3BIAX

Tim-4 in complex with sodium potassium tartrate
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
110
structure length
110
Chain Sequence
EDTIIGFLGQPVTLPCHYLSWSQSRNSMCWGKGSCPNSKCNAELLRTDGTRIISRKSTKYTLLGKVQFGEVSLTISNTNRGDSGVYCCRIEVPGWFNDVKKNVRLELRRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T-cell immunoglobulin and mucin domain-containing protein 4
publication title Structures of T Cell Immunoglobulin Mucin Protein 4 Show a Metal-Ion-Dependent Ligand Binding Site where Phosphatidylserine Binds.
pubmed doi rcsb
source organism Mus musculus
total genus 25
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2007-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3biaX00
1F2XK 4JZOB 5ICYB 4JQVA 2AABH 5H2BB 4MLSA 1K6QH 4FZEH 2GTWA 1R3KB 3R4DA 3O0RL 4XPFL 3VWKD 4HX1B 2KDGA 3L5HA 25C8L 2VLLB 5IMKB 5CIPA 2VISB 3IFOA 1JFQH 1J12A 3MR9B 3FRUA 4LSPH 4UT7H 3LDBC 1V7MH 2BNQD 3ZE2E 1FJ1B 4QXTA 5ID1B 3MRMA 1R3JB 1G7HB 1TQCC 4HJJH 3UTQA 3IKCA 5E8NB 1FVEA 3L5XL 4G6JH 4ZSOE 2FH6A 1TIUA 3S88L 3OKNB 3QIUC 2IANA 4L9DA 1R0AL 4OIIH 4XAWL 5FKPB 5C09A 3QNXA 2E6JA 1IL1B 4ZAKD 4F7MB 1GPOH 2YXMA 3TT1H 1P2CA 1Y0LA 3HPLB 1KIPA 4JFOB 1D9KD 2OR9H 3GBLA 2OL3B 5GSRA 4DEPB 1QLFA 3NACL 2D03L 4HG4K 4Y4KD 5B3NA 2AEQH 3GKZA 3MCKA 1ACYL 4X6DF 3O6FD 4Y8DC 5FYKU 1UZ6F 4N9GB 3LKRA 2NXYD 4KDWA 1KB5B 5CEZD 3BT2H 3FHQA 3N85H 2QHRL 1FN4A 1U91A 5JQHC 1TCMA 1GH7A 3V4UH 1OPGL 3UAJC 3KYMA 4YFLF 1KG0A 2J5LB 1UENA 3IDNB 3NIGE 5IBTH 1ORQA 4LCUB 4UV4L 4LSUL 3P30H 4D9RD 5DO2C 1MF2H 5FYJU 4JDTH 2EDFA 2XN9E 5D96C 5IW3A 3E2HC 1YEEH 2A83A 3D3VE 2ESVA 1X5IA 3EHBD 1I3UA 3LKOB 4LK4A 1YMME 3BD4A 1O7VA 3QG7L 4AEIL 3SCMB 4M9OA 7FABH 4NGHH 1KTDA 5E5MB 1YEDA 1IBGL 5EUOE 4GQ9L 1SYVB 1XGQB 4GQPH 4XC1H 2Z31B 2CQVA 5EBGA 4WRLA 3S98A 3PHQA 3ZE1F 2VLRE 2W9EH 2ZUQB 3QYCA 5C3LD 1N6QH 2YPLB 2EIDA 4X6DB 2E3VA 4X5LA 4YC2C 1NAMB 2D7TH 1Q9WA 4LLQA 1E6OL 2X4NB 2NY3D 1OT1A 2DQJH 1U0QA 1UB6B 4LQFH 3VWJD 3EFDH 1RK1B 3WKMH 3QSKB 3FB6B 1S7TB 1NC4B 1KEML 1DE4A 1N64H 3SE9L 4CVWA 1IC5L 1D5IL 1IGJB 3VXTB 5JDJA 3CC5B 3VD9A 3WXWL 5GZOD 5F3HB 5FGRA 2PUQT 1XF1A 2W38A 2F53A 3MV8D 1EXUB 1CXIA 4NM8H 3OR6A 2FX8H 2R0WH 2P24A 2AJUL 4P2QD 2MTPA 5GGRA 5KG9A 4ISVB 3AVEA 3BUYA 5IR1B 4WEMB 1IEHA 5KAQG 4PY7A 4PJAE 2NY5L 5CJXC 3HMWL 4QRUA 1D5MA 5L8LB 2XZZA 4ZFGL 1CFSA 1WBXA 1B90A 1KXTB 3O3DB 4CN4A 4HCRL 2XI9A 1DBMH 1G0YR 2IAMA 2G5BB 5DJYA 1MCDA 1U8MB 2UWEA 2I5YH 2ARWA 1XF3B 4U4BA 1J88A 3IF1B 1KTLA 4HZLB 1H8SA 2GW5A 3QXUA 3UBXA 4UDUA 3UO1L 1UM6L 3CSYA 2BOCA 2GAZA 1I9JL 4LSSH 3BP6A 5IG7B 3LHPH 2E9WA 5HGGS 3QG6B 3U4BL 4OF3A 3PWPD 5CD5D 1TQCB 4KI5C 3WE6B 4P57B 4ODVL 1IQDA 4Q9RH 4OD1H 1CFTB 1GZPB 3P3YA 1TZIA 3GSVA 3K4ZA 3SJVD 2K1MA 3X11B 3E8UH 2DM3A 3KLDA 4FG6D 3TNNA 1YPZE 2IFGA 1KOAA 2BHUA 1DQDH 2R2HA 5E9DA 3WO4C 3VFRA 3RQ3A 3D85D 2R56H 2DJSA 4JFFA 5EBMB 1J18A 3O9WB 3V6OE 4C59B 3QDJE 2FSEA 4POYA 5IB2A 4Y2DD 3AS3A 2R4SL 3RDTC 3FFDA 5I8EB 1OF2B 4OLYH 4Z7WE 4PGEB 4KK8C 4XNMA 4N90D 4P5MA 4HUKB 3S37L 1X7QA 5C0FA 4XXCA 1OP5K 4PJGF 5KSBE 5J6HB 3IDIB 4ZPTB 4XP5H 5GS0D 4Z95L 2A6JA 1WT5C 4R3SA 3P4MA 1NPUA 3HZYA 2NY7H 2JJSA 4TUJB 4GXVH 3LPGA 5I6XC 1I1AC 1DANT 2OJEB 3N1QC 5D96B 2JJUA 2OTPA 4PRIA 2VNCA 1S7SA 3AXLB 3UZEA 4NZDA 3T3PE 1TTFA 4K3EH 5A1AA 1YYMH 2FJHB 1G7QB 4FQXD 4JPIB 3TJHC 2HVKB 4H0IA 4J1UB 4ONGH 2VZUA 3FOLA 1IE5A 3HTLX 4HQQH 5TQ0L 5C07E 5TH2B 2QQQA 3QFJB 5TGBA 4K3DL 5DUBB 1NLBH 2JIXA 3OKDA 1RJYB 5D7JD 3CZFA 2GJ6D 4OFDA 5DD6B 4YDIL 3AUVA 3O41A 1J8HE 3DV6A 5CJOL 5FV1L 3REWA 2UY6A 3WJLA 3OJDA 3PGDB 2YEZA 2F54E 4U1JB 3G04A 4YC2B 4JRYE 4BFBD 3V4PH 5DEZA 3MFFB 4QCIB 1KENH 4DN3L 1MLBB 4HUUB 4D94A 4KI5F 2HN7B 2P5WB 4LSQH 1OGAD 3A67H 3BN3B 4P59L 3FQNA 5AYUH 4FQCH 1DQMH 2Q76B 4WI3A 4X4ZA 5FHBH 2W91A 5LGJB 5IWLA 5GRYA 1XCQA 5C2BH 1X5XA 5DD5L 4M6AA 3OZ9L 2FBJH 3SDAD 4OV6F 4U1NB 4ELKB 3TBYB 5DMYA 1NEZB 1ZHNB 1G7PA 2AAVA 3ZYIA 1K8DA 2Q6WB 1Q9OB 4KRPC 3BIKB 3FQRB 1ZKAA 4BFGA 3K2UL 4HUVA 5C0AE 3KWWA 3SKUD 2M26A 3HUJE 5DRNA 2L0DA 1UVQA 3MXWL 3TBTA 4BUGA 5DJCA 4K94C 1YY8B 5JXED 3MREB 5SWQB 1HQRB 3O11B 5IMLB 1RZJL 5EC2A 4ZTOL 5CP7B 4PS4L 1GCFA 1P4LB 1A7QH 5F9OL 3NCFB 1IGYB 4GBXC 5T3ZH 1SJHA 2GITA 2NY0C 4KVCH 1S7XA 1KB9K 1MY7A 1B0RA 1MI5B 5F7MC 1I9EA 5ANMA 3TCXA 4MDIB 3QBTB 1ORSA 5DRXA 3E1F1 1X5YA 1QFWM 3SKJL 3TIEB 4GMSH 4YFDB 3V7AE 2A2QT 3O0RH 2RIKA 1BLNA 3IAPA 4XPFH 5FM5O 3C60D 1SJEB 1BD2D 3K8MA 2HJLB 3FN0H 2N1KA 25C8H 5CINL 1XF2A 1AGCB 3L5IA 3BZEA 1FL6B 3ZKSD 2A6KB 1YMHB 3WO4B 4TVPH 1S7UA 2PXYA 5DDHB 1V3MA 3U0TB 5DSCB 3RPIA 3DWTA 3VFUA 1EHAA 3RFZC 1RIVL 4HUNB 1EFXA 4LCWE 1XGPB 1JRHI 1IQWL 4ESKA 3RDTB 1U8NA 1T6VN 3C08H 1UT9A 1U41A 2YRPA 1OGTA 4OLEA 4WW1A 1R0AH 1ITCA 4XAWH 1CGWA 1WC7B 1ZXQA 1LD9B 5C9JB 3S5LB 1G1CA 2V5SA 1QSFE 2I27N 5INDA 5IV2B 4KV5F 4PV9B 4QWWD 1S5HB 1BZ9A 3ULUH 1OCWL 2D03H 4ZNEA 1OD7A 4ODXA 1HH6B 1ACYH 4FP8L 5TE4L 3TBWB 5I6XB 3ARGD 5CSBA 4G8GB 1OTUD 4HWEL 5E8OB 1I7ZB 2JJVA 4PD4K 3ARDC 4U1KB 4JO3L 3G6JA 2QHRH 3PWNA 5C7XL 3PABA 1UXSA 3V5KB 3L3DB 4HUXA 4KMTL 1XH3B 3WSQL 3EYQC 4XBPA 1JZ7A 1B0GB 1NCDH 3MNZA 4XRCA 2BNQE 4HLJA 4TSCL 4UV4H 3RL2A 