3BHPA

Crystal structure of upf0291 protein ynzc from bacillus subtilis at resolution 2.0 a. northeast structural genomics consortium target sr384
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
52
structure length
52
Chain Sequence
MISNAKIARINELAAKAKAGVITEEEKAEQQKLRQEYLKGFRSSMKNTLKSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0291 protein ynzC
publication title Crystal structure of the UPF0291 protein ynzC from Bacillus subtilis at the resolution 2.0 A.
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 18
structure length 52
sequence length 52
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3bhpA00
4CH5A 2PGGA 4CH4A 4CS3A 4CH6A 1O9HA 2HEPA 2YI9A 3ZEDA 3QTCA 2Q7EA 2RJZA 4TQFA 2PUSA 2R72A 2ZIMA 4CS4A 5K1PA 1G6UA 2ZCEA 4BW9A 2YIBA 3VQXA 4BWAA 3VQVA 3VQWA 4CH3A 2JVDA 2ZNJA 4CS2A 3BHPA 4TQDA 2R70A 4Q6GA 2YIBD 2RQ6A 2E3CA 3VQYA 2Q7HA 2YIAA 1O9GA 2QJ1A 2ZINA 2ZIOA 2YI8A 2Q7GA 5K1XA 4ZIBA 3DSQA 2ZNIA
chains in the Genus database with same CATH superfamily
4FZ1A 5FNVA 1KKDA 4JYYA 4K8ZA 1S5HC 1V9PA 1H2KA 3IJ4A 4O4JB 3ZJZA 4G27B 3JSNA 3J81N 3QF7A 1Y4MA 1WP7A 2ILMA 5BZBA 2R70A 4DUZB 3CHXA 1R3JC 2VQFB 3L73H 1T5EA 2Y48A 1URFA 1Y74B 4IHJB 4LFAB 3OD4A 5BY1A 1XMOO 1M56C 4E2LA 1OCCB 3ZMZA 4GUNA 1Q81W 4PA6A 1RM1B 2DN9A 4BW9A 4X8AA 1SRYA 4AQYB 4O2BB 2BSKA 1KECA 3Q4HB 1SS3A 3BPZA 2EX3A 3VQYA 4Z1VA 1AI7A 4W4LA 2ZXWB 1SF9A 1UPGA 1MNGA 3LDDA 1BQ0A 2AZ0A 1NKDA 2VWJA 4GX1A 4PDRA 2EIJB 1F23A 4J9ZB 4OPHA 3LSUA 4UFZA 3H1KH 3QO8A 4QPKA 3E8GA 1PV0A 4RUFA 1K34A 1X4TA 3CX5F 2CTWA 4RAIA 5LMUO 4DV2O 2YDEA 4J10A 2IJKA 3GVMA 1EN6A 5BMVB 3E35A 3I5DA 4ABMA 2OYQA 4DR7B 1Q7YW 1NZ6A 4O4IA 5KHGA 1SQQH 1PP9H 1XMOB 1J95A 1R3KC 2Y69C 3SYPA 3IAYA 1EZVH 2GSMB 2YC0A 3CCJV 1FXKB 4XBFA 4DR5O 5TISZ 2PYLA 5IJ0B 1ZL8A 2NNUA 3JARB 3FB5C 2P5OA 1VQ6V 4JAUA 4W4KA 4X20A 3BHPA 1TUBA 3RYHA 1TA8A 3GWKC 1SQVH 2DMXA 3CD6V 3AK2A 2RMKB 1VQ9V 1XMQO 3JD2A 3JYCA 4X1YA 4NR1A 2ZCEA 2W0XA 1ZAUA 2JIZG 5H6QA 1HP8A 5EZYA 3N2KA 1VQ8V 4YXWG 4LBEC 1R3LC 1M9NA 1Q6HA 3BABA 4JYAO 1XEQA 4DV2B 2RDCA 4B3MO 2L6LA 5LA6B 2AHYA 3K5NA 3N27A 1EFRG 2JGDA 1Q43A 3FAVA 4L87A 1SQFA 3EHBB 1KQSU 3SPIA 3K03A 4TOIA 4DR4O 2X0LA 2QTSA 1K7DA 1B04A 1Q90D 3I55V 4WFFA 2UXBB 4I50B 5B1NA 5L3EA 4IIJB 3W7SA 4G2KA 3CCEV 3TK1A 5KHJA 4LF7O 1EBOA 2HVJC 4PA9A 4LF6O 4MSWC 2XNDG 3CCLV 3A2FA 1SERA 2DOSA 1HR0O 5IJ9A 3RYFB 4RWUA 5B66Z 5BR8O 4NXMO 4DRXB 5EBMC 4JASA 5EK0A 1K33A 1VF5B 2Q69A 1KU9A 1M57C 4HNAB 1QVGU 4LR3A 3NXSA 4ZHQA 3OEHG 1KP2A 2BOBC 3AG3B 3AG4B 4JI7B 4UB6Z 2ZQMA 5BXZA 3MHSC 4PDLA 5LMNB 3VBBA 1LNQA 1OJHA 3ETQA 1IURA 4LF8O 4LF4O 4DR4B 1K3EA 2RN9A 4NKGB 2WLHA 2ZR2A 4MVOA 4TSFG 4U3JA 4OX9B 3AK1A 2WLIA 3CC2V 1HNZO 2P06A 2LGQA 4EEQA 3EVKA 4LF7B 1DF4A 1QU7A 2LJ2A 2QWOB 3B77A 3STLC 3QO5A 1XNQO 2CGOA 3UO3A 5DEDA 4FK5C 1E1RG 4X62O 4ZI7A 4NXMB 4JI5O 2CH7B 2BE3A 5CN0A 3IFXA 3ZIAG 1NTMH 3UQ8A 2LP7A 4YJ3B 3E8HA 3FB6C 3BY6A 2A79B 3T4DA 4DW0A 3ZS8C 4EB6A 2ADPA 4K0KB 3RYIB 4K8XA 1OHHG 2O57A 1XILA 3APQA 3JSLA 2XAHA 1TGOA 5IY5C 3IC7A 4LF8B 3DXRB 1KUQA 4LF4B 3DC5A 3F7YC 3CEIA 1VQMV 1BZKA 1HDJA 1JA8A 2Q0AA 1NQTA 4CS2A 1L1FA 3OE7G 2EIMB 1I94O 2YIBD 2KKWA 4MTGA 1XHZA 1JJOA 3E22B 2P7TC 1HNZB 5B1BB 3T1CA 4LFBB 1P84F 2LFSA 3ZHSA 1IBKO 1BHBA 2UUCO 2F1MA 1XNQB 3HPLC 4JI1B 5GONB 4CH3A 4X62B 1ENVA 1FJGO 5LP6B 1SQBH 4JZ2A 2IBZH 1YCIA 4JI5B 3OMIB 2E3CA 4UV9A 4X88A 3D36C 3B2EE 3RWRD 4WBNA 2HHHB 3X2QB 2Q6AA 4BW5A 1GN2A 4YHHO 5KAIZ 3JATB 1IBLB 4QPJA 4J7ZA 1XDCA 1G6UA 1ZWIC 2BTQA 5C93A 3LSSA 1H2MA 3ETGA 4GX0A 4NVPA 2DYRB 1GH6A 4I0XA 2UUBO 4NTWA 4GKKO 1AI4A 4F4LA 1WAZA 2DYSC 2ZE6A 4G28B 3G71V 1XHXA 1BMFG 3RBZA 4X65O 1B06A 3K5MA 4JAVA 4LNUB 4IGGA 2PUSA 3GB7C 1AI5A 1GN3A 2DJVA 2EJRA 1QLEB 2UXDB 1SA0B 1MA1A 4DV1O 4H0LB 1BSMA 4DR2O 2YEVB 5KUMA 4NXNO 1Y76A 2OIEA 1QLNA 1CPYA 4TWKA 4JI3O 5B5EZ 1FJGB 3ZRSA 1V54B 1YXBA 2ODMA 5LGTA 1K5SA 4O4HB 1VEWA 1L0LH 3WB2A 1R6TA 3HKBB 2ZKOA 4YHHB 3CCMV 5IYBO 2IU0A 1NI8A 5LOVA 3JASA 1AROP 5D5PA 4PA3A 1IXMA 3CC7V 1WP8A 4HZ3A 1QHTA 4DXWA 4DK1A 4B7KA 1S3JA 5FPRA 3TGUH 5JJEB 3SYCA 5C8YB 1JQ0A 1WLEA 4LWSB 3F5WC 5GTHZ 2ZDIC 1IX9A 2NLJC 2A7WA 4X65B 1L0NH 3ABTA 3P32A 1SZXA 2B9ZA 1WB7A 3ICXA 3WB0A 2BOCC 2P67A 2HEPA 4J7JA 4FM2A 4DV3O 3L74H 4X1KB 5KX5A 2ATKC 4DR2B 4RUEA 3JALB 1YIJV 1HW7A 2H8PC 5KMGB 5FL7G 2H94A 4ZOLB 4B08A 1N36B 2ADQB 3D36A 3L70H 4J9YB 3WU2Z 1SQXH 2WPDG 3T1HB 1BCCH 2OCCC 1MSWD 1OCOB 1WNSA 3A0BZ 1MZFA 5CBGA 3MD0A 2WLLA 1BL8A 1P7BA 2JDIG 5FNVB 1I7FA 3OR7C 2XOKG 2GUZA 2MK3A 2JEXA 5CA0A 1CEZA 5E1AC 4MW3A 2OIGA 4HYOA 3QVNA 3RGBA 3J7AU 5H9CA 1ZSPA 1MSDA 5K1PA 1NT2B 4PELA 4LFAO 1OZ0A 4GX2A 4UCSA 2IH1C 2VWKA 1GO3F 4FFBA 3RVZA 2E76B 2WWWA 4LCUC 4DK0A 3G6EV 2N05A 2CUGA 1KKCA 1R1BA 3UCSC 3CXCU 1OCCC 1H38A 3C90A 5CB4B 4A5UB 2ITCC 4ICGA 2B5UA 4MTOA 1OV9A 2HP8A 1I08A 3K5LA 4DUYB 4CH5A 