3BI0A

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a transition state analog of glu-glu
Total Genus 267
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
267
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural basis of interactions between human glutamate carboxypeptidase II and its substrate analogs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 267
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2007-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3bi0A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3bi0A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3bi0A02
2PCUA 5THWA 4A39A 3B3TA 3WC5A 4LQGA 2EK8A 2V8VA 1V6CA 3CT9A 1TF8A 2ZEOA 4P4JA 4EMEA 1AMPA 3GUXA 3V38A 3WC7A 1R43A 5JM6A 4R76A 2HC9A 5HVHA 4C8FA 1Y9ZA 2Q43A 3RAMA 2BOAA 1OBRA 4A37A 4TJXA 2PVWA 1TKFA 2GREA 4UEEA 2BCOA 3VH9A 3MRUA 3D66A 4NGMA 3SI0A 4B6ZA 1HEEA 3WC6A 4MRIA 4C8AA 1DTDA 3DGVA 4OP4A 2ANPA 4ZY0A 3IEHA 4P4EA 2PJCA 2XEIA 1ZG9A 1XRYA 4FBEA 1FT7A 4OIWA 4CDKA 1YMEA 1ZG7A 3IFEA 4GM5A 4A38A 1IY7A 1VHEA 1XFOA 3SJEA 3TC8A 4R8FA 3PB8X 4ZX8A 2ZEDA 2NYQA 4JZ0A 2VL1A 5D8NA 5K8NA 4IK2A 1FNOA 3WT4A 1CPXA 2PJ2A 2WYRA 5HVFA 5K8OA 1ARLA 1LAMA 5HVGA 1EE3P 4UIBA 1Z5RA 2XEGA 5LYFA 1PYTB 3EIFA 2I3CA 2EK9A 5LYIA 1TF9A 5LRGA 4P4IA 5F09A 2PIZA 4C85A 4AXVA 2V77A 3TX8A 3GLJA 4OC4A 2ZEPA 3NH4A 1ARMA 1BPNA 4PQAA 4MCSA 3CPAA 4C9VA 4PXEA 3B3WA 3KHXA 2AFSA 5LYLA 3NA6A 3PBEA 1CP6A 1ELLP 1H8LA 5JH9A 4FUUA 4F9UA 4X2TA 1BPMA 2ZEMA 3VARA 3HLPA 4OIDA 4WWVA 3D68A 4OC3A 2AFUA 1CP7A 2JBKA 3H8FA 1YSJA 1LAPA 3SI1A 2PJ9A 3IIBA 4MCRA 2V8HA 4P6YA 1HDUA 4W9YA 5DS0A 3FH4A 2OR4A 2PVVA 4ZYQA 3IO1A 1LOKA 2BO9A 4UEFA 4P44A 4X8IA 4ZY2A 3RZAA 1F57A 3PEIA 3D7GA 1BLLE 6CPAA 1XJOA 2PJ8A 1XF1A 2O53A 1AYEA 3PRTA 4UIAA 3T8WA 1PCAA 3SJXA 2ZEGA 3D7HA 4PXBA 4PXCA 3KQZA 2F7VA 4TWEA 4DUKA 3I1UA 4MMOA 3MN8A 1Y0YA 4R6TA 4C8CA 4MXUA 5CBMA 3RBUA 4C8UA 3S9NA 4NJQA 3I74A 1GYTA 2Q4ZA 2PJ6A 1LCPA 3CDXA 2J9AA 1M4LA 2XEFA 3KQXA 3B2YA 2PJBA 2V8GA 3FMCA 3V7ZA 2WZNA 4NJRA 4IHMA 2C6GA 3LWUA 4OC2A 1XMBA 4DYOA 1VHOA 4R7MA 2AFWA 2OOTA 4KSIA 2HB6A 4C99A 3BHXA 4MCPA 3N5FA 4FAIA 2NSMA 2PJ4A 1F2PA 3BI1A 4C84A 3GB0A 2RFHA 3PB6X 4MHZA 1UWYA 5K8MA 2ZELA 1Q7LA 4P45A 5IB9A 3B3VA 3K9TA 4ONWA 4YN3A 1R3NA 3ISZA 2ZEFA 3VTAA 4YU9A 1TXRA 4OC5A 2GLJA 2GLFA 4RUHA 1BAVA 4O23A 3BXMA 2PJ1A 2DEAA 1YLOA 1TKHA 1CPSA 3NH5A 3KL9A 4C9RA 3KGQA 2C6CA 4H2KA 4ZI6A 3H8GA 3D4UA 1QQ9A 4Z65A 2Q51A 4CDJA 2AFXA 2XEJA 3FEEA 3FEDA 5ELYA 4YWYA 1ELMP 4C9EA 1ZG8A 2FVGA 4OC0A 2GU2A 1ZLIA 2ZEHA 3LMSA 3SJFA 5CPAA 4ZY1A 1YW6A 3B7IA 2QYVA 3B3CA 1RTQA 4PPZA 2QJ8A 3H8EA 4EFDA 4C8PA 3L2NA 2PE3A 8CPAA 4KNGE 3D7DA 5HXDA 2G9DA 3ISXA 4OMEA 5I4MA 4PXDA 4MHNA 4K3NA 4P4DA 3NFZA 3PBBA 2POKA 3KI9A 4BD9A 1JQGA 4WJBA 3VATA 3KASA 3JRUA 2ZENA 3K2KA 1LFWA 3KR5A 1VGYA 2PJ3A 3KR4A 5LYDA 2AFOA 2IQ6A 2IMOA 5J1QA 4UEZA 2JEWA 1XBUA 2RB7A 2O4HA 3PB4X 2ZOGA 4TJVA 1LANA 2ZEEA 3QNVA 1Y0RA 1NSAA 3FX6A 4ZX9A 5JGFA 2CIJA 2ABZA 4MHPA 2ZOFA 4C8TA 3PFEA 3S9MA 3FJUA 2CTBA 3DLJA 1YW4A 2EWBA 4Q7AA 2F8HA 4NGRA 2CTCA 4NGPA 1KWMA 2IJZA 4F8ZA 4JYWA 3S9LA 3ICUA 3PB9X 4NFRA 4C86A 2PJ0A 1WVMA 1F2OA 3CPXA 1Z8LA 2PRQA 5LRKA 1DE4C 3FF3A 3D7FA 1ZLHA 3IC1A 4MHYA 4OC1A 4C9UA 1VIXA 1Z2LA 2AFMA 1CX8A 4G1PA 1CBXA 3B3SA 1CG2A 4OKOA 2PJ5A 4NGNA 1QMUA 5K8PA 3SI2A 4EWTA 4CPAA 1Y7EA 2JBJA 3BI0A 4NGSA 2PIYA 3FECA 4A94A 4F9VA 4X3RA 4P4FA 2C6PA 3D67A 2CF4A 3WABA 3B35A 3PB7X 1IGBA 3SJGA 2QVPA 1HDQA 3IWWA 4P4BA 5LRJA 1TKJA 4FWUA 4NGQA 2C1CA 4MCQA 4P10A 5D29A 3IJ3A 3KZWA 4IAVA 4NGTA 3I6SA 3NH8A 4C9AA 4DJLA 4TNUA 4UF4A 2AFZA 2V8DA 7CPAA 3PFOA 2PJ7A 2PJAA 3FVLA 3KHZA 3HUVA
chains in the Genus database with same CATH superfamily
1XIXA 1WK4A 2KCWA 2PCUA 2R8VA 3DSBA 5THWA 3EFAA 3B3TA 3WC5A 4A39A 4LQGA 3HMJG 2EK8A 3K4IA 2V8VA 1V6CA 4H1HA 3CT9A 4BBHA 3GJZA 1TF8A 2YGWA 2OZGA 2FS5A 2ZEOA 5AG7A 4UCPA 5HH1A 3OWCA 1VI4A 4COBA 4A4BA 4GXHA 4L8AA 4M3SA 4P4JA 4EMEA 1AMPA 3BUXB 3CXQA 2RC4A 3GUXA 3V38A 1S7NA 3WC7A 4C85A 1R43A 1BO4A 4R76A 4CRYB 5JM6A 4C2YA 2PCNA 1P0HA 4J0NA 5BY0A 1IYKA 2HC9A 4KOYA 5HVHA 1C3OB 1Y9ZA 4C8FA 2Z3LA 2Q43A 3GKRA 3RAMA 4A38A 1SQHA 2BOAA 4PK2A 1OBRA 4CAXA 4X5KA 1MJAA 3RNZA 4Q36A 4A37A 1J3LA 4XPLA 1Z4RA 3PGPA 1VKCA 2FSRA 2GANA 4HPSA 4CS0B 1M44A 4TJXA 2B5GA 2PVWA 5FD8A 4U9YA 1PUAA 1TKFA 2GREA 2O28A 3JTKA 4UEEA 2BCOA 2E28A 2YNEA 4F6AA 3VH9A 2EZCA 