3BIBX

Tim-4 in complex with phosphatidylserine
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
DTIIGFLGQPVTLPCHYLSWSQSRNSMCWGKGSCPNSKCNAELLRTDGTRIISRKSTKYTLLGKVQFGEVSLTISNTNRGDSGVYCCRIEVPGWFNDVKKNVRLELRRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell immunoglobulin and mucin domain-containing protein 4
publication title Structures of T Cell Immunoglobulin Mucin Protein 4 Show a Metal-Ion-Dependent Ligand Binding Site where Phosphatidylserine Binds.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 23
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2007-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bibX00
3L7FA 4PJ5E 3S7GA 2VIRB 1NUGA 2IWGA 4PJ8D 4HKBA 5IMOA 5J11C 1DVFC 2APWA 3R0NA 2CLZB 4JFEE 1D9KD 5DFVC 4PJXB 1IE5A 5JW4Q 3IJYA 1FNGB 3QPXL 4MD0A 1AGCB 5B38G 2D7TL 2GTWA 5JW4R 3GKWL 2YRZA 3I50L 3ULUD 3DRTA 4IRSB 5GS2D 1F4YL 5DK3A 3OBAA 3QZWA 5LXGH 3ARFA 4TUJA 5EFIB 3WS6A 4X6CE 1FSKB 5BZDB 1FC1A 1F90L 2VLKB 2Y07H 4R2GB 1U3ZA 5JW3L 4AIZA 1IM9B 4MCZA 3FB8A 1KXQE 2LABA 4MA1C 2AQ2A 2VC2H 4R0LC 3ECBA 3JWOC 5ESQA 2GJZB 3JVGA 4DK3A 1OHQA 1CFQA 4F15B 5FF6B 1HKLL 3TPUA 3RWEB 4OM0L 2XKSA 2JE8A 1FIGH 1NCAH 3P11L 3PDGA 1BMGA 4NO2A 5HHNA 4HG4J 4S1SL 1CTOA 4PJGA 1IGFL 1KJ3H 3QFJA 4RIRA 4DAGL 4TPRL 3HLAA 4A6YA 1Q9WB 2XA8L 2QV2A 1UH3A 5GRXG 2I60H 5L9DL 3RA7L 4P59L 2MQ0A 2FBOJ 4ODWA 1A6WL 5IROC 1RUAL 5CJQH 2FSEB 1CE1L 3FN3A 1KELH 3X3FH 4U6YA 1CLYH 2A9NL 1N5AB 1RK1A 2QQNL 4P3WA 3DNKA 3OTTA 2V2XB 4Q9QH 2EDQA 4N8PA 2HJLB 2X05A 1LD9A 1QYGL 1HQRB 3WN5B 3BGMB 3P0GB 1JPGB 2X9YA 2Q86A 2Q7YB 1SY6L 4U1KA 2AJYL 1FHGA 3RL2A 4JKLA 4MAUH 3FONB 2D2OA 3G6DH 3WLWC 5SX5H 4U05A 4U3HA 2B1HH 4ZFZA 3V5DA 1F2XK 1S7VB 4H0HB 3DX8B 1TIUA 4XNXH 2R1WB 3L7EB 4AIXA 1Z3GL 4X99B 2E9IA 4LBEA 2GITA 3JV6A 3W81A 4N8VA 4CL7A 1NJ9B 1N4XL 2DRUA 2QEJA 1ZLSL 4P23A 3H42L 3MRKB 4EDWL 1B0RA 1ZANH 2Y25A 4HWBH 4PLKD 1AGBB 3WCYA 2X09A 1JHTA 3LCYA 1ZVYA 4U1HA 3BP4B 2IC2A 4NNYA 3IKCA 1DQLL 1YC7A 5TGBB 3MV9B 4LSTH 2VDRL 2IBGA 2KQNA 3U1SH 1KB5A 3QG6B 5F7YC 3BKCL 1RK0B 3TBSA 5GJSH 2Y6SC 2A6DA 1BJMA 3H7BA 3LAFA 5HHPB 2X6MA 1YQ2A 4XC3L 5JDJA 5F97E 4KXZI 1YEDA 4TUOA 4RGOL 5C0AA 4LLQB 1I3UA 1V05A 1OL0A 5HDBF 4ELMF 4FN0A 2UVEA 4R4NC 4U1NA 2HG5B 4KMTL 4RA0C 1JN6A 4UAOB 5IR1A 3HMXH 3NIDE 4LHJB 3VXRD 2JK5A 4KV5F 3MNVB 4NKDA 3TT3L 1NC2B 3ARUA 5DJ0A 2FZ3B 3GHEH 5FYLH 3S37L 4OKDA 2CRYA 2R2EB 3C6LB 3L1OL 1XCQB 3FHQA 4YHMH 4ETQB 5DJ6B 1OLZA 2ENSA 3SDXF 5CEXB 4Y1AD 1C1EH 3QUKA 4KAQH 5C70A 4RZCB 1UCTA 4YO0B 4NCDA 4YHPB 1T1YB 3MRHB 4CAGA 3VG0H 2CUMA 4W4NA 3V5HA 5J57B 5D1ZD 5CGYD 5D4QA 5BZWB 2PYFB 3BW9B 3PWVB 4ALAH 1LEIB 1CD0A 5E5RB 1CGVA 3DUSB 4S1DD 3P30L 2WK2A 4XNYL 4AMKH 3EOYG 5I1GH 1UCBL 2ZSWB 4XRCA 5GRJH 5FYLD 1MLBB 2NY1C 5JW4M 1I1RA 4D0BA 1I4FA 1ZT7A 5FUZL 5IVZA 3D0LB 4WUUD 5K9OA 5EOTB 2F5BH 2GEEA 2C1OA 1U42A 1QACA 3NZHL 3Q0HA 4B53A 4EXPX 5JQHC 4JVWA 1FH5H 3PJSB 4Z7VE 2A1WL 5CP3A 3O6LH 3DURB 4ZUSA 5IB1B 2LU4A 3KXFD 15C8L 3PABB 3S3SA 5EO1B 5DQJB 2EEAA 1MCFA 1Q1JH 4I48B 4LMQI 5DJ8A 4GMTL 5LKNA 4HZLB 3V7MA 4D9LH 4AT6B 1YPZE 3N1MC 1JK8B 4NKIH 5HPMA 1MWAA 4EN3B 3CVHL 5H35B 4GH7B 1MFNA 3SKJL 4TULL 4X4MA 5HHOD 5I17B 1R6VA 5E1AA 4XMPH 3LN4A 2DD8L 1P7QA 4PR5B 3TN0B 4YWGH 2VH5H 2HTKD 1KCLA 1PSKH 3E6FB 4Y19A 4NN7B 5GGTA 1YY8B 2CPCA 3WIFB 2VZOA 2H32A 4LDEB 3L3IA 3DROA 1QSED 4I2XE 4UOW1 2IH3B 4ZAKB 3PL6A 4QHLB 1HHGA 1G7PB 1WGOA 3VWJC 3VXUE 2APVA 3WO4C 4Q7DA 1S7RB 1XEDA 4EUPG 4WO4A 3WS3B 3BJLA 2DQHH 2ILLA 1G1YA 43CAB 5JOFA 5DD0H 5HXMA 1EX0A 4YR6B 1OP9A 3BQUC 4X0KA 4W6YB 4ZS7L 3UBXB 2OL3L 1D5ZB 3E2HC 1S7WA 3HE7A 3KLSA 3QQ3B 2DKUA 1HXYA 2ZCHL 4I8DA 5CSZA 5D72L 4UDTA 4M4RA 2FL5A 3QZWG 2IPKA 4JFPA 1IGIL 5FYJL 4N5UA 1XGYL 3PHSA 3U4BH 1JZ4A 4JO4H 3FB7A 4OCSL 1ZHKA 3ZL4L 3QG7H 3W0WA 1KPRB 2CR3A 2DQTL 5DR5L 1XF2B 1UKTA 1A7NH 2NZ9D 2NY3C 2HVKB 4JB9L 2AEPH 3U2SA 2QR0B 4TOYH 5IW6A 5KVMC 4QYOB 1J0HA 3B6SA 4DTGL 5I1CL 4JM2B 1P4IL 3D39D 4G80A 5GGVH 1T0PB 1NGZB 5FYKH 1F8TH 1OLLA 5EN2A 4ZFOB 1BVKA 2BJMH 1NUFA 1OM3L 2CLRB 2VN7A 3JWDH 4OIIH 4KK6D 2O5XL 2DL2A 3NCYP 4GKNA 5C2BH 3RVXD 1A6TA 5KSUA 3QIWB 1GZQA 4PJIB 1XGRA 2DLFH 4WW2F 5CUSH 3NOIA 1WVZA 2MWCA 1LE5B 4MSWB 1AD9B 1DEEA 4JFHD 3S36L 1PX4A 5EUOB 1INDH 1TTFA 1WT5C 4HH9A 2UWEB 5SWQA 5CCKL 1DLHA 3QEQE 4KRPD 4PJDB 1OAZL 1HYSD 3LEVH 1C5BL 4BM7A 4V1DD 4DGVH 3PQYE 4PJHF 1N2RB 5FYKD 2X4PB 5F9AC 4KPHH 5BVPH 5I71B 2PXYD 1KLGB 1QLRA 5D7IA 1KG0A 2FJGB 3B9VA 4JO1H 4NQEA 1U41A 2ORBL 4WW1B 5DVLA 2IMMA 12E8H 3NTCL 4I3GA 5DO2C 2HT4D 3CVIH 4PJ9A 4IDJL 1QR1B 1MJJA 1MHCB 3JV5A 4N8VG 1G1CA 3HE6D 5IVXB 1YN7A 3EOBB 3WHXB 4MWFA 3OAZH 2I26N 5C08A 5I8OL 1I9IH 4X7EC 3D5OF 5KJRH 2EZ0C 1TFHA 4UV4H 5GZNC 3T2PA 3QDME 3B9KD 1IGTA 2O61B 5C0RH 5EU4A 3VWKB 5DLML 5I8EB 1HSAA 1FG2A 4UQ2A 1ZVHA 2NY0D 2AV7A 2EYRA 1YECL 3RY6C 2MHAA 3RZWA 4ZG1A 1A47A 1EGJA 2HH0H 4X6FA 1NCNA 4XNMB 1LILA 2XWJA 3X17A 6FABL 3RWIB 5D93B 3RI5F 4HEPG 1QQDB 4YHKH 5IFHL 5CD3B 3EBAA 2Z93A 1JGVH 1ETZB 2UY6A 1U2HA 4NBZB 3G6AA 4OD2A 3BZDA 1Q9LA 3R4DA 1PQZA 3K80A 2J4WL 5KANG 4ZO7A 3QI9C 3IYLW 4PJAB 4C83A 3ILQD 4MZ3A 4N90E 4XMLL 2CRZA 3P0VL 