3BHVB

Structure of phosphorylated thr160 cdk2/cyclin a in complex with the inhibitor variolin b
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
262
structure length
262
Chain Sequence
SVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein kinase 2
publication title Meriolins, a new class of cell death inducing kinase inhibitors with enhanced selectivity for cyclin-dependent kinases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 98
structure length 262
sequence length 262
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3bhvB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3bhvB02
1H28B 5CYIB 1TFBA 4F6UB 1E9HB 4BCNB 1OGUB 4TTHA 4EONB 3POMA 1QMZB 4F7SB 3LQ5B 5IDPB 3RGFB 3EOCB 2W2HA 1JKWA 3MY5B 1AD6A 4OGRB 4ROEA 4ELJA 1OL1B 1H26B 2WEVB 2W99A 4ROCA 1VYWB 3BLRB 2IVXA 4YOSA 2W96A 4BCQD 5HNBB 1O9KB 1FVVB 1GH6B 2WMAB 1H24B 4EOLB 3EJ1B 3TN8B 4BCGB 4EOSB 3BHUB 4BCIB 1OKVB 4F6SB 2UZLB 2C6TB 1H1QB 1VOLA 4RODA 1D3UB 2V22B 5IF1B 1AISB 1ZP2A 1GUXA 1OIYB 2WFYB 4F7JB 1H1RB 3MY1B 1FINB 1H1SB 4BCMB 1H1PB 2G9XB 1F5QB 3DOGB 4F70B 4ELLA 2WPAB 4EOQB 5HVYB 3M03A 2UZDB 5EFQB 4BCQB 2QDJA 2PMIB 2EUFA 2C5VB 3DDQB 3MIAB 1OKWB 4EOKB 4I3ZB 5LMKB 5HBHB 3F5XB 1JOWA 4IMYB 1VINA 3BHTB 1PKDB 2WMBB 1OIUB 2UZEB 2UUEB 2X1NB 2UZBB 2BKZB 5HBJB 4EC8B 1G3NC 1O9KA 2PK2A 4CFVB 1C9BA 2IW9B 3QHRB 1UNLD 2IW6B 5LQFB 2W9ZA 2CCHB 4BCPB 2WXVB 5ACBA 2C5NB 1BU2A 4KRCB 1XO2A 3H4CA 3QHWB 4CFUD 2PK9B 1JSUB 4F7NB 4F7LB 3O0GD 1JSTB 2I40B 3TNHB 4EC9B 4CRLB 4YOZA 3TNWB 4OR5B 2R7GA 2W9FA 1GY3B 1OI9B 2C5OB 1UNHD 2JGZB 2WHBB 3BHVB 4KRDB 2WIPB 5IDNB 1H4LD 1P5EB 4NSTB 1UNGD 2B9RA 4G6LB 4CFNB 2IW8B 4BCKB 4Y72B 4EOIB 4CFMB 5FGKB 4BCND 4EOOB 5CEIB 2C5XB 3BLHB 4BCHB 4FX3B 2BPMB 4F6WB 1URCB 1H27B 4II5B 4EOJB 2CJMB 3EIDB 2F2CA 4BCJB 5HQ0B 4BCOB 2C4GB 3G33B 3MI9B 4CFUB 5L2WB 4BCMD 1OL2B 3DDPB 2I53A 4UN0A 5ICPB 5BNJB 4EOMB 2WIHB 3K7AM 5HBEB 4CFXB 5I5ZB 2CCIB 4EORB 3TNIB 1H25B 2PHGA 1KXUA 4CFWB 1N4MA 1W98B 4BCFB 4EOPB 4CXAB 1GUXB 3BLQB 4YC3B 4YOOA
chains in the Genus database with same CATH superfamily
