3BIBX

Tim-4 in complex with phosphatidylserine
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
109
structure length
109
Chain Sequence
DTIIGFLGQPVTLPCHYLSWSQSRNSMCWGKGSCPNSKCNAELLRTDGTRIISRKSTKYTLLGKVQFGEVSLTISNTNRGDSGVYCCRIEVPGWFNDVKKNVRLELRRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of T Cell Immunoglobulin Mucin Protein 4 Show a Metal-Ion-Dependent Ligand Binding Site where Phosphatidylserine Binds.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords T-cell immunoglobulin and mucin domain-containing protein 4
total genus 23
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2007-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bibX00
4G6JH 1CYGA 1JZ6A 3FQNB 3U4BL 1YEFL 3GK8H 1F8TH 3FQTA 1U36A 5IJVB 1W72B 1M6OB 3N06B 4G8GD 1N5YH 3BKCL 2OSLB 2EDYA 5D2LF 4ZNCD 5L7XL 2ID5A 4ZNEA 4I0PC 4K7PH 5FYKH 4KI5E 3RGHA 3BQUA 4CDHA 2NW3B 5GS0C 4NQCE 1BD2A 4LSUH 2OP4H 1RJLB 5HPMA 5MHSE 5GRVK 2WWKO 1T5WA 3TZVD 4NKDA 3QFDB 1WAAE 3B9KA 3OKEA 1AXIB 4BUHA 4GJTB 1PG7W 3LN9A 1TITA 1T20B 3CXDH 1CGYA 2PO6D 1NFKA 4WGWB 1N6QH 1XGYL 4QCIB 4N9GA 3RNKB 2YPLD 3QIBC 5I8OH 4OZ4B 1RUPH 5BO1H 4X4XA 4H5SB 3HE6A 1TJIL 3MJ9L 3ESVF 2BSED 3MFFB 1A1NA 1MCSA 1NBZA 4HWBH 3NZHL 5EZJB 2IADA 2R4SH 2FL5B 1CFTA 2VNCA 5I1GL 4NUGH 1QEWA 5KJRL 2ZSWA 3NCEB 4P2OB 3QR2A 4UOJA 2UWEA 3RAJH 5CGYC 3FQWB 3AC0A 2BMKB 4Y5VB 5GS1C 3MNVB 3F62A 1UCTA 4U6HB 4XWGL 3D9AL 5E2UH 5LXGH 1NCWH 1K6QL 2ZPKH 3QRFM 1CL7I 2H2SD 2OZ4L 3O2DL 4JO1L 3HG1B 1KCSH 1ZWIA 3UTSE 2E8YA 4NM4L 4XP4H 4C4KO 2ARWA 2D9CA 2HG5B 3HC0A 3LDBC 3SKOA 1I3RA 3WFBH 3UBXI 1FL6B 3L3HA 4HWZA 4JFED 4L8DA 1RK1B 4NGHH 5IKCA 3UPRB 2KKQA 1MHEB 4KJQD 2VSCA 1U3HA 1BZQK 4ERSH 1CFNB 1WZKA 3GNML 1EFXB 2GEEA 1F3RB 2NY3D 3MRLA 4UBDD 3DX8A 2VXTH 1MJ8L 2WK2A 3GSNB 2P4AB 4X0KA 1IQDA 1YY9C 5IVXF 3PHQB 2AQ1A 3CDYA 1UQSA 3WJJC 2FATH 3B43A 3CH1B 3MLZL 3IAGC 2Z8VC 3IDJA 3S5LA 3SDYH 