5DMGC 4Z7NE 1MLCA 3WJLA 2BNQB 4YHNB 3I6GA 1MVUA 2E7CA 1WEJL 3BT2H 3WE6B 3ABZA 2EYSA 3C87A 3SCMD 3VRJA 4Y5YB 1N6UA 4XTRD 4GAGL 4K3JH 1GOGA 2A77L 4YNYA 4KKBD 3FRPG 4Q6IA 3MJ7A 4ODHL 1OOAA 3VFRA 5HYSA 5BV7C 3L3HA 2OXHA 1UVQA 1OB1B 3DBXA 3TNNA 2YWZA 5DWUH 2XPGA 5J3HD 3G6JF 4PJ8A 4GG6B 3TESA 3O45B 5E08L 4WGVB 3MRIB 4YXLL 1D9KA 4Y4HB 2F5AH 4MXQD 4PGCB 2A83A 3KPMA 2A0LD 5T3ZE 3OKNA 4C58B 4LK4A 2YWYA 3F7RA 3S35H 5BJTB 4ZXBD 3UTZB 4MD5B 1JGDB 4JDZB 4JFFD 3RWGB 3QIUB 1YEIL 4L5FL 1IGCL 3MO1A 4ELMA 3IXTB 1NUNB 4NHUB 4OQTA 4S2SB 4L8SC 4LLVA 2Z31B 1FNEB 4G8GB 3T0EE 1SJHA 3TF7C 1R3LB 1NH6A 2PO6D 1BVLA 1FJ1A 3EZJB 3FOMA 4IRZH 4PRHE 3P0YL 2N1KA 3FMGH 4MAYC 4MJ4A 5FKAB 1OCWL 1KJ2A 3F12B 3MNWB 2JJTC 1IAOA 5CP7A 3SDXA 2UZIL 3NIFF 1DFBL 1I7ZB 2VE6A 5IBLD 5IW3A 1M6OA 5D70L 1UB6B 1FFPB 5I8KH 1IM3B 2VUOA 1I8KA 5ID0B 1UACH 4JFDB 3IU4H 1JGEB 1T89A 1IT9H 4J8RB 2W1NA 4JPVH 5F3HB 4MB4A 2YPVL 4NT6B 2EIEA 1JI1A 4R96B 1NBYB 2Y36L 4OFVA 2DQEL 3HFMH 5E00A 3ROOA 5ENWB 1A0QH 1S7TA 3GMPB 4LVNC 5ICXB 4JO3L 5D7JD 5FUCE 2DAVA 4P3CL 4R7DA 1C5DA 5EZLA 1YNKH 2J6EL 4QRRE 4XT1C 4Z0BH 1MCCA 1OGAD 3RIAK 1JGUL 4DWHA 1ZA6B 4TNWK 1GGBH 2IADA 2I07A 1X5LA 4NQVB 3GEWB 1K5NB 3O3EA 1FZMA 3HPJA 3HTLX 1MCOH 4HBCH 2HJKA 4Y5XB 1D6EA 1I8MB 1C7TA 4NRXA 1YY9C 4HUWA 3UYRH 5LVEA 4NPYA 3EYUL 1CGTA 2FLRT 1TXKA 2BHZA 2EH8H 1OW0C 2MPAH 4NQUA 4LCUB 3M45A 2APTA 2WP3O 3KYOA 3DV6A 2P5ED 4WO4C 1T04B 2DYPB 4KJPC 3SE8H 1F2QA 1Y18B 2W0LA 3MFFB 2J8UF 3NGBC 3T1FB 4N0UB 4GKSB 4FQXB 3BO8B 4XPBL 4CVXA 1EHLL 5KSBB 5ABDE 1MCQA 3T3MF 4Z5RB 1L0YA 5DI8A 4UINL 1ZHBA 2CDEA 2MCPH 1JZ8A 1XFPA 2P42B 4PRPE 5D7LD 1NGPH 5I74B 3BXNA 5T3XL 5ICYB 1LK2A 3H9SE 3GBNH 5MERB 3NA4A 1QP1A 3H9HB 2HFFB 4LCCC 2VDQH 4PJCE 3O4LB 1CDHA 3O3AB 5F1OB 1BZ9A 2E27H 5KS9B 3U0TB 3BKYL 3TCXA 2PTUA 4EIZC 1EJOH 1AXSB 4LCIL 3VXRA 3RBGA 4HWBA 4WI9A 3VFWB 2ZUQC 5ALCH 3ZKNC 1AGFA 1SYVB 4KTEL 1F4HA 4MA7L 2A9ML 3H3BC 4IOIA 1QSFB 1E6OL 1N0XH 4Y1AA 1ZEAH 3KPSD 2AKRB 5A16B 1S5IH 2V9QA 5EWIH 3KPLA 4UBDD 5I1JL 2XACC 1RUQH 4QY8A 2VDNH 3T09A 3BZFB 4XVTL 3MGOB 1N59A 3F7VB 4XPGL 1J1OH 3CLEL 3WXWL 5D1ZA 4MD4B 4NWTL 4OGYL 4FMFA 3R8QA 3KLAA 3UYOD 2LVCA 1T5WA 1PYWB 2GYSA 3HMXA 1PD6A 2V7NA 5TDNB 3CSGA 5D7LE 3BRGC 2ERJB 4YFLI 2CRIA 3QPQC 2OYPA 1FYTE 4HIEB 4OZGE 4WUUA 3BPNB 4M8QB 3OWEA 2Z8VC 2D0HA 3AU1A 4PB0L 1FL3B 1UM5H 1JBJA 5IFAH 4HKXA 2VO5A 3UC0L 1JPFB 3MJ9L 5I2IB 1Y6NR 3BEVA 3SGJC 3OZ9H 1CK0L 2R9HC 5EC1B 4WHTA 1ZHNA 5DK0A 1FLTX 3KXFA 5DRZA 1RJLB 1VERA 3FFCB 1NMCC 2KDGA 3T0BA 1EHAA 1K8IB 5DEFA 3RFZC 2VABA 4U6VH 1QO3B 2G5BA 4H1LH 4X7TA 1YEFL 4FTVE 1EBPA 4CDGC 4PJHA 1I75A 2HT2D 4UU9A 5IB5B 3ULSB 3GB7B 3QJHB 5HHOA 1HZHH 1N7MH 1GHFH 4H8WH 4GO6B 1W72B 3F7QA 1FZKB 25C8L 3QULB 2YD2A 1IC4L 1MCEA 4NJAL 4WI4A 5JQ6H 3O2VL 5IV2A 1GGYA 3AAZA 3ETBF 1SJEB 4QRQB 2FEDD 4GRLC 3IFPB 3V6FB 1YMHA 3VXPA 1QSEA 2XI9A 3BSZH 4HIJA 3MV9D 4G6AD 4PIRF 3VGEA 1A5FL 2I24N 1BFOB 4ORGB 3QEUA 2QKIA 3MJ8B 4K7PX 2VLRB 2CIKA 1D5MB 2VAAB 4UT7L 3LEYL 4NNPH 1E4WH 4G8FB 3TLRA 4HUUB 5HYSG 4Z18A 1FVCB 1TJIH 4FFVC 4P2QD 1ZHLB 1ADQH 3BD4A 1QBLL 3JBG7 3WFHB 4JM4H 3CPLB 3W5MA 4K7FA 4HFUH 4L4VE 2J88L 5GGRA 1VCAA 3S34H 1F6FB 5EPMA 2W65A 1S9KC 2BHUA 2VITB 4IJ3C 2HT3C 5E8OB 4H20H 4E41E 4LHUB 1A6ZA 1JNHB 4X80L 2ZUTA 1I1FA 3MLSL 1KUMA 3KYMB 4LLYB 4XCCL 1U8JB 4H26B 2D0FA 4LF3A 2OLDA 1D3CA 4QHMA 1WWCA 5CFHA 2F19L 2EDHA 1NCDH 4K23H 3LKPB 1KTLA 2H2PD 4MVBC 3SDAD 4HIIA 2AXFB 1FBIL 3D18B 1JNLH 3O6FC 1DE4B 2FBJH 1CXHA 2I5YL 1AXIB 1ZE3C 4QRPE 3D39A 1AI1L 2X4OA 5ERWA 4YPJA 3LRGA 5I1LA 3DXAD 2BSTA 3WXVH 5GRZA 3C8KA 4PB9L 3TWCL 3IFLL 3INUL 3GMNB 5I30H 2GCYA 5CJOL 3V0VB 3JV4B 4WV1B 4LSPH 1RZ8A 3IDGB 4ZUUB 4YK4B 1A1NB 2AI0L 2SEBA 2Z91B 5TH2A 3G6JA 4JQIH 5IMLB 1U95A 3KPNA 2HTLC 4F2MA 1BF8A 4F37K 1U93A 3RIFK 2NW2B 4M1DH 4XVUC 3EYFA 5F7EL 4HV8B 3WUWA 1OP5H 5KTEH 2EDDA 3BH9A 4YZFF 2EE2A 4AEHL 5C9KA 3E6HB 3A6BL 3FO9A 4KRLB 4QF1A 4LLWA 2NY7L 4YXKL 5HI4D 3PWLA 4LOUD 3B3IB 3J8F7 3BUYB 4Z7UB 3SE3A 4LAQH 2P43B 1I85C 4PYGA 3MBEC 1BD2B 2HRPH 1T89C 5C0CB 2YR3A 2XWBA 3MODH 1CBVL 1EUTA 1IEBB 3NFSL 4V1DA 1JNNL 2HJFB 4CU7A 3P77A 1A4JA 1P2CA 2G5RA 3QIBD 4PJBF 4WFFD 2R0WL 1R3HB 2DQJH 5J89A 2PXYA 2RBLA 2B5IC 4XC1L 1UJ3C 2EC9T 2WBWB 3KHOA 4ZSOB 4M61A 1C16B 2ZKHH 3KLDA 4KDTA 5ISZE 4ORZC 3VFNB 1L0QA 4O4YH 1Q9KA 5FM5O 1F11B 1MCRA 5GZOC 3HE6A 1A6UH 2AABH 1CGXA 3BN9D 4U2YA 5K9QI 3O41B 1JUFB 4M5ZL 3O8XC 1BOYA 4WFHD 3QCUL 1JNJA 5ADOL 3NZ8B 4MYWB 1QLFA 2APFA 3B9KA 1JL8A 4M6MH 1VPOH 3G5VB 2RB8A 3UJJH 2HFEB 4D0CA 3UTSB 5JPMA 1FFRA 3V52L 4B50A 2RQ8A 4HUNB 5LWYL 2R8SL 3BIAX 1RU9L 3IJSB 2V2WA 3B5GA 2AJUL 4EI5B 4BFGA 5GGRY 2WLZA 1P5VA 5FKPB 3IDIA 5LGJB 3OJ2C 3HZMB 3SJVB 3WJJA 4PY7B 2EDEA 4KXZH 4JN1L 3QO0B 5ESVB 4C4KT 2JB5H 5C09E 3ARDB 2D03L 3GSNL 4L9LB 3V8CA 5E2WL 5E8DL 4YBQD 2PNDA 5L2JB 2GJ6E 4UIMB 5FO7B 1VFBB 2BVQB 4FFZL 2F74A 2OX5A 1FVDA 1ES0A 2YD6A 3Q2CA 4WU7A 5DHXB 4AEIH 1J1XL 3HPLA 5I0ZA 3HZVA 4PLNC 4ZS6D 4OFPA 1KJVB 3SCMA 4LQFH 5CBAB 3GIVB 2J8UA 2X4TA 3QNYA 1S78D 2XTLA 2BMKA 2VKXA 3IGAA 5ILTL 4JDTH 2MTPA 5EORL 3BEWB 3UPAA 3SDDB 2JCCE 1EAPB 4F57L 3BWAA 5ACZA 3ARYA 3DETC 