA 5L3GA 3BVOA 2QTSA 4MVUA 3EHBB 1M1KW 4WBNB 5B1OA 2Q9LA 3THOA 1QCEA 2DE0X 3OD4A 5KHJA 4JI4B 4J9ZB 2BCCH 2IJKA 3RYIA 4DV0B 5J2TA 2HJFC 1XI1A 3G80A 2Q6AA 4UFZA 1DF4A 2DN9A 1GTOA 3MHSC 1HNZO 4ZIBA 4HBNA 4UV9A 1B06A 4AI8A 1ZL8B 4AILC 1Q81W 3KCYA 1VQMV 1OCOC 1AJNA 1R3KC 2H3OA 4FLWA 4P30A 3QO5A 4QGPA 4CZZA 5BR8B 2DW4A 3ZN1A 3CEIA 5DM6V 1AR1B 3VQWA 1G4YB 3WB2A 4FM2A 2EIMC 2QSAA 4QJFB 3K08A 4DV7B 1H2SB 4GKJO 1F51A 1NR7A 2GUZB 5LYJB 1BSMA 4DR3O 5J2UB 4DUZB 2P90A 2ADPA 3RVZA 3K9AA 5JQGA 4BW9A 3ZS8C 1MZEA 5KMGA 4FLTA 3H01A 2R9IA 1KMIZ 4Q6GA 4TOIA 3LNMB 3E86A 4JI3B 2YXYA 4MTGA 1Q82W 1S3JA 2P67A 3OAAG 1M9NA 3ZMUA 5LP6A 2NR5A 1XHXA 3E8HA 2AXTZ 4X62B 3CRMA 3FYIB 2BOCC 1EZVH 4B3SO 3OFNG 4JTCB 4RQEA 1JFFB 3U10A 1AR5A 2RQ6A 4NKGB 2E74B 1AI5A 1Q7YW 3I56V 5L3BA 4DV4B 3K03A 2QWRB 5GONB 5IYCO 1UFIA 2N05A 4J41A 1TUBA 5IY5B 1ZAUA 3JAMN 3UQ8A 4JI6O 1QVFU 3OTOB 4IHJB 5IYZA 3ZHSA 3STLC 1DLBA 3AK2A 1R6TA 3RYHA 3B2EE 4DR6B 3S3XA 5CBFA 2Q8VA 1YDXA 2IBZH 5IYBO 1YZBA 3UT5B 1G8MA 5JH7A 1IX9A 1MZFA 4H13B 1Q6UA 1K97A 4DR7O 1JPXA 1KUQA 5L3FA 4UCOA 3LSUA 3AK3A 2AHYA 4FFBA 2QKAA 1QLEC 2FKXA 1GH6A 3H1KH 4NTWA 4CBCA 1VQ5V 5IWAO 3TJTA 3P3NA 3JD1A 1N34B 1LNQA 2QWPB 3VOUA 2XHBA 5C93A 4UCSA 2O57A 4MTFA 3A2FA 4B7KA 2UXBB 1H2KA 2UXCB 4NB5A 1RSOA 3RN4A 1OCZB 1R3IC 3SR2C 4RO2A 4TUYA 3OR7C 4ABMA 4TV8A 1GO3F 2XUMA 1SZTA 1YSCA 3ZRSA 1GN2A 3ML0A 4X1YB 4JI8B 3IAYA 4FPPA 2NNUA 2KB1A 4PA6A 1SKVA 3D36C 2HHHO 4H44B 1VQ7V 1CP9A 1TGOA 2LFSA 3RYIB 5J2TB 2IJIA 1R1BA 3JYCA 3JCZA 4PA3A 4IL6Z 2Q0OC 2CGNA 3ASOB 4PDLA 2RNBA 5B1BC 4DR5O 2Q0AA 3JD2A 1YHQV 2PTMA 5EC1C 3VBBA 2LGWA 3RBZA 4X20A 3G6BA 1K4CC 1SQXH 4A5UB 1GN3A 1FAFA 2VQEB 4CS2A 1W0JG 2R72A 4JI2B 3I5DA 3OT7A 1J5EB 1Q3EA 5LGTA 5JCOA 4DR2B 4B7EA 5KUMA 1P49A 5JQGB 1FXHA 2Q73A 3JSLA 5KMGB 2PYLA 4LP8A 1H38A 4MVQA 1Y67A 1KKCA 5HFMA 3KKYA 5DEDA 4DV5B 1XQ8A 1W0KG 4NXNO 4TV9A 1VARA 4MVSA 2JS3A 1P7BA 5LP6B 3CSXA 2B1IA 4GX1A 3JATA 2KSDA 1YJ9V 1FYJA 3CPWU 2YIBD 5KA5A 1XMOB 2IM9A 4B3MB 1THZA 2YIDA 2DOSA 1TUBB 3CCMV 3K58A 2ADQB 2PGGA 2UU9O 5DN6G 1L0NH 1QR9A 1NH2B 2R9RB 3AG4B 2ITDC 1Y74A 4LFAB 1V54C 2JVDA 4IGGA 5IYZB 3RYHB 2YS8A 1Z5WA 5JH7B 2VWKA 3BA8A 3SPJA 3SYCA 2E5LO 2F43G 4KHPO 5FPRA 1BQZA 5B3SB 5CBHA 4FFBB 4UB6Z 1M93A 3N27A 2CGOA 4O4IA 3RWRD 4K0KB 4K8ZA 1Q6HA 4UV8A 2Q68A 1TUEB 1IZ3A 5B3SC 2WA3A 3ASNB 4GX0A 1RSOB 5CN0A 2VQFB 3AK1A 2WLIA 5C8YA 3ZHVA 1E79G 1N4CA 1J95A 2DYRB 2DQ0A 4TUYB 4EEQA 1O9HA 4TV8B 3OE7G 4IT5A 3OEHG 2DYSB 3I55V 1XBLA 2EIKB 2MK3A 1PL0A 4R6ZA 3ABMB 2JK5C 3TETA 1HNZB 1AJPA 2JEXA 4G2KA 3K5OA 1N32O 1V9PA 4LF5O 4J11A 2WLJA 3CCVV 4FLVA 3SPGA 3T1CA 4X1KA 1ZX3A 1FFTB 5CBGA 2XNDG 3J7AU 3ABTA 3DXRA 1R73A 2A0LA 4GKJB 4DR3B 3QF7A 1AVMA 1Q6IA 1SRYA 4RUFA 3QO7A 4X20B 3R65A 3ZMTA 2UUCO 3QNEA 1IXBA 2XAJA 4LC1A 1MA1A 4PI2A 2QTOA 4XBFA 1DTOA 2DWEC 2YEVA 4WFHA 1RM1B 1B04A 1M56C 3E83A 3ABKC 4BAYA 5LXTA 1N33O 1BL8A 3P30A 2AZ2A 2X6AA 3CCUV 3LSQA 4B3SB 3AG7A 2BTOA 3U0ZA 1BCCH 1YXBA 1AP5A 4O4LA 3LDDA 3LDEA 2WLNA 2R9AA 3JAWA 4X88A 4BIZA 2YDEA 2KQXA 4TV9B 4DK0A 1K5QA 3VQXA 1Q5OA 1EN6A 5B5EZ 3JATB 1EN5A 2LP7A 4JI6B 2YC0A 3SDLA 1U96A 5CMUA 2IH1C 2IJJA 1PNLA 1VQPV 3ZMSA 4RWUA 2IJHA 1FXVA 4OPHA 4LF8O 1BHBA 2ARHA 1YITV 1VQOV 4UB8Z 1Y74B 4DR7B 3AG1B 1M57B 1IBLO 3TCUA 1XEQA 1IXMA 5JJJB 3UT5A 3UKMA 2P6JA 2WWWA 3CRAA 4DYLA 2ZR2A 4FK5C 1D5AA 4I50A 4WFFA 2BE3A 5IWAB 4E4EA 4ZOLA 4IYHA 5AG2A 4R7CA 1YTFD 1M5IA 5A9GA 3BABA 2QE7G 2E76B 3W7WA 1BT8A 2JIZG 3CD6V 2ETNA 3C3TA 4O4IB 5LBQA 5FNVA 3ZRXA 3H1LH 3ZEDA 4U3JA 1KU9A 1OCRC 5KUKA 5KHGA 3CXCU 3D36A 1E1RG 1JQ0A 2JS5A 4JI1O 3CRCA 2WLIB 5C8YB 2GTAA 1HWYA 3W7SA 5KAFZ 5KHIA 1AJQA 4GLXA 1WPXA 4E2LA 1S5HC 4TWKA 1NT2B 2CTPA 3T1HO 2HHHB 1OV9A 1MOFA 1S76D 4RAIA 2ZKOA 1WAZA 3OUSA 4JYCA 3VQVA 3UM7A 1OCOB 3EVKA 3RW0A 4PDMA 4DR5B 2G38A 4PA7A 4B3RO 4X1KB 3ZHQA 3CP1A 2EIMB 2PF4E 2OTLV 3QTCA 3DXRB 1N0JA 3CC7V 2D2CB 3OUFA 1QR8A 3CCLV 2XASA 2ZE8A 4EFBA 1LUVA 2JDIG 2ZXWB 4MT8A 4AQYO 2XAHA 1PM9A 5KAIZ 3HPLC 2PYJA 2PUSA 5LHGA 2V4DA 4BW5A 4UCUA 1X59A 1KD1W 4PD4F 3SJBC 2M7WA 1DK1A 5FLXN 4XDKA 2Y48A 