1UGSB 2ZPEB 1H28B 2LW4A 2IN3A 2D0QB 1JKWA 3MY5B 4ROEA 1VYWB 3BLRB 2IVXA 2ZZDB 3QYBA 1GH6B 1H24B 4ZGEB 4EOLB 1VOLA 4RODA 1D3UB 5IF1B 3QWLA 1OIYB 4BXXX 2KMGA 4OB0B 1H1PB 3A8MB 1QLBA 3VYGB 5EFQB 3DDQB 4I3ZB 3F5XB 4IMYB 1OIUB 2BKZB 2ZPHB 2W9ZA 2QFZA 2C5NB 1BU2A 2ZCFB 4HL4A 4KRCB 4EC9B 2QQ8A 4YOZA 2ZPFB 2R7GA 4Z6YA 2C5OB 2ZPBB 2JGZB 5IHYA 2DD4B 2BS3A 4CFNB 2IW8B 3VYHB 3QYHB 4OB3B 4CFMB 4EOJB 2ZPGB 4BCJB 4AKIA 2F2CA 3G33B 3MI9B 4MFEA 5L2WB 2WIHB 3TNIB 1H25B 4HLQA 1ENWA 3QYGB 4CFWB 3HHTB 1GUXB 4M6VA 4LOCA 3BG9A 5CYIB 2PJQA 1TFBA 3POMA 1QMZB 2BS2A 5IDPB 3RGFB 4HNVA 4ZGDB 1OL1B 3GTMS 4ROCA 4YOSA 2W96A 5HNBB 3X20B 3EJ1B 3BHUB 4BCIB 4F6SB 2C6TB 1AISB 3DL1A 2WFYB 4F7JB 1H1SB 4ELLA 4OB2B 3X24B 4BCQB 2PMIB 1OKWB 3WVDB 2DXBB 2WMBB 5HBJB 2UZEB 3HB9A 2UZBB 1G3NC 4CFVB 3QHRB 1UNLD 2IW6B 2ZPIB 3A8HB 4CFUD 3VKHA 4F7NB 2W9FA 1OI9B 2CZ0B 3A8GB 1P5EB 4NSTB 4AKHA 3TW6A 5FGKB 2CZ1B 4JX5A 2C5XB 3BLHB 2CZ6B 4FX3B 4F6WB 2BPMB 1H27B 4II5B 2CJMB 1UGQB 2I53A 3K7AM 5I5ZB 5EJCA 1KXUA 1N4MA 4YC3B 4YOOA 4F6UB 1E9HB 4BCNB 4TTHA 4EONB 3LQ5B 1TD6A 3X26B 1AD6A 3B57A 1O9KB 1FVVB 2WMAB 3TW7A 4EOSB 4BCGB 2UZLB 1H1QB 1IREB 1ZP2A 4JX4A 3VKGA 2DMEA 1GUXA 1H1RB 1E7PA 3MY1B 1FINB 2DXCB 4BCMB 1UGRB 2G9XB 1F5QB 3DOGB 4F70B 3A8OB 4EOQB 5HVYB 3M03A 2UZDB 2EUFA 4EOKB 5LMKB 3HBLA 5HBHB 5DQVA 2G77A 1JOWA 3BHTB 1PKDB 4EC8B 1AHJB 1C9BA 2PK2A 2IW9B 3NDQA 5LQFB 2CCHB 4BBRM 2WXVB 4AKGA 1XO2A 3X25B 3QHWB 2PK9B 3O0GD 2I40B 4OB1B 1GY3B 2WHBB 1UNHD 4KRDB 4ZGJB 3PO3S 5IDNB 4BCKB 4Y72B 3WVEB 4JX6A 2AHJB 2WJ9A 4BCOB 2C4GB 4BCMD 1OL2B 4UN0A 4NC6A 5HBEB 2CCIB 4FM4B 3BG5A 2PHGA 4BCFB 1W98B 4EOPB 3BLQB 5CEIB 3QXEB 1OGUB 4BY7X 3DJBA 4F7SB 5DQWA 3EOCB 2W2HA 4OGRB 2DPPB 4ELJA 2WEVB 1H26B 2W99A 4BCQD 4HNUA 1UGPB 2QF7A 3TN8B 1OKVB 2KR6A 2CZ7B 4MFDA 3QZ9B 2V22B 4BBSM 2BS4A 3HO8A 2WPAB 3KHIA 2QDJA 2C5VB 2CYZB 3MIAB 3QZ5B 3A8LB 3BG3A 3DTOA 1VINA 3HZJA 2X1NB 2UUEB 3X28B 1O9KA 4HNTA 4BCPB 5ACBA 3H4CA 1FKMA 1JSUB 2DD5B 4F7LB 1JSTB 3TNHB 4CRLB 3TNWB 4OR5B 3BHVB 2WIPB 1H4LD 1UNGD 2B9RA 4G6LB 4EOIB 4BCND 4EOOB 4BCHB 1V29B 1URCB 3EIDB 5HQ0B 2QGSA 4CFUB 3DDPB 5ICPB 5BNJB 4EOMB 4CFXB 3QYEA 4QSHA 2QDYB 4EORB 4MIMA 4AI6A 4CXAB 4BY1X
chains in the Genus database with same CATH topology
