3BHPA

Crystal structure of upf0291 protein ynzc from bacillus subtilis at resolution 2.0 a. northeast structural genomics consortium target sr384
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
52
structure length
52
Chain Sequence
MISNAKIARINELAAKAKAGVITEEEKAEQQKLRQEYLKGFRSSMKNTLKSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the UPF0291 protein ynzC from Bacillus subtilis at the resolution 2.0 A.
rcsb
molecule keywords UPF0291 protein ynzC
molecule tags Structural genomics, unknown function
source organism Bacillus subtilis
total genus 18
structure length 52
sequence length 52
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3bhpA00
2Q7GA 2R72A 2HEPA 1O9GA 2YIBD 3DSQA 3VQWA 3VQYA 4CH4A 4CS4A 2RQ6A 2ZNIA 1O9HA 2Q7HA 2YI9A 2YIAA 2ZNJA 4CH5A 4CH6A 2ZCEA 4TQDA 4CH3A 3VQVA 4BWAA 2JVDA 4CS2A 2ZINA 2E3CA 2QJ1A 5K1PA 2ZIOA 2PUSA 4CS3A 2PGGA 3QTCA 4Q6GA 2Q7EA 4ZIBA 2YI8A 5K1XA 4TQFA 3BHPA 2RJZA 1G6UA 2ZIMA 4BW9A 3ZEDA 2R70A 3VQXA 2YIBA
chains in the Genus database with same CATH superfamily
4DUZB 1GTOA 1HDJA 3JAWB 3QO8A 1HNXO 3W7XA 1FFXA 4WCEV 5KA6A 4KL1A 4GX5A 4J9ZB 3A8TA 3R66A 2QDOA 3BAAA 3RYHA 4F6RA 4RUEA 2UXBB 2UUBO 1S3JA 3KCYA 1AI6A 3JSNA 3R65A 4DUZO 2Q9LA 4BAYA 4DO2A 5IDJA 3EHBB 3K59A 3DSQA 3U10A 3ABLB 2E75B 1US6A 4MW8A 3K5OA 3TJTA 4IGGA 3RYFB 1AR1B 2UXBO 2EJRA 4U3FH 3N27A 4MVUA 3OM3B 3J80N 4LFCB 3JD4A 4MTOA 5B3SC 1WB8A 1NR7A 4GKKB 2P90A 2ZQMA 1AI7A 4I0XB 2F43G 4JYCA 1VQ4V 4EB6A 4PA6A 1AILA 2NN4A 2FYUH 1N0NA 3FAVB 3N2GA 2Z3YA 1F4NA 2YIDA 1LUWA 3ZMVA 3JARA 2GDSA 2YXYA 2ZCEA 2EZPA 4GKKO 5K1PA 5L3GA 3CP1A 5CA0B 4R7CA 1YI2V 2DYRB 2P6JA 2ZDIC 1VQ9V 1I94B 3A2FA 1XQ8A 2H3OA 3FYIB 3MAQA 4DR4B 2PI4A 1S77D 3SPCA 1YTFD 2EINC 4FK5C 4XDKA 1YXBA 1TVKA 1I94O 1FYJA 2V1DA 3QO7A 2CE4A 3AG4C 3OT7A 1EFRG 4LFAB 3FX7A 3K58A 4ZOLA 4DR4O 4BIOA 2WLJA 1Z5VA 2HFEC 1N32B 4DW1A 3K5MA 3SJCC 3T1YB 3E83A 3E8BA 3OW2U 1YCIA 4YHHO 5A2QN 4J41A 3ZRVA 5IYZB 4KXRA 4LFAO 4GX1A 3HKBA 4FIPC 2YEVB 5JJJB 4DV3B 3ETQA 1N32O 1IURA 2BOBC 3M8AA 4K35A 3T1YO 4UB8Z 3OUSA 4O2BB 3CCJV 2UUAB 3EVKA 2K1EA 1AR5A 3ZHTA 2E3CA 1EN4A 2JIZG 1WP8A 3FB7C 5H9CA 3T4DA 4DV3O 2FB5A 2E5LB 2V7QG 1XHZA 1WA8A 2UUAO 4OGQB 2Q69A 1RM1C 5EBLC 4X1YB 1X4TA 2E5LO 4F4LA 1URFA 5KAFZ 3ML0A 2F4VB 4QNHB 3STLC 4X9QA 1NH2D 1HW7A 3N2KA 2F95B 2JS5A 4QE9A 1NZ6A 3OFNG 1NS1A 2JS3A 1J5EB 1NTMH 4EFBA 1G8MA 3W7WA 3CXCU 2WLKA 3ZRSA 3OMNB 1FXKC 4NVPA 1RPOA 4J9YB 3SJQC 2F4VO 4C7UA 1OCZC 3OGIB 4B3MB 4LNUB 3HR0A 4JTAB 4LF9B 1Z5WA 3ZHSA 1BQZA 1J5EO 2QKCA 3QO5A 2LQTA 4W4LA 3KCXA 1BL8A 4WF9V 3OR6C 2OCHA 5KMGA 2YXLA 1K34A 1P7GA 3ETDA 1YDXA 2ZM6B 4DR1B 2HVJC 1H8HG 2QWRB 4LWSA 3CC4V 3DGEA 4B3MO 5J2TA 1MA1A 4LF9O 5KHHA 3H1LH 3CCLV 1VQOV 3PN1A 3HKEB 4ZBMA 1OCRC 2Z0AA 5B66Z 4LF6B 1JPXA 2JEUA 1JVMA 2UU9B 2WLIB 3SDLA 2ZM6O 4DR1O 3T1HB 4CH5A 1M56C 2ZR2A 1NT2B 4DV7B 1ZL8B 2A79B 1SESA 2GSMB 2XHBA 4U3JA 2ZKOA 2JGDA 4LF6O 1V54C 2UU9O 4X62O 2YSUB 5C93A 1XMOB 3K06A 1K97A 4FM1A 3T1HO 2P5OA 5B1AC 3TCUA 3ZRXA 1PNLA 1JCHA 4DV7O 2HKOA 2QR4A 3HKDB 1YVWA 3CD6V 1P4RA 4I55B 4JAUA 5KX5B 1VQ8V 3E22A 1K4DC 2PGGA 1XMOO 2M7WA 2Q5ZA 3DTUB 2BTOA 3ABMC 4FFBB 4U7NA 3RYCA 2CK3G 1FXHA 3ZMUA 1SA0A 3KKYA 4X20A 1NVPD 4K3AA 4QJFB 3TXSA 4H13B 1WN7A 4WFHA 2NNUA 5EZYB 4ZHQB 3LNNA 3B4SA 2HHHB 1XBLA 2EJ7A 2W6JG 3OTOB 1L8DA 3ZJZA 4K8ZA 1UFIA 2DW4A 2XAHA 5LGNA 3F5WC 1YTFB 1SRYA 1XL6A 3CRMA 4TV9B 3TK1A 4DV0B 2LGQA 3RYHB 4F6RB 2HHHO 3OTOO 4JTDB 3JAKA 3OR7C 4FLUA 4B3TB 3X2QB 3F7YC 3WB1A 2ILMA 4BIUA 1DK1A 3E35A 2RQ6A 2ZNIA 4TQDA 4GX0A 1JFFA 4DV0O 1PD3A 2P67A 4XBFA 4UCVA 3K0DA 4B3TO 3CCUV 2N04A 1RP3B 4DV6B 2PY5A 1A32A 1PKXA 3MD0A 3CRAA 2BCCH 2DN9A 5HFMA 3EFFK 5GTHZ 3UQ8A 4MVZA 3P3NA 4EB6B 1H2MA 3O65A 1H2SB 1TUBA 3N2GB 2F23A 1S5JA 1M57C 4YJ3B 2ZIOA 5IYDO 4DV6O 3G67A 3IGAC 5K1XA 2ADQB 2Y4TA 3RVYA 4D7SA 1QHTA 2Y0IA 1W0JG 4P2ZA 3UO2A 2GTAA 4YY3B 3A0RA 5H6RA 1PNKA 5IJ9B 4ZI7A 5KHJA 4PHZA 4O2AA 1MSDA 1CXZB 5GW7A 5KAIZ 2BSKA 4DUYB 1OHHG 1SF9A 3EXAA 2YI8A 3L70H 2WLNA 2OCCC 2RJZA 1VF6A 4NXMB 1G1XB 1K4CC 1GO3F 2QSAA 4YY3O 4O4LB 2KG7A 4ZOLB 3JD3A 1KU9A 1QVGU 2NLJC 1OV9A 2ZXWB 2A0LA 1ORQC 4DUYO 5JH7A 2CH7A 1K7DA 2ZE5A 1BE3H 5CB4B 3KZIZ 2FL4A 4O4HA 4JI4B 2CTPA 3ETEA 3ABKC 1IBKB 3RW0A 2KQXA 1R3JC 3HKBB 4EEQA 2QM4A 2XAQA 4R50A 2W0XA 4I4TB 2QM7A 2BTQA 4JI4O 3SJBC 2EIJC 1SZXA 4RUFA 4UV8A 1VQNV 1HR0B 3P32A 1H8EG 4TSFG 5JJNB 2Y0PA 4B7EA 2XNDG 4IYHA 3P30A 3ZN1A 2ZNJA 2HR3A 3FYEB 1HWYA 4I9QA 4LF7B 1HR0O 4JGSA 4FM2A 2K9PA 1VQ6V 4LFBB 2H94A 4JYAB 2JJ1G 5IJ0A 2PZSA 1VQPV 1KUQA 4QIWF 1D5AA 5FLXN 4LF7O 1ZAUA 4FZ0A 2LGWA 1I5YA 3W7SA 4JI2B 1Q86W 5EIBC 2RNBA 1FJGB 4LFBO 4GZRB 4B3SB 5B3SB 4JYAO 4JTCB 2QWQB 1K3EA 1R3LC 1Y74A 3CB2A 5C8YA 1QU7A 2IJKA 2CAZC 3CSXA 2R70A 3BCCH 4GCZA 1XNQB 4ICGA 1IBLB 4JI2O 1MG1A 4GKJB 2FTKA 3CCSV 1FJGO 3CYOA 1EBOA 4B3SO 4YIOA 