3BI0A

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a transition state analog of glu-glu
Total Genus 267
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
267
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of interactions between human glutamate carboxypeptidase II and its substrate analogs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
total genus 267
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2007-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3bi0A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3bi0A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3bi0A02
5K8NA 4OC0A 4EWTA 3PB9X 4Z65A 1ELMP 2C6CA 3DLJA 4NJQA 4EFDA 1ZLHA 4FAIA 3WC6A 4K3NA 1LCPA 4A38A 8CPAA 2GLJA 4MHNA 3I6SA 5LYIA 3T8WA 3VARA 3D7HA 2PCUA 2PJ4A 3PB8X 1VIXA 3D7FA 1CP7A 1Y9ZA 4NGQA 4P45A 3V7ZA 3PB6X 1F2OA 4OC2A 3VTAA 1XMBA 5THWA 4IAVA 2EWBA 3RAMA 4RUHA 2FVGA 3B3TA 2PJ7A 3PRTA 2RB7A 1ELLP 5HXDA 3HLPA 3PFOA 4B6ZA 2PJCA 5LRJA 1CPXA 4OC1A 4WJBA 2I3CA 3SJGA 1V6CA 3FEDA 3SI2A 1XFOA 3FEEA 2PVVA 4ZY1A 3SJEA 2ZEOA 2PJ3A 3MN8A 2ZEEA 5DS0A 4Q7AA 2PJ6A 1XF1A 5CPAA 3I1UA 1ARMA 4P4BA 1ZG7A 2JBKA 2POKA 4NGRA 4C8UA 3IIBA 4A37A 3KR5A 1BPNA 5LRKA 4C99A 1PYTB 2PVWA 2GLFA 3D4UA 1TF8A 2WYRA 4CDKA 3ISXA 1AMPA 3PBEA 2IJZA 3D68A 4C9VA 4WWVA 2EK9A 4DYOA 2AFZA 5J1QA 1UWYA 3KZWA 3SI0A 2V8HA 2XEFA 4PQAA 4PXEA 4X8IA 2G9DA 4R7MA 3ICUA 2PJAA 5IB9A 2BCOA 1RTQA 4P4IA 2F8HA 3WABA 1YMEA 5LYLA 4IHMA 4W9YA 3S9MA 4NGMA 3KHZA 4C85A 2AFOA 4OC3A 1EE3P 2V8DA 1PCAA 3HUVA 1YW4A 4UIBA 1GYTA 5HVGA 3KQXA 5LYFA 3FMCA 2Q43A 3B3CA 6CPAA 2PJ1A 4DJLA 3PBBA 4OIDA 3NH8A 2V8GA 4KNGE 1F2PA 3SJFA 5K8PA 3PEIA 1FNOA 2O53A 3D67A 4PXBA 1Z2LA 4FBEA 1IGBA 2NYQA 1DE4C 2ZOGA 5LYDA 4F8ZA 2AFMA 3KQZA 5LRGA 3MRUA 4OC4A 2AFWA 5I4MA 2O4HA 2PJ8A 1WVMA 2ZEGA 2ABZA 3H8GA 4NFRA 4CDJA 3SJXA 2ZEFA 3B7IA 3DGVA 3D7GA 4R8FA 1CBXA 2PE3A 4MCPA 4UEEA 2GU2A 4OC5A 2Q51A 4C8PA 3IO1A 1R43A 4KSIA 4A39A 3B3SA 1Z8LA 2F7VA 4H2KA 4F9UA 4X2TA 1CX8A 4MCRA 4NGNA 2EK8A 4MCSA 4ONWA 4G1PA 1CPSA 1LOKA 4A94A 5JM6A 2AFUA 3VATA 3RZAA 4ZX9A 2CTCA 4JZ0A 3FX6A 4P4DA 3BXMA 3PFEA 2AFXA 2IMOA 3K9TA 1Q7LA 3SI1A 3WC7A 4C9RA 4FWUA 3RBUA 3FJUA 3PB7X 4P10A 4ZY0A 5K8OA 4C9AA 2OR4A 5D8NA 3H8EA 3B35A 4PXCA 3D7DA 3PB4X 2PIYA 2DEAA 2RFHA 4C8AA 4C9UA 2ZEHA 4DUKA 3KASA 3IC1A 1CP6A 1BAVA 4MXUA 1HEEA 7CPAA 4C8TA 2PJ5A 4TNUA 4OP4A 3CPAA 4NGPA 4CPAA 3CT9A 2ZEMA 5K8MA 4IK2A 1TKFA 1ZG8A 3K2KA 3IEHA 4PXDA 3FVLA 1CG2A 1BLLE 1ZLIA 2ZEPA 4F9VA 3N5FA 4TJXA 5ELYA 4P6YA 1H8LA 1Y0RA 1HDQA 2PIZA 1TKJA 3V38A 3KHXA 4R76A 4C84A 4EMEA 2QYVA 4UEZA 3FECA 3GB0A 1NSAA 1VGYA 3KI9A 4NGTA 3TX8A 1VHEA 3L2NA 3I74A 1XRYA 2WZNA 3IJ3A 1M4LA 2PJ0A 1F57A 3S9LA 4MMOA 4YWYA 4MHPA 1YLOA 1TF9A 3GLJA 4ZX8A 1Z5RA 1TXRA 4OMEA 2HC9A 4NJRA 4P44A 1R3NA 3FF3A 2NSMA 3CPXA 1ZG9A 2ANPA 3EIFA 2J9AA 5F09A 2CIJA 2C1CA 1XJOA 5HVFA 2C6PA 3BI1A 1Y7EA 1IY7A 2HB6A 3B2YA 4YN3A 4UEFA 1QMUA 4UF4A 2GREA 1JQGA 4AXVA 4MRIA 4P4JA 2XEJA 4ZY2A 1YW6A 4O23A 4MHYA 4MCQA 3B3VA 2AFSA 4GM5A 2ZEDA 2V8VA 1DTDA 3VH9A 2CF4A 3WT4A 2Q4ZA 3KL9A 5JGFA 2ZELA 4C8CA 4LQGA 3LMSA 5HVHA 5JH9A 3TC8A 1AYEA 1YSJA 3CDXA 3GUXA 4ZYQA 2JBJA 2CTBA 2OOTA 4OIWA 4ZI6A 4X3RA 5CBMA 3BHXA 3NH4A 3KGQA 4UIAA 1TKHA 3BI0A 3B3WA 2C6GA 4FUUA 2ZOFA 3D66A 4C9EA 1LFWA 2QJ8A 1VHOA 4C8FA 2PJ2A 2BOAA 3JRUA 3IFEA 3FH4A 4C86A 1FT7A 3WC5A 3LWUA 1LANA 2BO9A 3NH5A 4MHZA 4TWEA 4NGSA 3ISZA 4YU9A 4JYWA 3NFZA 4OKOA 1ARLA 2QVPA 1LAMA 3QNVA 2PRQA 4P4FA 3S9NA 2ZENA 1Y0YA 1XBUA 4TJVA 4BD9A 2IQ6A 3NA6A 4R6TA 1BPMA 3H8FA 1OBRA 1KWMA 2XEIA 4P4EA 2PJBA 1HDUA 2JEWA 2XEGA 1QQ9A 4PPZA 2V77A 5D29A 1LAPA 2PJ9A 3IWWA 3KR4A 2VL1A
chains in the Genus database with same CATH superfamily
2Z3KA 5K8NA 4CO9A 2CY2A 4EVYA 4J3GA 4KVME 4OC0A 2PDOA 4EWTA 3PB9X 2VKZG 4Z65A 3OB1B 1ELMP 3RYOA 2C6CA 3IWEA 4YRHA 5C82A 2ZW6A 3DLJA 1YGHA 4NJQA 4EFDA 2DPSA 4L8AA 1ZLHA 3S6FA 4FAIA 3WC6A 4K3NA 4Y49C 1B87A 1LCPA 4PK3A 2GLJA 2VBQA 4A38A 8CPAA 5K99A 3IWGA 2Z3PA 1UFHA 4MHNA 3MGDA 3I6SA 3QAHA 5LYIA 1IB1E 3T8WA 3VARA 3D7HA 2PCUA 2PJ4A 3PB8X 1VIXA 3BUWB 3D7FA 3D2MA 1CP7A 4AVAA 1MJ9A 2G0BA 4NGQA 4P45A 2YNEA 3V7ZA 4AVBA 1Y9ZA 3CXSA 1B6BA 3PB6X 1F2OA 4OC2A 3VTAA 1XMBA 1YX0A 5THWA 4IAVA 4M6GA 2EWBA 3RAMA 4UCMA 4C8FA 2ATRA 4A4CA 2FVGA 4LX9A 4RUHA 4UWJA 2FCKA 2FL4A 3B3TA 2PJ7A 5IB0A 3NOJA 3TLBA 2OZUA 3PRTA 2RB7A 1ELLP 5HXDA 4H1HA 4X5KA 1R61A 