4YR6A 4MMXC 3LEVL 7FABL 5IJVA 3WFHB 1L4IA 5FYJH 1NBYA 4NN7B 4MA1B 5CBAB 2NY5C 4X6DB 2FBJH 4XPGL 1JNHB 2ZUQC 3TIDB 1FH5H 2E6JA 3H3BC 3VXNA 3U83A 4QHNB 4UINL 1I9JL 4OQTL 4LK4A 3GI9H 1MLCB 1X5YA 4XPHL 1CK0L 2Q6WB 4JN2A 1UKQA 3BEVA 1U2CA 1SHMA 1DDHA 1N3NB 2AK1L 4Y4FD 3SGKA 4YDLC 1K8DA 2NX5E 2VL5A 4PTTB 5I1JH 5ITBH 4RFEB 3SJVA 4LASH 2ZCHH 4F7TB 3MR9B 4XP9L 2XXMB 3MLSL 4KRPB 3AREA 5EU3A 3QEQB 1RULH 2QHRL 4WFHE 5BOPA 5HXMA 5L6YL 2DD8H 2Z91B 3THMH 2JLLA 3D69B 3QXVA 1WBYB 1KCRL 3D85B 4Z7WF 2VQTA 1L7IH 2P8MA 4MS8D 3MLTB 2LU3A 1NEUA 3TGXA 3HI1A 3QUXD 3A6CH 2P24A 4Y1AB 2DL9A 2YZ8A 2NX5D 4PRIE 3TCLA 1RK0A 3TBTB 3QEUB 3WFEH 2VAAB 4YPJA 4FG6C 3BQUB 3OXRB 3UAJD 3DSNA 1ND0A 5C0RL 3VXPA 1DTUA 5INDB 2IH3A 4HGWB 3REVA 4ZO7A 5CCKL 1UB6A 4Z6AT 4R2GB 5BS0D 2XNAB 5HYIA 1M05B 3GSWA 1TZHB 3R0MA 3U4AA 3A6CL 3VFGL 3M17A 3ZHLA 1BJ8A 5IHUH 2Y5TB 1BIIB 5TF1H 3MV8B 5CSZA 4IS6A 4E0RB 2HAZA 3GIZL 5FCUL 3MRGB 4NNXB 1F11B 5T3XE 3ARVA 4O00A 4HCRA 1LE5B 2YD7A 2J8OA 2J8UE 1I7TB 5ADOH 5I8KH 1G6RL 1K2DB 4NJ9L 1MREH 2FJHB 4NQVB 1A2YB 4RFOH 5JW4R 4KPHL 4HWUA 2DMCA 2VH5H 5TE4L 5I8CA 1RZGB 4HF5H 5AG8A 3BT2H 2RQ8A 3DX6B 1UH3A 1U93A 2A9MH 2PW1B 4HEME 4NJAL 4MDJB 4XMLL 5BS0A 5IR1B 3KYMB 3OAZH 5C0AB 3VFVB 5T5FH 4GRWE 1TLKA 1I3GH 5EBLA 3LDBB 2YWYA 1KIQA 2R0WH 1UXSB 2FIRT 3V6BR 3GI8L 3U7WH 5JNYA 2JB5L 3ARZA 4S10A 4N1EA 5JXEA 3K2UL 4G6ML 3V9FA 4C56D 3BH9B 1F4YH 2I9TB 5DA0B 3BZFB 4PJ9B 2APXA 3ZMRA 1NGXA 3SBWA 3HI6H 1T7YA 1TETL 5B39B 3IDMB 4G6MH 1B2WL 1AXSB 3U30B 4C56B 4XNMB 2HFFA 3GI8H 2FYYB 1BEYH 2FHCA 3O3EA 5F21B 5CD5C 3BE1H 4QHMA 5E2WL 3KNBB 2XV6B 3MZTA 4JHZA 1U8NB 4YFLF 5FF6B 3BO8B 3H8NA 4RAVB 5DHYA 4MXVF 5JW4M 5I66B 3MROA 2AP2A 5D71L 3STBA 3WV0A 3ZDZF 5IV2B 5I2IB 4ELKB 1BQHA 1HE7A 1YEDB 4MSWA 1HSAA 3OKNB 4NGHL 4RWYH 5DSCB 4XTRD 4RIRB 1IAIH 1ROWA 1RZJC 4HS8H 4IMKA 1KBGH 4QRUA 4WW1A 5IM7A 1A6TA 4OSUH 1PKQE 3C60A 4PJ7F 5KOMC 3V6FB 4P23B 