3TGUH 4FLVA 2F93B 1N8RW 4HYOA 2DQ3A 3OUFA 5JJEB 1EN5A 4MVSA 2A3QA 1IZ3A 3SPJA 3T4ZA 4MSWC 1SQGA 1XNQO 3ETGA 4G27B 1S72V 1IBLO 2ARHA 3SYPA 2CDYA 2EIKC 2Q7GA 1FD9A 3ZMTA 4GUNA 4PELA 2PYJA 1CEZA 4X66B 2EINB 1Y76A 4IHJB 3S3WA 3LSQA 4WBNB 2IW5A 1SQPH 3G4SV 2WAMA 3B2EE 2FMLA 2ODMA 4G2KA 3QF7A 5JWPA 3AG4B 3ASNC 2XAJA 2A06H 2JGDB 1SERA 1NKDA 4E4EA 1L1FA 3TETA 1AI5A 4UCUA 1AVMA 5DN6G 4KP4A 3OTFA 3ZS8C 3I56V 4LBEC 1FKAO 2W0FC 2F1MA 1WPXA 3SJAC 4JI7B 2WPDG 2GUZA 2O57A 4B08A 3MDSA 2WA4A 2JDIG 5CA1B 3OAAG 2DMXA 2KKWA 4N21A 3RYCB 1OCOC 2KB1A 3CJHA 1PNMA 4H37A 3Q4HB 4LFCO 4JI7O 2AZ2A 1H2KA 1PL4A 1SA0B 3JYCA 1GN4A 1IVSA 1BS3A 5IT9N 3MHHC 3MHSC 2LJ2A 5IY5C 2F66C 3OMIB 1DF5A 3VQXA 3CC7V 4JI8B 1DTOA 3BA8A 4L8JA 3G6BA 4PDVA 2L35A 4W4KA 2ZD9A 1F7YA 2QJ1A 1RM1B 4I50B 1QLEB 1S76D 3H01A 3ZBHA 4EKWA 1GN3A 3JASB 3CHXA 1JX9A 3JAMN 3D8CA 2P22C 4JI8O 2OYQA 1SQFA 1GRJA 5HFLA 3UM7A 2LFRA 5LGTA 1D2DA 3AG7A 5JVDB 1FXKB 1OZ0A 2MK3A 4BWAA 4FZ1A 4YIPA 1JFFB 2ATKC 1OCZB 1AP6A 2M6YA 5LOVB 5EYPA 4GLXA 4LF8B 4QE7A 3HB3B 1IXBA 1FS0G 2R9RB 1K5SA 3AK3A 3M7MX 4H44B 2YC0A 3ZRWB 3BEHA 5EC1C 1MABG 1TUBB 4WFFA 2IJHA 1PV0A 1W0KG 4MVRA 3L9DA 3IC7A 1VQ7V 2EIMC 1OCRB 2XT9A 4LF8O 4HNAA 4YJ2B 2XAGA 4K8XA 1KP3A 4KHPB 2YI9A 2XAFA 4L87A 1J95A 2ZT9B 1M56B 4IIJA 3CPWU 2FKXA 2IM9A 1QLEC 4LCUC 1V54B 3BRCA 5BMVA 2BSKB 3ZIAG 3AG2C 4O4IA 3L71H 4KHPO 5B1AB 3UO3A 4JYYA 4J11A 4XDJA 3CCQV 3BY6A 3A0HZ 5EIBD 2IU3A 4D7TA 4MVOA 3WB2A 1R6NA 1SS3A 1QCEA 5JH7B 1RSOA 2CH7B 1BMFG 5CA3A 5D5PA 3QVNA 1U96A 5B1BC 3ABMB 3K3WA 1VMGA 3WG7C 2HEPA 3JCZA 3SPGA 1R3IC 4CH3A 4UCOA 3ZHUA 4OPAA 1TUEB 2LFSA 1GN2A 1OCCC 3K04A 3FKSG 3WFVA 5EK0A 3L75H 1W2BU 1S5LZ 3ZHRA 1AI4A 1FFTB 3AG1C 2WSSG 4MTGA 4UFZA 2R72A 5LP6C 2ZE7A 4PDLA 3K5NA 5BY1A 1Q43A 4TOIA 4CH4A 3H1KH 3APOA 3UT5A 4TV8B 5LYJB 1S5HC 4LF5B 3D36A 4RQFA 2IH3C 5LBQA 2NR5A 3L73H 1P49A 4UB6Z 3AK1A 1KECA 4WFEA 1RPRA 4TUYB 4JASA 2H8PC 5LA6B 3H1JH 3JAWA 5LMNB 4JZ2A 1VF6C 1H2GA 4B3RB 4LF5O 5IJ0B 2P06A 3GB7C 1TAEA 4UCRA 1DLBA 5LXTB 2WLMA 1Q3EA 4CS2A 1MOFA 2DJVA 4FLTA 4CZZA 1YJWV 3U0ZA 5A9GA 1ZUQA 4RQEA 2ADPA 5LMNO 1MNGA 1R73A 3ZEDA 4B3RO 1I0HA 1YIJV 4WFBV 3RYFA 4MVMA 3DC5A 3SYAA 4XDLA 1O9GA 3K5LA 1M93A 1GH6A 2YIAA 1WPBA 2Z5UA 1M4UA 4X1KA 1SQBH 3OE7G 3T1CA 2X6CA 4Q20A 2AW9A 1M57B 4I0XA 2Q68A 1P7BA 2XASA 1EZJA 1HNWB 1GN6A 1DGSA 1XILA 3K0GA 2Y69C 2P4VA 4PDMA 1XDCA 4NTYA 4O4JA 5CA0A 1LNQA 5GONA 5J9PC 5KUKA 1FFXB 5FL7G 1HNWO 1ZTEA 1Y76B 5BR8B 4AHCA 2QKAA 4LH6A 4GX2A 4BW9A 2OCCB 2ITDC 4ZKIA 2V4DA 3ICXA 1QR8A 3ABTA 5B5EZ 1FPOA 5IE9A 4J80A 2D2CB 1SQXH 3RN4A 3CCEV 5BR8O 4JV5B 5L3CA 5B1NA 4UVBA 2VQFB 3G6EV 1QLNA 3ABKB 1G6UA 1WB7A 2GUZB 3FD9A 4J10A 4X65B 5IWAB 3SYQA 4H0LB 1ROPA 4FLXA 1NTZH 2UXCB 3K9AA 5E1AC 1SKVA 1XOUA 1LR1A 4JAVA 3C3SA 4P9PA 3SYOA 4G28B 4UCSA 2VQFO 4CC5A 2W6IG 3JARB 4E2LA 2EIJB 5LHGA 1Y4MA 2D3OW 4ZIBA 1WP7A 5IWAO 4X65O 5LP6A 2AZ0A 2UXDB 2UXCO 1KD1W 4ABMA 3PJSK 3RWRD 5CBGA 1H2LA 3B09A 1IBMB 1JOYA 3E8GA 1GMGA 1FXVA 4NYKA 4HAMA 1GK9A 4PI2A 5JCOA 1GM9A 3CXHF 3BHPA 1COWG 2UXDO 1K8AW 1GAXA 4LC1A 2CTRA 1SZTA 5DEDA 1TVKB 1KKCA 1NH2B 3QNEA 3CE2A 4UCTA 3SGIA 1IBMO 3QG5A 4AQYB 4IYIA 1UPGA 1AJNA 4I7ZB 4JI1B 4X1YA 2N05A 2WLLA 5LGUA 3UCSC 1AR4A 3GVMA 1BCCH 4MW3A 3SPIA 3APQA 3A0BZ 4FVMA 2HLDG 4NXMO 5KLVH 2JRIA 2UXNA 2X7RB 2Q73A 4AQYO 4JI1O 2A9HA 1R6KA 3VQWA 3D3QA 4DRXA 2CTQA 1K33A 5EYPB 3DXRA 3RT3C 4RO2A 4TT3G 2YXHA 3ASOC 1T5EA 2Q0AA 3RYIA 3CRCA 4LNUA 4Z2WA 1N4CA 1Q90D 3G71V 5ITZA 5FPOA 1IBKO 1YF2A 3LSUA 2HP8A 4TQFA 3CCVV 2YS8A 4JZGA 2BOCC 3B8NA 1HP8A 4K0KB 3LDCA 5EBMC 5IYBO 2EIKB 1ZX3A 4JPRA 3CRQA 3D3IA 1WA8B 4DYLA 3W7UA 2OWOA 2JEXA 3JATA 3THOA 1GKFA 5BZBA 3HKEA 4IIJB 5H2FZ 4FLWA 5KA5A 4MS2A 4K0KO 3ASNB 2WLIA 1Q7YW 1Q6HA 4BR6A 2WLHA 1I7FA 4O4IB 3N2KB 2WA3A 2DOSA 2Q7HA 1I08A 1ZL8A 3HKCA 2YUAA 1VF5B 1BZKA 1M90W 2DQ0A 1VQLV 3JD2A 5IYCO 3SPHA 2EBOA 3K9SA 2BE3A 1BT8A 4CS4A 1RSOB 4F6EA 4I5SA 4DR6B 3H1HH 1V55C 5DECA 3BVOA 4NXNB 2X6BA 3ZHVA 3HKDA 1OCOB 2UXXA 4KUMA 5KX5A 2L6LA 2B1IA 1NVPB 5KMGB 3AG3C 5FPRA 4NTXA 5IY5B 1L0NH 1PP9H 4LWSB 5DM6V 1DF4A 5J2TB 4DR6O 1VF7A 1WJZA 1V9PA 4NXNO 5KHIA 3UKMA 4X64B 1KQSU 4GKJO 3ZN0A 1VQMV 3E8FA 1QQCA 5B1OA 3CMAV 3LDEA 1Y67A 4ZHQA 4LF4B 2DYSC 2ZE8A 2Q7EA 1RFYA 4HZ3A 2E74B 1YEWA 4FLYA 2EILC 4X64O 2Q0OC 4U3JB 2QTSA 3E86A 1NTKH 1XMQB 1O9HA 4DR2B 4X66O 4LF4O 1MZFA 4TV9A 3CCMV 3CC2V 1E79G 2OT5A 3VBBA 2ZR3A 5FNVA 2JJ2G 3E22B 4FLZA 5L3EA 1XMQO 1N36B 1NR1A 1VARA 4DK0A 5CBFA 4DR2O 3RBZA 2B9ZA 4LH7A 2P7TC 2B5UA 2ZINA 4X1KB 1IXMA 4X20B 1BGYH 1N36O 1LUVA 3OEHG 3OGCC 3CEIA 2MW2B 2EIMB 3BABA 1K5QA 1XEQA 3VQYA 1QNMA 1B6QA 4YJ3A 4CBCA 4OPHA 4O4JB 5CBHA 3B40A 3D36C 2JK5C 5GONB 4DR3B 1QBZA 3JALA 1M5IA 4X1IA 2CGNA 3AG2B 4FM0A 4PD4F 3JAKB 5IJ9A 3ZMSA 2PYLA 1K73W 3VQVA 4NB5A 4DR3O 2YICA 4JI0B 4YHHB 4CS3A 1B04A 2GTSA 2PTMA 2CTWA 3DC6A 1Y66A 