1OQXA 3PQYA 3DXAA 5C0CB 5D1XA 3QA3A 4FFZH 1U3HC 4Y19A 1NBQA 2F19L 1T1XB 4EN3C 4DTGH 2WBWB 2PW2B 3IXTA 4MZ2A 1MCOL 1I7UB 4M7ZC 1WFTA 3HNTL 1EAPB 4S1RH 4LMQE 5DD3L 4AM0A 1JF6A 2VC2L 3MLVL 3H7BA 4FHBD 1AI1L 2NMSA 3P4NA 4U1IB 3QG7H 1F58H 1II4E 4AEIH 3HNSL 4NHUB 4YFEA 2NY1D 3D39B 5KS9A 1IBGH 5JQ6L 4GQ9H 1T0PB 4HXAL 3ILPB 1EHLL 4OCRL 1PDKA 4RFOL 5DJXB 2HFGH 2OMBA 2AJXL 3I75B 4LKXA 4YK4C 3Q1SL 2VSDA 3O81A 4Q9CA 4OZIA 4XNXL 1L4IA 3WXVL 5CEZE 4YBQC 2Q8AL 2KH2B 5BS0D 1E6OH 4R4NC 3PUCA 5I8KL 1RJLB 2K7PA 43CAB 4FTVA 1SYSA 2WIMA 2VDNH 4X4YB 3T4AA 1NL0H 4P5TC 1ZGLM 5EU4B 1EO8L 1KEMH 3L7EA 5DS8B 1EMTL 4KRPB 4XXDB 3SE9H 2DQGL 4LSTL 3G9VA 4OF0A 5A2KH 1X9QA 4U3CA 1D5IH 4FFYL 2Y23A 4D9RE 3SDDD 3WXWH 2DM4A 2Q3ZA 3FO9B 4J4PC 2BNUB 1MEXH 5E1AA 3ULVE 2XRAL 1JV5A 4NYLB 2AJUH 4G43B 4I0PC 5C08A 4GFTB 1PW3A 2YS4A 4Y1AB 1L7TH 5GJSL 3MOBL 5ID0A 3D0VB 4JFED 3V0AC 4GBXB 2CIIA 1OB1B 3GSQB 1JPSH 2NY5H 3LQAL 3HMWH 4LHUA 2NY0B 2CR3A 1CE1L 3ELAT 2RAMA 4M8VA 4ZFGH 1S9WB 4PJHA 2EICA 4NP4L 3JV6B 5ETUA 3M1BA 1BAFL 3VJ6B 3VXQA 1IARB 3BWAB 2Q1EA 1REIA 3VMPA 5FK9A 4TRPL 4GRMA 3MUY1 3RI5K 1AGDA 3QNYA 4I48A 2DS4A 2OR7A 4G7YL 1JWUB 1P7KB 4M1DH 1JNNL 4N0FA 3UO1H 1T0NB 4LLVA 1FAIL 1IC7L 4L8DA 1BJ1J 1XFPA 3U4BH 2P8PB 1T7WA 5I8OL 4JPKL 1CDYA 4OAWB 1DEDA 3DX8B 4XCEB 5MENA 1HWHB 3WLWD 1N59B 3BJLA 1DVFA 3VFTB 4WEUD 1DN0B 3EOBA 1MH5A 2CLZB 1FL5A 4P2QE 5TE6L 4ZUWB 1YQ2A 1Z5LA 1UZ8B 3UDWA 3UXFA 3SN6N 4GLRH 1QG3A 3RTQD 4JZOA 4UUJB 5H2BA 4FS0A 4PG2A 3HR5B 4BYHA 2ICCA 3LPWA 3GJFH 3ARDB 2VLLA 5IMKA 3S37H 1ZA3B 4I0KA 2VISA 5DK0B 1FSKC 1AY1H 2RFXB 4Z95H 1FJ1A 3EDEA 4F7CB 3ZTJG 1EBPA 4M3JA 1R3JA 3FRPA 1HKFA 5E8NA 5J1TC 5JMOC 4WNQB 5HHOB 3OKNA 3PWPE 5E6IC 5FF6B 1U3HB 1KCKA 4JM2A 1T7YA 4EN3B 4F7MA 4CW1A 4PFEA 4M7ZB 1HHJA 3DMMA 5BO1H 1I1FB 3SJVE 2H32H 3HPLA 2DTSA 1T0MA 5SWZE 4JFOA 4MNQD 4XNZC 3LB6D 2W59A 5E08L 3IDJB 2B2XL 3HZKB 4K3DH 5E2TL 5EWIH 4N9GA 4IOSD 5GGSA 5JOFB 5IBLD 5L2KB 4ZS6D 4YDIH 1KB5A 1L0XA 4MNGB 2SEBB 1UKTA 4YK4B 2GKIA 1OAYL 4OI7A 3QI9A 2NTSP 4N90E 4M6MH 4OCSH 4S10A 1J86A 3IDNA 4DN3H 4LCUA 4P5TB 5E00A 3KG5A 5LAXB 1CDHA 4C58B 3L1OL 3S97C 2YC1A 4NQVA 4GRWH 1JRHL 5F8QC 1EHNA 5DD5H 3OZ9H 3TPUB 5GXBB 1RFDL 2IQAB 3V0VB 3LKOA 4QOKB 2ADGB 4I0PB 3W9EA 4EEEA 3T77B 3MRDB 2XFXB 3MJ9L 4ZFZB 5E5MA 3QQ4B 5F1NB 3BDXA 1GHFL 3CCHB 1SYVA 1XGQA 2Z31A 4NCC2 4L4VD 5F88B 5MEPB 3GMOB 3L6FA 3JZ7A 3CD4A 3RKDD 3P9LB 3EKCA 3MXWH 4UQ2B 1OTSD 1BVKB 3RZCC 4IRSC 2KL6A 2GJ6E 2R2BB 4X6DA 3BYTA 1QVOB 5J7CC 2VN4A 2JCCF 3ARZA 1RZJH 1T80A 4NQTA 4QRSB 4ZTOH 3HE7C 2EDLA 3VDCA 1CLZL 1S7TA 5F96L 5F9OH 4CGTA 5F7EH 1T3FA 1BQSA 2HFEB 3I6GB 2X70B 2FCBA 3CC5A 5K9JH 2IPTL 3SKJH 1J1XL 4MWFA 1F4WH 5F3HA 1WAAA 2GI7A 4C56D 4S2SA 2XTJC 1IFHL 5EU6A 3JVGC 4PRNA 1N5YL 1EXUA 4NC1E 3F6IA 5E7FA 3NA4A 4EKXA 4LL9A 5CINH 1AIFB 2FLBT 4OD2A 1U8IB 5SWSA 1X4ZA 3BAEL 4X5WA 3EYFA 2JJTC 4UOW1 5IJVB 1IAOB 3P73B 4Y5VC 5DFVD 4MX7B 1FYTB 1KSRA 4LRIA 1QNZL 1XF3A 2VLKA 1PQZB 5D7SL 4I2XB 4HZLA 2AXGB 2Y6SD 1FSKB 3K74B 4PJ5B 2FLRT 2ITDB 5EZIL 2NPLX 1HINH 4TSBL 3V6ZB 2XT1B 1QRND 4V1DE 5BV7L 1JPFB 2JCCB 3IDXL 3GJEA 1OCWH 3QG6A 4NRXB 3QNZA 4BELD 3VD5A 4FP8H 3QIUA 5E6IB 4RNRB 2V9QA 4G9FA 3LKQB 1S7WB 1GZPA 1X6LA 2YBRA 4HWEH 3F12B 4JO3H 1RZGB 1KPRA 1BD2E 5C7XH 4DGIL 3QJFA 4KMTH 2Z8RA 4IHOB 3WSQH 5E8EB 5TF1L 4HT1L 4XNZB 1PD6A 5IBUB 3WFCH 4TSCH 5TDPA 4NWUH 4M6NH 5KVMC 5I8EA 1OF2A 2V2WB 2APBA 4PGEA 3RVTD 5CZVL 4LPYA 1NUDA 1QSEB 2NQCA 1MCOH 1JGVL 4XAKD 3HNTH 5J6HA 5DD3H 3CNKA 2VC2H 3IDIA 3MLVH 1AI1H 4W6XB 1WBYA 4GRLA 1X5GA 1WFUA 3F62A 5IHUL 2FZ3A 4TUJA 1VADB 5GPRA 1FORL 4PLNC 2ZCLL 3C8KB 5JQ6H 3BQUD 4HXAH 1EHLH 2DM7A 2FD6L 4OCRH 4KKAD 4RFOH 1UA6L 3AXLA 4OI8A 2AJXH 3LQZA 3MCG1 2FJHA 3CLFL 1BGXL 4XNXH 4NO0B 3WXVH 4NQXB 3B2VL 4J1UA 4O9HH 5DEGA 1EVTC 2Q8AH 4F7EB 3NFPB 2NXZD 3C5ZC 4A6YB 5KVEL 5HSFA 5J89A 5BZDA 1PGRB 3RVVD 1EO8H 2CDGA 2YD7A 5TH2A 1OM3L 2DQGH 5CEYB 1EK3A 4P0DA 3UTTD 4FFYH 3RWFB 1P5UA 4X98B 1HH9A 3RZCB 3UTSE 4IRSB 4U1JA 4H88L 3GMPB 1LK2B 1CD1B 5HVFB 2RBLA 4WW2C 2XRAH 4QCIA 5DGRA 1UKQA 4JAMA 3E6FB 1MLBA 2EZ0C 3OTTA 3HE7B 4FQ1L 3MOBH 4WU5B 5IHZB 2FDBP 4BSVB 4PJGA 2K3TA 4UDTB 5LVEA 3RVXD 3BZDA 5F97E 1CE1H 5LGJA 5BJTA 3ZT7A 4NP4H 1RZJC 5D7LD 2XTJB 5IGXL 3OMZA 3X17A 4ZFFB 5C6TH 4TRPH 5F7DB 5BS0E 1H3WM 4JN1L 5BRZB 4JKMA 4P46C 4WGWB 4G7YH 3Q0HA 1JNNH 1Q9OA 5CJXA 1FAKT 3EJZD 3GRWL 2H3NA 1FAIH 3IDYC 2B4CC 4XVSL 4KY1L 2AK4D 3QUZD 1XF4B 5I8OH 4KFZC 2PF6A 3S9DB 4JPKH 4MQTB 3E0GA 4UV7L 4Y5VB 2FWOB 2CUHA 2GSIB 2W0FA 2AEWA 2A1WL 4LEOB 1P84J 1FLTX 1YY8A 3MREA 1HQRA 3O11A 3N0PB 1Z3GH 2WIIB 4BZ1L 5CP7A 5FO9B 1NEZG 3L3HA 1P4LA 5JXAL 1CD8A 1PX4A 1QUNA 3CGTA 1MI5A 3GGWA 1UACL 3IETB 2E7CA 1YDPB 2I9LB 3GNML 2V2XB 1A9BB 3TIEA 4FFWC 5I1GL 5FGCB 1SJEA 2HJLA 8FABB 4B7LA 1AGCA 1C8PA 5FYKD 1FL6A 1BFTA 1DBJL 2A6KA 5DDHA 3U0TA 5DSCA 1T7ZA 5C2UB 3RPKA 1XGPA 2EKJA 5B4MD 4QHKI 3RDTA 2CMRL 1RUQL 2R0KL 4MA3A 3WV0A 4MJIA 2GSGB 2FX7L 4WW2F 4OIBA 4ZFOL 3TO2B 4L3EA 1OW0C 1FL3A 5K33A 1MOEA 4PGZA 2YPKB 1HEZA 3A0OA 4FMKA 3JWDL 4NPYA 3SO5A 5TPWL 5AUMB 5IV2A 4PV9A 3VRJB 1S5HA 4H25B 5E08H 4P23C 2CK2A 2O5YL 2C4XA 2IPUK 