2EUIA 3MRUA 1M6VB 1RXTA 1ZL0A 4A95A 3DR6A 3D66A 4NGMA 3VRPA 3SI0A 4B6ZA 1HEEA 3WC6A 4KUAA 2Q4YA 4MRIA 4E0AA 5JPHA 4C8AA 1DTDA 3DDDA 2VKZG 5AGEA 3PFVA 1S7KA 3DGVA 1BXRB 2REEA 4BINA 5IX3A 4MI1A 4OP4A 3LODA 2G3AA 2ANPA 3VGOA 4ZY0A 3IU2A 3IEHA 4CGNA 4P4EA 4PSWA 2PJCA 5AG6A 5F46A 2XEIA 3OP0A 1S3ZA 1XRYA 1ZG9A 4FBEA 1FT7A 4Y49B 4A4CA 4OIWA 1CJWA 1I21A 4CDKA 1YMEA 1ZG7A 1YK3A 2EO8A 2FCKA 1CM0A 2NMTA 3C26A 1IY7A 2PC1A 1VHEA 4GM5A 5KTCA 1EO0A 1Z8XA 1KC7A 1QSMA 1XFOA 4RS2A 3SJEA 3TC8A 4R8FA 3PB8X 4ZX8A 3OB1B 2ZEDA 2MP0A 2NYQA 3EIFA 4JZ0A 1UFHA 2VL1A 5D8NA 5K8NA 4IK2A 1FNOA 3WT4A 5F9MA 1CPXA 2PJ2A 4JXRA 5JYBA 2WYRA 5HVFA 3E0KA 5K8OA 3QAYA 5HKZA 2ARHA 2Y0MA 1ARLA 1LAMA 5HVGA 1EE3P 4UIBA 3VRRA 2B4DB 4A30A 2ZXVA 1ZO0A 1Z5RA 2HQYA 4CAEA 5IV0A 3EZBA 2XEGA 2QIRA 2DPTA 4MJ8A 5H84A 5KTAA 1PYTB 5LYFA 3P2FA 4UCMA 2REFA 1B47A 1P4NA 3BJ8A 3I9SA 4XPKA 2I3CA 2P6GA 2EZAA 4IIXA 2EK9A 1Q5XA 5LYIA 1TF9A 5LRGA 4LUAA 2F5IA 2R7HA 4FD7A 4P4IA 2YJTA 4KORA 5I0CA 5F09A 2PIZA 2FM4A 4CYPA 4B10A 3BUNB 4AXVA 3C8OA 2V77A 4KVXA 3GLJA 3GIUA 2Z3KA 4OC4A 2ZEPA 5F47A 3TX8A 5J8FA 3NH4A 2K5TA 5AG5A 4B5OA 2B5GB 1ARMA 1BPNA 2Z3NA 4MCSA 4NF1A 4PQAA 3LACA 3CPAA 3BUOB 1EZBA 4B13A 4PXEA 4C9VA 1ZRSA 1KEEB 3B3WA 1M4DA 3NFQA 3KHXA 4MFZA 3F5BA 2AFSA 1Y9KA 1S5KA 4MBUA 4AVCA 5H86A 3NA6A 3PBEA 4U5YA 5LYLA 4COGA 2Z3OA 1TIQA 4KLWA 1CP6A 1ELLP 1H8LA 3QAHA 1M4GA 4FUUA 4R87A 4F9UA 5JH9A 4C7IA 2VBQA 4X2TA 1BPMA 2Q44A 2ZEMA 4KOVA 3VARA 3HLPA 1GGOA 4E5SA 4OIDA 4A31A 4WWVA 1YVHA 1RO5A 4MFQA 4QVTA 3D68A 4OC3A 2CY2A 1MK4A 2AFUA 1CP7A 2JBKA 4MY3A 3H8FA 1YSJA 5IB0A 1YREA 1LAPA 4JXQA 2P0WA 4MFLA 3S6HA 4YFJA 4EYSA 3SI1A 4B11A 3HPHE 2PSWA 2PJ9A 3IIBA 4MCRA 2V8HA 4P6YA 1HDUA 4W9YA 4CO9A 3W6XA 5DS0A 3FH4A 4MFPA 3EC4A 2PVVA 2OR4A 4CYQA 4ZYQA 3IO1A 1LOKA 2BO9A 4MHDA 2DLAA 4UEFA 2AJ6A 1OZPA 2BEIA 4P44A 3TLGB 4NCZA 4X8IA 3VRQA 4ZY2A 2EVNA 3RZAA 1F57A 3G3SA 2PR8A 3PEIA 3D7GA 1IICA 2B4DA 1BLLE 5CNPA 1JDBC 2YJVA 2DF5A 1NSLA 1IB1E 1XJOA 2CXAA 6CPAA 2PJ8A 4L89A 1XF1A 2O53A 1AYEA 4B14A 3CXSA 3LD2A 3PRTA 4UIAA 3T8WA 4H6UA 4LQ6A 3O8ZA 1PCAA 4A32A 4CGOA 3SJXA 2ZEGA 2J8NA 2XPPA 3D7HA 1VBHA 4PXBA 4PXCA 3KQZA 4K30A 2F7VA 4TWEA 2DIKA 4CYOA 4DUKA 3NE8A 3I1UA 4MMOA 3MN8A 2VI7A 1Y0YA 4R6TA 1VHSA 1C30B 2AUNA 4C8CA 2PR1A 4MXUA 4C2ZA 5CBMA 3BJ7A 3RBUA 2WPXA 4C8UA 1NE9A 3T07A 3T05A 4OADA 3S9NA 4AVAA 4NJQA 1N71A 2GFQA 5KTDA 3I74A 1GYTA 3PP9A 4CRZB 2Q4ZA 1ZYMA 2PJ6A 1LCPA 3CDXA 2J9AA 1NMTA 1J4JA 1M4LA 4E8OA 2Y1NA 4NXYA 3P2HA 2XEFA 3KKWA 5EBVA 4E94A 3HPGG 3D3SA 3KQXA 3B2YA 1NBWA 3VWDA 2PJBA 2V8GA 3FMCA 3V7ZA 4QBJA 4RR2B 2WZNA 3MGDA 2AE6A 2C6GA 4IHMA 4NJRA 3LWUA 4OC2A 1XMBA 4QC6A 4RN7A 4DYOA 1VHOA 4H6ZA 2I00A 4R7MA 3R9GA 2AFWA 2OOTA 4KSIA 2P6FA 4LX9A 2HB6A 5DWMA 1EZAA 4C99A 2YNCA 3TOBA 3BHXA 3IFEA 4MCPA 1QSOA 5F5XA 3N5FA 4Y49C 4AG9A 4R3KA 4UCNA 4FAIA 1Q2CA 2NSMA 3R95A 1QSNA 3EZAA 2PJ4A 2QECA 1F2PA 3PT1A 3BI1A 3IU1A 1QSRA 4KOUA 4HNWB 3TLGA 4C84A 3GB0A 4ZBGA 2RFHA 3PB6X 4MHZA 2UV8G 1UWYA 2GP4A 4J3GA 5K8MA 1XMTA 2ZELA 1Q7LA 4XNHB 3TO6A 4P45A 2PQ8A 5IB9A 4UBRA 3B3VA 3K9TA 4ONWA 4KVOE 4U9ZA 4YN3A 3TLYA 1R3NA 3H5ZA 3ISZA 4KVME 4C68A 4JVOA 2ZEFA 3TYXA 4BPUB 4IIYA 3B8GA 4YU9A 3VTAA 2FT0A 1TXRA 4OC5A 2Q7SA 2GLJA 2GLFA 1K4JA 2FXFA 3H4QA 4JJXA 1Z8TA 2BSWA 4YGOA 1S7LA 4RUHA 4MI4A 2Q04A 2Y1MA 1IIDA 2FIWA 3D2MA 3QB8A 1BAVA 3S6GA 4AVBA 4O23A 4BTFA 3BXMA 2PJ1A 4PV6A 5E96A 2DEAA 1YLOA 1TKHA 1CPSA 3NH5A 3KL9A 4C9RA 4R57A 3KGQA 2C6CA 4H2KA 4ZI6A 3S6KA 4FD5A 3H8GA 4CYNA 3D4UA 1L0CA 1QQ9A 4Z65A 1R61A 2Q51A 3FIXA 2AFXA 4QUSA 4CDJA 1Q2YA 2XEJA 2X0SA 2B3VA 3FEEA 3FEDA 4FD6A 4MY0A 2AUMA 5ELYA 4YWYA 4BMHA 3FYNA 4E2AA 1ELMP 3CZXA 2N3AB 4C9EA 1ZG8A 2FVGA 4OC0A 2GU2A 3FXTA 3TLAA 2D0PA 3A9LA 1WWZA 3BLNA 4PK3A 3R9FA 3TLBA 2XPNA 1ZLIA 2ZEHA 3LMSA 4CGMA 2CNTA 2Q7BA 3T9YA 2VXKA 1Z4EA 3SJFA 1YR0A 5CPAA 4ZY1A 3GY9A 4OLLA 1YW6A 3T90A 1YX0A 3WR7A 3B7IA 2QYVA 3B3CA 1RTQA 4PPZA 2ZW6A 2QJ8A 2G3TA 3H8EA 4IUSA 4EFDA 4C8PA 2HI6A 1KUYA 2WPWA 3EXNA 3FBUA 4HKFA 4KLVA 4KOTA 3JVNA 1MJBA 4XPDB 2Z10A 1Y7RA 3L2NA 4B12A 2PE3A 8CPAA 4KNGE 3D7DA 3JUWA 5G22A 5HXDA 2G9DA 3EY5A 2R82A 2FL4A 2CBLA 1Z9UA 5F48A 2PRBA 2YNCC 4PSXA 3ISXA 4CAWA 4OMEA 5I4MA 1MJ9A 2ZW4A 2C5QA 3TCVA 4HNYB 4AG7A 1Q2DA 3SXNA 4PXDA 2GIVA 1IYLA 2JEVA 4ORFA 2XPLA 2D4OA 4JWPA 4K3NA 4MHNA 4P4DA 3N7ZA 3NFZA 3PBBA 4UA3A 2D0OA 2Q4VA 3F9KC 1DIKA 2POKA 2X7BA 5DWNA 5AXIA 3T0TA 