1MH5A 1IGIL 5KAQG 4M7ZB 3TO4B 5EORL 5E2JA 3IJSB 4O5LH 1KENH 3T08A 4C57C 4U3XA 3G5YA 2YN5A 1P4IL 3VFGH 1H0DA 1S9WB 4BSJA 4X83A 4N0YL 4BH7B 5T33L 1HIML 1FG9C 4YXLL 1A7RL 2IPKA 1P7HL 4AEHH 3EYUL 3IJHA 3QI9D 5I75C 1A0QH 1FZKA 3CC5B 4ZPTB 5HDOA 1TQBB 1VB9A 3ARBB 1V3LA 5K9JL 1IM9B 4OFKA 4QRTA 3OB0H 4UNTA 1MJ7L 4E41B 1HK6A 2RHEA 3RVTD 3HUJE 2EH7L 4KC3B 4O9HL 3K74B 5ADPL 3MBEB 4NN5B 4Z9KB 2VDPL 3GSUB 2D7MA 1OP9A 5F7YC 1RUPL 4ZDHB 2G2RA 1IKNC 4R26H 1IMHC 5ALCL 1AE6L 4MDIA 2R2BA 4OUUA 5FKPB 3I6GB 3IXTB 3U0TA 1YMMD 3CFCL 5L6YH 4MAUL 3IF1A 4X98A 3MV8E 1KPRA 3TN0D 3V6OE 2O61A 1OQOA 32C2B 1AXTH 1DLHA 5IMKA 1X5AA 2RB8A 2X89A 2CRZA 3LEXA 3SE3C 4IMLB 4G6KL 1H15B 1FN4A 4O2CB 2OI9C 2LV4A 4GS7C 2F54D 1ZTXL 4DZ8B 1KCKA 1MCQA 4L4VA 1HHHA 1CF8L 5E8NB 3W0WB 4U1SB 4LLDA 2DLEA 3GMNB 4M9PA 1EFQA 2XN9E 4MQ7A 5C6TH 2C1PA 3IGAB 1OAQH 3FB6B 1FFNB 3OKDA 5DR5H 1YMMA 5D2NC 4PP2A 3G5XA 1OPGL 5DJAB 5HYQB 4YX2L 1UG9A 1V7NL 2IH3B 4GAYA 1QSED 1XT5A 3GJEA 3RTQA 3QEQE 3VGEA 4YHIA 4K55A 1A6AB 5D8JH 1ZA6A 4UT9H 3HZYA 1JHKL 2F5BL 3L1OH 4HIHB 3KPOA 5DK2A 3D3VA 2P5WB 5BVJB 1AQDB 4BZ2H 3H3PL 3STZB 3AU1A 3G6DL 5FGSA 1VFAB 3PV6A 2BSSB 5C08B 4JZNB 4MNQA 5SWZB 4EI5B 3FO0H 3KPRA 3GMMB 1MWAB 2HMIC 4DVRH 2G5BB 4UOW1 4LNRB 2X7LB 2YWZA 4XMKL 4NBZB 5JOPE 4PJCA 5E08H 4X4XB 3BSZL 1K5NA 2JB6B 1CDIA 1EEYB 3FHQA 4RGMB 3KLHD 5B3NA 5D4QA 4MB3A 4LCIH 4HX1B 2GAZA 1PKQB 5DJ0B 3UC0H 2CLRB 1PDKA 4MJIA 4X6DE 3O6FA 5SWZD 2AW2A 3LKNA 4F2MB 2Z8SA 2IFGA 2X89D 2BRRH 1QZ1A 3EFFB 2P44B 2XWJB 3KJ6L 1FL3B 4M8VA 1T1ZB 4F37F 2XRAL 2OZ4H 4UNVA 5KG9A 2EEDA 5D1QC 4YAQB 4ZNEE 3QCVL 5C86A 2F58H 3SHSA 4LSPH 1OLZA 3SE9L 4Q58C 3UTTB 3CXHK 4X6BB 4L4TB 5T3ZH 2IGFH 2DQGL 4U1NB 5I1GH 5GJSH 1GGBL 5J6GB 3PJSA 4C56E 4LRNL 5BMFH 1G0YR 2PUQT 4KTEH 1J0HA 3S37L 1IAMA 4I0PA 4ZQKB 1TJIH 1D9KB 5LVEA 1FYTE 3NA9H 3BX7C 3A67L 5MEPB 1BZ9B 4JY4B 4UIMB 4RGOH 1K8IB 3MRLB 1E28B 1KJ3H 4PJ5E 1FDLH 