1Q86W 2UXNA 1VARA 4CC5A 1PNMA 1J5EB 3SPGA 2E75B 3N2GA 3SYOA 4F6RA 3AEIA 1VMGA 2EIJC 3SJBC 1VP7A 1YJ9V 4NYKA 1EZJA 3QO7A 2ZDIA 1Z2GA 4PDMA 2YIAA 2X6CA 4JV5O 4DR7O 4YJ2B 2QKCA 3K0DA 4IL6Z 3ZMVA 4GZRB 1FFXB 1WA8B 2PY5A 3K0GA 2YUAA 4JI2O 2QWNB 3KCXA 5JQGB 3RT3C 3T2MA 1WPBA 1THZA 1W0KG 2W6IG 5IYZB 2UXXA 5J2UA 1ZL8B 4P9OA 2QM7A 2YSUB 1FXKC 1N33B 2CTPA 2R9IA 1BS3A 2RJZA 4MVSA 1PL0A 3HKDB 2P6JA 2JEUA 1FYJA 1SQGA 5JVDA 2Z3YA 4PA4A 4R7CA 2Y4UA 5A2QN 1ZTEA 4I5SA 4BIZA 1PPJH 2HFEC 4D7SA 3B8MA 4FFKA 1M5IA 1JOYA 3DSQA 3K9SA 4TV9A 1YZBA 1Q8IA 3D3IA 3L75H 3N2KB 3OGIB 2GTSA 2HKOA 3SJAC 4I4TA 4FLVA 2Z5UA 1U97A 4UB8Z 4JV5B 4QIWF 2ZNJA 3UT5B 3B8NA 1YJNV 4DV4O 3EXAA 3OUSA 1MZEA 3ABUA 1M56B 2BCCH 4TT3G 5L3GA 4NTYA 4UCUA 4CS3A 1GTOA 1Y74A 5B1AB 4FLUA 4JI2B 2P90A 1YVWA 2Q68A 4JI8B 2UXBO 3CRQA 5E79Z 3K57A 2JRIA 1RFYA 2EJ7A 4KP4A 2WSSG 1HNXB 1NS1A 3C3TA 4FMTA 4GT1A 4MVQA 4Q6GA 2D2CB 5H6RA 4O2BA 1QR9A 2HVKC 1F7YA 2ZM6B 2YXHA 1VQKV 4MTXA 5IJ9B 3Q4HA 1K8AW 2JS3A 4X64O 3TCUA 4B3RB 4K3AA 1NTZH 1TUEB 3ZHTA 2AGAA 4H44B 3E2EA 1EN5A 4ZHQB 1H2GA 4JI7O 4I55B 3UO2A 4JI6O 4PI0A 5LMNO 3FFQA 3ASOB 2PGGA 4DV6O 4KFMA 2XAGA 4GCZA 2FYUH 1GM7A 1TAEA 1ZX3A 3AG3C 4JI0B 3AG4C 1IZ3A 4DV4B 3ZRVA 2V1DA 3G4SV 3LDCA 3K06A 3SJCC 2Y69B 1SKVA 2F4VB 3FYIB 4MS2A 4OX9O 5B1OA 1F51A 3CJHA 5IYCO 3C3SA 5D5QA 4MTFA 2WLIB 4CH4A 1FXKA 2QKSA 3B4SA 3ASNB 1AP6A 1AR1B 1JFFA 3CWBH 1RPRA 4C7UA 5KHKA 3O65A 1ZUQA 4XDJA 5LXTB 1VQOV 4I9QA 4KXRA 4FZ0A 3JARA 3OT7A 5IYDO 4X64B 3K5OA 3H1JH 3E8BA 4GKJB 4X89A 1AVMA 4XDLA 2JGUA 4R6ZA 2G38A 3FB7C 1GM9A 4JI6B 4K0KO 3W7WA 4P2ZA 1DTOA 5LYJB 4EB6B 1D5NA 1PL4A 2DE0X 1QCEA 4DV6B 5H2FZ 2CAZC 4DYLA 3JAKB 4BIOA 3OW2U 1L8DA 5L3FA 5LA6A 3ZEDA 1DK1A 3DTUB 1K97A 3OTFA 1LUVA 1GKFA 1TVKA 4XDKA 1Q3EA 3CXHF 1N34B 3ZMTA 4LFBO 3R66A 1AI6A 4DV7B 1Y66A 2QKAA 1SETA 2QM4A 3JD4A 2YXYA 1RSOA 2UU9B 1DLBA 3K79A 3HKEA 4JI1O 2DWEC 4P30A 4EFBA 4I50A 5DN6G 3H9VA 3BRCA 1N4CA 4B7EA 3EFFK 5EC1C 1Q6UA 4DV0O 5B1BC 1BT8A 1JR9A 3R65A 2E74B 3RYCA 4FM0A 3RYFA 2HHHO 3HR0A 3AG1B 2GBOA 1IBLO 1JPXA 4DRXA 4FLYA 4LF5B 5LP6C 2QWQB 2YI8A 4BIUA 5K1XA 2VS0A 2FTKA 1QNMA 4HNAA 2PI4A 1N32O 1MG1A 1WB8A 3SPJA 2OWOA 2ZR3A 2EILB 5EIBC 3I56V 4LF9O 4CC6A 2H3OA 2Q9LA 3GWOA 4IT5A 1W2BU 1H8EG 2DYRC 3OTOB 1QQCA 1R3IC 1NVPD 2UXDO 4X1IB 3G80A 2A0LA 2A06H 1XL4A 1KBHA 2ZE5A 5CA1A 4PD4F 4KHPO 3BEHA 1Y67A 2DQ0A 2MW2B 3SPHA 3LNMB 2Z0AA 4DV0B 2Q67A 4K35A 1GK9A 4IYIA 3K9AA 2HLDG 3K3WA 4HAMA 3CRMA 4OGQB 3ZX6A 1GMGA 3ABMC 4NB5A 2BTOA 3ZRWB 5LGUA 2CH7A 5HFLA 1D5AA 2ITDC 3JASB 3SDLA 3AG7A 4DV5B 1N32B 3ML0A 4IYHA 4YJ3A 2IW5A 5EYPB 5JH7B 2QWPB 2W6JG 3E8FA 1K4DC 1GAXA 4LF9B 4I9WA 2CTQA 4OPAA 2QE7G 4WF9V 2IJJA 3OGCC 1CP9A 1FD9A 4JYCA 2OT5A 4FLZA 1I5YA 4J80A 4WFAV 2FKXA 1NH2B 2DW4A 1YF2A 1M93A 4J7KA 5KX5B 4KL1A 1XBLA 4O2AA 4D6TH 4FPPA 4KHPB 3E22A 2L35A 1FXVA 1V55B 1NTKH 1N36O 1R6KA 2A3QA 3TXSA 5ITZA 3T1HO 1M90W 5GONA 1YTFD 2RQ6A 2Q7HA 2XAFA 1IVSA 2KG7B 5LP6A 1SC5B 2Q4PA 2CTRA 1Y6XA 3WB1A 2OCHA 1X59A 2EZPA 4O4LA 4H37A 2B1GA 3JATA 1BGYH 3LUTB 4WFGA 1OCOC 2X6AA 4LFCO 3U10A 5KHHA 2D3OW 4ZBMA 5DECA 2JJ2G 1PKXA 2Q7GA 2PF4E 4TV8B 4ZIBA 3AG2C 2JK5C 5J2TA 2R9RB 3P30A 4JF3A 4B3SB 2GV9A 4JTCB 1H8HG 4WCEV 2AXTZ 4DW1A 4RQEA 3K58A 3RN4A 2FB5A 5B3SB 4JTAB 4LNUA 4PJ0Z 1JX9A 1KP3A 1YDXA 3ZHRA 2PZSA 1OCRC 3ABKC 3J80N 4JZGA 3WG7B 5HFMA 2UUAO 1W59A 5KUKA 3S3XA 1MABG 2VQEO 3F7VC 4N21A 2YEVA 4UVCA 3KCYA 4FLXA 2HR3A 4MT8A 5LHGA 2IJHA 1XOUA 1Z5VA 3IC9A 4DUYO 2YICA 3SYAA 4TUYB 1S5LZ 3ABLB 1J5EO 3K04A 2CK3G 4AHCA 3ZHVA 4O4HA 4PA7A 3HKBA 1SQPH 2Q0OC 2ZIOA 1N0NA 3M8AA 2EBOA 5AG2A 2CGNA 4UUJC 3ZHUA 2Q7EA 4H13B 4LFCB 1IBMB 3K59A 2FL4A 1NH2D 1PM9A 3FX7A 1NR7A 3SGIA 2EINB 1K9MW 2AHZA 4QNHB 1BHAA 3IGAC 4L8JA 2V4DA 1OCZB 5C8YA 4OXSA 4LWSA 2K9PA 1M4UA 4MVMA 1LR1A 4CZZA 2OTLV 1DF5A 4X66O 2BSKB 1PNKA 2N74A 2KSDA 2UUAB 4YY3O 2F93B 4X1KA 4CBCA 5CA3A 1RM1C 3UM7A 3CMEV 5J2UB 2VQEB 4B3TB 1N33O 2JJ1G 4NTXA 2VRZA 3JALA 3ZN1A 3CCQV 1F4NA 4ZOLA 4FLTA 2OCCB 2CE4A 3OMNB 1YJWV 3LNNA 1Q5OA 1QR8A 5JVDB 2ZXWC 1NJIW 3JAWA 3SYQA 3H1LH 5IE9A 2XTAA 2AZ2A 3VQWA 1K5QA 2WAMA 3E86A 3RVYA 1MMMA 3HKCA 1Q6IA 3H01A 1XNRO 2ZINA 1ORQC 3G67A 4YIOA 2LFRA 1VF6C 4I4TB 3P3PA 2M7WA 2N04A 3W7UA 2PI5A 2K1EA 2WA3A 4O4IB 4U7OA 2Y0PA 2EIKB 3BVOA 3PN1A 4JI8O 3CRCA 4X66B 1HNXO 1SZTA 1UFIA 4KUMA 4YY3B 2B1IA 3OR6C 4PHZA 4X20B 2ZM6O 1I5XA 5FPOA 5B1AC 1TUBB 2YXLA 3DC6A 3RYHB 1AR5A 1IDSA 3OEEG 3A8TA 2Q73A 4B3RO 4X1YB 5CB4A 3ZMUA 5IT9N 4DO2A 3BFRA 1COWG 1KD1W 2NN4A 1WPXA 4FM1A 5EZYB 4LH7A 4RQFA 2JS5A 1XNRB 5JJJB 4O4JA 4JI0O 1S72V 2JGDB 3FAVB 1XI1A 1VQNV 5A9GA 2QWRB 2F4VO 4YJ2A 4IHJA 4E4EA 3ASOC 1M1KW 3MDSA 4U3FH 3T4ZA 3CS5A 5EBWC 3CJHB 2QEXV 1FFXA 1QVFU 1WA8A 1AJQA 1ZLZA 2RNBA 3CYOA 5JQGA 3MAQA 4I7ZB 1S0VA 3P3NA 2F66C 3M99B 1RPOA 1JFFB 5CBHA 5IYZA 1S76D 1AJNA 1H2SB 2QGNA 4J11A 3KZIZ 