1H28B 5CYIB 1TFBA 4F6UB 1E9HB 4BCNB 1OGUB 4TTHA 4EONB 3POMA 1QMZB 4F7SB 3LQ5B 5IDPB 3RGFB 3EOCB 2W2HA 1JKWA 3MY5B 1AD6A 4OGRB 4ROEA 4ELJA 1OL1B 1H26B 2WEVB 2W99A 4ROCA 1VYWB 3BLRB 2IVXA 4YOSA 2W96A 4BCQD 5HNBB 1O9KB 1FVVB 1GH6B 2WMAB 1H24B 4EOLB 3EJ1B 3TN8B 4BCGB 4EOSB 3BHUB 4BCIB 1OKVB 4F6SB 2UZLB 2C6TB 1H1QB 1VOLA 4RODA 1D3UB 2V22B 5IF1B 1AISB 1ZP2A 1GUXA 1OIYB 2WFYB 4F7JB 1H1RB 3MY1B 1FINB 1H1SB 4BCMB 1H1PB 2G9XB 1F5QB 3DOGB 4F70B 4ELLA 2WPAB 4EOQB 5HVYB 3M03A 2UZDB 5EFQB 4BCQB 2QDJA 2PMIB 2EUFA 2C5VB 3DDQB 3MIAB 1OKWB 4EOKB 4I3ZB 5LMKB 5HBHB 3F5XB 1JOWA 4IMYB 1VINA 3BHTB 1PKDB 2WMBB 1OIUB 2UZEB 2UUEB 2X1NB 2UZBB 2BKZB 5HBJB 4EC8B 1G3NC 1O9KA 2PK2A 4CFVB 1C9BA 2IW9B 3QHRB 1UNLD 2IW6B 5LQFB 2W9ZA 2CCHB 4BCPB 2WXVB 5ACBA 2C5NB 1BU2A 4KRCB 1XO2A 3H4CA 3QHWB 4CFUD 2PK9B 1JSUB 4F7NB 4F7LB 3O0GD 1JSTB 2I40B 3TNHB 4EC9B 4CRLB 4YOZA 3TNWB 4OR5B 2R7GA 2W9FA 1GY3B 1OI9B 2C5OB 1UNHD 2JGZB 2WHBB 3BHVB 4KRDB 2WIPB 5IDNB 1H4LD 1P5EB 4NSTB 1UNGD 2B9RA 4G6LB 4CFNB 2IW8B 4BCKB 4Y72B 4EOIB 4CFMB 5FGKB 4BCND 4EOOB 5CEIB 2C5XB 3BLHB 4BCHB 4FX3B 2BPMB 4F6WB 1URCB 1H27B 4II5B 4EOJB 2CJMB 3EIDB 2F2CA 4BCJB 5HQ0B 4BCOB 2C4GB 3G33B 3MI9B 4CFUB 5L2WB 4BCMD 1OL2B 3DDPB 2I53A 4UN0A 5ICPB 5BNJB 4EOMB 2WIHB 3K7AM 5HBEB 4CFXB 5I5ZB 2CCIB 4EORB 3TNIB 1H25B 2PHGA 1KXUA 4CFWB 1N4MA 1W98B 4BCFB 4EOPB 4CXAB 1GUXB 3BLQB 4YC3B 4YOOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H28 B;  5CYI B;  1TFB A;  4F6U B;  1E9H B;  4BCN B;  1OGU B;  4TTH A;  4EON B;  3POM A;  1QMZ B;  4F7S B;  3LQ5 B;  5IDP B;  3RGF B;  3EOC B;  2W2H A;  1JKW A;  3MY5 B;  1AD6 A;  4OGR B;  4ROE A;  4ELJ A;  1OL1 B;  1H26 B;  2WEV B;  2W99 A;  4ROC A;  1VYW B;  3BLR B;  2IVX A;  4YOS A;  2W96 A;  4BCQ D;  5HNB B;  1O9K B;  1FVV B;  1GH6 B;  2WMA B;  1H24 B;  4EOL B;  3EJ1 B;  3TN8 B;  4BCG B;  4EOS B;  3BHU B;  4BCI B;  1OKV B;  4F6S B;  2UZL B;  2C6T B;  1H1Q B;  1VOL A;  4ROD A;  1D3U B;  2V22 B;  5IF1 B;  1AIS B;  1ZP2 A;  1GUX A;  1OIY B;  2WFY B;  4F7J B;  1H1R B;  3MY1 B;  1FIN B;  1H1S B;  4BCM B;  1H1P B;  2G9X B;  1F5Q B;  3DOG B;  4F70 B;  4ELL A;  2WPA B;  4EOQ B;  5HVY B;  3M03 A;  2UZD B;  5EFQ B;  4BCQ B;  2QDJ A;  2PMI B;  2EUF A;  2C5V B;  3DDQ B;  3MIA B;  1OKW B;  4EOK B;  4I3Z B;  5LMK B;  5HBH B;  3F5X B;  1JOW A;  4IMY B;  1VIN A;  3BHT B;  