3BHPA

Crystal structure of upf0291 protein ynzc from bacillus subtilis at resolution 2.0 a. northeast structural genomics consortium target sr384
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
52
structure length
52
Chain Sequence
MISNAKIARINELAAKAKAGVITEEEKAEQQKLRQEYLKGFRSSMKNTLKSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the UPF0291 protein ynzC from Bacillus subtilis at the resolution 2.0 A.
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
molecule keywords UPF0291 protein ynzC
total genus 18
structure length 52
sequence length 52
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3bhpA00
4BWAA 4CS4A 4TQFA 3VQWA 3ZEDA 3VQYA 1O9GA 2RQ6A 4CH4A 2ZIMA 5K1XA 4TQDA 2ZIOA 4CS2A 3DSQA 2JVDA 4CH6A 5K1PA 1O9HA 2YI9A 2YI8A 3BHPA 3VQVA 2R72A 2ZNJA 2ZNIA 2HEPA 4CH5A 2QJ1A 2ZINA 4BW9A 3VQXA 2YIBD 2ZCEA 2RJZA 4ZIBA 2R70A 2YIAA 2Q7EA 2Q7GA 2E3CA 1G6UA 4CH3A 4CS3A 4Q6GA 2YIBA 2PGGA 3QTCA 2PUSA 2Q7HA
chains in the Genus database with same CATH superfamily
3FYEB 3KG2A 3CCUV 3OD4A 1P84F 3CMEV 4UVCA 2HHHO 4MTGA 5J2UB 4EFEA 1NTZH 5EYPA 4JI4O 2EZPA 2Q73A 1IBMO 4XDLA 4I7ZB 4GX0A 5KAFZ 2DWEC 3A0HZ 1IXMA 2G38A 4XDJA 4X9QA 3F5TA 2UUBB 3ZN0A 2VRZA 1U97A 2FYUH 2QKAA 3T1HB 2VQFO 3OW2U 1LUWA 1RPRA 2YXLA 4CC6A 4LH7A 4DV7O 4K0KO 4I50B 4ZOLB 1NH2D 3FAVA 1FS0G 3ZMSA 4DO2A 1ZTEA 2Q7EA 1V9PA 2IJJA 3RYFA 1LR1A 2JIZG 5IT9N 2W6IG 5JWPA 1NTMH 4TUYB 3H1LH 3VQVA 3E8HA 1BQZA 5H6RA 1QNMA 4I55A 3W7UA 4X20A 5L3EA 3Q4HA 3OAAG 4LF6B 2UXBO 3RYCA 3CD6V 3CRRA 3HB3B 1XMQB 1SRYA 3BEHA 3L74H 1EZVH 1FXKA 3PN1A 2ITCC 1IBLO 2OIEA 3HKDA 1VF7A 1TAEA 5L3BA 4CS2A 4QNHB 1YIJV 1OCOC 4RQFA 3SYOA 2PZSA 5FPOA 1GM9A 2LGWA 4N23A 3ASOC 4I9WA 4YIPA 2EJRA 5LHGA 4LNUA 4MW3A 4JI3B 2Y4UA 4NTWA 2DYSC 4I9QA 4EEQA 2DQ0A 4UCRA 3QF7A 2UXCO 4ZHQA 2E5LO 2NNUA 1M56B 4CC5A 1W59A 3LDEA 2BSKA 1RM1B 1NJIW 3QNEA 3ZJZA 3ZHTA 1VEWA 5LL6Y 3M7MX 2HR3A 1SQVH 3FX7A 3KZIZ 2EIJC 5K1PA 1OHHG 3B77A 2R72A 1AR5A 3OT7A 4DRXB 3J81N 1MSWD 1HDJA 3HKCB 1PPJH 4QGPA 3E22A 4IIJA 2YIDA 1SKVA 1B3QA 2YSUB 1HW7A 4LF5B 3JALB 1FXVA 2PYLA 4J9YB 4FLVA 3OR6C 3O65A 2CTWA 1TUEB 1OCCB 4JPRA 1GH6A 2CDYA 4FMTA 1MMMA 1KC8W 4MVMA 1F51A 2FMLA 2BOCC 2E76B 3K5NA 3JATA 4L8JA 3FB7C 1ZWIC 3ZRVA 1FXHA 4IHJB 1AILA 1N34O 4IGGA 1AJPA 1K97A 1NR1A 4RAIA 3SGIA 2QWNB 4DV4O 2CTQA 1SQGA 2UXXA 1AJQA 2A9HA 3NR7A 4JAUA 3K9SA 4X66O 3CCRV 5KMGA 1NVPD 2W6JG 4X64B 1QLEB 4DV5B 3TETA 1Q43A 2DOSA 1Q7YW 5IJ0B 3MDSA 4FPPA 3ZMVA 2Q4PA 4UCOA 1NS1A 4JI6B 2QKCA 1RP3B 1PL4A 4AHCA 5FPRA 4MVZA 3HPLC 1LUVA 1QR9A 4FM0A 4ZI7A 1JCHA 4WFGA 1VIBA 5CBFA 5KA5A 3RFRA 3D3IA 2OCCC 2CH7A 4HNAA 3J80N 2XTAA 3DC5A 4TT3G 4DW0A 4JI0B 4FZ0A 4EB6A 4KHPO 3W7WA 3OM3B 1R6NA 2ZIMA 1IBKB 3RBZA 1K7DA 1O9HA 3D36C 4LH6A 3ETGA 2ZDIA 4UVAA 2UUCB 4R50A 2YEVA 1WAZA 1M4UA 3N2KB 1F4NA 2N74A 2RMKB 4DR6O 2YS8A 2YEVB 1JFFB 4O4LA 2GSMB 4G2KA 3VBBA 4PDMA 4DR1B 3LSQA 1G1XB 3EXAA 1OCRC 4BIZA 3BY6A 5IYZB 4X62B 2F43G 4U7OA 4CBCA 4F6RA 4X65B 2CTPA 2F95B 5B1AC 3SJBC 4JI7O 1I94O 5B5EZ 1S77D 5B1BC 5D5PA 4NXNB 1UPGA 4MVQA 1TVKB 1OCRB 3IGAC 4TQDA 3B8NA 1S5LZ 1WP8A 1I7FA 2R9AA 5IJ0A 1AB3A 3G67A 4GX1A 3FB8C 4LF4O 3K5MA 1J5EB 1XUQA 2EULA 2QE7G 4E2LA 5CBGA 5LMUB 1KP3A 5DEDA 3SDLA 1R6KA 4FLYA 3CB2A 3ZX6A 1KP2A 1EN5A 4WFHA 4X1YB 4PJ0Z 5D5QA 1AI4A 2QJ1A 2UUAO 4K35A 4JV5B 2CTRA 1TUBB 3UQ8A 3DC6A 2W0FC 3GVMA 2DJVA 2DN9A 5KAIZ 2JS5A 4YIOA 4NTYA 4BWAA 4DV2O 4HZ3A 2QTSA 5KHKA 4D6TH 3E35A 4MTXA 1XL4A 2C2AA 4LC1A 5B3SC 4B3TB 1NZ6A 5HFMA 2PI4A 2Y4TA 1MNGA 1V54C 4A5UB 1Q6IA 3ETQA 1RM1C 3FKSG 3U11A 2BOBC 1WB8A 3HKCA 3WU2Z 4TV8B 1YZBA 2UUBO 4NKGB 1H2SB 1GN4A 4OPAA 2WLIA 4AI8A 2ADPA 1WPBA 2E75B 4TOIA 5LP6C 1T5EA 1ZX3A 4CS3A 4DV7B 5LXTA 1P49A 3ZCCA 5L3GA 4JGSA 2RN9A 2AGAA 5L3DA 1Y74B 2ATKC 2EBOA 3G6BA 5EC1C 2WLKA 2IU0A 1Z2GA 4N21A 4WBNB 3D36A 4PDVA 1YTFB 4O4LB 3CS5A 2Q67A 1BGYH 5IY5C 4LFBB 4LCUC 4LNUB 5HFLA 4G28B 4DR7B 5GTIZ 5LHHA 1UFIA 2EZOA 2WLLB 1HNWB 4PDLA 1TA8A 3JD3A 1YJWV 2UXBB 4LF6O 3S3XA 4CZZA 3CJHA 4PA4A 1XMQO 4FLTA 2F1MA 5JJJB 5LA6B 1FXKB 5KHIA 3BABA 2WWWA 1IXBA 3EVKA 1YVWA 4MS2A 2IH1C 5JQGB 3ZRXA 2P5OA 3CP1A 4UCVA 3ZRSA 1F7YA 1YCIA 4K8XA 1J95A 1ROPA 2AXTZ 4C7UA 1S5JA 5ITZA 4NTXA 5C8YB 2VWKA 4JI3O 2BTQB 3H01A 1N4CA 1SESA 1M57C 1K8AW 2E5LB 3WB0A 5IWAB 3T1YO 3ABMB 1YJNV 1I08A 4I4TA 1OJHA 3THOA 1PL0A 4WFAV 3N2GB 4P30A 2B5UA 2GDSA 2JDIG 4ZBMA 4W4LA 3K57A 2EILC 2YIAA 1VQMV 5JQGA 3JCZA 4JZ2A 3ICXA 3ABTA 1G6UA 3FB6C 2GTAA 1M5IA 2LO1A 5EZYA 3ZHVA 5F2VO 1EZJA 2NLJC 3ABKC 1JX9A 2L35A 3STZC 2KQXA 3SPGA 3OTOB 4WCEV 1R3KC 3SPCA 2ZT9B 5B1AB 2M6YA 3K79A 5FNVB 4PA6A 2AHYA 4UFZA 4QPKA 1QQCA 4RQEA 4DR4O 2P67A 2ZXWB 3ABUA 1OCCC 4HAMA 1YTFD 2Y48A 3ZBHA 3ZHUA 2MK3A 3WG7B 5LP6A 2Q7GA 3SJQC 3OMNB 4FIPC 4O2BB 4UV8A 2PUSA 1FXKC 5GONB 5LMNO 4X66B 5IY5B 1N36B 3JARA 3RYIB 3H9VA 1KQSU 4DV5O 1H2GA 5LGUA 