3BHVB

Structure of phosphorylated thr160 cdk2/cyclin a in complex with the inhibitor variolin b
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
262
structure length
262
Chain Sequence
b'SVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein kinase 2
publication title Meriolins, a new class of cell death inducing kinase inhibitors with enhanced selectivity for cyclin-dependent kinases
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 98
structure length 262
sequence length 262
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3bhvB01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3bhvB02
2PK2A 1H1PB 4EOJB 2C5VB 1URCB 3DDPB 4I3ZB 2IVXA 4BCOB 3EJ1B 3MY5B 1P5EB 1N4MA 5IDPB 1OI9B 1FINB 2C5NB 2CCIB 5HBJB 2UZDB 5LMKB 1VINA 2PMIB 3K7AM 2BKZB 4BCND 1PKDB 2WMAB 1JSUB 4BCNB 4BCJB 4F7SB 5I5ZB 3H4CA 4OGRB 4CFMB 1AISB 1O9KA 2UUEB 1JKWA 2WPAB 2WIPB 3EIDB 2PK9B 3MI9B 4KRDB 4NSTB 4BCPB 4BCIB 1H28B 1GUXB 3MIAB 4II5B 4F6WB 3O0GD 4BCKB 2BPMB 1OIYB 2I53A 1UNLD 5ACBA 5HBEB 1VOLA 1E9HB 4RODA 4BCGB 2G9XB 5CEIB 3MY1B 2WFYB 2R7GA 4EC8B 1TFBA 2B9RA 1OKVB 2UZEB 4KRCB 4YOZA 1D3UB 4ROEA 2W9FA 4EOSB 2WMBB 4UN0A 3BHVB 3M03A 1H4LD 1G3NC 2I40B 4CRLB 4EOKB 2IW8B 4F70B 4IMYB 4TTHA 3QHWB 1H1SB 3POMA 4CXAB 4F7NB 2PHGA 2C5XB 4BCHB 4EORB 3DOGB 4ELJA 4BCQD 1GH6B 1F5QB 1O9KB 2WIHB 1JOWA 2C6TB 4EONB 1H1RB 2UZLB 4G6LB 3F5XB 2W99A 2C4GB 2X1NB 5LQFB 1VYWB 5HQ0B 5FGKB 1GY3B 1QMZB 2CJMB 5CYIB 1OGUB 2CCHB 1ZP2A 4Y72B 4ELLA 3LQ5B 5HVYB 1OL2B 1W98B 3DDQB 2EUFA 2IW6B 4YOOA 1AD6A 3TNHB 4F6SB 3QHRB 2W96A 2JGZB 1UNGD 3TNIB 5BNJB 4EOOB 1H24B 4BCMD 4YC3B 5HNBB 4BCQB 4BCMB 4FX3B 3TN8B 3BHTB 2W2HA 3BLQB 3BHUB 4EOPB 1JSTB 4EOQB 5L2WB 2W9ZA 2QDJA 4ROCA 2V22B 3BLHB 3RGFB 1KXUA 1OL1B 4BCFB 1H25B 1OKWB 4CFUD 1H26B 1FVVB 5IF1B 4EOLB 4CFUB 2UZBB 4EC9B 2WEVB 5IDNB 1H1QB 4EOMB 2WHBB 1OIUB 1BU2A 3EOCB 1XO2A 3TNWB 3BLRB 4F7JB 4F7LB 2IW9B 5EFQB 1UNHD 4CFWB 2WXVB 4EOIB 4YOSA 1GUXA 2F2CA 4CFVB 1C9BA 5ICPB 4CFXB 1H27B 3G33B 4OR5B 2C5OB 4CFNB 5HBHB 4F6UB
chains in the Genus database with same CATH superfamily