4F4LA 3ZHUA 4X64O 2YEVB 1WA8A 1JMKC 4H0LB 4NXNB 1GAXA 2ZXWC 1KC8W 1HNXO 4I4TA 1LR1A 5IJ9A 3E2EA 5LXTB 1SQBH 4U7NA 4DXWA 2FTKA 3KZIZ 4NR1A 4O4LB 4DV3O 3K59A 3JAWB 1K9MW 3GWOA 3MD0A 5L3CA 4FLXA 4FLZA 5E1AC 2UUBO 2UU9B 2XAGA 3F5TA 1OZ0A 2RCVA 1I7FA 3F5WC 4JI5O 1FXKC 5LHHA 1FJGO 2X0LA 3SYPA 1GM8A 4O2AA 1S0VA 2Z0AA 1M4UA 1G6UA 4I9WA 4DR1O 2ZR3A 3UO3A 1QLEB 3ZRVA 2DQ3A 1IBKO 2E5LB 4KHPB 4J9YB 2UXDO 3FB7C 4P2ZA 2Y4UA 1HNWB 3M7MX 1NQTA 2LW1A 4R50A 4W4LA 3CX5F 4BR6A 2K9PA 2QWOB 4I50B 1P4RA 4LF6O 4UVCA 2DWDC 4ZOLB 1VEWA 1I0HA 5EIBD 2Z3YA 5KA6A 1EZJA 2Y0IA 4JYBA 2YICA 1O9GA 3D3IA 2Y4TA 1PPJH 3MDSA 3SJCC 1KP2A 3CCSV 1OCCB 3K79A 4K8XA 1KQSU 1AILA 2PI4A 1ZWIC 1PP9H 4PHZA 1ORQC 1R6NA 4MVMA 5FNVB 3CS5A 4U3JB 1UJWB 1M90W 1FKAO 4L87A 2EULA 4N23A 3JD0A 3IGAC 1JR9A 4I9QA 4XDLA 5TISZ 4YHHO 1OCCC 3K3WA 3X2QC 4MS2A 3IJ4A 4G27B 2XT9A 2Q67A 1N32B 2OIGA 2P4KA 4LF5B 1NVPD 3EXAA 3JD4A 4I55A 3D3QA 2V1DA 2ZQMA 2F23A 5EZYA 2L6LA 4NTXA 5B1BB 3KCXA 1NR1A 4WFAV 1Z5VA 3L75H 4OPAA 2YI9A 2Q7GA 1I94O 2CDYA 5ITZA 5FPOA 4DV6O 3ABUA 2L35A 1F7YA 2IU3A 1VF6C 1BS3A 4JAVA 2UUCB 1NKDA 4FLUA 1P84F 2GTSA 4ZI7A 2FMLA 2PY5A 3N2GA 1MSWD 2OT5A 4JZGA 2JJ2G 4DK1A 2KG7A 2QJ1A 4YY3O 1YF2A 2FYUH 3BY6A 4HNAA 1V55C 3R66A 1N33B 2W0FC 3CCQV 2X7RB 4P9OA 5B1AC 5EC2C 1HR0O 4FZ1A 1WA8B 4UCTA 3B4SA 1EFRG 4I4TB 5K1PA 5IJ9B 2ZIMA 2CAZC 3IC7A 4YJ3A 2Q69A 3PJSK 4JGSA 1XDCA 4X66O 1G1XB 1NU1H 2EZPA 2CUGA 4WF9V 2ODMA 2D3OW 1SQFA 3ZJZA 2OCCC 2YXLA 3N2KA 2ZNJA 2ZE6A 1SZXA 1OJHA 1U97A 1YEWA 4O4JA 4JAUA 1QNMA 3SYAA 1V54B 3BFRA 2RMKB 3L71H 4FM0A 4LF8B 1F23A 1FD9A 2YIBA 3ABLB 4MSWC 4OGQB 1IBLB 1UPGA 5LOVA 1SESA 2ZM6O 4O4HA 4HZ3A 1QQCA 3LDCA 4O2AB 4J7KA 1K4DC 3GVMA 5LMNO 4NTYA 1NJIW 1IURA 1QBZA 2QA4V 3CMEV 2QM7A 3ABLC 2OYQA 5EBLC 1VF5B 4LFBO 2N74A 3JAKA 3SYOA 4BIOA 1VQ4V 3CB2A 2EIJB 3OW2U 3ZRWA 3BA9A 5B1NA 3QVNA 3DSQA 4LFCO 3G67A 3ZIAG 4GKKO 1YIJV 2H8PC 3B77A 4AHCA 1GM9A 1N0NA 4HAMA 4JI1B 2MW2B 2EJRA 1KBHA 2EIJC 4CH4A 1XREA 4U7OA 4DUYO 3E22A 1K3EA 3UCSC 3RFRA 5JJNB 4X65O 3T1HB 2YI8A 5EIBC 3DC6A 4JI7O 1JA8A 3KG2A 3O9OA 3JSNA 1KP3A 2WA4A 1Y6XA 3FB6C 4D7TA 2Y69C 1H8EG 4FIPC 3J80N 2WLKA 3E35A 4I55B 4B3RB 1NVPB 2F4VO 5EZYB 2QR4A 1GN6A 3ZCCA 2CH7A 4JF3A 2LW7A 2P06A 1HP8A 4G28B 4RUEA 5E79Z 1RFYA 3GWKC 4TSFG 4DO2A 5LHIA 3CCRV 4GYCB 4DRXA 1XMQO 5ITZB 3ZMZA 1JJ2U 4R8CA 4AQYB 1JVMA 4PV1B 3ZHTA 3WFVA 5D5QA 3ZBHA 2HKOA 1M56B 4ZI7B 1JX9A 1I08A 3ABKB 4GCZA 2EX3A 3N2GB 1Q86W 4X64B 1NI8A 3SPHA 3HKBA 1N36O 2KG7B 3HKDA 1DF5A 2HFEC 1HNXB 4HNAB 3FB5C
chains in the Genus database with same CATH topology
5CA1B 1DGSA 2ZNIA 2F93B 4UCOA 3VQVA 4FFBA 3JARA 1HW7A 4PI0A 4DV3B 4DR5B 2RJZA 1N34B 4X1KB 2R70A 4YJ3B 3ICXA 2XHBA 3QTCA 4UCSA 1TA8A 2UUBB 3A2FA 5LP6C 4DR4B 2UXBB 2UXCB 1RSOA 3N2KB 4LF9B 4JI5B 3SR2C 4EFBA 4O4JB 1FJGB 4TUYA 4X1IA 1TVKA 4IIJB 4TV8A 4JI8B 3U11A 4X1YB 2PYJA 2ZCEA 3IAYA 2PUSA 2V4DA 4DR1B 4UCUA 1XHZA 1IBKB 1SKVA 5LOVB 3SJBC 2UXDB 4LNUA 4CH6A 4O4HB 1JMKC 1Q8IA 3HKCA 4NXNB 4I4TA 5IJ9A 1TGOA 5LXTB 3RYIB 4DV2B 4LF6B 5J2TB 5CB4A 1SQGA 2Q7EA 5EYPA 4O4LB 3JAKB 3K59A 3JAWB 2Q0AA 3BHPA 3K57A 4FLXA 2PTMA 4FLZA 4F6RB 1L8DA 4X20A 2UU9B 5JVDA 3RGBA 1WN7A 4ZHQB 1I7FA 4O2BB 2VQEB 4CS2A 2YIAA 2R72A 4JI2B 3PN1A 4JYAB 5K1XA 4WBNA 4O2AA 4YHHB 1J5EB 1Q3EA 5JCOA 4DR2B 4B08A 3E22B 1JJOA 5JJEB 1P49A 5JQGB 1M4UA 3JSLA 1G6UA 5KMGB 4CS4A 2PYLA 5IJ0B 2E5LB 4KHPB 1HNWB 3M7MX 4DV5B 1XQ8A 1VF7A 4B3TB 5LMUB 2KKWA 2E3CA 3ETQA 3FFQA 4TV9A 2HEPA 3JASA 4I50B 1I94B 5LP6B 1XNQB 3CSXA 4ZOLB 5EIBD 3JATA 4DV6B 3RYCA 2BTQB 4EB6A 5LA6A 1O9GA 2YIBD 5KHKA 1XMOB 3SJCC 3T1YB 4K8XA 5LYJA 4JI0B 2IM9A 2QM4A 3WB1A 4B3MB 3HKEA 4LH7A 3K5LA 2PZSA 5J2UA 4PHZA 1TUBB 3K58A 4CC6A 4DRXB 2PGGA 5FNVB 3BRCA 4YJ2A 4U3JB 4LF4B 4YY3B 4LFAB 2JVDA 5CA0B 5IYZB 1FFXA 3RYHB 4DV1B 4I9QA 4UCRA 5KX5A 1HR0B 1Z5WA 5JH7B 1N32B 1QHTA 4LF5B 2VWKA 3BA8A 4CC5A 4CH3A 3HKBB 3HKDB 3JALA 4I55A 4FVMA 5JCOC 5EZYA 1JFFA 5FPRA 4X66B 1Z5VA 2UUAB 4FFBB 1SA0A 2YI9A 3JARB 3VQYA 3OTFA 4TQDA 1M93A 5GONA 1WNSA 2Q7GA 5KHHA 4O4IA 3RWRD 5ITZA 5FPOA 4K0KB 5D5PA 4K8ZA 