3BIBX

Tim-4 in complex with phosphatidylserine
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
b'DTIIGFLGQPVTLPCHYLSWSQSRNSMCWGKGSCPNSKCNAELLRTDGTRIISRKSTKYTLLGKVQFGEVSLTISNTNRGDSGVYCCRIEVPGWFNDVKKNVRLELRRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T-cell immunoglobulin and mucin domain-containing protein 4
molecule tags Immune system
source organism Mus musculus
publication title Structures of T Cell Immunoglobulin Mucin Protein 4 Show a Metal-Ion-Dependent Ligand Binding Site where Phosphatidylserine Binds.
pubmed doi rcsb
total genus 23
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2007-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bibX00
2M8XA 1ACYL 4RBPH 1FO0H 5E8OA 4PYHA 3RWIB 1IJ9A 4KRLB 5I1CH 1NMCC 4FMFA 4P23B 1ZLWK 4U33A 4EOWL 4DVBB 3ZYOA 5GQBA 2NY2B 1Z9MA 4PV9A 1YPZF 5IKCA 1A6VL 1A0QH 2X09A 3V7AE 4ZD3L 5IW1A 5HHOD 5FGCB 4O2EA 1P9MA 4NOFA 1OM3L 3QDGD 2DAVA 5JNYB 4DCQB 4N0FB 3P4MB 1JYWA 4O58L 1UCBL 2COQA 2IPTH 3BWAA 4APQB 5BV7L 4G6AC 1JGLL 4MNHA 2AV7B 1H5BA 1W0WB 3ILQC 5DVMA 4G5ZL 4I2XB 1HH9A 1A3LH 5ESAB 4OCRL 1A6TA 3SKUD 4ZYKB 5DWUH 5D1ZA 4JPIA 1B88A 2LABA 4WCYH 2OI9C 4Q6IB 1EO8H 2PCPB 2EH8H 1J12A 1C12B 1KIRB 5CEZD 2FIRT 3MRKB 4U1HA 2HT3C 3BUTA 1T7VA 4N8PA 4XH2A 3ARED 4TVSa 1PYWA 4LU5L 2D03H 3H9SB 1KTKE 3LEXB 2CGRL 4U1LA 5DEFA 1NC2B 1MFBL 3C87A 1DE4A 3ZE0F 4QHLB 4JFYB 1UXSB 3WYRA 3RA7L 3Q0HA 4HH9A 4P23C 3QUKB 4L1DA 3LQAC 5AZ2H 1SHMA 2AAVA 4J4PD 3LSOB 1C16B 5HHQB 5IHZB 4LP4A 2P47B 4OCSH 3JVGA 5DDHA 2AXGA 4B7LA 2JJSA 4P3DA 1AC0A 2V2WB 1YMMA 5DI8B 1B6DA 2HLFC 3KYNA 4ODTH 2QQNH 4S2SB 3V8OA 5DJZA 3M1BB 2XZAH 1NAMH 2Y23A 4XCNA 1LQSR 1ZHLA 2BSSA 1F13A 5FCUL 3DXAE 5B38A 4HSQA 3OQ3B 1MJJB 3T8XB 1D6VL 5AZEH 5D7LA 2HH0H 3V0VA 4BSVA 5CBAA 5ITFA 1F3JA 5SWSB 1N2RB 4U1KB 5T33H 3FCTA 1SM3L 3MA9H 5E03A 2DQTL 5I1JL 1DQTA 1T7WA 1YEDB 2W0FA 1F97A 2H32B 4U6HB 3GSOA 4K7FB 4OZIA 1FORL 3D6GA 1QFWH 4R7NA 1UACH 1XGRB 2AJVL 1ZAGA 3C8KA 5DJXA 5TE4H 1J0KA 3DOSA 5BJTB 3AM8A 1R3KB 1TETL 1TETH 3TBYB 4OGXH 2KBGA 4PGEB 1RUPH 1NGXB 2ZUXA 2I5YL 3HZYA 3P9MA 4KJPC 2C26A 3SJVE 3V0AC 2D0GA 5DD1L 3QDJE 1AI1L 1MREH 2Y25A 4PB9H 8FABB 2B0SH 1AI1H 1MREL 3U6RB 5F97E 3RBSA 5HDLA 2A0LC 4M7LL 2QBWA 2PYEB 3ETBF 3ZE1F 1KULA 4UILH 1TFHA 4J6RH 3N1QC 5D7KE 1DSFH 1VFAA 1HXYB 1QHOA 3K3QA 3UBXA 4MD5A 1JGDA 2EYSA 2UZYB 1JGEB 1A7NL 4B53A 1BWWA 2XZAL 3DYMA 4G9DB 5LAXB 2HJFA 4HCRL 3WIHH 3W9DA 4U1JA 1BD2A 4QWWD 1DUZB 2HT4D 2BRRH 1NFDB 3Q5YA 3HE7C 2KDGA 3FT3A 5KVDH 1UKSA 3KLAA 2R2HB 5HVWA 4LHUG 5HHNA 1JGUH 1KJVA 4KV5F 4HLJA 3HR5A 4QRUA 4TTGA 2FECL 4XNZB 4PJIA 1FGNL 4RQQB 5D1ZD 4UT7L 3LAFA 3ZDYF 4FQHA 3ARXA 4HUUA 5BRZA 3QUYA 2ZOKA 4IOFC 3ZT5A 1MRFL 5I1IH 1PY4A 3EJYD 4PJIE 3GJFA 4QT5B 1RFDL 4JDVA 1RUKL 2R0WL 4U1MA 3UYRH 3FHQA 4JFZH 2FR4A 1CICC 4LFHG 4FZEH 3OB0K 5FGRA 5L2KB 4RNRA 3U9PL 3GHBL 5C08B 4G8IA 1IRAY 1BD2E 1DUYB 1IT9H 5EOCH 2P24B 3E3QC 2RAMA 1AGDB 5KANG 5HHPB 1NSNL 1CL7L 2RCSL 1LE9B 3C9NB 3HG1A 4L8BB 1ZMYA 3VRIA 2UZIL 1ZVSB 1QSZA 1GGCH 5F7DA 3MJ9H 4AIOA 4TUJA 1CK0H 4ESKA 3BEVA 4BK5A 1EEYB 5TDPB 5CEXB 5MERB 1C5BH 4UIKH 1UVQA 4U1SB 3MLUH 5DQDL 1SVZA 5E1HB 2A6DB 1CICD 3QNXA 2VL4A 3MRDB 5FGBC 4OLUL 5JW3H 1JPTL 3S96B 1SY6A 1BZ7A 4ZPVA 1TZHA 3CDFA 5TQ0L 3PHOA 3RWHA 5DF0A 4P2OD 1G6RH 3ZE2E 5DFVD 2DQGH 3S35X 3B43A 5CINH 2X4RA 4N0CC 5F9JB 4X6EA 3MOAH 4QHMB 3MRGB 3O41A 1BOGA 1ONQA 3L3OB 1UC6A 3E2HC 5GS0C 1KN2L 4RRPA 4PTTA 3FB8A 2HFEA 3S5LG 3BPLB 5IB3A 1JF6A 4U4BA 2NY3D 2Y06H 3TN0A 4QRSB 4I4WB 1ZVSA 1OP5H 5F7DB 2VXUL 3D85D 4R97C 5D6CA 4ZQKA 3QEQB 5CD5D 1Q1JL 3MROB 3MLUL 1N7ML 2ZUUA 1CQKA 4YO0B 3A0OA 3FO2B 4U05A 2XFXB 1YEHL 3M07A 3V79C 5HY9A 3I6GB 4LRNH 5I75B 4M9OA 3E8UL 1Q8MA 3P30L 4KHTH 3KVQA 5DUPL 2OYPA 1P4IL 1X3DA 2ADJA 2B5IC 1Y0LA 2H2PD 2ZZUT 2AGJH 1MCQA 1OAQL 3SE9H 1S7UB 1I3GH 2DWDA 1KELH 3GIZL 3VG0L 1CD8A 3L1OL 2RGSA 1B4RA 4O00A 4P5MA 4AMKL 3BP7A 1UXWB 2K7PA 3JWDC 1DQQA 4P59H 4NNYA 5DD3L 4R2GB 4MD4B 1DN0A 1DP0A 3BP5B 4UDUA 1FJ1A 2O5XL 5D72L 4ZS6D 5D71L 3TCLA 1MFBH 1L0XA 4UTAH 2D31A 3MLYL 4QRPD 1T5XB 4XCYA 4NC1E 5EORL 4D0BB 4Z78B 4ZAKB 1IEBB 4JFQA 2GK0A 3HE7A 5CWSB 5FUZL 2EDFA 4QOKE 3PP4H 1DFBL 4RZCB 1WICA 2DICA 5DR5H 5GZOD 1KXVC 1HZHL 4L3EA 4DUVA 4WTZA 1TLKA 3PWJA 5EO9B 3ORJA 3LH2H 1EGJA 1GH7A 4S1RL 4EDXB 4PS4L 1DQDL 3N1GC 3H8NA 5IK3B 2Q20A 3U36A 4K3JL 3PNWB 3VXTB 4OZHF 1RK1A 1QFUH 1UH3A 5JQHC 3F6IA 3LN9A 3HZVB 5D1XA 1CBVH 2OSLB 4K7PX 5FYJL 2IF7A 2IBGA 1FJ1B 3QDAA 4RAHA 5TDOB 4LHQB 2EIDA 2V6HA 1D5BB 2Z35B 4DAGH 3WL9A 2ZPKH 3GZKA 3QJHA 2NY1C 5D7IE 4NO5A 5FYKD 1YECL 4XXCC 4HUWB 3HG1D 4JN2B 2IAMD 4UT7H 3FO9B 1F4WH 1KCSL 3MZGB 4DOHB 3KPLA 3LY6A 4G7VL 5FO9A 2E3VA 4JZOA 1CLOH 3OTTA 1OSZB 2V2XA 1OARL 1BBJB 1G7IA 1U95B 4LLQB 4HUXA 2WM0A 3B2UC 3PWLA 2WIMA 4JZNB 2OL3H 2VLRB 5F96L 3M17B 1FSKB 1AE6L 3VG9C 4TNVF 3TNNB 4QRSA 2WIIA 3KNBB 4J7RA 1XGYH 4M7LH 3EYSL 4HFUH 5EBWB 4FXLA 3MR9B 4EQ2A 3I6LD 1RHFA 3RJQB 2IH3A 3VXMA 4Y5VB 3F7VA 4Z7OE 3K1KC 4AEEA 3QRGL 3M8OH 3U9UA 4YHNB 5E4IA 2ZUSA 4WRLA 5IMOA 3QI9B 1ITCA 1V3MA 4NYLA 4TRPH 2CRYA 3EHBD 3MXWH 4XP9L 4LCYA 5DURB 4OUUB 2DL2A 3I6LE 3HI1B 