3HLPA 1OZPA 5AG7A 2Z0ZA 3PFOA 4RN7A 4B6ZA 2B58A 2PJCA 3JTKA 1CPXA 5LRJA 4OC1A 1T36B 1XE4A 2I3CA 4WJBA 3SJGA 2J8NA 4KZTA 2GP4A 2OZHA 4C2YA 2QMLA 1Z8XA 4LUAA 5HKWA 1RO5A 2R98A 3CXPA 3FEDA 5F49A 2Z3LA 1XFOA 3F8KA 3SI2A 3WR7A 3FEEA 2B4JC 2PVVA 1ZRSA 5F48A 4MFKA 4BPWB 2J8RA 4R87A 4XPDB 4ZY1A 3SJEA 2ZEOA 3FIXA 2PJ3A 4CAWA 3MN8A 1VI4A 2ZEEA 2RC4A 3LD2A 5DS0A 3CXQA 4Q7AA 3HPGG 2PJ6A 3PGPA 3VWEA 5CPAA 1XF1A 5H84A 3D8PA 2YNDA 4KUBA 1XEBA 1ZL0A 2IL4A 4IF5A 5HH1A 2CBLA 3I1UA 1EZAA 4IIXA 1ARMA 1KUVA 2FXFA 2MP0A 3H5ZA 4P4BA 4M6IA 1JDEA 1GGOA 3TLYA 2AJ6A 1WK4A 1ZG7A 1L0CA 2JBKA 5KTDA 5FVJA 2POKA 1GHEA 4NGRA 3OP0A 4C8UA 2CNTA 3EZBA 2JLMA 3IIBA 4A37A 2AUMA 2FM4A 3F0AA 4C2XA 3KR5A 2WSAA 3NE7A 1J3LA 1BPNA 5LRKA 4E0AA 4FD7A 2HI6A 1NE9A 5ISVA 4C99A 4CGOA 3VRRA 1EZBA 1PYTB 4KS9A 4MHDA 3PLFB 3OB2B 1Z9EA 1M44A 2FSRA 2BL1A 5AG5A 2PVWA 2GLFA 3D4UA 1TF8A 1Y7RA 2WYRA 2A4NA 4CDKA 4NXYA 5BY0A 3ISXA 2Q4YA 3GKRA 1AMPA 4MFZA 2FE7A 1M6VB 3GJZA 3PBEA 4FD5A 2X0SA 2PC1A 1U6MA 1Z4RA 2IJZA 3BJ7A 3D68A 4ONUA 4C9VA 3H4QA 4WWVA 3TLAA 2EK9A 2QIRA 1NBWA 4DYOA 2P6GA 2XPOA 5F9MA 1KUYA 2AFZA 5IR2A 5J1QA 3KRVA 1UWYA 4B5PA 3KZWA 4KSAA 3SI0A 2GANA 4M8DA 4MI1A 2V8HA 4COGA 4A33A 3FNCA 2XEFA 1IYKA 1YREA 4PQAA 4Q38A 4PXEA 5AG4A 4RS2A 1SQHA 4X8IA 2OB0A 2G9DA 4F0XA 2WPXA 4CZ1A 4F0YA 4R7MA 3ICUA 2DF5A 1M4DA 2PJAA 2Q0YA 2XPLA 5IB9A 2BCOA 3U1BA 1RTQA 3P2HA 4P4IA 3I3GA 2F8HA 3WABA 5HKYA 4C7IA 1YMEA 2Z3NA 5LYLA 4IHMA 4W9YA 4GS4A 3S9MA 1R57A 3VRNA 1S5KA 4LQ6A 2P0WA 4NGMA 1KBLA 3GIUA 3SHPA 1Z9UA 3KHZA 4C85A 2AFOA 4OC3A 1I21A 1CE8B 2VEZA 1EE3P 4QBJA 2V8DA 5J3XA 4PK2A 5JPHA 1PCAA 3G23A 3HUVA 3TLCA 2D0PA 3T0TA 1YW4A 3W6XA 4UIBA 1GYTA 5JYBA 4GXHA 3KQXA 2ZW4A 5HVGA 3FMCA 2Q43A 3B3CA 5LYFA 3HMJG 5DWNA 1VBHA 2EZCA 6CPAA 4YGOA 2PJ1A 4DJLA 2PQ8A 2QECA 3PBBA 4OIDA 1NXJA 2CNMA 4JJXA 1IYLA 3NH8A 1IOIA 4CS0B 4MFQA 1A2ZA 2V8GA 3R9GA 1F2PA 1Z8WA 3SJFA 3SXNA 4KNGE 2R7HA 1AUGA 4QUSA 4B13A 2OLSA 4I49A 1WJTA 1S60A 3C26A 2C5QA 5KTAA 5K8PA 3PEIA 4B14A 1FNOA 3EFAA 4XNHC 2O53A 5KTCA 3D67A 4PXBA 3PT1A 3VROA 1CJWA 1Q2DA 1Z2LA 4FD6A 1IGBA 4FBEA 2NYQA 2WUUA 3UY5A 1DE4C 2GIVA 2D4PA 3T07A 1NMTA 2ZOGA 2B4BA 2H5MA 5LYDA 4KOTA 2AFMA 3TO7A 2NMTA 3FXTA 4F8ZA 4UFWA 3KQZA 5AXIA 3I9SA 3MRUA 4KLVA 5LRGA 4OAEA 3S6KA 4KSFA 4YFJA 4KOUA 4OC4A 2AFWA 5I4MA 2GE3A 1M4IA 2O4HA 4HPSA 4AG7A 2PJ8A 3A9LA 3ZZIA 1QSRA 1WVMA 5F5XA 2ZEGA 2ABZA 3H8GA 3ZNIA 4R57A 4UFXA 4NFRA 4CDJA 4A32A 2VQYA 4OLLA 4C2ZA 2EO8A 3SJXA 2Y0MA 2ZEFA 4UFVA 3S6GA 2EZAA 3B7IA 3DGVA 2Q4VA 1A9XB 3D7GA 4R8FA 2PCNA 2BEIA 4UBRA 1CBXA 2PE3A 4MCPA 4RR2B 4M85A 2FS5A 3LACA 2ZPAA 4UEEA 1Q2YA 2PR8A 1IIDA 1I1DA 3BUXB 2GU2A 4AB7A 2XPNA 5JVLA 4OC5A 2N3AB 4F6AA 2Q51A 3QAYA 1TIQA 5F47A 4C8PA 3IO1A 1R43A 2P6FA 4KSIA 5H86A 4A39A 3B3SA 4DNCA 1IICA 1X12A 1Z8LA 2ODFA 2PR1A 2ARHA 1IU8A 1S7FA 2F7VA 3P2FA 4B5PB 2FT0A 4H2KA 4F9UA 4X2TA 1CX8A 4R3KA 4MCRA 4NGNA 3TCVA 2EK8A 4MCSA 3G8WA 1C3OB 4ONWA 4G1PA 5F13A 1CPSA 1BOBA 1LOKA 2BUEA 2VZZA 4QC6A 4A94A 2AFUA 2Z10A 2Z11A 3TO9A 3VATA 5JM6A 3RZAA 3TFYA 4NF1A 4ZX9A 2CTCA 4JZ0A 4P4DA 3FX6A 3F9KC 3BXMA 3C8OA 1XIXA 3PFEA 3SR3A 3RNZA 3F5BA 2D0OA 2C27A 1K4JA 1LRZA 2AFXA 2IMOA 2OU2A 2YGWA 3K9TA 4MFPA 3T05A 1Q7LA 1P0HA 3NFQA 1KZFA 2PSWA 2R1IA 3IU2A 1MJBA 3SI1A 3WC7A 4AVCA 4C68A 4C9RA 4FWUA 3RBUA 2Q04A 3FJUA 3PB7X 2GFQA 2G3AA 4BPXB 4M3SA 1RXTA 4P10A 3FYNA 5IV0A 5G22A 3LODA 5JQ4A 1V6CA 1KC7A 1QSOA 4ZY0A 1I12A 4INJA 2PRBA 5K8OA 4C9AA 2JDCA 4OADA 3TO6A 2OR4A 1XOVA 2HUZA 2HV2A 5D8NA 3H8EA 3ZJ0A 3B35A 4PXCA 3TE4A 3D7DA 3B8GA 5FD8A 2B5GA 3PB4X 4IUSA 2VXKA 4R9MA 4IIYA 3EZAA 2PIYA 2DEAA 2RFHA 2R82A 4C8AA 5F1YA 4C9UA 5HMNA 1VKCA 1VBGA 2ZEHA 4DUKA 3BUNB 3KASA 3IC1A 4U9YA 3PP9A 5G20A 1CP6A 1BAVA 2ZXVA 3D2PA 4MXUA 4XPDC 3V8IA 1HEEA 3WT4A 7CPAA 2PJ5A 4CRYB 1BXRB 4C8TA 4TNUA 4OP4A 3CPAA 4BBHA 4CRZB 4RI1A 4NGPA 4CPAA 3O8ZA 2EBJA 4ZBGA 3CT9A 4KORA 4AG9A 2ZEMA 4MJ8A 4HNXB 3G3SA 4CAXA 5EC4A 3GYAA 3W6SA 2D4OA 4IK2A 3DR6A 5K8MA 4CYNA 1TKFA 1ZG8A 3PFVA 3BJ8A 3IEHA 3K2KA 4PXDA 3FVLA 1CG2A 4PSWA 3S6HA 5C88A 1BLLE 4XPLA 4EYSA 1ZLIA 2X7BA 2ZEPA 1QSNA 3R96A 4KOWA 4MBUA 1J4JA 3U88C 4FD4A 4F9VA 1JWQA 3N5FA 4XNHB 4B5OA 4TJXA 4A30A 5ELYA 4P6YA 5A28A 2ZW7A 3TLEA 1H8LA 1XF8A 1Y0RA 1HDQA 2PIZA 4QVTA 3VWDA 3SXOA 3T5MA 4UWIA 3TYXA 1TKJA 3R1KA 3V38A 4CYQA 2E28A 4JLYA 3EO4A 3KHXA 4CGLA 4R76A 4HKFA 4C84A 4UA3A 4CAEA 4EMEA 4H6ZA 2QYVA 4UEZA 2XPPA 