2VWJA 2F66C 4IHJA 4LF7B 3BAAA 2UUCB 4FLUA 2VQFB 4ZI7A 5C8YA 3RYFA 2PY5A 3N2GA 3LNNA 2ZM6B 4TUYB 4EEQA 4X1IB 1O9HA 1TVKB 5BMVA 4DK1A 4TV8B 2QJ1A 4HNAA 5CA1A 1N33B 5LMNB 4JV5B 4NVPA 4LNUB 1HNZB 4LFBB 3K5OA 1V9PA 1X4TA 4UCTA 4FLVA 4NXMB 3HKCB 3WB0A 2P22C 1T5EA 1TAEA 4I4TB 5K1PA 4X1KA 5IJ9B 2ZIMA 4KL1A 1S5JA 2CAZC 4YJ3A 4D7SA 4L8JA 4LFCB 5CB4B 1SQFA 5EYPB 4GKKB 2YXLA 3N2KA 2ZNJA 1YEWA 4O4JA 4GKJB 4IIJA 4TQFA 4DR3B 3QF7A 4DUYB 4X1YA 4X20B 4FM0A 4OX9B 4LF8B 4FLYA 4X65B 5JVDB 2ZIOA 5BMVB 2YIBA 4FM1A 3QG5A 4PI2A 1IBLB 4LH6A 1WPBA 5LOVA 4JI7B 4O4HA 1QQCA 4WBNB 3THOA 4O2AB 1B04A 4BWAA 5KHJA 4JI4B 5LXTA 3RYIA 4DV0B 5J2TA 1XI1A 4B3SB 2BTOA 4UFZA 3U0ZA 2F4VB 2OYQA 4O4LA 4ZIBA 3JAKA 4HBNA 2R9AA 3JAWA 3CB2A 4TV9B 4AILC 3JASB 4DK0A 4F6RA 4FLWA 3VQXA 1Q5OA 3BA9A 5BR8B 1XMQB 3JATB 3RYCB 3DSQA 4EB6B 5LA6B 4JI6B 2ZINA 4ZHQA 4O2BA 4AHCA 3VQWA 3WB2A 4FM2A 1Q43A 4JI1B 4DV7B 1H2SB 5LYJB 2OWOA 3K5MA 4LR3A 4UCVA 3HKEB 4CH4A 4CH5A 5J2UB 4DUZB 3E22A 5JQGA 3RFRA 4BW9A 3ZS8C 5JJNB 3T1HB 4YJ2B 2YI8A 5KMGA 3SJAC 4FLTA 1N36B 4DR7B 5IJ0A 5EIBC 1KMIZ 4Q6GA 1FFXB 5JJJB 3SGIA 4TOIA 3UT5A 3JSNA 4JI3B 4D7TA 5KX5B 1D5AA 4I50A 5LP6A 1XHXA 2F1MA 5IWAB 4X62B 4ZOLA 3JALB 4I55B 4B3RB 2BTQA 5EZYB 1M5IA 1JFFB 2F95B 3U10A 2RQ6A 3MAQA 3BABA 1SA0B 2P5OA 3BPZA 4DV4B 5GONB 4CS3A 1TUBA 2GV9A 1XNRB 1ZAUA 4GYCB 4DRXA 4O4IB 3K5NA 5ITZB 1IBMB 5FNVA 3ZEDA 4U3JA 1KU9A 3UQ8A 3CHXA 2Q7HA 5KHGA 4AQYB 3OTOB 4IHJB 5CA0A 5IYZA 2JS5A 5D5QA 3RYHA 3B2EE 4DR6B 4ZI7B 5C8YB 3RYFB 5KHIA 2JGUA 4EFEA 4GLXA 2EX3A 3N2GB 3UT5B 1NT2B 4X64B 5JH7A 2HHHB 3HKBA 3HKDA 1HNXB 4HNAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PGG A;  2ZNJ A;  2ZNI A;  2Q7H A;  4BW9 A;  4CH6 A;  3BHP A;  3VQV A;  2YI8 A;  2JVD A;  1G6U A;  3VQX A;  4BWA A;  2RQ6 A;  4CS4 A;  3DSQ A;  2YI9 A;  4Q6G A;  4TQF A;  3VQY A;  1O9G A;  4TQD A;  2Q7G A;  2ZIN A;  2RJZ A;  2YIB D;  5K1P A;  1O9H A;  2ZIM A;  3VQW A;  4CS3 A;  2ZIO A;  2ZCE A;  2YIB A;  2R70 A;  2PUS A;  2QJ1 A;  4CS2 A;  2YIA A;  4ZIB A;  2Q7E A;  4CH3 A;  2E3C A;  2R72 A;  3QTC A;  3ZED A;  5K1X A;  4CH4 A;  4CH5 A;  2HEP A; 
#chains in the Genus database with same CATH topology
 4HYO A;  3SYQ A;  1SC5 B;  2F93 B;  5L3E A;  2A79 B;  3JAR A;  1SQV H;  5KLV H;  1HW7 A;  1K7D A;  4PI0 A;  1MAB G;  4DV3 B;  1I5X A;  5B66 Z;  3TXQ A;  2JGD A;  5L3D A;  2AZ0 A;  5EK0 A;  1R3L C;  4YJ3 B;  1FXK A;  3OMN B;  1TA8 A;  2EZO A;  2UUB B;  3FD9 A;  3SJQ C;  3C90 A;  5H9C A;  3N2K B;  4X9Q A;  4JI5 B;  2EIL C;  1WP7 A;  2HR3 A;  2ZE7 A;  3CC2 V;  1XNR O;  4O4J B;  4RQF A;  1FJG B;  1IBM O;  1S77 D;  2XAF A;  2WSS G;  4X1I A;  1TVK A;  2WLL A;  2EBO A;  2JJ1 G;  2X6B A;  2QKS A;  4I7Z B;  3WG7 C;  2ZCE A;  2CK3 G;  1EBO A;  4DR1 B;  1AB3 A;  3CMA V;  1GM7 A;  1XHZ A;  1IBK B;  3TK1 A;  5A2Q N;  5LOV B;  2UXD B;  1Z2G A;  4QIW F;  4CH6 A;  3NR7 A;  4O4H B;  3HKC A;  1EN4 A;  1F4M A;  4LF6 B;  1SS3 A;  2EIN C;  1YCI A;  1VP7 A;  3NXS A;  5CB4 A;  1SQG A;  4KUM A;  2Q7E A;  5GTH Z;  5IT9 N;  3JAK B;  1VQ9 V;  1BGY H;  1EM1 A;  3RVY A;  5IE9 A;  1OCR B;  4FJC C;  4J7Z A;  3K57 A;  4LWS A;  2IU0 A;  4JAA A;  3ZRW B;  2NN4 A;  1IDS A;  4DR4 O;  1BQ0 A;  2W6I G;  3RGB A;  1WN7 A;  4GUN A;  4LF9 O;  3T2M A;  5BXZ A;  2YIA A;  4I5S A;  3PN1 A;  2A9H A;  3ZMV A;  4YHH B;  3E22 B;  5F2V O;  1JJO A;  5JJE B;  1VQ6 V;  4GT1 A;  1ENV A;  4X89 A;  4GX2 A;  4CS4 A;  1GKF A;  1MG1 A;  2QWQ B;  1S5L Z;  3CC4 V;  4UXN A;  3F7V C;  3FKS G;  4WCE V;  1VF7 A;  2LJ2 A;  1XOU A;  1VF6 A;  2HEP A;  3JAS A;  1I94 B;  4DV2 O;  2AHZ A;  3APQ A;  4J42 A;  4DV6 B;  3RYC A;  4EB6 A;  2QGN A;  5LA6 A;  1SER A;  3B8M A;  2W0X A;  2NLJ C;  1XUQ A;  2IW5 A;  1PL4 A;  2CH7 B;  3STZ C;  1COW G;  5CA3 A;  2QM4 A;  3WB1 A;  3HKE A;  4LH7 A;  3K5L A;  1AI6 A;  4PEL A;  3LUT B;  1PD3 A;  4CC6 A;  3AEI A;  4DRX B;  1ZSP A;  5BZB A;  4YJ2 A;  4N21 A;  2DJV A;  4YY3 B;  4Z1M G;  1KB9 F;  2QEX V;  1FFX A;  3AG2 C;  2XTA A;  3ZN0 A;  4JYA O;  2LO1 A;  3CE2 A;  4WFG A;  4UCR A;  