3BHUB

Structure of phosphorylated thr160 cdk2/cyclin a in complex with the inhibitor meriolin 5
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
262
structure length
262
Chain Sequence
b'SVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein kinase 2
publication title Meriolins, a new class of cell death inducing kinase inhibitors with enhanced selectivity for cyclin-dependent kinases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 97
structure length 262
sequence length 262
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3bhuB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3bhuB02
4BCOB 1H4LD 2IVXA 4BCKB 2I40B 2QDJA 1FINB 1OIYB 4BCHB 3QHWB 4KRCB 1TFBA 2WPAB 3MY5B 1H28B 4KRDB 4Y72B 3BLHB 3EJ1B 1JKWA 4ROEA 2WIHB 2CCIB 4BCNB 2PK2A 3QHRB 1AD6A 3BLRB 4YC3B 3BHUB 4F6SB 1ZP2A 5I5ZB 5ACBA 4BCJB 2WFYB 1JOWA 1GH6B 1OL2B 4CFXB 5HVYB 5CEIB 1VYWB 2B9RA 1P5EB 1C9BA 3DDPB 2UZBB 1URCB 3MIAB 2UUEB 3RGFB 1O9KA 4IMYB 4EOLB 3MY1B 1OIUB 1O9KB 3DDQB 1UNHD 1H1SB 1H1RB 5IF1B 4ELJA 1GY3B 1VINA 4EOKB 2IW8B 4YOSA 5LMKB 4CFUB 1H1PB 2UZLB 2WXVB 4EOQB 5ICPB 2PHGA 4EC9B 2C5OB 1KXUA 4NSTB 4BCGB 3BHTB 3POMA 3TN8B 2BPMB 1JSTB 5HNBB 3O0GD 4BCQD 4F7JB 2IW6B 4F7SB 1JSUB 3G33B 4EOPB 1W98B 4CFNB 2PMIB 4EC8B 2R7GA 5HBHB 3F5XB 1UNGD 1OGUB 1H26B 4UN0A 4F70B 2WHBB 2JGZB 1H25B 2EUFA 1OI9B 2BKZB 4F6UB 4FX3B 4OGRB 1OL1B 1UNLD 4CFWB 4CFVB 2G9XB 4G6LB 4BCMD 1GUXA 4EOSB 3H4CA 4ROCA 3K7AM 4CFMB 1GUXB 3LQ5B 4BCQB 5LQFB 4EOMB 1G3NC 4YOOA 1FVVB 4RODA 1OKVB 2WMAB 1BU2A 3TNWB 4EOJB 5IDPB 2PK9B 4CXAB 2V22B 3TNHB 1D3UB 2C5NB 1E9HB 2I53A 4BCPB 2W2HA 4BCIB 4I3ZB 2CJMB 4EORB 1OKWB 1QMZB 2X1NB 2WIPB 2WMBB 5FGKB 5HQ0B 4II5B 4BCMB 5L2WB 2C6TB 3MI9B 2CCHB 2W9FA 5IDNB 4F7NB 4CRLB 5CYIB 2UZDB 4F7LB 3BLQB 1H27B 2WEVB 1F5QB 3TNIB 4F6WB 2IW9B 1N4MA 5EFQB 4OR5B 4CFUD 2W99A 1XO2A 5BNJB 1H1QB 4EOIB 1AISB 2C5XB 2F2CA 4TTHA 5HBJB 4EOOB 2W9ZA 4BCND 5HBEB 3EOCB 3M03A 4EONB 3DOGB 4YOZA 3EIDB 4ELLA 2UZEB 2C5VB 1PKDB 2C4GB 1VOLA 4BCFB 3BHVB 1H24B 2W96A
chains in the Genus database with same CATH superfamily