2GUOA 2PTTA 1CYGA 3SKJL 4XMKH 1U6AL 4UBDD 2SEBA 1V05A 1JZ4A 4FQLH 5GJSH 4MA7L 5DJDA 4NJAL 4F8TA 1BFVH 2R8SH 1AGBB 2VXVL 3O6FD 4GG6F 2YWZA 5BV7B 1MRDL 3RVUC 3L3DA 3V9FA 2YEZA 4OZIB 1W72B 2OTUA 4YBHA 3VU2A 3MFGB 3WHXB 3QWRD 5ALCH 3RVTC 4RRPG 1KIRA 4U1HB 4N0UE 5HGDA 4MQTB 1PQZB 4N1HB 3T4AA 3BD3A 3EO1B 3Q48A 4JRYB 4OKVB 3VMNA 4YEEA 3FFDB 3NIFE 4YXKL 3EFDL 1I4FB 4Z7WE 4LNVA 4Y8DC 4JRYD 4MJ5B 2C4XA 3SDXE 4MCZA 4JB9L 1I7UB 1U8PB 3KYOB 5D93B 1N59A 3C5JA 4LKXB 2R69H 3WFZA 4L3EE 4MSWB 2FO1A 5JDSA 4XNZC 4LPCA 1FG2A 4QWWC 5HHME 4DQOH 4PLKC 1I8KA 3RWHB 1F02I 2OJZH 5HD8D 4LLDB 3BD5A 4EI6B 3LSOA 4JY5H 1R3LB 1PX3A 4NRYB 1CE1H 3RX5A 3V5KA 4KMTH 3DXAD 4AIXA 4LP5A 3VXPB 3WFBH 4FQQA 1F6LL 5I1IL 4JO4L 3HMXL 2CDFB 3IDIA 2AJYL 2CKBL 3OGCB 1J0HA 1A6PA 1NMBL 1S9YA 4PD4J 4NGHH 4PRBB 3C6SB 4JHBA 3CFDB 2BNRE 3VFRB 3MNZA 2VZUA 3PWVA 1DEDA 4FG6C 1NGQH 4O2FB 3WFCL 2Z8RA 4K9EL 4UAOC 5GGUA 5DR5L 1U8PA 4ELMA 3UJIH 4PLNC 3O6FB 3VW3H 4HEPG 4JFXA 1IGCL 3DX9B 1RY7B 3VJ6A 2QHRH 3B9KB 3RFZC 1K6QH 4JFFE 4CN6A 4U1MB 2DYPD 5KS9E 1BF8A 1NLDL 4ELKA 1QVOB 2VWEE 2YOCA 3I9GL 4GAYB 4LAJH 4PJ7B 5D1QB 4FTVD 4JFZL 2DQHL 5HDQH 1GGIH 2GW5A 2HTKC 2JLLA 3L7FA 1U3HC 5IBLC 5LJYH 3MOBH 5CUSL 3O45A 4K7PH 3LKSA 2Y1VA 5A2IH 4WI4A 2ICEB 3SDAD 1MWAH 2IALB 1JWUB 4UBDC 1NGZA 1RMFL 4YIQB 4HIXH 1T2JA 2J8UB 5CAYB 5HYSB 5EN2B 2GCYA 2VDKL 3NCMA 4QTIH 2YR3A 3FRUA 5H94A 2R4SL 3HMWH 1YYLL 4CAGA 2VDNL 1JPGB 4WFHD 5H37H 4HW6A 1I1YA 4O51A 2DM2A 1LK3L 4HWZB 5DHXB 1HOCB 4LLVB 2X4SA 1D5XA 3QULA 4BYHA 1KPUA 1FZMA 1MFCL 4JG1L 1MPAH 4GO6B 2FECI 2UUDK 1XCTB 3DSNA 4WEBL 4KDVA 1Q72L 3U36B 4JQVA 2YA1A 4YLQT 5GHWL 3CVHL 2DL9A 4ZUUA 1ZV5A 1I9RH 4MAUH 1JF1A 3VXRE 3NTCH 1TTFA 4KXZH 1WAAA 3EJJX 5I1DA 1D5ZA 1UM4L 1NH6A 3HE6C 4Z7VE 4Z5RB 5F3BA 3ULVE 2VAAA 1AD0A 2D7PA 4NKQB 1ZHKB 2DN7A 4P9ML 4D3CL 1IGIL 1J88A 4I3RL 4JG0H 4OLEA 5EC1B 1YPZB 2HT3D 5EWIL 1MELA 1LK3H 3MXWL 4NQXB 4X7TA 2GTWA 4LLMB 1NAKL 4PJAE 1ZXQA 1S5IL 1V7NH 3QUMB 3L3HB 1B6UA 5K9JH 4M9PA 5MEQB 2XWBA 3B9VA 3C60B 4LEXL 1WFTA 2NY2C 4YX2L 5AYUH 1HQ4A 3L3JB 4MJ6A 3VFSA 1YY9D 4F15C 4R8WH 3CMOL 3X17A 3REVA 5ID1B 2BFVH 3W11C 4N0CD 5HHOA 5I1HL 1YPZE 4GBXA 3MV8D 3FAWA 3MLVL 4ELMF 5I1HH 3KHQA 3TWCH 3PG2A 5JLZA 3WDIA 3KYKL 2B1AL 2RJMA 3SCMA 5CIPH 5HYFA 1XIWB 1JZ2A 1NJ9B 4J3TA 3DMMD 3KPRD 1BX2B 4AH2A 1H8SA 4PP1D 3F8UB 2EH7L 3DRTA 4LGRB 4GXVH 1M71B 5DS8B 4EN3D 3RTQB 2OZ4H 4R6UA 2HG5A 1U2HA 1RZFH 1P4LA 1OY3B 1FHGA 4CMHC 4AK1A 3VFGL 5EU6D 4ZUWA 3MLTB 3IDMA 1KG0B 5INDA 5C6PB 5KS9A 3HCVB 3HC0B 3SDXF 1ZSDB 1S7RB 3SO5A 2F53D 3D5OF 5ANMA 2W60A 2IQ9L 2X5PA 4OB5L 4NBYB 2YSSB 1J1OL 3S98A 1WEJL 1UM4H 5ID0A 1SYVB 2VZVA 1EA9C 1BF2A 2VABA 3SE3C 5DMGC 1ZTXL 2G5RA 2EC9U 4MJIE 4PG2A 5HYJA 2J7LA 1XF2B 3KPQB 1H3PH 4HWNA 4J3VA 4MXVE 4BH7A 2VKWA 1ORSB 4RISH 3MRLA 2P5EA 4EJ1C 3K80A 1K4CA 3IFPA 4CDHA 2C1PB 4ZFOB 4NN5C 4JM2F 4U6XA 5ILTH 4YPGA 5BW7C 3K8LA 4V1DB 4UIMA 1IL1A 5I18L 3W2DL 3AREB 2EDNA 4WO4B 4X9FA 1V7ML 5E95B 1GZQB 3KLAB 1L7IL 5BO1H 1AXSB 1AFVH 4D9LH 4Z7OF 3H9SD 1E4KA 4C83B 2QQKH 1ZVYA 3PWNA 3LPFA 2MHAB 3IDMB 5AZEL 1I1CA 1A1MA 3HC0A 4RMTA 3TA3D 1EHNA 1UJ3A 1C16A 5SWSE 5E8DH 4YHKH 1PZUB 1YQVH 3R06A 5B8CC 2PKDA 4OAWB 4K07A 5HHXL 3MV9D 2R23B 5FGCE 4NM8H 2Y06L 4MQ7A 3DXAA 5ACLA 3WS6C 1HKLL 3CFKA 4HFWA 3LS4H 4KGJA 4N0YH 5DLMH 5LWYL 1U3ZA 1EBPA 5D96C 3U4BL 4P2OC 4XAKD 2NY1D 4N90D 3R1GL 4OFYD 3ECBA 4JRWA 1QRNB 4OGAD 1N4XH 5IJKA 5HI5D 5JHDE 2Q6WA 1WFNA 5HGBB 1D6EA 3B9EA 1EGJL 2ZSWB 4HIJB 5FHAL 4NUJB 3AC0A 1JHKL 2LTQB 2PCPA 3KPSD 3INUL 4XPFL 4M62L 4LDOB 3BN3B 4P5KB 1HILA 5FGBA 1WIUA 4DVRH 3QXWA 4JFHE 4F3FA 1J0YA 3MBEA 4RISL 3PGDA 4PBXA 4YQXL 3DHJA 4HUVB 2UVEA 2F9BT 1D7FA 4J1UA 5KG9A 2IPUG 4EDXA 1LD9B 1NFDA 4CVZB 1VHPA 1QP1A 5F3HA 3PP3K 4OCMC 1YJDH 2YD4A 3X3FL 2P5WD 4PJ5D 4UUJA 4HPOH 3KAAA 1ADQH 2OSLA 3L5XH 3VXME 1CICA 3WS3A 3B9AA 4ERSH 2PYEA 1KIUA 4X6DF 1EVUA 4X6DE 3U82B 4TVPL 2NX5D 2F19H 4ODBD 3EGSA 5C0RL 1QFOA 3G6JA 4FXKB 2BVYA 3CPLA 2XICA 4LCIL 4LCWD 5FGSA 2VOTA 2NY4C 4NDMA 1JHLH 4LCCB 4YHIB 4KKAC 4GW4A 4I0PA 5MENB 1CFQA 3MRNB 4YHOL 1T1WA 1RFDH 2H6PA 4LCWB 1E6OH 3O3EA 3ARDC 1E6OL 1NLBL 1BFTA 4NKDB 4QTHA 5E2UL 3GHEL 1IAIH 5TE7H 4RGMB 1JGUL 4PJCE 1F3DH 4DFHA 2W0FB 2VN4A 5JPNA 4OCLC 2FX8H 4XI5D 5IW6B 4LCCC 4OFVA 3BJ91 1RJZB 2F58L 4QXTB 4NNYB 5HYJD 3BKYL 3L3GB 4MA3B 2AJXL 5FHBL 2R1WA 5E24E 3C5JB 4LKXA 4PP1C 3RY6A 1DQDH 3OXRA 4W81A 1FNSH 2BCKA 5DJ2B 3TIDA 5CGMA 2WP3T 5CCKL 3F65A 5DUBA 4IRZH 5JMRA 43CAB 1KLGB 4HS3B 2PYEE 3PV6B 5KSUA 5GGRA 1OCWH 1JFQL 1CFQB 5JO5A 1UM6H 5HYIA 1UM6L 4NQDA 1H3GA 2G9HA 4OGAC 1P5VA 1G0XA 1RZGB 1YMHA 2NY3B 2VAJA 2YBRA 5GIRB 2NY4B 2Q86A 3C09C 5K9OA 3CVHB 2CK0H 1S9YB 4U7KA 4XPHH 4U3CA 2HTLC 1CZ8L 3QXDB 3GFUA 5JZ7D 3W0WA 3HAEG 1JWMB 3BZDA 4L5FL 3O8XD 5L2KE 2QR0B 1H3VA 3WNNA 3IU3B 5F88B 4JFYA 1I1AB 1KCRH 3SCMD 1NMCB 4L3ED 1CFBA 3OR7A 4LGSB 3WUWB 1M4KA 2AJZB 2P7TB 1NL0L 3GMQA 2OP4H 3KPSA 4ZXBA 3MV7B 4ELKB 1AO7D 3BEWB 1FZKB 1I9IH 3LRSA 4M7KL 4KI5C 5E6ZA 4BJLA 2HJLB 5CILL 1P69B 5C0ND 3WUWG 3G5XB 5B3JE 4WNQB 3NTCL 4FQIH 1KSRA 3MXVH 3FT2A 3WXVL 3X3GL 4XVUD 5EU7E 5DZOA 2R2BA 4W68A 1MH5B 2F58H 