4GKJO 3D3QA 1ROPA 1I0HA 2IJIA 3ETEA 4FIPC 5F2VO 3ASNC 3CRRA 5CMUA 3HKDA 4AILC 2RCVA 4DR6O 3M7MX 1KMIZ 2HG5C 3SJQC 4EFEA 5LHHA 5LHIA 2QJ1A 1DGSA 1R73A 4QE9A 3AK3A 1VF6A 1YI2V 4GLXA 3L72H 1VQ7V 1QBZA 5KAFZ 5JJNB 1JJ2U 4UXNA 5LMUB 3JCZA 5BMVA 3UT5A 1N34O 4U3JB 1TVKB 4DV7O 3CMAV 1O9HA 4BAYA 1BQZA 3ZCCA 3W7XA 4QJFB 2UU9O 3BA8A 3PJSK 1GN6A 1NVPB 2ZE8A 1RSOB 3HKEB 1W0JG 5EBLC 5IJ0A 2KQXA 4DR5B 1RP3B 3D8CA 1A32A 4ZI7B 1VQLV 2IH3C 2UXCO 5KHIA 4LP8A 1NU1H 2LW7A 3RYCB 3JD1A 1G1XB 5L3CA 4D7TA 4LF5O 4JTDB 3F5TA 4DR6B 1E1QG 3ZBHA 3ZMSA 3VQXA 4BWAA 4DR3O 1AILA 1XMQB 1YHQV 3CP1A 5LL6Y 1K92A 3AG1C 1US6A 3HB3B 4I55A 3A0HZ 5L3DA 4PI2A 3BA9A 4UCRA 4JYAB 4UCOA 2YIDA 3OTOO 2Y4TA 3CSXA 2ZE7A 4B3MB 1U96A 2P22C 2EILC 3ZHQA 1S77D 5JWPA 3CCSV 2Q8VA 1HWYA 4H33A 2GTAA 5JCOC 2F23A 2QTOA 2EIMC 3OFNG 5CA1B 3H1HH 1P7GA 4Z1MG 1FAFA 4IIJA 3QTCA 4EKWA 1WJZA 4Q20A 2YIBA 1JVMA 2UXCB 2E5LO 4JI4O 1M57B 1VQ5V 4LF6B 3S3WA 3UKMA 1HR0B 4WBNB 5LXTA 3OAAG 5BR8B 1P49A 3FB8C 4MW8A 4DR3B 2IM9A 1YTFB 2BTQB 5H5NA 1P4RA 4DV5O 1EN4A 2A9HA 3X2QC 4RO2A 1E79G 4I0XB 1YSCA 5LGNA 5FLXN 1XL6A 1KB9F 4DR1O 4TQDA 1AJPA 1AP5A 3CE2A 3JAMN 2QDOA 1YEWA 2DQ3A 5LYJA 2WLKA 4R8CA 5LBQA 2R9AA 1WN7A 1MOFA 4LC1A 2WA4A 3JAKA 2QR4A 3TETA 3T1YO 2XASA 5IWAO 3CRAA 3W7TA 2EULA 3L9DA 5EC2C 5GW7A 2YS8A 1HNWO 1GN4A 2AW9A 1Y76B 2LW1A 1GRJA 3ZN0A 1PD3A 3NR7A 2CDYA 4O2AB 2QSAA 1QLEC 1JMKC 4GYCB 3H1IH 4YIPA 3G6BA 2HJFC 2E5LB 4JI4B 3CCRV 5ITZB 3BAAA 2GHYA 4Z2WA 2XT9A 3U0ZA 1V55C 1Z5WA 4MVRA 1V54C 4WFHA 2LQTA 3STZC 5LOVB 1S5JA 5IDJA 3E89A 3B09A 4UCVA 4O4LB 3ETDA 2PYJA 1FKAO 1H2NA 2F95B 1B3QA 5IY5B 3SPCA 1GM8A 4DR1B 3ZRXA 2R72A 2ZD9A 3RYIA 3U11A 1VQPV 1CXZB 4B3SO 3DXRA 1LUWA 3APOA 3E83A 5KA6A 2EZOA 5JCOA 3T1YB 5J2TB 5IWAB 4QGPA 4UVBA 1K4CC 5J9PC 3SR2C 3WFVA 2GDSA 1D2DA 2W0FC 1XREA 4PDVA 1HNWB 1XUQA 1I94B 1FXHA 4X1IA 2C2AA 3O9OA 1IXBA 3FYEB 1VIBA 5B3SC 3OM3B 1G4YB 1IBKB 1FPOA 4JGSA 4BR6A 2UUCB 2WLMA 4P9PA 2ZNIA 3WG7C 3ABMB 4AI8A 3THOA 2YI9A 1JCHA 4FJCC 2WLLB 2ZIMA 2ZT9B 1VQ4V 2X7RB 3FD9A 4UVAA 1AR4A 4WFBV 4ASUG 2GUZB 2LO1A 2WLNA 2WLJA 2XHBA 5CA0B 3ZRWA 2LGWA 1IBMO 4ZKIA 2DYSB 3ABLC 2DWDC 3KKYA 1O9GA 3MHHC 2X6BA 3TJTA 3A0RA 2KB1A 5EYPA 5JH7A 4J41A 2XAQA 1PNLA 2XUMA 2UUBB 4GKKB 2Y0IA 3QG5A 3JCUZ 2XAJA 4FFBB 2JVDA 3LDEA 2IU3A 3BCCH 1SESA 2ETNA 2EINC 3TXQA 1YITV 2QA4V 5GTIZ 1VF7A 1SA0A 5CBFA 1OCZC 4B3TO 4CH6A 4DV1B 4JAAA 1N8RW 1R6NA 4UCTA 1H2LA 1NBMG 2V7QG 4F6EA 4NXNB 3VOUA 3L71H 4FLWA 4JI3B 2FMLA 5EIBD 3CCUV 4U7NA 3K08A 3JAWB 3RW0A 4JYBA 2M6YA 3N2GB 4LH6A 1KYOF 2KG7A 1AB3A 4F6RB 4JPRA 1NR1A 3OMAB 4PV1B 4WFEA 2Q5ZA 3HKCB 1Q82W 3CC4V 3OUFA 1K73W 3CCVV 4FVMA 1UJWB 1F4MA 3AG2B 3FKSG 5L3BA 2ARHA 2QM8A 3CB2A 4DUZO 2P4VA 4MVZA 4N23A 2VQFO 1BE3H 1G8MA 2NR5A 4TV8A 2OTJV 4TQFA 1EM1A 3LSQA 4QE7A 4J42A 1OCRB 3ABKB 3CPWU 2EIKC 1FFTB 1N0JA 4DV3B 4R50A 5KMGA 1KC8W 4X9QA 4AQYO 3DGEA 3KG2A 2P4KA 3RFRA 3B40A 4MVUA 5DM6V 4CS4A 4UV8A 1FS0G 1XQ8A 3JD0A 3JD3A 3VQVA 5KLVH 5KA5A 2PTMA 1B6QA 3QNEA 4TV9B 4HBNA 2HJDA 4TUYA 2F43G 4GX5A
chains in the Genus database with same CATH topology
5FNVA 4HNAA 4K8ZA 4GLXA 1V9PA 1QHTA 2OWOA 4O4JB 3JSNA 4DK1A 3QF7A 5EIBC 4CC6A 5FPRA 5JJEB 5C8YB 5JJNB 2R70A 4DUZB 3CHXA 5LMUB 2VQFB 5BMVA 4X65B 1T5EA 3UT5A 3OTOB 4IHJB 3ICXA 1QQCA 3WB0A 4LFAB 4U3JB 1TVKB 4X1IB 1O9HA 2HEPA 4FM2A 4X1KB 5KX5A 5CA1A 4BW9A 4DR2B 3BA8A 3JALB 4AQYB 4O2BB 1HW7A 3HKEB 5KMGB 5IJ0A 4DR5B 4ZOLB 4B08A 4ZI7B 3BPZA 2EX3A 4DV0B 3VQYA 1N36B 5KHIA 3RYCB 3T1HB 4D7TA 2VWJA 4DR6B 1WNSA 2BTOA 3VQXA 4BWAA 4UFZA 1D5AA 1XMQB 3JASB 5FNVB 1I7FA 4DV5B 1N32B 4YJ3A 5EYPB 5JH7B 1X4TA 5CA0A 4I55A 4LF9B 4PI2A 3RGBA 3BA9A 4UCRA 4JYAB 4UCOA 5K1PA 3CSXA 1NT2B 4B3MB 4FLZA 5BMVB 2P22C 2OYQA 4DR7B 4O4IA 5KHGA 4UCSA 2VWKA 1XMOB 5JCOC 4FFBA 3IAYA 1M93A 5KX5B 4KL1A 5CA1B 4O2AA 4DK0A 4KHPB 3E22A 4IIJA 3QTCA 2PYLA 5IJ0B 2YIBA 3JARB 2P5OA 2UXCB 5ITZA 4X20A 4LF6B 3BHPA 5CB4B 1TUBA 3RYHA 1TA8A 5GONA 1HR0B 2RQ6A 4WBNB 5LXTA 2Q7HA 5LP6A 5BR8B 1P49A 3WB1A 3K5LA 4DUYB 4DR3B 4CH5A 4X1YA 2IM9A 4O4LA 2BTQB 4CC5A 1J5EB 2ZCEA 3N2GA 1ZAUA 3JATA 4F6RA 5EZYA 3SJBC 3N2KA 4TQDA 3U10A 5KHHA 3BABA 1YEWA 4DV2B 5LYJA 2R9AA 2YIAA 5LA6B 3K5NA 1WN7A 4YJ2B 2Q7GA 4TV8B 4ZIBA 1Q43A 1SQFA 3JAKA 5J2TA 4TOIA 4B3SB 2GV9A 3K58A 1FFXB 2PY5A 4LNUA 5JQGB 1B04A 2PZSA 4O2AB 1JMKC 4GYCB 2UXBB 1WPBA 4I50B 4IIJB 5IYZB 5KHJA 5J2UA 2E5LB 3A2FA 4JI4B 5ITZB 3BAAA 5IJ9A 3RYFB 1N33B 2RJZA 4FLXA 3HKDB 3U0ZA 1SQGA 1Z5WA 4DRXB 5JVDA 1Z5VA 4TUYB 5LOVB 1S5JA 1KU9A 4AHCA 4O4HA 4UCVA 4HNAB 4O4LB 4D7SA 3HKBA 2PYJA 4LR3A 2ZIOA 1M5IA 4ZHQA 3DSQA 4TV9A 2F95B 1Q8IA 4DR1B 2Q7EA 4LFCB 4JI7B 2R72A 3N2KB 3RYIA 3U11A 3K59A 1IBMB 3SJAC 4I4TA 4FLVA 5LMNB 4JV5B 3SGIA 2ZNJA 3UT5B 4L8JA 3ETQA 2V4DA 5JCOA 3T1YB 5J2TB 5C8YA 5IWAB 4DR4B 1M4UA 3SR2C 4UCUA 4CS3A 1HNWB 4FLUA 4JI2B 1I94B 4JI8B 4U3JA 4OX9B 3K57A 