4BCOB 2IVXA 3QYGB 2I40B 2QDJA 3HO8A 1TFBA 4Y72B 3BLHB 4BCNB 2PK2A 5HVYB 1QLBA 1URCB 1O9KA 3X25B 5IF1B 5LMKB 4CFUB 2UZLB 2PHGA 4EC9B 5EJCA 1V29B 1JSTB 3O0GD 4BCQD 1W98B 4CFNB 2PMIB 4EC8B 2R7GA 1UNGD 2WJ9A 3DL1A 3KHIA 1E7PA 4F6UB 1UNLD 1GUXA 4EOSB 3H4CA 4BCQB 1G3NC 1OKVB 4CXAB 4HNVA 2I53A 4BCPB 2W2HA 4BCIB 2WIPB 5L2WB 4II5B 2ZPGB 2C6TB 3MI9B 2CCHB 4F7NB 2UZDB 4F6WB 5EFQB 4AKGA 5BNJB 1XO2A 4EOIB 4TTHA 2QGSA 5HBEB 4HNTA 4EONB 4BCFB 1H24B 2W96A 1FKMA 1H4LD 4LOCA 4BCHB 1FINB 1OIYB 3MY5B 4AKIA 1H28B 4KRDB 3HHTB 3B57A 2CCIB 3X24B 2CZ0B 3QWLA 4MIMA 4YC3B 1ZP2A 4OB1B 1IREB 3QYEA 4CFXB 3QZ9B 2B9RA 1P5EB 1C9BA 4HL4A 2UZBB 3RGFB 3A8MB 4BXXX 3DTOA 2DMEA 3DDQB 3X28B 1H1SB 2IN3A 1VINA 3BG5A 4EOKB 3GTMS 5ICPB 1KXUA 2QFZA 2BS4A 3A8GB 2G77A 3POMA 3X20B 4OB3B 2IW6B 1JSUB 3G33B 4BY1X 2PJQA 2ZPEB 5HBHB 4F70B 4FX3B 1OL1B 2LW4A 4BCMD 4CFMB 3LQ5B 4EOJB 5IDPB 4AI6A 2PK9B 2QF7A 2V22B 1D3UB 3DJBA 2CZ7B 2CZ6B 5IHYA 4ZGDB 2X1NB 1QMZB 4BCMB 5HQ0B 3QXEB 5IDNB 4BY7X 4F7LB 1F5QB 4OR5B 1H1QB 1AISB 3VKGA 3EOCB 3NDQA 1ENWA 4YOZA 2C5VB 3VYGB 2C4GB 1VOLA 2ZPHB 3WVDB 3BHVB 3QHWB 4KRCB 3EJ1B 4ROEA 4ZGJB 3PO3S 3QHRB 2QQ8A 3BLRB 4F6SB 4BCJB 2WFYB 4BBSM 1GH6B 5CEIB 3QYBA 3MIAB 3A8LB 3MY1B 1OIUB 1O9KB 2DD5B 1H1RB 2IW8B 1UGSB 4YOSA 1UGPB 3TW6A 3BHTB 4M6VA 3TN8B 2BPMB 3TW7A 4F7JB 4F7SB 4EOPB 2DXCB 3QYHB 3BG3A 2JGZB 5DQVA 1H25B 1OI9B 2EUFA 2BKZB 4CFWB 4OB0B 4G6LB 2DD4B 4ROCA 1GUXB 2ZCFB 3BG9A 1FVVB 4RODA 2CYZB 2WMAB 1BU2A 3TNWB 3TNHB 2C5NB 1TD6A 2CJMB 4EORB 1OKWB 4BBRM 5FGKB 3HBLA 2KMGA 2AHJB 2W9FA 2BS3A 5CYIB 2WEVB 2IW9B 1N4MA 4CFUD 2W99A 2C5XB 5HBJB 4EOOB 2W9ZA 3DOGB 4ZGEB 2DPPB 4ELLA 3WVEB 1PKDB 4MFEA 4BCKB 2WPAB 1JKWA 2WIHB 3HZJA 1AD6A 3BHUB 5I5ZB 5ACBA 1JOWA 4HNUA 2BS2A 1OL2B 1VYWB 2KR6A 3DDPB 2ZPIB 2UUEB 4Z6YA 4IMYB 2ZPFB 4EOLB 1UNHD 2ZPBB 4ELJA 1GY3B 3VYHB 3A8HB 1H1PB 2WXVB 4EOQB 2C5OB 4OB2B 4NSTB 4JX5A 4BCGB 5HNBB 4JX6A 3A8OB 3F5XB 2CZ1B 1OGUB 1H26B 4NC6A 4UN0A 2WHBB 4OGRB 4CFVB 2G9XB 3K7AM 1UGRB 5LQFB 4MFDA 4EOMB 4YOOA 3VKHA 4JX4A 1AHJB 2QDYB 1E9HB 2D0QB 2ZZDB 4I3ZB 1UGQB 2WMBB 4QSHA 3HB9A 4CRLB 3BLQB 1H27B 3TNIB 4FM4B 4AKHA 2F2CA 2DXBB 4HLQA 4BCND 3M03A 3EIDB 2UZEB 3QZ5B 3X26B 5DQWA
chains in the Genus database with same CATH topology