1KBLA 3KI9A 5EC4A 4BD9A 1JQGA 4UFWA 4WJBA 3KASA 1KUVA 3VATA 3JRUA 2ZENA 1YLEA 2OZHA 1Y9WA 3K2KA 1U6MA 1LFWA 3KR5A 3SXOA 3VROA 1VGYA 1CE8B 2PJ3A 3ZZIA 5F1YA 3IWEA 3KR4A 3T5MA 2IL4A 3SR3A 2R1IA 4KSFA 5LYDA 4EVYA 2AFOA 5C82A 4BPXB 3TOAA 2JDCA 2IQ6A 3VWEA 4GPLB 1GHEA 2IMOA 1NXJA 4KOXA 2I79A 2YNDA 5J1QA 4ONUA 4B5PA 4UEZA 5IR2A 2JEWA 1XBUA 2C27A 2RB7A 2O4HA 5J3XA 4I49A 3TE4A 1M1DA 3PB4X 4UWIA 1X12A 4KUBA 2ZOGA 1JWQA 3R9EA 1VBGA 5G20A 4MJXA 4CGPA 4GS4A 3NE7A 4BPWB 5HKYA 3PZJA 4TJVA 4RI1A 4MFKA 1LANA 2ZEEA 3IWGA 3QNVA 1Y0RA 1YQEA 4KS9A 3TFYA 1IU8A 1IOIA 1NSAA 3FX6A 4ZX9A 5JGFA 4CZ1A 2H5MA 3BUWB 2CIJA 1Z8WA 2ABZA 4MHPA 1XF8A 4F0YA 5A27A 4H89A 2ZOFA 4CGLA 4UFVA 1AUGA 1S7FA 1V0CA 1LRZA 3DR8A 3PFEA 2OU2A 3UY5A 2B3UA 4C8TA 1X10A 3S9MA 3FJUA 2CTBA 5C88A 3TLZA 1S60A 2VEZA 4KOSA 3DLJA 4FD4A 4Q38A 5EMIA 2B0AA 1YW4A 2EWBA 3NOJA 2Q0YA 4M8DA 4Q7AA 2F8HA 4A2ZA 5JVLA 3U1BA 2CNSA 3TO9A 1I12A 4NGRA 2CTCA 4C7HA 2JLMA 4AB7A 4M6HA 4NGPA 4II9A 2ZW7A 1KWMA 2IJZA 1B6BA 4M6GA 2VQYA 3SHPA 4F8ZA 4JYWA 4HNXB 3S9LA 3TLEA 3ICUA 2DPSA 3PB9X 2GE3A 3R96A 4OAEA 4NFRA 2OH1A 3TLCA 4UFXA 2QMLA 3I3GA 4C86A 2PJ0A 1R57A 3OB2B 3V8IA 1WVMA 1F2OA 2HUZA 3F8KA 3CPXA 1Z8LA 1FBVA 2PRQA 5LRKA 1WJTA 2ATRA 1DE4C 2JDDA 3FF3A 1I1DA 4XNHC 1QSTA 2WSAA 2G0BA 4CAVA 3D7FA 2Z3PA 1ZLHA 3G23A 2ZW5A 2Z11A 2B4JC 3IC1A 5A28A 3OAKA 2VZZA 2B4BA 4UWJA 3S6FA 4MHYA 4OC1A 2P6EA 3ZJ0A 2EZBA 4C9UA 1VIXA 4IF5A 1Z2LA 2AFMA 1CX8A 4G1PA 2FE7A 3G8WA 3RYOA 2D4PA 3TTHA 5ISVA 1CBXA 3B3SA 1CG2A 4JD6A 1Z9EA 4OKOA 3F0AA 3DNSA 2ODFA 3ZNIA 1B87A 2OB0A 2EBJA 2PJ5A 4NGNA 1QMUA 3FRMA 4B5PB 2Z3MA 4KZTA 4KSAA 3SI2A 2BUEA 5K8PA 4EWTA 4CPAA 2HWGA 1XEBA 1Y7EA 5AG4A 2JBJA 1FY7A 3BI0A 1PU9A 1JDEA 3TT2A 4ZGYB 4NGSA 1KZFA 3FECA 2PIYA 3D8PA 4A94A 2FIAA 4F9VA 3VRNA 4X3RA 4P4FA 4QB9A 5J8CA 4M85A 5F49A 2C6PA 3D67A 3TO7A 2CF4A 3WABA 3B35A 4MFJA 2HV2A 3PB7X 2ZPAA 4CAFA 3KRVA 3FB3A 1IGBA 3EO4A 3W91A 3D2PA 4NEXA 3SJGA 1XOVA 2QVPA 2R98A 3RO0A 5BWAB 2HROA 1HDQA 3IWWA 4P4BA 2VZYA 4KOWA 2OLSA 5LRJA 1TKJA 1ON0A 4FWUA 3GYAA 5JQ4A 4NGQA 1YVKA 2C1CA 4MCQA 1CS0B 3BUMB 4P10A 3R1KA 4JLYA 3PLFB 3FVLA 4DNCA 2Z0ZA 4XPDC 1XE4A 2J8RA 5D29A 3K9UA 4INJA 3IJ3A 3KZWA 4IAVA 4NSQA 2J8MA 2PDOA 4NGTA 3U88C 2B58A 1YVOA 1M4IA 3IGRA 2OZUA 4A33A 3I6SA 5F13A 2WUUA 5HKWA 2CNMA 3NH8A 2XPOA 5FVJA 5GCNA 4F0XA 5HMNA 4C9AA 2A4NA 4DJLA 1BOBA 4TNUA 4UF4A 2AFZA 4YRHA 3W6SA 2DXQA 1A9XB 1IOFA 4C2XA 2BL1A 2V8DA 4M6IA 4R9MA 7CPAA 1T36B 3FNCA 3PFOA 4R3LA 2PJ7A 5G1ZA 1KUXA 3EZEA 1YGHA 1A2ZA 2PJAA 3CXPA 3KHZA 5K99A 5G21A 3HUVA
chains in the Genus database with same CATH topology
2PCUA 5THWA 4A39A 3B3TA 3WC5A 4LQGA 2EK8A 2V8VA 1V6CA 3CT9A 1TF8A 2ZEOA 4P4JA 4EMEA 1AMPA 3GUXA 3V38A 3WC7A 1R43A 5JM6A 4R76A 2HC9A 5HVHA 4C8FA 1Y9ZA 2Q43A 3RAMA 2BOAA 1OBRA 4A37A 4TJXA 2PVWA 1TKFA 2GREA 4UEEA 2BCOA 3VH9A 3MRUA 3D66A 4NGMA 3SI0A 4B6ZA 1HEEA 3WC6A 4MRIA 4C8AA 1DTDA 3DGVA 4OP4A 2ANPA 4ZY0A 3IEHA 4P4EA 2PJCA 2XEIA 1ZG9A 1XRYA 4FBEA 1FT7A 4OIWA 4CDKA 1YMEA 1ZG7A 3IFEA 4GM5A 4A38A 1IY7A 1VHEA 1XFOA 3SJEA 3TC8A 4R8FA 3PB8X 4ZX8A 2ZEDA 2NYQA 4JZ0A 2VL1A 5D8NA 5K8NA 4IK2A 1FNOA 3WT4A 1CPXA 2PJ2A 2WYRA 5HVFA 5K8OA 1ARLA 1LAMA 5HVGA 1EE3P 4UIBA 1Z5RA 2XEGA 5LYFA 1PYTB 3EIFA 2I3CA 2EK9A 5LYIA 1TF9A 5LRGA 4P4IA 5F09A 2PIZA 4C85A 4AXVA 2V77A 3TX8A 3GLJA 4OC4A 2ZEPA 3NH4A 1ARMA 1BPNA 4PQAA 4MCSA 3CPAA 4C9VA 4PXEA 3B3WA 3KHXA 2AFSA 5LYLA 3NA6A 3PBEA 1CP6A 1ELLP 1H8LA 5JH9A 4FUUA 4F9UA 4X2TA 1BPMA 2ZEMA 3VARA 3HLPA 4OIDA 4WWVA 3D68A 4OC3A 2AFUA 1CP7A 2JBKA 3H8FA 1YSJA 1LAPA 3SI1A 2PJ9A 3IIBA 4MCRA 2V8HA 4P6YA 1HDUA 4W9YA 5DS0A 3FH4A 2OR4A 2PVVA 4ZYQA 3IO1A 1LOKA 2BO9A 4UEFA 4P44A 4X8IA 4ZY2A 3RZAA 1F57A 3PEIA 3D7GA 1BLLE 6CPAA 1XJOA 2PJ8A 1XF1A 2O53A 1AYEA 3PRTA 4UIAA 3T8WA 1PCAA 3SJXA 2ZEGA 3D7HA 4PXBA 4PXCA 3KQZA 2F7VA 4TWEA 4DUKA 3I1UA 4MMOA 3MN8A 1Y0YA 4R6TA 4C8CA 4MXUA 5CBMA 3RBUA 4C8UA 3S9NA 4NJQA 3I74A 1GYTA 2Q4ZA 2PJ6A 1LCPA 3CDXA 2J9AA 1M4LA 2XEFA 3KQXA 3B2YA 2PJBA 2V8GA 3FMCA 3V7ZA 2WZNA 4NJRA 4IHMA 2C6GA 3LWUA 4OC2A 1XMBA 4DYOA 1VHOA 4R7MA 2AFWA 2OOTA 4KSIA 2HB6A 4C99A 3BHXA 4MCPA 3N5FA 4FAIA 2NSMA 2PJ4A 1F2PA 3BI1A 4C84A 3GB0A 2RFHA 3PB6X 4MHZA 2GP4A 1UWYA 5K8MA 2ZELA 1Q7LA 4P45A 5IB9A 3B3VA 3K9TA 4ONWA 4YN3A 1R3NA 3ISZA 2ZEFA 3VTAA 4YU9A 1TXRA 4OC5A 2GLJA 2GLFA 4RUHA 1BAVA 4O23A 3BXMA 2PJ1A 2DEAA 1YLOA 1TKHA 1CPSA 3NH5A 3KL9A 4C9RA 3KGQA 