4FQCL 4V2CB 3TJEL 2GSIA 4KJYA 1HYRC 5F44A 5SX4H 2HVJB 1FNHA 3RX5A 3Q6GL 5C0JB 2VSCA 4OLYH 5JA9A 2FX8L 2LAGB 1DBKL 4LPVA 4NM4H 1K2DA 4I4WB 1B3JA 4ZXBA 4OF8A 1CICC 4JFFA 1VSCA 1UEMA 1YYMH 1RZFH 1OF2A 5EC2B 3VRIB 5FHBH 2P5WE 5IMKA 4YDIL 1YN6A 5J1AB 2YEZA 5C0BD 3KPRB 1NAML 2PO6A 5BCAA 4ZOBA 3I2CL 1ZT1A 4DGYH 1ZT4A 5GGVY 1RAMA 4APQC 4HW6A 1VGKB 4W6WB 3VGAB 4GQ9L 5JUEH 4O02L 4Q74A 2QJDA 4P4KC 3KJ4C 3LKQB 1QPPA 4DW2L 3VFOB 3VD5A 4RISL 5ID1B 4LL9A 1I7UB 2C1PA 1Q94A 5GS1A 3O9WD 4K94C 3H9YA 1EHNA 4G7VL 5AG8A 1YDPB 5JLZB 3QO1A 3M8OL 3TVMB 2X2YA 1JHKH 1KCRL 5EUKB 2IPUG 5ITBL 3U4EA 1H0DA 5FUOL 1MRFL 4KTDL 3DVGA 3WO3B 4D94A 2PYEB 2KL6A 4R97C 4UDUB 4RAVA 5D7JA 1RURH 5CZKA 3HA0A 4PP1D 3IDNA 5TDOA 5I8CA 3IVKA 3OKLA 4C54A 3BHBA 1OGAA 4JFZH 1ZA3B 1FL5B 5EZIH 1HK6A 1N8ZA 4JJHA 5C07E 1U3JA 2B7DT 2UUDH 2DDQL 4LSUH 1SM3H 4HJGA 4MJIB 5CS7A 3RRQA 2OP4H 1H3PH 1QFWH 2JB6A 5KAQF 2D31B 1IQWL 2E3VA 3CK0H 4DGIH 5DD5H 5ACMA 1R3IL 3C08L 3QWQB 1W0VA 2PW2A 1A3LL 4MXWL 2YD1A 4JZJA 5KW9L 2IH1A 3CDCA 5F96L 4XX1E 2YD8A 3GGWA 3SQOL 1F6AA 2AXGB 7CGTA 4XCYB 4Q0XH 2P5EA 3WDJA 1INEH 2BNQD 2ED7A 4N0FA 1H5BA 3KYKH 3NCBB 4XCNA 2IQAA 3ESVF 5I1AB 1SEQL 1F4XH 1CG9B 1NC4D 1M4KA 3LY6A 3BE1H 4AEEA 3SPVB 4OJFL 2JJSA 1WIPA 4DFIA 4Y16B 5JO5A 3U46A 4P3DB 4LASL 1MUJB 3OJDB 2VQ1A 2VIRA 1CL7L 2OQJB 5T33H 4JFYA 1FAKT 3QDHA 5D7LA 3OSKA 1T5XA 3MNZA 5FIEA 4PJIF 4XVSH 1A6VL 3QISA 4OCXL 4Y5VC 1SEBA 3DVNB 1U92B 5CSGA 1Z2KA 5C0DA 4RMRA 3RTQB 5EUOF 5CKAA 5C3LD 1KENH 3WUWG 3MRDB 4N9GB 5F88B 4P5KB 3LS5H 4LMQE 5EFIA 1P9MC 5E2VH 4DN4L 1TCMA 4G8GD 1J86A 4FHBD 1S9WA 2Y06L 2V17H 1XF5B 3QHZH 1IFHL 3SGKC 3T65B 2FCBA 4WFED 2FB4H 4JY6A 3VXMD 4WI7A 3KPSA 1NGXB 2OTWA 2OI9C 1F97A 2DIBA 4POYA 4Z7QF 1I1YB 3PWPE 1T20A 3RGVC 3OGCB 1LO0H 1WISA 2IF7A 1EO5A 1OAKL 3QR2A 4NYLB 3RVXC 5MHSD 3VRLE 1EEZB 1JZ5A 3RWDA 2VLLB 4RGMB 2W60B 5A40E 4NSKA 1QKZL 5DMIH 4DUVA 4D0DB 2VR5A 2DLEA 4NN6B 5T1DH 1WIUA 2FO4A 4BZ2L 3ES6B 1MRDH 2AAVA 2VDPH 2HFGH 5C0IB 4I77L 2YK1H 3SDCC 1AY1H 5I9QB 1QFOA 3WFZA 2GUOB 3ARBD 5E1HB 4Y7MA 1LO4H 4QHNB 2CO6B 1KNOB 4RFOH 4OD1L 4JFOA 5D7SH 4G8IB 4RCAA 2XWTA 3BGMA 2BCKB 4JANB 1JPGA 2AK4D 3W11C 4TVPH 1WITA 1HXMB 3KR3L 5DD6A 1AIFA 2PF6A 4M5YL 5LGHH 3HE6C 4TSCL 4HQQL 4ZUTB 4PGJA 1PY4A 4L29B 3V8OA 3VXSD 3JTTA 2B4CL 2Y7QB 3IJHB 4AH2B 4XBEL 5L88L 1DBMH 1S7VA 5DUBB 1Q9OA 3HG1B 1RZKL 3UJIH 4UTAH 2ZUWA 1IGYB 2DM2A 2CMRL 4M7ZB 4PJBA 2W9EH 4ODBD 3MOBL 3UZEA 4X8JB 5CWSA 2FECL 1TCRA 4NRZA 4IM8A 5DQ9B 2CUIA 2F54D 1GIGL 5JXAH 3IDYB 3LQZB 1B6DA 1U3HB 1JP5A 2C7UB 5D1XC 4KHXH 5E99L 3DUUB 4D9QD 2FR4A 2JIXB 3KGRA 4TVPD 4QKXB 2H9GA 5H94A 4DQOH 1BFVH 5TGBA 1LDPL 3MV9A 4HULB 4LPYA 1U6AL 3Q48A 4ONGL 5EIVA 5KVDH 1RZGA 3QG6A 4MCYA 1FCGA 2VQUA 3T0EC 1G6RH 3FQTA 4BH8A 4OFYD 1N0LA 3D3VB 2XG5A 3H9ZA 1T22A 4P2QA 4U1GB 4LKXB 4H1LA 5F72S 2CJUH 3MREA 4JPIB 4U1IB 2AK4E 5AUMB 1YQVH 3P9MA 3QEGH 2DI8A 2HG5A 4Y2DD 1U8PB 5DK2B 4DKFL 1F3RB 1CDUA 5GRUL 4YHIB 3SO5A 2F53B 2EXWC 4IRJC 1CFBA 2KZWA 1X4XA 5B38B 3MNVA 4ODVL 5D2LB 2FZ3A 4OUUB 3FQXA 1J18A 1T66D 4PS4H 4UTBH 5K9JL 3KYAA 1RSFA 3SOBL 1PW3A 2MMXA 5B8CA 3SDAA 4I3RH 2WWKO 1PG7H 3DGGA 3UEZA 2YBRA 4Q58C 5TF1H 1ADQA 4MQ7B 4G7YH 1WTGT 5FUCC 3L5IA 1AGDA 5T5FH 5TDPA 4YDKL 4M43H 1KN4H 3BW9A 4CADB 1AD0B 1H15A 1MRCL 3DXAA 1X7QA 4I18B 1M7DB 3BDXA 3EJYC 5IB4B 1QA9B 4KQ3L 4CU8A 1R5WA 1IKFL 1OSPH 5SWSE 1JRHL 4LGPB 1W72H 4X98A 4HCRL 3QJFB 3PIQB 5BRZB 3EOAB 4O51B 2FO1A 1C5CL 1AR1C 1JPST 5DVKA 1OAYL 5J13B 3MGTA 4S1RL 4XCEA 5EIIB 1RZ7H 1PGRB 4XPHL 5F89B 5GS1C 1NCCL 2HKHL 4EQ2A 4EXKA 4HPYH 5BS0E 2DQGL 4J4PC 2LU3A 4WHDA 2H41A 3QIBA 3ZE2F 3MRQA 4N0CD 3B9DA 3N1QC 3MQIA 5F7WC 3WYRA 3EFDH 5T1LB 4KI5D 4MHHG 1MREL 2MKWA 3ZYIA 4G9FD 2BERA 4Z78A 4A2MA 3P4NA 2FIKB 3E6FA 4TNVF 1KTDB 3N1GC 4NQCD 3EJZD 3WIFA 5IP4A 5KSBF 3QAZC 4XBPA 2V9RA 3GHBL 1XR9B 2X9XA 4WTWA 1UWGL 2DTML 2C4XA 4YX2H 6CGTA 1KIQA 1G7PA 5J6HB 1VKXB 4MXVE 3STLB 3VA2C 5DJYA 4LLUB 4OV6F 2AJXL 1HCVA 4AL8L 4N0RA 1WFTA 3WS3A 4X6DE 3TCLB 1KIRB 3SY0A 5A3ID 1J05A 1P6FA 2X10A 4R8WL 1QTYT 4M6OL 4U6HA 5IM7B 1G84A 3UBXA 4LKCA 2MNUA 3QQ3A 3GSRB 1OARL 4WWKC 2DLHA 3ZZ1A 4LHUD 1ODAA 3BPOC 5HGBA 2EIZA 5FECB 4TRPL 2NY2B 2R4SH 2G75B 1R5IB 3TA3C 2A73B 2VZVA 2ICWB 3LIZH 5EZJA 1MFAH 3CZFA 4NP4H 3GSWB 4Y4FC 3S96B 5BO1L 3PHOB 2DL9A 5EB9A 4LLMA 4KQ4H 3TO4B 1P7KA 2FIRT 3EYOB 2ADGB 4HMDA 2QR0A 4QTIH 3QEHA 4JJ5B 4ZDHB 3BVNA 5DD1L 3WLBB 5DJAA 2XTJD 3GK8L 4LPXA 5IG7B 1TENA 3ISWA 4OI8A 1DBJH 4XH2B 5IKCB 2FYYA 3QNXB 1BM3L 1AP2B 1D5IH 3QUZC 8FABB 3GBML 4NO3A 1DSFH 5IQ9A 1MF2H 2ADJA 1DQQA 2K9UA 1J11A 5B21A 3BAEL 4OGAC 2NXZD 1TQCB 1S3KL 4TUKH 4JRXB 1E4XL 3GJFK 4E42A 3ARED 3MUJA 5SWZB 3GMLA 4HGWA 4FXKA 3CX2A 4Y4KC 5D2NA 3FT4A 4HT1H 4WCYL 2X4UA 4LU5H 5HY9A 2YSSA 3QUXC 4EKXA 4X8XA 1T0MB 1YEHH 5C0BA 2BX5A 5TQ0H 4YHOL 2EIDA 3QCTL 2AJVL 4G6JL 1UQSB 1MPAL 2GKIA 2X4PA 5GISH 2WUBL 1PDKA 4AEFA 1KLGA 5F7NC 1LEKA 3UTQA 5C0FA 4KI5F 2NY6D 1FORL 4G3YH 5DC4B 4MJ2A 1P4LB 4DOHE 5D5MB 4PTTB 1BEYL 4KROD 5BQ7A 5J4MA 2K7QA 4XZUB 3GSQA 3TT1L 1A3RL 4LLDB 5DS8A 1FGNH 4JQVC 1AXTH 1AO7B 3G04A 5F9OL 3O9WA 3BPCB 1A7QL 4NNXA 3T0XA 3UROR 