4BBSM 2C5VB 1URCB 4I3ZB 2DXCB 1P5EB 2UZDB 5LMKB 2BKZB 3QZ5B 4F7SB 4BCNB 4JX4A 1AISB 3QXEB 2UUEB 2WPAB 4NSTB 2BS4A 4ZGEB 3DL1A 5HBEB 4MFEA 2G9XB 3QZ9B 1TD6A 1AHJB 2CZ6B 4KRCB 4UN0A 1UGQB 1G3NC 2LW4A 4CRLB 4IMYB 4CXAB 1F5QB 4OB3B 1JOWA 2C6TB 2ZPFB 1H1RB 4HNTA 5FGKB 3A8OB 4LOCA 1W98B 3DDQB 1E7PA 4OB1B 1AD6A 3TNHB 2JGZB 2IN3A 3WVDB 1H24B 3BG3A 3BHUB 1JSTB 4EOQB 4FM4B 3TW7A 3BG9A 3A8GB 4EOLB 4CFUB 5IDNB 1H1QB 4AKHA 1BU2A 2ZCFB 4F7LB 5EFQB 1GUXA 2F2CA 1C9BA 3X26B 2ZPEB 3HZJA 2QQ8A 2ZZDB 4MFDA 3X25B 2QDYB 3DDPB 2IVXA 1IREB 4HNUA 3MY5B 3VKHA 1FINB 2C5NB 4JX6A 3HO8A 4BCND 1PKDB 4BY1X 2WIPB 3EIDB 4BY7X 4KRDB 4BCPB 1GUXB 4BCKB 2BPMB 1OIYB 3QYEA 1VOLA 2R7GA 1UGPB 1OKVB 3A8LB 2W9FA 4EOSB 2WMBB 3BHVB 2I40B 4F70B 5EJCA 2ZPIB 2PHGA 3QYHB 4BCQD 2WIHB 2UZLB 3QYBA 3F5XB 3HBLA 5LQFB 4QSHA 1QMZB 5CYIB 4BXXX 1ZP2A 2D0QB 2ZPBB 4YOOA 2WJ9A 3QHRB 1UNGD 3GTMS 2DXBB 4YC3B 5HNBB 4BCQB 4NC6A 4BCMB 4FX3B 3TN8B 5L2WB 3PO3S 2QDJA 2DD4B 1OL1B 4BCFB 1H25B 4CFUD 5IF1B 4EOMB 1OIUB 3EOCB 3QYGB 2IW9B 2KMGA 2WXVB 4EOIB 3X20B 3DJBA 2CZ7B 4CFXB 3KHIA 2C5OB 4CFNB 4F6UB 2PK2A 4EOJB 3X24B 1OI9B 2CCIB 3B57A 1VINA 2PMIB 3K7AM 2CZ1B 3WVEB 3H4CA 5DQWA 4CFMB 3VKGA 1O9KA 3A8HB 4BCIB 3MIAB 4F6WB 3O0GD 2I53A 1E9HB 4RODA 4BCGB 5CEIB 4OB2B 4EC8B 1TFBA 2B9RA 4MIMA 4YOZA 2DMEA 1UGSB 2G77A 2IW8B 1H1SB 4F7NB 2C5XB 4EORB 3DOGB 4HLQA 2BS2A 3HB9A 1O9KB 4G6LB 2X1NB 2DD5B 2CCHB 4Y72B 4ELLA 5DQVA 1OL2B 2AHJB 2IW6B 1FKMA 4AKIA 2W96A 2DPPB 4BCMD 4AKGA 3BHTB 1UGRB 2W2HA 3BLQB 4EOPB 1QLBA 2V22B 3BLHB 3RGFB 1OKWB 1H26B 1FVVB 4EC9B 1V29B 2WHBB 3BLRB 4BBRM 1UNHD 4CFWB 4M6VA 1H27B 4Z6YA 4OR5B 4CFVB 1H1PB 2PJQA 4BCOB 3TW6A 3NDQA 3EJ1B 5IDPB 1N4MA 5HBJB 2WMAB 1JSUB 2QF7A 4BCJB 5I5ZB 1ENWA 4OGRB 4ZGJB 1JKWA 2PK9B 4AI6A 3MI9B 2QGSA 1H28B 4II5B 3DTOA 2QFZA 1UNLD 5ACBA 3MY1B 2WFYB 2KR6A 3VYGB 2UZEB 1D3UB 4ROEA 3M03A 1H4LD 4EOKB 4TTHA 3QHWB 3POMA 3VYHB 3X28B 4BCHB 4ZGDB 4ELJA 1GH6B 2ZPGB 4EONB 2ZPHB 2W99A 2C4GB 4HL4A 1VYWB 5HQ0B 1GY3B 2CJMB 1OGUB 2CZ0B 3LQ5B 5HVYB 2EUFA 3BG5A 4F6SB 3A8MB 3QWLA 2BS3A 4HNVA 3TNIB 5BNJB 4EOOB 2W9ZA 4ROCA 1KXUA 4OB0B 2UZBB 2WEVB 1XO2A 3TNWB 5IHYA 4F7JB 4YOSA 5ICPB 3G33B 2CYZB 4JX5A 3HHTB 5HBHB
chains in the Genus database with same CATH topology