4O4LA 5LHIA 2QA4V 1OJHA 5B1BB 2OTJV 4P30A 4CC6A 1YHQV 3WG7B 3ABLC 1YJ9V 4JI5B 4R6ZA 4AI8A 5CB4A 1P84F 4JI0O 2RN9A 1Q82W 4MTFA 4UV9A 1OCCB 4PA7A 1N0JA 2CGOA 2P4KA 2X6AA 3AK2A 2YIBA 4JI5O 3CCRV 3AG1B 4I4TA 3TXQA 1CPYA 5LP6B 1MMMA 2B1GA 1UJWB 1SQVH 1B3QA 4JI6B 1S0VA 4J7JA 1AB3A 3K79A 4LR3A 1Q6UA 2DYRC 3K03A 4ZI7B 4FJCC 4UUJC 4O2AB 1XI1A 3E8HA 1PPJH 3HPLC 5H5NA 4P9OA 3JD0A 4DXWA 4JI6O 1B06A 3H1IH 4Z1VA 1ZLZA 2KG7B 4PJ0Z 1SQQH 4KFMA 2QGNA 2WLLB 2AGAA 4NKGB 2CUGA 5J2UA 1NJIW 2ZIMA 5EC2C 4O4HB 3IFXA 1R6TA 1HNZB 2OTLV 3FB6C 1EN6A 3LDDA 2LP7A 4DRXB 1Q81W 1X59A 3RVZA 3DXRB 2EX3A 1BHBA 3B8MA 1IX9A 4PDRA 1Y6XA 1U97A 3RYIB 1E1QG 2BTQB 4DV1B 2HG5C 5ITZB 1ZSPA 1HNZO 3VOUA 1GM8A 3IAYA 2Y69B 4DW0A 2YIBD 1BSMA 1WAZA 3OD4A 5JQGA 2JGUA 2R9AA 4DV1O 3JATB 4J42A 2ZDIA 3C3TA 5KUMA 1KYOF 2LO1A 4JF3A 3SR2C 2EULA 5LHHA 2LW1A 1SC5B 2ETNA 4X62B 2QTOA 2VRZA 5JCOC 4WFAV 2UUCB 2IBZH 3LNMB 3NR7A 4RWUA 4MVQA 4QGPA 4IHJA 1NBMG 4WBNA 3ZX6A 3LSSA 2Q8VA 1XL4A 3HKCB 3FB8C 4IT5A 2QWNB 2RMKB 3S3XA 4YXWG 2UUCO 2DWDC 4J7KA 1TGOA 2RCVA 1Y74B 5C8YB 3IJ4A 1AP5A 3CRRA 1Z2GA 4UXNA 1GM7A 4CH6A 4QPJA 2DWEC 1KC8W 1EZVH 5CA1A 2QKSA 3G80A 2QM8A 1JMKC 1MSWD 3JCUZ 1VEWA 3FAVA 1F23A 5L3FA 3K57A 2AHZA 3Q4HA 1VQ5V 5AG2A 4D6TH 2G38A 4UVAA 1I5XA 1AJPA 1JA8A 3OEEG 1KKDA 1AJQA 3JSLA 4FMTA 2YDEA 3U11A 2XTAA 3NXSA 4I50A 2QWPB 1CP9A 4OXSA 3JASA 4LP8A 4X88A 5CN0A 2R9IA 1JJ2U 2HJDA 2GV9A 4R8CA 5EBWC 2VWJA 4N23A 1PM9A 4NR1A 5FNVB 5KHGA 4DK1A 2IJIA 1XREA 2N74A 4EFEA 4X89A 2IU0A 5JVDA 1FXKA 2Q4PA 4MTXA 3J7AU 4JV5O 5IYZA 1NU1H 3ASOB 2JVDA 4PV1B 3BPZA 3CJHB 3O9OA 5LOVA 2HVKC 2IH1C 4MT8A 4BW5A 2YEVA 1Q5OA 4I9WA 4FPPA 4IL6Z 1ZWIC 1MZEA 5E79Z 5KHKA 4FFKA 4O2BA 4DV2B 3BA9A 3JD1A 3ZRWA 3H9VA 1G4YB 3WU2Z 2PF4E 1JR9A 4BIZA 3RFRA 3AEIA 1KBHA 4DR5B 1K9MW 2XUMA 3C90A 1F51A 2VS0A 4QPKA 4J7ZA 5F2VO 4YJ2A 2A7WA 4DV2O 3GWOA 4NTWA 3F7VC 1QVFU 1VP7A 3JALB 3F5TA 2GBOA 4X1IB 4PI0A 3W7TA 1YJNV 3I55V 2AXTZ 2Q6AA 4DR5O 5L3BA 5TISZ 3I5DA 2EZOA 1WLEA 4WFGA 3J81N 4X8AA 2IJJA 3GWKC 2Y48A 3FFQA 3WB0A 3X2QC 3CWBH 3OMAB 1H2NA 1M9NA 1TA8A 4PA3A 2QWOB 5CMUA 1V55B 4GT1A 4DV4B 2AHYA 1W59A 1SETA 1K92A 1NI8A 2Q67A 3CS5A 1E1RG 1L0LH 1NQTA 3STZC 2VWKA 2PUSA 2Y4UA 3AG3B 1R3KC 5GTIZ 1YITV 4RAIA 1KB9F 1Q6IA 1YSCA 3SYCA 3ZHQA 4DV4O 1N33B 1VIBA 3E2EA 4ASUG 1KMIZ 4JYBA 5LL6Y 2C2AA 2RDCA 4HNAB 1VQKV 2DE0X 1BQ0A 1XHXA 5D5QA 4U7OA 3IC9A 2DYSB 3B77A 5BXZA 1R1BA 2VQEB 1Q8IA 1FAFA 1YZBA 4Z1MG 2OIGA 1N33O 1H38A 2EILB 5L3DA 4TV8A 4B7KA 2XOKG 5LYJA 4AILC 1PL0A 3ZMZA 5BMVB 4DV5B 4UVCA 3ABUA 2LW7A 1BHAA 1N34B 4PA4A 4TUYA 5LA6A 2OIEA 1THZA 2VQEO 2GHYA 2ITCC 3M99B 4TWKA 4OX9B 4DR7B 1D5NA 2KSDA 4GYCB 1ENVA 4A5UB 4DV5O 1IDSA 1KP2A 5J2UB 4JI3B 3T2MA 4HBNA 5LXTA 1WNSA 1N34O 1QR9A 2ZXWC 4I55A 4OX9O 4DR7O 4JAAA 1XNRB 3CX5F 3L74H 4FFBA 1XUQA 3QTCA 5H6QA 4Q6GA 1JQ0A 1AROP 3K08A 3L72H 2E76B 4JI3O 2QE7G 5LMUB 1JJOA 3P3PA 3CMEV 2HJFC 2QEXV 4PA9A 3KG2A 3ZCCA 2ZE6A 3BFRA 1HNXB 1XNRO 2PI5A 5EZYA 3LUTB 3UT5B 3RGBA 2X0LA 5JQGB 3E89A 4H33A 1F4MA 1M1KW 1EM1A 2WWWA 5LMUO 2UUBB 3FB5C
chains in the Genus database with same CATH topology
3RYFA 4I4TA 4DUZB 1O9GA 3JAWB 1M93A 4O4LB 5LP6B 3K5LA 4ZOLB 1FFXA 1KU9A 4KL1A 2YIAA 1WPBA 1M4UA 4X1KA 4JI6B 5JH7A 3BAAA 3RYHA 4F6RA 5CB4B 2UXBB 4LR3A 4O4HA 4JI4B 3JSNA 4ZI7B 1HNWB 1IBKB 4O2AB 1XI1A 1DGSA 3HKBB 4EEQA 3K59A 2QM4A 3DSQA 3U10A 3K5OA 4O4JA 3RYFB 4I4TB 5CA0A 5GONA 2BTQA 1FFXB 3SJBC 4LFCB 1HR0B 5BR8B 4GKKB 4AHCA 5J2UA 4LH6A 5JJNB 2ZIMA 4BW9A 4O4HB 2V4DA 3ICXA 4EB6A 1HNZB 3N2GA 2ZNJA 3JARA 2ZCEA 4DRXB 4I9QA 4LF7B 4JV5B 5K1PA 4FM2A 2EX3A 5CA0B 3RYIB 2VQFB 2BTQB 4DV1B 4LFBB 5ITZB 1I94B 3A2FA 4JYAB 1G6UA 1XQ8A 4X65B 5IWAB 3MAQA 5IJ0A 2PZSA 4FLXA 3IAYA 1D5AA 2YIBD 4DR4B 2UXCB 1SKVA 1ZAUA 4JI2B 5JQGA 2JGUA 4UCSA 5EIBC 4CC5A 2R9AA 3JARB 3JATB 1FJGB 1TVKA 4B3SB 4ZIBA 3SR2C 3CB2A 5C8YA 4LFAB 2CAZC 4X62B 3CSXA 2R70A 5LP6A 3K58A 4ZOLA 5JCOC 2UXDB 2UUCB 1Z5VA 1XNQB 1N32B 1IBLB 3K5MA 3RWRD 4IHJA 1IBMB 3SJCC 4GKJB 4WBNA 3T1YB 4FLVA 2F93B 3HKCB 5IYZB 5JJEB 4PI2A 5JCOA 3BHPA 3HKBA 5JJJB 4DV3B 3ETQA 1SQGA 1TVKB 1TGOA 4UCTA 3SGIA 2Q7GA 5C8YB 3QG5A 4AQYB 4JI1B 4X1YA 4O2BB 2PYJA 2UUAB 4CH6A 4X66B 2E3CA 4IHJB 4WBNB 5CA1A 3B2EE 4FVMA 3QF7A 2E5LB 1JMKC 1XHZA 3K57A 3VQWA 4DRXA 4UCUA 3OTFA 5EYPB 3ZS8C 1T5EA 2Q0AA 3RYIA 4LNUA 4X1YB 1X4TA 2F1MA 3SJAC 4JI7B 5ITZA 5FPOA 2F4VB 4TQFA 4B08A 3JSLA 1HW7A 5CA1B 3N2KA 2F95B 2JS5A 2KKWA 4K0KB 3U11A 3RYCB 1J5EB 4EFBA 2OWOA 4I50A 4NVPA 3JATA 3JASA 3THOA 1SA0B 3HKEA 2GV9A 2VWJA 4IIJB 4B3MB 4LNUB 4FLWA 5FNVB 5KHGA 4DK1A 2F66C 1Z5WA 4LF9B 3VQXA 1I7FA 4EFEA 5JVDA 4JI8B 3BA8A 4O4IB 3N2KB 4L8JA 5KMGA 2Q7HA 2YXLA 3HKCA 5IYZA 2ZM6B 4DR1B 2JVDA 2QJ1A 3BPZA 5LOVA 4I50B 5J2TA 1Q5OA 3JASB 5KHHA 3CHXA 3PN1A 3HKEB 4LF6B 2P22C 5KHKA 4CS4A 2UU9B 2OYQA 1SQFA 4DR6B 4O2BA 4DV2B 3BA9A 4NXNB 3HKDA 3T1HB 