3BI0A

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a transition state analog of glu-glu
Total Genus 267
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
267
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of interactions between human glutamate carboxypeptidase II and its substrate analogs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
total genus 267
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2007-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3bi0A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3bi0A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3bi0A02
2EK8A 1F2OA 2ZEGA 4ZY0A 1HDQA 4Q7AA 4TWEA 3LMSA 2O4HA 3PB6X 1TKJA 4C8CA 2J9AA 4DYOA 3PFOA 1Z2LA 4JZ0A 5LYLA 1ARMA 4MMOA 2EWBA 1M4LA 4P4BA 2AFWA 2Q4ZA 4C99A 5LRJA 4C9EA 3B7IA 1YSJA 2PJAA 4OIDA 2G9DA 3D7GA 4C84A 4UIBA 1R43A 2V8HA 4C8TA 4P4IA 1BAVA 1XBUA 2RB7A 1XF1A 1DTDA 3KASA 2ZEDA 3L2NA 4EWTA 4CDKA 5LYDA 2C6CA 3TX8A 6CPAA 1F57A 1HEEA 3IO1A 3WABA 4DJLA 5K8PA 1LOKA 1VIXA 4KSIA 5ELYA 3FH4A 5HVFA 4C8AA 1CX8A 2WYRA 3NFZA 3GLJA 2IJZA 4C9AA 4IHMA 1VHEA 4PQAA 3PB9X 4ZY1A 3JRUA 3K9TA 2CTBA 4P4JA 2IQ6A 5D29A 3RBUA 3B3SA 1BPMA 3KR5A 4K3NA 4FAIA 2PJ1A 5F09A 3PB8X 3RZAA 1R3NA 4YWYA 3FEDA 4F9UA 3D7HA 3NH8A 3PBEA 3EIFA 8CPAA 2QJ8A 4LQGA 2AFXA 4R7MA 5LYFA 4OC5A 1BLLE 3B2YA 2HB6A 2OR4A 1LFWA 1F2PA 2CF4A 5CBMA 4TNUA 3BI1A 2PJ6A 2BOAA 3S9LA 3PFEA 3BI0A 5THWA 2PJ2A 4NGPA 1Z5RA 4P44A 2QYVA 3CT9A 3FX6A 4ONWA 1TKHA 3DGVA 4P4EA 2I3CA 1ELLP 4A37A 2V8DA 4MRIA 2VL1A 3IEHA 2ZELA 4R76A 3KR4A 4CPAA 1JQGA 3SI0A 2V77A 1CG2A 4MHPA 1Z8LA 1Y7EA 4EMEA 3QNVA 4TJXA 2AFUA 1RTQA 3NA6A 2BO9A 2PJCA 4NFRA 3LWUA 3FEEA 3IFEA 4MCPA 4OC0A 3IC1A 4C9RA 4YN3A 3FVLA 4NGNA 1AMPA 1H8LA 1PCAA 1DE4C 3CPXA 1QMUA 1ZG9A 3SJGA 4MCRA 2BCOA 4UEZA 3B3TA 3KZWA 1CPXA 4NJQA 2GLFA 2AFMA 3CPAA 2F7VA 5CPAA 3WC5A 4R8FA 3WC7A 2XEFA 3ISZA 4C86A 2ZOFA 3D7DA 2PVVA 4NGRA 1CPSA 1VHOA 3GB0A 3WT4A 1CBXA 2ZEFA 5JGFA 5D8NA 3TC8A 4YU9A 4X2TA 4IK2A 2OOTA 4OC1A 2PCUA 4MCSA 4A94A 4WWVA 3VH9A 3BHXA 4EFDA 2NSMA 3B3WA 1EE3P 3D68A 1LAMA 2XEGA 4P10A 1GYTA 3ICUA 5K8OA 2NYQA 4C8PA 2AFSA 4NJRA 2CIJA 2XEJA 4W9YA 2PIZA 1OBRA 3KL9A 4A39A 4FUUA 2JBJA 2C6GA 2ABZA 3FECA 3SJXA 2V8VA 1Y0YA 7CPAA 5J1QA 4F8ZA 2WZNA 2RFHA 1AYEA 3V7ZA 2C1CA 4UIAA 4FWUA 1XRYA 3HUVA 3IIBA 3SJEA 2JBKA 1XJOA 1WVMA 5IB9A 2PJ4A 1ZLIA 2PVWA 3KQXA 4H2KA 3IJ3A 4UEEA 2ZEHA 1XFOA 1V6CA 3K2KA 5K8NA 3S9MA 1ARLA 2GLJA 1BPNA 1YLOA 5HVGA 1YMEA 3RAMA 4C85A 2ZENA 1CP7A 5JH9A 1TF8A 3KHZA 2PJ7A 1IGBA 2PJ9A 3SI1A 2PIYA 3FF3A 1TKFA 4TJVA 4MHZA 3H8EA 4P6YA 4BD9A 4FBEA 2C6PA 1TXRA 2ZOGA 4C8FA 4OKOA 1YW4A 2PRQA 3SI2A 2Q43A 5HVHA 4GM5A 4OMEA 4OP4A 3B35A 2HC9A 3PRTA 2POKA 4UF4A 4OIWA 5HXDA 2ZEMA 3KHXA 1CP6A 3NH5A 2V8GA 4ZX8A 2F8HA 4MCQA 3ISXA 3DLJA 2PJ5A 3KGQA 4MXUA 3D4UA 4OC2A 3SJFA 4DUKA 4PPZA 4C8UA 4IAVA 4R6TA 2EK9A 4MHYA 5K8MA 3VARA 4OC4A 1YW6A 3WC6A 1ZG7A 4NGMA 1LANA 1UWYA 1ZG8A 2ANPA 2DEAA 4G1PA 5LYIA 3S9NA 4B6ZA 2QVPA 4WJBA 4NGQA 1Q7LA 4X8IA 3D67A 4AXVA 2ZEEA 4P4DA 4Z65A 4X3RA 5LRKA 1ZLHA 4CDJA 4F9VA 4P4FA 2JEWA 4UEFA 3D66A 1FNOA 2GU2A 3B3VA 3V38A 4KNGE 3T8WA 4C9UA 2O53A 3VATA 3PB4X 1LCPA 3FMCA 3PB7X 3GUXA 4NGTA 3PBBA 1VGYA 2Q51A 4ZYQA 3NH4A 4PXCA 3VTAA 4JYWA 2FVGA 2ZEPA 3HLPA 2GREA 2ZEOA 4MHNA 1PYTB 4ZX9A 2PE3A 3IWWA 2AFZA 3H8FA 4PXEA 1IY7A 3MN8A 3H8GA 1HDUA 4OC3A 3KQZA 3PEIA 5DS0A 4ZY2A 4NGSA 2PJ0A 2PJ3A 1TF9A 3FJUA 2IMOA 3D7FA 4C9VA 1FT7A 1XMBA 4PXDA 5LRGA 3BXMA 1LAPA 1NSAA 2PJBA 4O23A 4ZI6A 3I6SA 4PXBA 2AFOA 1KWMA 3N5FA 5I4MA 4P45A 2CTCA 3CDXA 3I1UA 4A38A 1Y0RA 3KI9A 3I74A 5JM6A 4RUHA 3B3CA 3MRUA 1Y9ZA 1QQ9A 2XEIA 1ELMP 2PJ8A
chains in the Genus database with same CATH superfamily
2EK8A 3T9YA 1KEEB 1F2OA 2ZEGA 4ZY0A 1HDQA 2Z0ZA 4Q7AA 2PCNA 3IU2A 3JVNA 4Q36A 4H6UA 4TWEA 3LMSA 1QSOA 5KTDA 2JDCA 2O4HA 3PB6X 3VRRA 1TKJA 4C8CA 4KLWA 2J9AA 3VROA 3NOJA 4DYOA 1Y9WA 3PFOA 4B5OA 1Z2LA 2CNTA 2GANA 4JZ0A 2P6GA 4MFKA 1ARMA 1Q2YA 3D2MA 3VRNA 2VI7A 2EWBA 1M4LA 3FYNA 4P4BA 4MMOA 4C7IA 4INJA 3TLGB 2AFWA 2Q4ZA 3G23A 4C99A 2EZAA 2GP4A 3R96A 2B4BA 5LRJA 2WPXA 5BWAB 4C9EA 3B7IA 4CAXA 3BUOB 1YSJA 2P6EA 2PJAA 4EYSA 4DNCA 4NSQA 5HKWA 5EBVA 5IB0A 4OIDA 4UA3A 2Y1MA 2G9DA 4AVBA 3V8IA 1M4IA 3D7GA 4JVOA 2E28A 5G21A 3N7ZA 4C84A 2FCKA 4UIBA 1R43A 1CJWA 1Z9UA 4KOYA 2V8HA 3MGDA 4UFWA 3T5MA 4P4IA 1BAVA 4C8TA 4KLVA 1XBUA 2RB7A 5IX3A 1XF1A 