3U0PB 4WDIA 1BJMA 5DA0B 1I3RA 1HH6A 3W0WA 5EO9B 1I1AA 3QH3B 2AQ2A 5E2TH 4G8GA 4XI5D 5FAAA 1BQHB 4G6KL 4KKNA 5HYIA 1LEKB 4PJBF 5HHXH 1I7ZA 1T1WA 2AJ3A 4NDMA 4RMSA 3S5LG 1IM9D 1OAYH 4BH8B 1A2YB 3H2WA 4LLWA 3NZHL 4ONOA 1MCWM 4YWGL 4LPWA 3C5ZB 3DVFA 3LS5L 3OKMA 1B0GA 3L95B 5CJBA 1DBKL 4KQ3L 5I19H 3ZL4L 5D6DA 4XP9L 3VXOB 3L1OH 4BUHA 3IYLW 1W72L 1WLHA 1JRHH 4ZUUB 2EDKA 3OKEB 1K8IA 2PW2A 1DDHA 4PPTA 2FYYB 3LSOB 4IDJH 3CU7A 1EAPA 1RFDH 4WW2B 4H26B 4UNVA 1ZV5A 4U1IA 4F8TA 2R2EB 1NGQL 2VDOL 3MJ9H 4MNQE 2DMCA 2BSRA 3D39A 3TA3B 1GHFH 1N5AB 4Z7VE 3JV0A 3O8XB 3UPRB 2H9GA 2O5ZL 3MO1A 2DL9A 5ITFB 2EYSB 1E27B 1DUZB 1RK0B 2X1OA 4DGYH 2VDLL 3I75A 4F33A 1G7LB 3GKWL 3HG1D 5I16B 3CH1B 1GGYA 3LQAC 4OKVB 4U1GC 3DYPA 4JQIL 1K3IA 5EN2B 1RJLA 4PJBB 4OZHB 43CAA 5FYLH 5C8JB 3OR7A 4PRBB 4X4YA 3QDMA 5EU4A 1KXQE 3V95A 4XXDA 5FUCE 1I4FB 4KI1A 1RV6X 3C8DA 2BRRL 2Z91B 3ARYA 3IDYB 3OF6A 4PGDA 2C26A 2IPTH 1J1XH 2HLAA 3O9WD 1ADQL 3FO9A 3QPQC 4KK9D 3PL6C 1QACA 1IFHH 2BRQA 4PLJC 3QUXC 3PWUB 5C0JB 1N5YH 3KPSB 4EXKA 3WHE0 4R2GC 4NYLA 2WBJD 3I85A 4XWOD 3ZE0E 1FFPB 1GVIA 1SY6L 1XZ0A 1CDCA 2RGSA 3O45A 4KGJA 2ZCKL 4GBXA 2VH5L 1PSKL 3EOAB 2CR6A 1D5ZB 5CCKL 4RX4A 1S9WA 2A9NL 3G6DL 3JV6A 3RNQB 4K2UL 4L4VE 3OJ2C 4OUUB 5CEZL 4OQ1A 3OXRB 3BWAA 3NIFE 2X4SB 5IVNA 3S36L 1QNZH 2FHBA 3RVWC 5I1EH 5HHMB 1YY9D 3TV3L 1JNHB 3LKSB 1IMHC 5EBWB 4KK6D 4L4JA 1CIDA 1AO7A 3CVHB 4EVNB 1IGMH 3HC0B 2AJZB 4TSBH 3EW3B 4MAYD 5BV7H 5CS7A 3U30C 4J12A 2PTTB 3IDXH 4QYOA 4UT6L 4MD4B 5T1MB 3VXRD 4Q6YA 1G9NL 4YHPA 2A74A 3MRHB 1DQJB 4NQDD 4IMKC 5T1DL 1FDLL 3U0WL 3ULVL 1U8JB 4J8RA 3VFTA 5IF0B 2CUIA 3FZUC 1FQ9C 3OKKB 1UXWB 1HZHL 3B9DA 1VCAA 2HTKD 3QIBC 4U6HA 5JTWA 2P8MB 3B9KD 4P5KB 5TF1H 1UZ8A 4BA8A 3BJ91 3FTGB 2EIZB 4P23B 3WS6C 4X7EC 1MCJA 4D8PB 4UUJA 3QXAA 3BIBX 2A6IB 4PJFF 4QKXB 1VGKB 1MREL 3HZMB 2PCPA 3Q6FB 3ARDA 1ZVSA 4AL8L 1GGIL 3U36A 4AMKL 2HTLD 4Y16D 1NGZA 1INEL 5A2LH 1CGYA 1NUNB 3G6AA 5IHUH 2XQBL 1QRNE 4PRHD 1FORH 1ZT1B 5ACZB 2ZCLH 5HHOA 1U3HA 5C3TA 4KTDL 2OTWB 3QUMH 3HC3H 1UA6H 1NBYA 4XCYA 4IJ3C 4K3JL 4X6CA 3W9DB 5IVXE 3UEZA 3CLFH 4POZD 1I1FA 2D7PA 3OHXB 3NCEB 5KVEH 5DJZA 2C1OB 4R7NA 2YXFA 5DJ8A 2JTDA 1TCRB 3IDJA 1QKZL 1OM3H 3HZKA 1RZFL 1CD0A 5JOFA 5L2KA 4RRPG 1A4JB 5EORL 4OM0L 1SQ2N 4MNGA 5L2JB 3FFCE 4G80A 2BCKB 3BPCB 5KTEL 1G9EA 3JWNC 4PJFB 3T2PA 4J6RL 4U1GB 1CU4L 1G7IB 5CZXC 3LRGA 5TE7L 2FEDC 2X9WA 4FQ1H 4P5TA 4NQCE 2UV3A 1QSVA 1FNSL 5L9DL 2QSCL 1TNMA 2MQ0A 3NCCB 1U8HB 3TM6A 1X5LA 3IDUA 3H9SB 1F11B 5JHDB 4AIZB 3M45A 4L8SC 3OKOB 3F7YB 4NT6B 3PL6B 4LASL 3TPUA 2P4AB 3QUXB 4YHZH 5IGXH 2P45B 3N50A 5H94B 2DKUA 5BMFL 1OP3H 4R2GB 4QOKA 2DQTL 3RHWF 4JN1H 4JRXD 3MRDA 2XFXA 4NWTL 3QXWA 2AV7B 3WMSA 3QQ4A 5F1NA 2O61B 3GRWH 4KY1H 5EA0H 5MEPA 4XP4H 3GI9L 3CFKB 2VXVH 3GMOA 5ITBH 1E4KC 2DIBA 3UTTE 1CXLA 2R2BA 2E27L 4G42B 4R4FL 3NTCH 4ORGB 1QVOA 4A2MA 3MXVH 1EERB 5JZ7C 2BOBB 2J8OA 5IB4A 2X4RB 1RIHL 2OLDA 3Q5TA 2DBLL 4R96B 3PF2A 3BKJL 2HFEA 1MLCB 3U30B 3P40A 3ZE2F 2DYPD 1EGJL 5CUSL 1EAJA 3GNMH 1CR9L 4PLOB 5IFJB 3SKNA 1X6NA 5DC9B 3FHAA 5I1GH 3TN0A 4XB8A 4NQSA 1U8OB 3SDCC 5IKCA 4MD5A 1OTTD 1OAXL 3FT2A 1AIFA 3ARRA 1DBJH 3QIBB 2CGRL 3QIWC 4WUUB 3FKUS 4HG4J 1GL4B 4JHBA 1SBBA 1HSBA 5EU3B 3MX0A 5DUMH 4U0QB 5CJ5A 3NVQA 5BVPL 1K4DB 1IAOA 4GMTL 5HI5C 2CMRH 1RUQH 1URLA 2IPKB 5BQ7A 2FX7H 2DKMA 4WEBL 5JW5A 1FYTA 3LV3A 1EO7A 2NY4D 3MRNB 4PJ8B 1WZLA 1PQZA 5L7XL 4I2XA 5D9SA 2YD4A 3JWDH 5IEKB 4QHLB 2ZUTA 5TPWH 4PJ5A 1WTGT 2ITDA 4OLXH 5E56A 3DSNA 3V6ZA 3M8OH 1KUMA 1JPFA 4WV1A 5IROC 4IRJC 5HYQA 3IXAB 2D7OA 3MV7A 3NIGF 4KKLC 4NRXA 4AT6B 3T2QA 1UJ3A 3SE8L 3QJHB 5FOJA 5C09D 1BWMA 1SEQL 4RNRA 2EKSA 3QHZH 5AD0B 1I8KB 4G6KH 5HYJA 2Q7YA 3MRIB 4IJ3B 4Y0GA 4QRPD 4JO2L 3F12A 5D1ZC 5DYOB 1IM3B 1RZGA 2B1AH 5FDWA 2HT3C 2ITCB 3NZHH 4YWGH 5FYKE 5FECB 4UBDD 3LS5H 4CN1A 3GSRB 2EDWA 5ISZB 3RIAF 4OZFB 1FC1A 3K81A 3HLAB 3ZL4H 1U2CA 2VXUH 4O02L 1P4IL 2V2WA 1W72H 4K3HA 1J0YA 1NJ9B 4FXKB 4WTZG 2X4UB 4X9FA 2AQ1A 3V6OC 3CU1A 1FNLA 1KIRB 4LP4A 2HJKB 1MFNA 5FYJE 1FZMA 3GSNL 4NFBA 3MV9D 1BFVL 2VDOH 4U6XB 3ZT6A 4JO1L 5K9KB 5IBUG 4BFEA 2YPLE 3CFEA 1QPXA 3KLSA 1UZ6E 5LCVL 1RAMA 3C8KA 4KUZH 2QSVA 1QLRB 5IFHH 5CAYB 2HG5A 2O5ZH 3VW3L 4JFYB 4DZBA 2H26A 2PO6C 2VDLH 4L8SB 3GKWH 2ESVD 3Q3GB 1MWAH 3W11C 4WFFD 4F7EA 2IQ9L 1RPQA 2VAAB 1FRGL 1MCLA 1YN7B 4D0DB 3KPMB 4K55A 2XN9B 5E2WL 4IOIA 1RZ7L 1QD0A 3LN9A 3SGJA 1SEBB 5EZLA 4PP1D 4KJQD 1YC7A 5JIKA 5CEYA 3FCTB 4XX1G 1CFQB 2BRRH 1FYHB 3RWFA 4O5LL 1UGNA 1YMMB 4G8FB 3MLSL 1ADQH 4TNVF 2EYTA 2ARJQ 3QFDA 4QRRA 4PGBB 3GMPA 4KUCD 4YUEH 4FQQA 4WHCA 3HI5L 3BYYA 4APQA 3U48A 3E6FA 1F3DH 4S0SD 1SY6H 3QWQB 2BVEA 4WU5A 4HCRA 3BZ4B 2VLRB 3QEHB 2ZCKH 4BSVA 2VH5H 3H42L 4C57C 3TBVB 5F1SA 3V52L 3L7FB 2A9NH 1C5DA 4I18A 3C6SB 1JGUL 1AR1D 2KZ1B 1T5XB 3RY4A 5CEZH 3SDCB 3HG1E 2HKHL 1R5WB 5D4QA 3MRPB 1TJIH 2R9HC 4LVOC 4ZFFA 3TV3H 2DLGA 5DI8B 4MA8L 3MYZA 3OQ3B 4K7PL 4WFHE 2V5MA 3QIWB 3D2UB 2Y07L 2BNRB 2CIKB 5D2LF 1D5BA 2B1HL 1JWSB 1Y6NR 4B41A 1XMWA 2JJTA 2KQNA 3OAUL 4UT6H 1J8KA 4UQ3B 4WI7A 4LOUC 2FWOA 1GYAA 5T1DH 2GSIA 1IGIL 1JYXA 5AG8A 2RHEA 3U0WH 3ULVH 3RJDA 1U95B 2WIIA 