1PKD B;  2WMB B;  1OIU B;  2UZE B;  2UUE B;  2X1N B;  2UZB B;  2BKZ B;  5HBJ B;  4EC8 B;  1G3N C;  1O9K A;  2PK2 A;  4CFV B;  1C9B A;  2IW9 B;  3QHR B;  1UNL D;  2IW6 B;  5LQF B;  2W9Z A;  2CCH B;  4BCP B;  2WXV B;  5ACB A;  2C5N B;  1BU2 A;  4KRC B;  1XO2 A;  3H4C A;  3QHW B;  4CFU D;  2PK9 B;  1JSU B;  4F7N B;  4F7L B;  3O0G D;  1JST B;  2I40 B;  3TNH B;  4EC9 B;  4CRL B;  4YOZ A;  3TNW B;  4OR5 B;  2R7G A;  2W9F A;  1GY3 B;  1OI9 B;  2C5O B;  1UNH D;  2JGZ B;  2WHB B;  3BHV B;  4KRD B;  2WIP B;  5IDN B;  1H4L D;  1P5E B;  4NST B;  1UNG D;  2B9R A;  4G6L B;  4CFN B;  2IW8 B;  4BCK B;  4Y72 B;  4EOI B;  4CFM B;  5FGK B;  4BCN D;  4EOO B;  5CEI B;  2C5X B;  3BLH B;  4BCH B;  4FX3 B;  2BPM B;  4F6W B;  1URC B;  1H27 B;  4II5 B;  4EOJ B;  2CJM B;  3EID B;  2F2C A;  4BCJ B;  5HQ0 B;  4BCO B;  2C4G B;  3G33 B;  3MI9 B;  4CFU B;  5L2W B;  4BCM D;  1OL2 B;  3DDP B;  2I53 A;  4UN0 A;  5ICP B;  5BNJ B;  4EOM B;  2WIH B;  3K7A M;  5HBE B;  4CFX B;  5I5Z B;  2CCI B;  4EOR B;  3TNI B;  1H25 B;  2PHG A;  1KXU A;  4CFW B;  1N4M A;  1W98 B;  4BCF B;  4EOP B;  4CXA B;  1GUX B;  3BLQ B;  4YC3 B;  4YOO A; 
#chains in the Genus database with same CATH topology
 1UGS B;  2ZPE B;  1H28 B;  2LW4 A;  2IN3 A;  2D0Q B;  1JKW A;  3MY5 B;  4ROE A;  1VYW B;  3BLR B;  2IVX A;  2ZZD B;  3QYB A;  1GH6 B;  1H24 B;  4ZGE B;  4EOL B;  1VOL A;  4ROD A;  1D3U B;  5IF1 B;  3QWL A;  1OIY B;  4BXX X;  2KMG A;  4OB0 B;  1H1P B;  3A8M B;  1QLB A;  3VYG B;  5EFQ B;  3DDQ B;  4I3Z B;  3F5X B;  4IMY B;  1OIU B;  2BKZ B;  2ZPH B;  2W9Z A;  2QFZ A;  2C5N B;  1BU2 A;  2ZCF B;  4HL4 A;  4KRC B;  4EC9 B;  2QQ8 A;  4YOZ A;  2ZPF B;  2R7G A;  4Z6Y A;  2C5O B;  2ZPB B;  2JGZ B;  5IHY A;  2DD4 B;  2BS3 A;  4CFN B;  2IW8 B;  3VYH B;  3QYH B;  4OB3 B;  4CFM B;  4EOJ B;  2ZPG B;  4BCJ B;  4AKI A;  2F2C A;  3G33 B;  3MI9 B;  4MFE A;  5L2W B;  2WIH B;  3TNI B;  1H25 B;  4HLQ A;  1ENW A;  3QYG B;  4CFW B;  3HHT B;  1GUX B;  4M6V A;  4LOC A;  3BG9 A;  5CYI B;  2PJQ A;  1TFB A;  3POM A;  1QMZ B;  2BS2 A;  5IDP B;  3RGF B;  4HNV A;  4ZGD B;  1OL1 B;  3GTM S;  4ROC A;  4YOS A;  2W96 A;  5HNB B;  3X20 B;  3EJ1 B;  3BHU B;  4BCI B;  4F6S B;  2C6T B;  