4BCOB 1H4LD 2IVXA 4BCKB 2I40B 2QDJA 1FINB 1OIYB 4BCHB 3QHWB 4KRCB 1TFBA 2WPAB 3MY5B 1H28B 4KRDB 4Y72B 3BLHB 3EJ1B 1JKWA 4ROEA 2WIHB 2CCIB 4BCNB 2PK2A 3QHRB 1AD6A 3BLRB 4YC3B 3BHUB 4F6SB 1ZP2A 5I5ZB 5ACBA 4BCJB 2WFYB 1JOWA 1GH6B 1OL2B 4CFXB 5HVYB 5CEIB 1VYWB 2B9RA 1P5EB 1C9BA 3DDPB 2UZBB 1URCB 3MIAB 2UUEB 3RGFB 1O9KA 4IMYB 4EOLB 3MY1B 1OIUB 1O9KB 3DDQB 1UNHD 1H1SB 1H1RB 5IF1B 4ELJA 1GY3B 1VINA 4EOKB 2IW8B 4YOSA 5LMKB 4CFUB 1H1PB 2UZLB 2WXVB 4EOQB 5ICPB 2PHGA 4EC9B 2C5OB 1KXUA 4NSTB 4BCGB 3BHTB 3POMA 3TN8B 2BPMB 1JSTB 5HNBB 3O0GD 4BCQD 4F7JB 2IW6B 4F7SB 1JSUB 3G33B 4EOPB 1W98B 4CFNB 2PMIB 4EC8B 2R7GA 5HBHB 3F5XB 1UNGD 1OGUB 1H26B 4UN0A 4F70B 2WHBB 2JGZB 1H25B 2EUFA 1OI9B 2BKZB 4F6UB 4FX3B 4OGRB 1OL1B 1UNLD 4CFWB 4CFVB 2G9XB 4G6LB 4BCMD 1GUXA 4EOSB 3H4CA 4ROCA 3K7AM 4CFMB 1GUXB 3LQ5B 4BCQB 5LQFB 4EOMB 1G3NC 4YOOA 1FVVB 4RODA 1OKVB 2WMAB 1BU2A 3TNWB 4EOJB 5IDPB 2PK9B 4CXAB 2V22B 3TNHB 1D3UB 2C5NB 1E9HB 2I53A 4BCPB 2W2HA 4BCIB 4I3ZB 2CJMB 4EORB 1OKWB 1QMZB 2X1NB 2WIPB 2WMBB 5FGKB 5HQ0B 4II5B 4BCMB 5L2WB 2C6TB 3MI9B 2CCHB 2W9FA 5IDNB 4F7NB 4CRLB 5CYIB 2UZDB 4F7LB 3BLQB 1H27B 2WEVB 1F5QB 3TNIB 4F6WB 2IW9B 1N4MA 5EFQB 4OR5B 4CFUD 2W99A 1XO2A 5BNJB 1H1QB 4EOIB 1AISB 2C5XB 2F2CA 4TTHA 5HBJB 4EOOB 2W9ZA 4BCND 5HBEB 3EOCB 3M03A 4EONB 3DOGB 4YOZA 3EIDB 4ELLA 2UZEB 2C5VB 1PKDB 2C4GB 1VOLA 4BCFB 3BHVB 1H24B 2W96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BCO B;  1H4L D;  2IVX A;  4BCK B;  2I40 B;  2QDJ A;  1FIN B;  1OIY B;  4BCH B;  3QHW B;  4KRC B;  1TFB A;  2WPA B;  3MY5 B;  1H28 B;  4KRD B;  4Y72 B;  3BLH B;  3EJ1 B;  1JKW A;  4ROE A;  2WIH B;  2CCI B;  4BCN B;  2PK2 A;  3QHR B;  1AD6 A;  3BLR B;  4YC3 B;  3BHU B;  4F6S B;  1ZP2 A;  5I5Z B;  5ACB A;  4BCJ B;  2WFY B;  1JOW A;  1GH6 B;  1OL2 B;  4CFX B;  5HVY B;  5CEI B;  1VYW B;  2B9R A;  1P5E B;  1C9B A;  3DDP B;  2UZB B;  1URC B;  3MIA B;  2UUE B;  3RGF B;  1O9K A;  4IMY B;  4EOL B;  3MY1 B;  1OIU B;  1O9K B;  3DDQ B;  1UNH D;  1H1S B;  1H1R B;  5IF1 B;  4ELJ A;  1GY3 B;  1VIN A;  4EOK B;  2IW8 B;  4YOS A;  5LMK B;  4CFU B;  1H1P B;  2UZL B;  2WXV B;  4EOQ B;  5ICP B;  2PHG A;  4EC9 B;  2C5O B;  1KXU A;  4NST B;  4BCG B;  3BHT B;  3POM A;  3TN8 B;  2BPM B;  1JST B;  5HNB B;  3O0G D;  4BCQ D;  4F7J B;  2IW6 B;  4F7S B;  1JSU B;  3G33 B;  4EOP B;  1W98 B;  