3G6E V;  2IH3 C;  2ATK C;  5KX5 A;  2WLH A;  1HR0 B;  1YJW V;  1QHT A;  2YXH A;  2OIE A;  4CC5 A;  3HKB B;  3HKD B;  3JAL A;  2JRI A;  3HB3 B;  2CTR A;  4K35 A;  4X66 B;  1B6Q A;  4LCU C;  4B3T O;  5LMU O;  1SA0 A;  2B1G A;  2HVK C;  3JD3 A;  3M8A A;  3JAR B;  3VQY A;  3OTF A;  4IYI A;  1AI7 A;  1VQ8 V;  1Y76 A;  1WNS A;  4LBE C;  2QDO A;  1XNQ O;  5KHH A;  2UXX A;  2JGD B;  5D5P A;  4MW8 A;  2F66 C;  1FXK B;  1IVS A;  4DW1 A;  4MVR A;  1ARO P;  1XL6 A;  3T1Y O;  4JI0 O;  4U3F H;  1H2N A;  3APO A;  1NZ6 A;  3C3S A;  3RYF A;  3LNN A;  2ZM6 B;  3E8G A;  4X1I B;  1TVK B;  2WLL B;  1AR4 A;  4LF4 O;  1SF9 A;  2B5U A;  3IFX A;  5CA1 A;  5LMN B;  4H37 A;  4DV1 O;  4OXS A;  1LUW A;  3A0R A;  3L72 H;  3S3W A;  4LFB B;  2BSK B;  1X4T A;  1SET A;  3HKC B;  3FAV A;  3L70 H;  3O65 A;  1S5J A;  3E8F A;  4PDR A;  1JCH A;  2X6C A;  3Q4H A;  1NH2 D;  4L8J A;  2HLD G;  4LFC B;  2UUA O;  2ITC C;  5CB4 B;  3L9D A;  4J80 A;  4H33 A;  4GKK B;  5GTI Z;  5H2F Z;  2AGA A;  2FB5 A;  3FB8 C;  3ZHR A;  1WJZ A;  4IIJ A;  4LWS B;  1K92 A;  4DUY B;  1YVW A;  1YTF B;  4LF7 O;  4QNH B;  1F4N A;  3SPI A;  4X65 B;  2ZIO A;  5BMV B;  5IY5 C;  3X2Q B;  4FM1 A;  1MMM A;  1H8H G;  3QG5 A;  1KYO F;  3W7X A;  4LH6 A;  2Z5U A;  1WPB A;  3G71 V;  2JEU A;  1PNK A;  4JI7 B;  2EJ7 A;  3W7T A;  4K3A A;  4GX5 A;  3W7U A;  5H5N A;  3ETG A;  3HR0 A;  4PA4 A;  3CJH A;  1NS1 A;  4BWA A;  4JV5 O;  1L0L H;  1N8R W;  4PDV A;  2F4V B;  2ZDI C;  4UUJ C;  5FL7 G;  3ETE A;  5H6Q A;  2V7Q G;  4WFB V;  1XIL A;  4NXM O;  1K33 A;  3BEH A;  3JAS B;  4F6R A;  1B3Q A;  1NBM G;  1XMQ B;  4JAS A;  2W6J G;  3RYC B;  2YUA A;  4EB6 B;  5LA6 B;  5J9P C;  5IYD O;  2ZIN A;  4KP4 A;  4ZHQ A;  4O2B A;  3CCJ V;  3OM3 B;  1Q43 A;  4FZ0 A;  2OWO A;  3FYE B;  3K5M A;  4LR3 A;  4I0X A;  4UCV A;  3HKE B;  1V55 B;  3K0D A;  4CH5 A;  5LGU A;  4JPR A;  1OCZ C;  2A06 H;  4OX9 O;  4YJ2 B;  5B1A B;  3SJA C;  1N36 B;  4QE9 A;  4KFM A;  3WU2 Z;  5IJ0 A;  1ROP A;  4UVA A;  3GB7 C;  1FFX B;  3SGI A;  1ZTE A;  4BIU A;  3UO2 A;  4JZ2 A;  5KX5 B;  4JI4 O;  2HP8 A;  1R6K A;  4DV0 O;  1JOY A;  2F1M A;  2ZE5 A;  3CWB H;  3JAL B;  2OCC B;  3F7Y C;  2BTQ A;  4ZKI A;  2HVJ C;  2F95 B;  3MHH C;  4QPK A;  1VQK V;  2OCH A;  3MAQ A;  1WB8 A;  1SA0 B;  2N04 A;  2P5O A;  5EBW C;  3BPZ A;  1Y76 B;  4CS3 A;  3OR6 C;  1GRJ A;  3ASO C;  1L1F A;  2GV9 A;  1A32 A;  4D6T H;  1XNR B;  5BR8 O;  1BZK A;  3K5N A;  1NTM H;  1IBM B;  3CHX A;  3ETD A;  3J81 N;  2CTW A;  2Q7H A;  2GDS A;  5CA0 A;  4ZBM A;  3OGC C;  4DV7 O;  4C7U A;  3DTU B;  3RYF B;  2JGU A;  4EFE A;  4DUZ O;  1I5Y A;  1VQN V;  2QWN B;  1FS0 G;  3B09 A;  5CA1 B;  2RDC A;  1DGS A;  2ZNI A;  4JI3 O;  1K5S A;  2UXN A;  1YI2 V;  1MNG A;  1W59 A;  3CRQ A;  1BMF G;  2RJZ A;  4X62 O;  1AI4 A;  3FAV B;  2HJD A;  3A8T A;  2R70 A;  3ICX A;  2VRZ A;  3Q4H B;  3K0G A;  2BOB C;  5LP6 C;  3EFF K;  4DR4 B;  2GHY A;  3OGI B;  2GBO A;  2HG5 C;  4DV4 O;  1SQP H;  3T4D A;  4LF9 B;  3H1H H;  3P3P A;  1MSD A;  1ZUQ A;  4MTX A;  2GSM B;  3CCE V;  1FPO A;  2LQT A;  4IIJ B;  2WPD G;  3OTO O;  3U11 A;  2XOK G;  4QPJ A;  5IDJ A;  4ASU G;  1HDJ A;  4DR6 O;  1WLE A;  2Q5Z A;  2Y69 B;  1YJN V;  2CTQ A;  3AG4 C;  1BHA A;  3CXH F;  2P4V A;  4LNU A;  1HNW O;  1H2G A;  3IC9 A;  3L73 H;  1Q8I A;  1D5N A;  2DMX A;  3CJH B;  2RN9 A;  1RPO A;  3E8B A;  2P7T C;  1PNM A;  4DV2 B;  3JCU Z;  4Z1V A;  1W2B U;  4P9P A;  5EYP A;  2ZT9 B;  1RPR A;  2LGQ A;  1N34 O;  4PA9 A;  4EKW A;  3E89 A;  4J7J A;  3BHP A;  4F6R B;  1L8D A;  4DW0 A;  1S72 V;  2UXB O;  5JVD A;  2UXC O;  2XAQ A;  3AG3 B;  4ZHQ B;  4O2B B;  3T4Z A;  3OEE G;  3OMI B;  2FL4 A;  4JYA B;  5K1X A;  2VS0 A;  2AW9 A;  4I0X B;  4WBN A;  2A3Q A;  3ASN C;  4B08 A;  4JI8 O;  2CE4 A;  4Z2W A;  1URF A;  4QE7 A;  2DYR C;  2H94 A;  5IJ0 B;  3K9S A;  1P7G A;  1NTK H;  4Q20 A;  3CRR A;  3AG3 C;  4ICG A;  3TGU H;  5LGN A;  4B3T B;  1QLN A;  5LMU B;  1NTZ H;  2KKW A;  2E3C A;  3ETQ A;  3FFQ A;  2K1E A;  2DYS C;  3SPC A;  3A0H Z;  1ZL8 