3BI0A

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a transition state analog of glu-glu
Total Genus 267
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
267
sequence length
696
structure length
694
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural basis of interactions between human glutamate carboxypeptidase II and its substrate analogs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 267
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2007-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 3bi0A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 3bi0A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 3bi0A02
4C8AA 2PJ8A 2PE3A 4NGQA 5JH9A 3EIFA 3IO1A 4PXEA 1GYTA 2CF4A 1Z2LA 3N5FA 1VGYA 2PRQA 1F57A 3MRUA 5DS0A 4EMEA 3NFZA 3D68A 3S9NA 2ZEHA 4CDKA 1F2OA 4YU9A 3B7IA 3DGVA 3KL9A 4P4JA 4A94A 5F09A 2JBKA 1Q7LA 4NJQA 1ARMA 2PIYA 3GUXA 3IWWA 3FMCA 3PRTA 1RTQA 3PB6X 4A38A 4ZX9A 2RFHA 2ZEOA 3H8EA 1WVMA 2QYVA 2IQ6A 2ZEGA 3ISXA 5LYDA 3B2YA 3PEIA 4MCPA 5ELYA 4F8ZA 1TF8A 1M4LA 4MXUA 3SJEA 4FWUA 3T8WA 3IJ3A 3D7DA 3WC5A 3SJFA 1NSAA 4P6YA 3FVLA 2AFMA 3PB7X 4W9YA 4C8UA 3WT4A 3WABA 2AFZA 3HUVA 3PBEA 1BLLE 4F9VA 4LQGA 4OIDA 2ZEDA 2BCOA 4AXVA 2WZNA 2ANPA 2O53A 4FBEA 1VHOA 4C9AA 1TKHA 1ELMP 1BPNA 2J9AA 1XJOA 1ZG7A 3ICUA 4R7MA 4OIWA 5D29A 1UWYA 4TJXA 2GU2A 5HVFA 2DEAA 3MN8A 1CP6A 3CT9A 2C1CA 4C9EA 2GLFA 3V7ZA 1KWMA 4WWVA 4NJRA 1YSJA 4BD9A 4TWEA 6CPAA 2AFXA 3FEDA 4G1PA 3VARA 2IMOA 2V8GA 1F2PA 4P4FA 2AFUA 2ZEEA 3TC8A 4NGSA 2GREA 4FUUA 2V8HA 1HDUA 1DTDA 4ONWA 4UF4A 3KI9A 1HEEA 3PFEA 4F9UA 4UIBA 5THWA 3WC7A 4C86A 5J1QA 4UEFA 3PB8X 3H8FA 1TF9A 4ZYQA 3NH4A 2ZEFA 4UEZA 4P10A 4MCRA 5JGFA 2Q51A 3CDXA 3KHZA 4A39A 2V8DA 4PXBA 3BXMA 2I3CA 1XMBA 4CDJA 4OC3A 2JEWA 4OC5A 3WC6A 3FX6A 1XF1A 3SJGA 1ARLA 3D4UA 4OC1A 5CBMA 4DUKA 3L2NA 3BI0A 4X3RA 4YN3A 4PXDA 1CG2A 3FEEA 3DLJA 4OKOA 3JRUA 5D8NA 1XRYA 3D7GA 5K8MA 2WYRA 2BO9A 2EK8A 2PIZA 1Z5RA 1LOKA 4H2KA 1CX8A 3HLPA 3V38A 2GLJA 3SI0A 1CP7A 4R8FA 1XFOA 4IHMA 1Y0RA 4Z65A 2PVWA 2PCUA 5LYIA 2BOAA 4NGRA 2F7VA 3SJXA 2ZOFA 4C99A 1H8LA 4O23A 3S9LA 4FAIA 1PCAA 4MRIA 2C6CA 4CPAA 2ZELA 1YMEA 3KQZA 4OC2A 4RUHA 3VH9A 3ISZA 1Z8LA 4PPZA 1BPMA 2XEFA 4YWYA 4C9VA 4R6TA 3B3TA 2CIJA 1Y0YA 5LYFA 3IEHA 3PB9X 3PB4X 4C9RA 4IAVA 4ZI6A 1R3NA 3LWUA 1YW4A 2PJ4A 2AFOA 3CPXA 2PJ1A 5LRGA 1YLOA 4P4DA 4OMEA 3TX8A 4P45A 3KR5A 2POKA 4P44A 2PJAA 4ZY2A 2ZOGA 1ZLHA 2EK9A 4X2TA 4GM5A 2NSMA 5HVGA 4PQAA 3S9MA 1CPSA 3RBUA 2Q4ZA 2Q43A 5K8PA 4P4IA 1OBRA 3FH4A 2FVGA 1LANA 3NA6A 4C8FA 3GLJA 3B3SA 2HC9A 4DYOA 3B3VA 4UEEA 3IC1A 1TXRA 3B35A 2C6PA 2XEIA 4C8PA 4Q7AA 1V6CA 5JM6A 1HDQA 2ZEPA 4OC0A 1LFWA 3KR4A 3NH5A 2V8VA 3I6SA 1ZG9A 1ZLIA 8CPAA 3I74A 3IIBA 3D7FA 4C8TA 1QMUA 1AMPA 3IFEA 3SI2A 3FF3A 3KGQA 4NGPA 1LAPA 1FNOA 4EFDA 2OOTA 4C8CA 2PJ0A 2QVPA 3FJUA 2G9DA 4OP4A 2PJBA 3K9TA 4EWTA 1DE4C 2PJ9A 2V77A 2F8HA 3LMSA 4ZY0A 3B3CA 2PJCA 1ELLP 3VATA 1JQGA 2PJ7A 4JZ0A 2OR4A 4MHYA 2IJZA 1VIXA 3CPAA 1Y7EA 1CBXA 4NGTA 4C84A 4WJBA 1TKFA 4MHZA 4MCSA 1ZG8A 1YW6A 2PJ2A 1EE3P 4IK2A 2PVVA 3RAMA 1R43A 1QQ9A 4ZY1A 1PYTB 4TJVA 2CTBA 4B6ZA 3KHXA 1LAMA 2ZENA 3D7HA 1XBUA 3KQXA 4K3NA 4ZX8A 2XEJA 5LRKA 4C85A 4OC4A 2QJ8A 4A37A 4DJLA 4P4EA 2EWBA 3VTAA 3BHXA 3KZWA 5HVHA 1AYEA 4NFRA 1FT7A 2AFWA 3QNVA 3H8GA 5LYLA 3BI1A 2CTCA 2PJ3A 4MMOA 5IB9A 4TNUA 3SI1A 3D66A 4JYWA 3D67A 1LCPA 2PJ5A 2O4HA 1TKJA 1IGBA 3K2KA 2PJ6A 2ABZA 3KASA 2ZEMA 5K8NA 3GB0A 4NGMA 3RZAA 4X8IA 5HXDA 2C6GA 4PXCA 1CPXA 3NH8A 5I4MA 4MHPA 2VL1A 2NYQA 3PFOA 7CPAA 4R76A 4KNGE 2AFSA 1IY7A 4NGNA 2RB7A 3I1UA 2HB6A 4KSIA 5K8OA 2JBJA 4UIAA 1BAVA 4MHNA 3PBBA 5LRJA 3FECA 2XEGA 1Y9ZA 4C9UA 1VHEA 4P4BA 5CPAA 4MCQA 3B3WA
chains in the Genus database with same CATH superfamily