4CH5A 5KX5A 5JVDB 1NT2B 4BWAA 4DV7B 5KMGB 3RFRA 4DR5B 2XHBA 1JFFB 4U3JA 5FPRA 5LOVB 4YJ2A 1XMOB 5J2TB 1VF7A 1V9PA 4FM1A 5KHIA 5EYPA 3JALB 2P5OA 4GLXA 4X64B 4LF8B 4X1IB 1QQCA 4PI0A 3M7MX 4ZHQA 3HKDB 4LF4B 1TUBB 4I55B 5KX5B 3E22A 2PGGA 2Q7EA 2BTOA 1YEWA 4FFBB 4FLYA 3FFQA 3WB0A 4U3JB 3RYCA 4HNAA 1TA8A 1XMQB 4YJ2B 4DV4B 4K8XA 4KHPB 1O9HA 1SA0A 2YI9A 4DR2B 4X20A 4TV9A 4IIJA 2IM9A 2VWKA 2PUSA 5FNVA 1WN7A 5EZYB 4ZHQB 3BRCA 5BMVA 3LNNA 3E22B 4FLZA 1N36B 2HHHB 4DK0A 4O4IA 3OTOB 1L8DA 1N33B 4K8ZA 4LH7A 1KMIZ 4HNAB 1XHXA 2ZINA 5D5QA 5EIBD 4D7TA 4X1KB 3WB2A 4X20B 4TV9B 4DV0B 2VQEB 1Q8IA 5JH7B 1RSOA 3RYHB 4F6RB 5D5PA 3JAKA 4FLUA 4B3TB 4TV8A 3BABA 4AILC 5LYJA 3WB1A 2HEPA 5BMVB 4DV5B 3VQYA 2RQ6A 4YJ3A 2ZNIA 4TQDA 4CH3A 4UCOA 1N34B 1JFFA 4TUYA 5LA6A 4O4JB 5GONB 4UCVA 4OX9B 4DR3B 4DR7B 4DV6B 2PY5A 3JALA 4GYCB 1M5IA 4X1IA 5J2UB 4JI3B 4HBNA 4FM0A 4UFZA 2R72A 5LP6C 5LXTA 3K5NA 1Q43A 4TOIA 1WNSA 3JAKB 4CH4A 5IJ9A 3UT5A 3UQ8A 4TV8B 4EB6B 5LYJB 4LF5B 2PYLA 1H2SB 1TUBA 4I55A 3N2GB 3VQVA 1S5JA 1P49A 4JI0B 4YJ3B 2ZIOA 1XNRB 4YHHB 4CS3A 4FFBA 1B04A 3QTCA 2PTMA 4TUYB 4Q6GA 5LA6B 5K1XA 3JAWA 4O4LA 5LMUB 4D7SA 1QHTA 5LMNB 4CC6A 1JJOA 4B3RB 4JI5B 5IJ0B 5CB4A 4YY3B 4UCRA 1TAEA 1HNXB 5LXTB 1Q3EA 5IJ9B 4CS2A 4ZI7A 5EZYA 3UT5B 5KHJA 4FLTA 3RGBA 4PHZA 4O2AA 5JQGB 3U0ZA 4DUYB 2YI8A 2UUBB 2RJZA 3ZEDA 4NXMB 2YIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q7G A;  2R72 A;  2HEP A;  1O9G A;  2YIB D;  3DSQ A;  3VQW A;  3VQY A;  4CH4 A;  4CS4 A;  2RQ6 A;  2ZNI A;  1O9H A;  2Q7H A;  2YI9 A;  2YIA A;  2ZNJ A;  4CH5 A;  4CH6 A;  2ZCE A;  4TQD A;  4CH3 A;  3VQV A;  4BWA A;  2JVD A;  4CS2 A;  2ZIN A;  2E3C A;  2QJ1 A;  5K1P A;  2ZIO A;  2PUS A;  4CS3 A;  2PGG A;  3QTC A;  4Q6G A;  2Q7E A;  4ZIB A;  2YI8 A;  5K1X A;  4TQF A;  3BHP A;  2RJZ A;  1G6U A;  2ZIM A;  4BW9 A;  3ZED A;  2R70 A;  3VQX A;  2YIB A; 
#chains in the Genus database with same CATH topology
 4DUZ B;  1GTO A;  1HDJ A;  3JAW B;  3QO8 A;  1HNX O;  3W7X A;  1FFX A;  4WCE V;  5KA6 A;  4KL1 A;  4GX5 A;  4J9Z B;  3A8T A;  3R66 A;  2QDO A;  3BAA A;  3RYH A;  4F6R A;  4RUE A;  2UXB B;  2UUB O;  1S3J A;  3KCY A;  1AI6 A;  3JSN A;  3R65 A;  4DUZ O;  2Q9L A;  4BAY A;  4DO2 A;  5IDJ A;  3EHB B;  3K59 A;  3DSQ A;  3U10 A;  3ABL B;  2E75 B;  1US6 A;  4MW8 A;  3K5O A;  3TJT A;  4IGG A;  3RYF B;  1AR1 B;  2UXB O;  2EJR A;  4U3F H;  3N27 A;  4MVU A;  3OM3 B;  3J80 N;  4LFC B;  3JD4 A;  4MTO A;  5B3S C;  1WB8 A;  1NR7 A;  4GKK B;  2P90 A;  2ZQM A;  1AI7 A;  4I0X B;  2F43 G;  4JYC A;  1VQ4 V;  4EB6 A;  4PA6 A;  1AIL A;  2NN4 A;  2FYU H;  1N0N A;  3FAV B;  3N2G A;  2Z3Y A;  1F4N A;  2YID A;  1LUW A;  3ZMV A;  3JAR A;  2GDS A;  2YXY A;  2ZCE A;  2EZP A;  4GKK O;  5K1P A;  5L3G A;  3CP1 A;  5CA0 B;  4R7C A;  1YI2 V;  2DYR B;  2P6J A;  2ZDI C;  1VQ9 V;  1I94 B;  3A2F A;  1XQ8 A;  2H3O A;  3FYI B;  3MAQ A;  4DR4 B;  2PI4 A;  1S77 D;  3SPC A;  1YTF D;  2EIN C;  4FK5 C;  4XDK A;  1YXB A;  1TVK A;  1I94 O;  1FYJ A;  2V1D A;  3QO7 A;  2CE4 A;  3AG4 C;  3OT7 A;  1EFR G;  4LFA B;  3FX7 A;  3K58 A;  4ZOL A;  4DR4 O;  4BIO A;  2WLJ A;  1Z5V A;  2HFE C;  1N32 B;  4DW1 A;  3K5M A;  3SJC C;  3T1Y B;  3E83 A;  3E8B A;  3OW2 U;  1YCI A;  4YHH O;  5A2Q N;  4J41 A;  3ZRV A;  5IYZ B;  4KXR A;  4LFA O;  4GX1 A;  3HKB A;  4FIP C;  2YEV B;  5JJJ B;  4DV3 B;  3ETQ A;  1N32 O;  1IUR A;  2BOB C;  3M8A A;  4K35 A;  3T1Y O;  4UB8 Z;  3OUS A;  4O2B B;  3CCJ V;  2UUA B;  3EVK A;  2K1E A;  1AR5 A;  3ZHT A;  2E3C A;  1EN4 A;  2JIZ G;  1WP8 A;  3FB7 C;  5H9C A;  3T4D A;  4DV3 O;  2FB5 A;  2E5L B;  2V7Q G;  1XHZ A;  1WA8 A;  2UUA O;  4OGQ B;  2Q69 A;  1RM1 C;  5EBL C;  4X1Y B;  1X4T A;  2E5L O;  4F4L A;  1URF A;  5KAF Z;  3ML0 A;  2F4V B;  4QNH B;  3STL C;  4X9Q A;  1NH2 D;  1HW7 A;  3N2K A;  2F95 B;  2JS5 A;  4QE9 A;  1NZ6 A;  3OFN G;  1NS1 A;  2JS3 A;  1J5E B;  1NTM H;  4EFB A;  1G8M A;  3W7W A;  3CXC U;  2WLK A;  3ZRS A;  3OMN B;  1FXK C;  4NVP A;  1RPO A;  4J9Y B;  3SJQ C;  2F4V O;  4C7U A;  1OCZ C;  3OGI B;  4B3M B;  4LNU B;  3HR0 A;  4JTA B;  4LF9 B;  1Z5W A;  3ZHS A;  1BQZ A;  1J5E O;  2QKC A;  3QO5 A;  2LQT A;  4W4L A;  3KCX A;  1BL8 A;  4WF9 V;  3OR6 C;  2OCH A;  5KMG A;  2YXL A;  1K34 A;  1P7G A;  3ETD A;  1YDX A;  2ZM6 B;  4DR1 B;  2HVJ C;  1H8H G;  2QWR B;  4LWS A;  3CC4 V;  3DGE A;  4B3M O;  5J2T A;  1MA1 A;  4LF9 O;  5KHH A;  3H1L H;  3CCL V;  1VQO V;  3PN1 A;  3HKE B;  4ZBM A;  1OCR C;  2Z0A A;  5B66 Z;  4LF6 B;  1JPX A;  2JEU A;  1JVM A;  2UU9 B;  2WLI B;  3SDL A;  2ZM6 O;  4DR1 O;  3T1H B;  4CH5 A;  1M56 C;  2ZR2 A;  1NT2 B;  4DV7 B;  1ZL8 B;  2A79 B;  1SES A;  2GSM B;  2XHB A;  4U3J A;  2ZKO A;  2JGD A;  4LF6 O;  1V54 C;  2UU9 O;  4X62 O;  2YSU B;  5C93 A;  1XMO B;  3K06 A;  1K97 A;  4FM1 A;  3T1H O;  