1XOUA 4QIWF 1WNSA 3B40A 3K06A 1AP5A 4DUYO 2DQ3A 3W7SA 2JK5C 1NH2B 4LF9B 3IAYA 4R8CA 1EBOA 3B2EE 3LSUA 1QVFU 1MA1A 1NVPB 1JVMA 3BAAA 4MVOA 2Y0PA 3K5LA 3F7YC 3R65A 1Q82W 5EZYB 4O4HB 3JARB 3JAWA 3RYIA 3IFXA 1KECA 3ZHQA 4AQYO 4UCTA 4LFAB 1GK9A 1BMFG 2RNBA 2A3QA 2OCCB 3WB1A 4JI5O 2LP7A 2A0LA 1NBMG 1WP7A 1XNQB 5FLXN 3UO2A 1RFYA 3AG2B 3OMAB 3T4ZA 3FFQA 5KHGA 2DYSB 2QWPB 2DYRB 3AK3A 5J2TB 5FNVA 2OIGA 5LGNA 5TISZ 2FTKA 1SF9A 3UO3A 4DR1O 3K0DA 2P90A 1VQOV 1N32O 3FD9A 4J9ZB 5LBQA 2DW4A 5C8YA 1VF6C 4XBFA 4P9OA 3VQYA 1K4CC 4B7EA 3ZRWB 1FYJA 1YF2A 4X8AA 4X65O 1FAFA 3JSLA 3CX5F 1VQNV 4CH6A 3AG1B 1SERA 2HKOA 2NR5A 1H2KA 3SYAA 4RUFA 5JH7B 2F4VO 3D3QA 4H33A 2XASA 4B08A 2OWOA 3K03A 3P32A 3ZHRA 3WG7C 1PM9A 2Y69C 2EIMC 2JJ2G 2QWQB 4R7CA 3N2GA 4LF4B 3P3PA 4O2AB 5H2FZ 1XREA 1P7BA 2IJHA 1RPOA 4FFBA 2PY5A 2H8PC 2KG7A 4J7KA 2R9IA 3VOUA 1I5XA 1B06A 2VQEO 2AHZA 3NXSA 2Q7HA 1KB9F 1N0JA 2KKWA 5LOVB 2UUAB 5ITZB 4H13B 4UVBA 4JV5O 1G8MA 4B3MB 1PD3A 2XNDG 5JCOA 4U3JB 1M93A 4DV2B 2IH3C 3K3WA 2JS3A 3O9OA 4J80A 1L1FA 1EFRG 1YXBA 2CH7B 4MT8A 1D5NA 3TGUH 4DUZB 3TCUA 4UXNA 3HKEB 3L73H 4NXMB 2EIKB 4TV8A 3CJHB 4J42A 2AW9A 4LBEC 2ZINA 1FFTB 3X2QB 3RGBA 3CE2A 3A0RA 4GYCB 4DR5B 1US6A 2ZM6O 3OMIB 5C93A 3QO8A 4DV6O 3SYQA 3CC7V 1AJNA 3SJAC 4FVMA 1KYOF 1H2MA 3OGCC 4F4LA 4WBNA 2Q6AA 2ODMA 3WB2A 2A7WA 1Y6XA 1BSMA 3RVZA 1Q3EA 2P4KA 1IZ3A 4FZ1A 4KUMA 3L71H 3HR0A 2XAFA 3OEEG 5CA0A 2DYRC 4J7JA 4LFBO 1F4MA 2LGQA 4LFCB 1KBHA 4DR7O 2YUAA 5EBMC 4PELA 1HNWO 2F93B 5JVDA 5CA1A 1IDSA 1B04A 3T4DA 2YIBD 4YY3O 2LJ2A 1DF5A 3HKBB 3CEIA 2ZE5A 5EBWC 1KU9A 3GWOA 5K1XA 4Q20A 1E1RG 3E2EA 2EIJB 4K8ZA 1QU7A 4HYOA 4JI1B 2OT5A 3KKYA 4YJ3A 1UJWB 1HWYA 4FLXA 4F6RB 3JYCA 5EK0A 1X4TA 2CGOA 1BS3A 1YSCA 1PNMA 3CCLV 1D2DA 5LYJA 2Q0AA 1K73W 4ZHQB 2YI8A 4Z2WA 1XILA 3JASA 5IYCO 5H9CA 1L8DA 2Q9LA 1WN7A 5IWAO 3T1YB 1CP9A 1JFFA 2CUGA 3QO7A 2MW2B 1COWG 4ZKIA 2HG5C 3DTUB 3OTFA 2QEXV 1N0NA 3C3TA 2OYQA 4RUEA 4H0LB 2V7QG 2FL4A 3X2QC 2BTQA 2P4VA 4H37A 4E4EA 4GKKO 1JJ2U 1Y67A 1Y4MA 2RCVA 1SQQH 3AG2C 3DSQA 5JCOC 1S72V 2ZNIA 3ZMTA 1K92A 3K9AA 2Q5ZA 4JYAB 2IBZH 3JCUZ 3KCYA 1SQBH 3HKEA 4X88A 2E74B 2QA4V 1VP7A 4JASA 1S3JA 3I56V 3RWRD 4JTCB 1JA8A 5CA3A 1U96A 4DYLA 1R3JC 5LA6A 3Q4HB 3OTOO 2WSSG 1HP8A 5H5NA 2XAJA 4U3JA 4KFMA 4NYKA 3UM7A 3ZIAG 3RN4A 4PA9A 3LDCA 4J41A 4DW1A 2V4DA 4JI8B 3JAMN 4DR4B 5E79Z 4DV0O 2WLLA 3U10A 2EILB 3JAKB 3G71V 5DN6G 4GKJO 1SZXA 4ZOLA 1KMIZ 1K34A 4LF8B 1Q86W 5LYJB 3ETDA 2JJ1G 5LMNB 3F7VC 1NKDA 5AG2A 1N36O 5DM6V 1Q90D 2O57A 3JATB 1GAXA 5LXTB 2ZE6A 3BA9A 2Y0IA 4GLXA 3ZMUA 1OV9A 2GTSA 4DV1O 4H44B 4P2ZA 1NR7A 4DUYB 5EYPB 5A2QN 4EFBA 5L3FA 1P7GA 1SQPH 4LF9O 3CMAV 3AEIA 4I0XA 3HKBA 1MABG 3TJTA 5CB4B 4PD4F 1PP9H 4PI0A 3E8BA 5J2TA 4PI2A 3E22B 1FJGB 3UKMA 4UCUA 3AG3C 3LDDA 1L0NH 1MSDA 4B3RB 4DRXA 4AQYB 2GBOA 4LFAO 3SYCA 1THZA 3B4SA 2ZE7A 3AG3B 1R3IC 2LFSA 4IHJA 4JI5B 3OGIB 1PNKA 2QR4A 3AG4B 1XNQO 3CCVV 1QLNA 1RSOA 3EFFK 1PV0A 2BSKB 3WFVA 4WF9V 2Q8VA 2XAHA 4O4HA 4YJ2A 3CXCU 4YHHB 2OCHA 3RT3C 1D5AA 1BHBA 1FD9A 1N32B 1EN6A 4FJCC 3E89A 5E1AC 3LSSA 3CHXA 1F23A 3CSXA 1P4RA 2HJFC 3CXHF 3ZMZA 3QTCA 4IIJB 4PHZA 3P3NA 2WLJA 2F4VB 1ZAUA 1Q5OA 3OE7G 2XAQA 1DTOA 3A2FA 2ZKOA 4D7SA 3ABMC 3HKDB 4OX9B 5GONA 2R70A 1SQFA 4O2BA 1ZSPA 1R6TA 1K5QA 4U7NA 5EIBC 3RYCB 3CC4V 1VQ9V 4I55B 3SJCC 5EC2C 2VQEB 1SQXH 4QPJA 1PKXA 2HJDA 1K5SA 3FB5C 1K33A 2XT9A 4AILC 1SETA 5CN0A 1MZFA 1WA8A 1FFXA 4FM2A 4B3MO 1W2BU 3K5OA 1KD1W 2YIBA 3ZEDA 2B1GA 5BMVA 2KG7B 4CS4A 1I5YA 3FAVB 4ICGA 3T1CA 1HNXB 4FLZA 1XNRO 2WLMA 2V1DA 4YXWG 1BE3H 2HVJC 3GWKC 4B7KA 2Y69B 1DF4A 4GX2A 2FB5A 4DUZO 3APQA 2W0XA 4EB6B 1VQ4V 2ETNA 2ZCEA 2QWOB 2Z5UA 4NXMO 2RDCA 3OR7C 5JH7A 4X20B 1VQ6V 3I5DA 2Z3YA 5A9GA 3R66A 3JSNA 3C90A 4DR5O 3G4SV 2EINB 2ZM6B 4J10A 4I4TB 2F23A 4KP4A 4DV6B 2P22C 4D7TA 3JD1A 4IT5A 2BTOA 3L75H 4X89A 3RVYA 4X1KA 1Y76A 1M57B 1Y76B 4EKWA 1YEWA 3W7XA 3J7AU 4X1KB 1QHTA 1SZTA 1H8HG 4BIOA 1N33O 1O9GA 1TGOA 4NR1A 2YI9A 4QJFB 5GW7A 2WLNA 3A0BZ 1S5HC 4LFCO 1IX9A 1CXZB 3B8MA 2Q68A 1PNLA 4F6EA 1VARA 1XMOO 4YY3B 3QVNA 2LQTA 2HVKC 3JD4A 3QG5A 4MTFA 1XHZA 4ABMA 1GM7A 2KSDA 2CAZC 3CRAA 1AI6A 2QTOA 2LW7A 5BMVB 2PTMA 3BCCH 4O4JB 2QGNA 4FFKA 3G80A 2ZD9A 5BR8B 4QE9A 2QM4A 4HBNA 1CPYA 4JI1O 3SR2C 2IW5A 3I55V 1H2NA 2ZXWC 2OTLV 1MG1A 1VQ5V 3H1IH 1N8RW 4MSWC 4UCSA 2CK3G 3K0GA 4MVSA 4JI2O 1BCCH 1BL8A 3E8GA 1CEZA 5KA6A 5LP6B 3VQWA 2Q69A 3SPJA 1DGSA 3RYHA 1DLBA 3CRMA 2WLIB 4DV3O 3K59A 4W4KA 1YITV 4FM1A 1QVGU 4LF7B 2B9ZA 4DR2O 4GKKB 3CCMV 3BVOA 1H2LA 3CWBH 1KKDA 4I5SA 1WB7A 2H3OA 5H6QA 4JYAO 2PI5A 1OCZC 1NQTA 4IL6Z 2ZQMA 4FLUA 1YJ9V 2WLHA 3ABLB 1SA0B 4O4IB 1VQ7V 4MVUA 2XUMA 4DK0A 1TUBA 3QO5A 1VF6A 1XBLA 4UB6Z 3CRQA 4PDRA 4TUYA 1M9NA 3LNNA 4JI8O 2X6AA 4DV0B 4L87A 4CH5A 5B66Z 4ASUG 3M8AA 1NTKH 4JYBA 4GKJB 1NT2B 5CB4A 2ARHA 4LF8O 2R9RB 5GTHZ 1R73A 1JJOA 