5J8FA 2PJ8A 4C8AA 4XNHC 2PE3A 4A32A 3IWEA 3JVNA 4GS4A 4NGQA 4M85A 3NE7A 4U9YA 4CAXA 1Z8XA 5JH9A 3EIFA 3IO1A 5K99A 2C27A 4PXEA 1GYTA 2CF4A 1RXTA 1Z2LA 2Z3NA 3N5FA 1VGYA 2B5GA 4UCPA 2PRQA 2EUIA 4CYPA 5HMNA 1F57A 3MRUA 4E94A 4QB9A 4KOSA 3T90A 1XF8A 3FRMA 2MP0A 5DS0A 3RO0A 4EMEA 3NFZA 3D68A 2DIKA 3SR3A 4A4BA 3S9NA 2ZEHA 4PK3A 4UFWA 2IL4A 4CS0B 4CDKA 4JLYA 1F2OA 2Z3PA 4YU9A 3B7IA 3TLGA 1VBGA 3DR6A 1NXJA 3DGVA 3KL9A 3CZXA 4P4JA 4KLWA 3P2FA 4A94A 5F09A 2OB0A 3TO6A 2JBKA 1IB1E 1Q2DA 1Q7LA 1ARMA 1GHEA 2PIYA 3A9LA 3F0AA 3GUXA 3IWWA 4NJQA 4CO9A 1XIXA 1U6MA 3FMCA 3W6XA 3PRTA 1RTQA 2K5TA 1KBLA 3PB6X 4MJ8A 3GKRA 4A38A 4ZX9A 2RFHA 4AVAA 5IB0A 4II9A 2C5QA 5JQ4A 2ZEOA 4JVOA 3H8EA 1WVMA 5G21A 2QYVA 3DR8A 2IQ6A 4NXYA 2F5IA 4A30A 3PP9A 2ZEGA 3ISXA 4AG9A 4BPUB 5LYDA 3B2YA 1J4JA 1IOIA 3D8PA 2H5MA 3PEIA 4MCPA 1T36B 3R9FA 3VRNA 5ELYA 1YVOA 1IOFA 3BLNA 3R95A 1C30B 4F8ZA 2G3TA 4C7IA 1TF8A 1M4LA 4MXUA 1KC7A 5EMIA 4MBUA 3SJEA 4FWUA 2Q4YA 3F8KA 2PR8A 1Y9WA 1GGOA 3T8WA 1L0CA 3FIXA 3IJ3A 2YGWA 3D7DA 3QAYA 3RYOA 3T9YA 3WC5A 3SJFA 3BUOB 1OZPA 1YR0A 3T05A 1NSAA 1M1DA 1X10A 2VEZA 3LACA 2EO8A 5JPHA 1YGHA 4BPXB 2R7HA 4P6YA 3R9EA 5BY0A 4KLVA 4OADA 3FNCA 2HROA 3FVLA 2B3VA 4A4CA 2R98A 2AFMA 3PB7X 4W9YA 3H4QA 5H86A 3VWEA 4C8UA 1JWQA 1WK4A 1YLEA 2P6EA 3GIUA 3ZZIA 3WT4A 4MJXA 3WABA 4CAFA 3R1KA 1S3ZA 2AFZA 1B87A 2O28A 3HUVA 4UBRA 1Y7RA 3PBEA 1BLLE 4F9VA 3QAHA 4LQGA 4NCZA 4OIDA 2ZEDA 2BCOA 3TLZA 1I1DA 1XE4A 2I00A 4ONUA 3BUWB 5DWNA 4AXVA 2GIVA 1LRZA 2WZNA 5F47A 4CGNA 2ANPA 2O53A 4FBEA 2AUMA 1VHOA 1XOVA 5GCNA 4INJA 4C9AA 4DNCA 1NBWA 1TKHA 1ELMP 1S7NA 4R87A 4UA3A 1YVHA 1BPNA 2J9AA 1XJOA 2JDCA 2YNDA 1NE9A 1ZG7A 3OB2B 3EY5A 2DXQA 4H6UA 4MFLA 4B5PA 4UFXA 3ICUA 5BWAB 1Q2YA 4OIWA 5D29A 1Z9UA 1PUAA 1UWYA 4R7MA 4RN7A 4TJXA 2GU2A 2NMTA 5HVFA 3IU2A 2DEAA 3MN8A 4XPDC 2HI6A 4CRYB 1CP6A 3CXQA 4KOWA 3D2MA 4YRHA 5AG5A 5E96A 2KCWA 3CT9A 1Q2CA 2C1CA 3F9KC 1I12A 4C9EA 4CZ1A 1M6VB 1MJAA 2GLFA 3V7ZA 3S6FA 4FD5A 1KWMA 2Z11A 4WWVA 2FT0A 4NJRA 5F9MA 1YSJA 3BUNB 4BD9A 4Y49C 4TWEA 6CPAA 2DLAA 4KVOE 2AFXA 2FXFA 4MI4A 2D0PA 3FEDA 1KUXA 2G0BA 5CNPA 4G1PA 3VARA 2IMOA 2ZW4A 2V8GA 1F2PA 4P4FA 2AFUA 2ZEEA 4R9MA 3R9GA 4UWIA 3TC8A 1Z8WA 4NGSA 2GREA 4FUUA 4HKFA 2V8HA 4CYNA 4F6AA 1HDUA 1YK3A 1IYLA 1DTDA 1UFHA 2VBQA 5HKYA 2WSAA 4NSQA 3KI9A 4ONWA 4FD7A 4UF4A 2FSRA 1HEEA 2VI7A 4CGLA 1EO0A 3PFEA 3GJZA 2J8RA 4U5YA 2DPTA 3FB3A 2XPPA 4F9UA 4UIBA 5THWA 3WC7A 5F1YA 4C86A 5J1QA 4UEFA 3PB8X 3H8FA 1TF9A 4ZYQA 3NH4A 4KOVA 3LD2A 2ZEFA 1YX0A 5LYLA 4UEZA 1J3LA 1QSTA 4P10A 4MCRA 5A28A 5JGFA 2Q51A 2WPWA 3K9UA 3CDXA 3TE4A 5ISVA 3KHZA 3C8OA 3IWGA 4EYSA 1MK4A 2HWGA 3TTHA 1BOBA 4A39A 4L8AA 4A31A 3TLEA 2PSWA 2V8DA 4MFZA 3BXMA 1XEBA 4PXBA 4YFJA 1QSMA 1IU8A 2VZZA 3VWDA 2EZCA 2I3CA 3GY9A 3O8ZA 2GE3A 1XMBA 2Q0YA 3CXPA 5A27A 3T07A 4CDJA 4OC3A 2REEA 2FE7A 2JEWA 4OC5A 2J8NA 3WC6A 1M4GA 1JDEA 4C2XA 1YQEA 4KUAA 1YREA 4KS9A 1DIKA 3FX6A 4KORA 1P4NA 1XF1A 3SJGA 2XPOA 1ARLA 1WJTA 3D4UA 4OLLA 4OC1A 3OP0A 2BL1A 4BINA 4DUKA 5CBMA 2FCKA 3L2NA 3BI0A 4X3RA 1Y9KA 4CYOA 4YN3A 5IR2A 4PXDA 1CG2A 2QECA 4Q36A 3FEEA 4F0XA 3TOBA 4X5KA 3DLJA 4OKOA 1S5KA 3JRUA 4PSXA 5D8NA 2A4NA 1XRYA 3D7GA 4M3SA 4CYQA 5K8MA 3VRRA 2WYRA 2BO9A 2EK8A 2PIZA 2JDDA 2WPXA 2Y0MA 3HPGG 1Z5RA 3PGPA 2ZW6A 1LOKA 4H1HA 5HH1A 4GXHA 4H2KA 1CX8A 2CNMA 3IU1A 4OAEA 4BTFA 4BMHA 2QMLA 3FBUA 5HKZA 3HLPA 4KVME 2FL4A 2Z3LA 3V38A 2GLJA 3SI0A 1CP7A 4R8FA 1XFOA 4IHMA 2PR1A 1Z9EA 1Y0RA 5AXIA 3W91A 4Z65A 2YJTA 2PVWA 1ON0A 2PCUA 5LYIA 1NSLA 4QC6A 5F5XA 3VRQA 2BOAA 2FIWA 4NGRA 2F7VA 3SJXA 2GFQA 3G3SA 5EBVA 4B11A 1X12A 4GPLB 2OZGA 2ZOFA 1H8LA 4C99A 4O23A 2Z0ZA 3S9LA 1EZAA 2CY2A 4FAIA 1PCAA 4ZBGA 4MRIA 2AUNA 5DWMA 1NMTA 2C6CA 2ODFA 4UWJA 2CNTA 5EC4A 4CAVA 4CPAA 3ZJ0A 2ZELA 1YMEA 3KQZA 4OC2A 1MJ9A 3PLFB 4E5SA 4RUHA 5F46A 4IUSA 3VH9A 3ISZA 2AJ6A 2Z3OA 1Z8LA 3S6HA 3U88C 4PPZA 1BPMA 2PC1A 4C2ZA 2EZAA 2XEFA 2EBJA 2HV2A 3KKWA 2PQ8A 3JTKA 4YWYA 4C9VA 4R6TA 2E28A 4PK2A 3B3TA 2CIJA 1ZRSA 4PSWA 3G23A 1Y0YA 4RR2B 5LYFA 2OU2A 5JVLA 3UY5A 3BJ7A 3IEHA 4U9ZA 2Q7BA 3PB9X 1JDBC 2CBLA 3PB4X 3PFVA 4R3LA 1IYKA 4IIXA 4C9RA 2BSWA 3PT1A 4IAVA 2WUUA 2VQYA 1R3NA 3LWUA 3TCVA 1YW4A 2PJ4A 4ZI6A 2AFOA 1VHSA 3TLCA 1ZYMA 4M6IA 2VKZG 1CE8B 3CPXA 2PJ1A 2AE6A 4MY0A 3CXSA 5LRGA 3TFYA 4BPWB 3EZEA 5J3XA 3EZAA 1YLOA 4P4DA 3VRPA 4OMEA 2YNEA 3TX8A 4P45A 3KR5A 4COBA 2POKA 4P44A 2PJAA 1ZL0A 2B58A 4ZY2A 1Q5XA 4Q38A 2ZOGA 1CS0B 2P6FA 2DPSA 4LX9A 3V8IA 1ZLHA 4B13A 1AUGA 4EVYA 1QSRA 5I0CA 2EK9A 1S60A 4X2TA 4GM5A 1Z4EA 4RI1A 4JXQA 1R57A 2NSMA 4UFVA 5HVGA 4JJXA 4AVBA 3IGRA 4PQAA 2QIRA 3S9MA 2X7BA 3OB1B 4YGOA 2UV8G 1CPSA 3RBUA 1V0CA 2Q4ZA 2Z3KA 4XPLA 1A2ZA 2Q43A 1TIQA 1Z8TA 4L89A 3TOAA 5K8PA 5KTDA 4P4IA 1A9XB 2ZPAA 1OBRA 4ZGYB 2YNCA 2PRBA 1I21A 1RO5A 3FH4A 4NEXA 4R3KA 4XNHB 3TLYA 5F49A 2FVGA 2B0AA 1LANA 3FXTA 3NA6A 5C82A 1VI4A 2ZW5A 2HQYA 3R96A 4C8FA 3EZBA 3NE8A 3KRVA 2B4DB 1CJWA 3GLJA 2CNSA 4HNXB 3S6KA 4CGPA 2JEVA 3B3SA 3H5ZA 2HC9A 2JLMA 3SXNA 1B47A 2VXKA 2BUEA 2XPNA 3B3VA 1IICA 1IIDA 3D3SA 4ORFA 