4B10A 4J0NA 3FECA 2CNSA 3GB0A 1JDBC 1NSAA 1VGYA 3KI9A 2YNCC 4NGTA 4CGMA 3TX8A 4HNWB 4Q36A 4PSXA 5G21A 1VHEA 3IU1A 2YJVA 3TLZA 3L2NA 3I74A 2F5IA 1XRYA 2WZNA 3IJ3A 1M4LA 2PJ0A 4E5SA 4E94A 4CAVA 3HPHE 3RO0A 1FY7A 3FRMA 5EMIA 1F57A 3S9LA 2REFA 2REEA 3VGOA 3EXNA 4MMOA 4YWYA 1PUAA 4MHPA 2HROA 4CYOA 1YLOA 1TF9A 4GPLB 3GLJA 4KVXA 5CNPA 4ZX8A 3N7ZA 2EZBA 1Z5RA 1FBVA 1TXRA 3W91A 4OMEA 2HC9A 4A2ZA 1X10A 2Q44A 3JUWA 4NJRA 4P44A 1R3NA 2I79A 4A31A 3CZXA 1Z8TA 3FF3A 4XPKA 1VHSA 3PZJA 4NCZA 2AE6A 2NSMA 3CPXA 2HQYA 4CYPA 4MJXA 4KVOE 2OZGA 1ZG9A 2ANPA 3EIFA 2J9AA 3TLGA 4CGPA 5F09A 2CIJA 1Z4EA 2C1CA 1XJOA 2B3UA 2G3TA 5I0CA 5HVFA 2C6PA 4MY3A 3BI1A 1Y7EA 1IY7A 2HB6A 2J8MA 3B2YA 3NE8A 4KOXA 5EBVA 5A27A 4YN3A 3QB8A 4UEFA 2WPWA 1YK3A 1QMUA 2OH1A 2ZW5A 4MI4A 4UF4A 2GREA 1JQGA 1V0CA 1YVHA 1Y9WA 4AXVA 1BO4A 4MRIA 1Q5XA 1P4NA 4P4JA 1C30B 2XEJA 1QSTA 2JDDA 4BTFA 3IGRA 4BINA 3DSBA 4NEXA 4ZY2A 1YW6A 3BLNA 3D3SA 4O23A 4MHYA 4MCQA 1S3ZA 1KUXA 3B3VA 2AFSA 2AUNA 4H6UA 4MFLA 1S7LA 1S7KA 3KKWA 4GM5A 1Y9KA 2ZEDA 2V8VA 1M1DA 1DTDA 3VH9A 4B11A 2CF4A 4ORFA 4H89A 2FIWA 2JEVA 5HKZA 2Q4ZA 1ZO0A 3BUMB 3KL9A 4K30A 5AG6A 5DWMA 2ZELA 4ZGYB 5J8FA 5BWAB 5JGFA 4LQGA 4C8CA 4NSQA 3LMSA 5HVHA 5JH9A 3TC8A 2YJTA 3VRPA 3OWCA 1AYEA 1YSJA 3GY9A 3CDXA 3GUXA 4U5YA 4II9A 3T90A 4ZYQA 2KCWA 2JBJA 2CTBA 4BPUB 2OOTA 2P6EA 4OIWA 3BUOB 4ZI6A 4MFJA 4X3RA 2Y1NA 5CBMA 3BHXA 2I00A 3KGQA 3NH4A 4UIAA 1TKHA 4C7HA 3BI0A 2EVNA 3B3WA 3K9UA 4QB9A 2C6GA 2Y1MA 2O28A 4FUUA 2ZOFA 3D66A 5G1ZA 4JXRA 1YQEA 4HNYB 1MK4A 1DIKA 3DR8A 4A4BA 1WWZA 5J8CA 4C9EA 1YVOA 1LFWA 4JVOA 4E8OA 2QJ8A 3TT2A 1VHOA 4JD6A 2B4DA 2PJ2A 2BOAA 3JRUA 3EC4A 4UCPA 5AGEA 1CS0B 3IFEA 3TLGB 3FH4A 2Q7SA 3JVNA 2B0AA 4C86A 1FT7A 3WC5A 1Q2CA 4PV6A 3LWUA 1LANA 2BO9A 3NH5A 4M6HA 4MHZA 4TWEA 4NGSA 1YR0A 2CXAA 2K5TA 2EUIA 4L89A 3R9EA 5GCNA 3ISZA 3R95A 4CGNA 1MJAA 2VI7A 4JYWA 3NFZA 2B3VA 4KOYA 4OKOA 4YU9A 3R9FA 2HWGA 1ZYMA 1ARLA 3TOAA 3TTHA 2UV8G 2QVPA 2DIKA 4JXQA 4R3LA 1LAMA 2DXQA 3QNVA 1N71A 1EO0A 3VRQA 1IOFA 5F46A 2PRQA 4P4FA 3S9NA 2ZENA 1Y0YA 2DPTA 1XBUA 4TJVA 1YLEA 4U9ZA 3DDDA 4BD9A 2IQ6A 2R8VA 3NA6A 4E2AA 1ON0A 1M4GA 3T9YA 1YVKA 4COBA 4R6TA 3TOBA 2BSWA 1BPMA 1PU9A 4A95A 3H8FA 4BMHA 2Z3OA 3E0KA 1OBRA 4JWPA 1KWMA 1S7NA 4KLWA 2XEIA 2DLAA 4P4EA 3DNSA 3K4IA 2PJBA 4KOSA 2FIAA 2B4DB 1HDUA 1NSLA 4UCNA 4Y49B 3FB3A 4MY0A 1KEEB 2JEWA 4KUAA 3FBUA 2VZYA 4CAFA 2XEGA 1CM0A 1QSMA 4KOVA 3EZEA 1QQ9A 5IX3A 4PPZA 2Q7BA 4B12A 2V77A 3OAKA 3EY5A 5D29A 2YNCA 5E96A 1LAPA 2PJ9A 1B47A 3IWWA 2Z3MA 3KR4A 2B5GB 2VL1A 1XMTA
chains in the Genus database with same CATH topology
5K8NA 4OC0A 4EWTA 3PB9X 4Z65A 1ELMP 2C6CA 3DLJA 4NJQA 4EFDA 1ZLHA 4FAIA 3WC6A 4K3NA 1LCPA 4A38A 8CPAA 2GLJA 4MHNA 3I6SA 5LYIA 3T8WA 3VARA 3D7HA 2PCUA 2PJ4A 3PB8X 1VIXA 3D7FA 1CP7A 1Y9ZA 4NGQA 4P45A 3V7ZA 3PB6X 1F2OA 4OC2A 3VTAA 1XMBA 5THWA 4IAVA 2EWBA 3RAMA 4RUHA 2FVGA 3B3TA 2PJ7A 3PRTA 2RB7A 1ELLP 5HXDA 3HLPA 3PFOA 4B6ZA 2PJCA 5LRJA 1CPXA 4OC1A 4WJBA 2I3CA 3SJGA 2GP4A 1V6CA 3FEDA 3SI2A 1XFOA 3FEEA 2PVVA 4ZY1A 3SJEA 2ZEOA 2PJ3A 3MN8A 2ZEEA 5DS0A 4Q7AA 2PJ6A 1XF1A 5CPAA 3I1UA 1ARMA 4P4BA 1ZG7A 2JBKA 2POKA 4NGRA 4C8UA 3IIBA 4A37A 3KR5A 1BPNA 5LRKA 4C99A 1PYTB 2PVWA 2GLFA 3D4UA 1TF8A 2WYRA 4CDKA 3ISXA 1AMPA 3PBEA 2IJZA 3D68A 4C9VA 4WWVA 2EK9A 4DYOA 2AFZA 5IR2A 5J1QA 1UWYA 3KZWA 3SI0A 2V8HA 2XEFA 4PQAA 4PXEA 4X8IA 2G9DA 4R7MA 3ICUA 2PJAA 5IB9A 2BCOA 1RTQA 4P4IA 2F8HA 3WABA 1YMEA 5LYLA 4IHMA 4W9YA 3S9MA 4NGMA 3KHZA 4C85A 2AFOA 4OC3A 1EE3P 2V8DA 1PCAA 3HUVA 1YW4A 4UIBA 1GYTA 5HVGA 3KQXA 5LYFA 3FMCA 2Q43A 3B3CA 6CPAA 2PJ1A 4DJLA 3PBBA 4OIDA 3NH8A 2V8GA 4KNGE 1F2PA 3SJFA 2C5QA 5K8PA 3PEIA 1FNOA 2O53A 3D67A 4PXBA 1Z2LA 4FBEA 1IGBA 2NYQA 1DE4C 2ZOGA 5LYDA 4F8ZA 2AFMA 3KQZA 5LRGA 3MRUA 4OC4A 2AFWA 5I4MA 2O4HA 2PJ8A 1WVMA 2ZEGA 2ABZA 3H8GA 4NFRA 4CDJA 3SJXA 2ZEFA 3B7IA 3DGVA 3D7GA 4R8FA 1CBXA 2PE3A 4MCPA 4UEEA 2GU2A 4OC5A 2Q51A 4C8PA 3IO1A 1R43A 4KSIA 4A39A 3B3SA 1Z8LA 2F7VA 4H2KA 4F9UA 4X2TA 1CX8A 4MCRA 4NGNA 2EK8A 4MCSA 4ONWA 4G1PA 1CPSA 1LOKA 4A94A 5JM6A 2AFUA 3VATA 3RZAA 4ZX9A 2CTCA 4JZ0A 3FX6A 4P4DA 3BXMA 3PFEA 2AFXA 2IMOA 3K9TA 1Q7LA 3SI1A 3WC7A 4C9RA 4FWUA 3RBUA 3FJUA 3PB7X 4P10A 4ZY0A 5K8OA 4C9AA 2OR4A 5D8NA 3H8EA 3B35A 4PXCA 3D7DA 3PB4X 2PIYA 2DEAA 2RFHA 4C8AA 4C9UA 2ZEHA 4DUKA 3KASA 3IC1A 1CP6A 1BAVA 4MXUA 1HEEA 7CPAA 4C8TA 2PJ5A 4TNUA 4OP4A 3CPAA 4NGPA 