4B3SO 5KHJA 2XOKG 1OCOB 4Z1VA 3K08A 2M7WA 3P30A 3ZN1A 1OZ0A 2OTJV 1TVKA 2WA3A 2JEUA 5BXZA 4BAYA 2GUZB 3G6EV 1GMGA 2UXDO 1URFA 4DV1B 2DE0X 1W0KG 4PA7A 2UU9B 1HR0B 2ZE8A 2X7RB 3EHBB 2ADQB 2JRIA 2XAGA 2QKSA 1HNZO 4DK1A 5J2UA 5KHHA 3RW0A 2QSAA 1FJGO 1L0LH 2WAMA 3JAKA 2X6BA 4BR6A 4QE7A 4B3RO 2P6JA 5KUKA 1AI7A 3BA8A 4GX5A 1WA8B 4OPHA 3ASNB 3CCSV 4RO2A 1S0VA 3L9DA 2VS0A 4DR3B 2EINC 1LNQA 4GCZA 4NVPA 3JD2A 1Y74A 4KL1A 3MAQA 2YC0A 2HHHB 3MHSC 1B6QA 5KUMA 4JI4B 2DWDC 4UUJC 3UT5B 4DXWA 4YHHO 2ZR3A 4GZRB 1IBMB 1MZEA 3SPHA 2AZ0A 4JYCA 4ZI7B 3L72H 4U3FH 1QCEA 2HFEC 5KX5A 2N04A 1XHXA 2JGDA 2LW1A 4JF3A 4K3AA 3CCJV 3OUSA 1BHAA 3DXRB 2BE3A 3D8CA 2YXYA 3T1HO 1KUQA 2AZ2A 3F5WC 5IYDO 2VQFB 3LNMB 4J11A 2ILMA 3OUFA 4K0KB 1Q6HA 2PYJA 2L6LA 4OX9O 5KMGB 4OGQB 4MVRA 4G27B 2JGUA 2WPDG 4PA3A 3JASB 5IJ9B 2EIKC 4YJ2B 2QWRB 2QM8A 2YICA 1GN3A 1R1BA 3TXSA 1Q6UA 3CYOA 1E79G 3ASOB 1NU1H 2EJ7A 3CC2V 2IM9A 3N27A 1ZLZA 1M1KW 1RSOB 3S3WA 3CCEV 4X1IB 1WPXA 2IJKA 4X1YA 5IJ9A 2ZNJA 1ZL8B 1YDXA 1IBLB 1ORQC 3B09A 1V55C 1HNXO 1XNRB 1ZUQA 3GB7C 1G4YB 1GRJA 4GT1A 3T2MA 2PGGA 4BW9A 1GM8A 5JJEB 1GN6A 5EIBD 3IC7A 2X0LA 1ZL8A 4BW5A 5KX5B 1K4DC 4X1IA 4LR3A 2UXNA 1YI2V 2UXCB 2H94A 3H1KH 2XHBA 4Q6GA 3AG7A 4JTAB 2P7TC 2YDEA 4WFBV 3JD0A 2CGNA 1QR8A 4JZGA 4MW8A 2ZR2A 4LWSA 5B1NA 5IYZA 1YHQV 1EM1A 3AK2A 2PF4E 3ZS8C 3LUTB 1GO3F 2IU3A 1VQ8V 2ZDIC 2EIMB 2HEPA 3IC9A 1KKCA 3ASNC 1BZKA 1AR4A 2RJZA 5JJNB 1N33B 1VMGA 5B1BB 5DECA 3N2KA 4JYYA 2YXHA 4UB8Z 1Z5VA 3BFRA 3K04A 2Q0OC 4CH4A 1K3EA 4XDKA 5LGTA 5B1OA 1WJZA 4LF5O 1S76D 2JGDB 3BHPA 4GUNA 1SS3A 4WFFA 3BRCA 3BPZA 3U0ZA 1K9MW 2JEXA 3ZHSA 1FPOA 2B1IA 1OCZB 4TV9A 5EBLC 1XMOB 1BQ0A 4HNAB 3CCQV 1VQPV 2K9PA 4TV9B 4WFEA 2GUZA 3AG4C 1JOYA 2RQ6A 3OFNG 1XL6A 4NB5A 3MHHC 3FYIB 5BR8O 5LOVA 1N34B 1W0JG 2D3OW 4DV4B 4FK5C 2GV9A 3STLC 3IJ4A 3E86A 1V55B 4FFBB 4JAVA 4IYIA 3SPIA 4MTOA 3DGEA 4X64O 3C3SA 4I50A 4O2AA 4JI2B 1AROP 2HLDG 1FKAO 3PJSK 4LWSB 3KCXA 4JTDB 3TXQA 4J7ZA 4JI6O 1VF5B 4DV3B 3CRCA 4CH3A 3UCSC 1AI5A 2KB1A 4YJ3B 1QBZA 1V54B 2Z0AA 1M56C 5LHIA 1JR9A 4LF7O 4DR2B 2A79B 2F66C 2NN4A 4TWKA 2ZIOA 4Z1MG 1GKFA 3ABKB 1R3LC 4JI0O 3ZRWA 1DK1A 4KHPB 1H8EG 4ZIBA 1WLEA 3CPWU 1IBKO 4KXRA 5IYBO 3JALA 1Q81W 2EX3A 2QDOA 1M90W 4P9PA 1FFXB 2UUCO 3L70H 2D2CB 5L3CA 1SC5B 2HP8A 5CA1B 1GN2A 1H38A 5BY1A 1XI1A 5JVDB 1GTOA 4DR6B 5FL7G 2BCCH 1VQLV 1ENVA 5CA0B 3E8FA 1JMKC 1XEQA 3APOA 1Y66A 2IJIA 4O4IA 1SA0A 4X62O 4UV9A 1X59A 2GHYA 4R6ZA 1AVMA 2FKXA 4TQFA 3JAWB 5CMUA 1VQKV 2DMXA 1NI8A 3ETEA 5IE9A 2WA4A 1I94B 4JI7B 4PV1B 4NXNO 4RWUA 1E1QG 4BIUA 4JAAA 1I0HA 4B3SB 1AP6A 2P06A 2QM7A 3MD0A 4OXSA 2X6CA 2E3CA 1EN4A 3ABLC 5BZBA 2ITDC 4TSFG 1JPXA 1IURA 3DXRA 1J5EO 3H1JH 2UXDB 2K1EA 1XQ8A 5CBHA 3ML0A 5KLVH 4IYHA 4LP8A 5LMUO 2UU9O 1JQ0A 1Q8IA 3RYHB 3VQXA 1HR0O 4FLWA 3W7TA 1A32A 1AR1B 2N05A 1QLEC 3UT5A 1HNZB 2CE4A 3A8TA 2A06H 3AK1A 1MOFA 3AG1C 2VWJA 1Z5WA 5B3SB 2LFRA 5J9PC 3TK1A 2JVDA 3H1HH 3OEHG 3E83A 1XDCA 3K58A 1BT8A 3RYFB 5IDJA 1IVSA 3M99B 4I0XB 4DR3O 4B3TO 4O4JA 3SYPA
chains in the Genus database with same CATH topology
1TA8A 2BTQA 1JJOA 5KHJA 2UXBB 5J2UB 4EFEA 5EYPA 3DSQA 4FLTA 5JCOC 2ZNIA 4JYAB 1TVKA 2F1MA 3HKEA 5JJJB 5LA6B 5KHIA 3BABA 3RWRD 2UUBB 4DV1B 5JQGB 5LA6A 2UU9B 2P5OA 3T1HB 1HR0B 4UCVA 2YXLA 4CC6A 4LH7A 4U3JA 4K8XA 4I50B 4DK1A 5J2UA 1S5JA 5ITZA 4ZOLB 5KHHA 5C8YB 2VWKA 2BTQB 3JAKA 2Q7EA 1V9PA 4JI8B 2V4DA 4DR4B 3BA8A 3U10A 3RYFA 3JAKB 2E5LB 3WB0A 5IWAB 4ZOLA 4I4TA 1KMIZ 3THOA 4LF8B 4DR3B 4TUYB 3N2GB 3VQVA 4NVPA 5LYJB 4KL1A 4I55A 5LMNB 4X20A 3MAQA 2HHHB 4LF6B 3K57A 3RYCA 2YIAA 5JQGA 1XMQB 3JATB 4JI4B 3ICXA 5LXTB 1G6UA 3UT5B 1IBMB 3BA9A 3PN1A 1M5IA 4ZI7B 4GLXA 3HKDA 1VF7A 5EZYA 1TAEA 5KX5A 1XHXA 4CS2A 4DUYB 5EYPB 4EFBA 3OTOB 2VQFB 2PZSA 5FPOA 4K0KB 2PYJA 3HKBA 5CB4B 4PI0A 5FNVB 5J2TA 4PI2A 4LNUA 3E22B 1FJGB 4JI3B 5KMGB 4UFZA 4UCUA 2JGUA 1QQCA 4I9QA 4DRXA 4B3RB 3JASB 4EEQA 4AQYB 4UCRA 3QF7A 4ZHQA 5IJ9B 4YJ2B 4IHJA 4JI5B 4CC5A 1RSOA 5LP6A 2Q7GA 2IM9A 4O2BB 2PUSA 5GONB 4X66B 1N36B 4X1IB 3JARA 3M7MX 3RYIB 4O4HA 4X1YA 4YJ2A 5IJ9A 5K1PA 4YHHB 1D5AA 2R72A 2ZNJA 4DRXB 1N32B 1IBLB 3HKCB 3E22A 1WNSA 4IIJA 1SKVA 3CHXA 3CSXA 1XNRB 1HW7A 4LF5B 2PGGA 3JALB 3QTCA 4BW9A 2PYLA 4FLVA 4IIJB 4PHZA 4LF9B 3IAYA 5JJEB 3B2EE 5EIBD 2F4VB 1ZAUA 1Q5OA 3BAAA 3A2FA 3K5LA 5KX5B 5EZYB 4O4HB 3JARB 3JAWA 3RYIA 3HKDB 4D7SA 4OX9B 4X1IA 5GONA 2R70A 4LR3A 1SQFA 4O2BA 4UCTA 2UXCB 4LFAB 2XHBA 4Q6GA 3K5NA 3JATA 4L8JA 5EIBC 3RYCB 3WB1A 4IHJB 1XNQB 4I55B 3SJCC 5IYZA 3ZS8C 3SGIA 2VQEB 1SQGA 3FFQA 5KHGA 2HEPA 5KMGA 4AILC 2RJZA 5JJNB 5J2TB 5FNVA 1N33B 1FFXA 4FM2A 4X64B 4DV5B 1Q43A 3K5OA 2YIBA 3N2KA 3ZEDA 5BMVA 4CS4A 5IJ0B 5C8YA 1Z5VA 3VQYA 1HNXB 4FLZA 4CH4A 4UCOA 4JI6B 3JSLA 4CH6A 3BHPA 4AHCA 5FPRA 3BRCA 3BPZA 3U0ZA 4EB6B 4FM0A 5JH7B 4ZI7A 2ZCEA 4TV9A 1XMOB 3RFRA 4HNAB 4B08A 4HNAA 