2RC4A 3E0KA 4UEEA 3IC1A 4K30A 2D4OA 1TXRA 3B35A 2C6PA 2XEIA 1YVKA 1FBVA 1N71A 4HPSA 4BBHA 4C8PA 4Q7AA 1V6CA 3TT2A 5F13A 2GP4A 2B5GB 1HDQA 4HNWB 2ZEPA 4OC0A 1LFWA 3GYAA 5JM6A 2R8VA 5KTCA 3KR4A 3NH5A 2V8VA 3I6SA 1ZG9A 1ZLIA 2ARHA 8CPAA 3IIBA 3I74A 5FD8A 3D7FA 4MFKA 1P0HA 5IX3A 4C8TA 3BUXB 3ZNIA 1QMUA 2PCNA 1FY7A 1AMPA 3IFEA 2I79A 3SI2A 3FF3A 3KGQA 2ATRA 4NGPA 3HMJG 1LAPA 2B3UA 4KZTA 1FNOA 5AG7A 3WR7A 4AB7A 2REFA 4EFDA 1Z4RA 5G20A 2OOTA 2D4PA 2PJ0A 2QVPA 3SHPA 4C8CA 2D0OA 3FJUA 2G9DA 5FVJA 4OP4A 3TLAA 2PJBA 3K9TA 4EWTA 4MHDA 5C88A 1SQHA 3TYXA 2HUZA 1DE4C 2PJ9A 2V77A 1R61A 4E8OA 2GANA 2N3AB 2F8HA 4B10A 3LMSA 2PDOA 4ZY0A 3B3CA 2P0WA 1XMTA 1ELLP 2PJCA 4H89A 3VATA 1JQGA 4XPKA 3OAKA 3NFQA 2PJ7A 4IIYA 4JZ0A 2Q4VA 4C68A 4J3GA 5J8CA 2OR4A 4MHYA 2IJZA 1VIXA 3CPAA 5AG6A 1Y7EA 2OLSA 4M6HA 4KOUA 1QSNA 2OH1A 1WWZA 2P6GA 1CBXA 4NGTA 1BXRB 4C84A 2Z3MA 4MI1A 3HPHE 4WJBA 3TO9A 1TKFA 4MHZA 4MCSA 1ZG8A 3DNSA 4QUSA 1YW6A 2PJ2A 1EE3P 2FS5A 4IK2A 1C3OB 2PVVA 1BO4A 3RAMA 1R43A 2OZHA 1QQ9A 4ZY1A 2Y1MA 1PYTB 4TJVA 3K4IA 4F0YA 5AG4A 4CRZB 2CTBA 4B6ZA 4C2YA 4UCMA 3U1BA 3I3GA 4A95A 3KHXA 1LAMA 3TLGB 1S7KA 2ZENA 4MFPA 1CM0A 4KUBA 3D7HA 3I9SA 3EO4A 4MFQA 1XBUA 1KZFA 4J0NA 3KQXA 4K3NA 4LUAA 3QB8A 4ZX8A 2XEJA 2B4JC 4XPDB 4JD6A 5LRKA 4OC4A 5H84A 4C85A 2QJ8A 4NF1A 4A37A 3TLBA 3VROA 4KSFA 4KSAA 4I49A 4AG7A 4AVCA 3OWCA 2ZXVA 2OZUA 5F48A 4M8DA 2CXAA 4DJLA 4QVTA 4P4EA 2BEIA 3PZJA 3S6GA 1PU9A 2EWBA 1KEEB 4CGMA 3BHXA 3VTAA 3KZWA 5HVHA 1AYEA 4PV6A 4JXRA 3RNZA 3G8WA 4NFRA 4E2AA 1FT7A 1S7LA 2AFWA 3EXNA 3H8GA 3QNVA 2R1IA 1VKCA 1QSOA 3W6SA 2Y1NA 2Q44A 4B5PB 2VZYA 1M4IA 3BI1A 2CTCA 3BUMB 3MGDA 4M6GA 2PJ3A 4MMOA 4B14A 4CAWA 4DYOA 2ZW7A 4TNUA 4MY3A 3SI1A 5IB9A 4Y49B 3D66A 2R82A 4JYWA 5IV0A 4CAEA 3D67A 1LCPA 5G1ZA 2EVNA 2O4HA 2PJ5A 1TKJA 3F5BA 3LODA 3N7ZA 1IGBA 4KOTA 1EZBA 3K2KA 4A2ZA 2EZBA 3EC4A 4FD6A 3BJ8A 2Q04A 2PJ6A 3T5MA 2ABZA 3KASA 2ZEMA 2J8MA 4B5OA 4KVXA 4A33A 4QBJA 3FYNA 5K8NA 4FD4A 4KOYA 2X0SA 3GB0A 4NGMA 4HNYB 3RZAA 4X8IA 3P2HA 2Q7SA 2G3AA 3B8GA 5HXDA 1VBHA 5G22A 2C6GA 4PXCA 1S7FA 1M4DA 3VGOA 4LQ6A 4C7HA 1B6BA 2FM4A 1CPXA 3NH8A 5I4MA 3D2PA 1M44A 4MHPA 2Z10A 2VL1A 4B12A 2NYQA 4COGA 3PFOA 7CPAA 4R76A 3TO7A 2AFSA 4E0AA 3NOJA 1IY7A 4KNGE 3DDDA 3DSBA 5JYBA 4UCNA 4NGNA 2RB7A 1K4JA 3C26A 5HKWA 3I1UA 2HB6A 4KSIA 5K8OA 2YNCC 4R57A 4IF5A 2JBJA 1ZO0A 2DF5A 2YJVA 3EFAA 4UIAA 1KUYA 1BAVA 4MHNA 4MFJA 3PBBA 2XPLA 3FECA 1KUVA 2B4BA 5LRJA 1MJBA 2XEGA 4KOXA 2FIAA 3JUWA 4H6ZA 1Y9ZA 4C9UA 1VHEA 4P4BA 4RS2A 3T0TA 4JWPA 5KTAA 3SXOA 2B4DA 5AGEA 5CPAA 4CGOA 4MCQA 3B3WA
chains in the Genus database with same CATH topology
4C8AA 2PJ8A 2PE3A 4NGQA 5JH9A 3EIFA 3IO1A 4PXEA 1GYTA 2CF4A 1Z2LA 3N5FA 1VGYA 2PRQA 1F57A 3MRUA 5DS0A 4EMEA 3NFZA 3D68A 3S9NA 2ZEHA 4CDKA 1F2OA 4YU9A 3B7IA 3DGVA 3KL9A 4P4JA 4A94A 5F09A 2JBKA 1Q7LA 4NJQA 1ARMA 2PIYA 3GUXA 3IWWA 3FMCA 3PRTA 1RTQA 3PB6X 4A38A 4ZX9A 2RFHA 2C5QA 2ZEOA 3H8EA 1WVMA 2QYVA 2IQ6A 2ZEGA 3ISXA 5LYDA 3B2YA 3PEIA 4MCPA 5ELYA 4F8ZA 1TF8A 1M4LA 4MXUA 3SJEA 4FWUA 3T8WA 3IJ3A 3D7DA 3WC5A 3SJFA 1NSAA 4P6YA 3FVLA 2AFMA 3PB7X 4W9YA 4C8UA 3WT4A 3WABA 2AFZA 3HUVA 3PBEA 1BLLE 4F9VA 4LQGA 4OIDA 2ZEDA 2BCOA 4AXVA 2WZNA 2ANPA 2O53A 4FBEA 1VHOA 4C9AA 1TKHA 1ELMP 1BPNA 2J9AA 1XJOA 1ZG7A 3ICUA 4R7MA 4OIWA 5D29A 1UWYA 4TJXA 2GU2A 5HVFA 2DEAA 3MN8A 1CP6A 3CT9A 2C1CA 4C9EA 2GLFA 3V7ZA 1KWMA 4WWVA 4NJRA 1YSJA 4BD9A 4TWEA 6CPAA 2AFXA 3FEDA 4G1PA 3VARA 2IMOA 2V8GA 1F2PA 4P4FA 2AFUA 2ZEEA 3TC8A 4NGSA 2GREA 4FUUA 2V8HA 1HDUA 1DTDA 4ONWA 4UF4A 3KI9A 1HEEA 3PFEA 4F9UA 4UIBA 5THWA 3WC7A 4C86A 5J1QA 4UEFA 3PB8X 3H8FA 1TF9A 4ZYQA 3NH4A 2ZEFA 4UEZA 4P10A 4MCRA 5JGFA 2Q51A 3CDXA 3KHZA 4A39A 2V8DA 4PXBA 3BXMA 2I3CA 1XMBA 4CDJA 4OC3A 2JEWA 4OC5A 3WC6A 3FX6A 1XF1A 3SJGA 1ARLA 3D4UA 4OC1A 5CBMA 4DUKA 3L2NA 3BI0A 4X3RA 4YN3A 5IR2A 4PXDA 1CG2A 3FEEA 3DLJA 4OKOA 3JRUA 5D8NA 1XRYA 3D7GA 5K8MA 2WYRA 2BO9A 2EK8A 2PIZA 1Z5RA 1LOKA 4H2KA 1CX8A 3HLPA 3V38A 2GLJA 3SI0A 1CP7A 4R8FA 1XFOA 4IHMA 1Y0RA 4Z65A 2PVWA 2PCUA 5LYIA 2BOAA 4NGRA 2F7VA 3SJXA 2ZOFA 4C99A 1H8LA 4O23A 3S9LA 4FAIA 1PCAA 4MRIA 2C6CA 4CPAA 2ZELA 1YMEA 3KQZA 4OC2A 4RUHA 3VH9A 3ISZA 1Z8LA 4PPZA 1BPMA 2XEFA 4YWYA 4C9VA 4R6TA 3B3TA 2CIJA 1Y0YA 5LYFA 3IEHA 3PB9X 3PB4X 4C9RA 4IAVA 4ZI6A 1R3NA 3LWUA 1YW4A 2PJ4A 2AFOA 3CPXA 2PJ1A 5LRGA 1YLOA 4P4DA 4OMEA 3TX8A 4P45A 3KR5A 2POKA 4P44A 2PJAA 4ZY2A 