2C6CA 4H2KA 4ZI6A 3H8GA 3D4UA 1QQ9A 4Z65A 2Q51A 4CDJA 2AFXA 2XEJA 3FEEA 3FEDA 5ELYA 4YWYA 1ELMP 4C9EA 1ZG8A 2FVGA 4OC0A 2GU2A 1ZLIA 2ZEHA 3LMSA 3SJFA 5CPAA 4ZY1A 1YW6A 3B7IA 2QYVA 3B3CA 1RTQA 4PPZA 2QJ8A 3H8EA 4EFDA 4C8PA 3L2NA 2PE3A 8CPAA 4KNGE 3D7DA 5HXDA 2G9DA 3ISXA 4OMEA 5I4MA 2C5QA 4PXDA 4MHNA 4K3NA 4P4DA 3NFZA 3PBBA 2POKA 3KI9A 4BD9A 1JQGA 4WJBA 3VATA 3KASA 3JRUA 2ZENA 3K2KA 1LFWA 3KR5A 1VGYA 2PJ3A 3KR4A 5LYDA 2AFOA 2IQ6A 2IMOA 5J1QA 5IR2A 4UEZA 2JEWA 1XBUA 2RB7A 2O4HA 3PB4X 2ZOGA 4TJVA 1LANA 2ZEEA 3QNVA 1Y0RA 1NSAA 3FX6A 4ZX9A 5JGFA 2CIJA 2ABZA 4MHPA 2ZOFA 4C8TA 3PFEA 3S9MA 3FJUA 2CTBA 3DLJA 1YW4A 2EWBA 4Q7AA 2F8HA 4NGRA 2CTCA 4NGPA 1KWMA 2IJZA 4F8ZA 4JYWA 3S9LA 3ICUA 3PB9X 4NFRA 4C86A 2PJ0A 1WVMA 1F2OA 3CPXA 1Z8LA 2PRQA 5LRKA 1DE4C 3FF3A 3D7FA 1ZLHA 3IC1A 4MHYA 4OC1A 4C9UA 1VIXA 1Z2LA 2AFMA 1CX8A 4G1PA 1CBXA 3B3SA 1CG2A 4OKOA 2PJ5A 4NGNA 1QMUA 5K8PA 3SI2A 4EWTA 4CPAA 1Y7EA 2JBJA 3BI0A 4NGSA 2PIYA 3FECA 4A94A 4F9VA 4X3RA 4P4FA 2C6PA 3D67A 2CF4A 3WABA 3B35A 3PB7X 1IGBA 3SJGA 2QVPA 1HDQA 3IWWA 4P4BA 5LRJA 1TKJA 4FWUA 4NGQA 2C1CA 4MCQA 4P10A 5D29A 3IJ3A 3KZWA 4IAVA 4NGTA 3I6SA 3NH8A 4C9AA 4DJLA 4TNUA 4UF4A 2AFZA 2V8DA 7CPAA 3PFOA 2PJ7A 2PJAA 3FVLA 3KHZA 3HUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PCU A;  5THW A;  4A39 A;  3B3T A;  3WC5 A;  4LQG A;  2EK8 A;  2V8V A;  1V6C A;  3CT9 A;  1TF8 A;  2ZEO A;  4P4J A;  4EME A;  1AMP A;  3GUX A;  3V38 A;  3WC7 A;  1R43 A;  5JM6 A;  4R76 A;  2HC9 A;  5HVH A;  4C8F A;  1Y9Z A;  2Q43 A;  3RAM A;  2BOA A;  1OBR A;  4A37 A;  4TJX A;  2PVW A;  1TKF A;  2GRE A;  4UEE A;  2BCO A;  3VH9 A;  3MRU A;  3D66 A;  4NGM A;  3SI0 A;  4B6Z A;  1HEE A;  3WC6 A;  4MRI A;  4C8A A;  1DTD A;  3DGV A;  4OP4 A;  2ANP A;  4ZY0 A;  3IEH A;  4P4E A;  2PJC A;  2XEI A;  1ZG9 A;  1XRY A;  4FBE A;  1FT7 A;  4OIW A;  4CDK A;  1YME A;  1ZG7 A;  3IFE A;  4GM5 A;  4A38 A;  1IY7 A;  1VHE A;  1XFO A;  3SJE A;  3TC8 A;  4R8F A;  3PB8 X;  4ZX8 A;  2ZED A;  2NYQ A;  4JZ0 A;  2VL1 A;  5D8N A;  5K8N A;  4IK2 A;  1FNO A;  3WT4 A;  1CPX A;  2PJ2 A;  2WYR A;  5HVF A;  5K8O A;  1ARL A;  1LAM A;  5HVG A;  1EE3 P;  4UIB A;  1Z5R A;  2XEG A;  5LYF A;  1PYT B;  3EIF A;  2I3C A;  2EK9 A;  5LYI A;  1TF9 A;  5LRG A;  4P4I A;  5F09 A;  2PIZ A;  4C85 A;  4AXV A;  2V77 A;  3TX8 A;  3GLJ A;  4OC4 A;  2ZEP A;  3NH4 A;  1ARM A;  1BPN A;  4PQA A;  4MCS A;  3CPA A;  4C9V A;  4PXE A;  3B3W A;  3KHX A;  2AFS A;  5LYL A;  3NA6 A;  3PBE A;  1CP6 A;  1ELL P;  1H8L A;  5JH9 A;  4FUU A;  4F9U A;  4X2T A;  1BPM A;  2ZEM A;  3VAR A;  3HLP A;  4OID A;  4WWV A;  3D68 A;  4OC3 A;  2AFU A;  1CP7 A;  2JBK A;  3H8F A;  1YSJ A;  1LAP A;  3SI1 A;  2PJ9 A;  3IIB A;  4MCR A;  2V8H A;  4P6Y A;  1HDU A;  4W9Y A;  5DS0 A;  3FH4 A;  2OR4 A;  2PVV A;  4ZYQ A;  3IO1 A;  1LOK A;  2BO9 A;  4UEF A;  4P44 A;  4X8I A;  4ZY2 A;  3RZA A;  1F57 A;  3PEI A;  3D7G A;  1BLL E;  6CPA A;  1XJO A;  2PJ8 A;  1XF1 A;  2O53 A;  1AYE A;  3PRT A;  4UIA A;  3T8W A;  1PCA A;  3SJX A;  2ZEG A;  3D7H A;  4PXB A;  4PXC A;  3KQZ A;  2F7V A;  4TWE A;  4DUK A;  3I1U A;  4MMO A;  3MN8 A;  1Y0Y A;  4R6T A;  4C8C A;  4MXU A;  5CBM A;  3RBU A;  4C8U A;  3S9N A;  4NJQ A;  3I74 A;  1GYT A;  2Q4Z A;  2PJ6 A;  1LCP A;  3CDX A;  2J9A A;  1M4L A;  2XEF A;  3KQX A;  3B2Y A;  2PJB A;  2V8G A;  3FMC A;  3V7Z A;  2WZN A;  4NJR A;  4IHM A;  2C6G A;  3LWU A;  4OC2 A;  1XMB A;  4DYO A;  1VHO A;  4R7M A;  2AFW A;  2OOT A;  4KSI A;  2HB6 A;  4C99 A;  3BHX A;  4MCP A;  3N5F A;  4FAI A;  2NSM A;  2PJ4 A;  1F2P A;  3BI1 A;  4C84 A;  3GB0 A;  2RFH A;  3PB6 X;  4MHZ A;  1UWY A;  5K8M A;  2ZEL A;  1Q7L A;  4P45 A;  5IB9 A;  3B3V A;  3K9T A;  4ONW A;  4YN3 A;  1R3N A;  3ISZ A;  2ZEF A;  3VTA A;  4YU9 A;  1TXR A;  4OC5 A;  2GLJ A;  2GLF A;  4RUH A;  1BAV A;  4O23 A;  3BXM A;  2PJ1 A;  2DEA A;  1YLO A;  1TKH A;  1CPS A;  3NH5 A;  3KL9 A;  4C9R A;  3KGQ A;  2C6C A;  4H2K A;  4ZI6 A;  3H8G A;  3D4U A;  1QQ9 A;  4Z65 A;  2Q51 A;  4CDJ A;  2AFX A;  2XEJ A;  3FEE A;  3FED A;  5ELY A;  4YWY A;  1ELM P;  4C9E A;  1ZG8 A;  2FVG A;  4OC0 A;  2GU2 A;  1ZLI A;  2ZEH A;  3LMS A;  3SJF A;  5CPA A;  4ZY1 A;  1YW6 A;  3B7I A;  2QYV A;  3B3C A;  1RTQ A;  4PPZ A;  2QJ8 A;  3H8E A;  4EFD A;  4C8P A;  3L2N A;  2PE3 A;  8CPA A;  4KNG E;  3D7D A;  5HXD A;  2G9D A;  3ISX A;  4OME