4CPAA 3CT9A 2ZEMA 5K8MA 4IK2A 1TKFA 1ZG8A 3K2KA 3IEHA 4PXDA 3FVLA 1CG2A 1BLLE 1ZLIA 2ZEPA 4F9VA 3N5FA 4TJXA 5ELYA 4P6YA 1H8LA 1Y0RA 1HDQA 2PIZA 1TKJA 3V38A 3KHXA 4R76A 4C84A 4EMEA 2QYVA 4UEZA 3FECA 3GB0A 1NSAA 1VGYA 3KI9A 4NGTA 3TX8A 1VHEA 3L2NA 3I74A 1XRYA 2WZNA 3IJ3A 1M4LA 2PJ0A 1F57A 3S9LA 4MMOA 4YWYA 4MHPA 1YLOA 1TF9A 3GLJA 4ZX8A 1Z5RA 1TXRA 4OMEA 2HC9A 4NJRA 4P44A 1R3NA 3FF3A 2NSMA 3CPXA 1ZG9A 2ANPA 3EIFA 2J9AA 5F09A 2CIJA 2C1CA 1XJOA 5HVFA 2C6PA 3BI1A 1Y7EA 1IY7A 2HB6A 3B2YA 4YN3A 4UEFA 1QMUA 4UF4A 2GREA 1JQGA 4AXVA 4MRIA 4P4JA 2XEJA 4ZY2A 1YW6A 4O23A 4MHYA 4MCQA 3B3VA 2AFSA 4GM5A 2ZEDA 2V8VA 1DTDA 3VH9A 2CF4A 3WT4A 2Q4ZA 3KL9A 5JGFA 2ZELA 4C8CA 4LQGA 3LMSA 5HVHA 5JH9A 3TC8A 1AYEA 1YSJA 3CDXA 3GUXA 4ZYQA 2JBJA 2CTBA 2OOTA 4OIWA 4ZI6A 4X3RA 5CBMA 3BHXA 3NH4A 3KGQA 4UIAA 1TKHA 3BI0A 3B3WA 2C6GA 4FUUA 2ZOFA 3D66A 4C9EA 1LFWA 2QJ8A 1VHOA 4C8FA 2PJ2A 2BOAA 3JRUA 3IFEA 3FH4A 4C86A 1FT7A 3WC5A 3LWUA 1LANA 2BO9A 3NH5A 4MHZA 4TWEA 4NGSA 3ISZA 4YU9A 4JYWA 3NFZA 4OKOA 1ARLA 2QVPA 1LAMA 3QNVA 2PRQA 4P4FA 3S9NA 2ZENA 1Y0YA 1XBUA 4TJVA 4BD9A 2IQ6A 3NA6A 4R6TA 1BPMA 3H8FA 1OBRA 1KWMA 2XEIA 4P4EA 2PJBA 1HDUA 2JEWA 2XEGA 1QQ9A 4PPZA 2V77A 5D29A 1LAPA 2PJ9A 3IWWA 3KR4A 2VL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K8N A;  4OC0 A;  4EWT A;  3PB9 X;  4Z65 A;  1ELM P;  2C6C A;  3DLJ A;  4NJQ A;  4EFD A;  1ZLH A;  4FAI A;  3WC6 A;  4K3N A;  1LCP A;  4A38 A;  8CPA A;  2GLJ A;  4MHN A;  3I6S A;  5LYI A;  3T8W A;  3VAR A;  3D7H A;  2PCU A;  2PJ4 A;  3PB8 X;  1VIX A;  3D7F A;  1CP7 A;  1Y9Z A;  4NGQ A;  4P45 A;  3V7Z A;  3PB6 X;  1F2O A;  4OC2 A;  3VTA A;  1XMB A;  5THW A;  4IAV A;  2EWB A;  3RAM A;  4RUH A;  2FVG A;  3B3T A;  2PJ7 A;  3PRT A;  2RB7 A;  1ELL P;  5HXD A;  3HLP A;  3PFO A;  4B6Z A;  2PJC A;  5LRJ A;  1CPX A;  4OC1 A;  4WJB A;  2I3C A;  3SJG A;  1V6C A;  3FED A;  3SI2 A;  1XFO A;  3FEE A;  2PVV A;  4ZY1 A;  3SJE A;  2ZEO A;  2PJ3 A;  3MN8 A;  2ZEE A;  5DS0 A;  4Q7A A;  2PJ6 A;  1XF1 A;  5CPA A;  3I1U A;  1ARM A;  4P4B A;  1ZG7 A;  2JBK A;  2POK A;  4NGR A;  4C8U A;  3IIB A;  4A37 A;  3KR5 A;  1BPN A;  5LRK A;  4C99 A;  1PYT B;  2PVW A;  2GLF A;  3D4U A;  1TF8 A;  2WYR A;  4CDK A;  3ISX A;  1AMP A;  3PBE A;  2IJZ A;  3D68 A;  4C9V A;  4WWV A;  2EK9 A;  4DYO A;  2AFZ A;  5J1Q A;  1UWY A;  3KZW A;  3SI0 A;  2V8H A;  2XEF A;  4PQA A;  4PXE A;  4X8I A;  2G9D A;  4R7M A;  3ICU A;  2PJA A;  5IB9 A;  2BCO A;  1RTQ A;  4P4I A;  2F8H A;  3WAB A;  1YME A;  5LYL A;  4IHM A;  4W9Y A;  3S9M A;  4NGM A;  3KHZ A;  4C85 A;  2AFO A;  4OC3 A;  1EE3 P;  2V8D A;  1PCA A;  3HUV A;  1YW4 A;  4UIB A;  1GYT A;  5HVG A;  3KQX A;  5LYF A;  3FMC A;  2Q43 A;  3B3C A;  6CPA A;  2PJ1 A;  4DJL A;  3PBB A;  4OID A;  3NH8 A;  2V8G A;  4KNG E;  1F2P A;  3SJF A;  5K8P A;  3PEI A;  1FNO A;  2O53 A;  3D67 A;  4PXB A;  1Z2L A;  4FBE A;  1IGB A;  2NYQ A;  1DE4 C;  2ZOG A;  5LYD A;  4F8Z A;  2AFM A;  3KQZ A;  5LRG A;  3MRU A;  4OC4 A;  2AFW A;  5I4M A;  2O4H A;  2PJ8 A;  1WVM A;  2ZEG A;  2ABZ A;  3H8G A;  4NFR A;  4CDJ A;  3SJX A;  2ZEF A;  3B7I A;  3DGV A;  3D7G A;  4R8F A;  1CBX A;  2PE3 A;  4MCP A;  4UEE A;  2GU2 A;  4OC5 A;  2Q51 A;  4C8P A;  3IO1 A;  1R43 A;  4KSI A;  4A39 A;  3B3S A;  1Z8L A;  2F7V A;  4H2K A;  4F9U A;  4X2T A;  1CX8 A;  4MCR A;  4NGN A;  2EK8 A;  4MCS A;  4ONW A;  4G1P A;  1CPS A;  1LOK A;  4A94 A;  5JM6 A;  2AFU A;  3VAT A;  3RZA A;  4ZX9 A;  2CTC A;  4JZ0 A;  3FX6 A;  4P4D A;  3BXM A;  3PFE A;  2AFX A;  2IMO A;  3K9T A;  1Q7L A;  3SI1 A;  3WC7 A;  4C9R A;  4FWU A;  3RBU A;  3FJU A;  3PB7 X;  4P10 A;  4ZY0 A;  5K8O A;  4C9A A;  2OR4 A;  5D8N A;  3H8E A;  3B35 A;  4PXC A;  3D7D A;  3PB4 X;  2PIY A;  2DEA A;  2RFH A;  4C8A A;  4C9U A;  2ZEH A;  4DUK A;  3KAS A;  3IC1 A;  1CP6 A;  1BAV A;  4MXU A;  1HEE A;  7CPA A;  4C8T A;  2PJ5 A;  4TNU A;  4OP4 A;  3CPA A;  4NGP A;  4CPA A;  3CT9 A;  2ZEM A;  5K8M A;  4IK2 A;  1TKF A;  1ZG8 A;  3K2K A;  3IEH A;  4PXD A;  3FVL A;  1CG2 A;  1BLL E;  1ZLI A;  2ZEP A;  4F9V A;  3N5F A;  4TJX A;  5ELY A;  4P6Y A;  1H8L A;  1Y0R A;  1HDQ A;  2PIZ A;  1TKJ A;  3V38 A;  3KHX A;  4R76 A;  4C84 A;  4EME A;  2QYV A;  4UEZ A;  3FEC A;  3GB0 A;  1NSA A;  1VGY A;  3KI9 A;  4NGT A;  3TX8 A;  1VHE A;  3L2N A;  3I74 A;  1XRY A;  2WZN A;  3IJ3 A;  1M4L A;  2PJ0 A;  1F57 