2ED8A 4LOUD 4NFBA 2CKBA 5JW4Q 1BQUA 15C8L 1PZ5B 4G6FB 3TH3T 4EI5B 4OTXL 2VXUH 5JNYA 2QQNL 3F12A 1NPUA 1QR4A 3CC5B 1QA9A 3MGTB 4K3DH 1NAML 3OKOB 5T1KD 5DYOA 2GAZA 1NC4A 4DGVL 3EDFA 4FQQB 2D4DA 3MRQB 5IR1A 5CMAA 3O2WH 3KLDA 3BPCA 3FN9A 2JJVA 2VB5A 3MUHL 2B4CC 3RGVD 1NCAL 2ZPKL 1XF1A 3GSOB 4WY7H 3S3PA 1MUJA 3FQTA 3D0LB 4PJAF 4DTGH 2BNQE 1ZT1B 1UXSA 4PBWD 5C70A 5HYQA 3BEVB 4Z77B 2JJSC 1T1WB 3IYLW 4GH7B 4Y2DD 4PJIF 4XC1H 2DOCA 5DQ9A 3VRJB 3IFOA 1T20B 2VLJE 1G9NH 2NY3C 5CJXA 3TJHD 3ULUE 1T2QL 4UB0H 4X8XA 1JNNL 2YZ1A 1MHCB 2LAAA 4ODSL 4MYWB 4TN9A 3CFEB 4ZPTA 5HJ3A 3GI8H 1F2XK 1HI6A 2DD8H 4CRPA 2DQIH 5B22A 1UWXH 4NRXB 1WC7B 1NMBH 1LDPL 3FB6A 1LDPH 3QXAA 5T1LD 4OGZA 5ANME 5BV7C 1PY9A 2J8UF 1J8HD 5AG9A 1FYHB 2DQJL 4K9EH 4DUWA 4LRIC 4MLSA 1RV6X 4U2ZA 2HJKA 4M1DH 3P30H 1FO0B 4JFPA 2P44B 3RZCB 4PGZA 2V9QA 3NFSH 5ISZA 4WU5B 3FQTB 3OB8A 3QR2A 4HH9B 5FO9B 4ONGH 1ZLUK 3MLZL 4RCAA 1QLFA 2AEQL 4IEFB 3U7WH 2H2SD 3AS2A 4Y19A 1BQSA 4QHKJ 1NQBA 1VGKA 4NO2B 2P48B 2NY5L 2EKSB 5FV2A 5E9DB 4I3SH 4ENED 5IT2L 4MSWA 1KENH 2APBA 4GMTL 4F57L 1J8HE 5KVDL 3MRHA 1LO2L 3WL9B 3GMLA 5DC9B 2XG4A 2E9JA 5EUKA 4IDLA 1T66D 4BZ1L 2IH3B 1A9EB 1I9JL 3S4SB 3BRFA 3O3DA 2P49B 1DBBL 4I9WE 1HH9B 1NMAL 4YDIH 3H2WA 4LEOB 4XC1L 3QQ4A 3EYVA 3X14B 1UZ8A 1CICB 4E42B 1U42A 1UWGH 2CRZA 3ROOA 5L6YH 5AG8A 5I1CL 2R2EB 3WXWH 1E27B 3QCUH 8FABA 1JRHL 1JHTB 1U95A 1PDKA 4G43B 4LLQA 4LSPH 1T04B 2XWTA 1TENA 3NZHH 5A2KH 4Z7VA 1GAFL 1G1YA 2NY0B 1BOYA 3RWGB 3ZDZF 2EE9A 4LQFL 4CADA 4KTEH 4N1EA 1A1MB 5FK9A 5AWNL 3VXRA 1OAZL 5DK2B 4F9PA 1MFAH 1I1FA 2QSTA 3O3AB 5CSBA 2FL5B 2O26U 4FFZH 5CSGA 4QYOA 4XNXL 1INQA 3TO2A 2Y5TA 3VGAC 3CDGB 4JFOA 3GMNB 3QRGH 2CLVB 3DTXA 4C56E 3VFVA 3RDTC 3GMOB 5I16A 3BP4A 1TVBB 2PO6B 3GK8H 1JZ7A 1NAMB 3O6LH 1IKNA 2D3VA 4RDQG 1UACL 3D69B 3DRTB 1CGUA 4MDIA 1RIUH 2OR9L 1NJ9A 1JNHB 3ZLQC 1SBSL 1NEZA 7CGTA 2BDNL 2DKSA 4PRIB 3RU8L 3NABH 3OV6A 1GPOH 3IETA 5IHUH 3JWNC 5DQJA 4JPKL 1ZS8A 3KJ6L 4Q2ZB 3V6BR 5CEZE 2HT4C 4NT6B 5FOJA 4BKLA 2AJXH 2AQ2A 4L9DA 5I0ZA 3QEUA 3LKQB 3KPLB 1J1PL 2A83A 2IFGA 4MQXC 2ADIB 3MROA 2VITA 4BQ9A 4CVZA 1EFXD 5J11C 3O2VH 4K94L 2NXZD 5BS0A 2Q8BL 1HHJB 1IAIM 4OQTA 3DLQR 1CT8B 4JJ5B 3KPTA 3SKOB 3FFDA 5FUCC 3BIKA 4UV7L 3T0VA 5H35B 3JBG7 2FBJH 4NNPL 3HI5H 1T83A 5DD5H 4LPTA 4J3WA 4OSUH 5DD5L 4H0IA 4K8RC 2ITDB 1KJ3H 4U6XB 3VXSB 5JXED 3CX5K 4UIMB 1SBSH 3RGHA 1J8HA 4G3YH 2AJ3A 4UT9H 4F7CB 1FG2B 1EJOL 2V9TA 4C59B 2YD3A 1H8OA 1CDGA 4JPKH 2K7QA 4EXPX 3ZTNH 2WUBH 3QIUC 3DVNB 3GJFH 2VKXA 5AUMB 1FCGA 1WWCA 1MCWW 4XX1G 5IESL 4GUPB 4TULL 4KI5D 2EO1A 4WO4D 2Z92B 1MCEA 1S9WA 3CFKB 3ARBB 3N1MC 3U48A 2VITB 5JOFB 1AY1H 4H20H 1U93A 1G7LB 3IXTB 3MCKA 3OG4B 3DXAB 3PP3H 1BIIB 1C1EH 5T1DL 2P1YA 2M26A 1NUDA 5FF6B 2AEWA 4YC2B 3BQUA 4O4YH 4CN4A 2W0PA 4K7PL 1X5LA 2DTML 3ROOB 2DQEL 1MVUB 2OCFD 2VLLA 3WIHA 1XIWA 3DMMC 5C71A 5DEFB 1A7PH 1XIWC 1S7TA 1OF2A 3RVXC 3UC0H 1M1SA 1AP2A 3MRCB 3VG0H 1FRGH 1N0XH 1SEBB 3GIZH 3GKWL 2VRAA 3LKNA 4LVNC 5JA8B 2F74A 3AB0C 2DI9A 3CK0L 4FMKA 1QFWL 2P5WE 3OKMB 3GJFB 2IEPA 3GBNL 3TP4A 3DETD 1MJUH 3W5MA 4F15B 3QCTL 3ILPB 2R4RL 1R3JB 2XPGB 3GMNA 3NCFB 3DTXB 1D5MA 4A6YB 1S5HB 4OD1H 4NZRH 1SY6H 1P4IH 4PJBE 3P4MA 5CINL 5J9PA 3AB0B 1A6AB 1ZHKA 3FB5A 4YHPA 1WSST 3DUUB 4DK6A 5KN5B 1J8KA 5LBSH 3VW3L 5HHXH 4Y16D 1YC7A 1A22B 2QSCL 3QUMH 3C9NA 3CGTA 4C58B 4KK6D 3O3BB 2F53E 3P11H 2YPVL 4NWUL 4W6XB 3MREA 4F9PC 3I75A 3BGFC 5DA4A 4XT1C 5T1DH 4OCWL 4AT6B 2ZG1A 2DJ4A 3RIAF 2EDDA 4L4VE 2GKIA 3RWDB 3PHOB 3T4YB 4JEGB 4X9HA 2BVPB 2QLVB 1WZ1L 1I7RA 1NGXA 4S11A 1KJVB 4XCCH 2GSGA 1MFDH 1UEYA 4GRLC 1ZKAA 1MFDL 2FBOJ 5SWSD 1MQKH 4J3SA 4NO0B 3MV9A 3THML 5I76A 1U8IA 3DUSB 5ICXB 3VFNB 2NZ9C 2XNAB 3OXRB 4TOYL 3MODH 3T0WA 2JB5L 1MAJA 3KS0H 2XT1B 3OKLB 1ZGLB 3SGEI 3WO4B 1JWUA 4HHAB 5IFJB 3FFCE 4YX2H 3S36H 3C2AL 1NCAH 2IQAA 2NR6C 4NO3B 2VC2H 2W9EH 4LLUB 1JGEA 5GSVB 1OM3H 2YD7A 4KK9C 5FA4B 1RU9L 1TCRA 2JIXA 3TGXA 1CDHA 4EEEA 3TWCL 1O5DT 3MXVL 2Z4QA 4YFLF 1NCCH 5EDXA 3LRHA 1OP9A 1Y0LB 2E9WA 2EZ0C 3X13A 4WTXA 2B1HH 3HS0B 3P77A 4GW5B 2X70A 4PJXB 5C7XH 5J13C 3QG7H 4JFHD 4P3DB 3KS0J 5K9OB 1K9TA 4MJID 2BVTA 4O2EB 2VXSL 1KCVH 4NNPH 4JRXA 2JJTA 1ZHNA 2YK1H 4PGEA 5LXGL 5F72S 4F33B 3WUWA 1I8MB 4XMKL 5GJSL 3DGCR 1B4JH 3QEGH 5F1OB 2EYRA 1E28A 5EC1A 2ZJSL 4LSSL 4KMQA 4PRDA 1RUPL 3OPZH 4QRPA 3MRMB 5I15L 5HHVL 3SPVB 3S37L 4XAWH 3A67H 2GJZA 1QLFB 3L3OA 4OI7A 1KBGL 2M1KA 2Z8VC 3HE7D 4JZNA 4NRZA 4Z18A 1XR8B 4GXUM 1YYML 3QDMA 1GOFA 5ACZB 3HPLB 1JGDB 2EYSB 5ALCL 1Q0YH 2Q76B 3VDCA 3CLEH 2KZWA 1T7ZA 4RX4D 1MCFA 1OGTB 3MV7D 3F58H 4XNUH 4GG8A 1C1EL 1BLNB 2VSCA 3MNVB 4HZLA 4DWHA 1BVKA 2F53A 1II4E 3WLWD 5EOTB 3JTSA 1Q9WA 3S3SA 5F1IA 3T4AB 1IGML 1OPGH 1P7HL 4NWTL 4GXUN 2NPLX 4QKXB 1NBZA 5A2FA 4H8WC 4PRHE 4H25B 5HGDB 1EUUA 4OFYA 4MA3A 1IGJA 1T0NA 4X6EB 1OSPH 3VI3E 2QHRL 3JV6A 1V3KA 2XY2A 4YPJA 4P23A 1RUMH 1RJCA 1ZT1A 2XTJE 1FVDA 2K1MA 2WP3O 4KV5E 2FR4B 4U7SA 3EOBB 3FMGH 5KBNC 1QEWA 2YA0A 4ZDHB 5IFHH 2IPUK 3R1GH 1TPXC 3QIWB 1EPFA 3ARGA 3SKMA 4ZFGH 1NLBH 4KUCD 2D9CA 4JY6B 1MI5D 3MRFB 4ZXBC 4X4YB 2Q86B 3V4PL 5FKPB 4NQSB 2ZUQC 4OF0A 1E27A 3HG1B 2I26N 