A;  5I4M A;  4PXD A;  4MHN A;  4K3N A;  4P4D A;  3NFZ A;  3PBB A;  2POK A;  3KI9 A;  4BD9 A;  1JQG A;  4WJB A;  3VAT A;  3KAS A;  3JRU A;  2ZEN A;  3K2K A;  1LFW A;  3KR5 A;  1VGY A;  2PJ3 A;  3KR4 A;  5LYD A;  2AFO A;  2IQ6 A;  2IMO A;  5J1Q A;  4UEZ A;  2JEW A;  1XBU A;  2RB7 A;  2O4H A;  3PB4 X;  2ZOG A;  4TJV A;  1LAN A;  2ZEE A;  3QNV A;  1Y0R A;  1NSA A;  3FX6 A;  4ZX9 A;  5JGF A;  2CIJ A;  2ABZ A;  4MHP A;  2ZOF A;  4C8T A;  3PFE A;  3S9M A;  3FJU A;  2CTB A;  3DLJ A;  1YW4 A;  2EWB A;  4Q7A A;  2F8H A;  4NGR A;  2CTC A;  4NGP A;  1KWM A;  2IJZ A;  4F8Z A;  4JYW A;  3S9L A;  3ICU A;  3PB9 X;  4NFR A;  4C86 A;  2PJ0 A;  1WVM A;  1F2O A;  3CPX A;  1Z8L A;  2PRQ A;  5LRK A;  1DE4 C;  3FF3 A;  3D7F A;  1ZLH A;  3IC1 A;  4MHY A;  4OC1 A;  4C9U A;  1VIX A;  1Z2L A;  2AFM A;  1CX8 A;  4G1P A;  1CBX A;  3B3S A;  1CG2 A;  4OKO A;  2PJ5 A;  4NGN A;  1QMU A;  5K8P A;  3SI2 A;  4EWT A;  4CPA A;  1Y7E A;  2JBJ A;  3BI0 A;  4NGS A;  2PIY A;  3FEC A;  4A94 A;  4F9V A;  4X3R A;  4P4F A;  2C6P A;  3D67 A;  2CF4 A;  3WAB A;  3B35 A;  3PB7 X;  1IGB A;  3SJG A;  2QVP A;  1HDQ A;  3IWW A;  4P4B A;  5LRJ A;  1TKJ A;  4FWU A;  4NGQ A;  2C1C A;  4MCQ A;  4P10 A;  5D29 A;  3IJ3 A;  3KZW A;  4IAV A;  4NGT A;  3I6S A;  3NH8 A;  4C9A A;  4DJL A;  4TNU A;  4UF4 A;  2AFZ A;  2V8D A;  7CPA A;  3PFO A;  2PJ7 A;  2PJA A;  3FVL A;  3KHZ A;  3HUV A; 
#chains in the Genus database with same CATH topology
 1XIX A;  1WK4 A;  2KCW A;  2PCU A;  2R8V A;  3DSB A;  5THW A;  3EFA A;  3B3T A;  3WC5 A;  4A39 A;  4LQG A;  3HMJ G;  2EK8 A;  3K4I A;  2V8V A;  1V6C A;  4H1H A;  3CT9 A;  4BBH A;  3GJZ A;  1TF8 A;  2YGW A;  2OZG A;  2FS5 A;  2ZEO A;  5AG7 A;  4UCP A;  5HH1 A;  3OWC A;  1VI4 A;  4COB A;  4A4B A;  4GXH A;  4L8A A;  4M3S A;  4P4J A;  4EME A;  1AMP A;  3BUX B;  3CXQ A;  2RC4 A;  3GUX A;  3V38 A;  1S7N A;  3WC7 A;  4C85 A;  1R43 A;  1BO4 A;  4R76 A;  4CRY B;  5JM6 A;  4C2Y A;  2PCN A;  1P0H A;  4J0N A;  5BY0 A;  1IYK A;  2HC9 A;  4KOY A;  5HVH A;  1C3O B;  1Y9Z A;  4C8F A;  2Z3L A;  2Q43 A;  3GKR A;  3RAM A;  4A38 A;  1SQH A;  2BOA A;  4PK2 A;  1OBR A;  4CAX A;  4X5K A;  1MJA A;  3RNZ A;  4Q36 A;  4A37 A;  1J3L A;  4XPL A;  1Z4R A;  3PGP A;  1VKC A;  2FSR A;  2GAN A;  4HPS A;  4CS0 B;  1M44 A;  4TJX A;  2B5G A;  2PVW A;  5FD8 A;  4U9Y A;  1PUA A;  1TKF A;  2GRE A;  2O28 A;  3JTK A;  4UEE A;  2BCO A;  2E28 A;  2YNE A;  4F6A A;  3VH9 A;  2EZC A;  2EUI A;  3MRU A;  1M6V B;  1RXT A;  1ZL0 A;  4A95 A;  3DR6 A;  3D66 A;  4NGM A;  3VRP A;  3SI0 A;  4B6Z A;  1HEE A;  3WC6 A;  4KUA A;  2Q4Y A;  4MRI A;  4E0A A;  5JPH A;  4C8A A;  1DTD A;  3DDD A;  2VKZ G;  5AGE A;  3PFV A;  1S7K A;  3DGV A;  1BXR B;  2REE A;  4BIN A;  5IX3 A;  4MI1 A;  4OP4 A;  3LOD A;  2G3A A;  2ANP A;  3VGO A;  4ZY0 A;  3IU2 A;  3IEH A;  4CGN A;  4P4E A;  4PSW A;  2PJC A;  5AG6 A;  5F46 A;  2XEI A;  3OP0 A;  1S3Z A;  1XRY A;  1ZG9 A;  4FBE A;  1FT7 A;  4Y49 B;  4A4C A;  4OIW A;  1CJW A;  1I21 A;  4CDK A;  1YME A;  1ZG7 A;  1YK3 A;  2EO8 A;  2FCK A;  1CM0 A;  2NMT A;  3C26 A;  1IY7 A;  2PC1 A;  1VHE A;  4GM5 A;  5KTC A;  1EO0 A;  1Z8X A;  1KC7 A;  1QSM A;  1XFO A;  4RS2 A;  3SJE A;  3TC8 A;  4R8F A;  3PB8 X;  4ZX8 A;  3OB1 B;  2ZED A;  2MP0 A;  2NYQ A;  3EIF A;  4JZ0 A;  1UFH A;  2VL1 A;  5D8N A;  5K8N A;  4IK2 A;  1FNO A;  3WT4 A;  5F9M A;  1CPX A;  2PJ2 A;  4JXR A;  5JYB A;  2WYR A;  5HVF A;  3E0K A;  5K8O A;  3QAY A;  5HKZ A;  2ARH A;  2Y0M A;  1ARL A;  1LAM A;  5HVG A;  1EE3 P;  4UIB A;  3VRR A;  2B4D B;  4A30 A;  2ZXV A;  1ZO0 A;  1Z5R A;  2HQY A;  4CAE A;  5IV0 A;  3EZB A;  2XEG A;  2QIR A;  2DPT A;  4MJ8 A;  5H84 A;  5KTA A;  1PYT B;  5LYF A;  3P2F A;  4UCM A;  2REF A;  1B47 A;  1P4N A;  3BJ8 A;  3I9S A;  4XPK A;  2I3C A;  2P6G A;  2EZA A;  4IIX A;  2EK9 A;  1Q5X A;  5LYI A;  1TF9 A;  5LRG A;  4LUA A;  2F5I A;  2R7H A;  4FD7 A;  4P4I A;  2YJT A;  4KOR A;  5I0C A;  5F09 A;  2PIZ A;  2FM4 A;  4CYP A;  4B10 A;  3BUN B;  4AXV A;  3C8O A;  2V77 A;  4KVX A;  3GLJ A;  3GIU A;  2Z3K A;  4OC4 A;  2ZEP A;  5F47 A;  3TX8 A;  5J8F A;  3NH4 A;  2K5T A;  5AG5 A;  4B5O A;  2B5G B;  1ARM A;  1BPN A;  2Z3N A;  4MCS A;  4NF1 A;  4PQA A;  3LAC A;  3CPA A;  3BUO B;  1EZB A;  4B13 A;  4PXE A;  4C9V A;  1ZRS A;  1KEE B;  3B3W A;  1M4D A;  3NFQ A;  3KHX A;  4MFZ A;  