A;  3S9L A;  4MMO A;  4YWY A;  4MHP A;  1YLO A;  1TF9 A;  3GLJ A;  4ZX8 A;  1Z5R A;  1TXR A;  4OME A;  2HC9 A;  4NJR A;  4P44 A;  1R3N A;  3FF3 A;  2NSM A;  3CPX A;  1ZG9 A;  2ANP A;  3EIF A;  2J9A A;  5F09 A;  2CIJ A;  2C1C A;  1XJO A;  5HVF A;  2C6P A;  3BI1 A;  1Y7E A;  1IY7 A;  2HB6 A;  3B2Y A;  4YN3 A;  4UEF A;  1QMU A;  4UF4 A;  2GRE A;  1JQG A;  4AXV A;  4MRI A;  4P4J A;  2XEJ A;  4ZY2 A;  1YW6 A;  4O23 A;  4MHY A;  4MCQ A;  3B3V A;  2AFS A;  4GM5 A;  2ZED A;  2V8V A;  1DTD A;  3VH9 A;  2CF4 A;  3WT4 A;  2Q4Z A;  3KL9 A;  5JGF A;  2ZEL A;  4C8C A;  4LQG A;  3LMS A;  5HVH A;  5JH9 A;  3TC8 A;  1AYE A;  1YSJ A;  3CDX A;  3GUX A;  4ZYQ A;  2JBJ A;  2CTB A;  2OOT A;  4OIW A;  4ZI6 A;  4X3R A;  5CBM A;  3BHX A;  3NH4 A;  3KGQ A;  4UIA A;  1TKH A;  3BI0 A;  3B3W A;  2C6G A;  4FUU A;  2ZOF A;  3D66 A;  4C9E A;  1LFW A;  2QJ8 A;  1VHO A;  4C8F A;  2PJ2 A;  2BOA A;  3JRU A;  3IFE A;  3FH4 A;  4C86 A;  1FT7 A;  3WC5 A;  3LWU A;  1LAN A;  2BO9 A;  3NH5 A;  4MHZ A;  4TWE A;  4NGS A;  3ISZ A;  4YU9 A;  4JYW A;  3NFZ A;  4OKO A;  1ARL A;  2QVP A;  1LAM A;  3QNV A;  2PRQ A;  4P4F A;  3S9N A;  2ZEN A;  1Y0Y A;  1XBU A;  4TJV A;  4BD9 A;  2IQ6 A;  3NA6 A;  4R6T A;  1BPM A;  3H8F A;  1OBR A;  1KWM A;  2XEI A;  4P4E A;  2PJB A;  1HDU A;  2JEW A;  2XEG A;  1QQ9 A;  4PPZ A;  2V77 A;  5D29 A;  1LAP A;  2PJ9 A;  3IWW A;  3KR4 A;  2VL1 A; 
#chains in the Genus database with same CATH topology
 2Z3K A;  5K8N A;  4CO9 A;  2CY2 A;  4EVY A;  4J3G A;  4KVM E;  4OC0 A;  2PDO A;  4EWT A;  3PB9 X;  2VKZ G;  4Z65 A;  3OB1 B;  1ELM P;  3RYO A;  2C6C A;  3IWE A;  4YRH A;  5C82 A;  2ZW6 A;  3DLJ A;  1YGH A;  4NJQ A;  4EFD A;  2DPS A;  4L8A A;  1ZLH A;  3S6F A;  4FAI A;  3WC6 A;  4K3N A;  4Y49 C;  1B87 A;  1LCP A;  4PK3 A;  2GLJ A;  2VBQ A;  4A38 A;  8CPA A;  5K99 A;  3IWG A;  2Z3P A;  1UFH A;  4MHN A;  3MGD A;  3I6S A;  3QAH A;  5LYI A;  1IB1 E;  3T8W A;  3VAR A;  3D7H A;  2PCU A;  2PJ4 A;  3PB8 X;  1VIX A;  3BUW B;  3D7F A;  3D2M A;  1CP7 A;  4AVA A;  1MJ9 A;  2G0B A;  4NGQ A;  4P45 A;  2YNE A;  3V7Z A;  4AVB A;  1Y9Z A;  3CXS A;  1B6B A;  3PB6 X;  1F2O A;  4OC2 A;  3VTA A;  1XMB A;  1YX0 A;  5THW A;  4IAV A;  4M6G A;  2EWB A;  3RAM A;  4UCM A;  4C8F A;  2ATR A;  4A4C A;  2FVG A;  4LX9 A;  4RUH A;  4UWJ A;  2FCK A;  2FL4 A;  3B3T A;  2PJ7 A;  5IB0 A;  3NOJ A;  3TLB A;  2OZU A;  3PRT A;  2RB7 A;  1ELL P;  5HXD A;  4H1H A;  4X5K A;  1R61 A;  3HLP A;  1OZP A;  5AG7 A;  2Z0Z A;  3PFO A;  4RN7 A;  4B6Z A;  2B58 A;  2PJC A;  3JTK A;  1CPX A;  5LRJ A;  4OC1 A;  1T36 B;  1XE4 A;  2I3C A;  4WJB A;  3SJG A;  2J8N A;  4KZT A;  2GP4 A;  2OZH A;  4C2Y A;  2QML A;  1Z8X A;  4LUA A;  5HKW A;  1RO5 A;  2R98 A;  3CXP A;  3FED A;  5F49 A;  2Z3L A;  1XFO A;  3F8K A;  3SI2 A;  3WR7 A;  3FEE A;  2B4J C;  2PVV A;  1ZRS A;  5F48 A;  4MFK A;  4BPW B;  2J8R A;  4R87 A;  4XPD B;  4ZY1 A;  3SJE A;  2ZEO A;  3FIX A;  2PJ3 A;  4CAW A;  3MN8 A;  1VI4 A;  2ZEE A;  2RC4 A;  3LD2 A;  5DS0 A;  3CXQ A;  4Q7A A;  3HPG G;  2PJ6 A;  3PGP A;  3VWE A;  5CPA A;  1XF1 A;  5H84 A;  3D8P A;  2YND A;  4KUB A;  1XEB A;  1ZL0 A;  2IL4 A;  4IF5 A;  5HH1 A;  2CBL A;  3I1U A;  1EZA A;  4IIX A;  1ARM A;  1KUV A;  2FXF A;  2MP0 A;  3H5Z A;  4P4B A;  4M6I A;  1JDE A;  1GGO A;  3TLY A;  2AJ6 A;  1WK4 A;  1ZG7 A;  1L0C A;  2JBK A;  5KTD A;  5FVJ A;  2POK A;  1GHE A;  4NGR A;  3OP0 A;  4C8U A;  2CNT A;  3EZB A;  2JLM A;  3IIB A;  4A37 A;  2AUM A;  2FM4 A;  3F0A A;  4C2X A;  3KR5 A;  2WSA A;  3NE7 A;  1J3L A;  1BPN A;  5LRK A;  4E0A A;  4FD7 A;  2HI6 A;  1NE9 A;  5ISV A;  4C99 A;  4CGO A;  3VRR A;  1EZB A;  1PYT B;  4KS9 A;  4MHD A;  3PLF B;  3OB2 B;  1Z9E A;  1M44 A;  2FSR A;  2BL1 A;  5AG5 A;  2PVW A;  2GLF A;  3D4U A;  1TF8 A;  1Y7R A;  2WYR A;  2A4N A;  4CDK A;  4NXY A;  5BY0 A;  3ISX A;  2Q4Y A;  3GKR A;  1AMP A;  4MFZ A;  2FE7 A;  1M6V B;  3GJZ A;  3PBE A;  4FD5 A;  2X0S A;  2PC1 A;  1U6M A;  1Z4R A;  2IJZ A;  3BJ7 A;  3D68 A;  4ONU A;  4C9V A;  3H4Q A;  4WWV A;  3TLA A;  2EK9 A;  2QIR A;  1NBW A;  4DYO A;  2P6G A;  2XPO A;  5F9M A;  1KUY A;  2AFZ A;  5IR2 A;  5J1Q A;  3KRV A;  1UWY A;  4B5P A;  3KZW A;  4KSA A;  3SI0 A;  2GAN A;  4M8D A;  4MI1 A;  2V8H A;  4COG A;  4A33 A;  3FNC A;  2XEF A;  1IYK A;  1YRE A;  4PQA A;  4Q38 A;  4PXE A;  5AG4 A;  4RS2 A;  