4X1IA 2UUAB 2F93B 4X1KA 4EEQA 1HNXB 4LF7B 2VQEB 5J2UB 4B3TB 4Q6GA 1IBKB 3JALA 4O2BA 2UUCB 2ZM6B 5IJ9B 4ZOLA 4FLTA 4ZI7A 2ZNIA 3LNNA 4NXMB 1Q5OA 5JVDB 3THOA 2YI9A 4B3RB 2ZIMA 3JAWA 3UQ8A 3VQWA 4YJ3B 4ZHQB 2XHBA 5CA0B 5K1XA 4I55B 3HKCA 3ZS8C 1O9GA 2ZINA 4EB6A 4K0KB 4PI0A 3RYIB 4K8XA 3FFQA 4I4TB 2PGGA 5EYPA 5JH7A 3JSLA 1TAEA 4JI0B 1TGOA 4O4IB 4DV4B 2UUBB 4GKKB 4LF8B 4LF4B 3QG5A 4FFBB 2JVDA 3SJCC 2Q0AA 4CS2A 1SKVA 2F4VB 3PN1A 2YIBD 2KKWA 1XHZA 1JJOA 4X66B 3E22B 5D5QA 1VF7A 1SA0A 1HNZB 4YY3B 4CH4A 4LFBB 4CH6A 4PHZA 4DV1B 4X20B 2F1MA 4UCTA 5FPOA 1XNQB 1JFFA 1TUBB 2YXLA 4JI1B 3RYHB 4NXNB 5KHKA 5GONB 4CH3A 5LXTB 4I9QA 4X62B 4FLWA 4JI3B 5LP6B 3JARA 4JI5B 4X64B 3K5OA 5EIBD 4X1YB 2E3CA 4GKJB 3B2EE 5CB4A 3RWRD 3JAWB 2JGUA 4WBNA 2HHHB 3N2GB 4LH6A 3JATB 1IBLB 4F6RB 4FM1A 5EZYB 1G6UA 4JI6B 4LH7A 2BTQA 2JS5A 3HKCB 1XNRB 5LYJB 4EB6B 5JJJB 4NVPA 4O4JA 4DV6B 4FVMA 2CAZC 1XI1A 3JAKB 1L8DA 3CB2A 1XHXA 5LA6A 3ZEDA 4YJ2A 3K5MA 4IHJA 4TV8A 4LNUB 3OTFA 4TQFA 2PUSA 1TVKA 1Q3EA 1N34B 2UXDB 1SA0B 1FFXA 4DV7B 2QM4A 4DV3B 1RSOA 2UU9B 3HKEA 5KMGA 5JQGA 3MAQA 4EFBA 2F66C 1JFFB 4I50A 3BRCA 5IYZA 3RFRA 1FJGB 1H2SB 4CS4A 3RYCA 1XQ8A 4FM0A 3VQVA 4O4HB 3RYFA 3WB2A 3HKBB 3HKDA 2PTMA 4AILC 4YHHB 4TV9B 4HBNA 4DRXA 4EFEA 3M7MX 1KMIZ 4FLYA 4LF5B 5LP6C 4TUYA 5LOVA 2QJ1A 3JASA 2YI8A 1DGSA 5D5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CH5 A;  2PGG A;  4CH4 A;  4CS3 A;  4CH6 A;  1O9H A;  2HEP A;  2YI9 A;  3ZED A;  3QTC A;  2Q7E A;  2RJZ A;  4TQF A;  2PUS A;  2R72 A;  2ZIM A;  4CS4 A;  5K1P A;  1G6U A;  2ZCE A;  4BW9 A;  2YIB A;  3VQX A;  4BWA A;  3VQV A;  3VQW A;  4CH3 A;  2JVD A;  2ZNJ A;  4CS2 A;  3BHP A;  4TQD A;  2R70 A;  4Q6G A;  2YIB D;  2RQ6 A;  2E3C A;  3VQY A;  2Q7H A;  2YIA A;  1O9G A;  2QJ1 A;  2ZIN A;  2ZIO A;  2YI8 A;  2Q7G A;  5K1X A;  4ZIB A;  3DSQ A;  2ZNI A; 
#chains in the Genus database with same CATH topology
 4FZ1 A;  5FNV A;  1KKD A;  4JYY A;  4K8Z A;  1S5H C;  1V9P A;  1H2K A;  3IJ4 A;  4O4J B;  3ZJZ A;  4G27 B;  3JSN A;  3J81 N;  3QF7 A;  1Y4M A;  1WP7 A;  2ILM A;  5BZB A;  2R70 A;  4DUZ B;  3CHX A;  1R3J C;  2VQF B;  3L73 H;  1T5E A;  2Y48 A;  1URF A;  1Y74 B;  4IHJ B;  4LFA B;  3OD4 A;  5BY1 A;  1XMO O;  1M56 C;  4E2L A;  1OCC B;  3ZMZ A;  4GUN A;  1Q81 W;  4PA6 A;  1RM1 B;  2DN9 A;  4BW9 A;  4X8A A;  1SRY A;  4AQY B;  4O2B B;  2BSK A;  1KEC A;  3Q4H B;  1SS3 A;  3BPZ A;  2EX3 A;  3VQY A;  4Z1V A;  1AI7 A;  4W4L A;  2ZXW B;  1SF9 A;  1UPG A;  1MNG A;  3LDD A;  1BQ0 A;  2AZ0 A;  1NKD A;  2VWJ A;  4GX1 A;  4PDR A;  2EIJ B;  1F23 A;  4J9Z B;  4OPH A;  3LSU A;  4UFZ A;  3H1K H;  3QO8 A;  4QPK A;  3E8G A;  1PV0 A;  4RUF A;  1K34 A;  1X4T A;  3CX5 F;  2CTW A;  4RAI A;  5LMU O;  4DV2 O;  2YDE A;  4J10 A;  2IJK A;  3GVM A;  1EN6 A;  5BMV B;  3E35 A;  3I5D A;  4ABM A;  2OYQ A;  4DR7 B;  1Q7Y W;  1NZ6 A;  4O4I A;  5KHG A;  1SQQ H;  1PP9 H;  1XMO B;  1J95 A;  1R3K C;  2Y69 C;  3SYP A;  3IAY A;  1EZV H;  2GSM B;  2YC0 A;  3CCJ V;  1FXK B;  4XBF A;  4DR5 O;  5TIS Z;  2PYL A;  5IJ0 B;  1ZL8 A;  2NNU A;  3JAR B;  3FB5 C;  2P5O A;  1VQ6 V;  4JAU A;  4W4K A;  4X20 A;  3BHP A;  1TUB A;  3RYH A;  1TA8 A;  3GWK C;  1SQV H;  2DMX A;  3CD6 V;  3AK2 A;  2RMK B;  1VQ9 V;  1XMQ O;  3JD2 A;  3JYC A;  4X1Y A;  4NR1 A;  2ZCE A;  2W0X A;  1ZAU A;  2JIZ G;  5H6Q A;  1HP8 A;  5EZY A;  3N2K A;  1VQ8 V;  4YXW G;  4LBE C;  1R3L C;  1M9N A;  1Q6H A;  3BAB A;  4JYA O;  1XEQ A;  4DV2 B;  2RDC A;  4B3M O;  2L6L A;  5LA6 B;  2AHY A;  3K5N A;  3N27 A;  1EFR G;  2JGD A;  1Q43 A;  3FAV A;  4L87 A;  1SQF A;  3EHB B;  1KQS U;  3SPI A;  3K03 A;  4TOI A;  4DR4 O;  2X0L A;  2QTS A;  1K7D A;  1B04 A;  1Q90 D;  3I55 V;  4WFF A;  2UXB B;  4I50 B;  5B1N A;  5L3E A;  4IIJ B;  3W7S A;  4G2K A;  3CCE V;  3TK1 A;  5KHJ A;  4LF7 O;  1EBO A;  2HVJ C;  4PA9 A;  4LF6 O;  4MSW C;  2XND G;  3CCL V;  3A2F A;  1SER A;  2DOS A;  1HR0 O;  5IJ9 A;  3RYF B;  4RWU A;  5B66 Z;  5BR8 O;  4NXM O;  4DRX B;  5EBM C;  4JAS A;  5EK0 A;  1K33 A;  1VF5 B;  2Q69 A;  1KU9 A;  1M57 C;  4HNA B;  1QVG U;  4LR3 A;  3NXS A;  4ZHQ A;  3OEH G;  1KP2 A;  2BOB C;  3AG3 B;  3AG4 B;  4JI7 B;  4UB6 Z;  2ZQM A;  5BXZ A;  3MHS C;  4PDL A;  5LMN B;  3VBB A;  1LNQ A;  1OJH A;  3ETQ A;  1IUR A;  4LF8 O;  4LF4 O;  4DR4 B;  1K3E A;  2RN9 A;  4NKG B;  2WLH A;  2ZR2 A;  4MVO A;  4TSF G;  4U3J A;  4OX9 B;  3AK1 A;  2WLI A;  3CC2 V;  1HNZ O;  2P06 A;  2LGQ A;  4EEQ A;  3EVK A;  4LF7 B;  1DF4 A;  1QU7 A;  2LJ2 A;  2QWO B;  3B77 A;  3STL C;  3QO5 A;  1XNQ O;  2CGO A;  3UO3 A;  5DED A;  4FK5 C;  1E1R G;  4X62 O;  4ZI7 A;  4NXM B;  4JI5 O;  2CH7 B;  2BE3 A;  5CN0 A;  3IFX A;  3ZIA G;  1NTM H;  3UQ8 A;  2LP7 A;  4YJ3 B;  3E8H A;  3FB6 C;  3BY6 A;  2A79 B;  3T4D A;  4DW0 A;  3ZS8 C;  4EB6 A;  2ADP A;  