2P5O A;  5B1A C;  3TCU A;  3ZRX A;  1PNL A;  1JCH A;  4DV7 O;  2HKO A;  2QR4 A;  3HKD B;  1YVW A;  3CD6 V;  1P4R A;  4I55 B;  4JAU A;  5KX5 B;  1VQ8 V;  3E22 A;  1K4D C;  2PGG A;  1XMO O;  2M7W A;  2Q5Z A;  3DTU B;  2BTO A;  3ABM C;  4FFB B;  4U7N A;  3RYC A;  2CK3 G;  1FXH A;  3ZMU A;  1SA0 A;  3KKY A;  4X20 A;  1NVP D;  4K3A A;  4QJF B;  3TXS A;  4H13 B;  1WN7 A;  4WFH A;  2NNU A;  5EZY B;  4ZHQ B;  3LNN A;  3B4S A;  2HHH B;  1XBL A;  2EJ7 A;  2W6J G;  3OTO B;  1L8D A;  3ZJZ A;  4K8Z A;  1UFI A;  2DW4 A;  2XAH A;  5LGN A;  3F5W C;  1YTF B;  1SRY A;  1XL6 A;  3CRM A;  4TV9 B;  3TK1 A;  4DV0 B;  2LGQ A;  3RYH B;  4F6R B;  2HHH O;  3OTO O;  4JTD B;  3JAK A;  3OR7 C;  4FLU A;  4B3T B;  3X2Q B;  3F7Y C;  3WB1 A;  2ILM A;  4BIU A;  1DK1 A;  3E35 A;  2RQ6 A;  2ZNI A;  4TQD A;  4GX0 A;  1JFF A;  4DV0 O;  1PD3 A;  2P67 A;  4XBF A;  4UCV A;  3K0D A;  4B3T O;  3CCU V;  2N04 A;  1RP3 B;  4DV6 B;  2PY5 A;  1A32 A;  1PKX A;  3MD0 A;  3CRA A;  2BCC H;  2DN9 A;  5HFM A;  3EFF K;  5GTH Z;  3UQ8 A;  4MVZ A;  3P3N A;  4EB6 B;  1H2M A;  3O65 A;  1H2S B;  1TUB A;  3N2G B;  2F23 A;  1S5J A;  1M57 C;  4YJ3 B;  2ZIO A;  5IYD O;  4DV6 O;  3G67 A;  3IGA C;  5K1X A;  2ADQ B;  2Y4T A;  3RVY A;  4D7S A;  1QHT A;  2Y0I A;  1W0J G;  4P2Z A;  3UO2 A;  2GTA A;  4YY3 B;  3A0R A;  5H6R A;  1PNK A;  5IJ9 B;  4ZI7 A;  5KHJ A;  4PHZ A;  4O2A A;  1MSD A;  1CXZ B;  5GW7 A;  5KAI Z;  2BSK A;  4DUY B;  1OHH G;  1SF9 A;  3EXA A;  2YI8 A;  3L70 H;  2WLN A;  2OCC C;  2RJZ A;  1VF6 A;  4NXM B;  1G1X B;  1K4C C;  1GO3 F;  2QSA A;  4YY3 O;  4O4L B;  2KG7 A;  4ZOL B;  3JD3 A;  1KU9 A;  1QVG U;  2NLJ C;  1OV9 A;  2ZXW B;  2A0L A;  1ORQ C;  4DUY O;  5JH7 A;  2CH7 A;  1K7D A;  2ZE5 A;  1BE3 H;  5CB4 B;  3KZI Z;  2FL4 A;  4O4H A;  4JI4 B;  2CTP A;  3ETE A;  3ABK C;  1IBK B;  3RW0 A;  2KQX A;  1R3J C;  3HKB B;  4EEQ A;  2QM4 A;  2XAQ A;  4R50 A;  2W0X A;  4I4T B;  2QM7 A;  2BTQ A;  4JI4 O;  3SJB C;  2EIJ C;  1SZX A;  4RUF A;  4UV8 A;  1VQN V;  1HR0 B;  3P32 A;  1H8E G;  4TSF G;  5JJN B;  2Y0P A;  4B7E A;  2XND G;  4IYH A;  3P30 A;  3ZN1 A;  2ZNJ A;  2HR3 A;  3FYE B;  1HWY A;  4I9Q A;  4LF7 B;  1HR0 O;  4JGS A;  4FM2 A;  2K9P A;  1VQ6 V;  4LFB B;  2H94 A;  4JYA B;  2JJ1 G;  5IJ0 A;  2PZS A;  1VQP V;  1KUQ A;  4QIW F;  1D5A A;  5FLX N;  4LF7 O;  1ZAU A;  4FZ0 A;  2LGW A;  1I5Y A;  3W7S A;  4JI2 B;  1Q86 W;  5EIB C;  2RNB A;  1FJG B;  4LFB O;  4GZR B;  4B3S B;  5B3S B;  4JYA O;  4JTC B;  2QWQ B;  1K3E A;  1R3L C;  1Y74 A;  3CB2 A;  5C8Y A;  1QU7 A;  2IJK A;  2CAZ C;  3CSX A;  2R70 A;  3BCC H;  4GCZ A;  1XNQ B;  4ICG A;  1IBL B;  4JI2 O;  1MG1 A;  4GKJ B;  2FTK A;  3CCS V;  1FJG O;  3CYO A;  1EBO A;  4B3S O;  4YIO A;  3TGU H;  4FLV A;  2F93 B;  1N8R W;  4HYO A;  2DQ3 A;  3OUF A;  5JJE B;  1EN5 A;  4MVS A;  2A3Q A;  1IZ3 A;  3SPJ A;  3T4Z A;  4MSW C;  1SQG A;  1XNQ O;  3ETG A;  4G27 B;  1S72 V;  1IBL O;  2ARH A;  3SYP A;  2CDY A;  2EIK C;  2Q7G A;  1FD9 A;  3ZMT A;  4GUN A;  4PEL A;  2PYJ A;  1CEZ A;  4X66 B;  2EIN B;  1Y76 A;  4IHJ B;  3S3W A;  3LSQ A;  4WBN B;  2IW5 A;  1SQP H;  3G4S V;  2WAM A;  3B2E E;  2FML A;  2ODM A;  4G2K A;  3QF7 A;  5JWP A;  3AG4 B;  3ASN C;  2XAJ A;  2A06 H;  2JGD B;  1SER A;  1NKD A;  4E4E A;  1L1F A;  3TET A;  1AI5 A;  4UCU A;  1AVM A;  5DN6 G;  4KP4 A;  3OTF A;  3ZS8 C;  3I56 V;  4LBE C;  1FKA O;  2W0F C;  2F1M A;  1WPX A;  3SJA C;  4JI7 B;  2WPD G;  2GUZ A;  2O57 A;  4B08 A;  3MDS A;  2WA4 A;  2JDI G;  5CA1 B;  3OAA G;  2DMX A;  2KKW A;  4N21 A;  3RYC B;  1OCO C;  2KB1 A;  3CJH A;  1PNM A;  4H37 A;  3Q4H B;  4LFC O;  4JI7 O;  2AZ2 A;  1H2K A;  1PL4 A;  1SA0 B;  3JYC A;  1GN4 A;  1IVS A;  1BS3 A;  5IT9 N;  3MHH C;  3MHS C;  2LJ2 A;  5IY5 C;  2F66 C;  3OMI B;  1DF5 A;  3VQX A;  3CC7 V;  4JI8 B;  1DTO A;  3BA8 A;  4L8J A;  3G6B A;  4PDV A;  2L35 A;  4W4K A;  2ZD9 A;  1F7Y A;  2QJ1 A;  1RM1 B;  4I50 B;  1QLE B;  1S76 D;  3H01 A;  3ZBH A;  4EKW A;  1GN3 A;  3JAS B;  3CHX A;  1JX9 A;  3JAM N;  3D8C A;  2P22 C;  4JI8 O;  2OYQ A;  1SQF A;  1GRJ A;  5HFL A;  3UM7 A;  2LFR A;  5LGT A;  1D2D A;  3AG7 A;  5JVD B;  1FXK B;  1OZ0 A;  2MK3 A;  4BWA A;  4FZ1 A;  4YIP A;  1JFF B;  2ATK C;  1OCZ B;  1AP6 A;  2M6Y A;  5LOV B;  5EYP A;  4GLX A;  4LF8 B;  4QE7 A;  3HB3 B;  1IXB A;  1FS0 G;  2R9R B;  1K5S A;  3AK3 A;  3M7M X;  4H44 B;  2YC0 A;  3ZRW B;  3BEH A;  5EC1 C;  1MAB G;  1TUB B;  4WFF A;  2IJH A;  1PV0 A;  1W0K G;  4MVR A;  3L9D A;  3IC7 A;  1VQ7 V;  2EIM C;  1OCR B;  2XT9 A;  4LF8 O;  4HNA A;  4YJ2 B;  2XAG A;  4K8X A;  1KP3 A;  4KHP B;  2YI9 A;  2XAF A;  4L87 A;  1J95 A;  2ZT9 B;  1M56 B;  4IIJ A;  3CPW U;  2FKX A;  2IM9 A;  1QLE C;  4LCU C;  1V54 B;  3BRC A;  5BMV A;  2BSK B;  3ZIA G;  3AG2 C;  4O4I A;  3L71 H;  4KHP O;  5B1A B;  