2ZOGA 1ZLHA 2EK9A 4X2TA 4GM5A 2NSMA 5HVGA 4PQAA 3S9MA 1CPSA 3RBUA 2Q4ZA 2Q43A 5K8PA 4P4IA 1OBRA 3FH4A 2FVGA 1LANA 3NA6A 4C8FA 3GLJA 3B3SA 2HC9A 4DYOA 3B3VA 4UEEA 3IC1A 1TXRA 3B35A 2C6PA 2XEIA 4C8PA 4Q7AA 1V6CA 2GP4A 5JM6A 1HDQA 2ZEPA 4OC0A 1LFWA 3KR4A 3NH5A 2V8VA 3I6SA 1ZG9A 1ZLIA 8CPAA 3I74A 3IIBA 3D7FA 4C8TA 1QMUA 1AMPA 3IFEA 3SI2A 3FF3A 3KGQA 4NGPA 1LAPA 1FNOA 4EFDA 2OOTA 4C8CA 2PJ0A 2QVPA 3FJUA 2G9DA 4OP4A 2PJBA 3K9TA 4EWTA 1DE4C 2PJ9A 2V77A 2F8HA 3LMSA 4ZY0A 3B3CA 2PJCA 1ELLP 3VATA 1JQGA 2PJ7A 4JZ0A 2OR4A 4MHYA 2IJZA 1VIXA 3CPAA 1Y7EA 1CBXA 4NGTA 4C84A 4WJBA 1TKFA 4MHZA 4MCSA 1ZG8A 1YW6A 2PJ2A 1EE3P 4IK2A 2PVVA 3RAMA 1R43A 1QQ9A 4ZY1A 1PYTB 4TJVA 2CTBA 4B6ZA 3KHXA 1LAMA 2ZENA 3D7HA 1XBUA 3KQXA 4K3NA 4ZX8A 2XEJA 5LRKA 4C85A 4OC4A 2QJ8A 4A37A 4DJLA 4P4EA 2EWBA 3VTAA 3BHXA 3KZWA 5HVHA 1AYEA 4NFRA 1FT7A 2AFWA 3QNVA 3H8GA 5LYLA 3BI1A 2CTCA 2PJ3A 4MMOA 5IB9A 4TNUA 3SI1A 3D66A 4JYWA 3D67A 1LCPA 2PJ5A 2O4HA 1TKJA 1IGBA 3K2KA 2PJ6A 2ABZA 3KASA 2ZEMA 5K8NA 3GB0A 4NGMA 3RZAA 4X8IA 5HXDA 2C6GA 4PXCA 1CPXA 3NH8A 5I4MA 4MHPA 2VL1A 2NYQA 3PFOA 7CPAA 4R76A 4KNGE 2AFSA 1IY7A 4NGNA 2RB7A 3I1UA 2HB6A 4KSIA 5K8OA 2JBJA 4UIAA 1BAVA 4MHNA 3PBBA 5LRJA 3FECA 2XEGA 1Y9ZA 4C9UA 1VHEA 4P4BA 5CPAA 4MCQA 3B3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8A A;  2PJ8 A;  2PE3 A;  4NGQ A;  5JH9 A;  3EIF A;  3IO1 A;  4PXE A;  1GYT A;  2CF4 A;  1Z2L A;  3N5F A;  1VGY A;  2PRQ A;  1F57 A;  3MRU A;  5DS0 A;  4EME A;  3NFZ A;  3D68 A;  3S9N A;  2ZEH A;  4CDK A;  1F2O A;  4YU9 A;  3B7I A;  3DGV A;  3KL9 A;  4P4J A;  4A94 A;  5F09 A;  2JBK A;  1Q7L A;  4NJQ A;  1ARM A;  2PIY A;  3GUX A;  3IWW A;  3FMC A;  3PRT A;  1RTQ A;  3PB6 X;  4A38 A;  4ZX9 A;  2RFH A;  2ZEO A;  3H8E A;  1WVM A;  2QYV A;  2IQ6 A;  2ZEG A;  3ISX A;  5LYD A;  3B2Y A;  3PEI A;  4MCP A;  5ELY A;  4F8Z A;  1TF8 A;  1M4L A;  4MXU A;  3SJE A;  4FWU A;  3T8W A;  3IJ3 A;  3D7D A;  3WC5 A;  3SJF A;  1NSA A;  4P6Y A;  3FVL A;  2AFM A;  3PB7 X;  4W9Y A;  4C8U A;  3WT4 A;  3WAB A;  2AFZ A;  3HUV A;  3PBE A;  1BLL E;  4F9V A;  4LQG A;  4OID A;  2ZED A;  2BCO A;  4AXV A;  2WZN A;  2ANP A;  2O53 A;  4FBE A;  1VHO A;  4C9A A;  1TKH A;  1ELM P;  1BPN A;  2J9A A;  1XJO A;  1ZG7 A;  3ICU A;  4R7M A;  4OIW A;  5D29 A;  1UWY A;  4TJX A;  2GU2 A;  5HVF A;  2DEA A;  3MN8 A;  1CP6 A;  3CT9 A;  2C1C A;  4C9E A;  2GLF A;  3V7Z A;  1KWM A;  4WWV A;  4NJR A;  1YSJ A;  4BD9 A;  4TWE A;  6CPA A;  2AFX A;  3FED A;  4G1P A;  3VAR A;  2IMO A;  2V8G A;  1F2P A;  4P4F A;  2AFU A;  2ZEE A;  3TC8 A;  4NGS A;  2GRE A;  4FUU A;  2V8H A;  1HDU A;  1DTD A;  4ONW A;  4UF4 A;  3KI9 A;  1HEE A;  3PFE A;  4F9U A;  4UIB A;  5THW A;  3WC7 A;  4C86 A;  5J1Q A;  4UEF A;  3PB8 X;  3H8F A;  1TF9 A;  4ZYQ A;  3NH4 A;  2ZEF A;  4UEZ A;  4P10 A;  4MCR A;  5JGF A;  2Q51 A;  3CDX A;  3KHZ A;  4A39 A;  2V8D A;  4PXB A;  3BXM A;  2I3C A;  1XMB A;  4CDJ A;  4OC3 A;  2JEW A;  4OC5 A;  3WC6 A;  3FX6 A;  1XF1 A;  3SJG A;  1ARL A;  3D4U A;  4OC1 A;  5CBM A;  4DUK A;  3L2N A;  3BI0 A;  4X3R A;  4YN3 A;  4PXD A;  1CG2 A;  3FEE A;  3DLJ A;  4OKO A;  3JRU A;  5D8N A;  1XRY A;  3D7G A;  5K8M A;  2WYR A;  2BO9 A;  2EK8 A;  2PIZ A;  1Z5R A;  1LOK A;  4H2K A;  1CX8 A;  3HLP A;  3V38 A;  2GLJ A;  3SI0 A;  1CP7 A;  4R8F A;  1XFO A;  4IHM A;  1Y0R A;  4Z65 A;  2PVW A;  2PCU A;  5LYI A;  2BOA A;  4NGR A;  2F7V A;  3SJX A;  2ZOF A;  4C99 A;  1H8L A;  4O23 A;  3S9L A;  4FAI A;  1PCA A;  4MRI A;  2C6C A;  4CPA A;  2ZEL A;  1YME A;  3KQZ A;  4OC2 A;  4RUH A;  3VH9 A;  3ISZ A;  1Z8L A;  4PPZ A;  1BPM A;  2XEF A;  4YWY A;  4C9V A;  4R6T A;  3B3T A;  2CIJ A;  1Y0Y A;  5LYF A;  3IEH A;  3PB9 X;  3PB4 X;  4C9R A;  4IAV A;  4ZI6 A;  1R3N A;  3LWU A;  1YW4 A;  2PJ4 A;  2AFO A;  3CPX A;  2PJ1 A;  5LRG A;  1YLO A;  4P4D A;  4OME A;  3TX8 A;  4P45 A;  3KR5 A;  2POK A;  4P44 A;  2PJA A;  4ZY2 A;  2ZOG A;  1ZLH A;  2EK9 A;  4X2T A;  4GM5 A;  2NSM A;  5HVG A;  4PQA A;  3S9M A;  1CPS A;  3RBU A;  2Q4Z A;  2Q43 A;  5K8P A;  4P4I A;  1OBR A;  3FH4 A;  2FVG A;  1LAN A;  3NA6 A;  4C8F A;  3GLJ A;  3B3S A;  2HC9 A;  4DYO A;  3B3V A;  4UEE A;  3IC1 A;  1TXR A;  3B35 A;  2C6P A;  2XEI A;  4C8P A;  4Q7A A;  1V6C A;  5JM6 A;  1HDQ A;  2ZEP A;  4OC0 A;  1LFW A;  3KR4 A;  3NH5 A;  2V8V A;  3I6S A;  1ZG9 A;  1ZLI A;  8CPA A;  3I74 A;  3IIB