3TOAA 2DIKA 4J3GA 1DTDA 3KASA 3BUXB 1NE9A 2ZEDA 3L2NA 4UFVA 3BJ8A 3TO9A 4EWTA 3GJZA 3VRQA 4FD6A 5LYDA 2B5GB 4MJXA 2C6CA 2B4JC 3IWEA 2Q0YA 3TX8A 3UY5A 2OLSA 6CPAA 1F57A 1HEEA 3IO1A 1YQEA 4KS9A 4MFPA 4PV6A 5H84A 4E94A 3WABA 4U9ZA 4DJLA 3FB3A 5K8PA 5JVLA 1LOKA 5GCNA 1VIXA 2ZW5A 1RXTA 1Z8WA 5F1YA 4KSIA 3DSBA 5ELYA 3FH4A 5HVFA 4KVOE 3JTKA 4C8AA 2Q4YA 1CX8A 2WYRA 2YJVA 5F9MA 3NFZA 3GLJA 4XNHB 1NSLA 4A4BA 1I12A 2IJZA 2ATRA 4R3LA 2FM4A 4C9AA 1N71A 1L0CA 3BUNB 1BO4A 4IHMA 4KOWA 3S6GA 1EZAA 2C27A 3OP0A 1VHEA 1IU8A 4PQAA 3PB9X 4FD5A 2JLMA 4F0YA 4B11A 4ZY1A 4OLLA 2P0WA 3JRUA 3K9TA 2PDOA 4UBRA 2EBJA 2CTBA 1ZL0A 4PSXA 1S7FA 5AG4A 1YGHA 4P4JA 3IU1A 1FY7A 4KOTA 4II9A 1MJAA 2FE7A 4I49A 2PJ8A 1YX0A 2IQ6A 5D29A 2DLAA 3RBUA 1Z4EA 3B3SA 2IL4A 2Z10A 4BMHA 1BPMA 4COBA 2OH1A 3KR5A 4K3NA 3S6KA 4PK2A 4FAIA 1EZBA 2Y0MA 2PJ1A 5F09A 4HKFA 3PB8X 2HROA 4IIXA 2Y1NA 1R3NA 1M1DA 3RZAA 2HUZA 4YWYA 3FEDA 1YK3A 4RI1A 3P2HA 3D7HA 3O8ZA 1Z8TA 4MBUA 4PSWA 4R57A 4F9UA 5C88A 2OU2A 3NH8A 3PT1A 2B3VA 3OWCA 1S7LA 3PBEA 8CPAA 1BXRB 2RC4A 1R61A 3EIFA 3TLAA 2QJ8A 4LQGA 2AFXA 4MFZA 5FVJA 3TO6A 4R7MA 3TFYA 5LYFA 3T05A 4COGA 2MP0A 4OC5A 2JDDA 2B5GA 2DF5A 4ONUA 3U88C 1BLLE 4UCMA 2J8RA 2HB6A 1M4GA 2OR4A 3B2YA 2Q7BA 2O28A 1LFWA 1XOVA 3WR7A 1F2PA 3F8KA 2CF4A 5CBMA 4TNUA 4A95A 2XPNA 3BI1A 2BOAA 3S9LA 2PJ6A 3FBUA 3PFEA 4OAEA 3S6FA 4B12A 4BBHA 3BI0A 4IIYA 5HH1A 2B4DB 5THWA 4BPUB 2WSAA 1C3OB 4X5KA 2PJ2A 2DPTA 2F5IA 4NGPA 1Z5RA 1QSMA 4P44A 3EY5A 4ORFA 2REEA 4BTFA 2J8NA 5HKYA 2QYVA 3CT9A 3BUMB 3FX6A 2HWGA 2AUNA 4Y49C 3JUWA 1TKHA 4ONWA 2BSWA 1PU9A 3DGVA 2G3TA 4B13A 4P4EA 2I3CA 1NXJA 1ELLP 5CNPA 4A37A 2V8DA 4NEXA 4RS2A 3NE7A 4MRIA 2VL1A 4H1HA 4NCZA 3IEHA 3EO4A 4CYNA 2ZELA 5JPHA 1KUYA 3U1BA 4M6GA 4R76A 3K4IA 1M6VB 3D8PA 3KR4A 2GE3A 2PQ8A 4CPAA 1JQGA 1K4JA 2V77A 4KUAA 1CG2A 3SI0A 4MHPA 1VKCA 4C7HA 4KVXA 1Z8LA 2Q7SA 2R7HA 3NE8A 1Y7EA 2CXAA 4HPSA 4XPDC 2B3UA 2R8VA 1VBHA 4EMEA 2FL4A 3QNVA 1IYLA 4E0AA 4TJXA 3GY9A 2Z3LA 2OZHA 3SXNA 4CGOA 1DIKA 5JYBA 2AFUA 5HKZA 1RTQA 1GHEA 1UFHA 2I00A 3NA6A 2BO9A 3R9EA 3DDDA 3TTHA 1B47A 4R3KA 3TLZA 2PJCA 1B6BA 4KOXA 4KSAA 3HPGG 4NFRA 1MJBA 3IGRA 3TLBA 4NF1A 3LWUA 3PP9A 3FEEA 4B5PB 5IR2A 4MFLA 2X0SA 3IFEA 4MCPA 4OC0A 3IC1A 3LACA 4C9RA 2Z3NA 3FVLA 3LD2A 4YN3A 3GIUA 3T07A 4NGNA 2FXFA 3R9FA 1AMPA 1H8LA 1PCAA 1DE4C 3CPXA 1QMUA 1S60A 1U6MA 1ZG9A 3LODA 3PZJA 3F9KC 2Z3OA 1IICA 4B5PA 3SJGA 5J3XA 4MCRA 2BCOA 2CNMA 2Q04A 4YGOA 1ZO0A 5F46A 4UEZA 3B3TA 4OADA 3CXPA 1KZFA 3FXTA 3KZWA 2ODFA 4IF5A 1CPXA 4UWJA 5ISVA 5J8FA 2AUMA 2EZCA 4NJQA 3K9UA 4GS4A 4K30A 2GLFA 4KSFA 2AFMA 3CPAA 2F7VA 5CPAA 4FD4A 3OB2B 3H5ZA 3WC5A 4R8FA 3WC7A 4CGLA 1MK4A 2XEFA 3OB1B 3QB8A 1IIDA 3ISZA 2YNDA 4JD6A 4C86A 2ZOFA 3F0AA 2ZW7A 4BINA 3D7DA 3TLCA 3SR3A 4NGRA 1CPSA 1VHOA 3GB0A 3WT4A 1CBXA 2ZEFA 5JGFA 5E96A 1ZRSA 3A9LA 3BJ7A 5D8NA 3TC8A 4YU9A 5FD8A 2JEVA 3F5BA 2J8MA 4IK2A 2OOTA 4X2TA 4YRHA 3CZXA 5F49A 4OC1A 2PCUA 4ZBGA 1JDEA 4MCSA 2R98A 1IOFA 3DR6A 4A94A 1CE8B 3W6SA 4WWVA 1PUAA 3G3SA 3VH9A 3BHXA 1Q2DA 4M8DA 1KBLA 4M85A 4EFDA 2NSMA 4A31A 1YREA 2K5TA 2B58A 3B3WA 1EE3P 4AVCA 2D4OA 3E0KA 5EC4A 4H6ZA 3D68A 4R87A 4LQ6A 4YFJA 1LAMA 2XEGA 3EFAA 4P10A 1GYTA 4CYQA 4MI1A 2PC1A 2HV2A 4RR2B 4UCNA 5K8OA 3ICUA 2QIRA 2EUIA 2NYQA 2REFA 2BL1A 2PR8A 2AFSA 4NJRA 1T36B 2CIJA 2XEJA 4W9YA 4C8PA 2PIZA 4A2ZA 2BEIA 1OBRA 2AJ6A 5J8CA 3KL9A 4A39A 4FUUA 2JBJA 3VWEA 2C6GA 2ABZA 3FECA 3QAYA 3RO0A 3SJXA 2V8VA 1X12A 4AVAA 3KKWA 1Y0YA 2QMLA 7CPAA 1M44A 5G22A 3BLNA 5J1QA 1S5KA 3R9GA 3HPHE 4F8ZA 2WZNA 2RFHA 2Q4VA 3RYOA 4CAWA 4LX9A 4B10A 1AYEA 2OZGA 2C1CA 4UIAA 3V7ZA 1ON0A 4HNWB 4CGMA 4CYOA 4FWUA 4KOUA 2KCWA 1XMTA 4UCPA 1XRYA 1QSNA 5AG6A 3I9SA 5A28A 4C2ZA 3HUVA 3IIBA 3SJEA 1WJTA 2JBKA 1XJOA 2YGWA 4CAEA 3PFVA 4XPLA 5AXIA 4M6IA 2PJ4A 4A33A 1ZLIA 5IB9A 1WVMA 3I3GA 2PVWA 3KQXA 2OB0A 4H2KA 2ZW6A 3TLGA 3TLYA 4QBJA 4KOSA 3NFQA 4JJXA 4QVTA 3IJ3A 4HNYB 4CDKA 2ZXVA 4U9YA 4UEEA 4CGPA 2FIAA 1XFOA 2ZEHA 3EC4A 1ZYMA 3EXNA 3HMJG 1V6CA 2FS5A 3K2KA 5F13A 5K8NA 3S9MA 2CBLA 1ARLA 4BPWB 1QSRA 3PGPA 3ZZIA 3T0TA 2GLJA 1BPNA 1YLOA 5HVGA 1P0HA 5C82A 2ARHA 1OZPA 2FSRA 3EZEA 1YLEA 1YMEA 3RAMA 1EO0A 4C2XA 1C30B 2D0PA 2ZENA 3DNSA 1CP7A 5F48A 4QC6A 4Y49B 5JH9A 1TF8A 1JDBC 3TYXA 2R82A 3KHZA 2PJ7A 2Z3KA 4H89A 1IGBA 2HQYA 5F47A 2D4PA 2PJ9A 1TIQA 2DXQA 2PIYA 3FF3A 1TKFA 2VQYA 2X7BA 4MHZA 3SI1A 4MJ8A 4TJVA 2ZPAA 3H8EA 2D0OA 