1AIS B;  3DL1 A;  2WFY B;  4F7J B;  1H1S B;  4ELL A;  4OB2 B;  3X24 B;  4BCQ B;  2PMI B;  1OKW B;  3WVD B;  2DXB B;  2WMB B;  5HBJ B;  2UZE B;  3HB9 A;  2UZB B;  1G3N C;  4CFV B;  3QHR B;  1UNL D;  2IW6 B;  2ZPI B;  3A8H B;  4CFU D;  3VKH A;  4F7N B;  2W9F A;  1OI9 B;  2CZ0 B;  3A8G B;  1P5E B;  4NST B;  4AKH A;  3TW6 A;  5FGK B;  2CZ1 B;  4JX5 A;  2C5X B;  3BLH B;  2CZ6 B;  4FX3 B;  4F6W B;  2BPM B;  1H27 B;  4II5 B;  2CJM B;  1UGQ B;  2I53 A;  3K7A M;  5I5Z B;  5EJC A;  1KXU A;  1N4M A;  4YC3 B;  4YOO A;  4F6U B;  1E9H B;  4BCN B;  4TTH A;  4EON B;  3LQ5 B;  1TD6 A;  3X26 B;  1AD6 A;  3B57 A;  1O9K B;  1FVV B;  2WMA B;  3TW7 A;  4EOS B;  4BCG B;  2UZL B;  1H1Q B;  1IRE B;  1ZP2 A;  4JX4 A;  3VKG A;  2DME A;  1GUX A;  1H1R B;  1E7P A;  3MY1 B;  1FIN B;  2DXC B;  4BCM B;  1UGR B;  2G9X B;  1F5Q B;  3DOG B;  4F70 B;  3A8O B;  4EOQ B;  5HVY B;  3M03 A;  2UZD B;  2EUF A;  4EOK B;  5LMK B;  3HBL A;  5HBH B;  5DQV A;  2G77 A;  1JOW A;  3BHT B;  1PKD B;  4EC8 B;  1AHJ B;  1C9B A;  2PK2 A;  2IW9 B;  3NDQ A;  5LQF B;  2CCH B;  4BBR M;  2WXV B;  4AKG A;  1XO2 A;  3X25 B;  3QHW B;  2PK9 B;  3O0G D;  2I40 B;  4OB1 B;  1GY3 B;  2WHB B;  1UNH D;  4KRD B;  4ZGJ B;  3PO3 S;  5IDN B;  4BCK B;  4Y72 B;  3WVE B;  4JX6 A;  2AHJ B;  2WJ9 A;  4BCO B;  2C4G B;  4BCM D;  1OL2 B;  4UN0 A;  4NC6 A;  5HBE B;  2CCI B;  4FM4 B;  3BG5 A;  2PHG A;  4BCF B;  1W98 B;  4EOP B;  3BLQ B;  5CEI B;  3QXE B;  1OGU B;  4BY7 X;  3DJB A;  4F7S B;  5DQW A;  3EOC B;  2W2H A;  4OGR B;  2DPP B;  4ELJ A;  2WEV B;  1H26 B;  2W99 A;  4BCQ D;  4HNU A;  1UGP B;  2QF7 A;  3TN8 B;  1OKV B;  2KR6 A;  2CZ7 B;  4MFD A;  3QZ9 B;  2V22 B;  4BBS M;  2BS4 A;  3HO8 A;  2WPA B;  3KHI A;  2QDJ A;  2C5V B;  2CYZ B;  3MIA B;  3QZ5 B;  3A8L B;  3BG3 A;  3DTO A;  1VIN A;  3HZJ A;  2X1N B;  2UUE B;  3X28 B;  1O9K A;  4HNT A;  4BCP B;  5ACB A;  3H4C A;  1FKM A;  1JSU B;  2DD5 B;  4F7L B;  1JST B;  3TNH B;  4CRL B;  3TNW B;  4OR5 B;  3BHV B;  2WIP B;  1H4L D;  1UNG D;  2B9R A;  4G6L B;  4EOI B;  4BCN D;  4EOO B;  4BCH B;  1V29 B;  1URC B;  3EID B;  5HQ0 B;  2QGS A;  4CFU B;  3DDP B;  5ICP B;  5BNJ B;  4EOM B;  4CFX B;  3QYE A;  4QSH A;  2QDY B;  4EOR B;  4MIM A;  4AI6 A;  4CXA B;  4BY1 X; 