A;  3D7F A;  4C8T A;  1QMU A;  1AMP A;  3IFE A;  3SI2 A;  3FF3 A;  3KGQ A;  4NGP A;  1LAP A;  1FNO A;  4EFD A;  2OOT A;  4C8C A;  2PJ0 A;  2QVP A;  3FJU A;  2G9D A;  4OP4 A;  2PJB A;  3K9T A;  4EWT A;  1DE4 C;  2PJ9 A;  2V77 A;  2F8H A;  3LMS A;  4ZY0 A;  3B3C A;  2PJC A;  1ELL P;  3VAT A;  1JQG A;  2PJ7 A;  4JZ0 A;  2OR4 A;  4MHY A;  2IJZ A;  1VIX A;  3CPA A;  1Y7E A;  1CBX A;  4NGT A;  4C84 A;  4WJB A;  1TKF A;  4MHZ A;  4MCS A;  1ZG8 A;  1YW6 A;  2PJ2 A;  1EE3 P;  4IK2 A;  2PVV A;  3RAM A;  1R43 A;  1QQ9 A;  4ZY1 A;  1PYT B;  4TJV A;  2CTB A;  4B6Z A;  3KHX A;  1LAM A;  2ZEN A;  3D7H A;  1XBU A;  3KQX A;  4K3N A;  4ZX8 A;  2XEJ A;  5LRK A;  4C85 A;  4OC4 A;  2QJ8 A;  4A37 A;  4DJL A;  4P4E A;  2EWB A;  3VTA A;  3BHX A;  3KZW A;  5HVH A;  1AYE A;  4NFR A;  1FT7 A;  2AFW A;  3QNV A;  3H8G A;  5LYL A;  3BI1 A;  2CTC A;  2PJ3 A;  4MMO A;  5IB9 A;  4TNU A;  3SI1 A;  3D66 A;  4JYW A;  3D67 A;  1LCP A;  2PJ5 A;  2O4H A;  1TKJ A;  1IGB A;  3K2K A;  2PJ6 A;  2ABZ A;  3KAS A;  2ZEM A;  5K8N A;  3GB0 A;  4NGM A;  3RZA A;  4X8I A;  5HXD A;  2C6G A;  4PXC A;  1CPX A;  3NH8 A;  5I4M A;  4MHP A;  2VL1 A;  2NYQ A;  3PFO A;  7CPA A;  4R76 A;  4KNG E;  2AFS A;  1IY7 A;  4NGN A;  2RB7 A;  3I1U A;  2HB6 A;  4KSI A;  5K8O A;  2JBJ A;  4UIA A;  1BAV A;  4MHN A;  3PBB A;  5LRJ A;  3FEC A;  2XEG A;  1Y9Z A;  4C9U A;  1VHE A;  4P4B A;  5CPA A;  4MCQ A;  3B3W A; 
#chains in the Genus database with same CATH topology
 5J8F A;  2PJ8 A;  4C8A A;  4XNH C;  2PE3 A;  4A32 A;  3IWE A;  3JVN A;  4GS4 A;  4NGQ A;  4M85 A;  3NE7 A;  4U9Y A;  4CAX A;  1Z8X A;  5JH9 A;  3EIF A;  3IO1 A;  5K99 A;  2C27 A;  4PXE A;  1GYT A;  2CF4 A;  1RXT A;  1Z2L A;  2Z3N A;  3N5F A;  1VGY A;  2B5G A;  4UCP A;  2PRQ A;  2EUI A;  4CYP A;  5HMN A;  1F57 A;  3MRU A;  4E94 A;  4QB9 A;  4KOS A;  3T90 A;  1XF8 A;  3FRM A;  2MP0 A;  5DS0 A;  3RO0 A;  4EME A;  3NFZ A;  3D68 A;  2DIK A;  3SR3 A;  4A4B A;  3S9N A;  2ZEH A;  4PK3 A;  4UFW A;  2IL4 A;  4CS0 B;  4CDK A;  4JLY A;  1F2O A;  2Z3P A;  4YU9 A;  3B7I A;  3TLG A;  1VBG A;  3DR6 A;  1NXJ A;  3DGV A;  3KL9 A;  3CZX A;  4P4J A;  4KLW A;  3P2F A;  4A94 A;  5F09 A;  2OB0 A;  3TO6 A;  2JBK A;  1IB1 E;  1Q2D A;  1Q7L A;  1ARM A;  1GHE A;  2PIY A;  3A9L A;  3F0A A;  3GUX A;  3IWW A;  4NJQ A;  4CO9 A;  1XIX A;  1U6M A;  3FMC A;  3W6X A;  3PRT A;  1RTQ A;  2K5T A;  1KBL A;  3PB6 X;  4MJ8 A;  3GKR A;  4A38 A;  4ZX9 A;  2RFH A;  4AVA A;  5IB0 A;  4II9 A;  2C5Q A;  5JQ4 A;  2ZEO A;  4JVO A;  3H8E A;  1WVM A;  5G21 A;  2QYV A;  3DR8 A;  2IQ6 A;  4NXY A;  2F5I A;  4A30 A;  3PP9 A;  2ZEG A;  3ISX A;  4AG9 A;  4BPU B;  5LYD A;  3B2Y A;  1J4J A;  1IOI A;  3D8P A;  2H5M A;  3PEI A;  4MCP A;  1T36 B;  3R9F A;  3VRN A;  5ELY A;  1YVO A;  1IOF A;  3BLN A;  3R95 A;  1C30 B;  4F8Z A;  2G3T A;  4C7I A;  1TF8 A;  1M4L A;  4MXU A;  1KC7 A;  5EMI A;  4MBU A;  3SJE A;  4FWU A;  2Q4Y A;  3F8K A;  2PR8 A;  1Y9W A;  1GGO A;  3T8W A;  1L0C A;  3FIX A;  3IJ3 A;  2YGW A;  3D7D A;  3QAY A;  3RYO A;  3T9Y A;  3WC5 A;  3SJF A;  3BUO B;  1OZP A;  1YR0 A;  3T05 A;  1NSA A;  1M1D A;  1X10 A;  2VEZ A;  3LAC A;  2EO8 A;  5JPH A;  1YGH A;  4BPX B;  2R7H A;  4P6Y A;  3R9E A;  5BY0 A;  4KLV A;  4OAD A;  3FNC A;  2HRO A;  3FVL A;  2B3V A;  4A4C A;  2R98 A;  2AFM A;  3PB7 X;  4W9Y A;  3H4Q A;  5H86 A;  3VWE A;  4C8U A;  1JWQ A;  1WK4 A;  1YLE A;  2P6E A;  3GIU A;  3ZZI A;  3WT4 A;  4MJX A;  3WAB A;  4CAF A;  3R1K A;  1S3Z A;  2AFZ A;  1B87 A;  2O28 A;  3HUV A;  4UBR A;  1Y7R A;  3PBE A;  1BLL E;  4F9V A;  3QAH A;  4LQG A;  4NCZ A;  4OID A;  2ZED A;  2BCO A;  3TLZ A;  1I1D A;  1XE4 A;  2I00 A;  4ONU A;  3BUW B;  5DWN A;  4AXV A;  2GIV A;  1LRZ A;  2WZN A;  5F47 A;  4CGN A;  2ANP A;  2O53 A;  4FBE A;  2AUM A;  1VHO A;  1XOV A;  5GCN A;  4INJ A;  4C9A A;  4DNC A;  1NBW A;  1TKH A;  1ELM P;  1S7N A;  4R87 A;  4UA3 A;  1YVH A;  1BPN A;  2J9A A;  1XJO A;  2JDC A;  2YND A;  1NE9 A;  1ZG7 A;  3OB2 B;  3EY5 A;  2DXQ A;  4H6U A;  4MFL A;  4B5P A;  4UFX A;  3ICU A;  5BWA B;  1Q2Y A;  4OIW A;  5D29 A;  1Z9U A;  1PUA A;  1UWY A;  4R7M A;  4RN7 A;  4TJX A;  2GU2 A;  2NMT A;  5HVF A;  3IU2 A;  2DEA A;  3MN8 A;  4XPD C;  2HI6 A;  4CRY B;  1CP6 A;  3CXQ A;  4KOW A;  3D2M A;  4YRH A;  5AG5 A;  5E96 A;  2KCW A;  3CT9 A;  1Q2C A;  2C1C A;  3F9K C;  