2OWOA 4TV9B 4JI0B 5JH7A 4X20B 4EB6A 2RQ6A 2ZIMA 3JSNA 1IBKB 3N2GA 4LF4B 4O2AB 2ZM6B 1O9HA 4LH6A 4I4TB 4DV6B 2UUCB 2P22C 4D7TA 4FFBA 5LOVA 2PY5A 1N34B 2BTOA 1M4UA 4X1KA 3N2KB 4DV4B 2GV9A 1YEWA 4X1KB 1QHTA 2Q7HA 1JFFB 2KKWA 4FFBB 5LOVB 2UUAB 1O9GA 1TGOA 4O4LA 5ITZB 4B3MB 4I50A 5JCOA 4O2AA 4DR1B 4JI2B 4U3JB 2YI9A 5IYZB 4X62B 1M93A 4DV2B 4F6RA 4X65B 4DV3B 2F95B 4CH3A 4YJ3B 3SJBC 5D5PA 4DUZB 4NXNB 3HKEB 4YY3B 1TVKB 4DR2B 4NXMB 4TQDA 2F66C 2ZIOA 3QG5A 1XHZA 4TV8A 2ZINA 1I7FA 4KHPB 2CAZC 2R9AA 4ZIBA 5BMVB 3RGBA 5IJ0A 2PTMA 3JALA 4GYCB 4O4JB 2EX3A 4DR5B 3K5MA 1J5EB 1FFXB 5BR8B 3SJAC 4FVMA 2QM4A 5LMUB 4HBNA 3SR2C 5CA1B 1XI1A 4FLYA 5JVDB 3CB2A 4WBNA 3WB2A 4DR6B 4X1YB 5D5QA 2QJ1A 4UCSA 1Q3EA 5CA0B 4JV5B 1JMKC 1TUBB 3UQ8A 4O4IA 2JS5A 1SA0A 5LP6B 4BWAA 5CA0A 4TQFA 3VQWA 1DGSA 5KHKA 3RYHA 3JAWB 4LFCB 4JI7B 1I94B 2F93B 3K59A 4B3TB 5JVDA 5CA1A 1B04A 2YIBD 4FM1A 4LF7B 4B3SB 4GKKB 3HKBB 3ETQA 2E3CA 3U11A 1KU9A 3HKCA 5K1XA 4TV8B 2UXDB 1XQ8A 1H2SB 4K8ZA 1WPBA 1Q8IA 3RYHB 3VQXA 4JI1B 4FLUA 4TOIA 5LP6C 4FLWA 1SA0B 4O4IB 4YJ3A 1T5EA 4CS3A 3UT5A 4DV7B 4DK0A 5LXTA 1HNZB 1P49A 1TUBA 4FLXA 4F6RB 1X4TA 5LYJA 2VWJA 2Q0AA 1Z5WA 4TUYA 3LNNA 2JVDA 4ZHQB 4WBNB 2YI8A 4DV0B 3JASA 1L8DA 1WN7A 4O4LB 4CH5A 4LFBB 3T1YB 4LNUB 4GKJB 1JFFA 1NT2B 3K58A 4DR7B 3RYFB 5CB4A 3OTFA 1HNWB 2OYQA 4O4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BWA A;  4CS4 A;  4TQF A;  3VQW A;  3ZED A;  3VQY A;  1O9G A;  2RQ6 A;  4CH4 A;  2ZIM A;  5K1X A;  4TQD A;  2ZIO A;  4CS2 A;  3DSQ A;  2JVD A;  4CH6 A;  5K1P A;  1O9H A;  2YI9 A;  2YI8 A;  3BHP A;  3VQV A;  2R72 A;  2ZNJ A;  2ZNI A;  2HEP A;  4CH5 A;  2QJ1 A;  2ZIN A;  4BW9 A;  3VQX A;  2YIB D;  2ZCE A;  2RJZ A;  4ZIB A;  2R70 A;  2YIA A;  2Q7E A;  2Q7G A;  2E3C A;  1G6U A;  4CH3 A;  4CS3 A;  4Q6G A;  2YIB A;  2PGG A;  3QTC A;  2PUS A;  2Q7H A; 
#chains in the Genus database with same CATH topology
 3FYE B;  3KG2 A;  3CCU V;  3OD4 A;  1P84 F;  3CME V;  4UVC A;  2HHH O;  4MTG A;  5J2U B;  4EFE A;  1NTZ H;  5EYP A;  4JI4 O;  2EZP A;  2Q73 A;  1IBM O;  4XDL A;  4I7Z B;  4GX0 A;  5KAF Z;  2DWE C;  3A0H Z;  1IXM A;  2G38 A;  4XDJ A;  4X9Q A;  3F5T A;  2UUB B;  3ZN0 A;  2VRZ A;  1U97 A;  2FYU H;  2QKA A;  3T1H B;  2VQF O;  3OW2 U;  1LUW A;  1RPR A;  2YXL A;  4CC6 A;  4LH7 A;  4DV7 O;  4K0K O;  4I50 B;  4ZOL B;  1NH2 D;  3FAV A;  1FS0 G;  3ZMS A;  4DO2 A;  1ZTE A;  2Q7E A;  1V9P A;  2IJJ A;  3RYF A;  1LR1 A;  2JIZ G;  5IT9 N;  2W6I G;  5JWP A;  1NTM H;  4TUY B;  3H1L H;  3VQV A;  3E8H A;  1BQZ A;  5H6R A;  1QNM A;  4I55 A;  3W7U A;  4X20 A;  5L3E A;  3Q4H A;  3OAA G;  4LF6 B;  2UXB O;  3RYC A;  3CD6 V;  3CRR A;  3HB3 B;  1XMQ B;  1SRY A;  3BEH A;  3L74 H;  1EZV H;  1FXK A;  3PN1 A;  2ITC C;  1IBL O;  2OIE A;  3HKD A;  1VF7 A;  1TAE A;  5L3B A;  4CS2 A;  4QNH B;  1YIJ V;  1OCO C;  4RQF A;  3SYO A;  2PZS A;  5FPO A;  1GM9 A;  2LGW A;  4N23 A;  3ASO C;  4I9W A;  4YIP A;  2EJR A;  5LHG A;  4LNU A;  4MW3 A;  4JI3 B;  2Y4U A;  4NTW A;  2DYS C;  4I9Q A;  4EEQ A;  2DQ0 A;  4UCR A;  3QF7 A;  2UXC O;  4ZHQ A;  2E5L O;  2NNU A;  1M56 B;  4CC5 A;  1W59 A;  3LDE A;  2BSK A;  1RM1 B;  1NJI W;  3QNE A;  3ZJZ A;  3ZHT A;  1VEW A;  5LL6 Y;  3M7M X;  2HR3 A;  1SQV H;  3FX7 A;  3KZI Z;  2EIJ C;  5K1P A;  1OHH G;  3B77 A;  2R72 A;  1AR5 A;  3OT7 A;  4DRX B;  3J81 N;  1MSW D;  1HDJ A;  3HKC B;  1PPJ H;  4QGP A;  3E22 A;  4IIJ A;  2YID A;  1SKV A;  1B3Q A;  2YSU B;  1HW7 A;  4LF5 B;  3JAL B;  1FXV A;  2PYL A;  4J9Y B;  4FLV A;  3OR6 C;  3O65 A;  2CTW A;  1TUE B;  1OCC B;  4JPR A;  1GH6 A;  2CDY A;  4FMT A;  1MMM A;  1KC8 W;  4MVM A;  1F51 A;  2FML A;  2BOC C;  2E76 B;  3K5N A;  3JAT A;  4L8J A;  3FB7 C;  1ZWI C;  3ZRV A;  1FXH A;  4IHJ B;  1AIL A;  1N34 O;  4IGG A;  1AJP A;  1K97 A;  1NR1 A;  4RAI A;  3SGI A;  2QWN B;  4DV4 O;  2CTQ A;  1SQG A;  2UXX A;  1AJQ A;  2A9H A;  3NR7 A;  4JAU A;  3K9S A;  4X66 O;  3CCR V;  5KMG A;  1NVP D;  2W6J G;  4X64 B;  1QLE B;  4DV5 B;  3TET A;  1Q43 A;  2DOS A;  1Q7Y W;  5IJ0 B;  3MDS A;  4FPP A;  3ZMV A;  2Q4P A;  4UCO A;  1NS1 A;  4JI6 B;  2QKC A;  1RP3 B;  1PL4 A;  4AHC A;  5FPR A;  4MVZ A;  3HPL C;  1LUV A;  1QR9 A;  4FM0 A;  4ZI7 A;  1JCH A;  4WFG A;  1VIB A;  5CBF A;  5KA5 A;  3RFR A;  3D3I A;  2OCC C;  2CH7 A;  4HNA A;  3J80 N;  2XTA A;  3DC5 A;  4TT3 G;  4DW0 A;  4JI0 B;  4FZ0 A;  4EB6 A;  4KHP O;  3W7W A;  3OM3 B;  1R6N A;  2ZIM A;  1IBK B;  3RBZ A;  1K7D A;  1O9H A;  3D36 C;  4LH6 A;  3ETG A;  2ZDI A;  4UVA A;  2UUC B;  4R50 A;  2YEV A;  1WAZ A;  1M4U A;  3N2K B;  1F4N A;  2N74 A;  2RMK B;  4DR6 O;  2YS8 A;  2YEV B;  1JFF B;  4O4L A;  2GSM B;  4G2K A;  3VBB A;  4PDM A;  4DR1 B;  3LSQ A;  1G1X B;  3EXA A;  1OCR C;  4BIZ A;  3BY6 A;  5IYZ B;  4X62 B;  2F43 G;  4U7O A;  4CBC A;  4F6R