3TO4B 3JTSB 2R1YA 1AGDA 3UO1H 3VXUA 5MEOB 1HH6B 3CZJA 1ADQL 1C5CH 3L5XL 1N5YH 3RVVD 1KTLA 5EULV 1KNOA 1MVUA 4FZ8L 2DKUA 1S7WB 4S1RH 4YXHH 1YEIL 3T3PF 2WZPD 3QXUA 3VFRA 1IQWL 3ZDXF 1PW3A 1IQWH 4M6NH 4ZXBB 3GI8L 5TE6H 1K4DA 1HSBA 5JXEA 3CXDL 4UINL 2K3TA 5EZJB 4IMLA 1CFNB 2YD1A 5SX5H 2H3NA 2AKRB 1YEHH 4G8FA 4HX1B 4IRJC 3SQOL 5T3ZE 4QHUA 2OS7A 1A4JB 1U92A 3B9DA 2X9YA 2IC2A 4M8VA 3C5ZA 2D7NA 1MCBA 2SEBB 4G3YL 4HIHA 3GBMH 4F7MA 2BJML 4QF1B 4EXKA 4JN1H 5IVZB 1IC7L 1AKJB 3G6AA 1QA9B 3MGTA 3IB4A 4RMQA 5JZ7C 3UEZA 3CZFB 5BRZE 4LAQH 2P8PB 4BFGA 3BUYB 1T2QH 2IGFH 2R4RH 5T1LB 1JCKA 1QRNA 1SJXA 4KPHH 4MCYB 5E6YA 1JN6A 5FYKH 1PLGL 1ZA3A 4RDQF 4ZD3H 5T3ZD 4L4TD 1WT5C 5K33A 2X1PA 3HZVA 3SDAA 1X5ZA 4XTRD 5DJ8A 3GUTA 1AHWB 2B8OT 1PG7W 5MI0C 5C0DA 3V95A 3HPLA 4OM0L 4CNIA 3CSYA 3NN8B 1IEAA 3QEQE 4HX1A 5IHUL 3ZDZE 5IW1B 4PB0L 4DKEL 3HI6H 3BKJL 4XNMB 1M05B 3CDCA 3K2UL 4J23A 4PD4K 2CDGA 3TJHC 3OX8A 5I30L 4E41E 4N9GA 1P53A 3PQYA 4YZFE 2FL5A 5F93C 1GGCL 2F5AL 1LD9A 2NQCA 4L1HA 1JVKA 1GJIA 4U1IB 1JF1B 4K3DL 3TZVB 5F7LB 5FXCH 3FB6B 3AMLA 4MJ2A 4LOUC 4OLZH 5E6IB 4Z5RA 3QBTB 3CSBA 2UY6A 4LEXH 1Q0XL 2VNCA 4O9HH 4JAMA 3KR3L 4UQ2B 1KV3A 1M6OA 3WE6B 3A6CL 4RA3A 3UTPD 2YWYA 4Q6YA 2FIKA 2HVJB 4LCCA 5HHVH 1CE6A 5CILH 3MYZA 3QPXL 1WFOA 1N6UA 5M7QA 4HKZB 3ALWA 4NHUA 4NCDA 3UDWA 2Z4QB 1P84K 2ZSVA 5F89B 3L5HA 3STZB 1NBVL 5BS0B 2VLLB 4FQJH 4HKJA 3WXWL 1QLEH 1F4XH 1OB1A 5F44A 2ADIA 4GXVL 5LVEA 2A6KA 3VD7A 3VFPB 3TBYA 3NMEA 3LEVH 1QG3A 2EDYA 1FH5L 3IDGB 4XNQB 3I84A 4P23D 4MMZC 3UYPA 1A6AA 3D9AH 3KPRE 3V8CA 5J11B 4KVNL 3V7MA 3D3VA 4ODWB 3KHOA 4U1GC 3ESUF 4MCZB 4U1NA 1W2KT 5HYQB 2KUTA 3D1MC 1EDQA 4LEOA 2GJ6E 3MO1B 2ICEA 4GMSH 5E1AA 5T1MB 3PXJA 5IB3B 3LH2L 3OPZL 2H8PA 3ULVH 1MIML 4U1KA 2XQYK 4JR9H 1MIMH 2L7JA 3PJSA 1CK0L 4HJJH 4U1JB 3TT3L 4B0MM 3RWFA 1A47A 4FHBD 2XZCH 1RVFL 4WHTB 5CZXC 1FFRA 2IFFL 3V4UH 4KJWC 3T1WA 2EDBA 1XF4A 3UTOA 3IS0X 3D39E 4J8RA 1ORSA 3DGGA 4MX7A 4M5YH 1CDIA 1D9KD 4HQQH 3FONB 1UENA 1XCTA 3O3BA 1GXEA 1CDJA 4F7EA 1XAUA 3QXDA 2XI9A 4YWGH 5ICYB 2ILLA 2ICWB 5HDOA 3UROR 3CUPB 4B41A 1GZPA 1FFPB 3RWCB 3I50L 4KKAD 4BQCA 1EMTL 2BY0A 3BD4A 5C9JA 1JNNH 1ORQA 1NC4D 5DZNA 4DN3L 1U8JB 4XCYB 2MHAA 1ZWIA 3NZHL 2Y72A 3ZT7A 5E08H 4WFHE 5DEGB 4PRIA 5L2KA 1AGBA 4KZEH 5C0JA 2I24N 4N5ED 4P48A 5J0BA 3IJYB 5EOQL 1XFPA 2QSQA 4V1DA 3VI4F 4FFZL 2NY6D 2V7HA 1NKOA 4M62H 4BZ1H 2IANE 5A43C 2E7BA 3BWUC 1EEQA 4HS8H 4NQDE 5L7XL 4GLRH 1U8QA 2VLKB 1MCOH 4RX4A 4OT1H 5AYQA 1OOAA 1FFPA 2DF3A 1FNGA 2YKLH 2DLEA 3QFDB 2XZQH 1TTGA 3MLYH 4BFBD 4NSKA 2AABL 2Z8SA 3MLXH 3TCXA 2GJZB 2RR3A 1SY6L 3L3KA 1CGSL 2XACC 1KB5H 3HNSL 4J4PC 5KG9B 3EOYG 1CLZH 3AM8C 4R9HA 4PJDF 1CLZL 1V8HA 5KOVC 3UJIL 1ZA6B 4G7YL 3BKJH 5AUMA 3WHE0 2OMNA 4Z95H 3JWOH 3DV4B 2VIRA 3C5ZC 3TPKA 4X83A 1IGTA 1K6QL 5DUBB 4I13B 4Q58C 4Z76A 3ARZA 1CTOA 3VE0A 4M6NL 5TPWL 1QO3A 2P5EB 5DZLA 3IDXL 1G7HB 3CNKA 1VA9A 4MNGA 4LLVA 1XF2A 1F4HA 3MRKA 4KJWD 2OX5A 5CIPB 1NDMA 4GKSB 5LCVH 1X5JA 4FFWC 4NPYB 1SEQL 4F58H 2Q7YA 1H3XA 3OKLA 1XGRA 4LVOC 1TIUA 1E4XI 1ZK9A 3V4PH 1R5VA 2UZIH 1MLBB 5LGHH 1DE4B 5JR1L 3BP5A 3VWKD 5I1DB 2C7UB 2XRAL 3LZFH 5IB5B 1DQQB 4HC1L 5JPNB 1FAIH 1Y6KR 4M6OL 1DBJL 3EIFA 3OX8B 3X12A 1QVOA 1D5ZB 2BVQB 4GAYA 3TLRA 3WO3B 3KXFA 3HS0A 4GW5A 4K94H 2OZ4A 5I18H 1HHGA 1YJDC 3BT2L 2B4CL 1CGTA 3KLHC 1FZOA 4PJBB 3G9VA 4HFWB 5F9OH 3SGKC 5F9WB 3KYNB 2YRPA 3U9PH 3UTTE 4YHIA 3ARFD 5GGUB 1OQXA 1FVCA 3H3KA 3TVMD 4PJEA 5C0NC 4BM7A 4KAQH 4HC1A 1EJOH 1XH3B 5HGBA 3DIFB 2OJZL 4LSQH 4ZTOL 1N6QH 4PJCA 3GJFK 3O2VL 3BMWA 4XBGA 3QUKA 3PNWA 4J12A 5FO8B 3AS3A 1NDGB 3FT4A 4MXWL 2OR8A 4G80B 2FB4H 3W82A 4YHLH 1IKFL 2X1WL 4L4VB 4M5ZH 2FNBA 3MBXH 3UYRL 3BN9C 2AP2A 4MA7H 5C0BA 4J1UB 4OM1L 1HHKA 2BDNH 3H7LA 4ZFZB 4ZUUB 2IPKB 5DTFB 5IMOB 2Z8WC 4OIAA 5FB8A 1A21A 3HZKB 4TNVK 3IDJA 4XCNB 4I0PD 2L4OA 4WHYH 4BFIB 3VGDA 4QHNA 2QHLA 4NCC1 7FABH 4JPIB 2Z9TA 2VZ1A 4FQCL 3LQZA 3W11D 4X6CA 3WFEH 3QULB 1QLEL 3L3KB 4K23L 1WGOA 3DX8A 4KK6C 3G6DH 1URLA 3UBXI 1G7JA 4OIIL 3MNZB 3GGWB 2OQJA 1U8MA 2DM3A 3OMZA 3L3DB 1H8NA 3GIVB 4PRHD 5F70A 3P0VL 1ED3B 3KR3H 1X44A 4RSVA 2DQTH 5I15H 4U1SA 1TXKA 4QRTA 4Y5VC 2OXHA 4U6VH 1TPXB 3QIWC 1U8HA 3V6OE 5D9SA 2GQHA 3ABZA 2NX5B 3DETC 4LASL 2P46B 3CLEL 3NCEB 4X6CB 4NC0B 4XPTL 4ODHL 2W9DL 3VXSA 1BM3H 1N8ZB 3JTTB 3JV4A 3KPMA 5I17B 4HKBB 2CUHA 2CKBB 4S2SA 1IFHH 2KL6A 1FCCA 1ORQB 3P4OB 4PR5A 5GGRB 3VFOB 4AZ8A 4R7DA 1AJ7H 4PJHF 1SYVA 4U1IA 3MRIA 3HMWL 1UZ6E 3TM6A 2DQJH 2W60B 3N1PC 4FQPA 4KKCC 4BH7B 1F4WL 5EFIA 1OLLA 2VLRA 2DLTA 3O81A 3IJYA 3OAZH 3NCYP 5JUEL 4XPBL 3VRIB 1Z9SA 3WKMH 3GMMB 4WHCA 5ERWB 4F80A 1AKJA 4YXHL 2PYFA 4PS4H 4XB8A 4WWKA 1RIVH 1BAFH 1NBYB 4RQQA 5MEPB 4YEFA 1MUJB 4JHAH 3RIAK 1FBIH 1EHAA 4DVBA 3PGDB 1F90H 4WW2A 3I6GA 5DD6A 1QFUL 5FYJH 4HJGB 4HKZA 3MTRA 2XWJA 4M6ML 4PRNB 2C4FU 5T1LA 4F58L 3VA2C 4YNYA 1LEIB 1IGJB 2A38A 2FX7L 1JGVH 1YNTA 2EDOA 5F3BB 2C3VB 3H7BB 5DWUL 1OTSC 4LCYB 4P9MH 4D3CH 4ZYKA 2NTFA 3N9GH 4UAOB 5IMMB 2XRAH 2MQ3A 5EH1A 1ZLUH 4AMKH 3T0XA 4PY7A 1U3YA 1AGCB 3WKML 2FD6H 2ITCA 4Z7UB 1TVDA 5L6YL 3S8WA 3HB3C 5D5MB 1JMZA 4ETYA 4HS6A 4XBPB 4X4YA 3O9WD 