A;  3D8C A;  2EIK C;  2WLM A;  4GZR B;  1XL4 A;  3ABM C;  1XNQ B;  1K34 A;  3RT3 C;  3BCC H;  2BTQ B;  1R3J C;  2EIL B;  2QM8 A;  1E1Q G;  1WP8 A;  1H2L A;  4YIP A;  5KHK A;  1GMG A;  3K06 A;  4YIO A;  3T1Y B;  4WFE A;  2GUZ A;  5LYJ A;  4JI0 B;  3WG7 B;  2PZS A;  5J2U A;  1K8A W;  3OMA B;  1CPY A;  3BRC A;  3G4S V;  4LF4 B;  1KKD A;  1QU7 A;  5CA0 B;  3B40 A;  1BE3 H;  2VQE O;  1H2M A;  1PKX A;  4JI2 O;  4DV1 B;  2LFR A;  3L74 H;  1J5E O;  4DR2 O;  1GK9 A;  2EIN B;  4CH3 A;  4F6E A;  4X8A A;  1ZLZ A;  4JYY A;  3FX7 A;  1QVG U;  4FVM A;  5JCO C;  1Q90 D;  1RM1 C;  1JFF A;  4JTD B;  4XDJ A;  2BSK A;  4MW3 A;  2WAM A;  4DV5 O;  4YXW G;  2PI5 A;  2UUA B;  4W4K A;  4TQD A;  4MVO A;  5GON A;  2Q4P A;  1VQL V;  1AP6 A;  3TXS A;  4FMT A;  2VWJ A;  1CXZ B;  5HFL A;  1VIB A;  2OTJ V;  4IHJ A;  4LF7 B;  3BAA A;  1Y66 A;  1XMO O;  2M6Y A;  1K73 W;  4B3M O;  1GN4 A;  3LSS A;  4MVZ A;  1RP3 B;  4PJ0 Z;  3DC5 A;  3K04 A;  1Y4M A;  5BMV A;  2E75 B;  2ZDI A;  4LFA O;  3P32 A;  1WB7 A;  3QO8 A;  4JTA B;  3B8N A;  1SQQ H;  1KEC A;  4JV5 B;  3CYO A;  4NYK A;  4UVB A;  4NVP A;  3DGE A;  3AG1 C;  4LNU B;  4MTO A;  1M57 C;  2A7W A;  4NXM B;  3M99 B;  4FFK A;  3WB0 A;  5EBM C;  1CEZ A;  2P22 C;  1T5E A;  1TAE A;  2YSU B;  1OHH G;  4KL1 A;  2B9Z A;  2QKC A;  3H1I H;  3H9V A;  1PV0 A;  4D7S A;  5LL6 Y;  1D2D A;  3A0B Z;  5EYP B;  5H6R A;  5GW7 A;  5JWP A;  3H1J H;  2Y0P A;  4J10 A;  5BY1 A;  1US6 A;  2ILM A;  4K0K O;  2C2A A;  5DEC A;  3ZX6 A;  4TQF A;  3AG2 B;  1VMG A;  4X1Y A;  4OX9 B;  4FLY A;  5JVD B;  4TT3 G;  2VQF O;  2ZD9 A;  4KXR A;  5L3G A;  3BVO A;  2QTS A;  4MVU A;  3EHB B;  1M1K W;  4WBN B;  5B1O A;  2Q9L A;  3THO A;  1QCE A;  2DE0 X;  3OD4 A;  5KHJ A;  4JI4 B;  4J9Z B;  2BCC H;  2IJK A;  3RYI A;  4DV0 B;  5J2T A;  2HJF C;  1XI1 A;  3G80 A;  2Q6A A;  4UFZ A;  1DF4 A;  2DN9 A;  1GTO A;  3MHS C;  1HNZ O;  4ZIB A;  4HBN A;  4UV9 A;  1B06 A;  4AI8 A;  1ZL8 B;  4AIL C;  1Q81 W;  3KCY A;  1VQM V;  1OCO C;  1AJN A;  1R3K C;  2H3O A;  4FLW A;  4P30 A;  3QO5 A;  4QGP A;  4CZZ A;  5BR8 B;  2DW4 A;  3ZN1 A;  3CEI A;  5DM6 V;  1AR1 B;  3VQW A;  1G4Y B;  3WB2 A;  4FM2 A;  2EIM C;  2QSA A;  4QJF B;  3K08 A;  4DV7 B;  1H2S B;  4GKJ O;  1F51 A;  1NR7 A;  2GUZ B;  5LYJ B;  1BSM A;  4DR3 O;  5J2U B;  4DUZ B;  2P90 A;  2ADP A;  3RVZ A;  3K9A A;  5JQG A;  4BW9 A;  3ZS8 C;  1MZE A;  5KMG A;  4FLT A;  3H01 A;  2R9I A;  1KMI Z;  4Q6G A;  4TOI A;  3LNM B;  3E86 A;  4JI3 B;  2YXY A;  4MTG A;  1Q82 W;  1S3J A;  2P67 A;  3OAA G;  1M9N A;  3ZMU A;  5LP6 A;  2NR5 A;  1XHX A;  3E8H A;  2AXT Z;  4X62 B;  3CRM A;  3FYI B;  2BOC C;  1EZV H;  4B3S O;  3OFN G;  4JTC B;  4RQE A;  1JFF B;  3U10 A;  1AR5 A;  2RQ6 A;  4NKG B;  2E74 B;  1AI5 A;  1Q7Y W;  3I56 V;  5L3B A;  4DV4 B;  3K03 A;  2QWR B;  5GON B;  5IYC O;  1UFI A;  2N05 A;  4J41 A;  1TUB A;  5IY5 B;  1ZAU A;  3JAM N;  3UQ8 A;  4JI6 O;  1QVF U;  3OTO B;  4IHJ B;  5IYZ A;  3ZHS A;  3STL C;  1DLB A;  3AK2 A;  1R6T A;  3RYH A;  3B2E E;  4DR6 B;  3S3X A;  5CBF A;  2Q8V A;  1YDX A;  2IBZ H;  5IYB O;  1YZB A;  3UT5 B;  1G8M A;  5JH7 A;  1IX9 A;  1MZF A;  4H13 B;  1Q6U A;  1K97 A;  4DR7 O;  1JPX A;  1KUQ A;  5L3F A;  4UCO A;  3LSU A;  3AK3 A;  2AHY A;  4FFB A;  2QKA A;  1QLE C;  2FKX A;  1GH6 A;  3H1K H;  4NTW A;  4CBC A;  1VQ5 V;  5IWA O;  3TJT A;  3P3N A;  3JD1 A;  1N34 B;  1LNQ A;  2QWP B;  3VOU A;  2XHB A;  5C93 A;  4UCS A;  2O57 A;  4MTF A;  3A2F A;  4B7K A;  2UXB B;  1H2K A;  2UXC B;  4NB5 A;  1RSO A;  3RN4 A;  1OCZ B;  1R3I C;  3SR2 C;  4RO2 A;  4TUY A;  3OR7 C;  4ABM A;  4TV8 A;  1GO3 F;  2XUM A;  1SZT A;  1YSC A;  3ZRS A;  1GN2 A;  3ML0 A;  4X1Y B;  4JI8 B;  3IAY A;  4FPP A;  2NNU A;  2KB1 A;  4PA6 A;  1SKV A;  3D36 C;  2HHH O;  4H44 B;  1VQ7 V;  1CP9 A;  1TGO A;  2LFS A;  3RYI B;  5J2T B;  2IJI A;  1R1B A;  3JYC A;  3JCZ A;  4PA3 A;  4IL6 Z;  2Q0O C;  2CGN A;  3ASO B;  4PDL A;  2RNB A;  5B1B C;  4DR5 O;  2Q0A A;  3JD2 A;  1YHQ V;  2PTM A;  5EC1 C;  3VBB A;  2LGW A;  3RBZ A;  4X20 A;  3G6B A;  1K4C C;  1SQX H;  4A5U B;  1GN3 A;  1FAF A;  2VQE B;  4CS2 A;  1W0J G;  2R72 A;  4JI2 B;  3I5D A;  3OT7 A;  1J5E B;  1Q3E A;  5LGT A;  5JCO A;  4DR2 B;  4B7E A;  5KUM A;  1P49 A;  5JQG B;  1FXH A;  2Q73 A;  3JSL A;  5KMG B;  2PYL A;  4LP8 A;  1H38 A;  4MVQ A;  1Y67 A;  1KKC A;  5HFM A;  3KKY A;  5DED A;  4DV5 B;  1XQ8 A;  1W0K G;  4NXN O;  4TV9 A;  1VAR A;  4MVS A;  2JS3 A;  1P7B A;  5LP6 B;  3CSX A;  2B1I A;  4GX1 A;  3JAT A;  2KSD A;  1YJ9 V;  1FYJ A;  3CPW U;  2YIB D;  5KA5 A;  1XMO B;  2IM9 A;  4B3M B;  1THZ A;  2YID A;  2DOS A;  1TUB B;  3CCM V;  3K58 A;  2ADQ B;  2PGG A;  2UU9 O;  5DN6 G;  1L0N H;  1QR9 A;  1NH2 B;  2R9R B;  3AG4 B;  2ITD C;  1Y74 A;  4LFA B;  1V54 C;  2JVD A;  4IGG A;  5IYZ B;  3RYH B;  2YS8 A;  1Z5W A;  5JH7 B;  2VWK A;  3BA8 A;  3SPJ A;  3SYC A;  2E5L O;  2F43 G;  4KHP O;  5FPR A;  1BQZ A;  5B3S B;  5CBH A;  4FFB B;  4UB6 Z;  1M93 A;  3N27 A;  2CGO A;  4O4I A;  3RWR D;  4K0K B;  4K8Z A;  1Q6H A;  4UV8 A;  2Q68 A;  1TUE B;  1IZ3 A;  5B3S C;  2WA3 A;  3ASN B;  4GX0 A;  1RSO B;  5CN0 A;  2VQF B;  3AK1 A;  2WLI A;  5C8Y A;  3ZHV A;  1E79 G;  1N4C A;  1J95 A;  2DYR B;  2DQ0 A;  4TUY B;  4EEQ A;  1O9H A;  4TV8 B;  3OE7 G;  4IT5 A;  3OEH G;  2DYS B;  3I55 V;  1XBL A;  2EIK B;  2MK3 A;  1PL0 A;  4R6Z A;  3ABM B;  2JK5 C;  3TET A;  1HNZ B;  1AJP A;  2JEX A;  4G2K A;  3K5O A;  1N32 O;  1V9P A;  4LF5 O;  4J11 A;  2WLJ A;  3CCV V;  4FLV A;  3SPG A;  3T1C A;  4X1K A;  1ZX3 A;  1FFT B;  5CBG A;  2XND G;  3J7A U;  3ABT A;  3DXR A;  1R73 A;  2A0L A;  4GKJ B;  4DR3 B;  3QF7 A;  1AVM A;  1Q6I A;  1SRY A;  4RUF A;  3QO7 A;  4X20 B;  3R65 A;  3ZMT A;  2UUC O;  3QNE A;  1IXB A;  2XAJ A;  4LC1 A;  1MA1 A;  4PI2 A;  2QTO A;  4XBF A;  1DTO A;  2DWE C;  2YEV A;  4WFH A;  1RM1 B;  1B04 A;  1M56 C;  3E83 A;  3ABK C;  4BAY A;  5LXT A;  1N33 O;  1BL8 A;  3P30 A;  2AZ2 A;  2X6A A;  3CCU V;  3LSQ A;  4B3S B;  3AG7 A;  2BTO A;  3U0Z A;  1BCC H;  1YXB A;  1AP5 A;  4O4L A;  3LDD A;  3LDE A;  2WLN A;  2R9A A;  3JAW A;  4X88 A;  4BIZ A;  2YDE A;  2KQX A;  4TV9 B;  4DK0 A;  1K5Q A;  3VQX A;  1Q5O A;  1EN6 A;  5B5E Z;  3JAT B;  1EN5 A;  2LP7 A;  4JI6 B;  2YC0 A;  3SDL A;  1U96 A;  5CMU A;  2IH1 C;  2IJJ A;  1PNL A;  1VQP V;  3ZMS A;  4RWU A;  2IJH A;  1FXV A;  4OPH A;  4LF8 O;  1BHB A;  2ARH A;  1YIT V;  1VQO V;  4UB8 Z;  1Y74 B;  4DR7 B;  3AG1 B;  1M57 B;  1IBL O;  3TCU A;  1XEQ A;  1IXM A;  5JJJ B;  3UT5 A;  3UKM A;  2P6J A;  2WWW A;  3CRA A;  4DYL A;  2ZR2 A;  4FK5 C;  1D5A A;  4I50 A;  4WFF A;  2BE3 A;  5IWA B;  4E4E A;  4ZOL A;  4IYH A;  5AG2 A;  4R7C A;  1YTF D;  1M5I A;  5A9G A;  3BAB A;  2QE7 G;  2E76 B;  3W7W A;  1BT8 A;  2JIZ G;  3CD6 V;  2ETN A;  3C3T A;  4O4I B;  5LBQ A;  5FNV A;  3ZRX A;  3H1L H;  3ZED A;  4U3J A;  1KU9 A;  1OCR C;  5KUK A;  5KHG A;  3CXC U;  3D36 A;  1E1R G;  1JQ0 A;  2JS5 A;  4JI1 O;  3CRC A;  2WLI B;  5C8Y B;  2GTA A;  1HWY A;  3W7S A;  5KAF Z;  5KHI A;  1AJQ A;  4GLX A;  1WPX A;  4E2L A;  1S5H C;  4TWK A;  1NT2 B;  2CTP A;  3T1H O;  2HHH B;  1OV9 A;  1MOF A;  1S76 D;  4RAI A;  2ZKO A;  1WAZ A;  3OUS A;  4JYC A;  3VQV A;  3UM7 A;  1OCO B;  3EVK A;  3RW0 A;  4PDM A;  4DR5 B;  2G38 A;  4PA7 A;  4B3R O;  4X1K B;  3ZHQ A;  3CP1 A;  2EIM B;  2PF4 E;  2OTL V;  3QTC A;  3DXR B;  1N0J A;  3CC7 V;  2D2C B;  3OUF A;  1QR8 A;  3CCL V;  2XAS A;  2ZE8 A;  4EFB A;  1LUV A;  2JDI G;  2ZXW B;  4MT8 A;  4AQY O;  2XAH A;  1PM9 A;  5KAI Z;  3HPL C;  2PYJ A;  2PUS A;  5LHG A;  2V4D A;  4BW5 A;  4UCU A;  1X59 A;  1KD1 W;  4PD4 F;  3SJB C;  2M7W A;  1DK1 A;  5FLX N;  4XDK A;  2Y48 A;  4F4L A;  3ZHU A;  4X64 O;  2YEV B;  1WA8 A;  1JMK C;  4H0L B;  4NXN B;  1GAX A;  2ZXW C;  1KC8 W;  1HNX O;  4I4T A;  1LR1 A;  5IJ9 A;  3E2E A;  5LXT B;  1SQB H;  4U7N A;  4DXW A;  2FTK A;  3KZI Z;  4NR1 A;  4O4L B;  4DV3 O;  3K59 A;  3JAW B;  1K9M W;  3GWO A;  3MD0 A;  5L3C A;  4FLX A;  4FLZ A;  5E1A C;  2UUB O;  2UU9 B;  2XAG A;  3F5T A;  1OZ0 A;  2RCV A;  1I7F A;  3F5W C;  4JI5 