3UO3 A;  4JYY A;  4J11 A;  4XDJ A;  3CCQ V;  3BY6 A;  3A0H Z;  5EIB D;  2IU3 A;  4D7T A;  4MVO A;  3WB2 A;  1R6N A;  1SS3 A;  1QCE A;  5JH7 B;  1RSO A;  2CH7 B;  1BMF G;  5CA3 A;  5D5P A;  3QVN A;  1U96 A;  5B1B C;  3ABM B;  3K3W A;  1VMG A;  3WG7 C;  2HEP A;  3JCZ A;  3SPG A;  1R3I C;  4CH3 A;  4UCO A;  3ZHU A;  4OPA A;  1TUE B;  2LFS A;  1GN2 A;  1OCC C;  3K04 A;  3FKS G;  3WFV A;  5EK0 A;  3L75 H;  1W2B U;  1S5L Z;  3ZHR A;  1AI4 A;  1FFT B;  3AG1 C;  2WSS G;  4MTG A;  4UFZ A;  2R72 A;  5LP6 C;  2ZE7 A;  4PDL A;  3K5N A;  5BY1 A;  1Q43 A;  4TOI A;  4CH4 A;  3H1K H;  3APO A;  3UT5 A;  4TV8 B;  5LYJ B;  1S5H C;  4LF5 B;  3D36 A;  4RQF A;  2IH3 C;  5LBQ A;  2NR5 A;  3L73 H;  1P49 A;  4UB6 Z;  3AK1 A;  1KEC A;  4WFE A;  1RPR A;  4TUY B;  4JAS A;  2H8P C;  5LA6 B;  3H1J H;  3JAW A;  5LMN B;  4JZ2 A;  1VF6 C;  1H2G A;  4B3R B;  4LF5 O;  5IJ0 B;  2P06 A;  3GB7 C;  1TAE A;  4UCR A;  1DLB A;  5LXT B;  2WLM A;  1Q3E A;  4CS2 A;  1MOF A;  2DJV A;  4FLT A;  4CZZ A;  1YJW V;  3U0Z A;  5A9G A;  1ZUQ A;  4RQE A;  2ADP A;  5LMN O;  1MNG A;  1R73 A;  3ZED A;  4B3R O;  1I0H A;  1YIJ V;  4WFB V;  3RYF A;  4MVM A;  3DC5 A;  3SYA A;  4XDL A;  1O9G A;  3K5L A;  1M93 A;  1GH6 A;  2YIA A;  1WPB A;  2Z5U A;  1M4U A;  4X1K A;  1SQB H;  3OE7 G;  3T1C A;  2X6C A;  4Q20 A;  2AW9 A;  1M57 B;  4I0X A;  2Q68 A;  1P7B A;  2XAS A;  1EZJ A;  1HNW B;  1GN6 A;  1DGS A;  1XIL A;  3K0G A;  2Y69 C;  2P4V A;  4PDM A;  1XDC A;  4NTY A;  4O4J A;  5CA0 A;  1LNQ A;  5GON A;  5J9P C;  5KUK A;  1FFX B;  5FL7 G;  1HNW O;  1ZTE A;  1Y76 B;  5BR8 B;  4AHC A;  2QKA A;  4LH6 A;  4GX2 A;  4BW9 A;  2OCC B;  2ITD C;  4ZKI A;  2V4D A;  3ICX A;  1QR8 A;  3ABT A;  5B5E Z;  1FPO A;  5IE9 A;  4J80 A;  2D2C B;  1SQX H;  3RN4 A;  3CCE V;  5BR8 O;  4JV5 B;  5L3C A;  5B1N A;  4UVB A;  2VQF B;  3G6E V;  1QLN A;  3ABK B;  1G6U A;  1WB7 A;  2GUZ B;  3FD9 A;  4J10 A;  4X65 B;  5IWA B;  3SYQ A;  4H0L B;  1ROP A;  4FLX A;  1NTZ H;  2UXC B;  3K9A A;  5E1A C;  1SKV A;  1XOU A;  1LR1 A;  4JAV A;  3C3S A;  4P9P A;  3SYO A;  4G28 B;  4UCS A;  2VQF O;  4CC5 A;  2W6I G;  3JAR B;  4E2L A;  2EIJ B;  5LHG A;  1Y4M A;  2D3O W;  4ZIB A;  1WP7 A;  5IWA O;  4X65 O;  5LP6 A;  2AZ0 A;  2UXD B;  2UXC O;  1KD1 W;  4ABM A;  3PJS K;  3RWR D;  5CBG A;  1H2L A;  3B09 A;  1IBM B;  1JOY A;  3E8G A;  1GMG A;  1FXV A;  4NYK A;  4HAM A;  1GK9 A;  4PI2 A;  5JCO A;  1GM9 A;  3CXH F;  3BHP A;  1COW G;  2UXD O;  1K8A W;  1GAX A;  4LC1 A;  2CTR A;  1SZT A;  5DED A;  1TVK B;  1KKC A;  1NH2 B;  3QNE A;  3CE2 A;  4UCT A;  3SGI A;  1IBM O;  3QG5 A;  4AQY B;  4IYI A;  1UPG A;  1AJN A;  4I7Z B;  4JI1 B;  4X1Y A;  2N05 A;  2WLL A;  5LGU A;  3UCS C;  1AR4 A;  3GVM A;  1BCC H;  4MW3 A;  3SPI A;  3APQ A;  3A0B Z;  4FVM A;  2HLD G;  4NXM O;  5KLV H;  2JRI A;  2UXN A;  2X7R B;  2Q73 A;  4AQY O;  4JI1 O;  2A9H A;  1R6K A;  3VQW A;  3D3Q A;  4DRX A;  2CTQ A;  1K33 A;  5EYP B;  3DXR A;  3RT3 C;  4RO2 A;  4TT3 G;  2YXH A;  3ASO C;  1T5E A;  2Q0A A;  3RYI A;  3CRC A;  4LNU A;  4Z2W A;  1N4C A;  1Q90 D;  3G71 V;  5ITZ A;  5FPO A;  1IBK O;  1YF2 A;  3LSU A;  2HP8 A;  4TQF A;  3CCV V;  2YS8 A;  4JZG A;  2BOC C;  3B8N A;  1HP8 A;  4K0K B;  3LDC A;  5EBM C;  5IYB O;  2EIK B;  1ZX3 A;  4JPR A;  3CRQ A;  3D3I A;  1WA8 B;  4DYL A;  3W7U A;  2OWO A;  2JEX A;  3JAT A;  3THO A;  1GKF A;  5BZB A;  3HKE A;  4IIJ B;  5H2F Z;  4FLW A;  5KA5 A;  4MS2 A;  4K0K O;  3ASN B;  2WLI A;  1Q7Y W;  1Q6H A;  4BR6 A;  2WLH A;  1I7F A;  4O4I B;  3N2K B;  2WA3 A;  2DOS A;  2Q7H A;  1I08 A;  1ZL8 A;  3HKC A;  2YUA A;  1VF5 B;  1BZK A;  1M90 W;  2DQ0 A;  1VQL V;  3JD2 A;  5IYC O;  3SPH A;  2EBO A;  3K9S A;  2BE3 A;  1BT8 A;  4CS4 A;  1RSO B;  4F6E A;  4I5S A;  4DR6 B;  3H1H H;  1V55 C;  5DEC A;  3BVO A;  4NXN B;  2X6B A;  3ZHV A;  3HKD A;  1OCO B;  2UXX A;  4KUM A;  5KX5 A;  2L6L A;  2B1I A;  1NVP B;  5KMG B;  3AG3 C;  5FPR A;  4NTX A;  5IY5 B;  1L0N H;  1PP9 H;  4LWS B;  5DM6 V;  1DF4 A;  5J2T B;  4DR6 O;  1VF7 A;  1WJZ A;  1V9P A;  4NXN O;  5KHI A;  3UKM A;  4X64 B;  1KQS U;  4GKJ O;  3ZN0 A;  1VQM V;  3E8F A;  1QQC A;  5B1O A;  3CMA V;  3LDE A;  1Y67 A;  4ZHQ A;  4LF4 B;  2DYS C;  2ZE8 A;  2Q7E A;  1RFY A;  4HZ3 A;  2E74 B;  1YEW A;  4FLY A;  2EIL C;  4X64 O;  2Q0O C;  4U3J B;  2QTS A;  3E86 A;  1NTK H;  1XMQ B;  1O9H A;  4DR2 B;  4X66 O;  4LF4 O;  1MZF A;  4TV9 A;  3CCM V;  3CC2 V;  1E79 G;  2OT5 A;  3VBB A;  2ZR3 A;  5FNV A;  2JJ2 G;  3E22 B;  4FLZ A;  5L3E A;  1XMQ O;  1N36 B;  1NR1 A;  1VAR A;  4DK0 A;  5CBF A;  4DR2 O;  3RBZ A;  2B9Z A;  4LH7 A;  2P7T C;  2B5U A;  2ZIN A;  4X1K B;  1IXM A;  4X20 B;  1BGY H;  1N36 O;  1LUV A;  3OEH G;  3OGC C;  3CEI A;  2MW2 B;  2EIM B;  3BAB A;  1K5Q A;  1XEQ A;  3VQY A;  1QNM A;  1B6Q A;  4YJ3 