4MZ3A 2YXFA 3FL7A 5C0CA 3EFDH 5J56B 1BD2B 1NCNA 4YE4L 2Y07L 3HNSH 5LAXA 3N1FC 3QO1A 4L3EB 4KGLA 2X7LB 5EU3A 4BZ2L 3SPVA 3T8XA 1U91B 1MI5E 4OLYH 1GC1H 1C7TA 4EQ3A 4ZAKD 4GJTB 5IROC 3VXRB 1AIFA 2CR6A 3OBAA 2NMSA 3CVHA 4WCYL 5JPMB 5E2VH 3TBTB 4EI5C 4WI5A 4OZHA 3TN0D 3ZYJA 2HG5B 3ZDYE 1A9EA 3RWDA 4K3GA 5DFVC 4Z6AT 3GSWA 1UKTA 3PHSA 3VXQB 4HH8A 3EOTL 4JM2D 2PR4L 4OLXH 1CGWA 1E4WL 2BCKB 4LSUL 2JKXA 3V5KB 1F3DJ 4X99B 5FAAA 1L7TL 3SKNB 1T2XA 4FOMA 4P3WA 1JYXA 5C09D 1JL8A 3X3GH 4W6YB 3T1FB 5GS1B 5D5ME 7FABL 2APXA 4TPRH 2V2XB 4P2YA 3K8KA 1UH2A 1FNGB 4J3OC 5CHNB 3TYFA 1IAKA 3G6JF 3WFEL 5F6IB 1PG7L 1ZGLA 3CLFL 4HMCA 1HDMB 1LP9F 1KFAL 4QYOB 3BKCL 1ZA3B 4W6WB 5D1XC 5CZKA 3X11B 2PO6D 3S3JA 4MA1C 4P46B 2ZG3A 1KTDB 1RZFL 1WQVT 4TQEL 1TMCB 4YHYB 2GYSA 1KJ3L 4YZFF 3MRHB 2ADGA 1OTUC 2H45A 1EO5A 3HNVH 4LARL 3VH8G 2VLRE 1S8DB 4QHMA 4XX1E 1IAIL 3RZCC 2CO6B 3BXNA 3GMQB 3QDMD 3QZWG 5GJTL 1DVFB 4HJJL 2VXQL 5CJ8A 3IS1X 5J6GB 2XZCL 3ROLB 1BJ1H 1G6VK 2EYRB 1ZA6A 5C0GA 1MAKA 3CAFA 3EYQC 4YHOH 1YEIH 3Q6GL 3PWJB 3HE6D 3OAYK 4NQED 4PRAA 4HZAA 1I75A 2ENYA 5DURD 4GG6A 1IKNC 1A7QL 1W8NA 1RZ8B 1DZBA 3QWOB 3OKOA 5IVZA 1DLFL 1TQCC 2NXYD 1EHLH 3H3PH 2I60H 1RPQA 1S9WB 3MRQA 2ZSVB 4NPYA 4NCC2 1YMME 1R24B 2DJUA 3QSKB 1GYAA 2MQ0A 4CVUA 3H42L 4XVTH 2N7BA 5EA0H 2Y36L 1QR1B 3I3BA 3K74B 2OTPA 2AS5M 4H8WL 2X42A 3D69A 4Z77A 1SEBA 4FQ2L 4ONHA 2B2XH 1XR9A 3BEWA 1UJ3C 2C7UA 3LRSB 3V52H 4QNPE 4TQEH 5B38B 2UUDH 4WUUD 5D71H 3LHPH 3T04D 3MO1A 3TBTA 3LV3A 4F7TB 5CD3B 3FT2B 1WC7A 3GO1H 3R4DA 4KI5F 4LBEB 5JW4R 1K8IB 1MCDA 1L9NA 3Q6FB 3FB7A 2XOTA 3INUH 5FUZH 2R23A 5KSVB 4OZFA 3QHFL 5DJDB 3L1OH 2WIIB 1DFBH 4JO2L 4MJ4A 1FFQA 4MLIA 3JSSA 5DO2C 1WBXB 5DJAA 5DQJB 2A83B 5EBMB 2QQLH 2YEZB 3OGCA 3QQ9C 3JUYA 4G9DA 1MFCH 1QO3B 1CI5A 1T89A 3U0PA 4JRYE 5J4MA 1CXEA 2EIZB 2ED9A 1QSEB 3IDUA 3LS5L 2QV2A 3TV3H 3SCMB 5IR1B 2FIKB 4N0UA 4OUUA 4OM0H 4UZGA 3ZKMD 4ZS7H 5I6XC 4WGWB 1MFNA 1U8LB 5D7IA 2AJ3B 4XMLL 5JXEC 4PJ7E 1LVEA 5A40E 2R1WB 3MA9L 4OZGE 1HK6A 5HHQA 1XF3A 3OKDB 3DWTA 2JIXD 3GMPA 3KWWB 3TPUB 2YPLA 2F5AH 2YSSA 3VFVB 4JQVC 4JKLA 3TZVA 3U7WL 1FL3A 1I3UA 1A8JH 3DRQA 1C08B 3FRUB 2E9BA 5H94B 5KOMC 3RL1B 4TVPD 1BEYH 5C6TH 2GCYB 2YKLL 4I0KA 1WTLA 3B9KC 2QADB 1GGBH 5DXWA 1VEOA 5MP6H 3FO1A 5I74B 5L88L 1O0VA 1IMHC 2R2EA 4G6KL 1XR8A 1U93B 3IXTA 4QLRA 4HF5L 5CGTA 4CU8A 4LDLB 3AREC 3BO8A 3LPGA 1JGLH 3W81A 4LCUB 5ICZA 1OF2B 4PJ9D 2G60H 1A6WL 4U7MA 2YUWA 3VWJA 2H6PB 1JWMA 4LSTL 4TUKL 3H9YA 2R0KL 2HFGL 4QT5A 1EO8L 4APQA 3BRDA 5EIQA 3MYJB 1KIQB 3BKML 4UNVA 3FQNA 2EH7H 3MJ7A 4OTXH 4Y5YC 2MJWA 5D1XD 2F5BH 4HLZG 3P9MB 4NYLB 2J6EH 3MA7A 3MCG1 4LU5H 4NO2A 3GMLB 4PY8J 5D1XB 1U8HB 3TJEH 1H0DA 3WBDA 4O4YL 4PJXA 3TESA 1UQSA 4YIQA 4LLMA 4KROB 4AQOA 5FECB 4NN7C 4R4FH 5TGBB 4WWKB 3AROA 3TIDB 1BHGA 5ISZB 1BPVA 1NC2A 2O5ZL 4K94C 5EO9A 1QPPA 1OAQH 3SE9L 4KROD 4QHLA 1FYTA 1KN4H 4MNGB 4JR9L 2RHEA 5JW4M 2NY7H 5E2TH 4X9GA 1GHFL 1KLFA 2VDOL 2VR4A 3LS4L 1NCBL 4TSBL 5JORB 1T04A 1MEXL 3B2VH 3WFHB 1M7DB 1HWHB 2DDQL 4X7SL 3VGFA 1S5IH 1V7NL 1G7QA 4JO1H 3S96A 2DS4A 3MBEB 4Z0BH 4ZFGL 4XNUL 1A6VH 4NKDA 4M48H 5MEOA 4NC1C 2NTFB 1K8DB 3D9AL 3W0WD 1KNOB 1PGRB 2WW8A 4S1QH 5DQ9B 1P4LB 4WUUE 5IQ7L 2D7OA 1Q0YL 1UWGL 4FQCH 3S5LA 4PGBB 3H3BC 2ORBH 3RTQD 3IVKA 1DQLH 3S6CA 1ROWA 5L2JB 4TRPL 1H15B 4C56D 1WZMA 2WINA 5EU6B 3SE4C 4AG4H 1N5AA 3DMMB 1YEDA 4KZEL 5EBGA 4X8JB 4Y8AA 2R15A 4MB3A 1B4JL 1KENL 3UMTA 1FO0A 2Q3AA 4RIRA 2ZJSH 4LSSH 4YJZL 4ZFOA 4I18C 5D5MA 5ADPH 4B5EA 4WHTA 1KLUA 3NA9L 3NA9H 4OF3A 1BVKB 2F53B 4M1CD 3MRIB 5ADOL 1JPST 4ELMB 3VDBA 1L4IA 2CIIB 2OBGA 5FHBH 2R1YB 1IC4L 2Z91A 3GNML 1F6AA 5IEKA 1MQ8A 3REWB 1CLOL 4NSKB 3BHBB 2DJSA 3PUCA 3HRPA 5A3ID 4V1DD 1KGCD 1NEUA 2VXTL 4XP4L 2N7AA 3B3IB 2AK4D 4URTB 4ZUTB 3EOBA 1EAJA 5T5NF 5ANMB 3F7PC 2ARJA 3EYVB 5I30H 3QIBC 1MHPH 3MRMA 3LV3B 2BVUA 4RFOH 4ZOEA 1A4JA 5GGTL 4Z0XA 3STBA 3D3VE 1IC7H 1CFNA 1HCVA 1S9VB 1YMHB 2WMPA 4NO0A 1MCKA 1FIGH 1VACB 2J5LB 3L95A 4M02A 5HHOB 5D8JH 1B0WA 5DYOB 5D93C 5J3HD 4G8IB 2WLZA 4HWZA 1BEYL 3MOBL 5C6TL 5FV1L 3G6AB 4UQ2A 5MHSD 2MNUA 4FQHB 2CIKB 2X1XR 1DLHB 5TDOA 2UWEB 4PP2A 3WJLA 1H3UA 1I8LC 4JFED 4AT6A 1YJDL 4WTWA 1EGJH 3PL6A 5HVGB 3CFIC 3NABL 5IBUG 3MREB 2IG2H 1FN4B 2IG2L 1TCRB 1LO0L 3QCVL 1G1CA 4IMLB 5C0EA 5D9SB 3NOIA 2C9AA 1MWAA 2P7TA 3HZYB 4G8GB 4YDVB 4Z95L 3KPSB 3U30C 3L9RA 4YQXH 1T3FA 3QUML 1MIEH 4JO3L 2CLZB 4XNMA 1CD0A 1HHHB 3U2SB 2VR9A 1BD2D 2XKNB 4K55A 2J6EA 4EIZC 2APFA 3U46A 5BCAA 2VQUA 2ZUYA 4AY0A 3VXQA 4Z78A 3G5YB 5AEAA 4TUJB 1NKRA 3QCTH 1IM3A 3BAEL 4PLKD 5GSRB 4OGYL 4A6YA 3ULUH 3LEXA 5KVEL 4M3KB 1CVSC 4GRLA 2CIKA 4G5ZH 4NT6A 4NQSA 1OTUD 3C6SA 4FXKA 1A7RL 3MRNA 4NZRL 3CC5A 1NGYA 5IM7A 3GSUB 5CZXD 1KJ2H 3OJDB 1B0RA 3TA3A 3QRFM 2X40A 4YHNA 5FYLD 1KCUH 2BNUB 2HWZL 2AI0L 4X99A 2F74B 5TF1L 3X13B 5IK3A 4I48A 1U9KA 5FA4A 3EO9H 4XP9H 4RGNB 2ATKB 5FDWA 5T3ZL 2DLIA 4OLUH 1T3FB 4CADB 4EBQH 4EBQL 4IJ3B 4A6YL 2V2WA 5DI8A 5CJ5A 3V4VH 1LO5A 1PLGH 5C0BB 2AXGB 4AQ1B 5CJQH 4M7KH 1QYGL 1OCWL 1HSBB 1NGQL 3J7HA 4KJQC 2P42B 4ZQKB 1OGAD 5ETUA 3PWPB 2J8UA 3H3PL 4ZOBA 5EZIH 3PDGA 4XMLH 3BSZH 5DMIL 3T3MF 4LNRB 