O;  1FXK C;  5LHH A;  1FJG O;  2X0L A;  3SYP A;  1GM8 A;  4O2A A;  1S0V A;  2Z0A A;  1M4U A;  1G6U A;  4I9W A;  4DR1 O;  2ZR3 A;  3UO3 A;  1QLE B;  3ZRV A;  2DQ3 A;  1IBK O;  2E5L B;  4KHP B;  4J9Y B;  2UXD O;  3FB7 C;  4P2Z A;  2Y4U A;  1HNW B;  3M7M X;  1NQT A;  2LW1 A;  4R50 A;  4W4L A;  3CX5 F;  4BR6 A;  2K9P A;  2QWO B;  4I50 B;  1P4R A;  4LF6 O;  4UVC A;  2DWD C;  4ZOL B;  1VEW A;  1I0H A;  5EIB D;  2Z3Y A;  5KA6 A;  1EZJ A;  2Y0I A;  4JYB A;  2YIC A;  1O9G A;  3D3I A;  2Y4T A;  1PPJ H;  3MDS A;  3SJC C;  1KP2 A;  3CCS V;  1OCC B;  3K79 A;  4K8X A;  1KQS U;  1AIL A;  2PI4 A;  1ZWI C;  1PP9 H;  4PHZ A;  1ORQ C;  1R6N A;  4MVM A;  5FNV B;  3CS5 A;  4U3J B;  1UJW B;  1M90 W;  1FKA O;  4L87 A;  2EUL A;  4N23 A;  3JD0 A;  3IGA C;  1JR9 A;  4I9Q A;  4XDL A;  5TIS Z;  4YHH O;  1OCC C;  3K3W A;  3X2Q C;  4MS2 A;  3IJ4 A;  4G27 B;  2XT9 A;  2Q67 A;  1N32 B;  2OIG A;  2P4K A;  4LF5 B;  1NVP D;  3EXA A;  3JD4 A;  4I55 A;  3D3Q A;  2V1D A;  2ZQM A;  2F23 A;  5EZY A;  2L6L A;  4NTX A;  5B1B B;  3KCX A;  1NR1 A;  4WFA V;  1Z5V A;  3L75 H;  4OPA A;  2YI9 A;  2Q7G A;  1I94 O;  2CDY A;  5ITZ A;  5FPO A;  4DV6 O;  3ABU A;  2L35 A;  1F7Y A;  2IU3 A;  1VF6 C;  1BS3 A;  4JAV A;  2UUC B;  1NKD A;  4FLU A;  1P84 F;  2GTS A;  4ZI7 A;  2FML A;  2PY5 A;  3N2G A;  1MSW D;  2OT5 A;  4JZG A;  2JJ2 G;  4DK1 A;  2KG7 A;  2QJ1 A;  4YY3 O;  1YF2 A;  2FYU H;  3BY6 A;  4HNA A;  1V55 C;  3R66 A;  1N33 B;  2W0F C;  3CCQ V;  2X7R B;  4P9O A;  5B1A C;  5EC2 C;  1HR0 O;  4FZ1 A;  1WA8 B;  4UCT A;  3B4S A;  1EFR G;  4I4T B;  5K1P A;  5IJ9 B;  2ZIM A;  2CAZ C;  3IC7 A;  4YJ3 A;  2Q69 A;  3PJS K;  4JGS A;  1XDC A;  4X66 O;  1G1X B;  1NU1 H;  2EZP A;  2CUG A;  4WF9 V;  2ODM A;  2D3O W;  1SQF A;  3ZJZ A;  2OCC C;  2YXL A;  3N2K A;  2ZNJ A;  2ZE6 A;  1SZX A;  1OJH A;  1U97 A;  1YEW A;  4O4J A;  4JAU A;  1QNM A;  3SYA A;  1V54 B;  3BFR A;  2RMK B;  3L71 H;  4FM0 A;  4LF8 B;  1F23 A;  1FD9 A;  2YIB A;  3ABL B;  4MSW C;  4OGQ B;  1IBL B;  1UPG A;  5LOV A;  1SES A;  2ZM6 O;  4O4H A;  4HZ3 A;  1QQC A;  3LDC A;  4O2A B;  4J7K A;  1K4D C;  3GVM A;  5LMN O;  4NTY A;  1NJI W;  1IUR A;  1QBZ A;  2QA4 V;  3CME V;  2QM7 A;  3ABL C;  2OYQ A;  5EBL C;  1VF5 B;  4LFB O;  2N74 A;  3JAK A;  3SYO A;  4BIO A;  1VQ4 V;  3CB2 A;  2EIJ B;  3OW2 U;  3ZRW A;  3BA9 A;  5B1N A;  3QVN A;  3DSQ A;  4LFC O;  3G67 A;  3ZIA G;  4GKK O;  1YIJ V;  2H8P C;  3B77 A;  4AHC A;  1GM9 A;  1N0N A;  4HAM A;  4JI1 B;  2MW2 B;  2EJR A;  1KBH A;  2EIJ C;  4CH4 A;  1XRE A;  4U7O A;  4DUY O;  3E22 A;  1K3E A;  3UCS C;  3RFR A;  5JJN B;  4X65 O;  3T1H B;  2YI8 A;  5EIB C;  3DC6 A;  4JI7 O;  1JA8 A;  3KG2 A;  3O9O A;  3JSN A;  1KP3 A;  2WA4 A;  1Y6X A;  3FB6 C;  4D7T A;  2Y69 C;  1H8E G;  4FIP C;  3J80 N;  2WLK A;  3E35 A;  4I55 B;  4B3R B;  1NVP B;  2F4V O;  5EZY B;  2QR4 A;  1GN6 A;  3ZCC A;  2CH7 A;  4JF3 A;  2LW7 A;  2P06 A;  1HP8 A;  4G28 B;  4RUE A;  5E79 Z;  1RFY A;  3GWK C;  4TSF G;  4DO2 A;  5LHI A;  3CCR V;  4GYC B;  4DRX A;  1XMQ O;  5ITZ B;  3ZMZ A;  1JJ2 U;  4R8C A;  4AQY B;  1JVM A;  4PV1 B;  3ZHT A;  3WFV A;  5D5Q A;  3ZBH A;  2HKO A;  1M56 B;  4ZI7 B;  1JX9 A;  1I08 A;  3ABK B;  4GCZ A;  2EX3 A;  3N2G B;  1Q86 W;  4X64 B;  1NI8 A;  3SPH A;  3HKB A;  1N36 O;  2KG7 B;  3HKD A;  1DF5 A;  2HFE C;  1HNX B;  4HNA B;  3FB5 C; 
#chains in the Genus database with same CATH homology
 5CA1 B;  1DGS A;  2ZNI A;  2F93 B;  4UCO A;  3VQV A;  4FFB A;  3JAR A;  1HW7 A;  4PI0 A;  4DV3 B;  4DR5 B;  2RJZ A;  1N34 B;  4X1K B;  2R70 A;  4YJ3 B;  3ICX A;  2XHB A;  3QTC A;  4UCS A;  1TA8 A;  2UUB B;  3A2F A;  5LP6 C;  4DR4 B;  2UXB B;  2UXC B;  1RSO A;  3N2K B;  4LF9 B;  4JI5 B;  3SR2 C;  4EFB A;  4O4J B;  1FJG B;  4TUY A;  4X1I A;  1TVK A;  4IIJ B;  4TV8 A;  4JI8 B;  3U11 A;  4X1Y B;  2PYJ A;  2ZCE A;  3IAY A;  2PUS A;  2V4D A;  4DR1 B;  4UCU A;  1XHZ A;  1IBK B;  1SKV A;  5LOV B;  3SJB C;  2UXD B;  4LNU A;  4CH6 A;  4O4H B;  1JMK C;  1Q8I A;  3HKC A;  4NXN B;  4I4T A;  5IJ9 