4K0K B;  3RYI B;  4K8X A;  1OHH G;  2O57 A;  1XIL A;  3APQ A;  3JSL A;  2XAH A;  1TGO A;  5IY5 C;  3IC7 A;  4LF8 B;  3DXR B;  1KUQ A;  4LF4 B;  3DC5 A;  3F7Y C;  3CEI A;  1VQM V;  1BZK A;  1HDJ A;  1JA8 A;  2Q0A A;  1NQT A;  4CS2 A;  1L1F A;  3OE7 G;  2EIM B;  1I94 O;  2YIB D;  2KKW A;  4MTG A;  1XHZ A;  1JJO A;  3E22 B;  2P7T C;  1HNZ B;  5B1B B;  3T1C A;  4LFB B;  1P84 F;  2LFS A;  3ZHS A;  1IBK O;  1BHB A;  2UUC O;  2F1M A;  1XNQ B;  3HPL C;  4JI1 B;  5GON B;  4CH3 A;  4X62 B;  1ENV A;  1FJG O;  5LP6 B;  1SQB H;  4JZ2 A;  2IBZ H;  1YCI A;  4JI5 B;  3OMI B;  2E3C A;  4UV9 A;  4X88 A;  3D36 C;  3B2E E;  3RWR D;  4WBN A;  2HHH B;  3X2Q B;  2Q6A A;  4BW5 A;  1GN2 A;  4YHH O;  5KAI Z;  3JAT B;  1IBL B;  4QPJ A;  4J7Z A;  1XDC A;  1G6U A;  1ZWI C;  2BTQ A;  5C93 A;  3LSS A;  1H2M A;  3ETG A;  4GX0 A;  4NVP A;  2DYR B;  1GH6 A;  4I0X A;  2UUB O;  4NTW A;  4GKK O;  1AI4 A;  4F4L A;  1WAZ A;  2DYS C;  2ZE6 A;  4G28 B;  3G71 V;  1XHX A;  1BMF G;  3RBZ A;  4X65 O;  1B06 A;  3K5M A;  4JAV A;  4LNU B;  4IGG A;  2PUS A;  3GB7 C;  1AI5 A;  1GN3 A;  2DJV A;  2EJR A;  1QLE B;  2UXD B;  1SA0 B;  1MA1 A;  4DV1 O;  4H0L B;  1BSM A;  4DR2 O;  2YEV B;  5KUM A;  4NXN O;  1Y76 A;  2OIE A;  1QLN A;  1CPY A;  4TWK A;  4JI3 O;  5B5E Z;  1FJG B;  3ZRS A;  1V54 B;  1YXB A;  2ODM A;  5LGT A;  1K5S A;  4O4H B;  1VEW A;  1L0L H;  3WB2 A;  1R6T A;  3HKB B;  2ZKO A;  4YHH B;  3CCM V;  5IYB O;  2IU0 A;  1NI8 A;  5LOV A;  3JAS A;  1ARO P;  5D5P A;  4PA3 A;  1IXM A;  3CC7 V;  1WP8 A;  4HZ3 A;  1QHT A;  4DXW A;  4DK1 A;  4B7K A;  1S3J A;  5FPR A;  3TGU H;  5JJE B;  3SYC A;  5C8Y B;  1JQ0 A;  1WLE A;  4LWS B;  3F5W C;  5GTH Z;  2ZDI C;  1IX9 A;  2NLJ C;  2A7W A;  4X65 B;  1L0N H;  3ABT A;  3P32 A;  1SZX A;  2B9Z A;  1WB7 A;  3ICX A;  3WB0 A;  2BOC C;  2P67 A;  2HEP A;  4J7J A;  4FM2 A;  4DV3 O;  3L74 H;  4X1K B;  5KX5 A;  2ATK C;  4DR2 B;  4RUE A;  3JAL B;  1YIJ V;  1HW7 A;  2H8P C;  5KMG B;  5FL7 G;  2H94 A;  4ZOL B;  4B08 A;  1N36 B;  2ADQ B;  3D36 A;  3L70 H;  4J9Y B;  3WU2 Z;  1SQX H;  2WPD G;  3T1H B;  1BCC H;  2OCC C;  1MSW D;  1OCO B;  1WNS A;  3A0B Z;  1MZF A;  5CBG A;  3MD0 A;  2WLL A;  1BL8 A;  1P7B A;  2JDI G;  5FNV B;  1I7F A;  3OR7 C;  2XOK G;  2GUZ A;  2MK3 A;  2JEX A;  5CA0 A;  1CEZ A;  5E1A C;  4MW3 A;  2OIG A;  4HYO A;  3QVN A;  3RGB A;  3J7A U;  5H9C A;  1ZSP A;  1MSD A;  5K1P A;  1NT2 B;  4PEL A;  4LFA O;  1OZ0 A;  4GX2 A;  4UCS A;  2IH1 C;  2VWK A;  1GO3 F;  4FFB A;  3RVZ A;  2E76 B;  2WWW A;  4LCU C;  4DK0 A;  3G6E V;  2N05 A;  2CUG A;  1KKC A;  1R1B A;  3UCS C;  3CXC U;  1OCC C;  1H38 A;  3C90 A;  5CB4 B;  4A5U B;  2ITC C;  4ICG A;  2B5U A;  4MTO A;  1OV9 A;  2HP8 A;  1I08 A;  3K5L A;  4DUY B;  4CH5 A;  1Q86 W;  2UXN A;  1VAR A;  4CC5 A;  1PNM A;  1J5E B;  3SPG A;  2E75 B;  3N2G A;  3SYO A;  4F6R A;  3AEI A;  1VMG A;  2EIJ C;  3SJB C;  1VP7 A;  1YJ9 V;  4NYK A;  1EZJ A;  3QO7 A;  2ZDI A;  1Z2G A;  4PDM A;  2YIA A;  2X6C A;  4JV5 O;  4DR7 O;  4YJ2 B;  2QKC A;  3K0D A;  4IL6 Z;  3ZMV A;  4GZR B;  1FFX B;  1WA8 B;  2PY5 A;  3K0G A;  2YUA A;  4JI2 O;  2QWN B;  3KCX A;  5JQG B;  3RT3 C;  3T2M A;  1WPB A;  1THZ A;  1W0K G;  2W6I G;  5IYZ B;  2UXX A;  5J2U A;  1ZL8 B;  4P9O A;  2QM7 A;  2YSU B;  1FXK C;  1N33 B;  2CTP A;  2R9I A;  1BS3 A;  2RJZ A;  4MVS A;  1PL0 A;  3HKD B;  2P6J A;  2JEU A;  1FYJ A;  1SQG A;  5JVD A;  2Z3Y A;  4PA4 A;  4R7C A;  2Y4U A;  5A2Q N;  1ZTE A;  4I5S A;  4BIZ A;  1PPJ H;  2HFE C;  4D7S A;  3B8M A;  4FFK A;  1M5I A;  1JOY A;  3DSQ A;  3K9S A;  4TV9 A;  1YZB A;  1Q8I A;  3D3I A;  3L75 H;  3N2K B;  3OGI B;  2GTS A;  2HKO A;  3SJA C;  4I4T A;  4FLV A;  2Z5U A;  1U97 A;  4UB8 Z;  4JV5 B;  4QIW F;  2ZNJ A;  3UT5 B;  3B8N A;  1YJN V;  4DV4 O;  3EXA A;  3OUS A;  1MZE A;  3ABU A;  1M56 B;  2BCC H;  4TT3 G;  5L3G A;  4NTY A;  4UCU A;  4CS3 A;  1GTO A;  1Y74 A;  5B1A B;  4FLU A;  4JI2 B;  2P90 A;  1YVW A;  2Q68 A;  4JI8 B;  2UXB O;  3CRQ A;  5E79 Z;  3K57 A;  2JRI A;  1RFY A;  2EJ7 A;  4KP4 A;  2WSS G;  1HNX B;  1NS1 A;  3C3T A;  4FMT A;  4GT1 A;  4MVQ A;  4Q6G A;  2D2C B;  5H6R A;  4O2B A;  1QR9 A;  2HVK C;  1F7Y A;  2ZM6 B;  2YXH A;  1VQK V;  4MTX A;  5IJ9 B;  3Q4H A;  1K8A W;  2JS3 A;  4X64 O;  3TCU A;  4B3R B;  4K3A A;  1NTZ H;  1TUE B;  3ZHT A;  2AGA A;  4H44 B;  3E2E A;  1EN5 A;  4ZHQ B;  1H2G A;  4JI7 O;  4I55 B;  3UO2 A;  4JI6 O;  4PI0 A;  5LMN O;  3FFQ A;  3ASO B;  2PGG A;  4DV6 O;  4KFM A;  2XAG A;  4GCZ A;  2FYU H;  1GM7 A;  1TAE A;  1ZX3 A;  3AG3 C;  4JI0 B;  3AG4 C;  1IZ3 A;  4DV4 B;  3ZRV A;  2V1D A;  3G4S V;  3LDC A;  3K06 A;  3SJC C;  2Y69 B;  1SKV A;  2F4V B;  3FYI B;  4MS2 A;  4OX9 O;  5B1O A;  1F51 A;  3CJH A;  5IYC O;  3C3S A;  5D5Q A;  4MTF A;  2WLI B;  4CH4 A;  1FXK A;  