A;  4CBC A;  4OPH A;  4O4J B;  5CBH A;  3B40 A;  3D36 C;  2JK5 C;  5GON B;  4DR3 B;  1QBZ A;  3JAL A;  1M5I A;  4X1I A;  2CGN A;  3AG2 B;  4FM0 A;  4PD4 F;  3JAK B;  5IJ9 A;  3ZMS A;  2PYL A;  1K73 W;  3VQV A;  4NB5 A;  4DR3 O;  2YIC A;  4JI0 B;  4YHH B;  4CS3 A;  1B04 A;  2GTS A;  2PTM A;  2CTW A;  3DC6 A;  1Y66 A;  4O4L A;  5LHI A;  2QA4 V;  1OJH A;  5B1B B;  2OTJ V;  4P30 A;  4CC6 A;  1YHQ V;  3WG7 B;  3ABL C;  1YJ9 V;  4JI5 B;  4R6Z A;  4AI8 A;  5CB4 A;  1P84 F;  4JI0 O;  2RN9 A;  1Q82 W;  4MTF A;  4UV9 A;  1OCC B;  4PA7 A;  1N0J A;  2CGO A;  2P4K A;  2X6A A;  3AK2 A;  2YIB A;  4JI5 O;  3CCR V;  3AG1 B;  4I4T A;  3TXQ A;  1CPY A;  5LP6 B;  1MMM A;  2B1G A;  1UJW B;  1SQV H;  1B3Q A;  4JI6 B;  1S0V A;  4J7J A;  1AB3 A;  3K79 A;  4LR3 A;  1Q6U A;  2DYR C;  3K03 A;  4ZI7 B;  4FJC C;  4UUJ C;  4O2A B;  1XI1 A;  3E8H A;  1PPJ H;  3HPL C;  5H5N A;  4P9O A;  3JD0 A;  4DXW A;  4JI6 O;  1B06 A;  3H1I H;  4Z1V A;  1ZLZ A;  2KG7 B;  4PJ0 Z;  1SQQ H;  4KFM A;  2QGN A;  2WLL B;  2AGA A;  4NKG B;  2CUG A;  5J2U A;  1NJI W;  2ZIM A;  5EC2 C;  4O4H B;  3IFX A;  1R6T A;  1HNZ B;  2OTL V;  3FB6 C;  1EN6 A;  3LDD A;  2LP7 A;  4DRX B;  1Q81 W;  1X59 A;  3RVZ A;  3DXR B;  2EX3 A;  1BHB A;  3B8M A;  1IX9 A;  4PDR A;  1Y6X A;  1U97 A;  3RYI B;  1E1Q G;  2BTQ B;  4DV1 B;  2HG5 C;  5ITZ B;  1ZSP A;  1HNZ O;  3VOU A;  1GM8 A;  3IAY A;  2Y69 B;  4DW0 A;  2YIB D;  1BSM A;  1WAZ A;  3OD4 A;  5JQG A;  2JGU A;  2R9A A;  4DV1 O;  3JAT B;  4J42 A;  2ZDI A;  3C3T A;  5KUM A;  1KYO F;  2LO1 A;  4JF3 A;  3SR2 C;  2EUL A;  5LHH A;  2LW1 A;  1SC5 B;  2ETN A;  4X62 B;  2QTO A;  2VRZ A;  5JCO C;  4WFA V;  2UUC B;  2IBZ H;  3LNM B;  3NR7 A;  4RWU A;  4MVQ A;  4QGP A;  4IHJ A;  1NBM G;  4WBN A;  3ZX6 A;  3LSS A;  2Q8V A;  1XL4 A;  3HKC B;  3FB8 C;  4IT5 A;  2QWN B;  2RMK B;  3S3X A;  4YXW G;  2UUC O;  2DWD C;  4J7K A;  1TGO A;  2RCV A;  1Y74 B;  5C8Y B;  3IJ4 A;  1AP5 A;  3CRR A;  1Z2G A;  4UXN A;  1GM7 A;  4CH6 A;  4QPJ A;  2DWE C;  1KC8 W;  1EZV H;  5CA1 A;  2QKS A;  3G80 A;  2QM8 A;  1JMK C;  1MSW D;  3JCU Z;  1VEW A;  3FAV A;  1F23 A;  5L3F A;  3K57 A;  2AHZ A;  3Q4H A;  1VQ5 V;  5AG2 A;  4D6T H;  2G38 A;  4UVA A;  1I5X A;  1AJP A;  1JA8 A;  3OEE G;  1KKD A;  1AJQ A;  3JSL A;  4FMT A;  2YDE A;  3U11 A;  2XTA A;  3NXS A;  4I50 A;  2QWP B;  1CP9 A;  4OXS A;  3JAS A;  4LP8 A;  4X88 A;  5CN0 A;  2R9I A;  1JJ2 U;  2HJD A;  2GV9 A;  4R8C A;  5EBW C;  2VWJ A;  4N23 A;  1PM9 A;  4NR1 A;  5FNV B;  5KHG A;  4DK1 A;  2IJI A;  1XRE A;  2N74 A;  4EFE A;  4X89 A;  2IU0 A;  5JVD A;  1FXK A;  2Q4P A;  4MTX A;  3J7A U;  4JV5 O;  5IYZ A;  1NU1 H;  3ASO B;  2JVD A;  4PV1 B;  3BPZ A;  3CJH B;  3O9O A;  5LOV A;  2HVK C;  2IH1 C;  4MT8 A;  4BW5 A;  2YEV A;  1Q5O A;  4I9W A;  4FPP A;  4IL6 Z;  1ZWI C;  1MZE A;  5E79 Z;  5KHK A;  4FFK A;  4O2B A;  4DV2 B;  3BA9 A;  3JD1 A;  3ZRW A;  3H9V A;  1G4Y B;  3WU2 Z;  2PF4 E;  1JR9 A;  4BIZ A;  3RFR A;  3AEI A;  1KBH A;  4DR5 B;  1K9M W;  2XUM A;  3C90 A;  1F51 A;  2VS0 A;  4QPK A;  4J7Z A;  5F2V O;  4YJ2 A;  2A7W A;  4DV2 O;  3GWO A;  4NTW A;  3F7V C;  1QVF U;  1VP7 A;  3JAL B;  3F5T A;  2GBO A;  4X1I B;  4PI0 A;  3W7T A;  1YJN V;  3I55 V;  2AXT Z;  2Q6A A;  4DR5 O;  5L3B A;  5TIS Z;  3I5D A;  2EZO A;  1WLE A;  4WFG A;  3J81 N;  4X8A A;  2IJJ A;  3GWK C;  2Y48 A;  3FFQ A;  3WB0 A;  3X2Q C;  3CWB H;  3OMA B;  1H2N A;  1M9N A;  1TA8 A;  4PA3 A;  2QWO B;  5CMU A;  1V55 B;  4GT1 A;  4DV4 B;  2AHY A;  1W59 A;  1SET A;  1K92 A;  1NI8 A;  2Q67 A;  3CS5 A;  1E1R G;  1L0L H;  1NQT A;  3STZ C;  2VWK A;  2PUS A;  2Y4U A;  3AG3 B;  1R3K C;  5GTI Z;  1YIT V;  4RAI A;  1KB9 F;  1Q6I A;  1YSC A;  3SYC A;  3ZHQ A;  4DV4 O;  1N33 B;  1VIB A;  3E2E A;  4ASU G;  1KMI Z;  4JYB A;  5LL6 Y;  2C2A A;  2RDC A;  4HNA B;  1VQK V;  2DE0 X;  1BQ0 A;  1XHX A;  5D5Q A;  4U7O A;  3IC9 A;  2DYS B;  3B77 A;  5BXZ A;  1R1B A;  2VQE B;  1Q8I A;  1FAF A;  1YZB A;  4Z1M G;  2OIG A;  1N33 O;  1H38 A;  2EIL B;  5L3D A;  4TV8 A;  4B7K A;  2XOK G;  5LYJ A;  4AIL C;  1PL0 A;  3ZMZ A;  5BMV B;  4DV5 B;  4UVC A;  3ABU A;  2LW7 A;  1BHA A;  1N34 B;  4PA4 A;  4TUY A;  5LA6 A;  2OIE A;  1THZ A;  2VQE O;  2GHY A;  2ITC C;  3M99 B;  4TWK A;  4OX9 B;  4DR7 B;  1D5N A;  2KSD A;  4GYC B;  1ENV A;  4A5U B;  4DV5 O;  1IDS A;  1KP2 A;  5J2U B;  4JI3 B;  3T2M A;  4HBN A;  5LXT A;  1WNS A;  1N34 O;  1QR9 A;  2ZXW C;  4I55 A;  4OX9 O;  4DR7 O;  4JAA A;  1XNR B;  3CX5 F;  3L74 H;  4FFB A;  1XUQ A;  3QTC A;  5H6Q A;  4Q6G A;  1JQ0 A;  1ARO P;  3K08 A;  3L72 H;  2E76 B;  4JI3 O;  2QE7 G;  5LMU B;  1JJO A;  3P3P A;  3CME V;  2HJF C;  2QEX V;  4PA9 A;  3KG2 A;  3ZCC A;  2ZE6 A;  3BFR A;  1HNX B;  1XNR O;  2PI5 A;  5EZY A;  3LUT B;  3UT5 B;  3RGB A;  2X0L A;  5JQG B;  3E89 A;  4H33 A;  1F4M A;  1M1K W;  1EM1 A;  2WWW A;  5LMU O;  2UUB B;  3FB5 C; 