1I12 A;  4C9E A;  4CZ1 A;  1M6V B;  1MJA A;  2GLF A;  3V7Z A;  3S6F A;  4FD5 A;  1KWM A;  2Z11 A;  4WWV A;  2FT0 A;  4NJR A;  5F9M A;  1YSJ A;  3BUN B;  4BD9 A;  4Y49 C;  4TWE A;  6CPA A;  2DLA A;  4KVO E;  2AFX A;  2FXF A;  4MI4 A;  2D0P A;  3FED A;  1KUX A;  2G0B A;  5CNP A;  4G1P A;  3VAR A;  2IMO A;  2ZW4 A;  2V8G A;  1F2P A;  4P4F A;  2AFU A;  2ZEE A;  4R9M A;  3R9G A;  4UWI A;  3TC8 A;  1Z8W A;  4NGS A;  2GRE A;  4FUU A;  4HKF A;  2V8H A;  4CYN A;  4F6A A;  1HDU A;  1YK3 A;  1IYL A;  1DTD A;  1UFH A;  2VBQ A;  5HKY A;  2WSA A;  4NSQ A;  3KI9 A;  4ONW A;  4FD7 A;  4UF4 A;  2FSR A;  1HEE A;  2VI7 A;  4CGL A;  1EO0 A;  3PFE A;  3GJZ A;  2J8R A;  4U5Y A;  2DPT A;  3FB3 A;  2XPP A;  4F9U A;  4UIB A;  5THW A;  3WC7 A;  5F1Y A;  4C86 A;  5J1Q A;  4UEF A;  3PB8 X;  3H8F A;  1TF9 A;  4ZYQ A;  3NH4 A;  4KOV A;  3LD2 A;  2ZEF A;  1YX0 A;  5LYL A;  4UEZ A;  1J3L A;  1QST A;  4P10 A;  4MCR A;  5A28 A;  5JGF A;  2Q51 A;  2WPW A;  3K9U A;  3CDX A;  3TE4 A;  5ISV A;  3KHZ A;  3C8O A;  3IWG A;  4EYS A;  1MK4 A;  2HWG A;  3TTH A;  1BOB A;  4A39 A;  4L8A A;  4A31 A;  3TLE A;  2PSW A;  2V8D A;  4MFZ A;  3BXM A;  1XEB A;  4PXB A;  4YFJ A;  1QSM A;  1IU8 A;  2VZZ A;  3VWD A;  2EZC A;  2I3C A;  3GY9 A;  3O8Z A;  2GE3 A;  1XMB A;  2Q0Y A;  3CXP A;  5A27 A;  3T07 A;  4CDJ A;  4OC3 A;  2REE A;  2FE7 A;  2JEW A;  4OC5 A;  2J8N A;  3WC6 A;  1M4G A;  1JDE A;  4C2X A;  1YQE A;  4KUA A;  1YRE A;  4KS9 A;  1DIK A;  3FX6 A;  4KOR A;  1P4N A;  1XF1 A;  3SJG A;  2XPO A;  1ARL A;  1WJT A;  3D4U A;  4OLL A;  4OC1 A;  3OP0 A;  2BL1 A;  4BIN A;  4DUK A;  5CBM A;  2FCK A;  3L2N A;  3BI0 A;  4X3R A;  1Y9K A;  4CYO A;  4YN3 A;  5IR2 A;  4PXD A;  1CG2 A;  2QEC A;  4Q36 A;  3FEE A;  4F0X A;  3TOB A;  4X5K A;  3DLJ A;  4OKO A;  1S5K A;  3JRU A;  4PSX A;  5D8N A;  2A4N A;  1XRY A;  3D7G A;  4M3S A;  4CYQ A;  5K8M A;  3VRR A;  2WYR A;  2BO9 A;  2EK8 A;  2PIZ A;  2JDD A;  2WPX A;  2Y0M A;  3HPG G;  1Z5R A;  3PGP A;  2ZW6 A;  1LOK A;  4H1H A;  5HH1 A;  4GXH A;  4H2K A;  1CX8 A;  2CNM A;  3IU1 A;  4OAE A;  4BTF A;  4BMH A;  2QML A;  3FBU A;  5HKZ A;  3HLP A;  4KVM E;  2FL4 A;  2Z3L A;  3V38 A;  2GLJ A;  3SI0 A;  1CP7 A;  4R8F A;  1XFO A;  4IHM A;  2PR1 A;  1Z9E A;  1Y0R A;  5AXI A;  3W91 A;  4Z65 A;  2YJT A;  2PVW A;  1ON0 A;  2PCU A;  5LYI A;  1NSL A;  4QC6 A;  5F5X A;  3VRQ A;  2BOA A;  2FIW A;  4NGR A;  2F7V A;  3SJX A;  2GFQ A;  3G3S A;  5EBV A;  4B11 A;  1X12 A;  4GPL B;  2OZG A;  2ZOF A;  1H8L A;  4C99 A;  4O23 A;  2Z0Z A;  3S9L A;  1EZA A;  2CY2 A;  4FAI A;  1PCA A;  4ZBG A;  4MRI A;  2AUN A;  5DWM A;  1NMT A;  2C6C A;  2ODF A;  4UWJ A;  2CNT A;  5EC4 A;  4CAV A;  4CPA A;  3ZJ0 A;  2ZEL A;  1YME A;  3KQZ A;  4OC2 A;  1MJ9 A;  3PLF B;  4E5S A;  4RUH A;  5F46 A;  4IUS A;  3VH9 A;  3ISZ A;  2AJ6 A;  2Z3O A;  1Z8L A;  3S6H A;  3U88 C;  4PPZ A;  1BPM A;  2PC1 A;  4C2Z A;  2EZA A;  2XEF A;  2EBJ A;  2HV2 A;  3KKW A;  2PQ8 A;  3JTK A;  4YWY A;  4C9V A;  4R6T A;  2E28 A;  4PK2 A;  3B3T A;  2CIJ A;  1ZRS A;  4PSW A;  3G23 A;  1Y0Y A;  4RR2 B;  5LYF A;  2OU2 A;  5JVL A;  3UY5 A;  3BJ7 A;  3IEH A;  4U9Z A;  2Q7B A;  3PB9 X;  1JDB C;  2CBL A;  3PB4 X;  3PFV A;  4R3L A;  1IYK A;  4IIX A;  4C9R A;  2BSW A;  3PT1 A;  4IAV A;  2WUU A;  2VQY A;  1R3N A;  3LWU A;  3TCV A;  1YW4 A;  2PJ4 A;  4ZI6 A;  2AFO A;  1VHS A;  3TLC A;  1ZYM A;  4M6I A;  2VKZ G;  1CE8 B;  3CPX A;  2PJ1 A;  2AE6 A;  4MY0 A;  3CXS A;  5LRG A;  3TFY A;  4BPW B;  3EZE A;  5J3X A;  3EZA A;  1YLO A;  4P4D A;  3VRP A;  4OME A;  2YNE A;  3TX8 A;  4P45 A;  3KR5 A;  4COB A;  2POK A;  4P44 A;  2PJA A;  1ZL0 A;  2B58 A;  4ZY2 A;  1Q5X A;  4Q38 A;  2ZOG A;  1CS0 B;  2P6F A;  2DPS A;  4LX9 A;  3V8I A;  1ZLH A;  4B13 A;  1AUG A;  4EVY A;  1QSR A;  5I0C A;  2EK9 A;  1S60 A;  4X2T A;  4GM5 A;  1Z4E A;  4RI1 A;  4JXQ A;  1R57 A;  2NSM A;  4UFV A;  5HVG A;  4JJX A;  4AVB A;  3IGR A;  4PQA A;  2QIR A;  3S9M A;  2X7B A;  3OB1 B;  4YGO A;  2UV8 G;  1CPS A;  3RBU A;  1V0C A;  2Q4Z A;  2Z3K A;  4XPL A;  1A2Z A;  2Q43 A;  1TIQ A;  1Z8T A;  4L89 A;  3TOA A;  5K8P A;  5KTD A;  4P4I A;  1A9X B;  2ZPA A;  1OBR A;  4ZGY B;  2YNC A;  2PRB A;  1I21 A;  1RO5 A;  3FH4 A;  4NEX A;  4R3K A;  4XNH B;  3TLY A;  5F49 A;  2FVG A;  2B0A A;  1LAN A;  3FXT A;  3NA6 A;  5C82 A;  1VI4 A;  2ZW5 A;  2HQY A;  