1SQH A;  4X8I A;  2OB0 A;  2G9D A;  4F0X A;  2WPX A;  4CZ1 A;  4F0Y A;  4R7M A;  3ICU A;  2DF5 A;  1M4D A;  2PJA A;  2Q0Y A;  2XPL A;  5IB9 A;  2BCO A;  3U1B A;  1RTQ A;  3P2H A;  4P4I A;  3I3G A;  2F8H A;  3WAB A;  5HKY A;  4C7I A;  1YME A;  2Z3N A;  5LYL A;  4IHM A;  4W9Y A;  4GS4 A;  3S9M A;  1R57 A;  3VRN A;  1S5K A;  4LQ6 A;  2P0W A;  4NGM A;  1KBL A;  3GIU A;  3SHP A;  1Z9U A;  3KHZ A;  4C85 A;  2AFO A;  4OC3 A;  1I21 A;  1CE8 B;  2VEZ A;  1EE3 P;  4QBJ A;  2V8D A;  5J3X A;  4PK2 A;  5JPH A;  1PCA A;  3G23 A;  3HUV A;  3TLC A;  2D0P A;  3T0T A;  1YW4 A;  3W6X A;  4UIB A;  1GYT A;  5JYB A;  4GXH A;  3KQX A;  2ZW4 A;  5HVG A;  3FMC A;  2Q43 A;  3B3C A;  5LYF A;  3HMJ G;  5DWN A;  1VBH A;  2EZC A;  6CPA A;  4YGO A;  2PJ1 A;  4DJL A;  2PQ8 A;  2QEC A;  3PBB A;  4OID A;  1NXJ A;  2CNM A;  4JJX A;  1IYL A;  3NH8 A;  1IOI A;  4CS0 B;  4MFQ A;  1A2Z A;  2V8G A;  3R9G A;  1F2P A;  1Z8W A;  3SJF A;  3SXN A;  4KNG E;  2R7H A;  1AUG A;  4QUS A;  4B13 A;  2OLS A;  4I49 A;  1WJT A;  1S60 A;  3C26 A;  2C5Q A;  5KTA A;  5K8P A;  3PEI A;  4B14 A;  1FNO A;  3EFA A;  4XNH C;  2O53 A;  5KTC A;  3D67 A;  4PXB A;  3PT1 A;  3VRO A;  1CJW A;  1Q2D A;  1Z2L A;  4FD6 A;  1IGB A;  4FBE A;  2NYQ A;  2WUU A;  3UY5 A;  1DE4 C;  2GIV A;  2D4P A;  3T07 A;  1NMT A;  2ZOG A;  2B4B A;  2H5M A;  5LYD A;  4KOT A;  2AFM A;  3TO7 A;  2NMT A;  3FXT A;  4F8Z A;  4UFW A;  3KQZ A;  5AXI A;  3I9S A;  3MRU A;  4KLV A;  5LRG A;  4OAE A;  3S6K A;  4KSF A;  4YFJ A;  4KOU A;  4OC4 A;  2AFW A;  5I4M A;  2GE3 A;  1M4I A;  2O4H A;  4HPS A;  4AG7 A;  2PJ8 A;  3A9L A;  3ZZI A;  1QSR A;  1WVM A;  5F5X A;  2ZEG A;  2ABZ A;  3H8G A;  3ZNI A;  4R57 A;  4UFX A;  4NFR A;  4CDJ A;  4A32 A;  2VQY A;  4OLL A;  4C2Z A;  2EO8 A;  3SJX A;  2Y0M A;  2ZEF A;  4UFV A;  3S6G A;  2EZA A;  3B7I A;  3DGV A;  2Q4V A;  1A9X B;  3D7G A;  4R8F A;  2PCN A;  2BEI A;  4UBR A;  1CBX A;  2PE3 A;  4MCP A;  4RR2 B;  4M85 A;  2FS5 A;  3LAC A;  2ZPA A;  4UEE A;  1Q2Y A;  2PR8 A;  1IID A;  1I1D A;  3BUX B;  2GU2 A;  4AB7 A;  2XPN A;  5JVL A;  4OC5 A;  2N3A B;  4F6A A;  2Q51 A;  3QAY A;  1TIQ A;  5F47 A;  4C8P A;  3IO1 A;  1R43 A;  2P6F A;  4KSI A;  5H86 A;  4A39 A;  3B3S A;  4DNC A;  1IIC A;  1X12 A;  1Z8L A;  2ODF A;  2PR1 A;  2ARH A;  1IU8 A;  1S7F A;  2F7V A;  3P2F A;  4B5P B;  2FT0 A;  4H2K A;  4F9U A;  4X2T A;  1CX8 A;  4R3K A;  4MCR A;  4NGN A;  3TCV A;  2EK8 A;  4MCS A;  3G8W A;  1C3O B;  4ONW A;  4G1P A;  5F13 A;  1CPS A;  1BOB A;  1LOK A;  2BUE A;  2VZZ A;  4QC6 A;  4A94 A;  2AFU A;  2Z10 A;  2Z11 A;  3TO9 A;  3VAT A;  5JM6 A;  3RZA A;  3TFY A;  4NF1 A;  4ZX9 A;  2CTC A;  4JZ0 A;  4P4D A;  3FX6 A;  3F9K C;  3BXM A;  3C8O A;  1XIX A;  3PFE A;  3SR3 A;  3RNZ A;  3F5B A;  2D0O A;  2C27 A;  1K4J A;  1LRZ A;  2AFX A;  2IMO A;  2OU2 A;  2YGW A;  3K9T A;  4MFP A;  3T05 A;  1Q7L A;  1P0H A;  3NFQ A;  1KZF A;  2PSW A;  2R1I A;  3IU2 A;  1MJB A;  3SI1 A;  3WC7 A;  4AVC A;  4C68 A;  4C9R A;  4FWU A;  3RBU A;  2Q04 A;  3FJU A;  3PB7 X;  2GFQ A;  2G3A A;  4BPX B;  4M3S A;  1RXT A;  4P10 A;  3FYN A;  5IV0 A;  5G22 A;  3LOD A;  5JQ4 A;  1V6C A;  1KC7 A;  1QSO A;  4ZY0 A;  1I12 A;  4INJ A;  2PRB A;  5K8O A;  4C9A A;  2JDC A;  4OAD A;  3TO6 A;  2OR4 A;  1XOV A;  2HUZ A;  2HV2 A;  5D8N A;  3H8E A;  3ZJ0 A;  3B35 A;  4PXC A;  3TE4 A;  3D7D A;  3B8G A;  5FD8 A;  2B5G A;  3PB4 X;  4IUS A;  2VXK A;  4R9M A;  4IIY A;  3EZA A;  2PIY A;  2DEA A;  2RFH A;  2R82 A;  4C8A A;  5F1Y A;  4C9U A;  5HMN A;  1VKC A;  1VBG A;  2ZEH A;  4DUK A;  3BUN B;  3KAS A;  3IC1 A;  4U9Y A;  3PP9 A;  5G20 A;  1CP6 A;  1BAV A;  2ZXV A;  3D2P A;  4MXU A;  4XPD C;  3V8I A;  1HEE A;  3WT4 A;  7CPA A;  2PJ5 A;  4CRY B;  1BXR B;  4C8T A;  4TNU A;  4OP4 A;  3CPA A;  4BBH A;  4CRZ B;  4RI1 A;  4NGP A;  4CPA A;  3O8Z A;  2EBJ A;  4ZBG A;  3CT9 A;  4KOR A;  4AG9 A;  2ZEM A;  4MJ8 A;  4HNX B;  3G3S A;  4CAX A;  5EC4 A;  3GYA A;  3W6S A;  2D4O A;  4IK2 A;  3DR6 A;  5K8M A;  4CYN A;  1TKF A;  1ZG8 A;  3PFV A;  3BJ8 A;  3IEH A;  3K2K A;  4PXD A;  3FVL A;  1CG2 A;  4PSW A;  3S6H A;  5C88 A;  1BLL E;  4XPL A;  4EYS A;  1ZLI A;  2X7B A;  2ZEP A;  1QSN A;  3R96 A;  4KOW A;  4MBU A;  1J4J A;  3U88 C;  4FD4 A;  4F9V A;  1JWQ A;  3N5F A;  4XNH B;  4B5O A;  4TJX A;  4A30 A;  5ELY A;  4P6Y A;  5A28 A;  2ZW7 A;  