3SXOA 4P6YA 4BD9A 4FBEA 5G20A 4HNXB 2C6PA 1TXRA 5I0CA 2ZOGA 4C8FA 4JWPA 4OKOA 1YW4A 2PRQA 5DWNA 3SI2A 4AB7A 2Q43A 1IB1E 3TOBA 5HVHA 4XPDB 2CNSA 4KORA 2OZUA 3FRMA 4Q38A 3SHPA 2AE6A 1YVOA 4GM5A 4OMEA 4OP4A 3TLEA 3B35A 1A2ZA 2R1IA 1RO5A 3FIXA 2B4DA 1SQHA 2HC9A 2G0BA 2FIWA 3PRTA 2POKA 4KOVA 4UF4A 4OIWA 1P4NA 5HXDA 1J3LA 2ZEMA 4KZTA 3KHXA 1CP6A 4KVME 3NH5A 4MY0A 2HI6A 5AG5A 4C2YA 4KUBA 1VI4A 2V8GA 4ZX8A 4JXQA 4A30A 2F8HA 1NBWA 2WPWA 4MCQA 4MHDA 3ISXA 4GPLB 2BUEA 3C26A 3DLJA 2PJ5A 2XPPA 3KGQA 2NMTA 4MXUA 4OC2A 1S3ZA 3SJFA 2GFQA 3D4UA 4DUKA 4J0NA 4PPZA 4C8UA 4IAVA 4XNHC 4R6TA 4CAVA 4C68A 2EK9A 4MHYA 5K8MA 3VARA 1Z9EA 4OC4A 1YW6A 2ZW4A 1KUVA 2Q44A 3WC6A 1ZG7A 1ZG8A 4NGMA 1I1DA 1LANA 1UWYA 1XF8A 4A4CA 1X10A 2ANPA 2DEAA 4G1PA 3S9NA 5LYIA 3TT2A 4B6ZA 2QVPA 4FD7A 4NXYA 1VBGA 4C85A 4MFJA 2N3AB 4CO9A 4WJBA 4GXHA 3IWGA 4NGQA 3ZJ0A 1Q7LA 4X8IA 3D67A 4AXVA 2YNCC 2ZEEA 4P4DA 1R57A 4U5YA 3C8OA 2WUUA 4Z65A 4A32A 1IYKA 4X3RA 3R95A 4AG7A 3VGOA 1ZLHA 4BPXB 5LRKA 3KRVA 4CDJA 4F9VA 4P4FA 3OAKA 1S7NA 4F6AA 4M6HA 4JXRA 2B0AA 1Q2CA 2FT0A 2JEWA 1Z8XA 5HMNA 5F5XA 4UEFA 2DPSA 3D66A 5DWMA 2PSWA 5AGEA 1J4JA 1FNOA 2GU2A 2I79A 3B3VA 1CM0A 1A9XB 3GKRA 3V38A 4KNGE 2CY2A 2EVNA 3GYAA 3T8WA 2YNCA 3VWDA 1YVKA 3P2FA 4CAFA 4UWIA 4C9UA 2VZYA 4UFXA 2VKZG 1V0CA 1VHSA 1QSTA 2YNEA 2O53A 3VATA 1LRZA 3PB4X 4CRZB 1LCPA 3FMCA 2PRBA 3GUXA 3PB7X 4NGTA 1S7KA 1WK4A 3PBBA 4QB9A 5JQ4A 2EZBA 1B87A 3RNZA 1Z4RA 2VZZA 3B8GA 1VGYA 1GGOA 1NMTA 2Q51A 5IV0A 5LYLA 4CRYB 1XIXA 4ZYQA 2Z3MA 3NH4A 4PXCA 3VTAA 4CZ1A 2XPLA 4JYWA 4ZGYB 2VEZA 2FVGA 4CS0B 2ZEPA 3HLPA 2GREA 2ZEOA 4MHNA 1YVHA 1PYTB 4ZX9A 2H5MA 2YJTA 2PE3A 4L8AA 3IWWA 2AFZA 3TO7A 3W91A 3H8FA 1WWZA 4PXEA 4AG9A 1IOIA 3G8WA 1AUGA 5H86A 1IY7A 2EO8A 3DR8A 4E8OA 2C5QA 1Y9KA 2UV8G 5AG7A 3BUWB 3T90A 2G3AA 5A27A 3S6HA 5EMIA 3W6XA 3MN8A 1Q5XA 4MI4A 3H8GA 5KTAA 1HDUA 4OC3A 3KQZA 2A4NA 3PEIA 5DS0A 1FBVA 4ZY2A 4NGSA 4JLYA 2PJ0A 4E5SA 3D3SA 1Y7RA 2PJ3A 1TF9A 4MY3A 3FJUA 3EZBA 4CGNA 2IMOA 2VXKA 2Z11A 3D7FA 4E2AA 4PK3A 4C9VA 1KC7A 1FT7A 1XMBA 1I21A 4QUSA 3TCVA 4LUAA 4CYPA 1MJ9A 3EZAA 2XPOA 3D2PA 4B14A 4PXDA 1KUXA 1CS0B 5LRGA 3BXMA 3PLFB 1LAPA 1NSAA 2PJBA 4F0XA 4O23A 4ZI6A 2P6FA 5BY0A 4IUSA 3I6SA 4PXBA 2AFOA 2QECA 1KWMA 1XEBA 3H4QA 3N5FA 5K99A 4L89A 4RN7A 2VBQA 5I4MA 3TE4A 4P45A 2CTCA 3CDXA 3I1UA 1BOBA 5G1ZA 1XE4A 4A38A 3CXSA 1M4DA 3R1KA 4R9MA 1Y0RA 3FNCA 4XPKA 1YR0A 3KI9A 3QAHA 2PR1A 3I74A 1JWQA 4RUHA 5JM6A 4EVYA 3VRPA 3B3CA 3MRUA 3ZNIA 1QQ9A 4M3SA 1Y9ZA 2XEIA 2GIVA 2Z3PA 4MFQA 1ELMP 5KTCA 2PVVA 3CXQA
chains in the Genus database with same CATH topology
2EK8A 1F2OA 2ZEGA 4ZY0A 1HDQA 4Q7AA 4TWEA 3LMSA 2O4HA 3PB6X 1TKJA 4C8CA 2J9AA 4DYOA 3PFOA 1Z2LA 4JZ0A 5LYLA 1ARMA 4MMOA 2EWBA 1M4LA 4P4BA 2AFWA 2Q4ZA 4C99A 2GP4A 5LRJA 4C9EA 3B7IA 1YSJA 2PJAA 4OIDA 2G9DA 3D7GA 4C84A 4UIBA 1R43A 2V8HA 4C8TA 4P4IA 1BAVA 1XBUA 2RB7A 1XF1A 1DTDA 3KASA 2ZEDA 3L2NA 4EWTA 4CDKA 5LYDA 2C6CA 3TX8A 6CPAA 1F57A 1HEEA 3IO1A 3WABA 4DJLA 5K8PA 1LOKA 1VIXA 4KSIA 5ELYA 3FH4A 5HVFA 4C8AA 1CX8A 2WYRA 3NFZA 3GLJA 2IJZA 4C9AA 4IHMA 1VHEA 4PQAA 3PB9X 4ZY1A 3JRUA 3K9TA 2CTBA 4P4JA 2IQ6A 5D29A 3RBUA 3B3SA 1BPMA 3KR5A 4K3NA 4FAIA 2PJ1A 5F09A 3PB8X 3RZAA 1R3NA 4YWYA 3FEDA 4F9UA 3D7HA 3NH8A 3PBEA 3EIFA 8CPAA 2QJ8A 4LQGA 2AFXA 4R7MA 5LYFA 4OC5A 1BLLE 3B2YA 2HB6A 2OR4A 1LFWA 1F2PA 2CF4A 5CBMA 4TNUA 3BI1A 2PJ6A 2BOAA 3S9LA 3PFEA 3BI0A 5THWA 2PJ2A 4NGPA 1Z5RA 4P44A 2QYVA 3CT9A 3FX6A 4ONWA 1TKHA 3DGVA 4P4EA 2I3CA 1ELLP 4A37A 2V8DA 4MRIA 2VL1A 3IEHA 2ZELA 4R76A 3KR4A 4CPAA 1JQGA 3SI0A 2V77A 1CG2A 4MHPA 1Z8LA 1Y7EA 4EMEA 3QNVA 4TJXA 2AFUA 1RTQA 3NA6A 2BO9A 2PJCA 4NFRA 3LWUA 3FEEA 5IR2A 3IFEA 4MCPA 4OC0A 3IC1A 4C9RA 4YN3A 3FVLA 4NGNA 1AMPA 1H8LA 1PCAA 1DE4C 3CPXA 1QMUA 1ZG9A 3SJGA 4MCRA 2BCOA 4UEZA 3B3TA 3KZWA 1CPXA 4NJQA 2GLFA 2AFMA 3CPAA 2F7VA 5CPAA 3WC5A 4R8FA 3WC7A 2XEFA 3ISZA 4C86A 2ZOFA 3D7DA 2PVVA 4NGRA 1CPSA 1VHOA 3GB0A 3WT4A 1CBXA 2ZEFA 5JGFA 5D8NA 3TC8A 4YU9A 4X2TA 4IK2A 2OOTA 4OC1A 2PCUA 4MCSA 4A94A 4WWVA 3VH9A 3BHXA 4EFDA 2NSMA 3B3WA 1EE3P 3D68A 1LAMA 2XEGA 4P10A 1GYTA 3ICUA 5K8OA 2NYQA 4C8PA 2AFSA 4NJRA 2CIJA 2XEJA 4W9YA 2PIZA 1OBRA 3KL9A 4A39A 4FUUA 2JBJA 2C6GA 2ABZA 3FECA 3SJXA 2V8VA 1Y0YA 7CPAA 5J1QA 4F8ZA 2WZNA 2RFHA 1AYEA 3V7ZA 2C1CA 4UIAA 4FWUA 1XRYA 3HUVA 3IIBA 3SJEA 2JBKA 1XJOA 1WVMA 5IB9A 2PJ4A 1ZLIA 2PVWA 3KQXA 4H2KA 3IJ3A 4UEEA 