3OKMA 1PBYA 5ESAA 4M62L 4K3GA 1EJ6A 5A43C 3E2HB 4MNQB 2XZQH 4GAFB 4L4TB 2O61A 4RNRB 2DQIH 3U36B 4M93C 4P46A 4XBGA 5I8EA 1MI5D 3UTSD 2OTPA 5DJDB 5EO9A 1S5HB 2AEIT 5DRXA 5GIRA 3CU7A 5GGUA 2ESVB 4HUVA 1GC1H 5FDWA 2P24B 4XP5L 2OR9L 2R69H 3L3KA 4XNMA 4H1LG 5C6PB 1HEZA 3L7FB 4GBXC 4M7LH 3BFOA 1WZMA 2YN5A 5IMOB 2IFFH 3MXVL 5IESL 4GUPA 3Q5TA 1CR9L 4PLOB 5CD3A 3MPCA 2GIYA 4O9HL 4JCLA 7FABH 5MP6L 4MD0B 4FQQB 2GTWB 4KKAC 1J5OH 4XI5D 2VXQL 1A7RL 1K4CA 4OF6A 3DRTB 2C3GA 4JQXA 3MXWH 5FGCE 3LQMA 3O81A 4NQDD 3ARFB 4TUJB 4FFYH 2BNQA 4P9HC 4AIZB 1CDIA 2VLJB 3FB8B 3ZKMD 5AZEH 4BA8A 5EZOL 1B88A 1NC4A 4WTZA 3DHMA 1J8HD 5ESQB 3T4AA 3QUMH 4F8TA 2WIMA 4RSVA 1CFQB 1U8KA 3TPUB 1CXIA 4RQQA 4IOFC 3L95A 2OJEA 2OZ4H 2P8MA 5KG9A 5KVEL 5HTSA 4NO2B 3VGHA 1UKQA 5ADPL 2CXGA 5HHNB 3MUGA 3BUTA 1IGMH 4PJGB 1MJ7H 1F90H 1G9NH 3MLUH 3QFJB 4RIRB 5EG6C 3HLAB 4A6YB 4JY5L 4FG6C 4XHQA 4XWOC 4NKMA 4MD5A 1JGDA 1WF5A 3CFJB 3LRHA 5CJ5A 2HRLA 5I73C 1UZ6E 2G2RA 1CYGA 3OQ3B 4Z7UF 4BKLA 1ULVA 3HC4L 5F6HJ 4U6YB 5MEQA 4NM8L 4OM0H 1RK1B 4G8GA 4YXHL 3GM8A 5CILL 4S1SH 4BH7A 4M6NL 2K3TA 1YMMD 2JLLA 1FVEA 4DAGH 5ANME 5FKAA 3EAKA 4MA3A 4P2RE 2Q86B 2X7LB 3VXMA 3BYYA 1K85A 4NQDE 4U1KB 3H8NA 3V4UH 4NQXA 2J5LB 3RL2B 3TH3T 2VN4A 1LO5A 4K55A 5DYOA 4NHCL 4C56E 4AENA 4K8RL 3JZ7A 3ZTJH 1DEDA 4ZFZB 3V5DB 32C2A 5F7DB 4WY7L 1QR4A 3C5ZD 3GIZL 5HHQA 3V6OE 4YFLF 4A6YL 4JEGB 4LBEB 1HHKB 2GITB 3JV6B 4N8VB 2PTTA 3T2QA 4S11A 4P23B 2ZNWA 1NBYA 5SV4A 1KCVL 2AJYH 4XXCC 1B0RB 3MGAA 3QQ9C 1NBVL 5DTFA 2R0KL 4HKJA 3MLRL 1JHTB 2PYED 3ARBA 3MYJA 1WAAE 1JJUA 4U1HB 1E4JA 4NZTH 4NNYB 1KCUL 2M8XA 3IKCB 4Z0XA 5TF0A 3MFGB 2AK4A 3HI1A 5DUPL 1Z3GH 1KB5B 3MLTA 1ZA6A 4MGXA 1WFOA 2Q1EA 1Q0YH 3KAAA 3TBSB 1WUNT 4OCNC 2A6DB 3H7BB 4Z95H 4MJID 3UBXG 3NA9L 1N4XH 3BKJL 3IU3A 4TNWF 4KZEL 3O6KL 1ZLSH 4CRPA 1YEDB 3KHQA 4TUOB 3VXSA 1RIVH 2QADD 3DECA 1F4WL 1OGTA 1WBZA 5JIIA 3KDMA 1JN6B 4JREC 5KAQG 5IR1B 1G7JA 4XMKL 4R4FL 5I6XC 4NKDB 5EH1A 3L5XL 5BV7B 5DJ0B 5IHZA 1KACB 3BKCH 1Y18A 4N68A 3ULVH 1OTUD 2F54A 3T1FA 3X12A 1IEHA 1FRGL 2NXYB 1U8HA 4GKSA 1KJMB 3ZLQC 3MRRA 2CDGA 4CNIB 4L1DA 1ROWA 5C86A 3HNVL 5KSBA 4RGOH 3QUKB 3ARZA 4Z5RA 4AY0A 1BGXL 3G5ZB 3OKDA 3DJ9A 1KOAA 3WKMH 4LGRB 1KB5L 4D3CH 1P84J 1X5AA 3DSFL 1I9JH 1X9QA 4OFYA 2DJSA 4JRYE 2WUCL 3TT3H 3V5HB 3ZKXC 2PUQT 4YBQC 4M48L 3S37H 5GS0L 1LEGA 3H9HA 3RVWC 4WI8A 2HFFA 1X5ZA 1E6JL 4PJXE 3RTQD 4HFWA 4MAYB 4YE4H 1M1SA 4Y2DA 3FJTA 3F58L 3BJ91 3OG4B 3V9FA 4LDLB 1RUML 4RMQA 3ULVD 2DTSA 1FC2D 1OWWA 3T3PF 4D0BB 1I4FB 1ZT7B 5LAXA 5IVZB 5LG1A 5C7XL 4HSQA 5K9OB 2VLKE 4OZIA 5IHUH 2C1OB 2Y72A 2NY4B 1SYVA 1MCLA 1NDGB 5BS0A 3MZTA 3NFNA 2CGRL 1OPGL 4K9EC 3IDXL 1MCWM 2XN9D 2QBWA 1G6RA 3S3JA 3CDGA 2ARWA 1T1XA 2BVYA 3OAUH 5C0ND 2M2DA 5DGQA 5D6DC 5TQ2H 5DJ8B 1F58L 2NY5C 2X1WL 4LSDA 3GDBA 4GXVL 4LVNB 4PJEB 5HPMB 1MWAB 3IDMA 3NZHH 5E1AB 1PYWA 5I66B 4N1EA 2A1WH 1P7QB 5TDNA 4Y19B 3U82B 3EFFB 1JYVA 3H6JA 1U8IA 1KCSL 1YEJL 2H32B 3MA7A 3L3IB 1FAIH 4R3SA 3FT3A 3DROB 3NABL 2O5YL 1FL3A 2XYCA 5FAAA 2GK2A 3BPLB 3GM0A 3PL6B 4LPCA 5KSAC 3FB5A 1IAII 2VDLH 4HLJA 3MRFA 2DWDA 4QT5A 1U3YA 3MRJB 3QWOB 4TULH 2GY5A 3MV11 2AEQH 4P2YA 4ODTL 4WO4B 4X5XB 2ZPKL 3MLWH 1JPSH 1JF6A 1UA6H 3TNMA 3NGBB 1ZGLM 3MSPA 2HKFL 3HG1D 4ERSL 3O4OB 4ZFFA 2VDML 1S7WB 3HE7B 3F7PC 4P46C 1D5BA 3JWOH 3MOAL 3BP5A 1KXTB 4N5ED 4B7IA 5CSZB 4GKZA 1CF8H 3HC0A 4G9FA 2FL5B 5K9KA 1FNSL 1I1AC 2V5MA 2IPKB 5IQ7H 1GCFA 1A02N 4JFPB 1DUYA 4NQCA 1IAKB 1DVFD 2X4QA 3D85D 4C57C 4LCWD 1RUKH 5DFVD 1FO0L 3IFPA 3FB7B 5JIHA 1ZHKB 3WNPA 4LCCB 3EO9L 1O7VA 1HSBA 4X7SL 2ZP0T 2OL3H 3QDJD 1BFOA 3U9PH 4ZO8A 1MEXL 4G6KL 2VAAA 4NZUL 1V3KA 3CSBA 1JZ7A 5FGBC 4OF0A 5HVHB 3O2DL 5IW6B 3MUHL 3B6SB 1KBGL 4YHZL 2Q3ZA 1JFQH 4G80B 4NZRL 2HLAA 3DRQA 4PJFA 1YZZA 5L2KD 5EBWA 2LU7A 5FYJH 3PG2A 2EO1A 1VGEH 5EN2B 3CXHK 1BVKB 3ULVF 2BNUA 3FCTB 1JZ3A 2F58L 1N26A 2DQDL 4Y2OA 4JB9H 1SVCP 3TZVC 5KSUB 1GZQB 1MHPL 1CL7I 1ONQB 1U8JA 4H26A 4QXGH 4PGEA 2X4SA 1A14H 5I1CH 1XGRB 2P8LB 1P4IH 1L7IL 2KUTA 1KF9B 4N8CL 2Z4QB 5DMJB 1DEEB 3FQWA 4RRPA 1BLNB 1EA9C 5DHVB 5SWQB 1DLHB 2NPLX 4P5TC 3CC5A 5C71A 4RGND 5FYJD 2ICCA 1QLRB 5D7IB 2HLFC 1KG0B 4NQEB 5TE6L 1OTSC 3QDJE 1KEMH 3SBWC 4PJ9B 2EEDA 4FQJL 4DFHA 1MFDL 4DVRL 4NC0B 3ZDYE 1MJJB 5IWLA 3S36H 2NLJA 3C2AH 3IDGA 1CXLA 2VQTA 3HUJF 1YN7B 3ROLA 1WBXA 5C08B 1DQDL 2FX9L 5BRZD 4EEEA 1OAZH 3WLWD 3MRGB 1NMCB 5M7QA 4ZYKB 1C5BH 3HRZA 4HV8A 1M71B 3AREA 4GMSL 5JNYA 5I1KL 1IGTB 3SDYH 2FWOA 5EDXA 5EU4B 1HSAB 4PJ5B 4AM0A 1EAJA 4UQ2B 4Z7UA 5F8RC 1ZVSA 3ZE1E 2D7OA 4U3CA 1I3GH 4S10A 2AV7B 2CQVA 4KK9C 4P57A 2EYRB 3PHQA 2MHAB 1YNLL 3C9NA 2HJFA 4X6FB 1F13A 3TBYA 3MRNA 3FQUA 5A2LH 3EO0A 4OB5L 3VFNA 3ARBC 3FAXA 3K8LA 1ACYH 4RGNE 1CFTA 2Y6SD 3E8UL 4OD2B 1Q9LB 5DJXA 1A7PH 1G9MC 1IKNA 1PQZB 1J10A 3CXHJ 4ZO9A 1YECH 5FA4A 4WFGE 3EOTL 5CJXA 4WNQA 3FT2A 1MLCB 4HPOH 4R4ND 5J06A 4IIQA 4R26L 3I6GB 2ID5A 1MVUB 3G5VA 1PEWA 1MI5A 1FZOA 3UTSA 3VRJB 4JZNB 4YAQA 2AERT 1NMBH 2BY0A 4Q6IB 1WC7A 3MJ7B 3OKOA 4YFDB 3VFRB 5HYSB 2E7HA 3L3HB 4YJZL 2J4WH 1EGJL 3DBXB 1UVQB 1YEGL 3TNNB 4KVCL 1Q72L 2XPGB 2BRRH 3HZMA 4YBLC 3FAWA 2LQRA 4PJ8B 