3F5B A;  2AFS A;  1Y9K A;  1S5K A;  4MBU A;  4AVC A;  5H86 A;  3NA6 A;  3PBE A;  4U5Y A;  5LYL A;  4COG A;  2Z3O A;  1TIQ A;  4KLW A;  1CP6 A;  1ELL P;  1H8L A;  3QAH A;  1M4G A;  4FUU A;  4R87 A;  4F9U A;  5JH9 A;  4C7I A;  2VBQ A;  4X2T A;  1BPM A;  2Q44 A;  2ZEM A;  4KOV A;  3VAR A;  3HLP A;  1GGO A;  4E5S A;  4OID A;  4A31 A;  4WWV A;  1YVH A;  1RO5 A;  4MFQ A;  4QVT A;  3D68 A;  4OC3 A;  2CY2 A;  1MK4 A;  2AFU A;  1CP7 A;  2JBK A;  4MY3 A;  3H8F A;  1YSJ A;  5IB0 A;  1YRE A;  1LAP A;  4JXQ A;  2P0W A;  4MFL A;  3S6H A;  4YFJ A;  4EYS A;  3SI1 A;  4B11 A;  3HPH E;  2PSW A;  2PJ9 A;  3IIB A;  4MCR A;  2V8H A;  4P6Y A;  1HDU A;  4W9Y A;  4CO9 A;  3W6X A;  5DS0 A;  3FH4 A;  4MFP A;  3EC4 A;  2PVV A;  2OR4 A;  4CYQ A;  4ZYQ A;  3IO1 A;  1LOK A;  2BO9 A;  4MHD A;  2DLA A;  4UEF A;  2AJ6 A;  1OZP A;  2BEI A;  4P44 A;  3TLG B;  4NCZ A;  4X8I A;  3VRQ A;  4ZY2 A;  2EVN A;  3RZA A;  1F57 A;  3G3S A;  2PR8 A;  3PEI A;  3D7G A;  1IIC A;  2B4D A;  1BLL E;  5CNP A;  1JDB C;  2YJV A;  2DF5 A;  1NSL A;  1IB1 E;  1XJO A;  2CXA A;  6CPA A;  2PJ8 A;  4L89 A;  1XF1 A;  2O53 A;  1AYE A;  4B14 A;  3CXS A;  3LD2 A;  3PRT A;  4UIA A;  3T8W A;  4H6U A;  4LQ6 A;  3O8Z A;  1PCA A;  4A32 A;  4CGO A;  3SJX A;  2ZEG A;  2J8N A;  2XPP A;  3D7H A;  1VBH A;  4PXB A;  4PXC A;  3KQZ A;  4K30 A;  2F7V A;  4TWE A;  2DIK A;  4CYO A;  4DUK A;  3NE8 A;  3I1U A;  4MMO A;  3MN8 A;  2VI7 A;  1Y0Y A;  4R6T A;  1VHS A;  1C30 B;  2AUN A;  4C8C A;  2PR1 A;  4MXU A;  4C2Z A;  5CBM A;  3BJ7 A;  3RBU A;  2WPX A;  4C8U A;  1NE9 A;  3T07 A;  3T05 A;  4OAD A;  3S9N A;  4AVA A;  4NJQ A;  1N71 A;  2GFQ A;  5KTD A;  3I74 A;  1GYT A;  3PP9 A;  4CRZ B;  2Q4Z A;  1ZYM A;  2PJ6 A;  1LCP A;  3CDX A;  2J9A A;  1NMT A;  1J4J A;  1M4L A;  4E8O A;  2Y1N A;  4NXY A;  3P2H A;  2XEF A;  3KKW A;  5EBV A;  4E94 A;  3HPG G;  3D3S A;  3KQX A;  3B2Y A;  1NBW A;  3VWD A;  2PJB A;  2V8G A;  3FMC A;  3V7Z A;  4QBJ A;  4RR2 B;  2WZN A;  3MGD A;  2AE6 A;  2C6G A;  4IHM A;  4NJR A;  3LWU A;  4OC2 A;  1XMB A;  4QC6 A;  4RN7 A;  4DYO A;  1VHO A;  4H6Z A;  2I00 A;  4R7M A;  3R9G A;  2AFW A;  2OOT A;  4KSI A;  2P6F A;  4LX9 A;  2HB6 A;  5DWM A;  1EZA A;  4C99 A;  2YNC A;  3TOB A;  3BHX A;  3IFE A;  4MCP A;  1QSO A;  5F5X A;  3N5F A;  4Y49 C;  4AG9 A;  4R3K A;  4UCN A;  4FAI A;  1Q2C A;  2NSM A;  3R95 A;  1QSN A;  3EZA A;  2PJ4 A;  2QEC A;  1F2P A;  3PT1 A;  3BI1 A;  3IU1 A;  1QSR A;  4KOU A;  4HNW B;  3TLG A;  4C84 A;  3GB0 A;  4ZBG A;  2RFH A;  3PB6 X;  4MHZ A;  2UV8 G;  1UWY A;  2GP4 A;  4J3G A;  5K8M A;  1XMT A;  2ZEL A;  1Q7L A;  4XNH B;  3TO6 A;  4P45 A;  2PQ8 A;  5IB9 A;  4UBR A;  3B3V A;  3K9T A;  4ONW A;  4KVO E;  4U9Z A;  4YN3 A;  3TLY A;  1R3N A;  3H5Z A;  3ISZ A;  4KVM E;  4C68 A;  4JVO A;  2ZEF A;  3TYX A;  4BPU B;  4IIY A;  3B8G A;  4YU9 A;  3VTA A;  2FT0 A;  1TXR A;  4OC5 A;  2Q7S A;  2GLJ A;  2GLF A;  1K4J A;  2FXF A;  3H4Q A;  4JJX A;  1Z8T A;  2BSW A;  4YGO A;  1S7L A;  4RUH A;  4MI4 A;  2Q04 A;  2Y1M A;  1IID A;  2FIW A;  3D2M A;  3QB8 A;  1BAV A;  3S6G A;  4AVB A;  4O23 A;  4BTF A;  3BXM A;  2PJ1 A;  4PV6 A;  5E96 A;  2DEA A;  1YLO A;  1TKH A;  1CPS A;  3NH5 A;  3KL9 A;  4C9R A;  4R57 A;  3KGQ A;  2C6C A;  4H2K A;  4ZI6 A;  3S6K A;  4FD5 A;  3H8G A;  4CYN A;  3D4U A;  1L0C A;  1QQ9 A;  4Z65 A;  1R61 A;  2Q51 A;  3FIX A;  2AFX A;  4QUS A;  4CDJ A;  1Q2Y A;  2XEJ A;  2X0S A;  2B3V A;  3FEE A;  3FED A;  4FD6 A;  4MY0 A;  2AUM A;  5ELY A;  4YWY A;  4BMH A;  3FYN A;  4E2A A;  1ELM P;  3CZX A;  2N3A B;  4C9E A;  1ZG8 A;  2FVG A;  4OC0 A;  2GU2 A;  3FXT A;  3TLA A;  2D0P A;  3A9L A;  1WWZ A;  3BLN A;  4PK3 A;  3R9F A;  3TLB A;  2XPN A;  1ZLI A;  2ZEH A;  3LMS A;  4CGM A;  2CNT A;  2Q7B A;  3T9Y A;  2VXK A;  1Z4E A;  3SJF A;  1YR0 A;  5CPA A;  4ZY1 A;  3GY9 A;  4OLL A;  1YW6 A;  3T90 A;  1YX0 A;  3WR7 A;  3B7I A;  2QYV A;  3B3C A;  1RTQ A;  4PPZ A;  2ZW6 A;  2QJ8 A;  2G3T A;  3H8E A;  4IUS A;  4EFD A;  4C8P A;  2HI6 A;  1KUY A;  2WPW A;  3EXN A;  3FBU A;  4HKF A;  4KLV A;  4KOT A;  3JVN A;  1MJB A;  4XPD B;  2Z10 A;  1Y7R A;  3L2N A;  4B12 A;  2PE3 A;  8CPA A;  4KNG E;  3D7D A;  3JUW A;  5G22 A;  5HXD A;  2G9D A;  3EY5 A;  2R82 A;  2FL4 A;  2CBL A;  1Z9U A;  5F48 A;  2PRB A;  2YNC C;  4PSX A;  3ISX A;  4CAW A;  4OME A;  5I4M A;  1MJ9 A;  