5C0DA 4EUPA 2QL1A 3FZUD 4GBXD 1FNLA 5GGSA 3RHWF 4J1UA 1QNZH 5C0AE 3L3KA 3BIAX 1UC6A 1RZ8A 2B7DT 4CN1A 1KJVB 2DWEA 2WNGA 5F3BB 3VD5A 2FX8H 3OF6A 4KI5F 4BFIA 3ALXA 3V0WL 4NRZA 5GRYA 2VQ1A 3EYSH 4HQQL 1NANI 3RWDA 3SE9H 3UYPA 4NO2B 3KXFD 3R4DA 1KXTB 1O0VA 2QSVA 5FCSH 5F7MC 2GSIB 3QCVH 4OZGB 1JI2A 4BH7A 3KYNB 1GZQB 3LN5A 3UJTH 5EUKA 2ESVB 3WS6C 1V8HA 4DGVH 4JR9L 4MA3A 4ZPVB 3TVMA 2EH8H 3PG2A 5CEXB 5KSVB 1CGSL 4L4TD 3FOMB 2OQJA 2R2CA 1AC6A 1S7RA 2YEZA 1XZ0B 2HJFA 5CMAA 3DO3A 1TJGH 2JB6A 5A2KH 5D6DC 3CCHB 3OWEA 2BJML 4LLMB 1S9YB 2WUBL 5L2JA 4KKCC 2X44D 5J11B 4OJFH 1DEDA 1FORL 1J8HD 1TZIB 4LKCB 4PRPB 4LBEB 35C8H 1H3TA 1DN2A 2PCPA 1EHAA 4NZTL 4F33A 3LHPH 2HRPL 5KSBA 2QADB 2AQ3A 2F5BH 1CD8A 4JAMB 1ZHBB 5GISL 1F00I 2VE6B 3PWLA 4LSRH 1C5DB 4S2SA 1P4BH 3MRQA 1IC7L 1DQJA 1MCWM 3BKJH 1I8LA 3DV6A 4PY8I 4L3ED 1IQWH 2ZOLA 5EU7E 5CEZD 4P3DB 1AJ7L 4KKAC 2GQHA 1F90L 3B9DA 4Q7DA 4KK5C 1OB1A 2CRIA 2DI7A 5D9SB 3O81A 2FEEI 3JUZA 3JV6B 4G7VH 1DUZB 3TCXA 3V52L 4GBXB 4I13B 1IE5A 1HNGA 3S35L 5EC1B 3T2NH 3L3GA 2VMFA 1ZLVK 1A9EB 1S7XA 1UJ3C 1ZLVH 1RU9H 3FB8A 1WISA 1EH9A 2ZCKH 4K2UH 4IHOB 1BVLB 3KPOB 2WBWB 5GSRA 3UTZA 1WT5A 1ZHKA 2G75A 4U0RB 3WXWH 2YA1A 2OZ4A 3WD5L 2GSGA 1WAAF 1D5IL 1GRWA 2ZUYA 4DTGH 3HCVA 3MA9H 3QG7H 1IGTB 5IB5A 4OLUL 4A6YB 3KPSD 4O58L 3DETD 2JCCF 5B38B 3T3PE 2WIIA 2ICCA 1GZQA 3EOYG 3S6CA 1P7QB 4K3HA 4PLNC 4PREA 5CEZL 1F6FB 4QEGA 3QJHA 5H94A 4DJMA 4M4RA 1MLBA 3QAZC 5ESQA 5C08E 3O6FB 4WDIB 5DD0L 4WHTA 2NY6B 4WTXA 4XVJL 5DMGD 5EUOB 1OAYH 5F9WC 1IEHA 2NNAB 3PQYA 5DUML 2VDOL 4M5ZL 4Z5RA 3QDJA 1NBVH 2LTQC 4MYWB 1KCVH 2FR4A 4XP5L 4BQ6A 2DKMA 2R23A 3SGEI 5JA8B 4PGJA 1QSFB 4Y4KB 1ACYL 4NIKB 4NM8L 3MOAH 4YHNA 1CD0A 1EEZA 4O4YL 4PS4H 2VXSH 1DEEA 1VA9A 1VFUA 1J8KA 3K80A 2COQA 4X6BA 2X1OA 3BQUD 5H8DA 4HG4J 1T3FB 1GGTA 2QADD 3DVIA 3CDGA 4QXUH 4OCWH 4WFHD 3CMOL 4LOUC 2UYLB 1WIPA 1Z0MA 4CKVX 2BOCB 2QEJA 2VISB 4XC1H 