2PK2A 1H1PB 4EOJB 2C5VB 1URCB 3DDPB 4I3ZB 2IVXA 4BCOB 3EJ1B 3MY5B 1P5EB 1N4MA 5IDPB 1OI9B 1FINB 2C5NB 2CCIB 5HBJB 2UZDB 5LMKB 1VINA 2PMIB 3K7AM 2BKZB 4BCND 1PKDB 2WMAB 1JSUB 4BCNB 4BCJB 4F7SB 5I5ZB 3H4CA 4OGRB 4CFMB 1AISB 1O9KA 2UUEB 1JKWA 2WPAB 2WIPB 3EIDB 2PK9B 3MI9B 4KRDB 4NSTB 4BCPB 4BCIB 1H28B 1GUXB 3MIAB 4II5B 4F6WB 3O0GD 4BCKB 2BPMB 1OIYB 2I53A 1UNLD 5ACBA 5HBEB 1VOLA 1E9HB 4RODA 4BCGB 2G9XB 5CEIB 3MY1B 2WFYB 2R7GA 4EC8B 1TFBA 2B9RA 1OKVB 2UZEB 4KRCB 4YOZA 1D3UB 4ROEA 2W9FA 4EOSB 2WMBB 4UN0A 3BHVB 3M03A 1H4LD 1G3NC 2I40B 4CRLB 4EOKB 2IW8B 4F70B 4IMYB 4TTHA 3QHWB 1H1SB 3POMA 4CXAB 4F7NB 2PHGA 2C5XB 4BCHB 4EORB 3DOGB 4ELJA 4BCQD 1GH6B 1F5QB 1O9KB 2WIHB 1JOWA 2C6TB 4EONB 1H1RB 2UZLB 4G6LB 3F5XB 2W99A 2C4GB 2X1NB 5LQFB 1VYWB 5HQ0B 5FGKB 1GY3B 1QMZB 2CJMB 5CYIB 1OGUB 2CCHB 1ZP2A 4Y72B 4ELLA 3LQ5B 5HVYB 1OL2B 1W98B 3DDQB 2EUFA 2IW6B 4YOOA 1AD6A 3TNHB 4F6SB 3QHRB 2W96A 2JGZB 1UNGD 3TNIB 5BNJB 4EOOB 1H24B 4BCMD 4YC3B 5HNBB 4BCQB 4BCMB 4FX3B 3TN8B 3BHTB 2W2HA 3BLQB 3BHUB 4EOPB 1JSTB 4EOQB 5L2WB 2W9ZA 2QDJA 4ROCA 2V22B 3BLHB 3RGFB 1KXUA 1OL1B 4BCFB 1H25B 1OKWB 4CFUD 1H26B 1FVVB 5IF1B 4EOLB 4CFUB 2UZBB 4EC9B 2WEVB 5IDNB 1H1QB 4EOMB 2WHBB 1OIUB 1BU2A 3EOCB 1XO2A 3TNWB 3BLRB 4F7JB 4F7LB 2IW9B 5EFQB 1UNHD 4CFWB 2WXVB 4EOIB 4YOSA 1GUXA 2F2CA 4CFVB 1C9BA 5ICPB 4CFXB 1H27B 3G33B 4OR5B 2C5OB 4CFNB 5HBHB 4F6UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PK2 A;  1H1P B;  4EOJ B;  2C5V B;  1URC B;  3DDP B;  4I3Z B;  2IVX A;  4BCO B;  3EJ1 B;  3MY5 B;  1P5E B;  1N4M A;  5IDP B;  1OI9 B;  1FIN B;  2C5N B;  2CCI B;  5HBJ B;  2UZD B;  5LMK B;  1VIN A;  2PMI B;  3K7A M;  2BKZ B;  4BCN D;  1PKD B;  2WMA B;  1JSU B;  4BCN B;  4BCJ B;  4F7S B;  5I5Z B;  3H4C A;  4OGR B;  4CFM B;  1AIS B;  1O9K A;  2UUE B;  1JKW A;  2WPA B;  2WIP B;  3EID B;  2PK9 B;  3MI9 B;  4KRD B;  4NST B;  4BCP B;  4BCI B;  1H28 B;  1GUX B;  3MIA B;  4II5 B;  4F6W B;  3O0G D;  4BCK B;  2BPM B;  1OIY B;  2I53 A;  1UNL D;  5ACB A;  5HBE B;  1VOL A;  1E9H B;  4ROD A;  4BCG B;  2G9X B;  5CEI B;  3MY1 B;  2WFY B;  2R7G A;  4EC8 B;  1TFB A;  2B9R A;  1OKV B;  2UZE B;  4KRC B;  4YOZ A;  1D3U B;  4ROE A;  2W9F A;  4EOS B;  2WMB B;  4UN0 A;  3BHV B;  3M03 A;  1H4L D;  1G3N C;  2I40 B;  4CRL B;  4EOK B;  2IW8 B;  4F70 B;  4IMY B;  4TTH A;  3QHW B;  1H1S B;  