2QKS A;  3B4S A;  3ASN B;  1AP6 A;  1AR1 B;  1JFF A;  3CWB H;  1RPR A;  4C7U A;  5KHK A;  3O65 A;  1ZUQ A;  4XDJ A;  5LXT B;  1VQO V;  4I9Q A;  4KXR A;  4FZ0 A;  3JAR A;  3OT7 A;  5IYD O;  4X64 B;  3K5O A;  3H1J H;  3E8B A;  4GKJ B;  4X89 A;  1AVM A;  4XDL A;  2JGU A;  4R6Z A;  2G38 A;  3FB7 C;  1GM9 A;  4JI6 B;  4K0K O;  3W7W A;  4P2Z A;  1DTO A;  5LYJ B;  4EB6 B;  1D5N A;  1PL4 A;  2DE0 X;  1QCE A;  4DV6 B;  5H2F Z;  2CAZ C;  4DYL A;  3JAK B;  4BIO A;  3OW2 U;  1L8D A;  5L3F A;  5LA6 A;  3ZED A;  1DK1 A;  3DTU B;  1K97 A;  3OTF A;  1LUV A;  1GKF A;  1TVK A;  4XDK A;  1Q3E A;  3CXH F;  1N34 B;  3ZMT A;  4LFB O;  3R66 A;  1AI6 A;  4DV7 B;  1Y66 A;  2QKA A;  1SET A;  2QM4 A;  3JD4 A;  2YXY A;  1RSO A;  2UU9 B;  1DLB A;  3K79 A;  3HKE A;  4JI1 O;  2DWE C;  4P30 A;  4EFB A;  4I50 A;  5DN6 G;  3H9V A;  3BRC A;  1N4C A;  4B7E A;  3EFF K;  5EC1 C;  1Q6U A;  4DV0 O;  5B1B C;  1BT8 A;  1JR9 A;  3R65 A;  2E74 B;  3RYC A;  4FM0 A;  3RYF A;  2HHH O;  3HR0 A;  3AG1 B;  2GBO A;  1IBL O;  1JPX A;  4DRX A;  4FLY A;  4LF5 B;  5LP6 C;  2QWQ B;  2YI8 A;  4BIU A;  5K1X A;  2VS0 A;  2FTK A;  1QNM A;  4HNA A;  2PI4 A;  1N32 O;  1MG1 A;  1WB8 A;  3SPJ A;  2OWO A;  2ZR3 A;  2EIL B;  5EIB C;  3I56 V;  4LF9 O;  4CC6 A;  2H3O A;  2Q9L A;  3GWO A;  4IT5 A;  1W2B U;  1H8E G;  2DYR C;  3OTO B;  1QQC A;  1R3I C;  1NVP D;  2UXD O;  4X1I B;  3G80 A;  2A0L A;  2A06 H;  1XL4 A;  1KBH A;  2ZE5 A;  5CA1 A;  4PD4 F;  4KHP O;  3BEH A;  1Y67 A;  2DQ0 A;  2MW2 B;  3SPH A;  3LNM B;  2Z0A A;  4DV0 B;  2Q67 A;  4K35 A;  1GK9 A;  4IYI A;  3K9A A;  2HLD G;  3K3W A;  4HAM A;  3CRM A;  4OGQ B;  3ZX6 A;  1GMG A;  3ABM C;  4NB5 A;  2BTO A;  3ZRW B;  5LGU A;  2CH7 A;  5HFL A;  1D5A A;  2ITD C;  3JAS B;  3SDL A;  3AG7 A;  4DV5 B;  1N32 B;  3ML0 A;  4IYH A;  4YJ3 A;  2IW5 A;  5EYP B;  5JH7 B;  2QWP B;  2W6J G;  3E8F A;  1K4D C;  1GAX A;  4LF9 B;  4I9W A;  2CTQ A;  4OPA A;  2QE7 G;  4WF9 V;  2IJJ A;  3OGC C;  1CP9 A;  1FD9 A;  4JYC A;  2OT5 A;  4FLZ A;  1I5Y A;  4J80 A;  4WFA V;  2FKX A;  1NH2 B;  2DW4 A;  1YF2 A;  1M93 A;  4J7K A;  5KX5 B;  4KL1 A;  1XBL A;  4O2A A;  4D6T H;  4FPP A;  4KHP B;  3E22 A;  2L35 A;  1FXV A;  1V55 B;  1NTK H;  1N36 O;  1R6K A;  2A3Q A;  3TXS A;  5ITZ A;  3T1H O;  1M90 W;  5GON A;  1YTF D;  2RQ6 A;  2Q7H A;  2XAF A;  1IVS A;  2KG7 B;  5LP6 A;  1SC5 B;  2Q4P A;  2CTR A;  1Y6X A;  3WB1 A;  2OCH A;  1X59 A;  2EZP A;  4O4L A;  4H37 A;  2B1G A;  3JAT A;  1BGY H;  3LUT B;  4WFG A;  1OCO C;  2X6A A;  4LFC O;  3U10 A;  5KHH A;  2D3O W;  4ZBM A;  5DEC A;  2JJ2 G;  1PKX A;  2Q7G A;  2PF4 E;  4TV8 B;  4ZIB A;  3AG2 C;  2JK5 C;  5J2T A;  2R9R B;  3P30 A;  4JF3 A;  4B3S B;  2GV9 A;  4JTC B;  1H8H G;  4WCE V;  2AXT Z;  4DW1 A;  4RQE A;  3K58 A;  3RN4 A;  2FB5 A;  5B3S B;  4JTA B;  4LNU A;  4PJ0 Z;  1JX9 A;  1KP3 A;  1YDX A;  3ZHR A;  2PZS A;  1OCR C;  3ABK C;  3J80 N;  4JZG A;  3WG7 B;  5HFM A;  2UUA O;  1W59 A;  5KUK A;  3S3X A;  1MAB G;  2VQE O;  3F7V C;  4N21 A;  2YEV A;  4UVC A;  3KCY A;  4FLX A;  2HR3 A;  4MT8 A;  5LHG A;  2IJH A;  1XOU A;  1Z5V A;  3IC9 A;  4DUY O;  2YIC A;  3SYA A;  4TUY B;  1S5L Z;  3ABL B;  1J5E O;  3K04 A;  2CK3 G;  4AHC A;  3ZHV A;  4O4H A;  4PA7 A;  3HKB A;  1SQP H;  2Q0O C;  2ZIO A;  1N0N A;  3M8A A;  2EBO A;  5AG2 A;  2CGN A;  4UUJ C;  3ZHU A;  2Q7E A;  4H13 B;  4LFC B;  1IBM B;  3K59 A;  2FL4 A;  1NH2 D;  1PM9 A;  3FX7 A;  1NR7 A;  3SGI A;  2EIN B;  1K9M W;  2AHZ A;  4QNH B;  1BHA A;  3IGA C;  4L8J A;  2V4D A;  1OCZ B;  5C8Y A;  4OXS A;  4LWS A;  2K9P A;  1M4U A;  4MVM A;  1LR1 A;  4CZZ A;  2OTL V;  1DF5 A;  4X66 O;  2BSK B;  1PNK A;  2N74 A;  2KSD A;  2UUA B;  4YY3 O;  2F93 B;  4X1K A;  4CBC A;  5CA3 A;  1RM1 C;  3UM7 A;  3CME V;  5J2U B;  2VQE B;  4B3T B;  1N33 O;  2JJ1 G;  4NTX A;  2VRZ A;  3JAL A;  3ZN1 A;  3CCQ V;  1F4N A;  4ZOL A;  4FLT A;  2OCC B;  2CE4 A;  3OMN B;  1YJW V;  3LNN A;  1Q5O A;  1QR8 A;  5JVD B;  2ZXW C;  1NJI W;  3JAW A;  3SYQ A;  3H1L H;  5IE9 A;  2XTA A;  2AZ2 A;  3VQW A;  1K5Q A;  2WAM A;  3E86 A;  3RVY A;  1MMM A;  3HKC A;  1Q6I A;  3H01 A;  1XNR O;  2ZIN A;  1ORQ C;  3G67 A;  4YIO A;  2LFR A;  1VF6 C;  4I4T B;  3P3P A;  2M7W A;  2N04 A;  3W7U A;  2PI5 A;  2K1E A;  2WA3 A;  4O4I B;  4U7O A;  2Y0P A;  2EIK B;  3BVO A;  3PN1 A;  4JI8 O;  3CRC A;  4X66 B;  1HNX O;  1SZT A;  1UFI A;  4KUM A;  4YY3 B;  2B1I A;  3OR6 C;  4PHZ A;  4X20 B;  2ZM6 O;  1I5X A;  5FPO A;  5B1A C;  1TUB B;  2YXL A;  3DC6 A;  3RYH B;  1AR5 A;  1IDS A;  3OEE G;  3A8T A;  2Q73 A;  4B3R O;  4X1Y B;  5CB4 A;  3ZMU A;  5IT9 N;  4DO2 A;  3BFR A;  1COW G;  1KD1 W;  2NN4 A;  1WPX A;  4FM1 A;  5EZY B;  4LH7 A;  4RQF A;  2JS5 A;  1XNR B;  5JJJ B;  4O4J A;  4JI0 O;  1S72 V;  2JGD B;  3FAV B;  1XI1 A;  1VQN V;  5A9G