5I1LA 2IG2H 5MP6L 4CBPA 4ZS7H 1PSKH 4PJGE 1U42A 2MFNA 2H3NA 5KVGL 5FA3A 2ORBL 2W60A 3BW9A 4LGSB 3QHFH 4D3CH 3CZJA 1GGUA 3RI5F 1WGOA 1H0DB 1S9WA 2ADIA 3ISWA 3PHOA 4NT6A 3JBG7 2KUTA 2IBZX 5F3HA 2NXYC 1NMCC 4YBQD 1IC5H 1NCCH 5DLMH 4X5LA 1W0VA 3WIIH 4GOSA 3O0RL 3VD3A 4R7DA 1BECA 4NFCA 3LKQB 3K2MC 4PJ7E 5KVGH 2PF6A 5IF0B 1AD9A 1AP2B 5F7EL 4NQCB 5CJQH 4Y16B 4NZJA 2LTQB 3MLVH 5EOCH 3KR3H 1JI1A 3RWCA 5KSBB 1ZV5A 1EJOH 2H6PB 3WIFA 2GJ6D 3KPRD 3LSOA 1T89A 4ZXBA 4LFHD 1M71B 3HUJA 4HUWB 4WU5B 4PJ9D 1JWSB 3MFFA 1NFDB 2D03H 2A0LD 4P5MB 5JLZB 4F7PA 5KSAB 3H0TB 2JJUA 3NCJH 4FQXC 3MA7A 3VXSA 4D94A 1EFXD 2BNUB 3O6ML 1S7VB 2HKFH 5TGBA 5MENB 3QI9B 4NYLA 4PRHB 4LAQH 1EAJA 5FECA 1A22B 3PE9A 4UDTB 4CVWA 3P0YL 3NCBB 3LKSA 1VACB 1I4FB 3NFPA 4Z7UB 2YRZA 5DD1L 1JGVH 5GRJH 4N1CA 3I85A 1R3IH 5DRNB 4G7YL 3EJYC 3GMOA 4FZ8L 3PWJB 5K93A 1ZLSH 3JTTB 4EN3B 1IL1A 4G6AC 5DFTA 5SWQB 3QXDB 5ACLA 4DEPB 2P45B 5E99L 2D4FA 3IRZA 4LEXH 1BBJA 2WMPA 1GC1L 5DXWA 1E4WL 4JY5H 1CFSA 2XKSA 2ZSVB 4G9FE 4GG6B 1U92A 1J1XL 2G5BA 2H3NB 4WI9A 3D2UD 5B8CC 1CBVL 3HAEB 5E99H 1ZS8A 4ZS6D 4KKCD 2XQYK 3WO4C 4GRWB 5E8DH 1KUMA 4JFDA 4PB0L 5LCVL 4NKDB 4E42B 3TLRA 1A6UL 2QJDA 2Y06L 1UJTA 3T1WA 1J88A 4OCRL 3UTQA 1OD7A 1KNOB 3QG6A 5KS9A 1ORSB 2O5YH 4L8SB 1B4JH 4ODWA 4KI5D 1P4LA 1Q0XH 3QQNA 2UWEE 2KZWA 1NAMB 3B4NA 3P0GB 4FQCH 2C4FT 3ZE2F 3VRJB 4IIQB 2ADGA 2UV3A 3SDXA 5L88L 1BVKB 1KC5H 5KS9E 3QDME 1KPUB 2AJUH 5E03A 3RGVB 4HC1A 5E00B 3MRCB 3BP5A 2EDNA 1H3PH 2AJXL 1NAML 3WHE1 5HDQL 3CDCA 5D1QD 5JORB 3PQYB 1NDMA 5EU6D 1LO5A 5ENWB 1A4KA 1E6JH 4FFWD 1TMCB 3L95A 4BFEA 1KGCD 5C0BB 4ZQKA 4OZFG 4JKPL 4HWZB 4L8DB 4YHLH 2R8SL 3MODH 3PL6D 4MA1C 4NN6B 1MJ8H 5GZND 2C5DC 4K7PY 5JPMA 3RNQB 3GSXB 4KQ3H 2C1OB 4GW5A 1RHHB 5I30L 5CGTA 4GSDL 3ZL4H 2BK8A 1Q72L 1LO4L 5F9JA 2HTLD 4ZUVA 2YUVA 1XCTA 4JZJB 3P9MA 2W59A 4HUVB 1MPAL 1HHJA 5E5MB 2YK1H 4YHZH 3IDJB 5IK3B 5JXAH 3QIUA 1MRCH 3LEYH 