3POM A;  4CXA B;  4F7N B;  2PHG A;  2C5X B;  4BCH B;  4EOR B;  3DOG B;  4ELJ A;  4BCQ D;  1GH6 B;  1F5Q B;  1O9K B;  2WIH B;  1JOW A;  2C6T B;  4EON B;  1H1R B;  2UZL B;  4G6L B;  3F5X B;  2W99 A;  2C4G B;  2X1N B;  5LQF B;  1VYW B;  5HQ0 B;  5FGK B;  1GY3 B;  1QMZ B;  2CJM B;  5CYI B;  1OGU B;  2CCH B;  1ZP2 A;  4Y72 B;  4ELL A;  3LQ5 B;  5HVY B;  1OL2 B;  1W98 B;  3DDQ B;  2EUF A;  2IW6 B;  4YOO A;  1AD6 A;  3TNH B;  4F6S B;  3QHR B;  2W96 A;  2JGZ B;  1UNG D;  3TNI B;  5BNJ B;  4EOO B;  1H24 B;  4BCM D;  4YC3 B;  5HNB B;  4BCQ B;  4BCM B;  4FX3 B;  3TN8 B;  3BHT B;  2W2H A;  3BLQ B;  3BHU B;  4EOP B;  1JST B;  4EOQ B;  5L2W B;  2W9Z A;  2QDJ A;  4ROC A;  2V22 B;  3BLH B;  3RGF B;  1KXU A;  1OL1 B;  4BCF B;  1H25 B;  1OKW B;  4CFU D;  1H26 B;  1FVV B;  5IF1 B;  4EOL B;  4CFU B;  2UZB B;  4EC9 B;  2WEV B;  5IDN B;  1H1Q B;  4EOM B;  2WHB B;  1OIU B;  1BU2 A;  3EOC B;  1XO2 A;  3TNW B;  3BLR B;  4F7J B;  4F7L B;  2IW9 B;  5EFQ B;  1UNH D;  4CFW B;  2WXV B;  4EOI B;  4YOS A;  1GUX A;  2F2C A;  4CFV B;  1C9B A;  5ICP B;  4CFX B;  1H27 B;  3G33 B;  4OR5 B;  2C5O B;  4CFN B;  5HBH B;  4F6U B; 
#chains in the Genus database with same CATH topology
 4BBS M;  2C5V B;  1URC B;  4I3Z B;  2DXC B;  1P5E B;  2UZD B;  5LMK B;  2BKZ B;  3QZ5 B;  4F7S B;  4BCN B;  4JX4 A;  1AIS B;  3QXE B;  2UUE B;  2WPA B;  4NST B;  2BS4 A;  4ZGE B;  3DL1 A;  5HBE B;  4MFE A;  2G9X B;  3QZ9 B;  1TD6 A;  1AHJ B;  2CZ6 B;  4KRC B;  4UN0 A;  1UGQ B;  1G3N C;  2LW4 A;  4CRL B;  4IMY B;  4CXA B;  1F5Q B;  4OB3 B;  1JOW A;  2C6T B;  2ZPF B;  1H1R B;  4HNT A;  5FGK B;  3A8O B;  4LOC A;  1W98 B;  3DDQ B;  1E7P A;  4OB1 B;  1AD6 A;  3TNH B;  2JGZ B;  2IN3 A;  3WVD B;  1H24 B;  3BG3 A;  3BHU B;  1JST B;  4EOQ B;  4FM4 B;  3TW7 A;  3BG9 A;  3A8G B;  4EOL B;  4CFU B;  5IDN B;  1H1Q B;  4AKH A;  1BU2 A;  2ZCF B;  4F7L B;  5EFQ B;  1GUX A;  2F2C A;  1C9B A;  3X26 B;  2ZPE B;  3HZJ A;  2QQ8 A;  2ZZD B;  4MFD A;  3X25 B;  2QDY B;  3DDP B;  2IVX A;  1IRE B;  4HNU A;  3MY5 B;  3VKH A;  1FIN B;  2C5N B;  4JX6 A;  3HO8 A;  4BCN D;  1PKD B;  4BY1 X;  2WIP B;  3EID B;  4BY7 X;  4KRD B;  4BCP B;  1GUX B;  4BCK B;  2BPM B;  1OIY B;  3QYE A;  