4KHXL 4B53A 5J3HD 5TFSH 1C5CL 1HZHH 4HHAB 2X1QA 1O7SA 4F7PB 3IVKB 2E6QA 5KSBF 1FFRA 2DN7A 5HJ3B 4D0BB 1TQBC 1VACA 4IRJB 3IETA 4M7KH 1U8KB 3PXHA 4PGCB 4OZGA 3JWDC 4QTIL 4ZYKB 1KEGL 3LEYL 4HUWB 1S9XA 5D1ZB 4Z9KB 3GSXB 4AL8H 4JZNB 1QQDB 4G8IA 1GGIH 2QQKL 4U7KA 5E9DD 3T3PF 4AMKH 1Q38A 4KRLB 1INEH 3QDGD 3EJJX 5F70A 1BPVA 1ROWA 5DZOA 2COQA 4HFUL 5GRVL 3KPLB 1ULVA 2WLZA 2OR8A 2V7NB 4KTDH 1DBAL 1YA5A 5D2LB 3TO2A 5I9QC 3VMOA 4NQDE 1PKQA 1A7NL 1UH3A 5C86A 1WCQA 3BSZL 3QFJE 3S96B 3QDJB 2ORBL 1T5WB 3BEWA 4QHKJ 3VXSA 1SBSH 3UZQA 3CUPB 4MS8C 3TEUA 3CK0L 2YKLL 1FVCB 4S1DC 1QKZH 5E2VH 1F02I 4PRID 1FO0B 5EO9A 1RZFH 4ETQB 3QH3A 3UPAA 4M1GL 5T3XD 4RBPK 2BY3A 3GMMB 1BQHA 1A7RL 3AM8A 5FO8A 2PO6B 3ZZ1A 2P5WE 2I24N 1BOGA 2HLFC 3BO8B 4NUJB 1RVFL 4BH8A 3IJSB 4BSJA 2WQRA 2R23B 3IFPA 4K7PY 4HJGA 4QO1A 3RBSA 1KN2L 2NW2A 3L95A 3MRGA 3AFLA 5IK3B 5DXWA 1E4XI 4GW5A 2H8PB 2JIXD 3SKMB 3DUSB 3T0EA 3VWKC 5L9DH 5HYSB 3AB0C 2QSCH 4XH2A 3GUTB 5GGRY 1SJXA 2VQ1B 1BQHG 2G75A 1LO5B 5DD1L 3OKEA 3HUJF 2FYYA 4PTTB 5E4EC 5KSUB 1FFOA 5BMFH 4WW2A 4HUMB 2IBZX 4POUB 2DQTH 2R2EA 1Y18B 2EXYD 2WWKT 4OCWL 1BX2B 1KB9J 3KPNB 1F42A 4NWTH 4MJ6B 2DQIH 1G6RB 1EEZB 4DN4L 1N5AA 2P8LB 3UPRA 4ZAKC 2EYSA 1E27A 1HXMA 3P9MB 4EXPX 3L3GB 4G5ZL 5C71A 2E27H 3CH1A 5D93C 4DVBA 1D9KC 2D0FA 2X40A 2BP3A 2WUCH 1OSPL 2Z4QB 2YUWA 4LVOB 1AKJD 1P7QB 3CFDB 4PJBA 4Y4KC 1QBLL 3O6FC 1V3LA 4PRBA 4P46A 2DAVA 4L4TB 1MAMH 2DBLH 1FZKB 2NXYC 5CEXB 3BKJH 1MFCH 4UI2A 2GUOB 3WFEL 1EGJH 4N68A 5CUSH 2DQEL 2FR4B 4LVEA 1H3GA 4GKSB 4ZNCD 4DKAA 1L7IL 3DUUB 5FGBC 3VG0H 2WV3A 3PWUA 4ENED 5C0JA 3KPSA 2NZIA 4UMGA 5C0AB 4AIOA 3HUJB 5KOMC 2CGRH 5H8DA 2ICWA 2Z93B 3G08A 1G9NC 4JRXE 4ZFOB 4MDJB 2EH7L 4M4RA 2V9RA 4KRMB 1K5NB 2QJDA 1KELL 3O2WL 4GMTH 3RNQA 4PD4J 1C16B 1YJDL 1LO3L 3EHBC 4OLZH 2GJZB 1Q94B 5K59F 3KDMB 1H8OA 3QCTL 3OXRA 1JNHA 1WWCA 3LKSA 4YX2L 4ALAH 5L7XH 5KSAA 1T66D 2EDOA 4Y4HA 3TIDA 3JTSB 3ESUF 3ARPA 5EZJB 4J3OC 1EUUA 4X7TA 3O2VH 4NO0D 2WSKA 4JHWL 2VXQL 3QZWB 3O3EB 1RMFH 4G3YH 2I60L 1LMKA 5TJWK 3SE8H 3MRHA 1DQJA 3SBWA 4WFEE 3F8UB 2NY3C 5I9QB 3ET9F 4HGMA 4QF1B 1U8JA 3MRRB 3VWJC 3U7WL 4YDJB 2YUVA 2EDDA 5C0CE 1UXWA 2XQYG 3R06B 4M7LH 1O0VA 4PBVC 4LLMB 2D7NA 3FTGA 5GZOC 2EIZA 1OAUH 5ALCL 4ERSL 4NQEA 4N0YH 3L9RB 1QSFB 1X5JA 3ILQD 4U1LB 4O02H 1JF1B 1VGKA 1S9VB 4NQUA 2XNAA 2E9BA 3OX8B 3MUJA 1EH9A 3Q6FA 3QISA 3ARUA 2JB6B 3LVEA 1VPOL 4CL7A 5E8PA 32C2A 4M6OL 5F89B 2QQNL 3VD4A 4KV5E 2QTEA 3GSNH 4DKEL 3B5GA 1Q72H 3QXDA 4N8VB 1JIBA 4Y5XC 5CILL 3RZWA 3RL1B 1LHZA 1GGUA 1XGRB 1FZJB 2GK0B 5JPNB 3VWKB 1SHMA 5LCVH 3AB0B 3BUTA 2A77L 4N9OB 4WFGD 3TBSB 2LTQC 3VW3H 1UKSA 4I13B 3W9DA 2BNQB 1MQ8A 2J88H 5E4EB 5ELIA 4QRPE 2D31B 3OHXA 3NABL 1FRGH 1WTLA 4L8BA 3KHOA 5CD5C 5E2WH 1WZKA 5EU5B 2JJWA 1RZ7H 5GGQL 4NOFA 4N0UA 1TCRA 1A7PL 3C5JA 5B39B 1PY9A 3ZKQD 5M7QA 2ZKHL 2H2PD 1A4JA 5GS1C 4O5LH 5TDOA 3C2SA 4FG6C 4Y1AE 5FKAA 5L2JA 2X2YA 4JY4B 1FZOB 1AHWC 2BCKA 5DQ9B 4MA7L 2IH3B 5D93B 5JIPA 1D9KB 2CRZA 5EOTA 4PJFA 3B5HA 3FO1A 1H3XA 1MFDL 4FTVD 3DVNB 1G7IA 2W9LA 4Y2DC 4Y4KB 3VA6A 4D9QE 2ZUWA 3QRFM 3O6FB 3MRCA 1U8LB 5DR5L 3MV9E 1JBJA 2NXYB 1JE6A 2J6EL 3H42H 2DTML 3AAZB 3V52H 3BIAX 5FGSA 4AIZA 3B9EA 4H0GA 4OTXL 5GS0C 5JPMB 3QUXA 4O2CA 1H3VA 5C08D 1MCRA 4MA8H 1SJVA 4WFFE 4GAYA 4K7PH 4W6YB 4FQ2H 5HI4D 2J8UB 1N4XL 5DT1L 4LHUD 5I17B 2AV7A 2FGWL 2WP3O 4NRYB 3IDMA 2ZJSH 4IS6A 4MXVE 5IESL 3DVGA 3OAUH 5DD0L 4FQXC 4Q7DA 2N7BA 1UQSB 4WI9A 5IVOA 1QRKA 1IGIH 2QADD 2ZOLA 3ROOB 4RWYL 1GGBL 2BOBA 3HRPA 4KHXH 4PJIA 4YDKL 3MRFA 4OSUH 1C5CH 1MUJB 2FECL 4OFVA 3W81A 1G7JA 5D7JC 4KTEL 3N06B 3VCLB 5LGHL 5GZND 5I75C 2ZG1A 1E4XL 3DYOA 3STLB 4I0CC 5MEND 3KPQB 1RJZB 4KK5D 4QTIH 2I26N 4N5ED 2NY3B 1U9KA 1KEGH 3FQWB 3MGAA 5DJ0A 4LF3B 5DMIL 3VWJB 5LXGL 3DSFH 2ZSWB 3NCJL 3GBNL 3PE9A 1KPUA 4AK1A 4U1MA 2HH0H 4NZUL 3TESA 3DJ9A 1BBJB 3H9HA 1IGTB 2IC2A 3GMQA 2XYCA 3WS6A 3MJ7B 4HFUH 5I1CL 3ARFB 1K4DA 3MV8B 2OJZL 4DOHE 1MHEB 4OGYL 2DWEB 5GHWL 3SDAC 4P2QB 1DBAH 3OKYA 3ULSB 1VERA 5C0IA 1A7NH 5JMRA 1U93B 3O8XD 2CO7B 4WWKA 5IEKA 4XGZB 1VHPA 3FT4A 3WHE1 3DRTA 15C8L 1A6AB 4Y5XB 4K8RH 3CDFA 4JY5H 5BZWA 2AXHA 2APWA 1P7HL 1KJ2L 2LV4A 3IXAA 2HFFB 1VEPA 3CK0H 4AT6A 4JFHD 4CJ1A 1R24B 4QEGA 3QJHA 4JM2D 5JXEC 4J3TA 2BSTB 4M1GH 3U82B 3HAEB 2LTQB 4LSVL 1EBAA 4TUKL 5DLML 4MYWB 5L0QC 4JPWH 4GAFB 5HDBE 3DMMD 1WITA 4OGXH 1IM3A 1JNLL 1RVFH 4K3GA 2ITCA 4ZSOA 5EH1A 5I2IA 3PWPB 2OK0L 1KN2H 5I1HL 5C0ND 3QDGE 4OZFA 1NCWL 4JFDB 4HS3B 1QR1B 5GSVA 3VXMB 2VR4A 4XBGB 3C60C 4LPTA 5ILTL 5EPMA 3SJVB 4AQ1B 3QWOB 5D1QA 5GS1B 4HBCL 2OL3L 3BKCL 4FXKA 2EDBA 2X4UA 3QI9D 1TZHB 3RNKB 4NRZB 1AHWB 3BEVB 3D85B 1YEHL 3MJ9A 1UWXK 2X1XR 3OB0K 5C6PB 1PLGL 4X9HA 1KB5L 4Y2DB 1FNGB 5JUEL 2FO4B 5DHXB 5GGUB 4OZFG 5HHMD 5JW4Q 1U58B 4DQOL 4DN4H 5J9PB 1MCBA 1T89C 4HKBB 2UUDK 3DO7A 4JFYA 2ZG2A 4G5ZH 1WCBA 1UEMA 3Q3GA 4QWWC 3K1KC 4ZXBA 2VAAA 1RULL 4RWHA 5JR1L 4D0DA 1RZKL 1OD9A 2XN9A 1NBVL 3MNWB 5HGBA 4F9LC 1QBLH 5CSGA 3ARGC 5E5RB 1OTUC 4M5ZL 2APVA 1JUFB 1CF8L 3ZHKA 1CLYL 3WFEH 2GT9A 3D3VA 4TOYL 4J7RA 4FQXB 2OP4H 1YMMA 2DQEH 1E4KA 1ZWIA 3H3PL 4KTYA 3IRPX 2QEJA 4PGBA 5TDNB 5FYJL 