3BMVA 1C8PA 3QIUD 4FQXA 1T5XA 1Q94B 3T3ME 3NPSC 2ZSWA 3GKWH 3J8F7 2VWEC 3EDEA 4IOFD 4JE4B 5FDYA 4GS7C 4O2FA 3CCHB 1IC1A 1EV2E 4HT1H 3RIFK 3TNMA 1DDHB 1S7UA 4FQ2H 3ZHLA 3EJZD 1X5YA 3HI5L 5F6IC 3TN0C 5GRXG 4ISVB 3CXHJ 4UU9A 2E7CA 2DWDB 5D5MF 1H3TA 3QNXB 2WBJD 3IFNL 3U0PB 4H5SB 2EE3A 3ARRA 1A9BA 2J12B 4GAJL 4NRYA 1DR9A 1BZQK 1T7XA 1A3RH 4BSWB 4H1LB 2GSIA 4NQVB 3R06B 5HDBF 3HE6B 4RZCA 2BNQA 2EE2A 3DX7A 3AS0A 4ZAKA 3KJ4B 1JNLL 2CRIA 4MD5B 2FSEA 5FYLL 1S5HA 1EAPB 3STLB 2X2YA 4WJ5B 3IETB 4K3JH 2FO4B 3K0WA 1IGYB 2VXSH 5HYSA 2ZKHL 2NW2A 4XTRC 3QFJB 4OLWL 4KQ3H 4QRQA 3C5ZD 3X3FH 3WJLC 5C1MB 2H3NB 1MRCH 5D70H 2FGWH 2ENSA 4PJ8A 2X4QA 5A16B 3HNVL 4JY6A 4GBXB 4HIJA 4G6ML 1MHPL 2YA2A 3LEYH 1N2RA 4OLVH 2HVJA 2Q6WB 4PJEE 1G7HA 3V6FA 4UQ3A 4F37F 5DRNA 1YMMD 4KJYA 3U0WH 3ULVC 5JIIA 4YDLC 1OWRM 4KK8D 1T0MB 3U0TB 5BVPL 5H35A 4U6YA 1P2CB 5ELIA 5EU5A 3HUJE 5T1KB 5DHYA 1OP3H 5C0JB 3X11A 5HI4D 2ADJB 1AGEB 5EWIH 1A7BA 3GIVA 3CDGA 3O6LL 5I75C 1LO3L 2J88H 4YK4C 4PGDB 4P59L 1IC4H 5D6DC 5E8OB 4HDIB 5I8KL 4QEGA 1RJYA 4GS7B 4CW1B 1UQSB 5FECA 1P84J 3E1F1 1YNKL 3DX7B 2X89D 5JDSB 5KS9B 3OKNA 1AD0B 5IF0A 4OKDA 4LMQI 1VEPA 3VFUB 4HF5H 2BK8A 5FYJE 1CWVA 1XGQB 3DV6B 2ICWJ 1PSKH 1ZVHA 5C0IA 3BIAX 1IEBA 3PWUB 2HKHL 2AV7A 3CD4A 1CQYA 4RNRB 2PYED 4LHUD 1VENA 5TE4L 4G7VH 2OR7A 3KNBA 4EOWH 3T0EC 3DJ9A 2X4PB 4X80L 2PW2A 4LHUB 2WQ8A 2ZOLA 1U2CA 3F7VB 4K7PY 2V7NB 2ZCHH 3SOBH 1UZ6F 2QQKL 4LQFH 3QIWA 1JYNA 4B7IA 3K46A 5GZNC 1OT1A 1E4KC 4O9HL 3MACH 1Q94A 1FNEB 1UVQB 4FQXB 2KKQA 5B39A 4JZJC 4X6BB 1VERA 3I02A 1LO2H 3S4SG 5L0QC 4WW1B 1WV7T 1IM9A 3NFSL 4R97B 2O5ZH 4H26A 2AJUH 3PL6D 1AO7A 3B83A 1S7QA 5F7EL 1M05A 5CJXC 4IRSA 4KJQD 3P4NA 3JWOC 3OKMA 3NN8A 3WFBL 4KDWA 1TDQA 4XMPH 3SGJC 1AO7E 3UBXB 1FGVH 3AU1A 3L7FB 1W72A 1R5WB 1XGUA 4JO3H 3PDOB 1G0DA 3QI9D 1D9KC 3WNOA 5IT2H 3C2AH 1SMOA 4E42A 1MJ7H 1ETZA 1WT5A 3DVNA 2DQGL 2HTLD 2VC2L 2W9EL 3MV8B 1J10A 5K59E 4X98A 3UTZA 2FYYA 1BVZA 5AZ2L 1DN2A 1HI6B 4R0LA 3PWLB 2IANA 3LKRA 2C1PA 1CL7H 4Y4FC 5ACZA 4JQIH 2VL5B 1I1YB 4H0GA 4YFLI 3F62A 4V1DE 1HOCA 4PV9B 3FQUB 4X7DC 4QRUB 1W72L 2CQVA 3NIDF 1AXIB 1UB5A 3LKPA 4HIEB 1W0YT 1WWAX 2BVEA 2Y6SD 3KPNB 3OF6D 4PRIE 5DK2A 5IMLB 4PV8A 1RZJC 5LQBH 2MFNA 5F9OL 2VH5H 4R7NB 1YUHB 5JOEA 1RURL 5AAWA 5KTEL 1KG0A 1T6WA 3G08B 4OZ4A 3OGOE 5IVXB 1QPXA 3NGBC 4EI6A 4ERSL 3IDGA 4KRPB 2R69L 1DN0B 3BDYL 1OAUH 2VISA 4LVEA 5F7NC 1IEAB 4YDJA 1HYSC 1EXUA 2X1OA 5C08A 3EZ8A 3D48R 4S1SH 3TT1H 1C12A 4XP6H 3FFCD 5D8JL 4Y4HB 1Z9LA 1DQML 3WEXA 4FZ8H 2ARJQ 4JO4H 5EPMA 1W0VB 5GGSY 1ITBB 2NYYC 4LQ1A 4JKMA 4NHCL 2KZ1B 4NQDD 4NO3A 2J5LC 3T0AA 1BFSA 2RB8A 3IAQA 2YD8A 1TJIH 5T3XD 3NFPA 3OJ2C 4O51B 1VGKB 1JIBA 3Q6FA 5KVFL 1BQHA 2I07A 3P0VH 4LARH 5BVJB 4GKZB 2Z31B 3SDDB 2NXZB 1HHHA 3OKYA 2H9GA 3U2SA 5J13B 2CK0L 2KPNA 2OQJB 4KK5C 4PTTB 5CGYC 4J3XA 5FM4A 4TUOB 3RY6C 1IAOB 3BH9A 3KPRA 2DQDL 4P5MB 1M7IA 5GRZA 3HB3D 1NAMA 4DK3A 2NY1B 2BVPA 5BRZB 1OL0A 4PJFB 4ZMAT 5D7LB 3GMOA 1J8HB 1JFQH 5EOTA 5I16B 3DVIA 2ADGB 4JPWL 4NNXA 2ZCLH 4LLWB 3KDMB 4HIXL 4Y88A 2CK2A 4S0TD 2FSEB 2EDWA 4KKNA 5C9JB 1U36A 5CJQL 4KKLD 3CVHH 4YO0A 1XGTA 3O2DA 4I77H 5I17A 4P5KA 4QNPF 4WNQA 3RJDA 5DGRA 1WBXA 4KMLB 4KY1L 3EO9L 1OD9A 5D7KD 4CN1A 3SKMB 1WTGT 3IU3A 5F88A 1LO5B 1AXSA 1MNUH 1CLCA 5EA0L 5BZWB 4Y4HD 1RIHH 3JXAA 1A1NA 3QUZB 4ODVH 4JDZA 1GAFH 4WO4A 4PJCB 4L8DA 2H26A 2JELH 1FE8H 5MEPA 2X4TA 1NC4B 3QPQC 2PTTB 3O2DH 4KC3B 3D2UB 1DANT 5KVEH 3H9SA 1YEJL 4U0QB 1MWAL 1XGYL 4H25A 3DROB 2ZG2A 1T0NB 1UJ3B 3RDTB 4X5LA 5D7JA 3BGMA 2NY6C 2H8PB 2ATPA 2VLMD 5EC2A 1ZLSH 3L3JA 43CAA 3S88H 3THMH 2BSSB 1FDLH 1NCBH 4TSBH 1NFKA 4P46D 3MBEC 2DDQH 1RZJL 4ZNCD 4HS3A 4QHNB 2X4OB 4RMRA 4KUZL 5HHOE 4PRPB 1A1OA 4FP8L 2CSPA 1R3IL 3DSFL 3OWEA 4ODTL 1DUZA 2CLZA 1BJMA 3MRFA 4HMEA 2NY6B 4YH6A 2VTFA 3HR5B 2DIBA 3KPQA 1A9BB 1VFUA 4RFNC 3RVUD 4XPGH 1F11A 2BFVL 2HLAB 2VLJB 2R2HA 4NQCD 5DD1H 4WI7A 4PJGE 1UM5H 3LN5B 3HLAB 4KROC 2G75A 5EU7C 3FQXB 4OCXL 4NKIL 1G9NL 4P2QE 3VFMB 4HV8A 1MHHA 1HHIA 4ZOAA 4UV4H 5HDBE 3GSUA 4Q74A 3C6LA 4Y5YB 3QZWB 4DKFL 3I2CL 5I1GH 1T20A 2VZOA 1RZKL 4KVCH 3VFPA 1JUFB 3FMGL 2IBZY 3LD8B 2DMCA 4IRSD 5DC4B 4AEIH 2BOBB 3PGFL 4PTUB 5GRUL 2CD0A 3T0EA 3G5VB 1G9MH 3MACL 3HZMB 1PX4A 4NQXA 1ND0B 5TDNB 2AW2A 3TYGH 4FQLL 2BSED 3HUJF 3VXPA 3BH8A 5L88H 5FHAH 4LHJB 4N8CH 2EO9A 3UTSB 1DBAL 5CKGA 4NO0D 5E2VL 1GC1C 2ESVA 5I8CA 5ITBL 4DTGL 1LK2B 3V5HB 1ZGLM 2R0LL 3BN9D 1JZ5A 1YY9C 3QPXH 4LLUA 5E8DL 3VXOA 5JORA 4HHAA 4WWKD 5IFJA 5ERWA 3B6SB 5BOZG 4G9FE 2A2QT 3HAEA 2IQAB 2E6QA 3ULUC 1FNLA 5E6IA 3SDAB 4RGOH 4Q9RL 4PPTA 3Q3GB 3K8MA 3T08A 4ZO9A 3VI4E 4ODHH 4MS8C 4TNWK 1WISA 3SE3A 3AAZB 1V7MH 4LDEB 1JRHI 2CH8A 3ET9F 5DMKA 1G7PA 3CX2A 4XCFL 4UOJA 3ZKQD 4Q9QL 3ILPA 3PF2A 1SJVA 3BQUC 4OGYH 4JB9H 3ULUL 4FFVD 5EOCL 4QHKI 3W9DB 1ONQB 3TYGL 25C8H 2CDGB 3GBML 2Y5EA 2X4PA 4Z76B 4Y0GA 3QQ9D 1B3JA 2R0LH 1RK0B 2V5TA 3RX7A 5EN2A 4X6CE 4IOIA 3WLBA 5E8NB 5DHVB 4OQTL 2WNGA 1K85A 3FO2A 2VR5A 3O6FC 5C0IB 3LVEA 4LSRH 1CD1A 4NIKB 5B38G 4GBXC 3WO4C 2ARWA 4EDWH 4JREC 3BPCB 1G9ML 1BIIA 2BNRA 2XFXA 3QH3B 1J87A 2VUYA 3GM0A 4HUXB 4MDJA 4FZEL 3QDME 2ICES 1CFSB 2F8XC 3LD8C 1FZJA 3P4NB 2P8MA 4L3CA 1MI5B 4Q0XH 3P40A 3V5DA 5DSCB 5DJ8B 1U58A 3D3VD 4JCLA 3VXMD 3WJJC 4X5WA 3SDCA 3RL2A 4E9LA 3QUXD 1FNEA 5B39B 1IGFL 3NCJL 4Y5XB 1FV1A 3S36X 5EU5B 5E99L 3MNVA 5E7BA 1XF4B 4RMSA 3I02B 1F45A 3VGAB 3GNMH 3BVNA 5MI0B 1W0WA 4WFGE 3SDYH 1FBIL 5IVXF 3VGBA 5BW7A 3A6BL 5F9DC 5DD0L 5C07E 4MAYB 4MXWH 4V2CB 5DUMH 5D1QD 5GS2D 1M7IB 3IDIB 4ZO7A 3MV7A 5IW6A 4RFNB 4L8SC 3SDXA 5IB4B 3N85H 3N85L 2YN5A 3ARPA 3QXTA 4ZUSB 1YNLH 4KAQL 4QRRB 2BXZA 4J3UA 1J1PH 1XGQA 1ZWIB 2ERJB 4PJHB 4PRHB 4EVNB 3O3EB 4HLZH 2B20A 3PWUA 3S88L 1ZOXA 3D87B 3LDBB 2X05A 5E2WH 3DX8B 1KCSH 2VXQH 3F12B 1I3VA 4MNQB 2R39A 3KPSE 4TSCH 3C8DA 3FN3A 4CKVX 3P4LA 5HD8C 3TC9A 2G2RA 3D39B 4LVHC 2FDBP 5IEHB 1NCUA 3ARBA 2EDLA 3TN0B 1OGAE 1FNAA 4RGND 5FM5M 1LE5A 3CMOH 3D39D 2APWA 2JELL 1KJ2B 1JWSB 1QOKA 3MV9E 4TTDD 5IGXL 3ZTJG 2ZOKB 2LU3A 3LIZL 4DKEH 3BP4B 3BXNB 4PJGF 2LVEA 5DMIH 4QGYA 4YHML 5L9DL 4ZXBD 5IB2A 4BZYA 1CG9A 1OAXH 2AQ1A 2JJUA 4DEPC 5ID0B 5FYLE 4HGKC 2EDJA 2C4FT 4H8WH 5FUCE 3ARDB 3GBNH 3VFNA 4POUB 5DA0B 4JFEA 4WENB 4HG4J 6CGTA 2WWMD 1RUQL 2HT2C 3HUJA 5FF6A 1ZHBB 4JPWH 3JVGC 1FVCB 2FHBA 4K3HA 4M61B 4Q2ZA 4XP5L 5IBLD 4HWUA 4IDJL 4OBSA 1KEGL 1QYGH 4I5BA 3TO4C 5C8JB 1Z6JT 3CMGA 1YEKH 1I1AA 1QUNA 1QRKA 4FNLH 2AI0H 4X98B 3UTZB 5JLZB 2DQDH 4FFVC 4N0UB 4UOW0 3K2UH 5I8EB 3T0ED 1JN6B 4KK8C 4PJAB 3WKNA 4JFXB 1KB9K 1MCHA 1LP9A 1TZIB 2BC4A 32C2B 3G5XA 5T3ZH 3UP1A 3B5GA 5TF0A 4YHLL 2IMMA 4L8CA 3OAUH 5FYKL 5K9QG 5BO1L 2B4CH 1JPFA 1F00I 3MOAL 3RWJA 4AEIL 5CSZB 2LFGA 2XWBB 3C60A 4Y5XA 3VMOA 1D3CA 2X41A 4ORZC 3O4LA 4WI6A 5BV7H 3VI3F 2IPTL 1BMGA 3SCMC 4PRDB 1NFIA 5CZVL 4K9EC 1MOEA 4YHKL 1HEZA 1G7MB 3QPQD 3V0WH 2NZIA 5GPRA 3T3PE 1P7KB 4P0DA 4LGPB 2VERN 4Z7VB 2F5BL 2AV1A 1CE1L 1H3PL 3WIFA 3RWGA 5JTWA 1KCLA 4XBPA 1F58H 4Y1AD 1JHTA 4G43A 4WUUB 1MFEH 2FBJL 2CMRL 4LRIA 5IIEB 2CMRH 2GJ6D 1EH9A 3V0VB 4BSVB 2EIZA 1I7ZA 4AM0A 3MJGX 3SGDI 4NHUB 2RFXA 3QUZD 4RAVA 4HBCH 3BPNB 4RWYL 5KJRH 4IIQA 1I1AC 5SWQB 4FTVE 5ALBH 1NCWH 1VEMA 1UG9A 5DMJB 4YWGL 4FA8A 4JFDE 1X5IA 1I7RB 3DVGA 4G9FA 2HJLA 4NM4H 3TO4D 2YD9A 4P3CL 3DROA 1OP3K 3C2SA 1CXIA 5SV3A 1JI2A 1BM3L 4F7MB 4NQUA 5DD0H 2OZ4L 3ME0A 2WLYA 3V4UL 2ZCHL 1I8IA 2I5YH 4OSUL 3U4BH 5HVHC 2X7LA 5EU3B 1JTTA 2G75B 2NR6D 2NNAB 3NCYS 2Y4SA 4G7YH 4WU5A 4NJ9H 1D5IH 2WV3A 5FYJD 1BFVL 2R8SL 1KXTB 5EFIB 1KJMA 3CSYB 1TVHA 3DX9A 4ZPVB 5F7EH 1ZLSL 1DQLL 1H9VA 4JLRB 3DURB 4TTDC 1S7WA 2AVGA 4WVRA 2HLFD 1KTLB 2UWEA 3IDYB 4PP2B 5DJ6A 5DMGD 5LXGH 3SKOA 3O3DB 1RHHB 5DDHB 1R3JA 5LKNA 2J3SA 3P9LA 1AY1L 1QLRB 1KLUB 1FFNB 1PAMA 2AQ3A 3UPCA 2OLDA 4PIRF 1X5XA 4Y1AB 2P5EE 4G42B 4HK0A 5ICYA 4YNYB 3C6LB 1AFVL 1ODAA 1KT2A 2H2SC 4PB9L 3N9GL 4QRTB 2VDPL 4ZS7L 5CEZH 1WBZB 1DBML 4HIHB 3D2UA 1HN1A 4LBEA 2AXFA 2J4WH 4H1LH 3BKYH 4Z7WB 2PETA 2OL3B 2C1OB 5C09A 4M43H 4F7TA 5CD3A 3IJSB 1X7QA 5I71C 1T1ZA 2ARJB 5KSBF 3M8OL 1RZGA 2AJSL 2GITB 1C5BL 3B3IA 3FJTA 1G7JB 2GI7A 1FORH 1G7LA 3MCKB 2AEPL 4GW4B 2YK1L 4MB4A 2OL3L 4HBQA 2P5ED 3VRLE 1HINL 4PJ8B 5A16A 1AE6H 1LEGA 4QXWA 5D2NE 2Q3ZA 1S7TB 1NSNH 4CMMA 2HN7B 1GZQA 1MCIA 4DAGL 5INCA 3FHAA 1KPRB 3VXNA 5C2BH 4P5TC 3S34H 3GSNA 1T1YB 4XNQA 2O61B 3P0YL 3P0YH 3ZTNL 3HMXA 4I0PC 1HHKB 3KYKH 2A1WL 3DI2B 2IPKA 1K3IA 4L8SB 2MQCA 2OK0L 5KAQF 5KZCD 1JNJA 3MODL 4X7SH 4PJFF 2C1OA 3OF6A 4JJHA 3WUZA 1WF5A 3SY0B 1OHQA 4MAYC 1SBBA 3EBAA 5D6DA 3DYPA 3O0RL 1JJUA 5JA9A 2WINB 2R2CA 5EU6A 1J0IA 3WNLA 2BVOB 1CL7I 5CJOH 1YEGL 5BS0D 1INEH 5D2NA 1I7TA 4JZJA 4DJMA 3NFNA 3DGGB 2YUZA 1A2YB 3T2OA 3MNWA 5IBTL 5GRVK 1P6FA 4MXVF 3VFWB 5IMMA 2QADC 4HD9A 5C0CE 4JAMB 4GMSL 4JM2C 4QXGH 1WAAE 2IH1A 5BZDB 3OXSA 5GRWA 3WMSA 2Y7QA 3N50A 4S1SL 5JOPD 5GSRA 2Z31C 3SDDC 3O6MH 3EUUA 1JPGA 1FL6A 1X4XA 1QBLH 4RFEB 2VDQL 3O4OB 2KQMA 4YFDB 4JHZA 1S7RA 1G7QB 1QZ1A 1IARB 3L6FB 5K9QI 3QIBD 5HY9B 4CDGC 5MP6L 1U3HB 3OL2A 4A6YH 2DIAA 3OR6B 2OJEA 4KHTL 2FJFA 2GK2A 1TCMA 4XVJH 1OQOA 2IWGA 2H9GB 1AO7B 2Y6SC 4O02L 4JQXA 2FLRT 2R0ZH 3UO1L 3BPNC 4FQIL 4LK4A 4LPWA 3B4NA 4Y4HC 1YQVL 5T5FL 4NN6C 4FFWD 1C08A 4NZJA 5CP7B 2DLHA 5I6XB 4K2UH 1CF8L 3OJDA 3LCYA 5C08E 4Z7VF 1SVCP 5KW9H 1CDBA 3BW9B 1S9VA 1AH1A 3GMRB 5SX5K 4FG6D 4DGVH 2YMXL 1HXYA 3QWRA 4F8QA 1Z3GL 2C5DC 3QUMA 3LHPL 2P45B 4PUBL 4N8VG 4IS6A 5TQ2L 2PW1A 1A7PL 4POZC 1OTSD 1FRGL 2X4UA 2HWZH 1Z2KA 2OTWA 3AUVA 4X4XB 3TVMB 2ZWLT 3CU7A 5CBEB 5IB5A 1FFOA 5IVXA 1WWWX 2DLFH 1A6WH 2YUVA 4XPAH 1T0PB 2GFBA 4LLYA 3Q1SH 4PG2C 4FTVA 4F7PA 1DBKL 4G6JL 4OF6A 3T0DA 4R96A 4ODSH 1KPRA 3REWA 3CDYA 3WD5H 1L0YA 4R26L 1TQBC 5GZND 3RWEB 2E8YA 3QA3B 1BGXH 1PKOA 4NGHL 1HILB 5D7LD 2DQUH 1P7QA 4JHWL 3HC3L 4NUJA 4M7LT 4NZTL 3AXLA 1DQJA 1J1OH 3U4AA 2BNQD 2H1PL 9CGTA 4QY8A 1HSAA 4NQEA 4AENA 2ZOLB 4QCIB 1RIVL 4AYFA 4F2MA 3MJ8A 4I0CC 4DN3H 3WIIH 1ED3A 3W9EA 2Y36H 4PG9B 5I71B 3MRBA 5AAMA 5TE6L 3QDGE 3CH8A 1HXMA 2V9RA 2BSTA 5SWZE 4G8FB 4U49A 1IQDA 1ZLVH 1YNKH 1G9EA 3MGOB 5C0BE 1IFHL 4M48L 1S7QB 1AR1C 1DEEA 1X4YA 4JHWH 3P73A 4L4JA 4WUKL 3ZO0A 4NC2B 3OKNB 3HRZB 5JW5A 5KSAD 3W39B 4C83A 5C0GB 2PXYC 1IAII 2A0LD 4XGZB 5J6GA 2F8OA 2E8ZA 4HKBA 1LEKB 1Q38A 2JB5H 5GISL 2X4RB 5F9JA 3MRGA 3O41B 4J8RB 