5CGMA 4PY7A 2OJZL 1D9KB 1FGVL 5B3JF 3CMGA 5MI0C 5ESVA 4GRWE 3KPMB 3RJQB 4KHTH 5AYUL 3VGFA 1MCBA 4GAGH 3AVEA 1GAFH 4M1GL 5ANMA 3MO1B 1U0QA 5HVGB 4ELMB 2BXZA 5FO7A 2BVQA 4NQDA 4BK4A 4ODHH 3B5TA 4LLVB 4QHKJ 2IPTH 1DZBA 4LPTA 1ZV5A 5BOPA 1FJ1B 2IMNA 1KJVA 2NY1D 1EMTL 5E08H 3NFPB 1J8HA 2BY1A 1HH9A 1CXEA 4ENEC 1KJ2B 4JPWL 3Q3GA 3SGEH 3ELAT 1IAOB 5CP7B 3SDXB 2JKXA 1X5YA 2JJWA 4LSSL 4WW2C 1ZLWH 1A9EA 2VE6B 2YN3A 1M6OB 1IGCH 2DQFB 2W38A 2VDKL 3HC3H 3EIFA 4MA8H 5JOPE 4RFNC 5E03A 3VI3F 5C0JA 1I9RH 4LEXH 3MBEB 4NFCA 3K46A 5D1QC 4JRXD 2QQKH 5JW4N 2QSQA 5DQDH 4KZDH 1LNUA 4L8CB 1ZSDB 2B5IB 2FD6L 2UZIH 1DL7H 1DFBH 5E00B 3ROOB 5M94B 1S7TB 2VZTA 4OQTL 3SE9H 3VE0A 2UWEE 3CFEA 3QUMA 1YMMA 1C5DB 4PJDE 4R7DB 4BQ9A 1JRHI 1EH9A 5EZLB 2P44B 3GJEB 2H3NA 3KJ6L 1G7QA 3TBWA 4IOSD 3ET9F 2OZ4A 2I07B 2W9DL 1MHHA 4NGHL 1NGQH 1I7TA 3O3EB 1WZ1H 1AHWC 2VLME 3QFDA 1FZMB 2EDLA 3HPJB 2HJKB 3THMH 1D6EB 3VWJD 2Y36H 4NRXB 2VMFA 4NPYB 1AO7D 3VG9B 3C5ZA 1NANI 5IVXE 1EXUA 2WSKA 4JO3H 1OAQL 2HAZA 2AGJH 1DANU 1KCKA 3BQUD 3FO0H 3UMTA 5B3NA 2WIIA 3DV6B 3BKMH 2BVOA 1JGUH 5ALBL 5EUKA 1FP5A 4L4TD 1U91A 2VUYA 1SHMA 4ZQKA 3NACH 1BIIA 2AK1L 3N0PB 2PYEA 5E6IC 4CVXB 5DSCA 3ARPA 4YDLC 5DI8B 3EYUH 2ITCA 1ZHBB 4F7PB 2J8OA 5E4EC 3O3UN 5AEAA 5DURD 1OY3B 1AFVL 1NCAL 3BXNB 1LP9F 3LMJH 1MCSA 3REWB 1DQMH 2NY3D 1LK2B 2JJUA 5FO9A 3RY5A 3TH4T 3MV8D 3BESR 3IAPA 3D2UD 1KJ3L 4LHUG 5D7KE 4XPBH 1QLEH 3QDGD 4ZOEA 4CVUA 4OI9A 2I60L 2L7UA 4Z7VB 2BXYA 3TFKC 2AXGA 3VXRB 4PJAE 3BMVA 2NTSP 1YUHA 1LHZA 2VLJD 5MEOA 1AGFB 1CG9A 1X6LA 2IQ9L 4Q9QL 4IOIB 2B39A 4H0GA 4UOW0 2BOBB 4L3ED 3VMPA 1TMCB 5B4MC 3WDIA 5IJKA 4RMVA 2EIBA 1V7NL 4P3DA 3KPLB 3ZTNH 4QY8B 4NUGH 3CNKA 1N59B 4GOSA 4YUEH 5HGHA 3G6DL 5LBSH 5HI5C 5JHDD 4GG6E 1RV6X 1JIBA 2B1HL 2F8VA 3MBXH 1NAKH 1ZLVK 5E8PA 4KTEH 4JKMA 3UCRA 1BP3B 4LIQH 2H1PH 4PJ7E 2VNCA 3N9GL 1T5WB 4IMLA 2V7NB 2BY3A 1G0XA 3TH2T 3KPPB 3IFNL 1AQDA 5JR1H 2R0LL 4P4KB 4WUUB 1ZANL 3KG5A 4OF7A 3AU1B 4HWBL 4CMHB 1I8LA 3QDGE 3ZDZF 4HKXB 2ZCKL 3CLEH 2XA3A 4LSTL 3IKKA 1EBAA 1NGXA 4F7MA 5J6GB 2XN9A 4WHTB 1ZHNB 2EZ0D 5D5MF 5DK0B 5GZND 1E4XI 3UXFA 3OGCA 4KK5C 3KXFB 5DRZB 3VFTA 2YPLE 3NCFB 2AJ3A 3DO7A 2VLLA 2G5BB 4C55A 5L0QC 1EFXD 1QBML 4PJHB 3E0GA 4UU9B 4JFDE 4MMZC 1NGWB 5HHOB 3C60C 3HMXL 3LD8B 3V6BR 4ODUA 5C0IA 3MA9H 4OM1H 5BV7H 2NW3A 5IV2B 3CDYA 3AAZB 3VFUB 3PWJA 1J0ZA 3AS1A 3HUJA 3L6FA 1YMHB 3VXPB 1QSEB 4KY1L 1VENA 4YHML 4F9PA 1C1EL 4JANA 1RULL 1KYOK 1C12A 1BZQK 2QKIB 3QEUB 3QI9D 3H7LA 2D7MA 4WHYH 5IGXL 3RUGE 4UV7H 3MRCA 5CIPH 5DMGD 5T3XE 4PP2A 3FRUA 2E7BA 5CD5C 4NJAH 2BNRD 3VG0L 4AH2A 4CUCA 3O2VH 5GGRB 1X5XA 4X7DC 3HG1A 3LKRA 3TM6A 5EPMB 1IGYA 2W65B 1QRNE 4U0RC 2B2XH 1MFCH 1RPQA 5F9JA 4TTGA 3ZT6A 5I1GL 4AMKL 5LCVH 1RJCA 3J7HA 3I02A 3LQAC 3CFCL 1A6ZB 1I1FB 3LEYH 2XRAH 4LF3B 2C7UA 1DVFA 2F5BL 5JA8B 4LVHC 3LDBB 4N0UE 3D85A 4LCWA 3TJHC 1ZOXA 4QHMB 5F1KC 5F6IC 1IC7L 3CVHA 2WWMC 3FL7A 3BGFC 4NOFA 3QDJA 3O6LL 4HIIB 2PR4H 3MRBA 4JHAL 3W9DB 4NC1E 4Z7WE 2NX5D 1G7MA 3FKUS 2FEEL 1Q1JL 3D39B 3V0AC 2X4OB 4XCCH 1V5JA 1JHLL 5I1LB 5L2KA 2BSTB 4R0LA 5D71H 3C8KB 4NKIL 3GI8H 4MAYD 1ZLUK 1FLRH 3O4LE 4MMXC 1YA5A 1A6AA 5M95B 3B83A 3GFUA 1RZ8B 3MV7D 2OI9B 5ELIA 4U7MA 5KS9E 1MQKH 5TH2B 4YWGL 3G6JB 1U95B 1T7VA 3KPNB 1PSKL 4F2MB 3DIFA 5GGTH 1FBIH 2X9WA 4DEPB 4UNVA 3V6OC 1AI1H 3FO9B 2OL3A 1QSFE 2IJ0C 4QF1B 3RAJH 4LLWB 4KVNH 3PWLB 3TWCH 1B0GB 3BD3A 3RWFA 3INUH 4EI6A 3MV01 3RZCC 4UB0H 5CJOH 4KRPB 5IROA 3IB4A 5HYFA 4MQ7A 4KTYA 1MFEL 2DQHL 4V1DB 2DBJA 3NPSC 1A4JB 1XH3A 3P77B 5DD0L 4G5ZL 1W2KT 4FZEH 1OSZB 4UT9H 4FOMA 3SHSA 4OZ4A 5F7EH 2NNAA 4M61B 4ISVA 1TQBC 3ZDXF 4ZTPH 2DJ4A 5CEYA 3EYQC 1UWXK 2OTUA 1Q9KB 2EDWA 3GRWH 3IRPX 3HE6B 4HX1A 5FM8A 3P4LA 4G43B 2NTFA 3RJDA 1YY9D 3EOAA 3U4BL 2B8OT 3NFSH 4RFEA 4O51A 5EOQH 2IAND 4R9HA 1QLFB 3B9KB 4HBQA 2EDTA 3MRPA 4D0CB 1A7NL 3BH8A 4X6BA 5JPMB 5DJCA 2NY0B 1UB5A 4OSUL 4KJPD 4TOYL 4YHYC 2DICA 4ZO6A 2R23A 4JO2H 3ZE0E 5ITFA 3FFCE 2V2WB 4JPKH 1BFTA 1T2XA 5GGVL 2CLVA 2IBZY 2FATH 3IDIB 3MMEA 5E94B 1F8TL 5FYKL 4XP4H 2D7PA 3LH2H 3JTSA 3QCUH 2BJML 2HMIC 3KS0J 3JWDL 4OIIL 5FA3A 1VESA 1QEWA 1TDQA 5C2BL 5DRWA 1D6VH 1EFQA 4PGBA 2EDFA 3PGCA 1MIMH 4L8DA 5K9QG 1RVFL 2DLFL 3FFDA 5CUSL 4HJ0C 4HWEH 4HXBH 4IRSC 3Q6FB 5AG9A 2F74B 1ES0B 3EYSH 2Q20A 4WU7B 3UTTD 4ZD3H 3HPLB 1INDL 2VR4A 1U8OA 1VKXA 1FSKC 3F65A 3HZVB 3STLA 2VLRE 4OLXH 4R2GC 4P9MH 4LLUA 5DHVH 3SCMB 4QXWA 3GMOA 1JMXA 2X4TB 1CS6A 3QNYB 1IEAA 4JN1H 3ARXA 2BMKB 5JMOC 3IGAB 3ZKND 4I3SL 4QHUA 3GSNH 2QHRH 4KPHL 3OL2A 5BVPL 1AE6H 1NFIA 2IANE 3BWAB 4JO1L 4F15C 4O58L 3OJMB 3GSXA 1EHXA 2CKBL 1X5KA 2GSIB 4KJYB 12E8L 3L5WA 4PUBH 5E56A 3PDDA 2A6KB 3SGDH 3V6ZA 3KPQA 4M3KB 1J1XH 2Q6WA 1LP9A 9CGTA 4HIHA 1CZ8H 2AV1A 4POUB 4ZNEE 4ZXBB 1I9IL 4UMGA 5IJKC 3CDFA 2G75A 4QRRB 3QQ4B 1UXSA 5KJRL 5ILTH 1OF2B 1WCBA 2P4AB 1DCLA 5DD3H 3T04D 1YN6B 4KUCD 5CZVH 3OAYK 1SJXA 2HN7A 2YEZB 4HK0A 2PO6B 43C9A 3Q6GH 4PJEF 3QPQD 1ZT1B 1ZT4B 1W0WA 1TPXB 2MOVA 3PP3K 5IG7A 3WN5C 2CDFA 1DBKH 2HH0L 1U8NB 5KANI 5IKCA 3U7AA 4KKNA 1X5GA 1YEKL 8FABA 1RZIA 4EBQL 2R9HD 3WIHH 4YDIH 1Z9MA 1UZ8A 4YHKL 1KN2H 5FM4A 2APBA 