2ZEHA 1XFOA 1V6CA 3K2KA 5K8NA 3S9MA 1ARLA 2GLJA 1BPNA 1YLOA 5HVGA 1YMEA 3RAMA 4C85A 2ZENA 1CP7A 5JH9A 1TF8A 3KHZA 2PJ7A 1IGBA 2PJ9A 3SI1A 2PIYA 3FF3A 1TKFA 4TJVA 4MHZA 3H8EA 4P6YA 4BD9A 4FBEA 2C6PA 1TXRA 2ZOGA 4C8FA 4OKOA 1YW4A 2PRQA 3SI2A 2Q43A 5HVHA 4GM5A 4OMEA 4OP4A 3B35A 2HC9A 3PRTA 2POKA 4UF4A 4OIWA 5HXDA 2ZEMA 3KHXA 1CP6A 3NH5A 2V8GA 4ZX8A 2F8HA 4MCQA 3ISXA 3DLJA 2PJ5A 3KGQA 4MXUA 3D4UA 4OC2A 3SJFA 4DUKA 4PPZA 4C8UA 4IAVA 4R6TA 2EK9A 4MHYA 5K8MA 3VARA 4OC4A 1YW6A 3WC6A 1ZG7A 4NGMA 1LANA 1UWYA 1ZG8A 2ANPA 2DEAA 4G1PA 5LYIA 3S9NA 4B6ZA 2QVPA 4WJBA 4NGQA 1Q7LA 4X8IA 3D67A 4AXVA 2ZEEA 4P4DA 4Z65A 4X3RA 5LRKA 1ZLHA 4CDJA 4F9VA 4P4FA 2JEWA 4UEFA 3D66A 1FNOA 2GU2A 3B3VA 3V38A 4KNGE 3T8WA 4C9UA 2O53A 3VATA 3PB4X 1LCPA 3FMCA 3PB7X 3GUXA 4NGTA 3PBBA 1VGYA 2Q51A 4ZYQA 3NH4A 4PXCA 3VTAA 4JYWA 2FVGA 2ZEPA 3HLPA 2GREA 2ZEOA 4MHNA 1PYTB 4ZX9A 2PE3A 3IWWA 2AFZA 3H8FA 4PXEA 2C5QA 1IY7A 3MN8A 3H8GA 1HDUA 4OC3A 3KQZA 3PEIA 5DS0A 4ZY2A 4NGSA 2PJ0A 2PJ3A 1TF9A 3FJUA 2IMOA 3D7FA 4C9VA 1FT7A 1XMBA 4PXDA 5LRGA 3BXMA 1LAPA 1NSAA 2PJBA 4O23A 4ZI6A 3I6SA 4PXBA 2AFOA 1KWMA 3N5FA 5I4MA 4P45A 2CTCA 3CDXA 3I1UA 4A38A 1Y0RA 3KI9A 3I74A 5JM6A 4RUHA 3B3CA 3MRUA 1Y9ZA 1QQ9A 2XEIA 1ELMP 2PJ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EK8 A;  1F2O A;  2ZEG A;  4ZY0 A;  1HDQ A;  4Q7A A;  4TWE A;  3LMS A;  2O4H A;  3PB6 X;  1TKJ A;  4C8C A;  2J9A A;  4DYO A;  3PFO A;  1Z2L A;  4JZ0 A;  5LYL A;  1ARM A;  4MMO A;  2EWB A;  1M4L A;  4P4B A;  2AFW A;  2Q4Z A;  4C99 A;  5LRJ A;  4C9E A;  3B7I A;  1YSJ A;  2PJA A;  4OID A;  2G9D A;  3D7G A;  4C84 A;  4UIB A;  1R43 A;  2V8H A;  4C8T A;  4P4I A;  1BAV A;  1XBU A;  2RB7 A;  1XF1 A;  1DTD A;  3KAS A;  2ZED A;  3L2N A;  4EWT A;  4CDK A;  5LYD A;  2C6C A;  3TX8 A;  6CPA A;  1F57 A;  1HEE A;  3IO1 A;  3WAB A;  4DJL A;  5K8P A;  1LOK A;  1VIX A;  4KSI A;  5ELY A;  3FH4 A;  5HVF A;  4C8A A;  1CX8 A;  2WYR A;  3NFZ A;  3GLJ A;  2IJZ A;  4C9A A;  4IHM A;  1VHE A;  4PQA A;  3PB9 X;  4ZY1 A;  3JRU A;  3K9T A;  2CTB A;  4P4J A;  2IQ6 A;  5D29 A;  3RBU A;  3B3S A;  1BPM A;  3KR5 A;  4K3N A;  4FAI A;  2PJ1 A;  5F09 A;  3PB8 X;  3RZA A;  1R3N A;  4YWY A;  3FED A;  4F9U A;  3D7H A;  3NH8 A;  3PBE A;  3EIF A;  8CPA A;  2QJ8 A;  4LQG A;  2AFX A;  4R7M A;  5LYF A;  4OC5 A;  1BLL E;  3B2Y A;  2HB6 A;  2OR4 A;  1LFW A;  1F2P A;  2CF4 A;  5CBM A;  4TNU A;  3BI1 A;  2PJ6 A;  2BOA A;  3S9L A;  3PFE A;  3BI0 A;  5THW A;  2PJ2 A;  4NGP A;  1Z5R A;  4P44 A;  2QYV A;  3CT9 A;  3FX6 A;  4ONW A;  1TKH A;  3DGV A;  4P4E A;  2I3C A;  1ELL P;  4A37 A;  2V8D A;  4MRI A;  2VL1 A;  3IEH A;  2ZEL A;  4R76 A;  3KR4 A;  4CPA A;  1JQG A;  3SI0 A;  2V77 A;  1CG2 A;  4MHP A;  1Z8L A;  1Y7E A;  4EME A;  3QNV A;  4TJX A;  2AFU A;  1RTQ A;  3NA6 A;  2BO9 A;  2PJC A;  4NFR A;  3LWU A;  3FEE A;  3IFE A;  4MCP A;  4OC0 A;  3IC1 A;  4C9R A;  4YN3 A;  3FVL A;  4NGN A;  1AMP A;  1H8L A;  1PCA A;  1DE4 C;  3CPX A;  1QMU A;  1ZG9 A;  3SJG A;  4MCR A;  2BCO A;  4UEZ A;  3B3T A;  3KZW A;  1CPX A;  4NJQ A;  2GLF A;  2AFM A;  3CPA A;  2F7V A;  5CPA A;  3WC5 A;  4R8F A;  3WC7 A;  2XEF A;  3ISZ A;  4C86 A;  2ZOF A;  3D7D A;  2PVV A;  4NGR A;  1CPS A;  1VHO A;  3GB0 A;  3WT4 A;  1CBX A;  2ZEF A;  5JGF A;  5D8N A;  3TC8 A;  4YU9 A;  4X2T A;  4IK2 A;  2OOT A;  4OC1 A;  2PCU A;  4MCS A;  4A94 A;  4WWV A;  3VH9 A;  3BHX A;  4EFD A;  2NSM A;  3B3W A;  1EE3 P;  3D68 A;  1LAM A;  2XEG A;  4P10 A;  1GYT A;  3ICU A;  5K8O A;  2NYQ A;  4C8P A;  2AFS A;  4NJR A;  2CIJ A;  2XEJ A;  4W9Y A;  2PIZ A;  1OBR A;  3KL9 A;  4A39 A;  4FUU A;  2JBJ A;  2C6G A;  2ABZ A;  3FEC A;  3SJX A;  2V8V A;  1Y0Y A;  7CPA A;  5J1Q A;  4F8Z A;  2WZN A;  2RFH A;  1AYE A;  3V7Z A;  2C1C A;  4UIA A;  4FWU A;  1XRY A;  3HUV A;  3IIB A;  3SJE A;  2JBK A;  1XJO A;  1WVM A;  5IB9 A;  2PJ4 A;  1ZLI A;  2PVW A;  3KQX A;  4H2K A;  3IJ3 A;  4UEE A;  2ZEH A;  1XFO A;  1V6C A;  3K2K A;  5K8N A;  3S9M A;  1ARL A;  2GLJ A;  1BPN A;  1YLO A;  5HVG A;  1YME A;  3RAM A;  4C85 A;  2ZEN A;  1CP7 A;  5JH9 A;  1TF8 A;  3KHZ A;  2PJ7 A;  1IGB A;  2PJ9 A;  3SI1 A;  2PIY A;  3FF3 A;  1TKF A;  4TJV A;  4MHZ A;  3H8E A;  4P6Y A;  4BD9 A;  4FBE A;  2C6P A;  1TXR A;  2ZOG A;  4C8F A;  4OKO A;  1YW4 A;  2PRQ A;  3SI2 A;  2Q43 A;  5HVH A;  4GM5 A;  4OME A;  4OP4 A;  3B35 A;  2HC9 