1VOL A;  2R7G A;  1UGP B;  1OKV B;  3A8L B;  2W9F A;  4EOS B;  2WMB B;  3BHV B;  2I40 B;  4F70 B;  5EJC A;  2ZPI B;  2PHG A;  3QYH B;  4BCQ D;  2WIH B;  2UZL B;  3QYB A;  3F5X B;  3HBL A;  5LQF B;  4QSH A;  1QMZ B;  5CYI B;  4BXX X;  1ZP2 A;  2D0Q B;  2ZPB B;  4YOO A;  2WJ9 A;  3QHR B;  1UNG D;  3GTM S;  2DXB B;  4YC3 B;  5HNB B;  4BCQ B;  4NC6 A;  4BCM B;  4FX3 B;  3TN8 B;  5L2W B;  3PO3 S;  2QDJ A;  2DD4 B;  1OL1 B;  4BCF B;  1H25 B;  4CFU D;  5IF1 B;  4EOM B;  1OIU B;  3EOC B;  3QYG B;  2IW9 B;  2KMG A;  2WXV B;  4EOI B;  3X20 B;  3DJB A;  2CZ7 B;  4CFX B;  3KHI A;  2C5O B;  4CFN B;  4F6U B;  2PK2 A;  4EOJ B;  3X24 B;  1OI9 B;  2CCI B;  3B57 A;  1VIN A;  2PMI B;  3K7A M;  2CZ1 B;  3WVE B;  3H4C A;  5DQW A;  4CFM B;  3VKG A;  1O9K A;  3A8H B;  4BCI B;  3MIA B;  4F6W B;  3O0G D;  2I53 A;  1E9H B;  4ROD A;  4BCG B;  5CEI B;  4OB2 B;  4EC8 B;  1TFB A;  2B9R A;  4MIM A;  4YOZ A;  2DME A;  1UGS B;  2G77 A;  2IW8 B;  1H1S B;  4F7N B;  2C5X B;  4EOR B;  3DOG B;  4HLQ A;  2BS2 A;  3HB9 A;  1O9K B;  4G6L B;  2X1N B;  2DD5 B;  2CCH B;  4Y72 B;  4ELL A;  5DQV A;  1OL2 B;  2AHJ B;  2IW6 B;  1FKM A;  4AKI A;  2W96 A;  2DPP B;  4BCM D;  4AKG A;  3BHT B;  1UGR B;  2W2H A;  3BLQ B;  4EOP B;  1QLB A;  2V22 B;  3BLH B;  3RGF B;  1OKW B;  1H26 B;  1FVV B;  4EC9 B;  1V29 B;  2WHB B;  3BLR B;  4BBR M;  1UNH D;  4CFW B;  4M6V A;  1H27 B;  4Z6Y A;  4OR5 B;  4CFV B;  1H1P B;  2PJQ A;  4BCO B;  3TW6 A;  3NDQ A;  3EJ1 B;  5IDP B;  1N4M A;  5HBJ B;  2WMA B;  1JSU B;  2QF7 A;  4BCJ B;  5I5Z B;  1ENW A;  4OGR B;  4ZGJ B;  1JKW A;  2PK9 B;  4AI6 A;  3MI9 B;  2QGS A;  1H28 B;  4II5 B;  3DTO A;  2QFZ A;  1UNL D;  5ACB A;  3MY1 B;  2WFY B;  2KR6 A;  3VYG B;  2UZE B;  1D3U B;  4ROE A;  3M03 A;  1H4L D;  4EOK B;  4TTH A;  3QHW B;  3POM A;  3VYH B;  3X28 B;  4BCH B;  4ZGD B;  4ELJ A;  1GH6 B;  2ZPG B;  4EON B;  2ZPH B;  2W99 A;  2C4G B;  4HL4 A;  1VYW B;  5HQ0 B;  1GY3 B;  2CJM B;  1OGU B;  2CZ0 B;  3LQ5 B;  5HVY B;  2EUF A;  3BG5 A;  4F6S B;  3A8M B;  3QWL A;  2BS3 A;  4HNV A;  3TNI B;  5BNJ B;  4EOO B;  2W9Z A;  4ROC A;  1KXU A;  4OB0 B;  2UZB B;  2WEV B;  1XO2 A;  3TNW B;  5IHY A;  4F7J B;  4YOS A;  5ICP B;  3G33 B;  2CYZ B;  4JX5 A;  3HHT B;  5HBH B; 