2EDBA 1JGVL 2IBBA 2G60L 4YDVB 2C1PB 1Q94B 5GS1B 4F7EA 2Z92A 1NAMH 2FHFA 2DM7A 4OZHE 3QO1B 3F5WA 4CVZA 1K8DB 1B2WH 2XZZA 4PJ5D 3U4EB 5IFJA 1H0DB 3DWTA 1GRWA 2XZAL 3DVGB 4CDHA 3BT2L 3T77B 4JFED 1VADA 5D7JB 4K3JL 1P4BH 1BD2E 5C0CE 4OLEA 3IDNB 3CZJA 5TDOB 5I8CB 3OKLB 3BHBB 1OGAB 4GRLD 1IAIH 1Z9LA 3G9AB 1N8ZB 4ZSOE 1P4LA 4LAJH 5D5MA 2ENYA 2JB6B 5ITBH 3N85H 4OV5A 3RL1A 2I9TA 3VWJA 1NFDF 2F5AL 1LMKA 4FA8A 1W0VB 2E8YA 1JZ2A 2PW2B 4FFVD 1AO7A 3RBSA 5IVNA 1UJTA 3S35L 4JZJB 2IH1B 3DOSA 3UJTH 1BJ8A 4ZOCA 3GGWB 3BQUA 1F6AB 2P5EB 3QT2A 4L4TA 4N0FB 1SMAA 3HR5A 4J1UA 2IQAB 4XCNB 1P7HL 1NL0H 2PETA 2DDQH 2HT3D 2QSTA 5DJDA 4R4BB 3Q5OA 3FO2A 3FQRA 1ZS8A 4N1HB 5E9DE 1XGUA 3C6LC 4OCRH 4U1JB 3FMGL 1UH4A 3C08H 4MNHB 1J1PH 1YYLL 2LE9A 3C2SA 4QOKD 4P5MA 4PJ7A 1UWEH 3U46B 4BZYA 3DMMC 1LE9A 5F96H 2VQ1B 1NMAH 4ONFH 4GG8A 4LVEA 4HAGA 4CN6A 4JFYB 3RX7A 3EDDA 4FQ2H 5D7LB 3SJVE 1D5XA 1T5XB 2DIAA 3MNZB 1TNNA 2RCSL 4YEFA 2P1YA 2EDJA 4MVBD 5DJZB 4FABH 3GO1H 5I8KL 3MV8A 3D2UA 1PKQE 3O6FD 4XVJH 1SEBB 1UACL 3CXDL 3IU4L 4FQQA 5F7LB 2P8PA 5C0DB 1N6QH 3QDGA 4HUKB 1IT9L 4F58H 2RJMA 4IS6B 4JPVL 2RFXA 4OJFH 4KUCF 5KVGH 4FP8L 3VD4A 1YJDC 1S9WB 2VLJA 3HFML 4JG0L 3BMWA 1A0QL 5JXEC 2GT9A 2AJSH 5D7IF 1F02I 3I6LE 2HTLD 2JTDA 2AEWA 1A6VH 4JY6B 3PWNA 4FTVB 1F3JA 4L3EA 1YNKL 4Z0BL 3KPSB 4OCXH 2OTWB 5E7FA 4XVUD 2DOCA 4J3OC 1EZVY 1T20B 1GGBL 2WLYA 3T4YB 1L9NA 4XP6H 3RWDB 1WT5A 3U30B 1MCOL 5JHDA 4HBCL 4DN4H 3QUXB 4MX7A 4NSKB 3MBED 3UYRL 4U1MB 4QOKE 4PG2C 2VXUL 2EH8L 3CFKA 4EN3C 3OKEA 2MPAL 1JE6A 3CFJA 2FO4B 2X5PA 3P73A 4AK1A 3N1FC 1BBJB 4ONOA 5MENE 3TN0C 4OI7A 4RGNC 3QNZA 3RUGA 3SE8L 4NDMA 1OAKH 4NQSA 4NCC2 3VGDA 4LRIC 4JFOB 3KPRE 4XNUH 5GZOD 3STZA 2XWTB 4L4VB 2FGWH 2P48B 2X7LA 4ZAKC 5DD6B 3O8XD 1AIFB 3HCVA 4U49A 4GLRH 4X6CF 4OCYH 5J7CC 5FDYA 3T8XA 4E41B 1TZGH 1NGPL 3LVEA 4M93B 3JTTB 4ZUWA 4URTB 3D87B 1Q9OB 5F7DA 4FQLH 2FJFA 1EFXA 1HNFA 4FZ8L 2VDQL 1LWRA 5GQBA 4PJBB 3VJ6B 5TFSH 3RY6A 1HHKA 2VL5A 3HZYB 3VH8A 3VFPB 5CWSB 4XPTH 1TCRB 5DT1H 4NRZB 1EJOL 1UXWA 3KR3H 4POZC 5INDA 4NO0D 5IOPA 4Z7WA 4IHOA 4TSCH 5L8LB 4WTXA 1VFAA 1ZKAA 1XF3B 4NWUL 2FR4B 3P3YA 4QRPB 4PRIE 2H9GB 5H94B 3QXVA 4DKDC 5L88H 4AQ1B 1N0XL 2AJZA 1ZEAL 1T2QL 1RZGB 3QI9A 5IUSA 4MCYB 1TZIA 1S5IL 3ZYZA 5IW1A 5EWIL 3MOBH 3FQTB 2VDNL 4BH8B 5I1HH 1T22B 4P2QB 4MS8C 4H1LB 5HHME 2WM0A 3MREB 1L9MA 4I1NB 5EU6E 1XCTA 4UZGA 2P47B 1J1OL 4JM2C 2BNRA 5HPOA 3ULUF 2QTEA 3WHE0 3P9MB 3U6RA 4LNVA 5FB8A 4ONGH 1M7IA 4IEFB 3VD9A 3DETD 1GSMA 1IILE 5TE4L 1X5FA 3FQXB 5I18H 1JWUA 1KJMA 2NR6D 3QIWC 4CNIA 1UM5L 5IFAL 1NLDH 4M8VA 3G5ZA 3U0WL 1E28A 1CGYA 4K94H 3WFBL 1CICD 1I3VA 5B8CB 3SDAB 5I73B 3OR7A 5CIPA 3DGGB 2YBRB 2R56H 2NX5A 2BSSA 1Z5LA 1AGDB 4L8SA 4ODVH 4HS3B 5TDPB 2LV4A 4JDVB 4U6VL 4J23A 1H15B 4MQSB 5AWNL 3DXAB 4HGKC 5CINH 1X7QB 4O2CA 4APQD 4MAYA 1S7UB 3K81A 4OLWH 5SX5K 5HVFB 1HZHL 1N7ML 1GHFL 4H8WL 1R5WB 2NZIA 3MV7A 2JJTA 3ARVA 2WP3T 3DYOA 3VXUD 4PG9A 4X98B 4P4KD 2O5ZH 1BPVA 1UGNA 3CD4A 4QTHA 4V2BA 1NDGA 4GW5A 4JG1H 2YD3A 4JE4B 3VMOA 1G0DA 1MRCH 1HINH 3AS0A 4DZBA 3GSOB 3MGTB 4NKOA 2COQA 4XCEB 3VWKC 1H3TA 4GW4A 1E4WL 5IIEB 4JKPH 1JRHH 4BZ1H 5J8OA 5C09B 1ADQL 4WEBH 3QIBB 4JM4L 4PJEA 3MRQB 4HFUL 1HHJA 3A6CH 3S34L 4HWNA 5I66A 1JPTL 5D93C 3QH3A 3W9EA 1BAFH 4PRAA 4Z78B 3UZVB 3P4NB 1DN0A 3EFFA 3GUTA 2ZG3A 3VD3A 1W8OA 1YJDL 4XPHH 4XBPB 1NCCH 1NANH 1P53A 5HDQL 5ICZA 1QNZH 2IANA 3PV7A 1KIQB 5GPRA 1NCDL 4K23L 1OW0A 4HEME 3QWOA 3MRJA 5L6YH 5DJYB 3OXSA 5K33A 5I6XB 1PZ5B 4M1CC 1NCWH 2B0SH 4X5XA 2YC1A 1T03L 4Y5YC 2FBJL 3SY0B 1DDHA 1J05B 3X13A 1S7QA 4GXUM 4U6HB 4Z7VF 4XPFL 4LKCB 3WXVL 3ME0A 1T21A 5DJ2A 1UWGH 2DTMH 4BYHA 3GRWA 4MNGA 5HGBB 1S9YA 3QEQD 2AXHA 2EIZB 4JQIL 2AJXH 5T1MA 1IAKA 4M7JH 1YPZF 3ZKXB 3BIKA 3GNML 1XF4A 1NFDA 3OHXA 3PQYD 5EZJB 4LCCA 3RNKA 3CZFB 1IBGL 3QIUC 3QCVH 5K59E 4M6OH 1MCJA 1LK3L 4OT1H 3UTTA 2ED8A 4ZPVA 2ATKA 4LLMB 1P7KB 5JHLH 1CT8A 4LAQL 1QFUH 2C3WA 2Z31C 3HHRB 4ODSH 2WAHA 3QEHB 4QGYA 2IPUK 2HRPL 3BVNB 2DBLL 3MODL 1CU4L 5DJAB 1GXEA 4LSRL 4KK8C 2EH7H 5I1IH 1XF1A 2UYLB 4LSVH 1B4JH 2FYYB 5D8JH 3ILPA 2H26A 2YZ8A 3FCTA 5F8QC 3K4AA 3QDMD 3W82A 2ZKHL 4NO3B 5IQ9B 2ADJB 1DQQB 1CGSL 2OMBA 2F53E 5TE7L 3RGVD 5I75B 4O4YL 2Y5TA 2N7BA 5D2LE 3TPKA 1A6UL 1AQKL 1ONQA 2AABL 3N06B 1KFAL 4OFKA 1SBSH 5DD1H 3U79A 2P8LA 4E42B 2ATPB 3VFMA 4M7KH 3GMLB 2Z4QA 4HGWB 4FXKB 1UM4L 5D2NB 3RI5K 1BLNA 3A67L 3FT4B 1FPTH 2X4UB 5SV3A 5CZXC 5HY9B 5DHVA 4YDJA 3C09B 2G9HB 2YSSB 1VPOL 4M6ML 5F9WB 3VW3H 3UJJL 5F7MC 5C0BB 2Y4SA 1ITCA 5E8NB 3GSNA 3BAEH 3SDCD 3F6LA 3QXUA 1LEKB 1S3KH 5T3ZH 1CD1A 2EXYC 3UTQB 5C0FB 3A6OA 1E4XH 4I5BB 3S4SA 1KULA 4OBRA 4N90D 3W11D 3SGJA 5BQ7B 4ZFOL 5I0DA 3GSQB 3O3DA 3LN5A 1QVOB 3RU8H 5DS8B 3VH8G 4Y5XC 1FL6A 3K4DA 5EBLA 3G04B 2JB5L 1X44A 3O9WB 4Z77B 3MRGA 4NNXB 4ZYKA 4X5WA 3ZHDA 3EHBD 3OKMB 5ESAB 3QCTH 2OK0H 2ARJA 2R2HA 1M71A 2WUBH 2E6PA 2OR7A 4P46B 4XBGB 1NPUA 4PJ5A 4RWYL 1JWMA 2E9JA 1IC5L 2EEBA 2YUXA 5EO9B 4JFEA 5DRXB 5GIRB 3QA3A 4LQFL 3WKNA 5GGUB 4HUVB 5T3ZD 5FDWB 5D1XD 3L3KB 5HGAB 4JDTL 3VMNA 4B7LA 4GRLA 1X5JA 3IS0X 1HEZB 3LEXA 5BXFA 5B39A 3R06A 4MLSA 5J9PB 4M62H 4NC1C 