A;  3PRT A;  2POK A;  4UF4 A;  4OIW A;  5HXD A;  2ZEM A;  3KHX A;  1CP6 A;  3NH5 A;  2V8G A;  4ZX8 A;  2F8H A;  4MCQ A;  3ISX A;  3DLJ A;  2PJ5 A;  3KGQ A;  4MXU A;  3D4U A;  4OC2 A;  3SJF A;  4DUK A;  4PPZ A;  4C8U A;  4IAV A;  4R6T A;  2EK9 A;  4MHY A;  5K8M A;  3VAR A;  4OC4 A;  1YW6 A;  3WC6 A;  1ZG7 A;  4NGM A;  1LAN A;  1UWY A;  1ZG8 A;  2ANP A;  2DEA A;  4G1P A;  5LYI A;  3S9N A;  4B6Z A;  2QVP A;  4WJB A;  4NGQ A;  1Q7L A;  4X8I A;  3D67 A;  4AXV A;  2ZEE A;  4P4D A;  4Z65 A;  4X3R A;  5LRK A;  1ZLH A;  4CDJ A;  4F9V A;  4P4F A;  2JEW A;  4UEF A;  3D66 A;  1FNO A;  2GU2 A;  3B3V A;  3V38 A;  4KNG E;  3T8W A;  4C9U A;  2O53 A;  3VAT A;  3PB4 X;  1LCP A;  3FMC A;  3PB7 X;  3GUX A;  4NGT A;  3PBB A;  1VGY A;  2Q51 A;  4ZYQ A;  3NH4 A;  4PXC A;  3VTA A;  4JYW A;  2FVG A;  2ZEP A;  3HLP A;  2GRE A;  2ZEO A;  4MHN A;  1PYT B;  4ZX9 A;  2PE3 A;  3IWW A;  2AFZ A;  3H8F A;  4PXE A;  1IY7 A;  3MN8 A;  3H8G A;  1HDU A;  4OC3 A;  3KQZ A;  3PEI A;  5DS0 A;  4ZY2 A;  4NGS A;  2PJ0 A;  2PJ3 A;  1TF9 A;  3FJU A;  2IMO A;  3D7F A;  4C9V A;  1FT7 A;  1XMB A;  4PXD A;  5LRG A;  3BXM A;  1LAP A;  1NSA A;  2PJB A;  4O23 A;  4ZI6 A;  3I6S A;  4PXB A;  2AFO A;  1KWM A;  3N5F A;  5I4M A;  4P45 A;  2CTC A;  3CDX A;  3I1U A;  4A38 A;  1Y0R A;  3KI9 A;  3I74 A;  5JM6 A;  4RUH A;  3B3C A;  3MRU A;  1Y9Z A;  1QQ9 A;  2XEI A;  1ELM P;  2PJ8 A; 
#chains in the Genus database with same CATH topology
 2EK8 A;  3T9Y A;  1KEE B;  1F2O A;  2ZEG A;  4ZY0 A;  1HDQ A;  2Z0Z A;  4Q7A A;  2PCN A;  3IU2 A;  3JVN A;  4Q36 A;  4H6U A;  4TWE A;  3LMS A;  1QSO A;  5KTD A;  2JDC A;  2O4H A;  3PB6 X;  3VRR A;  1TKJ A;  4C8C A;  4KLW A;  2J9A A;  3VRO A;  3NOJ A;  4DYO A;  1Y9W A;  3PFO A;  4B5O A;  1Z2L A;  2CNT A;  2GAN A;  4JZ0 A;  2P6G A;  4MFK A;  1ARM A;  1Q2Y A;  3D2M A;  3VRN A;  2VI7 A;  2EWB A;  1M4L A;  3FYN A;  4P4B A;  4MMO A;  4C7I A;  4INJ A;  3TLG B;  2AFW A;  2Q4Z A;  3G23 A;  4C99 A;  2EZA A;  2GP4 A;  3R96 A;  2B4B A;  5LRJ A;  2WPX A;  5BWA B;  4C9E A;  3B7I A;  4CAX A;  3BUO B;  1YSJ A;  2P6E A;  2PJA A;  4EYS A;  4DNC A;  4NSQ A;  5HKW A;  5EBV A;  5IB0 A;  4OID A;  4UA3 A;  2Y1M A;  2G9D A;  4AVB A;  3V8I A;  1M4I A;  3D7G A;  4JVO A;  2E28 A;  5G21 A;  3N7Z A;  4C84 A;  2FCK A;  4UIB A;  1R43 A;  1CJW A;  1Z9U A;  4KOY A;  2V8H A;  3MGD A;  4UFW A;  3T5M A;  4P4I A;  1BAV A;  4C8T A;  4KLV A;  1XBU A;  2RB7 A;  5IX3 A;  1XF1 A;  3TOA A;  2DIK A;  4J3G A;  1DTD A;  3KAS A;  3BUX B;  1NE9 A;  2ZED A;  3L2N A;  4UFV A;  3BJ8 A;  3TO9 A;  4EWT A;  3GJZ A;  3VRQ A;  4FD6 A;  5LYD A;  2B5G B;  4MJX A;  2C6C A;  2B4J C;  3IWE A;  2Q0Y A;  3TX8 A;  3UY5 A;  2OLS A;  6CPA A;  1F57 A;  1HEE A;  3IO1 A;  1YQE A;  4KS9 A;  4MFP A;  4PV6 A;  5H84 A;  4E94 A;  3WAB A;  4U9Z A;  4DJL A;  3FB3 A;  5K8P A;  5JVL A;  1LOK A;  5GCN A;  1VIX A;  2ZW5 A;  1RXT A;  1Z8W A;  5F1Y A;  4KSI A;  3DSB A;  5ELY A;  3FH4 A;  5HVF A;  4KVO E;  3JTK A;  4C8A A;  2Q4Y A;  1CX8 A;  2WYR A;  2YJV A;  5F9M A;  3NFZ A;  3GLJ A;  4XNH B;  1NSL A;  4A4B A;  1I12 A;  2IJZ A;  2ATR A;  4R3L A;  2FM4 A;  4C9A A;  1N71 A;  1L0C A;  3BUN B;  1BO4 A;  4IHM A;  4KOW A;  3S6G A;  1EZA A;  2C27 A;  3OP0 A;  1VHE A;  1IU8 A;  4PQA A;  3PB9 X;  4FD5 A;  2JLM A;  4F0Y A;  4B11 A;  4ZY1 A;  4OLL A;  2P0W A;  3JRU A;  3K9T A;  2PDO A;  4UBR A;  2EBJ A;  2CTB A;  1ZL0 A;  4PSX A;  1S7F A;  5AG4 A;  1YGH A;  4P4J A;  3IU1 A;  1FY7 A;  4KOT A;  4II9 A;  1MJA A;  2FE7 A;  4I49 A;  2PJ8 A;  1YX0 A;  2IQ6 A;  5D29 A;  2DLA A;  3RBU A;  1Z4E A;  3B3S A;  2IL4 A;  2Z10 A;  4BMH A;  1BPM A;  4COB A;  2OH1 A;  3KR5 A;  4K3N A;  3S6K A;  4PK2 A;  4FAI A;  1EZB A;  2Y0M A;  2PJ1 A;  5F09 A;  4HKF A;  3PB8 X;  2HRO A;  4IIX A;  2Y1N A;  1R3N A;  1M1D A;  3RZA A;  2HUZ A;  4YWY A;  3FED A;  1YK3 A;  4RI1 A;  3P2H A;  3D7H A;  3O8Z A;  1Z8T A;  4MBU A;  4PSW A;  4R57 A;  4F9U A;  5C88 A;  2OU2 A;  3NH8 A;  3PT1 A;  2B3V A;  3OWC A;  1S7L A;  3PBE A;  8CPA A;  1BXR B;  2RC4 A;  1R61 A;  3EIF A;  3TLA A;  2QJ8 A;  4LQG A;  2AFX A;  4MFZ A;  5FVJ A;  3TO6 A;  4R7M A;  3TFY A;  5LYF A;  3T05 A;  4COG A;  2MP0 A;  4OC5 A;  2JDD A;  2B5G A;  2DF5 A;  4ONU A;  3U88 C;  1BLL E;  4UCM A;  2J8R A;  2HB6 A;  1M4G A;  2OR4 A;  3B2Y A;  2Q7B A;  2O28 A;  1LFW A;  1XOV A;  