#chains in the Genus database with same CATH homology
 2PK2 A;  1H1P B;  4EOJ B;  2C5V B;  1URC B;  3DDP B;  4I3Z B;  2IVX A;  4BCO B;  3EJ1 B;  3MY5 B;  1P5E B;  1N4M A;  5IDP B;  1OI9 B;  1FIN B;  2C5N B;  2CCI B;  5HBJ B;  2UZD B;  5LMK B;  1VIN A;  2PMI B;  3K7A M;  2BKZ B;  4BCN D;  1PKD B;  2WMA B;  1JSU B;  4BCN B;  4BCJ B;  4F7S B;  5I5Z B;  3H4C A;  4OGR B;  4CFM B;  1AIS B;  1O9K A;  2UUE B;  1JKW A;  2WPA B;  2WIP B;  3EID B;  2PK9 B;  3MI9 B;  4KRD B;  4NST B;  4BCP B;  4BCI B;  1H28 B;  1GUX B;  3MIA B;  4II5 B;  4F6W B;  3O0G D;  4BCK B;  2BPM B;  1OIY B;  2I53 A;  1UNL D;  5ACB A;  5HBE B;  1VOL A;  1E9H B;  4ROD A;  4BCG B;  2G9X B;  5CEI B;  3MY1 B;  2WFY B;  2R7G A;  4EC8 B;  1TFB A;  2B9R A;  1OKV B;  2UZE B;  4KRC B;  4YOZ A;  1D3U B;  4ROE A;  2W9F A;  4EOS B;  2WMB B;  4UN0 A;  3BHV B;  3M03 A;  1H4L D;  1G3N C;  2I40 B;  4CRL B;  4EOK B;  2IW8 B;  4F70 B;  4IMY B;  4TTH A;  3QHW B;  1H1S B;  3POM A;  4CXA B;  4F7N B;  2PHG A;  2C5X B;  4BCH B;  4EOR B;  3DOG B;  4ELJ A;  4BCQ D;  1GH6 B;  1F5Q B;  1O9K B;  2WIH B;  1JOW A;  2C6T B;  4EON B;  1H1R B;  2UZL B;  4G6L B;  3F5X B;  2W99 A;  2C4G B;  2X1N B;  5LQF B;  1VYW B;  5HQ0 B;  5FGK B;  1GY3 B;  1QMZ B;  2CJM B;  5CYI B;  1OGU B;  2CCH B;  1ZP2 A;  4Y72 B;  4ELL A;  3LQ5 B;  5HVY B;  1OL2 B;  1W98 B;  3DDQ B;  2EUF A;  2IW6 B;  4YOO A;  1AD6 A;  3TNH B;  4F6S B;  3QHR B;  2W96 A;  2JGZ B;  1UNG D;  3TNI B;  5BNJ B;  4EOO B;  1H24 B;  4BCM D;  4YC3 B;  5HNB B;  4BCQ B;  4BCM B;  4FX3 B;  3TN8 B;  3BHT B;  2W2H A;  3BLQ B;  3BHU B;  4EOP B;  1JST B;  4EOQ B;  5L2W B;  2W9Z A;  2QDJ A;  4ROC A;  2V22 B;  3BLH B;  3RGF B;  1KXU A;  1OL1 B;  4BCF B;  1H25 B;  1OKW B;  4CFU D;  1H26 B;  1FVV B;  5IF1 B;  4EOL B;  4CFU B;  2UZB B;  4EC9 B;  2WEV B;  5IDN B;  1H1Q B;  4EOM B;  2WHB B;  1OIU B;  1BU2 A;  3EOC B;  1XO2 A;  3TNW B;  3BLR B;  4F7J B;  4F7L B;  2IW9 B;  5EFQ B;  1UNH D;  4CFW B;  2WXV B;  4EOI B;  4YOS A;  1GUX A;  2F2C A;  4CFV B;  1C9B A;  5ICP B;  4CFX B;  1H27 B;  3G33 B;  4OR5 B;  2C5O B;  4CFN B;  5HBH B;  4F6U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...