3T8XB 5EUOA 1G7MA 1DUYA 4UNUA 4NO3B 3LN5A 4E41D 3AY4C 1WWWX 5D7JB 1H0DA 2VLRA 2GJ6B 1NAML 4F37K 5I75B 3TBVA 1TMCB 3L7FA 5EU6D 3O2WH 1LO3H 2NLJB 2Z35B 1NCCL 1R3IH 1G1YA 2JCCE 1R5WA 4P9ML 1OGAB 4PR5B 5DI8A 2DI9A 2AK1L 4EQ3A 2NY1C 3U7AA 4YX2H 4X7CC 1C1EH 4WU7B 1BQUA 1JGLH 3QIWA 3GI8H 3D2UA 5SWSD 2ZOKB 2CIKA 3QRGL 4M48L 1GZQB 3LMJL 3F6LA 4HWNA 2EDQA 4JHWH 2C3VB 1HKLL 4HMDA 4NZTH 3TT3L 2OS7A 4X7FC 2I60H 4P48A 3BGMA 3MRKB 2I07B 4K9EC 3SDAB 3WCYA 1JN6B 2VLKD 1I85C 3BZFB 2ZNWA 4EI5D 2ZUVA 3QUYA 3I50L 4PJAA 1H15A 4U1SB 1U95A 4PTUB 4FQJH 1ZVYA 3WL9B 4HS6A 4TULH 2H45A 4F7PA 2WZPD 4FFVD 4Z78B 2IG2L 4MJ4A 3SDDC 1BIIB 4LPVA 3LPFA 5HJ3A 4D0BA 1QSEE 2P42B 4KKCD 5IROA 2YHGA 5ALCH 3BDYH 4PGCA 4DCQB 4ERSH 4G9FD 3KJ4C 3MLUL 3REVA 3K80A 1ZS8A 4HUWA 5D1ZA 9CGTA 5L0QB 1VPOH 4JZNA 4BQ6A 4UTAL 5EO0B 2BVUA 4OUOA 1MVUB 4M6OH 5EOQL 1RZIB 1LE5A 5JHDD 1N26A 5IMOB 5E4IA 2PTUA 1DEEB 4YH6A 2V17H 2VE6A 3JTTB 2FJGB 4XVUD 4Z0XB 5C0EB 3KPLA 3MA7A 1M71B 3C60B 2OZ4L 1YPZA 2A77H 3LY6A 2V7NA 4OLVL 1A3LL 5ESQB 5GRZA 3C2AH 1T2QL 3RI5F 1JHTB 3V6OA 2EC9T 5FM4A 3F5WB 3QDJA 1A02N 3NABH 1MJJA 4GRLD 1N8ZB 3W82A 1IRAY 1F45A 4Z7WA 3CUPA 3HFML 1NFIA 3QB7C 4WI5A 4N0CD 2X44D 4L8CA 1TDQA 1VGEL 1FVCA 4I5BA 3WLWC 4ETQA 4KJWD 2ZKHH 5KSBA 3V4VL 3U9PH 1OOAA 3TGXA 2WUBH 1S7RB 5K9QG 2PO6A 3OKLB 2X4TA 1HI6A 5FFLA 4C83B 1R3LA 4GUPA 5D5MF 4NKQB 3EO1B 1RUML 4LIQH 3M17A 5B8CA 3KYAA 3RTQC 3VXNA 1U36A 4TN9A 3D1MC 3BGFC 4G6AD 3ARGB 4FQLL 2XTJE 5DR5H 1HILB 3VXPB 3SKMA 2X1WL 1S9YB 2P5ED 4JKKA 2DTMH 4JCLA 2XWBB 1JJUA 3MLYH 2VQ1A 3FN9A 1VFUA 1N3NA 5BRZE 1LO5A 4WFGE 3FO2B 4OTXH 1J1OH 35C8L 4PTTA 1HYRC 4LHJB 5CMAB 5KSUA 1KJVA 4K7FB 5C07A 2QLVB 1RIUH 5FDYA 3RWIB 4NHCL 4Y5YA 3RGVD 3V8CA 4PJEE 1Y18A 3K3QA 4QHNB 1J8HA 1N4XH 4OFYD 3KPNA 5DT1H 5T1LD 2F54A 1G6RA 3EDJA 2P8LA 1NANI 4JRYA 5HYSG 5IESH 5DD0H 1JPGA 3P11L 3DROB 1GSMA 1I8IA 4WHTB 3I3EA 4ODWB 5IQ9A 4TSAL 2P47B 1WBZA 3VI3E 3LB6C 4KAQL 1ZGLB 1GGBH 1JZ8A 4JR9L 3P4OA 4Q6IC 2VDRL 2GFBB 4WI6A 2NY1B 4YDKH 1MCNA 1PAMA 4BSWB 4XHJD 3MJGX 1ZANL 3RWEA 1ZHLB 1FZKA 1YJDC 4KTEH 4NCC1 5B38B 5D5MB 4ZS6C 4GOSA 1INDL 2XICA 5E2JA 5DTFB 5HGDB 4TUOB 3STBA 1D6VL 1FVDB 1UFUA 4JQXC 4ETYA 1BVLB 4GKSA 1X5FA 3DECA 1P53A 3AS1A 1FFNA 2G9HA 3GK8H 5DMIH 4ZUVB 2ARJB 5J8OA 4LNRB 5FUCC 3NCJH 1I7RA 5C0AA 3GBNH 4ODHL 3HUJA 4NZUH 2GJJA 1M7IA 4RDQF 3VFSA 2W65A 3VRLF 3SDDB 3CDCA 5DF0A 4ZFOA 2VL5B 1RZ8B 4D9LL 1U92B 2Q3AA 1XAUA 3BP4A 5I1CH 5IW6A 2OJZH 2EDTA 3KJ4B 4OGYH 1LNUB 3EOTH 1Q94A 3KDMA 1YC8A 4PRPD 3CH8A 3ZTJH 1I7TA 3MNVB 2VAJA 1LO4H 4JFEB 2ZSVA 2D9QB 1HE7A 3ECBB 2VOTA 3JTSA 1NSNL 1FGNL 4JVPA 15C8H 1TVBB 1FE8L 4HKJB 3BD3A 3OAYK 5F6HI 1OTSC 5DWUL 5C0RL 5EZOL 3QZWA 1DANU 3O3EA 4NKIL 3NPZB 4Q74A 5CSZA 1JWMB 5IVZA 5KVGH 1UM4L 4L3ED 4M5YL 5BW7A 3S6CA 2AS5M 4F15C 2NR6D 3ARXA 4QF1A 4TUKH 5DLMH 1H5BC 2MPAL 4BQBA 3MRRA 4DZ8B 4HIIA 4LCWA 5F9WC 1K4CB 1LEIB 2EEAA 4GKOA 1CXFA 1WUNT 1JZ6A 3R06A 5I18L 2X9YA 5C92A 1P1ZA 3LKNA 3DI3B 1W72A 2BHZA 3V7AG 2G60L 5JNYB 3BOVA 4U6TA 1QA9A 1NMBL 1XGYL 3W0WD 1NCWH 5HXMA 2C1PB 3D69A 3QZWG 4RAUB 1QSFA 4OCNC 4OQTL 4DWHA 1S9VA 4B50A 3OAZK 1SM3L 4HBCH 2OL3H 4IIQC 3ROLA 3KYNB 2R1WB 3HNVL 4NKOA 4AG4L 1YEHH 5F89A 4OF8A 4HKXB 2V7HA 3ISWA 1PLGH 3RAJL 1X4XA 1ACZA 2EO9A 4N8VA 3HS0A 3RTQB 1KB5H 1BJ8A 3BGFB 3RL1A 3S3SA 5DFVC 1A4KB 2M8XA 4DQOH 2GK0A 5JPNA 5DQJB 1ITBB 3S4SB 3TBSA 3PWLB 1IVLA 4JFHE 4MJ5B 4OZHE 4Z7QE 3NA9L 4YR6B 3WJJC 1UYWH 2Y6SC 5IJKC 1V7NL 4E5XA 4LLUB 2BNQA 4F7TA 4OI9A 1I8MB 2CLVB 5J1AB 2AJSL 4H20L 4PG9A 1E4WH 4ZUTB 2C4FT 4N8VG 1RZKH 2AJYL 2A38A 3EDDA 5EU5A 2EE9A 1NGXA 3I6KA 3O6ML 4CVZB 3W5NA 1VKXA 1ADQA 2DBJA 3T2NL 3ZE0F 4JRWA 5B39A 3NAAL 1BM3L 4KC3B 4M5ZH 4ZAKA 3DX6B 3C5SB 4TOYH 3D18B 1A6VH 3H3PH 4JY4A 1IAIL 1SY6A 2IJ0C 1F4HA 2IH3A 4MNQB 1D9KA 4NC0B 3V6BR 5FYJH 3HPJB 4Q6IB 3NIFF 3QDMD 4Y4KA 1MRDL 1S78D 1IAIM 3O6FA 2XG4A 2UYLA 3NH7L 2HMID 4EIZC 1NAMH 5CLTA 1V3JA 5B39G 3RVTC 2Y36L 3AAZA 5HHME 2GY5A 1E28A 4Z7OF 3JV4A 2XG5A 5AYQA 3FONB 1JMZA 1VDGA 3P0VL 2CUMA 1TVDA 4UIMA 3OGOE 1KPVB 1Z2KA 4P4KD 4Z5RA 4P9MH 3MLWL 1KNOA 2FEEI 5L8JB 3BQUC 4D2NA 4KKAC 4RX4D 3KVQA 1U2HA 3D9AL 1C12A 3LMJH 2C3WA 1NLDL 1HKLH 3WDIA 5E7BA 4GW4B 1MVFA 5EFIA 2A9ML 2EIEA 5HGHA 2NXZC 4AY0A 5F9JB 2MCPL 3I50H 2H2SD 5JW3L 3ROOA 2R8SL 1S5IH 1AO7D 4CVUA 3RVVC 2JB5L 1WVZA 2IALA 4KH2A 3JBG7 3PHSA 1YNTB 3DRQB 5IQ7L 4E41E 3GO1H 4FNLL 1QBAA 1A1OA 3RGHA 2D0GA 2H6PB 2CRIA 3GMLA 1RUAH 3MYJB 1JPST 5E94A 3VGAC 1I8LC 4KPHH 3IAGC 4F15B 5DHVB 1ZOXA 3LKPB 4MJ2A 2CH8A 1H5BB 4LF3A 1HDMA 5JIHA 1BECA 5INCA 1S7QB 4UTAH 5F9WB 1A21A 3UTPD 5EOQH 3DTXB 4YJZL 5IVXF 3RVXC 3TLRA 4PRAA 1BBJA 1IGTA 2YD8A 4PUBL 3SGEI 1I1CA 1JZ3A 3WHXB 1R3HB 4C56B 5EIIB 1CD9B 3TPKA 4FA8A 4U6YB 4RCAA 2OZ4H 3ZYOA 3P0YL 1XIWD 4R97C 4P2QA 1A3LH 1QFOA 4IIQB 3ULSA 1D5XB 4R90L 2J12B 1XF5B 1U93A 5CP3H 2Y06L 2CKBB 1CL7I 4D3CL 4NNXB 3EJZC 4XGZA 3VFGL 2A73B 3QUZC 1A6AA 4Y5XA 2VLME 4KJPD 4ZOCA 4PJDF 1RSFA 3FB7A 2HFFA 4L3AA 1IEAB 1R24A 3PXJA 4KJYB 2FATL 5DJDA 1U3ZA 4XNQB 4PJXE 2VWEE 4MQ7A 5HPMA 4WENB 4Z8FL 4PY8I 3Q48A 5KW9L 4PP2B 4ACPA 1I1YA 2R29L 3K8KA 3PWPA 3H9SE 5HHPB 5JHDE 4HKZB 