3R96 A;  4C8F A;  3EZB A;  3NE8 A;  3KRV A;  2B4D B;  1CJW A;  3GLJ A;  2CNS A;  4HNX B;  3S6K A;  4CGP A;  2JEV A;  3B3S A;  3H5Z A;  2HC9 A;  2JLM A;  3SXN A;  1B47 A;  2VXK A;  2BUE A;  2XPN A;  3B3V A;  1IIC A;  1IID A;  3D3S A;  4ORF A;  2RC4 A;  3E0K A;  4UEE A;  3IC1 A;  4K30 A;  2D4O A;  1TXR A;  3B35 A;  2C6P A;  2XEI A;  1YVK A;  1FBV A;  1N71 A;  4HPS A;  4BBH A;  4C8P A;  4Q7A A;  1V6C A;  3TT2 A;  5F13 A;  2GP4 A;  2B5G B;  1HDQ A;  4HNW B;  2ZEP A;  4OC0 A;  1LFW A;  3GYA A;  5JM6 A;  2R8V A;  5KTC A;  3KR4 A;  3NH5 A;  2V8V A;  3I6S A;  1ZG9 A;  1ZLI A;  2ARH A;  8CPA A;  3IIB A;  3I74 A;  5FD8 A;  3D7F A;  4MFK A;  1P0H A;  5IX3 A;  4C8T A;  3BUX B;  3ZNI A;  1QMU A;  2PCN A;  1FY7 A;  1AMP A;  3IFE A;  2I79 A;  3SI2 A;  3FF3 A;  3KGQ A;  2ATR A;  4NGP A;  3HMJ G;  1LAP A;  2B3U A;  4KZT A;  1FNO A;  5AG7 A;  3WR7 A;  4AB7 A;  2REF A;  4EFD A;  1Z4R A;  5G20 A;  2OOT A;  2D4P A;  2PJ0 A;  2QVP A;  3SHP A;  4C8C A;  2D0O A;  3FJU A;  2G9D A;  5FVJ A;  4OP4 A;  3TLA A;  2PJB A;  3K9T A;  4EWT A;  4MHD A;  5C88 A;  1SQH A;  3TYX A;  2HUZ A;  1DE4 C;  2PJ9 A;  2V77 A;  1R61 A;  4E8O A;  2GAN A;  2N3A B;  2F8H A;  4B10 A;  3LMS A;  2PDO A;  4ZY0 A;  3B3C A;  2P0W A;  1XMT A;  1ELL P;  2PJC A;  4H89 A;  3VAT A;  1JQG A;  4XPK A;  3OAK A;  3NFQ A;  2PJ7 A;  4IIY A;  4JZ0 A;  2Q4V A;  4C68 A;  4J3G A;  5J8C A;  2OR4 A;  4MHY A;  2IJZ A;  1VIX A;  3CPA A;  5AG6 A;  1Y7E A;  2OLS A;  4M6H A;  4KOU A;  1QSN A;  2OH1 A;  1WWZ A;  2P6G A;  1CBX A;  4NGT A;  1BXR B;  4C84 A;  2Z3M A;  4MI1 A;  3HPH E;  4WJB A;  3TO9 A;  1TKF A;  4MHZ A;  4MCS A;  1ZG8 A;  3DNS A;  4QUS A;  1YW6 A;  2PJ2 A;  1EE3 P;  2FS5 A;  4IK2 A;  1C3O B;  2PVV A;  1BO4 A;  3RAM A;  1R43 A;  2OZH A;  1QQ9 A;  4ZY1 A;  2Y1M A;  1PYT B;  4TJV A;  3K4I A;  4F0Y A;  5AG4 A;  4CRZ B;  2CTB A;  4B6Z A;  4C2Y A;  4UCM A;  3U1B A;  3I3G A;  4A95 A;  3KHX A;  1LAM A;  3TLG B;  1S7K A;  2ZEN A;  4MFP A;  1CM0 A;  4KUB A;  3D7H A;  3I9S A;  3EO4 A;  4MFQ A;  1XBU A;  1KZF A;  4J0N A;  3KQX A;  4K3N A;  4LUA A;  3QB8 A;  4ZX8 A;  2XEJ A;  2B4J C;  4XPD B;  4JD6 A;  5LRK A;  4OC4 A;  5H84 A;  4C85 A;  2QJ8 A;  4NF1 A;  4A37 A;  3TLB A;  3VRO A;  4KSF A;  4KSA A;  4I49 A;  4AG7 A;  4AVC A;  3OWC A;  2ZXV A;  2OZU A;  5F48 A;  4M8D A;  2CXA A;  4DJL A;  4QVT A;  4P4E A;  2BEI A;  3PZJ A;  3S6G A;  1PU9 A;  2EWB A;  1KEE B;  4CGM A;  3BHX A;  3VTA A;  3KZW A;  5HVH A;  1AYE A;  4PV6 A;  4JXR A;  3RNZ A;  3G8W A;  4NFR A;  4E2A A;  1FT7 A;  1S7L A;  2AFW A;  3EXN A;  3H8G A;  3QNV A;  2R1I A;  1VKC A;  1QSO A;  3W6S A;  2Y1N A;  2Q44 A;  4B5P B;  2VZY A;  1M4I A;  3BI1 A;  2CTC A;  3BUM B;  3MGD A;  4M6G A;  2PJ3 A;  4MMO A;  4B14 A;  4CAW A;  4DYO A;  2ZW7 A;  4TNU A;  4MY3 A;  3SI1 A;  5IB9 A;  4Y49 B;  3D66 A;  2R82 A;  4JYW A;  5IV0 A;  4CAE A;  3D67 A;  1LCP A;  5G1Z A;  2EVN A;  2O4H A;  2PJ5 A;  1TKJ A;  3F5B A;  3LOD A;  3N7Z A;  1IGB A;  4KOT A;  1EZB A;  3K2K A;  4A2Z A;  2EZB A;  3EC4 A;  4FD6 A;  3BJ8 A;  2Q04 A;  2PJ6 A;  3T5M A;  2ABZ A;  3KAS A;  2ZEM A;  2J8M A;  4B5O A;  4KVX A;  4A33 A;  4QBJ A;  3FYN A;  5K8N A;  4FD4 A;  4KOY A;  2X0S A;  3GB0 A;  4NGM A;  4HNY B;  3RZA A;  4X8I A;  3P2H A;  2Q7S A;  2G3A A;  3B8G A;  5HXD A;  1VBH A;  5G22 A;  2C6G A;  4PXC A;  1S7F A;  1M4D A;  3VGO A;  4LQ6 A;  4C7H A;  1B6B A;  2FM4 A;  1CPX A;  3NH8 A;  5I4M A;  3D2P A;  1M44 A;  4MHP A;  2Z10 A;  2VL1 A;  4B12 A;  2NYQ A;  4COG A;  3PFO A;  7CPA A;  4R76 A;  3TO7 A;  2AFS A;  4E0A A;  3NOJ A;  1IY7 A;  4KNG E;  3DDD A;  3DSB A;  5JYB A;  4UCN A;  4NGN A;  2RB7 A;  1K4J A;  3C26 A;  5HKW A;  3I1U A;  2HB6 A;  4KSI A;  5K8O A;  2YNC C;  4R57 A;  4IF5 A;  2JBJ A;  1ZO0 A;  2DF5 A;  2YJV A;  3EFA A;  4UIA A;  1KUY A;  1BAV A;  4MHN A;  4MFJ A;  3PBB A;  2XPL A;  3FEC A;  1KUV A;  2B4B A;  5LRJ A;  1MJB A;  2XEG A;  4KOX A;  2FIA A;  3JUW A;  4H6Z A;  1Y9Z A;  4C9U A;  1VHE A;  4P4B A;  4RS2 A;  3T0T A;  4JWP A;  5KTA A;  3SXO A;  2B4D A;  5AGE A;  5CPA A;  4CGO A;  4MCQ A;  3B3W A; 
#chains in the Genus database with same CATH homology