2ZW4 A;  2C5Q A;  3TCV A;  4HNY B;  4AG7 A;  1Q2D A;  3SXN A;  4PXD A;  2GIV A;  1IYL A;  2JEV A;  4ORF A;  2XPL A;  2D4O A;  4JWP A;  4K3N A;  4MHN A;  4P4D A;  3N7Z A;  3NFZ A;  3PBB A;  4UA3 A;  2D0O A;  2Q4V A;  3F9K C;  1DIK A;  2POK A;  2X7B A;  5DWN A;  5AXI A;  3T0T A;  1KBL A;  3KI9 A;  5EC4 A;  4BD9 A;  1JQG A;  4UFW A;  4WJB A;  3KAS A;  1KUV A;  3VAT A;  3JRU A;  2ZEN A;  1YLE A;  2OZH A;  1Y9W A;  3K2K A;  1U6M A;  1LFW A;  3KR5 A;  3SXO A;  3VRO A;  1VGY A;  1CE8 B;  2PJ3 A;  3ZZI A;  5F1Y A;  3IWE A;  3KR4 A;  3T5M A;  2IL4 A;  3SR3 A;  2R1I A;  4KSF A;  5LYD A;  4EVY A;  2AFO A;  5C82 A;  4BPX B;  3TOA A;  2JDC A;  2IQ6 A;  3VWE A;  4GPL B;  1GHE A;  2IMO A;  1NXJ A;  4KOX A;  2I79 A;  2YND A;  5J1Q A;  4ONU A;  4B5P A;  4UEZ A;  5IR2 A;  2JEW A;  1XBU A;  2C27 A;  2RB7 A;  2O4H A;  5J3X A;  4I49 A;  3TE4 A;  1M1D A;  3PB4 X;  4UWI A;  1X12 A;  4KUB A;  2ZOG A;  1JWQ A;  3R9E A;  1VBG A;  5G20 A;  4MJX A;  4CGP A;  4GS4 A;  3NE7 A;  4BPW B;  5HKY A;  3PZJ A;  4TJV A;  4RI1 A;  4MFK A;  1LAN A;  2ZEE A;  3IWG A;  3QNV A;  1Y0R A;  1YQE A;  4KS9 A;  3TFY A;  1IU8 A;  1IOI A;  1NSA A;  3FX6 A;  4ZX9 A;  5JGF A;  4CZ1 A;  2H5M A;  3BUW B;  2CIJ A;  1Z8W A;  2ABZ A;  4MHP A;  1XF8 A;  4F0Y A;  5A27 A;  4H89 A;  2ZOF A;  4CGL A;  4UFV A;  1AUG A;  1S7F A;  1V0C A;  1LRZ A;  3DR8 A;  3PFE A;  2OU2 A;  3UY5 A;  2B3U A;  4C8T A;  1X10 A;  3S9M A;  3FJU A;  2CTB A;  5C88 A;  3TLZ A;  1S60 A;  2VEZ A;  4KOS A;  3DLJ A;  4FD4 A;  4Q38 A;  5EMI A;  2B0A A;  1YW4 A;  2EWB A;  3NOJ A;  2Q0Y A;  4M8D A;  4Q7A A;  2F8H A;  4A2Z A;  5JVL A;  3U1B A;  2CNS A;  3TO9 A;  1I12 A;  4NGR A;  2CTC A;  4C7H A;  2JLM A;  4AB7 A;  4M6H A;  4NGP A;  4II9 A;  2ZW7 A;  1KWM A;  2IJZ A;  1B6B A;  4M6G A;  2VQY A;  3SHP A;  4F8Z A;  4JYW A;  4HNX B;  3S9L A;  3TLE A;  3ICU A;  2DPS A;  3PB9 X;  2GE3 A;  3R96 A;  4OAE A;  4NFR A;  2OH1 A;  3TLC A;  4UFX A;  2QML A;  3I3G A;  4C86 A;  2PJ0 A;  1R57 A;  3OB2 B;  3V8I A;  1WVM A;  1F2O A;  2HUZ A;  3F8K A;  3CPX A;  1Z8L A;  1FBV A;  2PRQ A;  5LRK A;  1WJT A;  2ATR A;  1DE4 C;  2JDD A;  3FF3 A;  1I1D A;  4XNH C;  1QST A;  2WSA A;  2G0B A;  4CAV A;  3D7F A;  2Z3P A;  1ZLH A;  3G23 A;  2ZW5 A;  2Z11 A;  2B4J C;  3IC1 A;  5A28 A;  3OAK A;  2VZZ A;  2B4B A;  4UWJ A;  3S6F A;  4MHY A;  4OC1 A;  2P6E A;  3ZJ0 A;  2EZB A;  4C9U A;  1VIX A;  4IF5 A;  1Z2L A;  2AFM A;  1CX8 A;  4G1P A;  2FE7 A;  3G8W A;  3RYO A;  2D4P A;  3TTH A;  5ISV A;  1CBX A;  3B3S A;  1CG2 A;  4JD6 A;  1Z9E A;  4OKO A;  3F0A A;  3DNS A;  2ODF A;  3ZNI A;  1B87 A;  2OB0 A;  2EBJ A;  2PJ5 A;  4NGN A;  1QMU A;  3FRM A;  4B5P B;  2Z3M A;  4KZT A;  4KSA A;  3SI2 A;  2BUE A;  5K8P A;  4EWT A;  4CPA A;  2HWG A;  1XEB A;  1Y7E A;  5AG4 A;  2JBJ A;  1FY7 A;  3BI0 A;  1PU9 A;  1JDE A;  3TT2 A;  4ZGY B;  4NGS A;  1KZF A;  3FEC A;  2PIY A;  3D8P A;  4A94 A;  2FIA A;  4F9V A;  3VRN A;  4X3R A;  4P4F A;  4QB9 A;  5J8C A;  4M85 A;  5F49 A;  2C6P A;  3D67 A;  3TO7 A;  2CF4 A;  3WAB A;  3B35 A;  4MFJ A;  2HV2 A;  3PB7 X;  2ZPA A;  4CAF A;  3KRV A;  3FB3 A;  1IGB A;  3EO4 A;  3W91 A;  3D2P A;  4NEX A;  3SJG A;  1XOV A;  2QVP A;  2R98 A;  3RO0 A;  5BWA B;  2HRO A;  1HDQ A;  3IWW A;  4P4B A;  2VZY A;  4KOW A;  2OLS A;  5LRJ A;  1TKJ A;  1ON0 A;  4FWU A;  3GYA A;  5JQ4 A;  4NGQ A;  1YVK A;  2C1C A;  4MCQ A;  1CS0 B;  3BUM B;  4P10 A;  3R1K A;  4JLY A;  3PLF B;  3FVL A;  4DNC A;  2Z0Z A;  4XPD C;  1XE4 A;  2J8R A;  5D29 A;  3K9U A;  4INJ A;  3IJ3 A;  3KZW A;  4IAV A;  4NSQ A;  2J8M A;  2PDO A;  4NGT A;  3U88 C;  2B58 A;  1YVO A;  1M4I A;  3IGR A;  2OZU A;  4A33 A;  3I6S A;  5F13 A;  2WUU A;  5HKW A;  2CNM A;  3NH8 A;  2XPO A;  5FVJ A;  5GCN A;  4F0X A;  5HMN A;  4C9A A;  2A4N A;  4DJL A;  1BOB A;  4TNU A;  4UF4 A;  2AFZ A;  4YRH A;  3W6S A;  2DXQ A;  1A9X B;  1IOF A;  4C2X A;  2BL1 A;  2V8D A;  4M6I A;  4R9M A;  7CPA A;  1T36 B;  3FNC A;  3PFO A;  4R3L A;  2PJ7 A;  5G1Z A;  1KUX A;  3EZE A;  1YGH A;  1A2Z A;  2PJA A;  3CXP A;  3KHZ A;  5K99 A;  5G21 A;  3HUV A; 
#chains in the Genus database with same CATH homology
 2PCU A;  5THW A;  4A39 A;  3B3T A;  3WC5 A;  4LQG A;  2EK8 A;  2V8V A;  1V6C A;  3CT9 A;  1TF8 A;  2ZEO A;  4P4J A;  4EME A;  1AMP A;  3GUX A;  3V38 A;  3WC7 A;  1R43 A;  5JM6 A;  4R76 A;  2HC9 A;  5HVH A;  4C8F A;  1Y9Z A;  2Q43 A;  3RAM A;  2BOA A;  1OBR A;  4A37 A;  4TJX A;  2PVW A;  1TKF A;  2GRE A;  4UEE A;  2BCO A;  3VH9 A;  3MRU A;  3D66 A;  4NGM A;  3SI0 A;  4B6Z A;  1HEE A;  3WC6 A;  4MRI A;  4C8A A;  1DTD A;  3DGV A;  4OP4 A;  2ANP A;  4ZY0 A;  3IEH A;  4P4E A;  2PJC A;  2XEI A;  1ZG9 A;  1XRY A;  4FBE A;  1FT7 A;  4OIW A;  4CDK A;  1YME A;  1ZG7 A;  3IFE A;  4GM5 A;  4A38 A;  1IY7 A;  1VHE A;  1XFO A;  3SJE A;  3TC8 A;  4R8F A;  3PB8 X;  4ZX8 A;  2ZED A;  2NYQ A;  4JZ0 A;  2VL1 A;  5D8N A;  5K8N A;  4IK2 A;  1FNO A;  3WT4 A;  1CPX A;  2PJ2 A;  2WYR A;  5HVF A;  5K8O A;  1ARL A;  1LAM A;  5HVG A;  1EE3 P;  4UIB A;  1Z5R A;  2XEG A;  5LYF A;  1PYT B;  3EIF A;  2I3C A;  2EK9 A;  5LYI A;  1TF9 A;  5LRG A;  4P4I A;  5F09 A;  2PIZ A;  4C85 A;  4AXV A;  2V77 A;  3TX8 A;  3GLJ A;  4OC4 A;  2ZEP A;  3NH4 A;  1ARM A;  1BPN A;  4PQA A;  4MCS A;  3CPA A;  4C9V A;  4PXE A;  3B3W A;  3KHX A;  2AFS A;  5LYL A;  3NA6 A;  3PBE A;  1CP6 A;  1ELL P;  1H8L A;  5JH9 A;  4FUU A;  4F9U A;  4X2T A;  1BPM A;  2ZEM A;  3VAR A;  3HLP A;  4OID A;  4WWV A;  3D68 A;  4OC3 A;  2AFU A;  1CP7 A;  2JBK A;  3H8F A;  1YSJ A;  1LAP A;  3SI1 A;  2PJ9 A;  3IIB A;  4MCR A;  2V8H A;  4P6Y A;  1HDU A;  4W9Y A;  5DS0 A;  3FH4 A;  2OR4 A;  2PVV A;  4ZYQ A;  3IO1 A;  1LOK A;  2BO9 A;  4UEF A;  4P44 A;  4X8I A;  4ZY2 A;  3RZA A;  1F57 A;  3PEI A;  3D7G A;  1BLL E;  6CPA A;  1XJO A;  2PJ8 A;  1XF1 A;  2O53 A;  1AYE A;  3PRT A;  4UIA A;  3T8W A;  1PCA A;  3SJX A;  2ZEG A;  3D7H A;  4PXB A;  4PXC A;  3KQZ A;  2F7V A;  4TWE A;  4DUK A;  3I1U A;  4MMO A;  3MN8 A;  1Y0Y A;  4R6T A;  4C8C A;  4MXU A;  5CBM A;  3RBU A;  4C8U A;  3S9N A;  4NJQ A;  3I74 A;  1GYT A;  2Q4Z A;  2PJ6 A;  1LCP A;  3CDX A;  2J9A A;  1M4L A;  2XEF A;  3KQX A;  3B2Y A;  2PJB A;  2V8G A;  3FMC A;  3V7Z A;  2WZN A;  4NJR A;  4IHM A;  2C6G A;  3LWU A;  4OC2 A;  1XMB A;  4DYO A;  1VHO A;  4R7M A;  2AFW A;  2OOT A;  4KSI A;  2HB6 A;  4C99 A;  3BHX A;  4MCP A;  3N5F A;  4FAI A;  2NSM A;  2PJ4 A;  1F2P A;  3BI1 A;  4C84 A;  3GB0 A;  2RFH A;  3PB6 X;  4MHZ A;  2GP4 A;  1UWY A;  5K8M A;  2ZEL A;  1Q7L A;  4P45 A;  5IB9 A;  3B3V A;  3K9T A;  4ONW A;  4YN3 A;  1R3N A;  3ISZ A;  2ZEF A;  3VTA A;  4YU9 A;  1TXR A;  4OC5 A;  2GLJ A;  2GLF A;  4RUH A;  1BAV A;  4O23 A;  3BXM A;  2PJ1 A;  2DEA A;  1YLO A;  1TKH A;  1CPS A;  3NH5 A;  3KL9 A;  4C9R A;  3KGQ A;  2C6C A;  4H2K A;  4ZI6 A;  3H8G A;  3D4U A;  1QQ9 A;  4Z65 A;  2Q51 A;  4CDJ A;  2AFX A;  2XEJ A;  3FEE A;  3FED A;  5ELY A;  4YWY A;  1ELM P;  4C9E A;  1ZG8 A;  2FVG A;  4OC0 A;  2GU2 A;  1ZLI A;  2ZEH A;  3LMS A;  3SJF A;  5CPA A;  4ZY1 A;  1YW6 A;  3B7I A;  2QYV A;  3B3C A;  1RTQ A;  4PPZ A;  2QJ8 A;  3H8E A;  4EFD A;  4C8P A;  3L2N A;  2PE3 A;  8CPA A;  4KNG E;  3D7D A;  5HXD A;  2G9D A;  3ISX A;  4OME A;  5I4M A;  2C5Q A;  4PXD A;  4MHN A;  4K3N A;  4P4D A;  3NFZ A;  3PBB A;  2POK A;  3KI9 A;  4BD9 A;  1JQG A;  4WJB A;  3VAT A;  3KAS A;  3JRU A;  2ZEN A;  3K2K A;  1LFW A;  3KR5 A;  1VGY A;  2PJ3 A;  3KR4 A;  5LYD A;  2AFO A;  2IQ6 A;  2IMO A;  5J1Q A;  5IR2 A;  4UEZ A;  2JEW A;  1XBU A;  2RB7 A;  2O4H A;  3PB4 X;  2ZOG A;  4TJV A;  1LAN A;  2ZEE A;  3QNV A;  1Y0R A;  1NSA A;  3FX6 A;  4ZX9 A;  5JGF A;  2CIJ A;  2ABZ A;  4MHP A;  2ZOF A;  4C8T A;  3PFE A;  3S9M A;  3FJU A;  2CTB A;  3DLJ A;  1YW4 A;  2EWB A;  4Q7A A;  2F8H A;  4NGR A;  2CTC A;  4NGP A;  1KWM A;  2IJZ A;  4F8Z A;  4JYW A;  3S9L A;  3ICU A;  3PB9 X;  4NFR A;  4C86 A;  2PJ0 A;  1WVM A;  1F2O A;  3CPX A;  1Z8L A;  2PRQ A;  5LRK A;  1DE4 C;  3FF3 A;  3D7F A;  1ZLH A;  3IC1 A;  4MHY A;  4OC1 A;  4C9U A;  1VIX A;  1Z2L A;  2AFM A;  1CX8 A;  4G1P A;  1CBX A;  3B3S A;  1CG2 A;  4OKO A;  2PJ5 A;  4NGN A;  1QMU A;  5K8P A;  3SI2 A;  4EWT A;  4CPA A;  1Y7E A;  2JBJ A;  3BI0 A;  4NGS A;  2PIY A;  3FEC A;  4A94 A;  4F9V A;  4X3R A;  4P4F A;  2C6P A;  3D67 A;  2CF4 A;  3WAB A;  3B35 A;  3PB7 X;  1IGB A;  3SJG A;  2QVP A;  1HDQ A;  3IWW A;  4P4B A;  5LRJ A;  1TKJ A;  4FWU A;  4NGQ A;  2C1C A;  4MCQ A;  4P10 A;  5D29 A;  3IJ3 A;  3KZW A;  4IAV A;  4NGT A;  3I6S A;  3NH8 A;  4C9A A;  4DJL A;  4TNU A;  4UF4 A;  2AFZ A;  2V8D A;  7CPA A;  3PFO A;  2PJ7 A;  2PJA A;  3FVL A;  3KHZ A;  3HUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...