1VFBA 3PG2A 2OQJA 1CDJA 4FQLH 2XZCL 1QR1A 3I2CL 1JGDB 4JLRB 5IVXB 1MAKA 1J05A 4UILL 2W07A 2QR0B 3R1GL 4JKLA 3SJVA 3NFSL 3HAEG 1LWRA 5ACMA 4RAVB 5SWZA 4AH2B 1CCZA 2AV1B 3RIFF 5IFAL 3RNKA 4NRZA 35C8H 3EOYG 1CS6A 1TJGL 3TH2T 4ODTL 2AERT 5B4MC 5D6CB 4JFPA 1KULA 1KGCE 2PW1B 3QPXL 3HE6A 1T04B 5GGUA 1JGEA 1U58A 3RWHA 1HHIB 1LP9E 5CJQL 1ZHKA 2YD9A 5J13C 3U4EB 4LLAA 4HKBA 5D7IF 4I3GA 1UB5B 1L6XA 3P11H 4PJDB 4YXHL 4TSAH 4AENB 3MZGB 4KAQH 3WEXB 3EYVA 4JR9H 2EH8H 1EGJA 3TZVD 1QBML 2MOVA 1IGFH 3ZKMD 3DV4B 1SVCP 3BQUB 1XCTA 3JWOL 4XI5C 1ONQB 4HS8L 3EBAA 4OCYL 1INDH 4W6WB 2Z8WC 4ZDHB 2P5EE 1D6VH 1F3RB 2K9UA 5T3ZD 2J2ZA 2NXZB 1X5HA 1EEYB 1TVHB 4WUUE 4QXWA 2AW2A 3IFNH 5TDNA 1QO3A 2DJUA 1CGSL 4XCFH 4KXZH 2EC8A 3E6HB 4YIQB 4ODHH 2F74B 5I1JH 3MUZ1 2ZWLT 5EIQA 5CBEB 4PRDB 3MRBB 3UTTB 2AVGA 3U6RB 2GJ6A 4MHHG 5DFWH 1EJOL 4Z77B 1FHGA 1LK3L 4XBEL 3V6FA 5JIIA 1T21B 4TVPD 3VGAB 3VG9C 3TN0D 4MMZC 1OARL 2NLJA 2ZUSA 4XMPL 4HFWB 1U8PA 3S34L 4N1HB 4BK5A 5D7IB 1N6VA 4JEGB 3V7MA 1KJ2B 3CX5K 2UZIL 3HRZA 4JO4L 4YHKH 4X6FB 1J0IA 3SEPA 4OF5A 4QTHA 4WU7A 4RZCB 5E99L 1NSNH 5F72S 1FGNH 1CICA 2DLEA 4JFZL 4NIKB 2D7QA 4S1SL 1FE8H 4MD0A 1CQYA 1GZQA 5D7LB 4J3VA 1L9NA 2C3VA 5C0RH 2G5RA 2NZ9D 3K1DA 3JUZA 3EYOB 1A6UH 4JFQB 1GAFL 1T2XA 2MHAB 1UM4H 4M5YH 3MRKA 1LDPL 2I07A 4YPGB 3SDAA 4R97B 5HHQA 1JN6A 1IKNC 4I3RH 3BZFA 3ULUD 5ISZE 5IOPB 3BRGC 1BEYL 4MQSB 5DC4B 3WL9A 2ADJB 2PR4L 3MRJB 5I18H 2VDMH 3NCYP 4YDVB 2AK4B 3QUZB 1MCFA 2G60H 1BIIA 2CLRB 3STZA 3I6LD 5CKGA 3MV7D 1NMBH 3O9WC 2HRPH 4KK9C 4DCQA 3WFHB 4I3SL 4OQTH 5HYJD 4NUGL 4RA0C 2FIKB 3GSNA 4LCYB 1SM3H 1IAKB 2WBJC 3V0WL 1T22B 4XWOC 4RFEB 3ZYJA 4U6VL 3HNVH 4V1DA 3BVNB 4MVBD 4PRPE 3U4AA 1R6VA 3BMWA 4HW6A 4MXWL 5IMOA 3EGSB 1AXTL 4P9HC 3CFBA 4MSWB 2LAAA 1DEEA 1JTOA 1YNKH 4KROD 3JTTA 1MSPA 4YHNB 1ZTXL 1BOYA 2GHWB 1F6FB 2H1PL 2XWJB 3C60A 1BD2A 1M1SA 2R1XB 4X6BB 1YY9C 4X99A 1F6AA 2C7UB 3Q5OA 2Y25A 3O4OC 4KK6C 3RWDB 1WEJL 1DQQB 3P4LA 2X4QB 2EYRB 1RJCA 3PV6B 4MAYC 4YHOH 2AJSH 4H20H 1N8ZA 4GSDH 4GW1B 4RIRB 2AJYH 5ICZB 2X4PB 4NO2B 1JHLH 1WJ3A 3HZVA 3O6MH 2XWTA 4CU8A 3T2NH 3NAAH 1BM3H 4FABH 1A8JH 5J13B 1T89A 2MMXA 5HVHB 2IEPA 3NIDE 2HTKC 3OKLA 5T1KA 1IAIH 4JY6B 3VMNA 5LWYL 4C83A 1XGUA 4D0CB 3B9KC 1A1NB 4Z7UF 5DZNA 5DJAA 4DUWA 1MCQA 1MRDH 1MPAL 5JA8B 3ARGA 1HILA 3VXPA 3NH7H 4HPOL 2HKFL 2BZDA 2BMKB 1MCPL 4Q0XL 4ZO9A 5LBSH 1LE9A 4A6YL 1TFHA 2E7MA 1IM9B 2XWBA 5DQDL 3U46B 4QRRD 2HTLC 4Y16C 3P0VH 5MP6L 2BNRE 3ARFD 4K7FA 3RWIA 4APQD 1W0VA 4O2EB 3NZ8B 2Z0BA 4FQPA 1CL7L 1TTGA 4BQCA 4ELMF 3MLWH 1ZLUH 4ZOEA 3FB5A 3UTSA 1DLHB 4K94H 3WLBB 4X83A 3VFPA 3D9AH 3BPLC 2MKWA 1A7OH 3O3BA 4POZC 2OXHA 3D0LA 3DROA 3VG9B 2BFVL 2A9MH 3NPSC 4ODWA 3WIHA 2ID5A 3BW9A 2HJFB 2MCPH 5A2FA 5JW3H 1WGOA 2R8SH 3AU1A 2PNDA 4JFXB 4RA3A 2JB5H 5C0GA 3GIVB 3DLQR 1ZHLA 1XT5A 5IQ7H 5B38A 1EPFA 4Z7UB 2X09A 4FNLH 4O58L 3HG1B 4TUOA 2XKNB 1J1PL 5F3BB 1FVDA 3KXFD 5HDQH 5BS0A 4L9LC 4JFDD 1KJ3L 1I85A 1AXIB 4S11A 1KIQB 3VXMD 5H37G 3C9NB 3ME0A 5IM7B 2ARJA 2GTZB 1S3KL 4LNRA 4WI4A 1N7MH 1MCKA 1NDGA 4ODSL 4P3DA 3INUL 5D2LE 4PUBH 5B38G 1HOCA 2M1KA 3SDDA 1A6ZA 4ZS7H 3CXHK 1U92A 3S35H 4QY8A 4PB9H 3TO4A 4LDLB 4ELMB 5DJ6A 3X3FL 2LVEA 4N1EA 1NANH 4V2CB 4R7DB 1LNUA 1JF5A 2WBJB 3IJYB 1T20A 3S7GA 1A14H 3MNVA 3OXSA 1FV1B 3SDXF 2Y06H 4D3CH 3TVMD 2VZTA 3VFGH 1AGEB 3LEVH 4F3FA 4CUCA 1MIML 4HKJA 4G9DB 1ZGLP 1AQDA 5HPOA 3X14A 4JDVA 1A3QA 3I9GL 1CVSC 1JWMA 1FNFA 1HIML 3GMRB 4NNPL 4OJFH 2Z8SA 1N0XH 2FATH 3O4OB 3T0AA 3VD3A 4MCYB 4DZ8A 3LRSB 3PGCB 2WLYA 5MERB 3RY6C 5C0DB 4PREB 5F6HJ 3KR3H 1T1ZA 4EUPB 4EDXA 3VXSD 4MAYB 3LD8C 3UTPE 2R29H 3W39B 1VENA 4OGZA 5JNYA 4JCMA 1K85A 3VXRB 3ZLQC 4NQDB 4U1HB 1FGVH 2XZCH 4BZ2H 3I2CH 4NFDA 4LEXH 4UILH 1OTTC 3R1GH 4YHML 2ZZUT 3NFSH 4M43H 3U7YL 4GG8B 3M07A 1BFOB 5IFAH 3VA2C 1P6FA 1LEGA 3B9KB 5F7FA 1TJGH 4HKXA 1ETZB 1DLFH 4JQVC 4F58L 2DWDB 4ODTH 3RTQA 2W0LA 1QHOA 4HDIB 1I9IH 2CK0L 3T0ED 2KBGA 3SDXB 1A4KA 1CLOL 5C1MB 4MMXC 1Q0YH 5DQJA 5CJQH 2NY4C 3FMGL 3S4SA 4P2OD 5JW4N 2R1YB 4RDQG 4KKBD 3PWLA 1LQSR 4MJ5A 1NFDF 3KNBA 4YR6A 1BWWA 3W5MA 1QYGL 4Y16B 4L4TE 2R69H 4ZPVA 3D5OF 3SOBL 5JDSB 1ZA6A 3GJFK 3F58L 2V2TB 2CDFA 5JW4R 1D6EA 4AEFA 4PRHB 1QBMH 2AEPL 4ZO7A 3DX7A 4L29B 1MFBH 4QRTB 4JVUA 4HS8H 3KPPB 1MAJA 3EDKA 3S4SG 3BPLB 3C5SA 1WZMA 3DX6A 3FOMB 1G0DA 1EZVY 4Y4FD 1U8QB 3HI6L 4Z6AT 3NPSB 4YLQT 4UBDC 4GG6E 3MUGA 3SQOL 4MNQA 1HHGA 4HC1L 4PBWD 4IRZL 3HPJA 2X10A 4Z7VA 4P46D 4G8EA 4TPRL 3QHTC 3TFKD 5FCSH 5GS3A 4TQEL 2DI7A 4NO5B 5DRWB 4KGLA 4I9WD 1LILA 4EDWH 5D2NE 2NNAA 3OJMB 4NN5C 5E2UL 2NW3A 4XBEH 3RWJB 4HH9A 4U2YA 4JQXA 4CVXB 5IB5B 4L9LB 1OARH 5IEHB 3MROA 4XMPH 2J4WL 3S34H 3ZTNL 2B4CL 4E0RB 1NFDB 2UZIH 4JO4H 4YGVA 1UH2A 2DLFL 4R8WL 5E99H 4PB0L 4X0KB 4XVTL 1EJ6A 1G9MC 4LKCB 5DURD 1HXYA 3WD5L 5DFTA 1N2RB 1RUPL 2Y1VA 4GW4A 4BFIA 5I0DA 5C0BD 3L5XH 3S88H 2J8HA 3PDOB 2XPGB 1T4KA 3BP7B 5T3ZE 5KSAD 4JRXB 1HYSD 1RHHB 1BEYH 4Y4HD 1BBDL 5F71A 4PLKD 2QSTA 3FT3B 1OAZL 2PR4H 2W0KA 1BREA 4PP1C 4KJQC 1YNTA 3DRQA 5F21B 3UJTL 2BJML 4L4VA 2ZP0T 3DVIA 4XPHL 3H8NA 4O2FB 4DFHA 3NACH 6FABL 4J23A 3MYJA 5ACLA 2CDEA 2ZUXA 3CVHL 5FOBA 