A;  4X65 B;  2CTP A;  2F95 B;  5B1A C;  3SJB C;  4JI7 O;  1I94 O;  5B5E Z;  1S77 D;  5B1B C;  5D5P A;  4NXN B;  1UPG A;  4MVQ A;  1TVK B;  1OCR B;  3IGA C;  4TQD A;  3B8N A;  1S5L Z;  1WP8 A;  1I7F A;  2R9A A;  5IJ0 A;  1AB3 A;  3G67 A;  4GX1 A;  3FB8 C;  4LF4 O;  3K5M A;  1J5E B;  1XUQ A;  2EUL A;  2QE7 G;  4E2L A;  5CBG A;  5LMU B;  1KP3 A;  5DED A;  3SDL A;  1R6K A;  4FLY A;  3CB2 A;  3ZX6 A;  1KP2 A;  1EN5 A;  4WFH A;  4X1Y B;  4PJ0 Z;  5D5Q A;  1AI4 A;  2QJ1 A;  2UUA O;  4K35 A;  4JV5 B;  2CTR A;  1TUB B;  3UQ8 A;  3DC6 A;  2W0F C;  3GVM A;  2DJV A;  2DN9 A;  5KAI Z;  2JS5 A;  4YIO A;  4NTY A;  4BWA A;  4DV2 O;  4HZ3 A;  2QTS A;  5KHK A;  4D6T H;  3E35 A;  4MTX A;  1XL4 A;  2C2A A;  4LC1 A;  5B3S C;  4B3T B;  1NZ6 A;  5HFM A;  2PI4 A;  2Y4T A;  1MNG A;  1V54 C;  4A5U B;  1Q6I A;  3ETQ A;  1RM1 C;  3FKS G;  3U11 A;  2BOB C;  1WB8 A;  3HKC A;  3WU2 Z;  4TV8 B;  1YZB A;  2UUB O;  4NKG B;  1H2S B;  1GN4 A;  4OPA A;  2WLI A;  4AI8 A;  2ADP A;  1WPB A;  2E75 B;  4TOI A;  5LP6 C;  1T5E A;  1ZX3 A;  4CS3 A;  4DV7 B;  5LXT A;  1P49 A;  3ZCC A;  5L3G A;  4JGS A;  2RN9 A;  2AGA A;  5L3D A;  1Y74 B;  2ATK C;  2EBO A;  3G6B A;  5EC1 C;  2WLK A;  2IU0 A;  1Z2G A;  4N21 A;  4WBN B;  3D36 A;  4PDV A;  1YTF B;  4O4L B;  3CS5 A;  2Q67 A;  1BGY H;  5IY5 C;  4LFB B;  4LCU C;  4LNU B;  5HFL A;  4G28 B;  4DR7 B;  5GTI Z;  5LHH A;  1UFI A;  2EZO A;  2WLL B;  1HNW B;  4PDL A;  1TA8 A;  3JD3 A;  1YJW V;  2UXB B;  4LF6 O;  3S3X A;  4CZZ A;  3CJH A;  4PA4 A;  1XMQ O;  4FLT A;  2F1M A;  5JJJ B;  5LA6 B;  1FXK B;  5KHI A;  3BAB A;  2WWW A;  1IXB A;  3EVK A;  1YVW A;  4MS2 A;  2IH1 C;  5JQG B;  3ZRX A;  2P5O A;  3CP1 A;  4UCV A;  3ZRS A;  1F7Y A;  1YCI A;  4K8X A;  1J95 A;  1ROP A;  2AXT Z;  4C7U A;  1S5J A;  5ITZ A;  4NTX A;  5C8Y B;  2VWK A;  4JI3 O;  2BTQ B;  3H01 A;  1N4C A;  1SES A;  1M57 C;  1K8A W;  2E5L B;  3WB0 A;  5IWA B;  3T1Y O;  3ABM B;  1YJN V;  1I08 A;  4I4T A;  1OJH A;  3THO A;  1PL0 A;  4WFA V;  3N2G B;  4P30 A;  2B5U A;  2GDS A;  2JDI G;  4ZBM A;  4W4L A;  3K57 A;  2EIL C;  2YIA A;  1VQM V;  5JQG A;  3JCZ A;  4JZ2 A;  3ICX A;  3ABT A;  1G6U A;  3FB6 C;  2GTA A;  1M5I A;  2LO1 A;  5EZY A;  3ZHV A;  5F2V O;  1EZJ A;  2NLJ C;  3ABK C;  1JX9 A;  2L35 A;  3STZ C;  2KQX A;  3SPG A;  3OTO B;  4WCE V;  1R3K C;  3SPC A;  2ZT9 B;  5B1A B;  2M6Y A;  3K79 A;  5FNV B;  4PA6 A;  2AHY A;  4UFZ A;  4QPK A;  1QQC A;  4RQE A;  4DR4 O;  2P67 A;  2ZXW B;  3ABU A;  1OCC C;  4HAM A;  1YTF D;  2Y48 A;  3ZBH A;  3ZHU A;  2MK3 A;  3WG7 B;  5LP6 A;  2Q7G A;  3SJQ C;  3OMN B;  4FIP C;  4O2B B;  4UV8 A;  2PUS A;  1FXK C;  5GON B;  5LMN O;  4X66 B;  5IY5 B;  1N36 B;  3JAR A;  3RYI B;  3H9V A;  1KQS U;  4DV5 O;  1H2G A;  5LGU A;  1XOU A;  4QIW F;  1WNS A;  3B40 A;  3K06 A;  1AP5 A;  4DUY O;  2DQ3 A;  3W7S A;  2JK5 C;  1NH2 B;  4LF9 B;  3IAY A;  4R8C A;  1EBO A;  3B2E E;  3LSU A;  1QVF U;  1MA1 A;  1NVP B;  1JVM A;  3BAA A;  4MVO A;  2Y0P A;  3K5L A;  3F7Y C;  3R65 A;  1Q82 W;  5EZY B;  4O4H B;  3JAR B;  3JAW A;  3RYI A;  3IFX A;  1KEC A;  3ZHQ A;  4AQY O;  4UCT A;  4LFA B;  1GK9 A;  1BMF G;  2RNB A;  2A3Q A;  2OCC B;  3WB1 A;  4JI5 O;  2LP7 A;  2A0L A;  1NBM G;  1WP7 A;  1XNQ B;  5FLX N;  3UO2 A;  1RFY A;  3AG2 B;  3OMA B;  3T4Z A;  3FFQ A;  5KHG A;  2DYS B;  2QWP B;  2DYR B;  3AK3 A;  5J2T B;  5FNV A;  2OIG A;  5LGN A;  5TIS Z;  2FTK A;  1SF9 A;  3UO3 A;  4DR1 O;  3K0D A;  2P90 A;  1VQO V;  1N32 O;  3FD9 A;  4J9Z B;  5LBQ A;  2DW4 A;  5C8Y A;  1VF6 C;  4XBF A;  4P9O A;  3VQY A;  1K4C C;  4B7E A;  3ZRW B;  1FYJ A;  1YF2 A;  4X8A A;  4X65 O;  1FAF A;  3JSL A;  3CX5 F;  1VQN V;  4CH6 A;  3AG1 B;  1SER A;  2HKO A;  2NR5 A;  1H2K A;  3SYA A;  4RUF A;  5JH7 B;  2F4V O;  3D3Q A;  4H33 A;  2XAS A;  4B08 A;  2OWO A;  3K03 A;  3P32 A;  3ZHR A;  3WG7 C;  1PM9 A;  2Y69 C;  2EIM C;  2JJ2 G;  2QWQ B;  4R7C A;  3N2G A;  4LF4 B;  3P3P A;  4O2A B;  5H2F Z;  1XRE A;  1P7B A;  2IJH A;  1RPO A;  4FFB A;  2PY5 A;  2H8P C;  2KG7 A;  4J7K A;  2R9I A;  3VOU A;  1I5X A;  1B06 A;  2VQE O;  2AHZ A;  3NXS A;  2Q7H A;  1KB9 F;  1N0J A;  2KKW A;  5LOV B;  2UUA B;  5ITZ B;  4H13 B;  4UVB A;  4JV5 O;  1G8M A;  4B3M B;  1PD3 A;  2XND G;  5JCO A;  4U3J B;  1M93 A;  4DV2 B;  2IH3 C;  3K3W A;  2JS3 A;  3O9O A;  4J80 A;  1L1F A;  1EFR G;  1YXB A;  2CH7 B;  4MT8 A;  1D5N A;  3TGU H;  4DUZ B;  3TCU A;  4UXN A;  3HKE B;  3L73 H;  4NXM B;  2EIK B;  4TV8 A;  3CJH B;  4J42 A;  2AW9 A;  4LBE C;  2ZIN A;  1FFT B;  3X2Q B;  3RGB A;  3CE2 A;  3A0R A;  4GYC B;  4DR5 B;  1US6 A;  2ZM6 O;  3OMI B;  5C93 A;  3QO8 A;  4DV6 O;  3SYQ A;  3CC7 V;  1AJN A;  3SJA C;  4FVM A;  1KYO F;  1H2M A;  3OGC C;  4F4L A;  4WBN A;  2Q6A A;  2ODM A;  3WB2 A;  2A7W A;  1Y6X A;  1BSM A;  3RVZ A;  1Q3E A;  2P4K A;  1IZ3 A;  4FZ1 A;  4KUM A;  3L71 H;  3HR0 A;  2XAF A;  3OEE G;  5CA0 A;  2DYR C;  4J7J A;  4LFB O;  1F4M A;  2LGQ A;  4LFC B;  1KBH A;  4DR7 O;  2YUA A;  5EBM C;  4PEL A;  1HNW O;  2F93 B;  5JVD A;  5CA1 A;  1IDS A;  1B04 A;  3T4D A;  2YIB D;  4YY3 O;  2LJ2 A;  1DF5 A;  3HKB B;  3CEI A;  2ZE5 A;  5EBW C;  1KU9 A;  3GWO A;  5K1X A;  4Q20 A;  1E1R G;  3E2E A;  2EIJ B;  4K8Z A;  1QU7 A;  4HYO A;  4JI1 B;  2OT5 A;  3KKY A;  4YJ3 A;  1UJW B;  1HWY A;  4FLX A;  4F6R B;  3JYC A;  5EK0 A;  1X4T A;  2CGO A;  1BS3 A;  1YSC A;  1PNM A;  3CCL V;  1D2D A;  5LYJ A;  2Q0A A;  1K73 W;  4ZHQ B;  2YI8 A;  4Z2W A;  1XIL A;  3JAS A;  5IYC O;  5H9C A;  1L8D A;  2Q9L A;  1WN7 A;  5IWA O;  3T1Y B;  1CP9 A;  1JFF A;  2CUG A;  3QO7 A;  2MW2 B;  1COW G;  4ZKI A;  2HG5 C;  3DTU B;  3OTF A;  2QEX V;  1N0N A;  3C3T A;  2OYQ A;  4RUE A;  4H0L B;  2V7Q G;  2FL4 A;  3X2Q C;  2BTQ A;  2P4V A;  4H37 A;  4E4E A;  4GKK O;  1JJ2 U;  1Y67 A;  1Y4M A;  2RCV A;  1SQQ H;  3AG2 C;  3DSQ A;  5JCO C;  1S72 V;  2ZNI A;  3ZMT A;  1K92 A;  3K9A A;  2Q5Z A;  4JYA B;  2IBZ H;  3JCU Z;  3KCY A;  1SQB H;  3HKE A;  4X88 A;  2E74 B;  2QA4 V;  1VP7 A;  4JAS A;  1S3J A;  3I56 V;  3RWR D;  4JTC B;  1JA8 A;  5CA3 A;  1U96 A;  4DYL A;  1R3J C;  5LA6 A;  3Q4H B;  3OTO O;  2WSS G;  1HP8 A;  5H5N A;  2XAJ A;  4U3J A;  4KFM A;  4NYK A;  3UM7 A;  3ZIA G;  3RN4 A;  4PA9 A;  3LDC A;  4J41 A;  4DW1 A;  2V4D A;  4JI8 B;  3JAM N;  4DR4 B;  5E79 Z;  4DV0 O;  2WLL A;  3U10 A;  2EIL B;  3JAK B;  3G71 V;  5DN6 G;  4GKJ O;  1SZX A;  4ZOL A;  1KMI Z;  1K34 A;  4LF8 B;  1Q86 W;  5LYJ B;  3ETD A;  2JJ1 G;  5LMN B;  3F7V C;  1NKD A;  5AG2 A;  1N36 O;  5DM6 V;  1Q90 D;  2O57 A;  3JAT B;  1GAX A;  5LXT B;  2ZE6 A;  3BA9 A;  2Y0I A;  4GLX A;  3ZMU A;  1OV9 A;  2GTS A;  4DV1 O;  4H44 B;  4P2Z A;  1NR7 A;  4DUY B;  5EYP B;  5A2Q N;  4EFB A;  5L3F A;  1P7G A;  1SQP H;  4LF9 O;  3CMA V;  3AEI A;  4I0X A;  3HKB A;  1MAB G;  3TJT A;  5CB4 B;  4PD4 F;  1PP9 H;  4PI0 A;  3E8B A;  5J2T A;  4PI2 A;  3E22 B;  1FJG B;  3UKM A;  4UCU A;  3AG3 C;  3LDD A;  1L0N H;  1MSD A;  4B3R B;  4DRX A;  4AQY B;  2GBO A;  4LFA O;  3SYC A;  1THZ A;  3B4S A;  2ZE7 A;  3AG3 B;  1R3I C;  2LFS A;  4IHJ A;  4JI5 B;  3OGI B;  1PNK A;  2QR4 A;  3AG4 B;  1XNQ O;  3CCV V;  1QLN A;  1RSO A;  3EFF K;  1PV0 A;  2BSK B;  3WFV A;  4WF9 V;  2Q8V A;  2XAH A;  4O4H A;  4YJ2 A;  3CXC U;  4YHH B;  2OCH A;  3RT3 C;  1D5A A;  1BHB A;  1FD9 A;  1N32 B;  1EN6 A;  4FJC C;  3E89 A;  5E1A C;  3LSS A;  3CHX A;  1F23 A;  3CSX A;  1P4R A;  2HJF C;  3CXH F;  3ZMZ A;  3QTC A;  4IIJ B;  4PHZ A;  3P3N A;  2WLJ A;  2F4V B;  1ZAU A;  1Q5O A;  3OE7 G;  2XAQ A;  1DTO A;  3A2F A;  2ZKO A;  4D7S A;  3ABM C;  3HKD B;  4OX9 B;  5GON A;  2R70 A;  1SQF A;  4O2B A;  1ZSP A;  1R6T A;  1K5Q A;  4U7N A;  5EIB C;  3RYC B;  3CC4 V;  1VQ9 V;  4I55 B;  3SJC C;  5EC2 C;  2VQE B;  1SQX H;  4QPJ A;  1PKX A;  2HJD A;  1K5S A;  3FB5 C;  1K33 A;  2XT9 A;  4AIL C;  1SET A;  5CN0 A;  1MZF A;  1WA8 A;  1FFX A;  4FM2 A;  4B3M O;  1W2B U;  3K5O A;  1KD1 W;  2YIB A;  3ZED A;  2B1G A;  5BMV A;  2KG7 B;  4CS4 A;  1I5Y A;  3FAV B;  4ICG A;  3T1C A;  1HNX B;  4FLZ A;  1XNR O;  2WLM A;  2V1D A;  4YXW G;  1BE3 H;  2HVJ C;  3GWK C;  4B7K A;  2Y69 B;  1DF4 A;  4GX2 A;  2FB5 A;  4DUZ O;  3APQ A;  2W0X A;  4EB6 B;  1VQ4 V;  2ETN A;  2ZCE A;  2QWO B;  2Z5U A;  4NXM O;  2RDC A;  3OR7 C;  5JH7 A;  4X20 B;  1VQ6 V;  3I5D A;  2Z3Y A;  5A9G A;  3R66 A;  3JSN A;  3C90 A;  4DR5 O;  3G4S V;  2EIN B;  2ZM6 B;  4J10 A;  4I4T B;  2F23 A;  4KP4 A;  4DV6 B;  2P22 C;  4D7T A;  3JD1 A;  4IT5 A;  2BTO A;  3L75 H;  4X89 A;  3RVY A;  4X1K A;  1Y76 A;  1M57 B;  1Y76 B;  4EKW A;  1YEW A;  3W7X A;  3J7A U;  4X1K B;  1QHT A;  1SZT A;  1H8H G;  4BIO A;  1N33 O;  1O9G A;  1TGO A;  4NR1 A;  2YI9 A;  4QJF B;  5GW7 A;  2WLN A;  3A0B Z;  1S5H C;  4LFC O;  1IX9 A;  1CXZ B;  3B8M A;  2Q68 A;  1PNL A;  4F6E A;  1VAR A;  1XMO O;  4YY3 B;  3QVN A;  2LQT A;  2HVK C;  3JD4 A;  3QG5 A;  4MTF A;  1XHZ A;  4ABM A;  1GM7 A;  2KSD A;  2CAZ C;  3CRA A;  1AI6 A;  2QTO A;  2LW7 A;  5BMV B;  2PTM A;  3BCC H;  4O4J B;  2QGN A;  4FFK A;  3G80 A;  2ZD9 A;  5BR8 B;  4QE9 A;  2QM4 A;  4HBN A;  1CPY A;  4JI1 O;  3SR2 C;  2IW5 A;  3I55 V;  1H2N A;  2ZXW C;  2OTL V;  1MG1 A;  1VQ5 V;  3H1I H;  1N8R W;  4MSW C;  4UCS A;  2CK3 G;  3K0G A;  4MVS A;  4JI2 O;  1BCC H;  1BL8 A;  3E8G A;  1CEZ A;  5KA6 A;  5LP6 B;  3VQW A;  2Q69 A;  3SPJ A;  1DGS A;  3RYH A;  1DLB A;  3CRM A;  2WLI B;  4DV3 O;  3K59 A;  4W4K A;  1YIT V;  4FM1 A;  1QVG U;  4LF7 B;  2B9Z A;  4DR2 O;  4GKK B;  3CCM V;  3BVO A;  1H2L A;  3CWB H;  1KKD A;  4I5S A;  1WB7 A;  2H3O A;  5H6Q A;  4JYA O;  2PI5 A;  1OCZ C;  1NQT A;  4IL6 Z;  2ZQM