4CFN B;  2PMI B;  4EC8 B;  2R7G A;  5HBH B;  3F5X B;  1UNG D;  1OGU B;  1H26 B;  4UN0 A;  4F70 B;  2WHB B;  2JGZ B;  1H25 B;  2EUF A;  1OI9 B;  2BKZ B;  4F6U B;  4FX3 B;  4OGR B;  1OL1 B;  1UNL D;  4CFW B;  4CFV B;  2G9X B;  4G6L B;  4BCM D;  1GUX A;  4EOS B;  3H4C A;  4ROC A;  3K7A M;  4CFM B;  1GUX B;  3LQ5 B;  4BCQ B;  5LQF B;  4EOM B;  1G3N C;  4YOO A;  1FVV B;  4ROD A;  1OKV B;  2WMA B;  1BU2 A;  3TNW B;  4EOJ B;  5IDP B;  2PK9 B;  4CXA B;  2V22 B;  3TNH B;  1D3U B;  2C5N B;  1E9H B;  2I53 A;  4BCP B;  2W2H A;  4BCI B;  4I3Z B;  2CJM B;  4EOR B;  1OKW B;  1QMZ B;  2X1N B;  2WIP B;  2WMB B;  5FGK B;  5HQ0 B;  4II5 B;  4BCM B;  5L2W B;  2C6T B;  3MI9 B;  2CCH B;  2W9F A;  5IDN B;  4F7N B;  4CRL B;  5CYI B;  2UZD B;  4F7L B;  3BLQ B;  1H27 B;  2WEV B;  1F5Q B;  3TNI B;  4F6W B;  2IW9 B;  1N4M A;  5EFQ B;  4OR5 B;  4CFU D;  2W99 A;  1XO2 A;  5BNJ B;  1H1Q B;  4EOI B;  1AIS B;  2C5X B;  2F2C A;  4TTH A;  5HBJ B;  4EOO B;  2W9Z A;  4BCN D;  5HBE B;  3EOC B;  3M03 A;  4EON B;  3DOG B;  4YOZ A;  3EID B;  4ELL A;  2UZE B;  2C5V B;  1PKD B;  2C4G B;  1VOL A;  4BCF B;  3BHV B;  1H24 B;  2W96 A; 
#chains in the Genus database with same CATH topology
 4BCO B;  2IVX A;  3QYG B;  2I40 B;  2QDJ A;  3HO8 A;  1TFB A;  4Y72 B;  3BLH B;  4BCN B;  2PK2 A;  5HVY B;  1QLB A;  1URC B;  1O9K A;  3X25 B;  5IF1 B;  5LMK B;  4CFU B;  2UZL B;  2PHG A;  4EC9 B;  5EJC A;  1V29 B;  1JST B;  3O0G D;  4BCQ D;  1W98 B;  4CFN B;  2PMI B;  4EC8 B;  2R7G A;  1UNG D;  2WJ9 A;  3DL1 A;  3KHI A;  1E7P A;  4F6U B;  1UNL D;  1GUX A;  4EOS B;  3H4C A;  4BCQ B;  1G3N C;  1OKV B;  4CXA B;  4HNV A;  2I53 A;  4BCP B;  2W2H A;  4BCI B;  2WIP B;  5L2W B;  4II5 B;  2ZPG B;  2C6T B;  3MI9 B;  2CCH B;  4F7N B;  2UZD B;  4F6W B;  5EFQ B;  4AKG A;  5BNJ B;  1XO2 A;  4EOI B;  4TTH A;  2QGS A;  5HBE B;  4HNT A;  4EON B;  4BCF B;  1H24 B;  2W96 A;  1FKM A;  1H4L D;  4LOC A;  4BCH B;  1FIN B;  1OIY B;  3MY5 B;  4AKI A;  1H28 B;  4KRD B;  3HHT B;  3B57 A;  2CCI B;  3X24 B;  2CZ0 B;  3QWL A;  4MIM A;  4YC3 B;  1ZP2 A;  4OB1 B;  1IRE B;  3QYE A;  4CFX B;  3QZ9 B;  2B9R A;  1P5E B;  1C9B A;  4HL4 A;  2UZB B;  3RGF B;  3A8M B;  4BXX X;  3DTO A;  