#chains in the Genus database with same CATH homology
 3RYF A;  4I4T A;  4DUZ B;  1O9G A;  3JAW B;  1M93 A;  4O4L B;  5LP6 B;  3K5L A;  4ZOL B;  1FFX A;  1KU9 A;  4KL1 A;  2YIA A;  1WPB A;  1M4U A;  4X1K A;  4JI6 B;  5JH7 A;  3BAA A;  3RYH A;  4F6R A;  5CB4 B;  2UXB B;  4LR3 A;  4O4H A;  4JI4 B;  3JSN A;  4ZI7 B;  1HNW B;  1IBK B;  4O2A B;  1XI1 A;  1DGS A;  3HKB B;  4EEQ A;  3K59 A;  2QM4 A;  3DSQ A;  3U10 A;  3K5O A;  4O4J A;  3RYF B;  4I4T B;  5CA0 A;  5GON A;  2BTQ A;  1FFX B;  3SJB C;  4LFC B;  1HR0 B;  5BR8 B;  4GKK B;  4AHC A;  5J2U A;  4LH6 A;  5JJN B;  2ZIM A;  4BW9 A;  4O4H B;  2V4D A;  3ICX A;  4EB6 A;  1HNZ B;  3N2G A;  2ZNJ A;  3JAR A;  2ZCE A;  4DRX B;  4I9Q A;  4LF7 B;  4JV5 B;  5K1P A;  4FM2 A;  2EX3 A;  5CA0 B;  3RYI B;  2VQF B;  2BTQ B;  4DV1 B;  4LFB B;  5ITZ B;  1I94 B;  3A2F A;  4JYA B;  1G6U A;  1XQ8 A;  4X65 B;  5IWA B;  3MAQ A;  5IJ0 A;  2PZS A;  4FLX A;  3IAY A;  1D5A A;  2YIB D;  4DR4 B;  2UXC B;  1SKV A;  1ZAU A;  4JI2 B;  5JQG A;  2JGU A;  4UCS A;  5EIB C;  4CC5 A;  2R9A A;  3JAR B;  3JAT B;  1FJG B;  1TVK A;  4B3S B;  4ZIB A;  3SR2 C;  3CB2 A;  5C8Y A;  4LFA B;  2CAZ C;  4X62 B;  3CSX A;  2R70 A;  5LP6 A;  3K58 A;  4ZOL A;  5JCO C;  2UXD B;  2UUC B;  1Z5V A;  1XNQ B;  1N32 B;  1IBL B;  3K5M A;  3RWR D;  4IHJ A;  1IBM B;  3SJC C;  4GKJ B;  4WBN A;  3T1Y B;  4FLV A;  2F93 B;  3HKC B;  5IYZ B;  5JJE B;  4PI2 A;  5JCO A;  3BHP A;  3HKB A;  5JJJ B;  4DV3 B;  3ETQ A;  1SQG A;  1TVK B;  1TGO A;  4UCT A;  3SGI A;  2Q7G A;  5C8Y B;  3QG5 A;  4AQY B;  4JI1 B;  4X1Y A;  4O2B B;  2PYJ A;  2UUA B;  4CH6 A;  4X66 B;  2E3C A;  4IHJ B;  4WBN B;  5CA1 A;  3B2E E;  4FVM A;  3QF7 A;  2E5L B;  1JMK C;  1XHZ A;  3K57 A;  3VQW A;  4DRX A;  4UCU A;  3OTF A;  5EYP B;  3ZS8 C;  1T5E A;  2Q0A A;  3RYI A;  4LNU A;  4X1Y B;  1X4T A;  2F1M A;  3SJA C;  4JI7 B;  5ITZ A;  5FPO A;  2F4V B;  4TQF A;  4B08 A;  3JSL A;  1HW7 A;  5CA1 B;  3N2K A;  2F95 B;  2JS5 A;  2KKW A;  4K0K B;  3U11 A;  3RYC B;  1J5E B;  4EFB A;  2OWO A;  4I50 A;  4NVP A;  3JAT A;  3JAS A;  3THO A;  1SA0 B;  3HKE A;  2GV9 A;  2VWJ A;  4IIJ B;  4B3M B;  4LNU B;  4FLW A;  5FNV B;  5KHG A;  4DK1 A;  2F66 C;  1Z5W A;  4LF9 B;  3VQX A;  1I7F A;  4EFE A;  5JVD A;  4JI8 B;  3BA8 A;  4O4I B;  3N2K B;  4L8J A;  5KMG A;  2Q7H A;  2YXL A;  3HKC A;  5IYZ A;  2ZM6 B;  4DR1 B;  2JVD A;  2QJ1 A;  3BPZ A;  5LOV A;  4I50 B;  5J2T A;  1Q5O A;  3JAS B;  5KHH A;  3CHX A;  3PN1 A;  3HKE B;  4LF6 B;  2P22 C;  5KHK A;  4CS4 A;  2UU9 B;  2OYQ A;  1SQF A;  4DR6 B;  4O2B A;  4DV2 B;  3BA9 A;  4NXN B;  3HKD A;  3T1H B;  4CH5 A;  5KX5 A;  5JVD B;  1NT2 B;  4BWA A;  4DV7 B;  5KMG B;  3RFR A;  4DR5 B;  2XHB A;  1JFF B;  4U3J A;  5FPR A;  5LOV B;  4YJ2 A;  1XMO B;  5J2T B;  1VF7 A;  1V9P A;  4FM1 A;  5KHI A;  5EYP A;  3JAL B;  2P5O A;  4GLX A;  4X64 B;  4LF8 B;  4X1I B;  1QQC A;  4PI0 A;  3M7M X;  4ZHQ A;  3HKD B;  4LF4 B;  1TUB B;  4I55 B;  5KX5 B;  3E22 A;  2PGG A;  2Q7E A;  2BTO A;  1YEW A;  4FFB B;  4FLY A;  3FFQ A;  3WB0 A;  4U3J B;  3RYC A;  4HNA A;  1TA8 A;  1XMQ B;  4YJ2 B;  4DV4 B;  4K8X A;  4KHP B;  1O9H A;  1SA0 A;  2YI9 A;  4DR2 B;  4X20 A;  4TV9 A;  4IIJ A;  2IM9 A;  2VWK A;  2PUS A;  5FNV A;  1WN7 A;  5EZY B;  4ZHQ B;  3BRC A;  5BMV A;  3LNN A;  3E22 B;  4FLZ A;  1N36 B;  2HHH B;  4DK0 A;  4O4I A;  3OTO B;  1L8D A;  1N33 B;  4K8Z A;  4LH7 A;  1KMI Z;  4HNA B;  1XHX A;  2ZIN A;  5D5Q A;  5EIB D;  4D7T A;  4X1K B;  3WB2 A;  4X20 B;  4TV9 B;  4DV0 B;  2VQE B;  1Q8I A;  5JH7 B;  1RSO A;  3RYH B;  4F6R B;  5D5P A;  3JAK A;  4FLU A;  4B3T B;  4TV8 A;  3BAB A;  4AIL C;  5LYJ A;  3WB1 A;  2HEP A;  5BMV B;  4DV5 B;  3VQY A;  2RQ6 A;  4YJ3 A;  2ZNI A;  4TQD A;  4CH3 A;  4UCO A;  1N34 B;  1JFF A;  4TUY A;  5LA6 A;  4O4J B;  5GON B;  4UCV A;  4OX9 B;  4DR3 B;  4DR7 B;  4DV6 B;  2PY5 A;  3JAL A;  4GYC B;  1M5I A;  4X1I A;  5J2U B;  4JI3 B;  4HBN A;  4FM0 A;  4UFZ A;  2R72 A;  5LP6 C;  5LXT A;  3K5N A;  1Q43 A;  4TOI A;  1WNS A;  3JAK B;  4CH4 A;  5IJ9 A;  3UT5 A;  3UQ8 A;  4TV8 B;  4EB6 B;  5LYJ B;  4LF5 B;  2PYL A;  1H2S B;  1TUB A;  4I55 A;  3N2G B;  3VQV A;  1S5J A;  1P49 A;  4JI0 B;  4YJ3 B;  2ZIO A;  1XNR B;  4YHH B;  4CS3 A;  4FFB A;  1B04 A;  3QTC A;  2PTM A;  4TUY B;  4Q6G A;  5LA6 B;  5K1X A;  3JAW A;  4O4L A;  5LMU B;  4D7S A;  1QHT A;  5LMN B;  4CC6 A;  1JJO A;  4B3R B;  4JI5 B;  5IJ0 B;  5CB4 A;  4YY3 B;  4UCR A;  1TAE A;  1HNX B;  5LXT B;  1Q3E A;  5IJ9 B;  4CS2 A;  4ZI7 A;  5EZY A;  3UT5 B;  5KHJ A;  4FLT A;  3RGB A;  4PHZ A;  4O2A A;  5JQG B;  3U0Z A;  4DUY B;  2YI8 A;  2UUB B;  2RJZ A;  3ZED A;  4NXM B;  2YIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...