3WR7 A;  1F2P A;  3F8K A;  2CF4 A;  5CBM A;  4TNU A;  4A95 A;  2XPN A;  3BI1 A;  2BOA A;  3S9L A;  2PJ6 A;  3FBU A;  3PFE A;  4OAE A;  3S6F A;  4B12 A;  4BBH A;  3BI0 A;  4IIY A;  5HH1 A;  2B4D B;  5THW A;  4BPU B;  2WSA A;  1C3O B;  4X5K A;  2PJ2 A;  2DPT A;  2F5I A;  4NGP A;  1Z5R A;  1QSM A;  4P44 A;  3EY5 A;  4ORF A;  2REE A;  4BTF A;  2J8N A;  5HKY A;  2QYV A;  3CT9 A;  3BUM B;  3FX6 A;  2HWG A;  2AUN A;  4Y49 C;  3JUW A;  1TKH A;  4ONW A;  2BSW A;  1PU9 A;  3DGV A;  2G3T A;  4B13 A;  4P4E A;  2I3C A;  1NXJ A;  1ELL P;  5CNP A;  4A37 A;  2V8D A;  4NEX A;  4RS2 A;  3NE7 A;  4MRI A;  2VL1 A;  4H1H A;  4NCZ A;  3IEH A;  3EO4 A;  4CYN A;  2ZEL A;  5JPH A;  1KUY A;  3U1B A;  4M6G A;  4R76 A;  3K4I A;  1M6V B;  3D8P A;  3KR4 A;  2GE3 A;  2PQ8 A;  4CPA A;  1JQG A;  1K4J A;  2V77 A;  4KUA A;  1CG2 A;  3SI0 A;  4MHP A;  1VKC A;  4C7H A;  4KVX A;  1Z8L A;  2Q7S A;  2R7H A;  3NE8 A;  1Y7E A;  2CXA A;  4HPS A;  4XPD C;  2B3U A;  2R8V A;  1VBH A;  4EME A;  2FL4 A;  3QNV A;  1IYL A;  4E0A A;  4TJX A;  3GY9 A;  2Z3L A;  2OZH A;  3SXN A;  4CGO A;  1DIK A;  5JYB A;  2AFU A;  5HKZ A;  1RTQ A;  1GHE A;  1UFH A;  2I00 A;  3NA6 A;  2BO9 A;  3R9E A;  3DDD A;  3TTH A;  1B47 A;  4R3K A;  3TLZ A;  2PJC A;  1B6B A;  4KOX A;  4KSA A;  3HPG G;  4NFR A;  1MJB A;  3IGR A;  3TLB A;  4NF1 A;  3LWU A;  3PP9 A;  3FEE A;  4B5P B;  5IR2 A;  4MFL A;  2X0S A;  3IFE A;  4MCP A;  4OC0 A;  3IC1 A;  3LAC A;  4C9R A;  2Z3N A;  3FVL A;  3LD2 A;  4YN3 A;  3GIU A;  3T07 A;  4NGN A;  2FXF A;  3R9F A;  1AMP A;  1H8L A;  1PCA A;  1DE4 C;  3CPX A;  1QMU A;  1S60 A;  1U6M A;  1ZG9 A;  3LOD A;  3PZJ A;  3F9K C;  2Z3O A;  1IIC A;  4B5P A;  3SJG A;  5J3X A;  4MCR A;  2BCO A;  2CNM A;  2Q04 A;  4YGO A;  1ZO0 A;  5F46 A;  4UEZ A;  3B3T A;  4OAD A;  3CXP A;  1KZF A;  3FXT A;  3KZW A;  2ODF A;  4IF5 A;  1CPX A;  4UWJ A;  5ISV A;  5J8F A;  2AUM A;  2EZC A;  4NJQ A;  3K9U A;  4GS4 A;  4K30 A;  2GLF A;  4KSF A;  2AFM A;  3CPA A;  2F7V A;  5CPA A;  4FD4 A;  3OB2 B;  3H5Z A;  3WC5 A;  4R8F A;  3WC7 A;  4CGL A;  1MK4 A;  2XEF A;  3OB1 B;  3QB8 A;  1IID A;  3ISZ A;  2YND A;  4JD6 A;  4C86 A;  2ZOF A;  3F0A A;  2ZW7 A;  4BIN A;  3D7D A;  3TLC A;  3SR3 A;  4NGR A;  1CPS A;  1VHO A;  3GB0 A;  3WT4 A;  1CBX A;  2ZEF A;  5JGF A;  5E96 A;  1ZRS A;  3A9L A;  3BJ7 A;  5D8N A;  3TC8 A;  4YU9 A;  5FD8 A;  2JEV A;  3F5B A;  2J8M A;  4IK2 A;  2OOT A;  4X2T A;  4YRH A;  3CZX A;  5F49 A;  4OC1 A;  2PCU A;  4ZBG A;  1JDE A;  4MCS A;  2R98 A;  1IOF A;  3DR6 A;  4A94 A;  1CE8 B;  3W6S A;  4WWV A;  1PUA A;  3G3S A;  3VH9 A;  3BHX A;  1Q2D A;  4M8D A;  1KBL A;  4M85 A;  4EFD A;  2NSM A;  4A31 A;  1YRE A;  2K5T A;  2B58 A;  3B3W A;  1EE3 P;  4AVC A;  2D4O A;  3E0K A;  5EC4 A;  4H6Z A;  3D68 A;  4R87 A;  4LQ6 A;  4YFJ A;  1LAM A;  2XEG A;  3EFA A;  4P10 A;  1GYT A;  4CYQ A;  4MI1 A;  2PC1 A;  2HV2 A;  4RR2 B;  4UCN A;  5K8O A;  3ICU A;  2QIR A;  2EUI A;  2NYQ A;  2REF A;  2BL1 A;  2PR8 A;  2AFS A;  4NJR A;  1T36 B;  2CIJ A;  2XEJ A;  4W9Y A;  4C8P A;  2PIZ A;  4A2Z A;  2BEI A;  1OBR A;  2AJ6 A;  5J8C A;  3KL9 A;  4A39 A;  4FUU A;  2JBJ A;  3VWE A;  2C6G A;  2ABZ A;  3FEC A;  3QAY A;  3RO0 A;  3SJX A;  2V8V A;  1X12 A;  4AVA A;  3KKW A;  1Y0Y A;  2QML A;  7CPA A;  1M44 A;  5G22 A;  3BLN A;  5J1Q A;  1S5K A;  3R9G A;  3HPH E;  4F8Z A;  2WZN A;  2RFH A;  2Q4V A;  3RYO A;  4CAW A;  4LX9 A;  4B10 A;  1AYE A;  2OZG A;  2C1C A;  4UIA A;  3V7Z A;  1ON0 A;  4HNW B;  4CGM A;  4CYO A;  4FWU A;  4KOU A;  2KCW A;  1XMT A;  4UCP A;  1XRY A;  1QSN A;  5AG6 A;  3I9S A;  5A28 A;  4C2Z A;  3HUV A;  3IIB A;  3SJE A;  1WJT A;  2JBK A;  1XJO A;  2YGW A;  4CAE A;  3PFV A;  4XPL A;  5AXI A;  4M6I A;  2PJ4 A;  4A33 A;  1ZLI A;  5IB9 A;  1WVM A;  3I3G A;  2PVW A;  3KQX A;  2OB0 A;  4H2K A;  2ZW6 A;  3TLG A;  3TLY A;  4QBJ A;  4KOS A;  3NFQ A;  4JJX A;  4QVT A;  3IJ3 A;  4HNY B;  4CDK A;  2ZXV A;  4U9Y A;  4UEE A;  4CGP A;  2FIA A;  1XFO A;  2ZEH A;  3EC4 A;  1ZYM A;  3EXN A;  3HMJ G;  1V6C A;  2FS5 A;  3K2K A;  5F13 A;  5K8N A;  3S9M A;  2CBL A;  1ARL A;  4BPW B;  1QSR A;  3PGP A;  3ZZI A;  3T0T A;  2GLJ A;  1BPN A;  1YLO A;  5HVG A;  1P0H A;  5C82 A;  2ARH A;  1OZP A;  2FSR A;  3EZE A;  1YLE A;  1YME A;  3RAM A;  1EO0 A;  4C2X A;  1C30 B;  2D0P A;  2ZEN A;  3DNS A;  1CP7 A;  