2DME A;  3DDQ B;  3X28 B;  1H1S B;  2IN3 A;  1VIN A;  3BG5 A;  4EOK B;  3GTM S;  5ICP B;  1KXU A;  2QFZ A;  2BS4 A;  3A8G B;  2G77 A;  3POM A;  3X20 B;  4OB3 B;  2IW6 B;  1JSU B;  3G33 B;  4BY1 X;  2PJQ A;  2ZPE B;  5HBH B;  4F70 B;  4FX3 B;  1OL1 B;  2LW4 A;  4BCM D;  4CFM B;  3LQ5 B;  4EOJ B;  5IDP B;  4AI6 A;  2PK9 B;  2QF7 A;  2V22 B;  1D3U B;  3DJB A;  2CZ7 B;  2CZ6 B;  5IHY A;  4ZGD B;  2X1N B;  1QMZ B;  4BCM B;  5HQ0 B;  3QXE B;  5IDN B;  4BY7 X;  4F7L B;  1F5Q B;  4OR5 B;  1H1Q B;  1AIS B;  3VKG A;  3EOC B;  3NDQ A;  1ENW A;  4YOZ A;  2C5V B;  3VYG B;  2C4G B;  1VOL A;  2ZPH B;  3WVD B;  3BHV B;  3QHW B;  4KRC B;  3EJ1 B;  4ROE A;  4ZGJ B;  3PO3 S;  3QHR B;  2QQ8 A;  3BLR B;  4F6S B;  4BCJ B;  2WFY B;  4BBS M;  1GH6 B;  5CEI B;  3QYB A;  3MIA B;  3A8L B;  3MY1 B;  1OIU B;  1O9K B;  2DD5 B;  1H1R B;  2IW8 B;  1UGS B;  4YOS A;  1UGP B;  3TW6 A;  3BHT B;  4M6V A;  3TN8 B;  2BPM B;  3TW7 A;  4F7J B;  4F7S B;  4EOP B;  2DXC B;  3QYH B;  3BG3 A;  2JGZ B;  5DQV A;  1H25 B;  1OI9 B;  2EUF A;  2BKZ B;  4CFW B;  4OB0 B;  4G6L B;  2DD4 B;  4ROC A;  1GUX B;  2ZCF B;  3BG9 A;  1FVV B;  4ROD A;  2CYZ B;  2WMA B;  1BU2 A;  3TNW B;  3TNH B;  2C5N B;  1TD6 A;  2CJM B;  4EOR B;  1OKW B;  4BBR M;  5FGK B;  3HBL A;  2KMG A;  2AHJ B;  2W9F A;  2BS3 A;  5CYI B;  2WEV B;  2IW9 B;  1N4M A;  4CFU D;  2W99 A;  2C5X B;  5HBJ B;  4EOO B;  2W9Z A;  3DOG B;  4ZGE B;  2DPP B;  4ELL A;  3WVE B;  1PKD B;  4MFE A;  4BCK B;  2WPA B;  1JKW A;  2WIH B;  3HZJ A;  1AD6 A;  3BHU B;  5I5Z B;  5ACB A;  1JOW A;  4HNU A;  2BS2 A;  1OL2 B;  1VYW B;  2KR6 A;  3DDP B;  2ZPI B;  2UUE B;  4Z6Y A;  4IMY B;  2ZPF B;  4EOL B;  1UNH D;  2ZPB B;  4ELJ A;  1GY3 B;  3VYH B;  3A8H B;  1H1P B;  2WXV B;  4EOQ B;  2C5O B;  4OB2 B;  4NST B;  4JX5 A;  4BCG B;  5HNB B;  4JX6 A;  3A8O B;  3F5X B;  2CZ1 B;  1OGU B;  1H26 B;  4NC6 A;  4UN0 A;  2WHB B;  4OGR B;  4CFV B;  2G9X B;  3K7A M;  1UGR B;  5LQF B;  4MFD A;  4EOM B;  4YOO A;  3VKH A;  4JX4 A;  1AHJ B;  2QDY B;  1E9H B;  2D0Q B;  2ZZD B;  4I3Z B;  1UGQ B;  2WMB B;  4QSH A;  3HB9 A;  4CRL B;  3BLQ B;  1H27 B;  3TNI B;  4FM4 B;  4AKH A;  2F2C A;  2DXB B;  4HLQ A;  4BCN D;  3M03 A;  3EID B;  2UZE B;  3QZ5 B;  3X26 B;  5DQW A; 