3TLE A;  1H8L A;  1XF8 A;  1Y0R A;  1HDQ A;  2PIZ A;  4QVT A;  3VWD A;  3SXO A;  3T5M A;  4UWI A;  3TYX A;  1TKJ A;  3R1K A;  3V38 A;  4CYQ A;  2E28 A;  4JLY A;  3EO4 A;  3KHX A;  4CGL A;  4R76 A;  4HKF A;  4C84 A;  4UA3 A;  4CAE A;  4EME A;  4H6Z A;  2QYV A;  4UEZ A;  2XPP A;  4B10 A;  4J0N A;  3FEC A;  2CNS A;  3GB0 A;  1JDB C;  1NSA A;  1VGY A;  3KI9 A;  2YNC C;  4NGT A;  4CGM A;  3TX8 A;  4HNW B;  4Q36 A;  4PSX A;  5G21 A;  1VHE A;  3IU1 A;  2YJV A;  3TLZ A;  3L2N A;  3I74 A;  2F5I A;  1XRY A;  2WZN A;  3IJ3 A;  1M4L A;  2PJ0 A;  4E5S A;  4E94 A;  4CAV A;  3HPH E;  3RO0 A;  1FY7 A;  3FRM A;  5EMI A;  1F57 A;  3S9L A;  2REF A;  2REE A;  3VGO A;  3EXN A;  4MMO A;  4YWY A;  1PUA A;  4MHP A;  2HRO A;  4CYO A;  1YLO A;  1TF9 A;  4GPL B;  3GLJ A;  4KVX A;  5CNP A;  4ZX8 A;  3N7Z A;  2EZB A;  1Z5R A;  1FBV A;  1TXR A;  3W91 A;  4OME A;  2HC9 A;  4A2Z A;  1X10 A;  2Q44 A;  3JUW A;  4NJR A;  4P44 A;  1R3N A;  2I79 A;  4A31 A;  3CZX A;  1Z8T A;  3FF3 A;  4XPK A;  1VHS A;  3PZJ A;  4NCZ A;  2AE6 A;  2NSM A;  3CPX A;  2HQY A;  4CYP A;  4MJX A;  4KVO E;  2OZG A;  1ZG9 A;  2ANP A;  3EIF A;  2J9A A;  3TLG A;  4CGP A;  5F09 A;  2CIJ A;  1Z4E A;  2C1C A;  1XJO A;  2B3U A;  2G3T A;  5I0C A;  5HVF A;  2C6P A;  4MY3 A;  3BI1 A;  1Y7E A;  1IY7 A;  2HB6 A;  2J8M A;  3B2Y A;  3NE8 A;  4KOX A;  5EBV A;  5A27 A;  4YN3 A;  3QB8 A;  4UEF A;  2WPW A;  1YK3 A;  1QMU A;  2OH1 A;  2ZW5 A;  4MI4 A;  4UF4 A;  2GRE A;  1JQG A;  1V0C A;  1YVH A;  1Y9W A;  4AXV A;  1BO4 A;  4MRI A;  1Q5X A;  1P4N A;  4P4J A;  1C30 B;  2XEJ A;  1QST A;  2JDD A;  4BTF A;  3IGR A;  4BIN A;  3DSB A;  4NEX A;  4ZY2 A;  1YW6 A;  3BLN A;  3D3S A;  4O23 A;  4MHY A;  4MCQ A;  1S3Z A;  1KUX A;  3B3V A;  2AFS A;  2AUN A;  4H6U A;  4MFL A;  1S7L A;  1S7K A;  3KKW A;  4GM5 A;  1Y9K A;  2ZED A;  2V8V A;  1M1D A;  1DTD A;  3VH9 A;  4B11 A;  2CF4 A;  4ORF A;  4H89 A;  2FIW A;  2JEV A;  5HKZ A;  2Q4Z A;  1ZO0 A;  3BUM B;  3KL9 A;  4K30 A;  5AG6 A;  5DWM A;  2ZEL A;  4ZGY B;  5J8F A;  5BWA B;  5JGF A;  4LQG A;  4C8C A;  4NSQ A;  3LMS A;  5HVH A;  5JH9 A;  3TC8 A;  2YJT A;  3VRP A;  3OWC A;  1AYE A;  1YSJ A;  3GY9 A;  3CDX A;  3GUX A;  4U5Y A;  4II9 A;  3T90 A;  4ZYQ A;  2KCW A;  2JBJ A;  2CTB A;  4BPU B;  2OOT A;  2P6E A;  4OIW A;  3BUO B;  4ZI6 A;  4MFJ A;  4X3R A;  2Y1N A;  5CBM A;  3BHX A;  2I00 A;  3KGQ A;  3NH4 A;  4UIA A;  1TKH A;  4C7H A;  3BI0 A;  2EVN A;  3B3W A;  3K9U A;  4QB9 A;  2C6G A;  2Y1M A;  2O28 A;  4FUU A;  2ZOF A;  3D66 A;  5G1Z A;  4JXR A;  1YQE A;  4HNY B;  1MK4 A;  1DIK A;  3DR8 A;  4A4B A;  1WWZ A;  5J8C A;  4C9E A;  1YVO A;  1LFW A;  4JVO A;  4E8O A;  2QJ8 A;  3TT2 A;  1VHO A;  4JD6 A;  2B4D A;  2PJ2 A;  2BOA A;  3JRU A;  3EC4 A;  4UCP A;  5AGE A;  1CS0 B;  3IFE A;  3TLG B;  3FH4 A;  2Q7S A;  3JVN A;  2B0A A;  4C86 A;  1FT7 A;  3WC5 A;  1Q2C A;  4PV6 A;  3LWU A;  1LAN A;  2BO9 A;  3NH5 A;  4M6H A;  4MHZ A;  4TWE A;  4NGS A;  1YR0 A;  2CXA A;  2K5T A;  2EUI A;  4L89 A;  3R9E A;  5GCN A;  3ISZ A;  3R95 A;  4CGN A;  1MJA A;  2VI7 A;  4JYW A;  3NFZ A;  2B3V A;  4KOY A;  4OKO A;  4YU9 A;  3R9F A;  2HWG A;  1ZYM A;  1ARL A;  3TOA A;  3TTH A;  2UV8 G;  2QVP A;  2DIK A;  4JXQ A;  4R3L A;  1LAM A;  2DXQ A;  3QNV A;  1N71 A;  1EO0 A;  3VRQ A;  1IOF A;  5F46 A;  2PRQ A;  4P4F A;  3S9N A;  2ZEN A;  1Y0Y A;  2DPT A;  1XBU A;  4TJV A;  1YLE A;  4U9Z A;  3DDD A;  4BD9 A;  2IQ6 A;  2R8V A;  3NA6 A;  4E2A A;  1ON0 A;  1M4G A;  3T9Y A;  1YVK A;  4COB A;  4R6T A;  3TOB A;  2BSW A;  1BPM A;  1PU9 A;  4A95 A;  3H8F A;  4BMH A;  2Z3O A;  3E0K A;  1OBR A;  4JWP A;  1KWM A;  1S7N A;  4KLW A;  2XEI A;  2DLA A;  4P4E A;  3DNS A;  3K4I A;  2PJB A;  4KOS A;  2FIA A;  2B4D B;  1HDU A;  1NSL A;  4UCN A;  4Y49 B;  3FB3 A;  4MY0 A;  1KEE B;  2JEW A;  4KUA A;  3FBU A;  2VZY A;  4CAF A;  2XEG A;  1CM0 A;  1QSM A;  4KOV A;  3EZE A;  1QQ9 A;  5IX3 A;  4PPZ A;  2Q7B A;  4B12 A;  2V77 A;  3OAK A;  3EY5 A;  5D29 A;  2YNC A;  5E96 A;  1LAP A;  2PJ9 A;  1B47 A;  3IWW A;  2Z3M A;  3KR4 A;  2B5G B;  2VL1 A;  1XMT A; 
#chains in the Genus database with same CATH homology