A;  4FLU A;  1YJ9 V;  2WLH A;  3ABL B;  1SA0 B;  4O4I B;  1VQ7 V;  4MVU A;  2XUM A;  4DK0 A;  1TUB A;  3QO5 A;  1VF6 A;  1XBL A;  4UB6 Z;  3CRQ A;  4PDR A;  4TUY A;  1M9N A;  3LNN A;  4JI8 O;  2X6A A;  4DV0 B;  4L87 A;  4CH5 A;  5B66 Z;  4ASU G;  3M8A A;  1NTK H;  4JYB A;  4GKJ B;  1NT2 B;  5CB4 A;  2ARH A;  4LF8 O;  2R9R B;  5GTH Z;  1R73 A;  1JJO A;  4B3S O;  5KHJ A;  2XOK G;  1OCO B;  4Z1V A;  3K08 A;  2M7W A;  3P30 A;  3ZN1 A;  1OZ0 A;  2OTJ V;  1TVK A;  2WA3 A;  2JEU A;  5BXZ A;  4BAY A;  2GUZ B;  3G6E V;  1GMG A;  2UXD O;  1URF A;  4DV1 B;  2DE0 X;  1W0K G;  4PA7 A;  2UU9 B;  1HR0 B;  2ZE8 A;  2X7R B;  3EHB B;  2ADQ B;  2JRI A;  2XAG A;  2QKS A;  1HNZ O;  4DK1 A;  5J2U A;  5KHH A;  3RW0 A;  2QSA A;  1FJG O;  1L0L H;  2WAM A;  3JAK A;  2X6B A;  4BR6 A;  4QE7 A;  4B3R O;  2P6J A;  5KUK A;  1AI7 A;  3BA8 A;  4GX5 A;  1WA8 B;  4OPH A;  3ASN B;  3CCS V;  4RO2 A;  1S0V A;  3L9D A;  2VS0 A;  4DR3 B;  2EIN C;  1LNQ A;  4GCZ A;  4NVP A;  3JD2 A;  1Y74 A;  4KL1 A;  3MAQ A;  2YC0 A;  2HHH B;  3MHS C;  1B6Q A;  5KUM A;  4JI4 B;  2DWD C;  4UUJ C;  3UT5 B;  4DXW A;  4YHH O;  2ZR3 A;  4GZR B;  1IBM B;  1MZE A;  3SPH A;  2AZ0 A;  4JYC A;  4ZI7 B;  3L72 H;  4U3F H;  1QCE A;  2HFE C;  5KX5 A;  2N04 A;  1XHX A;  2JGD A;  2LW1 A;  4JF3 A;  4K3A A;  3CCJ V;  3OUS A;  1BHA A;  3DXR B;  2BE3 A;  3D8C A;  2YXY A;  3T1H O;  1KUQ A;  2AZ2 A;  3F5W C;  5IYD O;  2VQF B;  3LNM B;  4J11 A;  2ILM A;  3OUF A;  4K0K B;  1Q6H A;  2PYJ A;  2L6L A;  4OX9 O;  5KMG B;  4OGQ B;  4MVR A;  4G27 B;  2JGU A;  2WPD G;  4PA3 A;  3JAS B;  5IJ9 B;  2EIK C;  4YJ2 B;  2QWR B;  2QM8 A;  2YIC A;  1GN3 A;  1R1B A;  3TXS A;  1Q6U A;  3CYO A;  1E79 G;  3ASO B;  1NU1 H;  2EJ7 A;  3CC2 V;  2IM9 A;  3N27 A;  1ZLZ A;  1M1K W;  1RSO B;  3S3W A;  3CCE V;  4X1I B;  1WPX A;  2IJK A;  4X1Y A;  5IJ9 A;  2ZNJ A;  1ZL8 B;  1YDX A;  1IBL B;  1ORQ C;  3B09 A;  1V55 C;  1HNX O;  1XNR B;  1ZUQ A;  3GB7 C;  1G4Y B;  1GRJ A;  4GT1 A;  3T2M A;  2PGG A;  4BW9 A;  1GM8 A;  5JJE B;  1GN6 A;  5EIB D;  3IC7 A;  2X0L A;  1ZL8 A;  4BW5 A;  5KX5 B;  1K4D C;  4X1I A;  4LR3 A;  2UXN A;  1YI2 V;  2UXC B;  2H94 A;  3H1K H;  2XHB A;  4Q6G A;  3AG7 A;  4JTA B;  2P7T C;  2YDE A;  4WFB V;  3JD0 A;  2CGN A;  1QR8 A;  4JZG A;  4MW8 A;  2ZR2 A;  4LWS A;  5B1N A;  5IYZ A;  1YHQ V;  1EM1 A;  3AK2 A;  2PF4 E;  3ZS8 C;  3LUT B;  1GO3 F;  2IU3 A;  1VQ8 V;  2ZDI C;  2EIM B;  2HEP A;  3IC9 A;  1KKC A;  3ASN C;  1BZK A;  1AR4 A;  2RJZ A;  5JJN B;  1N33 B;  1VMG A;  5B1B B;  5DEC A;  3N2K A;  4JYY A;  2YXH A;  4UB8 Z;  1Z5V A;  3BFR A;  3K04 A;  2Q0O C;  4CH4 A;  1K3E A;  4XDK A;  5LGT A;  5B1O A;  1WJZ A;  4LF5 O;  1S76 D;  2JGD B;  3BHP A;  4GUN A;  1SS3 A;  4WFF A;  3BRC A;  3BPZ A;  3U0Z A;  1K9M W;  2JEX A;  3ZHS A;  1FPO A;  2B1I A;  1OCZ B;  4TV9 A;  5EBL C;  1XMO B;  1BQ0 A;  4HNA B;  3CCQ V;  1VQP V;  2K9P A;  4TV9 B;  4WFE A;  2GUZ A;  3AG4 C;  1JOY A;  2RQ6 A;  3OFN G;  1XL6 A;  4NB5 A;  3MHH C;  3FYI B;  5BR8 O;  5LOV A;  1N34 B;  1W0J G;  2D3O W;  4DV4 B;  4FK5 C;  2GV9 A;  3STL C;  3IJ4 A;  3E86 A;  1V55 B;  4FFB B;  4JAV A;  4IYI A;  3SPI A;  4MTO A;  3DGE A;  4X64 O;  3C3S A;  4I50 A;  4O2A A;  4JI2 B;  1ARO P;  2HLD G;  1FKA O;  3PJS K;  4LWS B;  3KCX A;  4JTD B;  3TXQ A;  4J7Z A;  4JI6 O;  1VF5 B;  4DV3 B;  3CRC A;  4CH3 A;  3UCS C;  1AI5 A;  2KB1 A;  4YJ3 B;  1QBZ A;  1V54 B;  2Z0A A;  1M56 C;  5LHI A;  1JR9 A;  4LF7 O;  4DR2 B;  2A79 B;  2F66 C;  2NN4 A;  4TWK A;  2ZIO A;  4Z1M G;  1GKF A;  3ABK B;  1R3L C;  4JI0 O;  3ZRW A;  1DK1 A;  4KHP B;  1H8E G;  4ZIB A;  1WLE A;  3CPW U;  1IBK O;  4KXR A;  5IYB O;  3JAL A;  1Q81 W;  2EX3 A;  2QDO A;  1M90 W;  4P9P A;  1FFX B;  2UUC O;  3L70 H;  2D2C B;  5L3C A;  1SC5 B;  2HP8 A;  5CA1 B;  1GN2 A;  1H38 A;  5BY1 A;  1XI1 A;  5JVD B;  1GTO A;  4DR6 B;  5FL7 G;  2BCC H;  1VQL V;  1ENV A;  5CA0 B;  3E8F A;  1JMK C;  1XEQ A;  3APO A;  1Y66 A;  2IJI A;  4O4I A;  1SA0 A;  4X62 O;  4UV9 A;  1X59 A;  2GHY A;  4R6Z A;  1AVM A;  2FKX A;  4TQF A;  3JAW B;  5CMU A;  1VQK V;  2DMX A;  1NI8 A;  3ETE A;  5IE9 A;  2WA4 A;  1I94 B;  4JI7 B;  4PV1 B;  4NXN O;  4RWU A;  1E1Q G;  4BIU A;  4JAA A;  1I0H A;  4B3S B;  1AP6 A;  2P06 A;  2QM7 A;  3MD0 A;  4OXS A;  2X6C A;  2E3C A;  1EN4 A;  3ABL C;  5BZB A;  2ITD C;  4TSF G;  1JPX A;  1IUR A;  3DXR A;  1J5E O;  3H1J H;  2UXD B;  2K1E A;  1XQ8 A;  5CBH A;  3ML0 A;  5KLV H;  4IYH A;  4LP8 A;  5LMU O;  2UU9 O;  1JQ0 A;  1Q8I A;  3RYH B;  3VQX A;  1HR0 O;  4FLW A;  3W7T A;  1A32 A;  1AR1 B;  2N05 A;  1QLE C;  3UT5 A;  1HNZ B;  2CE4 A;  3A8T A;  2A06 H;  3AK1 A;  1MOF A;  3AG1 C;  2VWJ A;  1Z5W A;  5B3S B;  2LFR A;  5J9P C;  3TK1 A;  2JVD A;  3H1H H;  3OEH G;  3E83 A;  1XDC A;  3K58 A;  1BT8 A;  3RYF B;  5IDJ A;  1IVS A;  3M99 B;  4I0X B;  4DR3 O;  4B3T O;  4O4J A;  3SYP A; 