5F48 A;  4QC6 A;  4Y49 B;  5JH9 A;  1TF8 A;  1JDB C;  3TYX A;  2R82 A;  3KHZ A;  2PJ7 A;  2Z3K A;  4H89 A;  1IGB A;  2HQY A;  5F47 A;  2D4P A;  2PJ9 A;  1TIQ A;  2DXQ A;  2PIY A;  3FF3 A;  1TKF A;  2VQY A;  2X7B A;  4MHZ A;  3SI1 A;  4MJ8 A;  4TJV A;  2ZPA A;  3H8E A;  2D0O A;  3SXO A;  4P6Y A;  4BD9 A;  4FBE A;  5G20 A;  4HNX B;  2C6P A;  1TXR A;  5I0C A;  2ZOG A;  4C8F A;  4JWP A;  4OKO A;  1YW4 A;  2PRQ A;  5DWN A;  3SI2 A;  4AB7 A;  2Q43 A;  1IB1 E;  3TOB A;  5HVH A;  4XPD B;  2CNS A;  4KOR A;  2OZU A;  3FRM A;  4Q38 A;  3SHP A;  2AE6 A;  1YVO A;  4GM5 A;  4OME A;  4OP4 A;  3TLE A;  3B35 A;  1A2Z A;  2R1I A;  1RO5 A;  3FIX A;  2B4D A;  1SQH A;  2HC9 A;  2G0B A;  2FIW A;  3PRT A;  2POK A;  4KOV A;  4UF4 A;  4OIW A;  1P4N A;  5HXD A;  1J3L A;  2ZEM A;  4KZT A;  3KHX A;  1CP6 A;  4KVM E;  3NH5 A;  4MY0 A;  2HI6 A;  5AG5 A;  4C2Y A;  4KUB A;  1VI4 A;  2V8G A;  4ZX8 A;  4JXQ A;  4A30 A;  2F8H A;  1NBW A;  2WPW A;  4MCQ A;  4MHD A;  3ISX A;  4GPL B;  2BUE A;  3C26 A;  3DLJ A;  2PJ5 A;  2XPP A;  3KGQ A;  2NMT A;  4MXU A;  4OC2 A;  1S3Z A;  3SJF A;  2GFQ A;  3D4U A;  4DUK A;  4J0N A;  4PPZ A;  4C8U A;  4IAV A;  4XNH C;  4R6T A;  4CAV A;  4C68 A;  2EK9 A;  4MHY A;  5K8M A;  3VAR A;  1Z9E A;  4OC4 A;  1YW6 A;  2ZW4 A;  1KUV A;  2Q44 A;  3WC6 A;  1ZG7 A;  1ZG8 A;  4NGM A;  1I1D A;  1LAN A;  1UWY A;  1XF8 A;  4A4C A;  1X10 A;  2ANP A;  2DEA A;  4G1P A;  3S9N A;  5LYI A;  3TT2 A;  4B6Z A;  2QVP A;  4FD7 A;  4NXY A;  1VBG A;  4C85 A;  4MFJ A;  2N3A B;  4CO9 A;  4WJB A;  4GXH A;  3IWG A;  4NGQ A;  3ZJ0 A;  1Q7L A;  4X8I A;  3D67 A;  4AXV A;  2YNC C;  2ZEE A;  4P4D A;  1R57 A;  4U5Y A;  3C8O A;  2WUU A;  4Z65 A;  4A32 A;  1IYK A;  4X3R A;  3R95 A;  4AG7 A;  3VGO A;  1ZLH A;  4BPX B;  5LRK A;  3KRV A;  4CDJ A;  4F9V A;  4P4F A;  3OAK A;  1S7N A;  4F6A A;  4M6H A;  4JXR A;  2B0A A;  1Q2C A;  2FT0 A;  2JEW A;  1Z8X A;  5HMN A;  5F5X A;  4UEF A;  2DPS A;  3D66 A;  5DWM A;  2PSW A;  5AGE A;  1J4J A;  1FNO A;  2GU2 A;  2I79 A;  3B3V A;  1CM0 A;  1A9X B;  3GKR A;  3V38 A;  4KNG E;  2CY2 A;  2EVN A;  3GYA A;  3T8W A;  2YNC A;  3VWD A;  1YVK A;  3P2F A;  4CAF A;  4UWI A;  4C9U A;  2VZY A;  4UFX A;  2VKZ G;  1V0C A;  1VHS A;  1QST A;  2YNE A;  2O53 A;  3VAT A;  1LRZ A;  3PB4 X;  4CRZ B;  1LCP A;  3FMC A;  2PRB A;  3GUX A;  3PB7 X;  4NGT A;  1S7K A;  1WK4 A;  3PBB A;  4QB9 A;  5JQ4 A;  2EZB A;  1B87 A;  3RNZ A;  1Z4R A;  2VZZ A;  3B8G A;  1VGY A;  1GGO A;  1NMT A;  2Q51 A;  5IV0 A;  5LYL A;  4CRY B;  1XIX A;  4ZYQ A;  2Z3M A;  3NH4 A;  4PXC A;  3VTA A;  4CZ1 A;  2XPL A;  4JYW A;  4ZGY B;  2VEZ A;  2FVG A;  4CS0 B;  2ZEP A;  3HLP A;  2GRE A;  2ZEO A;  4MHN A;  1YVH A;  1PYT B;  4ZX9 A;  2H5M A;  2YJT A;  2PE3 A;  4L8A A;  3IWW A;  2AFZ A;  3TO7 A;  3W91 A;  3H8F A;  1WWZ A;  4PXE A;  4AG9 A;  1IOI A;  3G8W A;  1AUG A;  5H86 A;  1IY7 A;  2EO8 A;  3DR8 A;  4E8O A;  2C5Q A;  1Y9K A;  2UV8 G;  5AG7 A;  3BUW B;  3T90 A;  2G3A A;  5A27 A;  3S6H A;  5EMI A;  3W6X A;  3MN8 A;  1Q5X A;  4MI4 A;  3H8G A;  5KTA A;  1HDU A;  4OC3 A;  3KQZ A;  2A4N A;  3PEI A;  5DS0 A;  1FBV A;  4ZY2 A;  4NGS A;  4JLY A;  2PJ0 A;  4E5S A;  3D3S A;  1Y7R A;  2PJ3 A;  1TF9 A;  4MY3 A;  3FJU A;  3EZB A;  4CGN A;  2IMO A;  2VXK A;  2Z11 A;  3D7F A;  4E2A A;  4PK3 A;  4C9V A;  1KC7 A;  1FT7 A;  1XMB A;  1I21 A;  4QUS A;  3TCV A;  4LUA A;  4CYP A;  1MJ9 A;  3EZA A;  2XPO A;  3D2P A;  4B14 A;  4PXD A;  1KUX A;  1CS0 B;  5LRG A;  3BXM A;  3PLF B;  1LAP A;  1NSA A;  2PJB A;  4F0X A;  4O23 A;  4ZI6 A;  2P6F A;  5BY0 A;  4IUS A;  3I6S A;  4PXB A;  2AFO A;  2QEC A;  1KWM A;  1XEB A;  3H4Q A;  3N5F A;  5K99 A;  4L89 A;  4RN7 A;  2VBQ A;  5I4M A;  3TE4 A;  4P45 A;  2CTC A;  3CDX A;  3I1U A;  1BOB A;  5G1Z A;  1XE4 A;  4A38 A;  3CXS A;  1M4D A;  3R1K A;  4R9M A;  1Y0R A;  3FNC A;  4XPK A;  1YR0 A;  3KI9 A;  3QAH A;  2PR1 A;  3I74 A;  1JWQ A;  4RUH A;  5JM6 A;  4EVY A;  3VRP A;  3B3C A;  3MRU A;  3ZNI A;  1QQ9 A;  4M3S A;  1Y9Z A;  2XEI A;  2GIV A;  2Z3P A;  4MFQ A;  1ELM P;  5KTC A;  2PVV A;  3CXQ A; 
#chains in the Genus database with same CATH homology