 5K8N A;  4OC0 A;  4EWT A;  3PB9 X;  4Z65 A;  1ELM P;  2C6C A;  3DLJ A;  4NJQ A;  4EFD A;  1ZLH A;  4FAI A;  3WC6 A;  4K3N A;  1LCP A;  4A38 A;  8CPA A;  2GLJ A;  4MHN A;  3I6S A;  5LYI A;  3T8W A;  3VAR A;  3D7H A;  2PCU A;  2PJ4 A;  3PB8 X;  1VIX A;  3D7F A;  1CP7 A;  1Y9Z A;  4NGQ A;  4P45 A;  3V7Z A;  3PB6 X;  1F2O A;  4OC2 A;  3VTA A;  1XMB A;  5THW A;  4IAV A;  2EWB A;  3RAM A;  4RUH A;  2FVG A;  3B3T A;  2PJ7 A;  3PRT A;  2RB7 A;  1ELL P;  5HXD A;  3HLP A;  3PFO A;  4B6Z A;  2PJC A;  5LRJ A;  1CPX A;  4OC1 A;  4WJB A;  2I3C A;  3SJG A;  2GP4 A;  1V6C A;  3FED A;  3SI2 A;  1XFO A;  3FEE A;  2PVV A;  4ZY1 A;  3SJE A;  2ZEO A;  2PJ3 A;  3MN8 A;  2ZEE A;  5DS0 A;  4Q7A A;  2PJ6 A;  1XF1 A;  5CPA A;  3I1U A;  1ARM A;  4P4B A;  1ZG7 A;  2JBK A;  2POK A;  4NGR A;  4C8U A;  3IIB A;  4A37 A;  3KR5 A;  1BPN A;  5LRK A;  4C99 A;  1PYT B;  2PVW A;  2GLF A;  3D4U A;  1TF8 A;  2WYR A;  4CDK A;  3ISX A;  1AMP A;  3PBE A;  2IJZ A;  3D68 A;  4C9V A;  4WWV A;  2EK9 A;  4DYO A;  2AFZ A;  5IR2 A;  5J1Q A;  1UWY A;  3KZW A;  3SI0 A;  2V8H A;  2XEF A;  4PQA A;  4PXE A;  4X8I A;  2G9D A;  4R7M A;  3ICU A;  2PJA A;  5IB9 A;  2BCO A;  1RTQ A;  4P4I A;  2F8H A;  3WAB A;  1YME A;  5LYL A;  4IHM A;  4W9Y A;  3S9M A;  4NGM A;  3KHZ A;  4C85 A;  2AFO A;  4OC3 A;  1EE3 P;  2V8D A;  1PCA A;  3HUV A;  1YW4 A;  4UIB A;  1GYT A;  5HVG A;  3KQX A;  5LYF A;  3FMC A;  2Q43 A;  3B3C A;  6CPA A;  2PJ1 A;  4DJL A;  3PBB A;  4OID A;  3NH8 A;  2V8G A;  4KNG E;  1F2P A;  3SJF A;  2C5Q A;  5K8P A;  3PEI A;  1FNO A;  2O53 A;  3D67 A;  4PXB A;  1Z2L A;  4FBE A;  1IGB A;  2NYQ A;  1DE4 C;  2ZOG A;  5LYD A;  4F8Z A;  2AFM A;  3KQZ A;  5LRG A;  3MRU A;  4OC4 A;  2AFW A;  5I4M A;  2O4H A;  2PJ8 A;  1WVM A;  2ZEG A;  2ABZ A;  3H8G A;  4NFR A;  4CDJ A;  3SJX A;  2ZEF A;  3B7I A;  3DGV A;  3D7G A;  4R8F A;  1CBX A;  2PE3 A;  4MCP A;  4UEE A;  2GU2 A;  4OC5 A;  2Q51 A;  4C8P A;  3IO1 A;  1R43 A;  4KSI A;  4A39 A;  3B3S A;  1Z8L A;  2F7V A;  4H2K A;  4F9U A;  4X2T A;  1CX8 A;  4MCR A;  4NGN A;  2EK8 A;  4MCS A;  4ONW A;  4G1P A;  1CPS A;  1LOK A;  4A94 A;  5JM6 A;  2AFU A;  3VAT A;  3RZA A;  4ZX9 A;  2CTC A;  4JZ0 A;  3FX6 A;  4P4D A;  3BXM A;  3PFE A;  2AFX A;  2IMO A;  3K9T A;  1Q7L A;  3SI1 A;  3WC7 A;  4C9R A;  4FWU A;  3RBU A;  3FJU A;  3PB7 X;  4P10 A;  4ZY0 A;  5K8O A;  4C9A A;  2OR4 A;  5D8N A;  3H8E A;  3B35 A;  4PXC A;  3D7D A;  3PB4 X;  2PIY A;  2DEA A;  2RFH A;  4C8A A;  4C9U A;  2ZEH A;  4DUK A;  3KAS A;  3IC1 A;  1CP6 A;  1BAV A;  4MXU A;  1HEE A;  7CPA A;  4C8T A;  2PJ5 A;  4TNU A;  4OP4 A;  3CPA A;  4NGP A;  4CPA A;  3CT9 A;  2ZEM A;  5K8M A;  4IK2 A;  1TKF A;  1ZG8 A;  3K2K A;  3IEH A;  4PXD A;  3FVL A;  1CG2 A;  1BLL E;  1ZLI A;  2ZEP A;  4F9V A;  3N5F A;  4TJX A;  5ELY A;  4P6Y A;  1H8L A;  1Y0R A;  1HDQ A;  2PIZ A;  1TKJ A;  3V38 A;  3KHX A;  4R76 A;  4C84 A;  4EME A;  2QYV A;  4UEZ A;  3FEC A;  3GB0 A;  1NSA A;  1VGY A;  3KI9 A;  4NGT A;  3TX8 A;  1VHE A;  3L2N A;  3I74 A;  1XRY A;  2WZN A;  3IJ3 A;  1M4L A;  2PJ0 A;  1F57 A;  3S9L A;  4MMO A;  4YWY A;  4MHP A;  1YLO A;  1TF9 A;  3GLJ A;  4ZX8 A;  1Z5R A;  1TXR A;  4OME A;  2HC9 A;  4NJR A;  4P44 A;  1R3N A;  3FF3 A;  2NSM A;  3CPX A;  1ZG9 A;  2ANP A;  3EIF A;  2J9A A;  5F09 A;  2CIJ A;  2C1C A;  1XJO A;  5HVF A;  2C6P A;  3BI1 A;  1Y7E A;  1IY7 A;  2HB6 A;  3B2Y A;  4YN3 A;  4UEF A;  1QMU A;  4UF4 A;  2GRE A;  1JQG A;  4AXV A;  4MRI A;  4P4J A;  2XEJ A;  4ZY2 A;  1YW6 A;  4O23 A;  4MHY A;  4MCQ A;  3B3V A;  2AFS A;  4GM5 A;  2ZED A;  2V8V A;  1DTD A;  3VH9 A;  2CF4 A;  3WT4 A;  2Q4Z A;  3KL9 A;  5JGF A;  2ZEL A;  4C8C A;  4LQG A;  3LMS A;  5HVH A;  5JH9 A;  3TC8 A;  1AYE A;  1YSJ A;  3CDX A;  3GUX A;  4ZYQ A;  2JBJ A;  2CTB A;  2OOT A;  4OIW A;  4ZI6 A;  4X3R A;  5CBM A;  3BHX A;  3NH4 A;  3KGQ A;  4UIA A;  1TKH A;  3BI0 A;  3B3W A;  2C6G A;  4FUU A;  2ZOF A;  3D66 A;  4C9E A;  1LFW A;  2QJ8 A;  1VHO A;  4C8F A;  2PJ2 A;  2BOA A;  3JRU A;  3IFE A;  3FH4 A;  4C86 A;  1FT7 A;  3WC5 A;  3LWU A;  1LAN A;  2BO9 A;  3NH5 A;  4MHZ A;  4TWE A;  4NGS A;  3ISZ A;  4YU9 A;  4JYW A;  3NFZ A;  4OKO A;  1ARL A;  2QVP A;  1LAM A;  3QNV A;  2PRQ A;  4P4F A;  3S9N A;  2ZEN A;  1Y0Y A;  1XBU A;  4TJV A;  4BD9 A;  2IQ6 A;  3NA6 A;  4R6T A;  1BPM A;  3H8F A;  1OBR A;  1KWM A;  2XEI A;  4P4E A;  2PJB A;  1HDU A;  2JEW A;  2XEG A;  1QQ9 A;  4PPZ A;  2V77 A;  5D29 A;  1LAP A;  2PJ9 A;  3IWW A;  3KR4 A;  2VL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...