5K59E 3FQTB 2UY7A 4TVPE 3V0WH 1H5BA 1NCTA 4P2YA 3EJYD 4U6VH 4GKZB 4HWZA 1NC2D 4ODUA 4XCNA 2DD8L 1S7VB 3LD8B 1OPGH 1OY3B 2DYPB 1PZ5B 1EA9C 4JDZB 2YA2A 1AR1C 1ZTXH 3ARQA 5ESAB 2H1PH 4LSUH 1DCLA 3QCUL 4HF5L 2P46B 4IIQA 5JLZB 4LDEB 1D5XA 1WEJH 1XF5A 4RGOL 5DZLA 3S35X 3X13A 3ULUE 3H0TA 1ZLWH 4X8XA 3AMKA 4NNXA 2B0SL 3UYRL 3GIZL 3CXDL 2A73A 2FGZA 3P2TA 3MMEB 3TH4T 2QKIA 1FG2B 4JG0L 5MEQB 1VEOA 2AQ3A 3I6LE 5CIPB 4KJYA 2NY4B 3QUKA 3IGAA 3FRUB 3ETBF 5J3HC 3WNPA 3WJJA 4XNQA 3ZDYF 5IJKA 5LWYH 4QXTB 2RJMA 5FB8A 2E8ZA 1QRNA 2J6EA 3IKCB 3EAKA 3KJ6L 1YUHB 2NCMA 5IHBA 1NKOA 1MPAH 5C09B 5D8JL 3QNXB 1JGDA 3CFIC 5SX5H 4HPOH 5HYEA 5EO1A 5IVXA 1MCPH 4Q0XH 4PY8J 2DQUL 4QRPB 5I1LB 1P2CB 1Y0LB 2VN7A 4A6YH 2YRZA 1YEIL 1IC5H 5EB9A 4RAVA 1PX3A 2J8UE 4MXVF 5HHNA 3RWGB 3B8SA 1A5FL 1JCKA 2F8VA 4AH2A 1F4XL 1XR8B 5GSRB 5MP6H 3JWOC 3T0VA 3MCKB 5EULV 2VLJD 1CL7H 2EXWD 1OSZA 4KUCF 2PW1A 1T04A 2UZXB 1WISA 3FFCA 3T65B 1HHIA 2QQLL 3ARVA 4MAUL 1ZT7B 1JYWA 4NN5B 3J7HA 1UB5A 43C9B 5F1IB 3MJ8A 1JVKA 1OVZA 2X4OA 4XPGL 5ADOL 1Q9LA 2BFVH 4HCRH 3MV9B 2JJSC 4NQCA 4CRPA 1SMAA 3ZO0A 4WJ5B 3L5WA 1KV3A 2R39A 3QQ3A 2RCSL 4XPAL 4P2RD 4LCIL 1NFKA 1UM6H 4O58H 4KDTC 1I9JH 4X4XB 2A83B 2GY7B 1J9CT 1J1PH 2ESVB 3VRIB 4IMLA 5I76A 3VDAA 4ODVH 1EEYA 2NYYD 1KJ3H 3AROA 2BSED 1QR4A 1YEDB 4M7JL 5K9QI 3MV8E 2F74A 4ODSH 5CBEA 2Y4SA 3UTTA 3WJLC 3INUH 3PHQB 1OAQL 1MCCA 2BVPA 4Z18A 2IF7A 1NUGA 1Q9WB 3FB8B 5ICYA 1I8LA 4UNTA 2R4SH 4PV8B 3X3FH 1QTYT 1R3KA 1ZT4B 3GEWB 4HFWA 2EXYC 1DE4B 5F1OB 3BD5A 4HX1A 1AD9B 1KJ2A 5IIEB 4X6FA 5HDBF 1N0LA 4RZCA 5FUOL 5HD8D 3MR9A 1BJ1H 3O4LD 4GH7B 1MIMH 4LARL 3RP1A 1KIUA 5HVGB 5ID1A 2R0LL 3EZJB 1TTUA 5HDOA 2Q20A 1G0XA 5BXFB 3EDFA 1G7HA 2P24B 4DKDC 1H3UA 4YPGA 5KG9B 3KXFE 4NNPH 1INQB 5IOPA 4PY7B 4CBPA 2AJVL 1KYOK 4JFDE 4WWKD 5FKPA 5FEBA 3VXME 1IL1A 2ADJA 3MRJA 1CFSB 5KANG 3ARTA 4DOHB 3I02B 1ZLVH 4DGVL 1HHKB 1HHHB 2OL3A 2DM2A 3MZTA 2IPUG 5TQ0H 4ENEC 3IDGB 1KTLB 2FIKA 4YHMH 3UBXB 1IAKA 2D2OA 5E5UB 4UDUB 5CJOH 1T22A 3U7YH 4K07A 3CSYB 4L5FL 4U3HA 4Q9QL 1VFAB 4F58H 4OKDA 4O51B 1KCSL 2MQ3A 5T5FL 3G5YB 5IP4A 4IDLA 2CJUL 2CK0H 1TLKA 4YHNA 1NQBA 3GSVB 2XWJA 3OB0H 4JGJA 4P59H 5D1QD 2R1XA 4X6BA 1Z9OA 1QFHA 2R2HB 5E9DB 3VFRB 4YNYB 1T66C 3WUWB 1DQQA 1QYGH 3F65A 3QDGB 2EYRA 3R0NA 3PV6A 3SOBH 2FSEB 3F58H 2AABL 4FZEL 3FFDB 4GW1A 4RIRA 2AEPH 4Q2ZB 3VGGA 2HFTA 4NO2A 2ADIB 3SCMA 5BCAA 4XNMB 1X7QB 3SO3B 4S1QL 3BDBA 3F7RA 3K2UH 1B6UA 1P84K 4UT7L 5FYLD 1V7ML 1J10A 2AI0L 4HSQA 2VZVA 2A6JB 3VGFA 3P4MB 4ZXBD 5B21A 3HZYB 2YPLA 3SQOH 3MGTB 1NAMA 4HC1H 2X4NA 3C87A 4TPRH 2XZQL 4TQEH 4PRIB 1UB6A 1S7SB 3ILQC 4MB4A 1BIHA 1RK1A 4PS4H 3FB6A 1NC4A 1IAMA 1PG7W 3BWUC 2JLLA 2BMKA 3D3VD 4F57L 1FPTL 3CFJB 1OGAE 3VXTA 1IGJA 3U46A 1V5JA 3FOLB 3BI9X 1JL8A 1UCTA 2DMBA 3PDDA 4UU9B 4CU7A 4J3XA 3KS0J 3ZTNH 2R0ZL 4O2EA 1BFSA 2B4CH 3NZ8A 5TGBB 5A3ID 3L3KB 2JIXB 3OKDB 1X4YA 5A40E 1HCVA 3CZFB 4OLUL 4PB0H 3DV6B 4ISVA 2V5YA 3KHQA 3BT2L 3QEQD 3OJDB 4XVTH 5F1KC 3RRQA 5IR1A 2YEZB 3T1WA 3WLBA 3G04B 4WI8A 2IMMA 3WD5H 1RIVH 3V4UL 5I1DB 1RUPH 2BDNL 3NFNB 1IQWH 4NKDB 3O3DA 3B83A 5IBTL 5AAWA 3DI2B 3VD7A 2G5BA 1U8MA 5IMMB 1MF2L 4JDTL 1BBDH 1OAZH 3IF1A 2H2PC 2E6PA 1XCQB 2BJMH 4LSDA 1OLZA 2YA1A 3V5DB 4XPHH 1TITA 5IG7A 3HG1A 2XKNA 2O93L 3TCLB 3CVHH 2C9AA 4P3WA 3QUYD 4P57A 5TE4H 3WE6A 1CFTA 1IKNA 1AKJB 1LGVA 4QNPF 4YEFA 4NGHL 5HY9B 5IM7A 2GTZA 4HULB 4URTB 1QOKA 3X11A 4XC1L 3HCVB 3T0WA 5DRNB 2OZ4A 1UVQB 3MLZL 3IT8D 3TBTB 1N6QL 5EBMA 3O9WA 1F90L 5CP3A 2K7QA 1R5IB 2NX5D 1CYGA 3IJYA 1G84A 5C0BE 1CDUA 5HI4C 3UYPA 1SJHB 2F19H 4RGOH 5GISL 4CADB 1S7XB 5FA4B 1B0RB 5D70L 5ANMB 2B0SH 3GIZH 3CXDH 1AGEA 3IFLL 1EZVX 2X89D 5AZ2L 4ZPTA 2E7BA 4G9DA 1BLNB 4HJ0D 4X4ME 4TVSa 4JG0H 2L7JA 3HNSH 4NM8L 3S37X 3VFOB 1OL0A 2R0WL 2QADC 1DQLL 3G5ZB 3HR6A 3KPRD 2OJEA 1S7UB 3RPIB 4PREA 3Q1SH 3ABZA 4EUPA 1G7QA 4JPIA 3ZKND 4OV5B 5GS2H 1FIEA 4LGRB 4MAYA 2HVKA 5GZNC 1U8NB 2LU7A 5I0ZA 1DBML 1OGTB 5I8KH 1PY4A 4PJEF 4HIEB 4NQDA 4KK5C 5D8JH 4N5EC 4ZODA 3QO0B 1EMTH 3QFJA 5DUBA 2DQUH 4LSTH 5ESVB 1RJYA 1YEIH 5DD6A 5INDB 2AGJL 3DBXB 1A5FH 1CTNA 1BFOA 4RGND 1R5VB 4UIKL 3PGDA 3UDWC 4LSSL 1BZ9B 3QULB 5CKAA 2FB4L 3ARBD 1FO0L 2Y5TB 2DQDL 4EUPG 1ETZA 4XMLL 4OZIF 2RR3A 3VI3F 3BFOA 3MFFA 4OD1L 2VDKL 4HDIA 4C4KO 4HUUA 2HN7A 3DX9B 2P5WA 5GJSH 2QQLH 3E8UL 2X6MA 3LQAH 4MAUH 3TA3C 5TF0A 3PABB 2Q76A 1QEWB 2R1YA 4HUXB 3O8XC 1S9KC 4QXUL 2D4DA 4XBPB 2R56L 4XPGH 5ADOH 5C07D 1BAFH 5D5ME 5JDSA 4XNUL 2V2TA 3HKFA 1J8HD 2DKSA 4U1NA 2OXGA 1T7VA 4ELKA 4Y19B 3TBYA 1NEZA 4JM2C 1ZHNA 1K9TA 4L29A 2RCSH 4PYGA 4XPAH 4JRYD 3DGCR 2Q6WA 3IXTB 3BIKA 3KPPA 3FQRA 3DMMC 2JKXA 1IC7H 3FOMA 3MRQB 2PYED 4PJEB 1U8QA 1GC1L 1IZJA 1G6RL 2NY7L 2R9HD 3MBED 2FL5B 3PP3H 2YOCA 3QQ9D 4GXVL 5C0NC 1KN4L 5SWQA 2LU4A 5IMLA 4R0LC 5DRWA 2VLJE 5CGMA 4G6FD 1HN1A 2M2DA 5TE6H 1IGYA 2B8OT 4OZIB 1FCCA 3QI9C 3C6LD 4JFEE 3H6JA 4ONGL 3RWJA 3ARWA 4MDIA 4H0HB 2W60B 1EO5A 4Y8AA 3MJ6A 1KF9B 5IB5A 4L9LA 4FTVB 3AS2A 1SYSB 1MNUL 1LVEA 3T04D 4UOW0 3L7EB 2JF1A 4M3KB 5DK2B 2GIYA 1NLBL 3ARED 1IC4L 2JK5B 4W68A 1YMHA 5FUOH 4OBRA 3LIZL 1HQ4B 1VEMA 4P2RE 5E1AB 1N2RA 3L3OB 1JV5B 