 4C8A A;  2PJ8 A;  2PE3 A;  4NGQ A;  5JH9 A;  3EIF A;  3IO1 A;  4PXE A;  1GYT A;  2CF4 A;  1Z2L A;  3N5F A;  1VGY A;  2PRQ A;  1F57 A;  3MRU A;  5DS0 A;  4EME A;  3NFZ A;  3D68 A;  3S9N A;  2ZEH A;  4CDK A;  1F2O A;  4YU9 A;  3B7I A;  3DGV A;  3KL9 A;  4P4J A;  4A94 A;  5F09 A;  2JBK A;  1Q7L A;  4NJQ A;  1ARM A;  2PIY A;  3GUX A;  3IWW A;  3FMC A;  3PRT A;  1RTQ A;  3PB6 X;  4A38 A;  4ZX9 A;  2RFH A;  2C5Q A;  2ZEO A;  3H8E A;  1WVM A;  2QYV A;  2IQ6 A;  2ZEG A;  3ISX A;  5LYD A;  3B2Y A;  3PEI A;  4MCP A;  5ELY A;  4F8Z A;  1TF8 A;  1M4L A;  4MXU A;  3SJE A;  4FWU A;  3T8W A;  3IJ3 A;  3D7D A;  3WC5 A;  3SJF A;  1NSA A;  4P6Y A;  3FVL A;  2AFM A;  3PB7 X;  4W9Y A;  4C8U A;  3WT4 A;  3WAB A;  2AFZ A;  3HUV A;  3PBE A;  1BLL E;  4F9V A;  4LQG A;  4OID A;  2ZED A;  2BCO A;  4AXV A;  2WZN A;  2ANP A;  2O53 A;  4FBE A;  1VHO A;  4C9A A;  1TKH A;  1ELM P;  1BPN A;  2J9A A;  1XJO A;  1ZG7 A;  3ICU A;  4R7M A;  4OIW A;  5D29 A;  1UWY A;  4TJX A;  2GU2 A;  5HVF A;  2DEA A;  3MN8 A;  1CP6 A;  3CT9 A;  2C1C A;  4C9E A;  2GLF A;  3V7Z A;  1KWM A;  4WWV A;  4NJR A;  1YSJ A;  4BD9 A;  4TWE A;  6CPA A;  2AFX A;  3FED A;  4G1P A;  3VAR A;  2IMO A;  2V8G A;  1F2P A;  4P4F A;  2AFU A;  2ZEE A;  3TC8 A;  4NGS A;  2GRE A;  4FUU A;  2V8H A;  1HDU A;  1DTD A;  4ONW A;  4UF4 A;  3KI9 A;  1HEE A;  3PFE A;  4F9U A;  4UIB A;  5THW A;  3WC7 A;  4C86 A;  5J1Q A;  4UEF A;  3PB8 X;  3H8F A;  1TF9 A;  4ZYQ A;  3NH4 A;  2ZEF A;  4UEZ A;  4P10 A;  4MCR A;  5JGF A;  2Q51 A;  3CDX A;  3KHZ A;  4A39 A;  2V8D A;  4PXB A;  3BXM A;  2I3C A;  1XMB A;  4CDJ A;  4OC3 A;  2JEW A;  4OC5 A;  3WC6 A;  3FX6 A;  1XF1 A;  3SJG A;  1ARL A;  3D4U A;  4OC1 A;  5CBM A;  4DUK A;  3L2N A;  3BI0 A;  4X3R A;  4YN3 A;  5IR2 A;  4PXD A;  1CG2 A;  3FEE A;  3DLJ A;  4OKO A;  3JRU A;  5D8N A;  1XRY A;  3D7G A;  5K8M A;  2WYR A;  2BO9 A;  2EK8 A;  2PIZ A;  1Z5R A;  1LOK A;  4H2K A;  1CX8 A;  3HLP A;  3V38 A;  2GLJ A;  3SI0 A;  1CP7 A;  4R8F A;  1XFO A;  4IHM A;  1Y0R A;  4Z65 A;  2PVW A;  2PCU A;  5LYI A;  2BOA A;  4NGR A;  2F7V A;  3SJX A;  2ZOF A;  4C99 A;  1H8L A;  4O23 A;  3S9L A;  4FAI A;  1PCA A;  4MRI A;  2C6C A;  4CPA A;  2ZEL A;  1YME A;  3KQZ A;  4OC2 A;  4RUH A;  3VH9 A;  3ISZ A;  1Z8L A;  4PPZ A;  1BPM A;  2XEF A;  4YWY A;  4C9V A;  4R6T A;  3B3T A;  2CIJ A;  1Y0Y A;  5LYF A;  3IEH A;  3PB9 X;  3PB4 X;  4C9R A;  4IAV A;  4ZI6 A;  1R3N A;  3LWU A;  1YW4 A;  2PJ4 A;  2AFO A;  3CPX A;  2PJ1 A;  5LRG A;  1YLO A;  4P4D A;  4OME A;  3TX8 A;  4P45 A;  3KR5 A;  2POK A;  4P44 A;  2PJA A;  4ZY2 A;  2ZOG A;  1ZLH A;  2EK9 A;  4X2T A;  4GM5 A;  2NSM A;  5HVG A;  4PQA A;  3S9M A;  1CPS A;  3RBU A;  2Q4Z A;  2Q43 A;  5K8P A;  4P4I A;  1OBR A;  3FH4 A;  2FVG A;  1LAN A;  3NA6 A;  4C8F A;  3GLJ A;  3B3S A;  2HC9 A;  4DYO A;  3B3V A;  4UEE A;  3IC1 A;  1TXR A;  3B35 A;  2C6P A;  2XEI A;  4C8P A;  4Q7A A;  1V6C A;  2GP4 A;  5JM6 A;  1HDQ A;  2ZEP A;  4OC0 A;  1LFW A;  3KR4 A;  3NH5 A;  2V8V A;  3I6S A;  1ZG9 A;  1ZLI A;  8CPA A;  3I74 A;  3IIB A;  3D7F A;  4C8T A;  1QMU A;  1AMP A;  3IFE A;  3SI2 A;  3FF3 A;  3KGQ A;  4NGP A;  1LAP A;  1FNO A;  4EFD A;  2OOT A;  4C8C A;  2PJ0 A;  2QVP A;  3FJU A;  2G9D A;  4OP4 A;  2PJB A;  3K9T A;  4EWT A;  1DE4 C;  2PJ9 A;  2V77 A;  2F8H A;  3LMS A;  4ZY0 A;  3B3C A;  2PJC A;  1ELL P;  3VAT A;  1JQG A;  2PJ7 A;  4JZ0 A;  2OR4 A;  4MHY A;  2IJZ A;  1VIX A;  3CPA A;  1Y7E A;  1CBX A;  4NGT A;  4C84 A;  4WJB A;  1TKF A;  4MHZ A;  4MCS A;  1ZG8 A;  1YW6 A;  2PJ2 A;  1EE3 P;  4IK2 A;  2PVV A;  3RAM A;  1R43 A;  1QQ9 A;  4ZY1 A;  1PYT B;  4TJV A;  2CTB A;  4B6Z A;  3KHX A;  1LAM A;  2ZEN A;  3D7H A;  1XBU A;  3KQX A;  4K3N A;  4ZX8 A;  2XEJ A;  5LRK A;  4C85 A;  4OC4 A;  2QJ8 A;  4A37 A;  4DJL A;  4P4E A;  2EWB A;  3VTA A;  3BHX A;  3KZW A;  5HVH A;  1AYE A;  4NFR A;  1FT7 A;  2AFW A;  3QNV A;  3H8G A;  5LYL A;  3BI1 A;  2CTC A;  2PJ3 A;  4MMO A;  5IB9 A;  4TNU A;  3SI1 A;  3D66 A;  4JYW A;  3D67 A;  1LCP A;  2PJ5 A;  2O4H A;  1TKJ A;  1IGB A;  3K2K A;  2PJ6 A;  2ABZ A;  3KAS A;  2ZEM A;  5K8N A;  3GB0 A;  4NGM A;  3RZA A;  4X8I A;  5HXD A;  2C6G A;  4PXC A;  1CPX A;  3NH8 A;  5I4M A;  4MHP A;  2VL1 A;  2NYQ A;  3PFO A;  7CPA A;  4R76 A;  4KNG E;  2AFS A;  1IY7 A;  4NGN A;  2RB7 A;  3I1U A;  2HB6 A;  4KSI A;  5K8O A;  2JBJ A;  4UIA A;  1BAV A;  4MHN A;  3PBB A;  5LRJ A;  3FEC A;  2XEG A;  1Y9Z A;  4C9U A;  1VHE A;  4P4B A;  5CPA A;  4MCQ A;  3B3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...