#chains in the Genus database with same CATH homology
 1TA8 A;  2BTQ A;  1JJO A;  5KHJ A;  2UXB B;  5J2U B;  4EFE A;  5EYP A;  3DSQ A;  4FLT A;  5JCO C;  2ZNI A;  4JYA B;  1TVK A;  2F1M A;  3HKE A;  5JJJ B;  5LA6 B;  5KHI A;  3BAB A;  3RWR D;  2UUB B;  4DV1 B;  5JQG B;  5LA6 A;  2UU9 B;  2P5O A;  3T1H B;  1HR0 B;  4UCV A;  2YXL A;  4CC6 A;  4LH7 A;  4U3J A;  4K8X A;  4I50 B;  4DK1 A;  5J2U A;  1S5J A;  5ITZ A;  4ZOL B;  5KHH A;  5C8Y B;  2VWK A;  2BTQ B;  3JAK A;  2Q7E A;  1V9P A;  4JI8 B;  2V4D A;  4DR4 B;  3BA8 A;  3U10 A;  3RYF A;  3JAK B;  2E5L B;  3WB0 A;  5IWA B;  4ZOL A;  4I4T A;  1KMI Z;  3THO A;  4LF8 B;  4DR3 B;  4TUY B;  3N2G B;  3VQV A;  4NVP A;  5LYJ B;  4KL1 A;  4I55 A;  5LMN B;  4X20 A;  3MAQ A;  2HHH B;  4LF6 B;  3K57 A;  3RYC A;  2YIA A;  5JQG A;  1XMQ B;  3JAT B;  4JI4 B;  3ICX A;  5LXT B;  1G6U A;  3UT5 B;  1IBM B;  3BA9 A;  3PN1 A;  1M5I A;  4ZI7 B;  4GLX A;  3HKD A;  1VF7 A;  5EZY A;  1TAE A;  5KX5 A;  1XHX A;  4CS2 A;  4DUY B;  5EYP B;  4EFB A;  3OTO B;  2VQF B;  2PZS A;  5FPO A;  4K0K B;  2PYJ A;  3HKB A;  5CB4 B;  4PI0 A;  5FNV B;  5J2T A;  4PI2 A;  4LNU A;  3E22 B;  1FJG B;  4JI3 B;  5KMG B;  4UFZ A;  4UCU A;  2JGU A;  1QQC A;  4I9Q A;  4DRX A;  4B3R B;  3JAS B;  4EEQ A;  4AQY B;  4UCR A;  3QF7 A;  4ZHQ A;  5IJ9 B;  4YJ2 B;  4IHJ A;  4JI5 B;  4CC5 A;  1RSO A;  5LP6 A;  2Q7G A;  2IM9 A;  4O2B B;  2PUS A;  5GON B;  4X66 B;  1N36 B;  4X1I B;  3JAR A;  3M7M X;  3RYI B;  4O4H A;  4X1Y A;  4YJ2 A;  5IJ9 A;  5K1P A;  4YHH B;  1D5A A;  2R72 A;  2ZNJ A;  4DRX B;  1N32 B;  1IBL B;  3HKC B;  3E22 A;  1WNS A;  4IIJ A;  1SKV A;  3CHX A;  3CSX A;  1XNR B;  1HW7 A;  4LF5 B;  2PGG A;  3JAL B;  3QTC A;  4BW9 A;  2PYL A;  4FLV A;  4IIJ B;  4PHZ A;  4LF9 B;  3IAY A;  5JJE B;  3B2E E;  5EIB D;  2F4V B;  1ZAU A;  1Q5O A;  3BAA A;  3A2F A;  3K5L A;  5KX5 B;  5EZY B;  4O4H B;  3JAR B;  3JAW A;  3RYI A;  3HKD B;  4D7S A;  4OX9 B;  4X1I A;  5GON A;  2R70 A;  4LR3 A;  1SQF A;  4O2B A;  4UCT A;  2UXC B;  4LFA B;  2XHB A;  4Q6G A;  3K5N A;  3JAT A;  4L8J A;  5EIB C;  3RYC B;  3WB1 A;  4IHJ B;  1XNQ B;  4I55 B;  3SJC C;  5IYZ A;  3ZS8 C;  3SGI A;  2VQE B;  1SQG A;  3FFQ A;  5KHG A;  2HEP A;  5KMG A;  4AIL C;  2RJZ A;  5JJN B;  5J2T B;  5FNV A;  1N33 B;  1FFX A;  4FM2 A;  4X64 B;  4DV5 B;  1Q43 A;  3K5O A;  2YIB A;  3N2K A;  3ZED A;  5BMV A;  4CS4 A;  5IJ0 B;  5C8Y A;  1Z5V A;  3VQY A;  1HNX B;  4FLZ A;  4CH4 A;  4UCO A;  4JI6 B;  3JSL A;  4CH6 A;  3BHP A;  4AHC A;  5FPR A;  3BRC A;  3BPZ A;  3U0Z A;  4EB6 B;  4FM0 A;  5JH7 B;  4ZI7 A;  2ZCE A;  4TV9 A;  1XMO B;  3RFR A;  4HNA B;  4B08 A;  4HNA A;  2OWO A;  4TV9 B;  4JI0 B;  5JH7 A;  4X20 B;  4EB6 A;  2RQ6 A;  2ZIM A;  3JSN A;  1IBK B;  3N2G A;  4LF4 B;  4O2A B;  2ZM6 B;  1O9H A;  4LH6 A;  4I4T B;  4DV6 B;  2UUC B;  2P22 C;  4D7T A;  4FFB A;  5LOV A;  2PY5 A;  1N34 B;  2BTO A;  1M4U A;  4X1K A;  3N2K B;  4DV4 B;  2GV9 A;  1YEW A;  4X1K B;  1QHT A;  2Q7H A;  1JFF B;  2KKW A;  4FFB B;  5LOV B;  2UUA B;  1O9G A;  1TGO A;  4O4L A;  5ITZ B;  4B3M B;  4I50 A;  5JCO A;  4O2A A;  4DR1 B;  4JI2 B;  4U3J B;  2YI9 A;  5IYZ B;  4X62 B;  1M93 A;  4DV2 B;  4F6R A;  4X65 B;  4DV3 B;  2F95 B;  4CH3 A;  4YJ3 B;  3SJB C;  5D5P A;  4DUZ B;  4NXN B;  3HKE B;  4YY3 B;  1TVK B;  4DR2 B;  4NXM B;  4TQD A;  2F66 C;  2ZIO A;  3QG5 A;  1XHZ A;  4TV8 A;  2ZIN A;  1I7F A;  4KHP B;  2CAZ C;  2R9A A;  4ZIB A;  5BMV B;  3RGB A;  5IJ0 A;  2PTM A;  3JAL A;  4GYC B;  4O4J B;  2EX3 A;  4DR5 B;  3K5M A;  1J5E B;  1FFX B;  5BR8 B;  3SJA C;  4FVM A;  2QM4 A;  5LMU B;  4HBN A;  3SR2 C;  5CA1 B;  1XI1 A;  4FLY A;  5JVD B;  3CB2 A;  4WBN A;  3WB2 A;  4DR6 B;  4X1Y B;  5D5Q A;  2QJ1 A;  4UCS A;  1Q3E A;  5CA0 B;  4JV5 B;  1JMK C;  1TUB B;  3UQ8 A;  4O4I A;  2JS5 A;  1SA0 A;  5LP6 B;  4BWA A;  5CA0 A;  4TQF A;  3VQW A;  1DGS A;  5KHK A;  3RYH A;  3JAW B;  4LFC B;  4JI7 B;  1I94 B;  2F93 B;  3K59 A;  4B3T B;  5JVD A;  5CA1 A;  1B04 A;  2YIB D;  4FM1 A;  4LF7 B;  4B3S B;  4GKK B;  3HKB B;  3ETQ A;  2E3C A;  3U11 A;  1KU9 A;  3HKC A;  5K1X A;  4TV8 B;  2UXD B;  1XQ8 A;  1H2S B;  4K8Z A;  1WPB A;  1Q8I A;  3RYH B;  3VQX A;  4JI1 B;  4FLU A;  4TOI A;  5LP6 C;  4FLW A;  1SA0 B;  4O4I B;  4YJ3 A;  1T5E A;  4CS3 A;  3UT5 A;  4DV7 B;  4DK0 A;  5LXT A;  1HNZ B;  1P49 A;  1TUB A;  4FLX A;  4F6R B;  1X4T A;  5LYJ A;  2VWJ A;  2Q0A A;  1Z5W A;  4TUY A;  3LNN A;  2JVD A;  4ZHQ B;  4WBN B;  2YI8 A;  4DV0 B;  3JAS A;  1L8D A;  1WN7 A;  4O4L B;  4CH5 A;  4LFB B;  3T1Y B;  4LNU B;  4GKJ B;  1JFF A;  1NT2 B;  3K58 A;  4DR7 B;  3RYF B;  5CB4 A;  3OTF A;  1HNW B;  2OYQ A;  4O4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...