1JRHH 4FXGB 4BUHA 1RIHL 4ODVL 1T0MA 3U0TA 3FKUS 2VJXA 2VXVH 4RIRB 2GY7B 2C3HA 2XA8L 5DEZA 1A64A 3BIKB 1UGNA 1YY8B 1FV1B 4XHJC 3ZDXE 1WAAF 4HIEA 3BZFA 3GSQB 1QFHA 5I1JH 4JANB 1XGPB 4XAWL 5FKAB 2EKJA 4I3RH 5TH2A 4HXAH 3TFKC 3ZKXC 2DQCL 2IAMC 3MA7B 2CLRB 3D25B 3HE6A 2RQ8A 4XWOD 1VFBB 3OZ9H 4BQ8A 2BHYA 2DBLH 2GSIB 2OR9H 3B5TA 3PV6A 5CBAB 2Z92A 4RGOL 2VLKE 5LGJB 3LQZB 1Q9KA 4YR6B 1G6RA 4GUPA 4AJ0A 4CBPA 3EGSB 4OM1H 1B90A 1NEZB 3U1SH 5T33L 1IBGH 1KPUB 4D0CB 3ROLA 1T6VN 3S37H 4D9RE 3UZQA 3MMEA 1EVTC 4OZGA 4ZUVA 4FQXD 4OCYH 1AXTH 1AD9A 3RNKB 1NMAH 4YDIL 5IM7B 1DQMH 2EXWD 1I3RB 5KSAA 5TFSL 4P49A 1CDCA 3VXMB 4Q9RH 2BSRA 1U8KB 4MA8L 3RNQA 4N90E 1CT8A 4LSPL 4S0SD 1JE6A 1UH4A 1TJIL 2YHGA 5FCUH 2DBJA 1RURH 3FOLB 5KTEH 4GW1B 1JPTH 4I0PB 3ZHKA 4WWKC 4DFIA 3GMPB 1ZHNB 3CX5J 1F4YH 4N9GB 2R56H 5EZLB 1BQLL 1MAMH 3H0TA 3QUXB 5C0EB 4PJDB 4N8CL 4ODXA 4G8GA 4YDVA 1CXFA 5DJYB 1OW0A 2OJEB 3SHSA 1IZKA 4L4TA 4M1GL 4MD0A 3KGRA 3MYJA 3I9GH 2VQ1A 4YUEH 3EO0A 4IOIB 4DW2L 2NY7L 5E2TL 2QQLL 4LAQL 1F58L 3RKPA 5E8PB 1WBYB 5KANI 2HVKB 5M94B 3VD3A 4LSRL 4ZSOB 4H20L 2AJYH 3UYOD 5DJAB 5EO1A 1KEMH 4I18A 3IKCB 1A3QA 3RHWK 1IC5H 1UCTA 3R8QA 4QOKB 1OD7A 1MJ7L 2Z93A 3GSXA 2IBBA 2XWJB 3IJHA 1UCBH 3GSRA 1I85A 3IFLL 1Z3GH 5DVKA 5F7KC 4BQ6A 2P8LA 1U8QB 4C54A 5KSBE 4P2QD 4XPBH 5HPMA 4WIQA 1AIFB 1A1NB 3VGHA 4TVPH 5E0QA 5GGTH 2H32A 1AR1D 1U92B 4XVTL 2GSGB 1P2CA 3TBVB 5EZJA 2XKNA 5AD0A 4N5UA 4C4KT 4BFEA 4ZO8A 3SJVD 3MCLL 3K1DA 4UV7H 2VMFA 4CU6A 4EIGB 3SOBL 4DN4L 4OZHE 5EIIB 3MUY1 1MH5A 4JPVH 4MA1B 4YFEA 4ONFL 2XQBL 1NBQA 3H9ZA 3EYUL 3O6KL 3QFJA 3MRJB 4GKNA 3O4LD 3W5NA 2F54A 3T65B 1P4BH 3RWEA 2QQQA 5T1MA 3QIUB 4WJ5A 4PRPE 4LLWA 3IRPX 4M7JL 3Q2CA 1S78D 3ARYA 1FZKA 5TDPA 5C2BL 4K71B 4PLJD 2BOCB 5C9KA 1QFPA 1B0GA 4Y5XC 1KACB 4I9WD 4D9QE 5FKPA 4YAQB 4P99A 5ADOH 5GS1C 4MNQA 1FO0L 3TBWA 1VADB 5K59F 4XBEL 4BKLB 4GG6B 2EKSA 4C56A 3QFDA 2CKNA 4X8JA 2ZUWA 4LPYA 2DLGA 1ZHBA 4N1CA 4WW2B 4ORGA 1YN6B 2GJ6A 1ULVA 1I1AD 1BOGB 1QNZL 3BP6A 1AGEA 3GSNL 4GT7A 3HFMH 1PKQB 4R4BB 3SE8L 3DBXB 3ULVD 2CUIA 5KSAB 3QUZA 3O45B 1VESA 2KQNA 1MWAB 4Y16A 3N06B 2MKLC 4LKCB 4L29A 4NKIH 3DO7A 2EC9T 1QR1A 4KTDH 1QBMH 3GSNB 2VDKH 5L9DH 1KEGH 3BVNB 1K2DB 1I4FA 1BAFL 4L9LB 1YECH 3QXAB 3R0MA 4HXAL 4P2QA 3SGKA 1CU4H 1RVFH 4FFYH 2FO4A 5HYEA 1E4JA 1F42A 3WJJA 3MSPA 1ZLWH 5I8KH 3HPJA 4XGZA 4XRCB 4P2OB 2Q7NA 4KUZH 5GGTA 3VCLB 1KCRL 5D7JB 2W38A 4ZAKC 4FP8H 3OHXA 3JTTA 3KPMB 1M7DA 1MY5A 5JHDB 4WEBH 3FCTB 5B4MD 1OSZA 5DT1H 1S7VB 4MNQE 4HKJB 3GJEB 3MLSH 4CUCA 5HYJB 1WIOA 5H2BA 1UA6H 2YRZA 4PGJA 5BXFA 1RU9H 4K8RH 4OD2A 4PJ5A 1FL5B 3O3UN 5C0DB 1MEXH 4HKXA 3OJVC 1H5BC 2R1XA 4NZUH 3TZVC 1CVRA 1IL1B 3QG7L 4LFHD 3VXSE 1RZ7H 1X5HA 5ECJE 1OTTD 1OWWA 2AK1L 3GSVA 2AEQH 3WCYA 5EORH 4NQCE 2I9LB 2NLJA 3QZWA 4NZDA 1CFTA 3AXLB 3QWQB 4TYUA 3VCLA 2B7DT 4PJGB 3TJEL 2CRMA 2LVCA 2W65B 4I2XA 4LIQE 1J1XL 4BH8A 1HIMH 4DQOL 4XPFH 1YDPA 3S97C 4ELME 4KQ4H 5KJRL 1N26A 3SJVA 2HMID 1TNNA 4ZO6A 4XZUB 3TYFB 3QDMB 3V6OC 4FFYL 2WWMC 4WEMB 4W70A 4WUUA 5E5MB 2ITCB 4Z7UA 1DBKH 4G6JH 5D6CB 2CGRH 4A2LA 1X5AA 4UTAL 4CJ1A 1JK8A 1MLBA 1JV5B 5FO7A 5F6HI 4AL8L 1WCBB 1QQDA 3NIGE 1J0ZA 1TJHL 4BK4A 2DQUL 3H6JA 2HKFH 2XY1A 4P5TB 3LDBC 5KVGL 1J5OL 1CFTB 3BZ4B 5IW3A 5EZIL 1J86A 3NGBB 4TNWF 3RUGB 4FQ1H 3LMJH 1D5BA 4QF1A 2EEDA 4TVPE 1UFUA 1LNUB 5IV2A 4MA8H 4G8EA 3SEPA 5DRXA 3QEHA 1MCOL 3B9KD 3MCLH 1HHGB 5D2NB 1N6VA 5EO0A 1EFXB 2Y07H 5LWYH 4R96B 3TNNA 2QKIB 1FZOB 2XN9B 3D18A 1CD9B 3WHE1 1D6VH 1BBDH 2J2ZA 1QTYT 5J1AA 2NY2D 3QP3A 3V6OA 5C0CB 5EOQH 5ISZD 1TZGH 2AV1B 2NXYC 4AL8H 1FYTB 3MFFB 2DI8A 2XG5A 1BBJA 3QISA 2MKWA 1TJHH 3EZJB 3IF1A 1P7KA 4PJEF 1KB5L 5DJ0A 4O02H 3K4AA 1AR2A 1HYRC 3TT1L 4CNIB 5E4EC 3EW3B 3FQRA 3BESR 4IMKA 5SWZD 3EOAB 5BMFH 3EYQD 5GS2H 1V3LA 3CFCL 3TVMC 3RVXD 3QQ3A 5IP4A 3DUHA 4JREB 3S35L 1T80A 2E5EA 4WV1C 5J57B 4ONHB 3TPUA 1Z0NA 3P9WB 2BOBA 5LQBL 2X89A 3VXUD 3LRGA 1IAOA 1TQBB 3SQOH 3IAGC 1KB5A 4YBLC 3SDCD 4JQIL 3F7QA 4QXGL 1N5AB 3DMMA 2DQFA 3NZ8A 3BJLA 1EIBA 4X7CC 4R3SB 4HIIA 3I6KB 3ZTJH 3K7UA 4LSVH 5F8RC 3SDXB 3O6ML 1CFSA 3QDHA 4YUEL 1U8MB 4JKPL 5ITFB 2HJFB 4KWUA 4XCEB 2OK0H 4I8DA 1MCPL 3ZE1E 1GGUA 3TBWB 1MJJA 2EXWC 1A02N 3OSKA 3RVWC 1CLYH 2G9HB 2BY3A 2VDLL 4IOSD 4HWBA 3IGAA 2WK2A 3QG6A 2UYLA 4MWFA 2FJGA 3DURA 4K8RD 3RP1A 1KIPB 1MHCA 3F7RA 1LDSA 4MGXA 3RI5F 2DWEA 5DHYB 2GEEA 1F5WA 1FGNH 2A77L 1FAKT 3EKCA 4E5XB 4Y16C 5JUEH 1WK0A 2XZZA 4QRRD 5TFSH 4M43L 4FQJL 4LKCA 3BX7C 2NY0D 3WLWC 3WFDL 4E0RB 1R3KA 4JFEE 1JBJA 2AJSH 2I27N 1WLHA 1FVDB 1A7QH 1N64H 1NFIB 3WLBB 4XC3L 3IVKB 4HCRH 3WIHL 3KXFE 1UWEL 1GPOL 3QHZL 3QHZH 4GAGH 5CHNA 5CD5C 1BVLB 3WXVH 5HHPA 3LKQA 5GS0D 1MFAL 1LE9A 3AMKA 5GS1A 3FQWA 4P4RB 4DZ8A 2VL5A 2ADFL 4QTIL 1VPOH 1PZ5A 3P77B 3ARFB 3E2HB 2D0HA 1JYVA 4GSDH 4NN5B 3RQ3A 1VGEL 5DRWA 4DZBB 2VDRH 5I0DA 4BUGA 4GLRI 4Y4KC 1NBVH 3VMPA 5J06A 2PO6C 3NVQA 4BFIA 5C0FA 1GSMA 3BZEB 2EDRA 5C8JA 5A2LH 2CUMA 3V4VL 2HFFB 3HNTH 2MPAL 4QXUL 2FJFB 2ED7A 3E0GA 5JQ6L 1P4BL 4HUUB 4C55A 2VE6B 4PJIB 5CEYB 2NW3A 4WHYG 1JZ3A 4H26B 1X6LA 3FOLA 4D8PB 1MLCA 3U83A 4JFEB 3LEYL 1QFWM 3UTSA 1A7RH 4TPRL 3RVWD