#chains in the Genus database with same CATH homology
 4BCO B;  1H4L D;  2IVX A;  4BCK B;  2I40 B;  2QDJ A;  1FIN B;  1OIY B;  4BCH B;  3QHW B;  4KRC B;  1TFB A;  2WPA B;  3MY5 B;  1H28 B;  4KRD B;  4Y72 B;  3BLH B;  3EJ1 B;  1JKW A;  4ROE A;  2WIH B;  2CCI B;  4BCN B;  2PK2 A;  3QHR B;  1AD6 A;  3BLR B;  4YC3 B;  3BHU B;  4F6S B;  1ZP2 A;  5I5Z B;  5ACB A;  4BCJ B;  2WFY B;  1JOW A;  1GH6 B;  1OL2 B;  4CFX B;  5HVY B;  5CEI B;  1VYW B;  2B9R A;  1P5E B;  1C9B A;  3DDP B;  2UZB B;  1URC B;  3MIA B;  2UUE B;  3RGF B;  1O9K A;  4IMY B;  4EOL B;  3MY1 B;  1OIU B;  1O9K B;  3DDQ B;  1UNH D;  1H1S B;  1H1R B;  5IF1 B;  4ELJ A;  1GY3 B;  1VIN A;  4EOK B;  2IW8 B;  4YOS A;  5LMK B;  4CFU B;  1H1P B;  2UZL B;  2WXV B;  4EOQ B;  5ICP B;  2PHG A;  4EC9 B;  2C5O B;  1KXU A;  4NST B;  4BCG B;  3BHT B;  3POM A;  3TN8 B;  2BPM B;  1JST B;  5HNB B;  3O0G D;  4BCQ D;  4F7J B;  2IW6 B;  4F7S B;  1JSU B;  3G33 B;  4EOP B;  1W98 B;  4CFN B;  2PMI B;  4EC8 B;  2R7G A;  5HBH B;  3F5X B;  1UNG D;  1OGU B;  1H26 B;  4UN0 A;  4F70 B;  2WHB B;  2JGZ B;  1H25 B;  2EUF A;  1OI9 B;  2BKZ B;  4F6U B;  4FX3 B;  4OGR B;  1OL1 B;  1UNL D;  4CFW B;  4CFV B;  2G9X B;  4G6L B;  4BCM D;  1GUX A;  4EOS B;  3H4C A;  4ROC A;  3K7A M;  4CFM B;  1GUX B;  3LQ5 B;  4BCQ B;  5LQF B;  4EOM B;  1G3N C;  4YOO A;  1FVV B;  4ROD A;  1OKV B;  2WMA B;  1BU2 A;  3TNW B;  4EOJ B;  5IDP B;  2PK9 B;  4CXA B;  2V22 B;  3TNH B;  1D3U B;  2C5N B;  1E9H B;  2I53 A;  4BCP B;  2W2H A;  4BCI B;  4I3Z B;  2CJM B;  4EOR B;  1OKW B;  1QMZ B;  2X1N B;  2WIP B;  2WMB B;  5FGK B;  5HQ0 B;  4II5 B;  4BCM B;  5L2W B;  2C6T B;  3MI9 B;  2CCH B;  2W9F A;  5IDN B;  4F7N B;  4CRL B;  5CYI B;  2UZD B;  4F7L B;  3BLQ B;  1H27 B;  2WEV B;  1F5Q B;  3TNI B;  4F6W B;  2IW9 B;  1N4M A;  5EFQ B;  4OR5 B;  4CFU D;  2W99 A;  1XO2 A;  5BNJ B;  1H1Q B;  4EOI B;  1AIS B;  2C5X B;  2F2C A;  4TTH A;  5HBJ B;  4EOO B;  2W9Z A;  4BCN D;  5HBE B;  3EOC B;  3M03 A;  4EON B;  3DOG B;  4YOZ A;  3EID B;  4ELL A;  2UZE B;  2C5V B;  1PKD B;  2C4G B;  1VOL A;  4BCF B;  3BHV B;  1H24 B;  2W96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...