A;  2QWR B;  2F4V O;  4YJ2 A;  4IHJ A;  4E4E A;  3ASO C;  1M1K W;  3MDS A;  4U3F H;  3T4Z A;  3CS5 A;  5EBW C;  3CJH B;  2QEX V;  1FFX A;  1QVF U;  1WA8 A;  1AJQ A;  1ZLZ A;  2RNB A;  3CYO A;  5JQG A;  3MAQ A;  4I7Z B;  1S0V A;  3P3N A;  2F66 C;  3M99 B;  1RPO A;  1JFF B;  5CBH A;  5IYZ A;  1S76 D;  1AJN A;  1H2S B;  2QGN A;  4J11 A;  3KZI Z;  4GKJ O;  3D3Q A;  1ROP A;  1I0H A;  2IJI A;  3ETE A;  4FIP C;  5F2V O;  3ASN C;  3CRR A;  5CMU A;  3HKD A;  4AIL C;  2RCV A;  4DR6 O;  3M7M X;  1KMI Z;  2HG5 C;  3SJQ C;  4EFE A;  5LHH A;  5LHI A;  2QJ1 A;  1DGS A;  1R73 A;  4QE9 A;  3AK3 A;  1VF6 A;  1YI2 V;  4GLX A;  3L72 H;  1VQ7 V;  1QBZ A;  5KAF Z;  5JJN B;  1JJ2 U;  4UXN A;  5LMU B;  3JCZ A;  5BMV A;  3UT5 A;  1N34 O;  4U3J B;  1TVK B;  4DV7 O;  3CMA V;  1O9H A;  4BAY A;  1BQZ A;  3ZCC A;  3W7X A;  4QJF B;  2UU9 O;  3BA8 A;  3PJS K;  1GN6 A;  1NVP B;  2ZE8 A;  1RSO B;  3HKE B;  1W0J G;  5EBL C;  5IJ0 A;  2KQX A;  4DR5 B;  1RP3 B;  3D8C A;  1A32 A;  4ZI7 B;  1VQL V;  2IH3 C;  2UXC O;  5KHI A;  4LP8 A;  1NU1 H;  2LW7 A;  3RYC B;  3JD1 A;  1G1X B;  5L3C A;  4D7T A;  4LF5 O;  4JTD B;  3F5T A;  4DR6 B;  1E1Q G;  3ZBH A;  3ZMS A;  3VQX A;  4BWA A;  4DR3 O;  1AIL A;  1XMQ B;  1YHQ V;  3CP1 A;  5LL6 Y;  1K92 A;  3AG1 C;  1US6 A;  3HB3 B;  4I55 A;  3A0H Z;  5L3D A;  4PI2 A;  3BA9 A;  4UCR A;  4JYA B;  4UCO A;  2YID A;  3OTO O;  2Y4T A;  3CSX A;  2ZE7 A;  4B3M B;  1U96 A;  2P22 C;  2EIL C;  3ZHQ A;  1S77 D;  5JWP A;  3CCS V;  2Q8V A;  1HWY A;  4H33 A;  2GTA A;  5JCO C;  2F23 A;  2QTO A;  2EIM C;  3OFN G;  5CA1 B;  3H1H H;  1P7G A;  4Z1M G;  1FAF A;  4IIJ A;  3QTC A;  4EKW A;  1WJZ A;  4Q20 A;  2YIB A;  1JVM A;  2UXC B;  2E5L O;  4JI4 O;  1M57 B;  1VQ5 V;  4LF6 B;  3S3W A;  3UKM A;  1HR0 B;  4WBN B;  5LXT A;  3OAA G;  5BR8 B;  1P49 A;  3FB8 C;  4MW8 A;  4DR3 B;  2IM9 A;  1YTF B;  2BTQ B;  5H5N A;  1P4R A;  4DV5 O;  1EN4 A;  2A9H A;  3X2Q C;  4RO2 A;  1E79 G;  4I0X B;  1YSC A;  5LGN A;  5FLX N;  1XL6 A;  1KB9 F;  4DR1 O;  4TQD A;  1AJP A;  1AP5 A;  3CE2 A;  3JAM N;  2QDO A;  1YEW A;  2DQ3 A;  5LYJ A;  2WLK A;  4R8C A;  5LBQ A;  2R9A A;  1WN7 A;  1MOF A;  4LC1 A;  2WA4 A;  3JAK A;  2QR4 A;  3TET A;  3T1Y O;  2XAS A;  5IWA O;  3CRA A;  3W7T A;  2EUL A;  3L9D A;  5EC2 C;  5GW7 A;  2YS8 A;  1HNW O;  1GN4 A;  2AW9 A;  1Y76 B;  2LW1 A;  1GRJ A;  3ZN0 A;  1PD3 A;  3NR7 A;  2CDY A;  4O2A B;  2QSA A;  1QLE C;  1JMK C;  4GYC B;  3H1I H;  4YIP A;  3G6B A;  2HJF C;  2E5L B;  4JI4 B;  3CCR V;  5ITZ B;  3BAA A;  2GHY A;  4Z2W A;  2XT9 A;  3U0Z A;  1V55 C;  1Z5W A;  4MVR A;  1V54 C;  4WFH A;  2LQT A;  3STZ C;  5LOV B;  1S5J A;  5IDJ A;  3E89 A;  3B09 A;  4UCV A;  4O4L B;  3ETD A;  2PYJ A;  1FKA O;  1H2N A;  2F95 B;  1B3Q A;  5IY5 B;  3SPC A;  1GM8 A;  4DR1 B;  3ZRX A;  2R72 A;  2ZD9 A;  3RYI A;  3U11 A;  1VQP V;  1CXZ B;  4B3S O;  3DXR A;  1LUW A;  3APO A;  3E83 A;  5KA6 A;  2EZO A;  5JCO A;  3T1Y B;  5J2T B;  5IWA B;  4QGP A;  4UVB A;  1K4C C;  5J9P C;  3SR2 C;  3WFV A;  2GDS A;  1D2D A;  2W0F C;  1XRE A;  4PDV A;  1HNW B;  1XUQ A;  1I94 B;  1FXH A;  4X1I A;  2C2A A;  3O9O A;  1IXB A;  3FYE B;  1VIB A;  5B3S C;  3OM3 B;  1G4Y B;  1IBK B;  1FPO A;  4JGS A;  4BR6 A;  2UUC B;  2WLM A;  4P9P A;  2ZNI A;  3WG7 C;  3ABM B;  4AI8 A;  3THO A;  2YI9 A;  1JCH A;  4FJC C;  2WLL B;  2ZIM A;  2ZT9 B;  1VQ4 V;  2X7R B;  3FD9 A;  4UVA A;  1AR4 A;  4WFB V;  4ASU G;  2GUZ B;  2LO1 A;  2WLN A;  2WLJ A;  2XHB A;  5CA0 B;  3ZRW A;  2LGW A;  1IBM O;  4ZKI A;  2DYS B;  3ABL C;  2DWD C;  3KKY A;  1O9G A;  3MHH C;  2X6B A;  3TJT A;  3A0R A;  2KB1 A;  5EYP A;  5JH7 A;  4J41 A;  2XAQ A;  1PNL A;  2XUM A;  2UUB B;  4GKK B;  2Y0I A;  3QG5 A;  3JCU Z;  2XAJ A;  4FFB B;  2JVD A;  3LDE A;  2IU3 A;  3BCC H;  1SES A;  2ETN A;  2EIN C;  3TXQ A;  1YIT V;  2QA4 V;  5GTI Z;  1VF7 A;  1SA0 A;  5CBF A;  1OCZ C;  4B3T O;  4CH6 A;  4DV1 B;  4JAA A;  1N8R W;  1R6N A;  4UCT A;  1H2L A;  1NBM G;  2V7Q G;  4F6E A;  4NXN B;  3VOU A;  3L71 H;  4FLW A;  4JI3 B;  2FML A;  5EIB D;  3CCU V;  4U7N A;  3K08 A;  3JAW B;  3RW0 A;  4JYB A;  2M6Y A;  3N2G B;  4LH6 A;  1KYO F;  2KG7 A;  1AB3 A;  4F6R B;  4JPR A;  1NR1 A;  3OMA B;  4PV1 B;  4WFE A;  2Q5Z A;  3HKC B;  1Q82 W;  3CC4 V;  3OUF A;  1K73 W;  3CCV V;  4FVM A;  1UJW B;  1F4M A;  3AG2 B;  3FKS G;  5L3B A;  2ARH A;  2QM8 A;  3CB2 A;  4DUZ O;  2P4V A;  4MVZ A;  4N23 A;  2VQF O;  1BE3 H;  1G8M A;  2NR5 A;  4TV8 A;  2OTJ V;  4TQF A;  1EM1 A;  3LSQ A;  4QE7 A;  4J42 A;  1OCR B;  3ABK B;  3CPW U;  2EIK C;  1FFT B;  1N0J A;  4DV3 B;  4R50 A;  5KMG A;  1KC8 W;  4X9Q A;  4AQY O;  3DGE A;  3KG2 A;  2P4K A;  3RFR A;  3B40 A;  4MVU A;  5DM6 V;  4CS4 A;  4UV8 A;  1FS0 G;  1XQ8 A;  3JD0 A;  3JD3 A;  3VQV A;  5KLV H;  5KA5 A;  2PTM A;  1B6Q A;  3QNE A;  4TV9 B;  4HBN A;  2HJD A;  4TUY A;  2F43 G;  4GX5 A; 