3UCRA 2ILLA 4KVNL 5C08B 1NUFA 3RJQB 3A6BL 4GLRI 5ID0B 3PDOA 2XPGA 3BP7A 5HDLA 2AJVH 1WC7A 4JRXA 1LD9A 3O6KL 4LHUB 5C9JA 1IT9L 1DQML 4CNIB 3S5LA 4J3UA 1OP9A 3K4DA 1OP3K 4XZUB 3VRLE 5GJTL 4OQTA 5CD3B 1XEDA 5ETUB 3M1BB 3VXQB 1CGUA 1WT5A 2DQCL 2VZ3A 3EO0B 2B2XH 2QADB 5FK9B 3G9AB 3TBWA 4I48B 1AFVL 1S8DB 5HYFA 4LCWD 5E8OA 4N0FB 1T83C 4HZAA 1A47A 4OZHF 3RY6A 4U1KA 4JM2F 4Z7QF 1UC6A 4L8DB 4Q9QH 4F37F 1S7VA 3V5KA 3L3DA 4MLIA 4Z7NE 5HTSA 1KCSH 1PZ5A 1XH3A 4JDZA 3SQBA 5ENWB 1I3VA 2IFFL 4W70A 3O4LE 2CJUH 5MENB 4XP1L 3QO1B 4L1DA 3CX2A 3BX7C 3UTOA 5C0CA 2WK2A 4M03A 1FL5B 4MHHI 3PJSB 5BVJB 5T3ZL 4FN0A 1Z5LB 4OZFH 1T1XA 5DRZB 5CJ8A 3WS3B 2LABA 1I7UA 4GMSL 3MMEA 4LNVA 4IM8A 1FG2A 1DJSA 5MEQA 4M7LT 3FN0L 5J6GB 4LRIC 4NHUA 4EI5C 3R8BB 4S1QH 5F9AC 3ILPA 4TVPL 1IKFL 2AI0H 5DJXA 1HWGB 1V8HA 2VMFA 4FFVC 4OFIA 4RMWA 5LQBL 4KKCC 3C08L 2AEIT 1YUHA 4PJ9D 2XZQH 4JM2B 3OJVC 1CLZH 2VWEC 5F96H 5DS8A 4CW1B 4F57H 4R4BB 4QRPA 1HHJB 3DMMB 5I1LA 1FPTH 3RWGA 1T0MB 3GM0A 5I30L 2DIJA 1XR8A 3ULUL 2BNUA 4NN6C 2YD3A 2R0ZH 3OSKA 1WIPA 4XVUC 4R0LB 5GGSB 4M00A 4G43A 4YAQB 2ZCHL 4OLUH 4Y1AA 3B4NA 3T65A 3D0VA 1YNLL 1OB1A 3GSQA 1ZT7A 3QI9B 3BAEH 3ALXA 2VDQL 2ZPKL 1XGTB 1QFWI 43C9A 4M61B 2BDNH 5F1IA 1NCDL 5FUZL 4GRLC 5FYLE 1WIOA 4HV8B 3VJ6A 3MV9A 1WAAF 5E00B 3SKOB 2E9IA 4N0CC 4FFZL 2YC1B 4NQVB 5D7SH 4WJ5A 2Z8VC 1RURL 4KJWC 5E95B 3TWCL 1JWUA 1P7KA 4DTGL 3ULVD 5EZIH 1T0NA 2G2RB 4Z7OE 1YECL 4X4XA 4ONHB 1JI2A 4NCDA 4S1RL 3VRIA 3LEXB 2P8PA 4H1LB 1F58L 2A6DB 4OAWA 3W9EB 3DX8A 4XCEA 4C4KT 4C56E 1N59A 4K23L 4G6AC 2ICWI 1DN0A 1I3GL 2CLZA 2DICA 4DGIH 2HFGL 3VDBA 3L6FB 3WNLA 3MLZH 4ZUWA 1A64A 4HT1H 4CMHC 5JA9A 3QEQE 5KN5B 1F90H 4WIQA 3FB8A 2NY2D 1JYVA 4PV8A 2HA1A 3RGVC 1ZT4A 3HR5A 2VDNL 3TC9A 4KU1A 1NL0L 1FNEB 4E41B 1T3FB 5CZVH 3S8WA 2EDJA 1AD9A 4X9IA 5GISH 4PJ8C 4PJXF 1ZA3A 5IIEA 1JGVH 5D70H 5I8CB 5DK0A 3IFLH 4MWFB 2RFXA 5AZ2H 5A2IH 4S2SB 1MEXL 5I71C 5EU6B 1YEFL 4IOFD 4PRNB 2J3SA 4F7CA 5DHYB 4GXUN 5MEOB 2UVFA 5BXFA 3HB3D 1DQLH 5F7LB 5DVLA 4WNQA 5KVFL 4J2XA 5FF6A 1ZSDB 1L7TL 1INQA 2YK1L 4OD2B 4RRPA 2FD6H 4WUKL 1JPSL 4XHJC 4EN3A 5B3JF 5SWSB 4X5WB 5L8KB 1BGXH 3EYFB 3B2VH 3I02A 2GYSA 2ENYA 1HHKA 1HHHA 5F6IC 5DJ2B 3DGGB 2VLKB 1OQOA 2YN3A 4EI5B 3IDGA 4WO4D 2YD5A 1LP9F 3FQXB 3WIIL 3LDBB 4M1DL 2AGJH 2NX5E 4UIKH 1MFAL 4JG1L 2SEBA 3HMXL 4HEME 4H88H 2FB4H 3GJEB 1FO0H 1VFAA 2DQDH 3QNZB 4XMLH 4O51A 3QWRA 3QIUB 4PJDE 3G5YA 2VDKH 4XAKE 4G9FB 2YBRB 4PJXB 4F2MB 1KPRB 5LAXA 5IW1B 5SWZD 3QJFB 3UBXG 4YNYA 5KZCD 4QXUH 3WUWA 1TZGL 3KPRE 4OCMC 4J4PA 3QDGA 4NN6B 5T5NG 4XNUH 4YZFF 5TDPB 2ADFL 2WANA 2IQAA 3V0VA 3GBML 5ERWB 3HE6D 2ADGA 4I0PA 4PJ7E 4Q2ZA 2ADIA 1EVUA 3T77A 2NR6C 4ZFZA 3DUHA 3CCHA 3HI1B 4XVSH 2X05A 1AY1L 5F88A 5LJYH 1NCUA 3WUWG 1WBYB 3P9LA 4UQ2A 4GRLB 1BVKA 4UV7H 4XTRD 1GC1H 2LQRA 3CX5J 1G6RH 3E3QC 2FZ3B 4HLZG 3MGTA 4RGNE 1LP9B 4QGTA 2A1WH 5DC0A 4YQXL 1KN4H 1JI1A 1PZUB 1OWRM 4GAJL 4NC2B 5JOEA 4BZ1H 1AC6A 4QRSA 1V05A 5GS0L 3LQZB 5JXAH 3E2HB 5D7KD 5D7IE 5BO1L 3CFJA 2VZSA 4KDTA 4MCZB 3VXUD 3I6GA 2X70A 4L3CB 4KDVA 5DEGB 5F93C 1UACH 3W2DL 1A6WL 3UJJL 5IT2L 4G7VL 4UU9A 1F00I 1MNUH 5BZDB 5D7LE 2CDGB 1NEUA 5D6DC 3L3KA 5EWIL 1IC4H 2DLHA 2J7LA 2P5EB 5J0BA 1HH9B 1U8IA 3LIZH 4CMHB 3S3JA 4JPVL 4EOWL 3IKKA 5KOVC 3LRHA 4JB9L 2MQCA 1JZ4A 5I1DA 3NFNA 4M6ML 4OCSL 1MIEL 4NKDA 4K71C 5IJVA 4JAMB 1OT2A 2R0KH 3P73A 4KVNH 3LZFL 2AK4E 3RGVB 2CRMA 2PYEE 3A6BH 1CI5A 1X3DA 4MX7A 4DVRL 5IMMA 4PJGB 3T3MF 3O6KH 3V8OA 1IT9H 3QP3A 5T1LB 1CICD 2DDQL 2AXGA 5BJTB 2Z9TA 5GJTH 1C7TA 3UZVB 3LAFA 3V5DA 5I71B 2JCCA 2DQCH 2O5YH 5L88L 1DL7L 4KZDL 3TCLA 2IAND 4MXQD 2WWKO 3D25B 5E6IA 1AFVH 1AKJA 5EC1B 3LKQA 1S7WA 4WTZA 5E6YA 1S78C 5HY9A 4NNYB 2EO1A 2H3NB 3SDYL 2HMIC 3EO9L 3HCVA 4Y7MA 4IHOA 3DETD 5E8EA 2QBWA 2IFFH 2W0FB 1NCAL 3FAWA 2XIDA 4CN6A 5F6IB 1DBKH 4XP1H 1BMGA 4KQ3H 1I1RA 1R5IA 2APXA 4P4KC 3SY0B 3QXVA 4XP9H 5SV4A 2AKRB 1QFWL 3L3HB 4V1DD 2FO1A 5EOCL 3ALWA 5F7EL 1QSEA 4CADA 5FA4A 3GGWB 3NIDF 3K2MC 4BM7A 3GHEL 5K9JL 3DIFB 1GOFA 3VI4E 1F4WL 3DURB 3ARSA 1NGQH 3KLHD 2Y72A 3RUGE 4YE4L 3VFOA 1VADA 4PRPB 3MA9L 2H2SC 2DI8A 3G5ZA 1B0WA 1T1YB 5CLWA 4CMMB 1IKFH 4UOJA 2N7AA 1FIGL 4JANB 2LAGB 1QHPA 3BHBB 1ND0B 5LQBH 4OV5A 4NO0A 4HWBA 3D6GA 4NQXA 4PJCE 4UTBL 4MA3B 3NFPA 4CKVX 4A6YA 2R2CA 4JQIH 4MJIB 4NJAL 4JVWA 4L3EB 4HIEA 1FL3B 3QO0A 1GRWA 1HEZB 4NPYB 5ESVA 5T1KD 4X98A 3DBXA 3WFBL 1HINL 2IMNA 5I30H 3VGHA 3RZCA 1R5VA 4IRSA 3QULA 2X7LB 2Y5TA 1J0KA 1LK2A 1CD1A 2FNBA 2RB8A 2BSSB 1I3RB 4WDIB 3W0WB 4DJMA 4LPCA 5I66B 1I1AB 4MQXD 3QCVL 4ZO6A 2ZCHH 4XVJL 3O2DL 2P48B 1XIWC 3HE7A 3DX9A 1T1WB 2AJ3B 2YD6A 5IHZA 4NDMB 1GC1C 1YNLH 4I1NB 1FLRL 4UDTA 3OB8A 4M1CD 1PSKH 1QEWA 4LLWB 2VDQH 2ZPKH 5CCKH 3OKMB 2WW8A 2KUTA 4TYUA 2C3HA 3G6DH 5FUZH 1DP0A 2F53D 1TJHL 2O5XL 4K2UH 4Z7UE 3WFCL 4KJPC 3JVGA 4NWUL 4M6NL 3S36H 3WBDA 3ZMRA 1KCRL 3BP5B 3UTSD 5F7DA 2QSQA 5BRZA 3CXHJ 1RURH 3TWCH 1K8IB 1DDHB 1W0WB 3OPZL 5CWSB 1GIGL 1YECH 3MRQA 4RISL 1B88A 1XF4A 3I3BA 4K71B 4PJEA 5JHLL 2IAMD 1G9NH 4Y5VA 2ZUUA 2Q87A 2FL5A 1FDLH 4LEOA 2BSRB 4K23H 4ELME 1I3GH 4W81A 1RY7B 2H9GB 3MO1B 3WIHL 5FO9A 3WNOA 1CBVL 4F33B 3