2VZUA 3WIHA 4GUPB 1XGPA 4X6CA 1RIHH 3K3QA 5I74C 3T0ED 4NIKB 4GRMA 1MELA 1NAMA 1BQSA 4WUKH 4PGDA 3HMWH 2OMNA 1K4CB 4PRHD 4ZODA 3RKDC 5HYEA 4BSVA 4XP5H 3G5XA 1RZFL 4LVOB 5FHBL 4KU1A 5H37G 4QXUL 4WHYG 3PP4L 2EXWD 3IS1X 4IRJD 1NC4B 1KEGH 5C6TL 4JZNA 3T4AB 4P2OC 1F3DJ 4O9HH 1XGQA 4DGYL 1FNLA 5FCSH 1U8KB 2Q8AL 4QOKA 4RQQB 5I1DB 3L95B 2OJEB 2VXQH 2P8MB 5KG9B 4MLIA 5JUEL 1N3NA 3MUGB 1EEYB 3PGFH 4FFWC 5HHXH 4KDWA 5MENA 3MUY1 1EO7A 3DI3B 3CGTA 2DN7A 1H8NA 4HF5H 1R5VA 3UDWC 5HYJE 1I3RA 5EZOH 2VXTH 3O6FA 4WVRA 4NKMB 1BVZA 1UH2A 4QRRD 2FEEI 4NN5B 1XAUA 4NZJA 2IG2H 2G2RB 3HS0A 4BKLB 4R7NA 5CLWA 1SQ2N 1JHKL 3EJYD 5MEQB 4WWID 2E8ZA 1ZLVH 4UT6H 4EUPH 4BH7B 3VA6A 4K3DH 2IALA 3BPNC 4J3VA 4HXAH 5DA0B 3NFPA 1FVEB 5GJTL 1RURL 4JFXB 2VR9A 4MA3B 4JY5H 3VXMB 4Z8FH 3EGSA 4Z7NF 4NQXB 4JFZL 5EZIL 1LO5B 5DYOB 3IT8D 1AR1D 2DQFA 4AENB 1SM3L 2RIKA 1MIEH 1TJGH 1H3PL 1QFWL 32C2B 4XPAH 4ZUVA 3DHJA 1Q0XH 4NM8H 1I85A 4Y8DC 1T4KA 3P4MA 2BHYA 3CK0L 4YXHH 3MBEA 3ZO0A 4DGIL 5DD5L 5HHQB 5FO8A 4J4PD 2PTTB 2W0PA 4JZOA 1J8KA 4L8CA 1ZSDA 5SWZE 5HBBA 2FLBT 1UJ3A 3CFDA 1U8QA 4PRPD 3KYKL 5DTFB 1FE8L 4YIQA 4HKJB 1F4XL 4NHCH 3ARBB 3MYJB 4FQIH 4XP9H 3H9SD 4OD3L 4OLVH 4WU5A 4BUGA 2VTFA 4Z0XB 3WSQH 4RDQF 3GJEA 3TBTA 2BSRA 2C4FT 2AK4B 3HI1B 3GIZH 5C0GB 3T1WA 4PTUA 2PW1A 3MLTB 3CH8A 1O7SA 2H45A 3O8XA 2N7AA 1BX2A 5CAYB 3IU3B 5T33L 3VXSB 1KCVH 4XWGH 4XVSL 3UPRA 4XP1H 1OGTB 3MLRH 1MSPA 1H8OA 1WBZB 4X5LA 3KDMB 1DUZB 3KNBB 4DKEL 1VEMA 4BFIA 1BF2A 3MLXH 2WQRA 1G7JB 4Z76A 1KENL 3O11A 5IHZB 2DMCA 4MNQE 4YBLB 4NO0A 2F54B 3X12B 2ZJSL 1U8HB 3NA9H 2BVUA 4WWKD 3MRRB 2CDGB 3CX5K 4H0IA 5MI0B 1HI6A 1JWSA 2Z9TA 1LGVA 2Q76A 3QHZL 1NSNH 1CQKA 1H8SA 3CFBB 2FB4L 3OKDB 2ESVE 1F4WH 3WEXA 4F7PA 5GXBB 4U4BA 3TA3D 3X3GH 4QEGA 2PKDA 1LO0L 3CLFH 3TO2A 4Y4FD 1CGWA 1QZ1A 3L5XH 1FYTD 3Q1SH 3REWA 1HHHB 1LEGB 1ZTXL 5GRYA 1CXKA 3GI9L 3AB0B 4HFWB 5DMIL 3KLHC 2ZG1A 4Y2DB 4Z7VA 2D9QB 5T1DL 1RMFH 3KS0H 3HI5H 1BGXH 3NCMA 5CJBA 4WV1C 4RBPK 5LAXB 2VDPL 2HFGL 3O2WL 3QUZD 4OZIB 3H2WA 2XQBH 2HWZH 1AY1L 4RFNB 4HWZA 5BS0B 4K2UH 1ZLUH 2WUCH 4OGAD 3NFNB 1M05A 4MJ6A 3M1BA 1YPZA 4FTVD 2BOBA 2FJHA 4OLUH 1T83C 3LKSA 1UYWH 1O0VA 4TVPL 1G6RB 2XICA 1CICA 3CDGB 2XZCL 1T1XB 3D6GA 5LGHL 4Y4KD 3S4SG 4X4YA 1F4AA 3QUXD 5C7XH 35C8H 4PJGE 2XNAB 1DBML 3IDMB 4GAYA 4K3EH 4I2XA 5C2UB 4UTAL 4APQA 2W9EL 1DBAH 3TYGH 1OPGH 1QSZA 3KPPA 1HQ4A 1LO2H 4LPWA 3VXUA 1VHPA 1AHWB 1U8IB 3MA7B 4I0PC 4P4KA 3RQ3A 3DPBA 3EYVA 4R3SB 3FT3B 1MJUH 5IHLB 5JXAL 1KLUA 2R0ZL 4KHXL 3OJVC 2AW2A 1OT2A 4L4VD 1KB9K 4FMKA 1BFVL 1G7LA 4O5LL 4DQOL 3FB5B 1KT2A 1QFWM 3MRFB 2DWDB 4QT5B 5J6GA 5KVDL 3C5JA 4J3TA 3V4PH 4E41D 1X4YA 2DF3A 3CX5J 4HS6B 5B39G 5FV1L 4QRTA 3TNMB 3I6KA 4P9HH 2CJUL 2ITDB 4UNUA 4GAJH 4ZFFB 4ZOAA 5FCUH 4EI5C 3H0TA 1D5BB 1NGWA 3BP5B 3QEGL 3LSOA 3HI6H 3HR6A 4GKZB 5E4EB 4TTDC 3HC0B 4G9FB 4Z9KB 5IBUB 5K9KB 1T0NB 4GBXD 1DUYB 2V5RA 3AMKA 4NQCB 5I16A 3VFUA 2X4QB 2X70A 4F9LC 3ARDC 4PS4L 4L9LC 2DB8A 4QRPD 4HUXA 4UTBL 2JELL 3RX8A 4XNQA 2HKFH 1HSBB 1L6XA 4ERSH 4KKAD 1HILA 2VWEE 2VDMH 5CBEB 4I13B 2Y5EA 5HHVH 5EU7E 2VXSH 4I3RL 2RAMA 4OZGF 1JMZA 4PPTA 1HH6A 1BREA 4NZDA 3VXTA 2EDXA 2HLAB 2J3SA 3DRQB 1WZLA 4PJFB 5T5FL 5EBWB 2B1AH 4MDIA 5C0AE 4M43L 1KN4L 3U7YH 3TV3H 4ZTOH 2BDNH 3MYZA 1FO0H 5D9SA 1DN2A 2BNUB 5AZ2H 4X7SH 4IOFD 5CMAA 1OSPL 2IAMC 2KZ1B 3OX8A 3QEQA 1W72L 5DVNA 2QQLH 3GSUA 3O2DH 2X42A 3G5YB 4PGEB 2X4SB 4UILL 5IBTH 3PQYA 4NZRH 2I25N 3V0WL 4FG6D 3FQWB 1KGCE 4D8PA 4Y5VA 4XWOD 1B9ZA 4BFEA 3NMEA 4F3FA 5ISZD 4DOHB 4HJJH 1RZ7L 3CC5B 3W9DA 1S7SA 1BHGA 1P9MA 1A2YA 2R29H 3HZKA 4HPYL 5GSRA 5GSVA 2XTJB 1MHPH 3CMOH 3EDFA 3I3EA 3H3PH 3VGAC 5MEPA 2F8OA 3SGKA 1DQJA 3EFDL 3QDMA 5IK3A 1VACB 2NLJB 2NYYD 5JPNB 4KUZH 1CLZH 4S1QH 3VI4E 1Y0LA 3RGVA 3ROLB 1WBXB 2EDOA 3PP3H 2NXZB 3BZ4A 3RWCA 5J12B 3HRZB 4X83A 4KJWC 3AREB 5JNYB 2FWOB 5TE6H 1SYSA 3TVMC 4GS7B 1B0GA 4AM0B 3R8BB 4HS8L 2XKNA 1ZVSB 3UX9B 1EEUA 4MQXC 1TLKA 5DDHA 4PV9A 4P57B 1MOEA 1J87A 5T1KD 1BZ7A 2QHLA 3PHQB 3C9NB 5C09D 5I15L 1H9VA 3QQ9D 3SDCA 4M9OA 1A8JH 3ARGA 1OSZA 3WHE1 3TBYB 2NY6B 2V9TA 3CCHA 3MRNB 2GJ6D 3FQUB 4HKZB 2YZ1A 5T5NF 3RVVC 1CD8A 3EO0B 4X4ME 5IJVA 4KROB 5EOCL 4BFBD 4J3UA 1CFTB 4KKLC 1VFOA 5DJXB 4Y19E 5GGQH 4LRNH 1DLFL 5DVOA 4WENB 1NBQA 3NIGE 1U8LB 1QFPA 4G43A 2R4SL 5FA4B 4KI1A 4RX4D 3LIZL 3FT2B 4WNQB 4NP4L 4IIQB 4U0RB 1OP3H 4D9RE 2J8HA 1MI5B 1Z0MA 1FZOB 5J1SC 4KQ4L 5E5MA 4YAQB 4XGZA 3D25A 4D2NA 4QTIL 1FNFA 2DLIA 4H88H 3WFDH 1CDBA 2HA1A 3UO1L 1QUNA 1WC7B 5D1XA 3OKOB 2C3VA 4JHWL 5E94A 4LCYA 4Y16C 5F6IB 2VDOL 1UC6A 4W4OC 2P5WD 4R90H 1D5IL 3BGFB 2I9LA 4K9EH 1DSFL 3BD5A 1X4ZA 5IB2A 5EU3B 3T0EA 1J7VR 1N5YL 3RVUD 2YKLL 2HFTA 5HI3C 4PRHA 3MLZL 5ANMB 2D0GA 5HDOA 3RVWD 2B20A 2NY5H 4CGTA 4NQDB 3Q6FA 3W0WE 1S8DA 2XFXB 4XAKE 4KVCH 1NEUA 1NCBH 4HT1L 4DJMA 4LU5L 4GSDH 1OP5K 3HB3C 1R0AL 4DN3L 4IRJA 5I19H 1J8HB 1YEHL 3RPKA 1FGVH 4TQEH 5TQ0L 1HH9B 2ZCLH 2OBGA 3Q3GB 2R39A 5AYUH 4NRYA 5GISL 1RJZA 3SO3C 2A6JA 1A9EB 1FN4A 3CH1A 2B4CC 2A6KA 2XG4A 2NR6C 4LP4A 4U33A 4WEUD 3RHWF 2WBJC 1RZKC 4RGMC 3BDYH 2YUVA 1OWRM 4YPGB 1AXTL 1EMTH 5TPWL 5D96B 3QQ4A 4QRRA 4NN6C 