#chains in the Genus database with same CATH homology
 1H28 B;  5CYI B;  1TFB A;  4F6U B;  1E9H B;  4BCN B;  1OGU B;  4TTH A;  4EON B;  3POM A;  1QMZ B;  4F7S B;  3LQ5 B;  5IDP B;  3RGF B;  3EOC B;  2W2H A;  1JKW A;  3MY5 B;  1AD6 A;  4OGR B;  4ROE A;  4ELJ A;  1OL1 B;  1H26 B;  2WEV B;  2W99 A;  4ROC A;  1VYW B;  3BLR B;  2IVX A;  4YOS A;  2W96 A;  4BCQ D;  5HNB B;  1O9K B;  1FVV B;  1GH6 B;  2WMA B;  1H24 B;  4EOL B;  3EJ1 B;  3TN8 B;  4BCG B;  4EOS B;  3BHU B;  4BCI B;  1OKV B;  4F6S B;  2UZL B;  2C6T B;  1H1Q B;  1VOL A;  4ROD A;  1D3U B;  2V22 B;  5IF1 B;  1AIS B;  1ZP2 A;  1GUX A;  1OIY B;  2WFY B;  4F7J B;  1H1R B;  3MY1 B;  1FIN B;  1H1S B;  4BCM B;  1H1P B;  2G9X B;  1F5Q B;  3DOG B;  4F70 B;  4ELL A;  2WPA B;  4EOQ B;  5HVY B;  3M03 A;  2UZD B;  5EFQ B;  4BCQ B;  2QDJ A;  2PMI B;  2EUF A;  2C5V B;  3DDQ B;  3MIA B;  1OKW B;  4EOK B;  4I3Z B;  5LMK B;  5HBH B;  3F5X B;  1JOW A;  4IMY B;  1VIN A;  3BHT B;  1PKD B;  2WMB B;  1OIU B;  2UZE B;  2UUE B;  2X1N B;  2UZB B;  2BKZ B;  5HBJ B;  4EC8 B;  1G3N C;  1O9K A;  2PK2 A;  4CFV B;  1C9B A;  2IW9 B;  3QHR B;  1UNL D;  2IW6 B;  5LQF B;  2W9Z A;  2CCH B;  4BCP B;  2WXV B;  5ACB A;  2C5N B;  1BU2 A;  4KRC B;  1XO2 A;  3H4C A;  3QHW B;  4CFU D;  2PK9 B;  1JSU B;  4F7N B;  4F7L B;  3O0G D;  1JST B;  2I40 B;  3TNH B;  4EC9 B;  4CRL B;  4YOZ A;  3TNW B;  4OR5 B;  2R7G A;  2W9F A;  1GY3 B;  1OI9 B;  2C5O B;  1UNH D;  2JGZ B;  2WHB B;  3BHV B;  4KRD B;  2WIP B;  5IDN B;  1H4L D;  1P5E B;  4NST B;  1UNG D;  2B9R A;  4G6L B;  4CFN B;  2IW8 B;  4BCK B;  4Y72 B;  4EOI B;  4CFM B;  5FGK B;  4BCN D;  4EOO B;  5CEI B;  2C5X B;  3BLH B;  4BCH B;  4FX3 B;  2BPM B;  4F6W B;  1URC B;  1H27 B;  4II5 B;  4EOJ B;  2CJM B;  3EID B;  2F2C A;  4BCJ B;  5HQ0 B;  4BCO B;  2C4G B;  3G33 B;  3MI9 B;  4CFU B;  5L2W B;  4BCM D;  1OL2 B;  3DDP B;  2I53 A;  4UN0 A;  5ICP B;  5BNJ B;  4EOM B;  2WIH B;  3K7A M;  5HBE B;  4CFX B;  5I5Z B;  2CCI B;  4EOR B;  3TNI B;  1H25 B;  2PHG A;  1KXU A;  4CFW B;  1N4M A;  1W98 B;  4BCF B;  4EOP B;  4CXA B;  1GUX B;  3BLQ B;  4YC3 B;  4YOO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...