#chains in the Genus database with same CATH homology
 5FNV A;  4HNA A;  4K8Z A;  4GLX A;  1V9P A;  1QHT A;  2OWO A;  4O4J B;  3JSN A;  4DK1 A;  3QF7 A;  5EIB C;  4CC6 A;  5FPR A;  5JJE B;  5C8Y B;  5JJN B;  2R70 A;  4DUZ B;  3CHX A;  5LMU B;  2VQF B;  5BMV A;  4X65 B;  1T5E A;  3UT5 A;  3OTO B;  4IHJ B;  3ICX A;  1QQC A;  3WB0 A;  4LFA B;  4U3J B;  1TVK B;  4X1I B;  1O9H A;  2HEP A;  4FM2 A;  4X1K B;  5KX5 A;  5CA1 A;  4BW9 A;  4DR2 B;  3BA8 A;  3JAL B;  4AQY B;  4O2B B;  1HW7 A;  3HKE B;  5KMG B;  5IJ0 A;  4DR5 B;  4ZOL B;  4B08 A;  4ZI7 B;  3BPZ A;  2EX3 A;  4DV0 B;  3VQY A;  1N36 B;  5KHI A;  3RYC B;  3T1H B;  4D7T A;  2VWJ A;  4DR6 B;  1WNS A;  2BTO A;  3VQX A;  4BWA A;  4UFZ A;  1D5A A;  1XMQ B;  3JAS B;  5FNV B;  1I7F A;  4DV5 B;  1N32 B;  4YJ3 A;  5EYP B;  5JH7 B;  1X4T A;  5CA0 A;  4I55 A;  4LF9 B;  4PI2 A;  3RGB A;  3BA9 A;  4UCR A;  4JYA B;  4UCO A;  5K1P A;  3CSX A;  1NT2 B;  4B3M B;  4FLZ A;  5BMV B;  2P22 C;  2OYQ A;  4DR7 B;  4O4I A;  5KHG A;  4UCS A;  2VWK A;  1XMO B;  5JCO C;  4FFB A;  3IAY A;  1M93 A;  5KX5 B;  4KL1 A;  5CA1 B;  4O2A A;  4DK0 A;  4KHP B;  3E22 A;  4IIJ A;  3QTC A;  2PYL A;  5IJ0 B;  2YIB A;  3JAR B;  2P5O A;  2UXC B;  5ITZ A;  4X20 A;  4LF6 B;  3BHP A;  5CB4 B;  1TUB A;  3RYH A;  1TA8 A;  5GON A;  1HR0 B;  2RQ6 A;  4WBN B;  5LXT A;  2Q7H A;  5LP6 A;  5BR8 B;  1P49 A;  3WB1 A;  3K5L A;  4DUY B;  4DR3 B;  4CH5 A;  4X1Y A;  2IM9 A;  4O4L A;  2BTQ B;  4CC5 A;  1J5E B;  2ZCE A;  3N2G A;  1ZAU A;  3JAT A;  4F6R A;  5EZY A;  3SJB C;  3N2K A;  4TQD A;  3U10 A;  5KHH A;  3BAB A;  1YEW A;  4DV2 B;  5LYJ A;  2R9A A;  2YIA A;  5LA6 B;  3K5N A;  1WN7 A;  4YJ2 B;  2Q7G A;  4TV8 B;  4ZIB A;  1Q43 A;  1SQF A;  3JAK A;  5J2T A;  4TOI A;  4B3S B;  2GV9 A;  3K58 A;  1FFX B;  2PY5 A;  4LNU A;  5JQG B;  1B04 A;  2PZS A;  4O2A B;  1JMK C;  4GYC B;  2UXB B;  1WPB A;  4I50 B;  4IIJ B;  5IYZ B;  5KHJ A;  5J2U A;  2E5L B;  3A2F A;  4JI4 B;  5ITZ B;  3BAA A;  5IJ9 A;  3RYF B;  1N33 B;  2RJZ A;  4FLX A;  3HKD B;  3U0Z A;  1SQG A;  1Z5W A;  4DRX B;  5JVD A;  1Z5V A;  4TUY B;  5LOV B;  1S5J A;  1KU9 A;  4AHC A;  4O4H A;  4UCV A;  4HNA B;  4O4L B;  4D7S A;  3HKB A;  2PYJ A;  4LR3 A;  2ZIO A;  1M5I A;  4ZHQ A;  3DSQ A;  4TV9 A;  2F95 B;  1Q8I A;  4DR1 B;  2Q7E A;  4LFC B;  4JI7 B;  2R72 A;  3N2K B;  3RYI A;  3U11 A;  3K59 A;  1IBM B;  3SJA C;  4I4T A;  4FLV A;  5LMN B;  4JV5 B;  3SGI A;  2ZNJ A;  3UT5 B;  4L8J A;  3ETQ A;  2V4D A;  5JCO A;  3T1Y B;  5J2T B;  5C8Y A;  5IWA B;  4DR4 B;  1M4U A;  3SR2 C;  4UCU A;  4CS3 A;  1HNW B;  4FLU A;  4JI2 B;  1I94 B;  4JI8 B;  4U3J A;  4OX9 B;  3K57 A;  4X1I A;  2UUA B;  2F93 B;  4X1K A;  4EEQ A;  1HNX B;  4LF7 B;  2VQE B;  5J2U B;  4B3T B;  4Q6G A;  1IBK B;  3JAL A;  4O2B A;  2UUC B;  2ZM6 B;  5IJ9 B;  4ZOL A;  4FLT A;  4ZI7 A;  2ZNI A;  3LNN A;  4NXM B;  1Q5O A;  5JVD B;  3THO A;  2YI9 A;  4B3R B;  2ZIM A;  3JAW A;  3UQ8 A;  3VQW A;  4YJ3 B;  4ZHQ B;  2XHB A;  5CA0 B;  5K1X A;  4I55 B;  3HKC A;  3ZS8 C;  1O9G A;  2ZIN A;  4EB6 A;  4K0K B;  4PI0 A;  3RYI B;  4K8X A;  3FFQ A;  4I4T B;  2PGG A;  5EYP A;  5JH7 A;  3JSL A;  1TAE A;  4JI0 B;  1TGO A;  4O4I B;  4DV4 B;  2UUB B;  4GKK B;  4LF8 B;  4LF4 B;  3QG5 A;  4FFB B;  2JVD A;  3SJC C;  2Q0A A;  4CS2 A;  1SKV A;  2F4V B;  3PN1 A;  2YIB D;  2KKW A;  1XHZ A;  1JJO A;  4X66 B;  3E22 B;  5D5Q A;  1VF7 A;  1SA0 A;  1HNZ B;  4YY3 B;  4CH4 A;  4LFB B;  4CH6 A;  4PHZ A;  4DV1 B;  4X20 B;  2F1M A;  4UCT A;  5FPO A;  1XNQ B;  1JFF A;  1TUB B;  2YXL A;  4JI1 B;  3RYH B;  4NXN B;  5KHK A;  5GON B;  4CH3 A;  5LXT B;  4I9Q A;  4X62 B;  4FLW A;  4JI3 B;  5LP6 B;  3JAR A;  4JI5 B;  4X64 B;  3K5O A;  5EIB D;  4X1Y B;  2E3C A;  4GKJ B;  3B2E E;  5CB4 A;  3RWR D;  3JAW B;  2JGU A;  4WBN A;  2HHH B;  3N2G B;  4LH6 A;  3JAT B;  1IBL B;  4F6R B;  4FM1 A;  5EZY B;  1G6U A;  4JI6 B;  4LH7 A;  2BTQ A;  2JS5 A;  3HKC B;  1XNR B;  5LYJ B;  4EB6 B;  5JJJ B;  4NVP A;  4O4J A;  4DV6 B;  4FVM A;  2CAZ C;  1XI1 A;  3JAK B;  1L8D A;  3CB2 A;  1XHX A;  5LA6 A;  3ZED A;  4YJ2 A;  3K5M A;  4IHJ A;  4TV8 A;  4LNU B;  3OTF A;  4TQF A;  2PUS A;  1TVK A;  1Q3E A;  1N34 B;  2UXD B;  1SA0 B;  1FFX A;  4DV7 B;  2QM4 A;  4DV3 B;  1RSO A;  2UU9 B;  3HKE A;  5KMG A;  5JQG A;  3MAQ A;  4EFB A;  2F66 C;  1JFF B;  4I50 A;  3BRC A;  5IYZ A;  3RFR A;  1FJG B;  1H2S B;  4CS4 A;  3RYC A;  1XQ8 A;  4FM0 A;  3VQV A;  4O4H B;  3RYF A;  3WB2 A;  3HKB B;  3HKD A;  2PTM A;  4AIL C;  4YHH B;  4TV9 B;  4HBN A;  4DRX A;  4EFE A;  3M7M X;  1KMI Z;  4FLY A;  4LF5 B;  5LP6 C;  4TUY A;  5LOV A;  2QJ1 A;  3JAS A;  2YI8 A;  1DGS A;  5D5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...