2ED9A 1LNUB 3RWJA 2XZQL 1GGCH 4PV8A 3U48A 5C07D 5H2BA 5LGKA 1TVHB 3VE0B 2V7HB 2VDKH 3CFEB 4WJ5A 3QUMB 5I9QC 3MR9B 1YMMB 3PF2A 1RJYB 3FN9A 4H25A 2H3NB 1G7HB 1G7QB 3TBWB 1GC1L 3BZEA 2J1KA 2R69L 4JRWA 3CSPA 1MHHB 1OVZA 1U8NA 4KJQC 4NQEE 1I7TB 1Z9OA 4JVUA 1MQ8A 3QFDB 5KSAD 5F93C 2IFFL 1U58A 3WFEH 2A6IA 5F7HA 3S5LA 4YDVA 1CDGA 3C5ZB 7FABL 1EXUB 1FDLH 5C08E 1J5OL 2JCCF 4J4PA 2WIIB 3KJ6H 5FOJA 2BVOB 5JORA 3V7AG 1K8DA 4G6MH 1U91B 1YC8A 5BMFL 4X4ZA 4P46D 4ZQKB 2V2TA 4EUPA 4NGHH 1BIIB 4FFYL 4PRPA 4HIXH 5AZEL 3T77A 1GGUA 4JRYB 3IDYC 4EDXA 1U3HC 4M7LT 1I1AD 5DSCB 3H9SA 3QUML 1J0KA 2AP2A 2ITCB 4UIKH 4PJCA 4HMCA 2EYTA 1OAQH 3BOVA 1QPXA 2OZ4L 4FS0A 3MLVL 2BZDA 4EOWH 3I9GH 5ALBH 1ED3A 4LLAA 3VXOA 4OCMC 3FQNA 4M4PA 3IF1A 1IGML 5FO9B 1MJ7L 3UTPE 1G9NL 2AQ1A 1QD0A 3MLUL 4U1GC 5F21B 4S0TD 2QADB 2AK1H 1GYAA 3D9AH 4KKCC 1CFVH 2O26U 3FB6A 4XCFH 1IAMA 3PWPD 1YUHB 5DGRA 5MEOB 1AFVH 4TN9A 2EKSA 3AM8C 4Q9RL 4WWKA 4R4BA 3PWUA 1TVBB 4K71B 2A38A 3TZVD 1RFDH 4YC2B 4U1JA 4MNHA 3VXNA 1BOGA 4WHCA 3FO1A 2LTQB 1JTOA 4WEMB 3TA3A 1ZGLA 3V4UL 2F9BT 4J6RH 4BUHA 5HGHB 4Y4FA 3HKFA 1MCHA 4AG4L 4TSAH 1FYTA 5DJZA 4OZGA 4P5TD 5ETUA 4P4RA 5E8PB 3LKOA 3ORJA 2IQ9H 3P9WB 4IMLB 4OFDA 4IS6A 1UM6H 4I18C 2MJWA 4R6UA 4XNZB 2HLFD 1CLOL 3ULUE 1AQDB 3T2NH 1OTSD 5HDBE 4ELME 1JGLH 1AKJD 1V7NH 1NCTA 3QUZA 2W0KA 3UBXI 4CJ0A 3BISA 2A74A 4KV5E 1QFHA 1A7BA 4NZTL 1WZKA 4N0YL 1E4KC 2EKJA 4FTVA 2R1YA 3LKNA 1G9MH 4F7MB 3S35X 2XN9B 3U9UB 3N9GH 2J2ZA 4K7PH 3SDXE 5J13C 1WWBX 4W6XB 1Q0YL 3VFTB 2X1PA 4Z95L 3T4YA 2AJ3B 3DO7B 2XQYG 3IFNH 4Y4KA 5AAWA 2D4FA 3FZUC 1Z6JT 2R0LH 4DKAA 1MFBH 3QUXA 1KIPA 1RIVL 4KK9D 2UUDK 3LV3A 4U1MA 5A2KH 1JYXA 2ZCKH 2GTZA 1KPUA 1OD7A 3C6SB 1NEZA 1BBJA 4ODUB 1FV1A 4X9IA 3U0PA 3RDTC 1HNGA 2NW3B 3ULVL 3PWJB 1C7SA 4U0QB 3ARGC 3HUJB 3L6FB 3D1MC 1A3QA 1VEOA 4JQVA 4L4VA 1QBMH 2PCPA 1C12B 5EBMA 4L3CA 1DBBH 1A1MA 3WKML 4E0RA 2KBGA 3L5JA 3MRCB 3RKPA 3U83A 1F00I 2L0DA 4RDQG 4PP2B 4E41A 4D3CL 3FRUB 1I9JL 3EHBC 3FHAA 5E0QA 1DQTA 3LKRB 1HIML 1SBBA 2OXGA 3VJ6A 4X4XB 5F9JB 4KY1H 1CTNA 4YE4L 3K0WA 4KFZC 3HZYA 1E27A 3VFPA 4B0MM 2WW8A 3I02B 3V5KA 1RULH 3DMMB 3VRLF 3DX7A 4GBXA 5IGXH 5J11B 1K4DA 1DVFB 5IHUL 1ITBB 4Q9CA 3D85B 5SX4I 1XF3A 4LCWB 2NY2C 5DA4A 4QRPA 3WFCH 3FRPA 3CVHB 4OCWL 4OZFH 2YA1A 3QDJB 5FOBA 3LZFH 3MRBB 5I76A 2X4RA 2C26A 1KXVC 3TO4C 1G7MB 5SWSD 3OAUL 3CFCH 2E6QA 3B2VH 5TQ2L 4TSBL 4MA1B 5L2KB 4Y88A 4R0LB 2X41A 1XIWC 2ZOKA 4ENED 3EZ8A 4HAFA 4LEOA 3CFIC 1A6AB 1IC7H 5IEKB 1QHPA 2VJXA 3QUYC 3VXRE 3DIFB 4JHAH 1MCWW 2RHEA 4UUJA 4G6FD 3MRMA 3NVQA 5BS0D 1FAIL 1TQCC 2DI9A 3T2OA 4Z7OF 2OL3B 1JHLH 5FGRA 4Y1AE 5D1QD 3RWFB 1RZJC 4EI6B 2FDBP 2VDLL 3HNSH 1MCPH 5ISZA 4TNVK 2AEQL 3G9VA 2FHBA 5E2TH 1OT1A 3WL9A 4X6EA 1F3DH 4RGNB 4J2XA 3MLWL 1XH3B 4HS3A 1JPSL 1UA6L 1II4E 4JDVA 1FO0A 1MVFA 4OZ4B 3S5LG 2NNAB 3NCJL 4ISVB 1OAXH 1S7UA 3JWOL 3VFSB 4QRUA 4YGAB 1H3VA 5CEYB 2OTUB 3ZYOA 4B5EA 1CF8L 3RWHA 3DLQR 5FYLE 3O2DA 1O5DT 4HX1B 2VISB 5IQ7L 4G8EA 3AROA 2R2BB 3SE4C 4L8BB 4WUUE 2NTFB 1MFEH 1QFWI 3MX0A 1Z0NA 4RFEB 1RUKL 5DC0A 1A4KB 4CJ1A 4G5ZH 3L3GA 3GSOA 3MRPB 4GJTB 3U9PL 3BH8B 1IGJA 4X6BB 5DJCB 1UB5B 5IT2H 2E7LC 4NC2B 5IIEA 3KXFE 2R23B 5DEGA 5ITFB 5T1KA 4GRWB 1S7XB 4XXCA 5C09A 1JFQL 2P7TB 2CLVB 1I9EA 5E6ID 3MMEB 4PJHE 1VGEL 2GJ6A 2F15A 3JTSB 1A6PA 3TIEA 5HHOE 5JDSB 4A2LA 3TBVA 3U7WH 4NUJA 5DHYA 1K3ZA 5FA3B 1JYNA 3BP6A 1J0IA 1QEWB 5BVJA 3AXLA 5DRWB 4PGBB 2FX7L 4OSUH 3PGCB 1BQLH 1GZPA 3SKMA 2RR3A 2ZOLA 1WWAX 4L8DB 4QXGL 4FQ1L 4LHQB 1A14L 3FFDB 3V7AE 4OLZH 4RX4A 1QSEE 4XAWH 5KSVB 1HCFX 2JCCA 4CBPA 1D7FA 1DANT 4LARH 3ARFC 1BBDH 1P1ZA 1U8OB 5DFTA 3WS6C 1GVIA 3TFKD 4ZPTB 3LHPH 1PZ5A 2W59A 3GMOB 4LSQL 4ESKA 4XHJC 4I0CC 1IEAB 1JV5A 3QYCA 4QHUB 5FK9A 3JVGC 1NFIB 4PRDA 1LO3H 3GSXB 2WMPA 2H2SC 1RVFH 2DMBA 3L5WB 1KEML 2GAZA 4K8RC 3U4AA 1ORSA 1XR8A 2P5WA 5B4MD 3SKOB 3V6ZB 1EUUA 4OZIF 3KPQB 3SKNB 3C2AL 4G42B 1EO8L 2Q6WB 1LP9B 4HIHB 2AV1B 3CSYA 4AZ8A 5HI5D 3STBA 3GSVB 3IDJA 1UXSB 5KN5A 3K2UL 4I3SH 4QNPF 1WCBB 2YS4A 3KVQA 3SDYL 2ZUUA 4O58H 3RVTC 3M17A 2CKBH 2E9BA 2HN7B 4HK0B 1PLGH 43C9B 4BJLA 3NPZB 1I3GL 2NY1B 1F6LL 1W0WB 2QSVA 1HHIA 3UYPA 3MCLH 3EW3B 3D39E 2CDFB 2UYLA 4E5XA 4YHLH 1MNUH 1T2JA 4MXVF 1RZIB 2J5LC 3FN0H 1VB9A 1UZ8B 5DZNA 1EVTC 3FOLA 5KVFH 2YXMA 4X6DF 1ACYL 4KK5D 2YMXH 4NJ9H 3WIIL 4F7EB 2X4NB 2IGFH 3G6JE 1KSRA 1NEZG 2Z92B 1A7PL 2YD5A 3OKYA 4OIBA 4F7TA 5D6DA 3F5WB 2ATPA 5C1MB 4CVZB 1T7YA 4AQOA 1ND0A 4B41A 5K93A 4OGXH 1T7ZA 2VXVH 3RPIA 1L7TL 5IFJB 4C59B 4ZFGL 1FFQA 4HPOL 4JFHE 3ZKSD 3B2UC 3B9EA 4JN2A 4P23C 5C07A 3HAEB 2G9HA 1YEKH 4DVBA 3IFOA 5KBNC 3C60D 2YPKA 4EBQH 1VADB 1FFNA 4LNRB 5E8NA 3LQAH 2QQQA 5ECJE 2G60H 2VKWA 2Q8BH 1NMBL 1M7XA 3D48R 4V1DE 5FYKE 2VWEC 1RIUH 2D9CA 5EU7C 4I5BA 1YEEH 5CEZL 1J0JA 5F7KC 1WBYB 2BRRL 1WLHA 5KSAA 1T6WA 4OV5B 1ORQA 3RL1B 3VWJB 5GS0C 3NIFE 2I9TB 1QVOA 3WO4B 2ZSVA 2XZAH 1KC5H 3W39A 1WQVT 3X14A 5T5NG 1PKOA 5C6WH 4KHTL 3UAJC 3QP3A 2F8XC 4Z77A 3R0MA 5CD5D 5JMRA 3AUVA 1GAFL 1BFSA 3BQUB 1NLBH 1TJHH 1N64H 1Z9SA 3HNTH 4X7FC 3L3OA 3HR5B 5C3TA 3TC9A 4J1UB 3QXDA 1RZJL 2IPTL 3NH7H 2NQCA 3FO2B 4PJFF 3FQRB