A;  1TGO A;  5LXT B;  3RYI B;  4DV2 B;  4LF6 B;  5J2T B;  5CB4 A;  1SQG A;  2Q7E A;  5EYP A;  4O4L B;  3JAK B;  3K59 A;  3JAW B;  2Q0A A;  3BHP A;  3K57 A;  4FLX A;  2PTM A;  4FLZ A;  4F6R B;  1L8D A;  4X20 A;  2UU9 B;  5JVD A;  3RGB A;  1WN7 A;  4ZHQ B;  1I7F A;  4O2B B;  2VQE B;  4CS2 A;  2YIA A;  2R72 A;  4JI2 B;  3PN1 A;  4JYA B;  5K1X A;  4WBN A;  4O2A A;  4YHH B;  1J5E B;  1Q3E A;  5JCO A;  4DR2 B;  4B08 A;  3E22 B;  1JJO A;  5JJE B;  1P49 A;  5JQG B;  1M4U A;  3JSL A;  1G6U A;  5KMG B;  4CS4 A;  2PYL A;  5IJ0 B;  2E5L B;  4KHP B;  1HNW B;  3M7M X;  4DV5 B;  1XQ8 A;  1VF7 A;  4B3T B;  5LMU B;  2KKW A;  2E3C A;  3ETQ A;  3FFQ A;  4TV9 A;  2HEP A;  3JAS A;  4I50 B;  1I94 B;  5LP6 B;  1XNQ B;  3CSX A;  4ZOL B;  5EIB D;  3JAT A;  4DV6 B;  3RYC A;  2BTQ B;  4EB6 A;  5LA6 A;  1O9G A;  2YIB D;  5KHK A;  1XMO B;  3SJC C;  3T1Y B;  4K8X A;  5LYJ A;  4JI0 B;  2IM9 A;  2QM4 A;  3WB1 A;  4B3M B;  3HKE A;  4LH7 A;  3K5L A;  2PZS A;  5J2U A;  4PHZ A;  1TUB B;  3K58 A;  4CC6 A;  4DRX B;  2PGG A;  5FNV B;  3BRC A;  4YJ2 A;  4U3J B;  4LF4 B;  4YY3 B;  4LFA B;  2JVD A;  5CA0 B;  5IYZ B;  1FFX A;  3RYH B;  4DV1 B;  4I9Q A;  4UCR A;  5KX5 A;  1HR0 B;  1Z5W A;  5JH7 B;  1N32 B;  1QHT A;  4LF5 B;  2VWK A;  3BA8 A;  4CC5 A;  4CH3 A;  3HKB B;  3HKD B;  3JAL A;  4I55 A;  4FVM A;  5JCO C;  5EZY A;  1JFF A;  5FPR A;  4X66 B;  1Z5V A;  2UUA B;  4FFB B;  1SA0 A;  2YI9 A;  3JAR B;  3VQY A;  3OTF A;  4TQD A;  1M93 A;  5GON A;  1WNS A;  2Q7G A;  5KHH A;  4O4I A;  3RWR D;  5ITZ A;  5FPO A;  4K0K B;  5D5P A;  4K8Z A;  2VWJ A;  2F66 C;  4IHJ A;  4LF7 B;  3BAA A;  2UUC B;  4FLU A;  2VQF B;  4ZI7 A;  5C8Y A;  3RYF A;  2PY5 A;  3N2G A;  3LNN A;  2ZM6 B;  4TUY B;  4EEQ A;  4X1I B;  1O9H A;  1TVK B;  5BMV A;  4DK1 A;  4TV8 B;  2QJ1 A;  4HNA A;  5CA1 A;  1N33 B;  5LMN B;  4JV5 B;  4NVP A;  4LNU B;  1HNZ B;  4LFB B;  3K5O A;  1V9P A;  1X4T A;  4UCT A;  4FLV A;  4NXM B;  3HKC B;  3WB0 A;  2P22 C;  1T5E A;  1TAE A;  4I4T B;  5K1P A;  4X1K A;  5IJ9 B;  2ZIM A;  4KL1 A;  1S5J A;  2CAZ C;  4YJ3 A;  4D7S A;  4L8J A;  4LFC B;  5CB4 B;  1SQF A;  5EYP B;  4GKK B;  2YXL A;  3N2K A;  2ZNJ A;  1YEW A;  4O4J A;  4GKJ B;  4IIJ A;  4TQF A;  4DR3 B;  3QF7 A;  4DUY B;  4X1Y A;  4X20 B;  4FM0 A;  4OX9 B;  4LF8 B;  4FLY A;  4X65 B;  5JVD B;  2ZIO A;  5BMV B;  2YIB A;  4FM1 A;  3QG5 A;  4PI2 A;  1IBL B;  4LH6 A;  1WPB A;  5LOV A;  4JI7 B;  4O4H A;  1QQC A;  4WBN B;  3THO A;  4O2A B;  1B04 A;  4BWA A;  5KHJ A;  4JI4 B;  5LXT A;  3RYI A;  4DV0 B;  5J2T A;  1XI1 A;  4B3S B;  2BTO A;  4UFZ A;  3U0Z A;  2F4V B;  2OYQ A;  4O4L A;  4ZIB A;  3JAK A;  4HBN A;  2R9A A;  3JAW A;  3CB2 A;  4TV9 B;  4AIL C;  3JAS B;  4DK0 A;  4F6R A;  4FLW A;  3VQX A;  1Q5O A;  3BA9 A;  5BR8 B;  1XMQ B;  3JAT B;  3RYC B;  3DSQ A;  4EB6 B;  5LA6 B;  4JI6 B;  2ZIN A;  4ZHQ A;  4O2B A;  4AHC A;  3VQW A;  3WB2 A;  4FM2 A;  1Q43 A;  4JI1 B;  4DV7 B;  1H2S B;  5LYJ B;  2OWO A;  3K5M A;  4LR3 A;  4UCV A;  3HKE B;  4CH4 A;  4CH5 A;  5J2U B;  4DUZ B;  3E22 A;  5JQG A;  3RFR A;  4BW9 A;  3ZS8 C;  5JJN B;  3T1H B;  4YJ2 B;  2YI8 A;  5KMG A;  3SJA C;  4FLT A;  1N36 B;  4DR7 B;  5IJ0 A;  5EIB C;  1KMI Z;  4Q6G A;  1FFX B;  5JJJ B;  3SGI A;  4TOI A;  3UT5 A;  3JSN A;  4JI3 B;  4D7T A;  5KX5 B;  1D5A A;  4I50 A;  5LP6 A;  1XHX A;  2F1M A;  5IWA B;  4X62 B;  4ZOL A;  3JAL B;  4I55 B;  4B3R B;  2BTQ A;  5EZY B;  1M5I A;  1JFF B;  2F95 B;  3U10 A;  2RQ6 A;  3MAQ A;  3BAB A;  1SA0 B;  2P5O A;  3BPZ A;  4DV4 B;  5GON B;  4CS3 A;  1TUB A;  2GV9 A;  1XNR B;  1ZAU A;  4GYC B;  4DRX A;  4O4I B;  3K5N A;  5ITZ B;  1IBM B;  5FNV A;  3ZED A;  4U3J A;  1KU9 A;  3UQ8 A;  3CHX A;  2Q7H A;  5KHG A;  4AQY B;  3OTO B;  4IHJ B;  5CA0 A;  5IYZ A;  2JS5 A;  5D5Q A;  3RYH A;  3B2E E;  4DR6 B;  4ZI7 B;  5C8Y B;  3RYF B;  5KHI A;  2JGU A;  4EFE A;  4GLX A;  2EX3 A;  3N2G B;  3UT5 B;  1NT2 B;  4X64 B;  5JH7 A;  2HHH B;  3HKB A;  3HKD A;  1HNX B;  4HNA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...