 2EK8 A;  1F2O A;  2ZEG A;  4ZY0 A;  1HDQ A;  4Q7A A;  4TWE A;  3LMS A;  2O4H A;  3PB6 X;  1TKJ A;  4C8C A;  2J9A A;  4DYO A;  3PFO A;  1Z2L A;  4JZ0 A;  5LYL A;  1ARM A;  4MMO A;  2EWB A;  1M4L A;  4P4B A;  2AFW A;  2Q4Z A;  4C99 A;  2GP4 A;  5LRJ A;  4C9E A;  3B7I A;  1YSJ A;  2PJA A;  4OID A;  2G9D A;  3D7G A;  4C84 A;  4UIB A;  1R43 A;  2V8H A;  4C8T A;  4P4I A;  1BAV A;  1XBU A;  2RB7 A;  1XF1 A;  1DTD A;  3KAS A;  2ZED A;  3L2N A;  4EWT A;  4CDK A;  5LYD A;  2C6C A;  3TX8 A;  6CPA A;  1F57 A;  1HEE A;  3IO1 A;  3WAB A;  4DJL A;  5K8P A;  1LOK A;  1VIX A;  4KSI A;  5ELY A;  3FH4 A;  5HVF A;  4C8A A;  1CX8 A;  2WYR A;  3NFZ A;  3GLJ A;  2IJZ A;  4C9A A;  4IHM A;  1VHE A;  4PQA A;  3PB9 X;  4ZY1 A;  3JRU A;  3K9T A;  2CTB A;  4P4J A;  2IQ6 A;  5D29 A;  3RBU A;  3B3S A;  1BPM A;  3KR5 A;  4K3N A;  4FAI A;  2PJ1 A;  5F09 A;  3PB8 X;  3RZA A;  1R3N A;  4YWY A;  3FED A;  4F9U A;  3D7H A;  3NH8 A;  3PBE A;  3EIF A;  8CPA A;  2QJ8 A;  4LQG A;  2AFX A;  4R7M A;  5LYF A;  4OC5 A;  1BLL E;  3B2Y A;  2HB6 A;  2OR4 A;  1LFW A;  1F2P A;  2CF4 A;  5CBM A;  4TNU A;  3BI1 A;  2PJ6 A;  2BOA A;  3S9L A;  3PFE A;  3BI0 A;  5THW A;  2PJ2 A;  4NGP A;  1Z5R A;  4P44 A;  2QYV A;  3CT9 A;  3FX6 A;  4ONW A;  1TKH A;  3DGV A;  4P4E A;  2I3C A;  1ELL P;  4A37 A;  2V8D A;  4MRI A;  2VL1 A;  3IEH A;  2ZEL A;  4R76 A;  3KR4 A;  4CPA A;  1JQG A;  3SI0 A;  2V77 A;  1CG2 A;  4MHP A;  1Z8L A;  1Y7E A;  4EME A;  3QNV A;  4TJX A;  2AFU A;  1RTQ A;  3NA6 A;  2BO9 A;  2PJC A;  4NFR A;  3LWU A;  3FEE A;  5IR2 A;  3IFE A;  4MCP A;  4OC0 A;  3IC1 A;  4C9R A;  4YN3 A;  3FVL A;  4NGN A;  1AMP A;  1H8L A;  1PCA A;  1DE4 C;  3CPX A;  1QMU A;  1ZG9 A;  3SJG A;  4MCR A;  2BCO A;  4UEZ A;  3B3T A;  3KZW A;  1CPX A;  4NJQ A;  2GLF A;  2AFM A;  3CPA A;  2F7V A;  5CPA A;  3WC5 A;  4R8F A;  3WC7 A;  2XEF A;  3ISZ A;  4C86 A;  2ZOF A;  3D7D A;  2PVV A;  4NGR A;  1CPS A;  1VHO A;  3GB0 A;  3WT4 A;  1CBX A;  2ZEF A;  5JGF A;  5D8N A;  3TC8 A;  4YU9 A;  4X2T A;  4IK2 A;  2OOT A;  4OC1 A;  2PCU A;  4MCS A;  4A94 A;  4WWV A;  3VH9 A;  3BHX A;  4EFD A;  2NSM A;  3B3W A;  1EE3 P;  3D68 A;  1LAM A;  2XEG A;  4P10 A;  1GYT A;  3ICU A;  5K8O A;  2NYQ A;  4C8P A;  2AFS A;  4NJR A;  2CIJ A;  2XEJ A;  4W9Y A;  2PIZ A;  1OBR A;  3KL9 A;  4A39 A;  4FUU A;  2JBJ A;  2C6G A;  2ABZ A;  3FEC A;  3SJX A;  2V8V A;  1Y0Y A;  7CPA A;  5J1Q A;  4F8Z A;  2WZN A;  2RFH A;  1AYE A;  3V7Z A;  2C1C A;  4UIA A;  4FWU A;  1XRY A;  3HUV A;  3IIB A;  3SJE A;  2JBK A;  1XJO A;  1WVM A;  5IB9 A;  2PJ4 A;  1ZLI A;  2PVW A;  3KQX A;  4H2K A;  3IJ3 A;  4UEE A;  2ZEH A;  1XFO A;  1V6C A;  3K2K A;  5K8N A;  3S9M A;  1ARL A;  2GLJ A;  1BPN A;  1YLO A;  5HVG A;  1YME A;  3RAM A;  4C85 A;  2ZEN A;  1CP7 A;  5JH9 A;  1TF8 A;  3KHZ A;  2PJ7 A;  1IGB A;  2PJ9 A;  3SI1 A;  2PIY A;  3FF3 A;  1TKF A;  4TJV A;  4MHZ A;  3H8E A;  4P6Y A;  4BD9 A;  4FBE A;  2C6P A;  1TXR A;  2ZOG A;  4C8F A;  4OKO A;  1YW4 A;  2PRQ A;  3SI2 A;  2Q43 A;  5HVH A;  4GM5 A;  4OME A;  4OP4 A;  3B35 A;  2HC9 A;  3PRT A;  2POK A;  4UF4 A;  4OIW A;  5HXD A;  2ZEM A;  3KHX A;  1CP6 A;  3NH5 A;  2V8G A;  4ZX8 A;  2F8H A;  4MCQ A;  3ISX A;  3DLJ A;  2PJ5 A;  3KGQ A;  4MXU A;  3D4U A;  4OC2 A;  3SJF A;  4DUK A;  4PPZ A;  4C8U A;  4IAV A;  4R6T A;  2EK9 A;  4MHY A;  5K8M A;  3VAR A;  4OC4 A;  1YW6 A;  3WC6 A;  1ZG7 A;  4NGM A;  1LAN A;  1UWY A;  1ZG8 A;  2ANP A;  2DEA A;  4G1P A;  5LYI A;  3S9N A;  4B6Z A;  2QVP A;  4WJB A;  4NGQ A;  1Q7L A;  4X8I A;  3D67 A;  4AXV A;  2ZEE A;  4P4D A;  4Z65 A;  4X3R A;  5LRK A;  1ZLH A;  4CDJ A;  4F9V A;  4P4F A;  2JEW A;  4UEF A;  3D66 A;  1FNO A;  2GU2 A;  3B3V A;  3V38 A;  4KNG E;  3T8W A;  4C9U A;  2O53 A;  3VAT A;  3PB4 X;  1LCP A;  3FMC A;  3PB7 X;  3GUX A;  4NGT A;  3PBB A;  1VGY A;  2Q51 A;  4ZYQ A;  3NH4 A;  4PXC A;  3VTA A;  4JYW A;  2FVG A;  2ZEP A;  3HLP A;  2GRE A;  2ZEO A;  4MHN A;  1PYT B;  4ZX9 A;  2PE3 A;  3IWW A;  2AFZ A;  3H8F A;  4PXE A;  2C5Q A;  1IY7 A;  3MN8 A;  3H8G A;  1HDU A;  4OC3 A;  3KQZ A;  3PEI A;  5DS0 A;  4ZY2 A;  4NGS A;  2PJ0 A;  2PJ3 A;  1TF9 A;  3FJU A;  2IMO A;  3D7F A;  4C9V A;  1FT7 A;  1XMB A;  4PXD A;  5LRG A;  3BXM A;  1LAP A;  1NSA A;  2PJB A;  4O23 A;  4ZI6 A;  3I6S A;  4PXB A;  2AFO A;  1KWM A;  3N5F A;  5I4M A;  4P45 A;  2CTC A;  3CDX A;  3I1U A;  4A38 A;  1Y0R A;  3KI9 A;  3I74 A;  5JM6 A;  4RUH A;  3B3C A;  3MRU A;  1Y9Z A;  1QQ9 A;  2XEI A;  1ELM P;  2PJ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...