4B53A 1LP9A 1QO3B 4WFFE 1I7UA 2H9GA 1J18A 4UNUA 3F7YA 4P57A 1QACA 4XWGH 4LCCA 1ZT7B 5KVEH 1LDPL 2UZIH 5DK0A 5F88A 1XF4A 3H2WA 3LY6A 4JFDE 4WW2C 1GPOL 1QNZL 3QIBD 5IB3A 4XPBH 1CIDA 3G6JB 2FIKB 4KJQC 5F7DB 4I0KA 1BX2B 4GW1B 4MHHI 1NDGA 3AREC 3FOMA 5ICYA 4HUNB 1AP2A 3H9SD 3NZHH 3BPCA 3VFPB 4NQDD 2BNQB 1YN6A 3ARPA 3FN3A 3G9VA 1EAPB 5EO9A 2NY7L 2YBRB 3HUJF 4OKVB 1CDJA 1HOCA 4HLJA 4PD4J 2ZKHH 1NANH 4CDGC 3KPSB 5EIQA 3UCRA 3FB5A 3N1QC 4JANB 5H2BA 3HC3L 4RMTA 1S7WB 3RWGA 1HYSD 3SE4C 2VLJA 2V6HA 3PL6A 2DQFA 3KYKH 3QUMB 2A6KA 3DV4B 2PTTB 2X6MA 4PJ8A 3MRNA 4YHPB 2DWDB 4UILL 4PRHD 4NNPH 1DL7L 1UKTA 3P73B 1S7SB 4FQIH 5C7XH 5D7IB 5FYKL 4KJWD 1I1CA 3EOBA 3D5OF 1K4CB 4BQBA 2V17H 4CMHC 3O11A 3MV7D 5EOTA 1NGXB 1RIUH 3SE8L 4F58H 3FT4B 2AXJA 1G9MC 2GITA 4DOHE 1U91A 2W91A 4DN4L 1J0ZA 4X9BA 1R24A 4UUJA 2YK1L 3QUML 1RK0B 3QB7C 2RBLA 4B7IA 2V9QA 1J12A 3BP7A 4R97C 1K4DB 2GJ6B 4U6TA 1NGQL 2AXFA 2CJUL 4OZHA 4LIQH 4LSSH 5AEAA 4FQXD 4MJIE 4DN3L 1G7HA 2Q86A 5ACZA 1A1OA 1NFDF 4LHJB 5EO0B 4YHLL 4JFEB 5FYLE 1U9KA 4JFFD 3P9LB 4OCXL 1FGNH 4J4PA 5F7LB 3ULSB 1QBMH 2VDRH 2APVA 1JHKH 1NGWA 3PGFH 4BYHA 2MCPH 2O26U 2DYPA 1GGIH 4ZYKB 4DKEL 5AWNL 3HMXA 4Q6IB 4PB9L 1EZVY 2LQRA 5JXEC 3E8UL 4WRLA 3Q1SL 4LLYB 1RUKL 2DI9A 2DQEL 5DF0A 2FD6H 5BS0E 3EUUA 5FM4A 1NAMH 4KUZH 1OPGH 1H3XA 4OT1H 2NY2B 4P4RA 4PJBA 1A2YA 3NTCL 2VDML 3QRGH 2FL5A 3REWB 2AJUL 2MPAH 4C56A 3BWAA 4R96B 3WJLC 3MRRA 3NCCB 3GO1H 2VDMH 1JN6B 4OFIA 4FQ1L 2N7BA 3VG0H 3BH9A 1EEQA 5C0GB 3D25A 1T66C 2A73A 2F53B 3Q1SH 4ESKA 2X4OA 4TULL 1AD0A 5IFHL 2H45A 3KYOB 2GTWA 3MRCA 1IC1A 4GXUM 5C0NC 1IGYB 3PV7A 2YPLB 2R0KH 4K9EL 4PJDE 3HPLA 1MHCA 4HKZA 2N56A 3BRFA 4A6YH 4IMKC 4CGTA 2VLJB 4X98B 5FYJU 1MI5A 3WNKA 2OTUA 4GXUN 1J9CT 2CIKB 3EOAB 1U0QA 4MGXA 1NEZB 1HZHL 4X9FA 4PRAA 1NMAL 3OKLA 2NY7H 3BP4A 4O9HH 5BV7B 1OVZA 2HVJA 4WTZG 5E8EB 5FHBL 4HG4K 5DGRA 3IFOB 3ULUE 5C2BL 1P7QD 4U2YA 2P47B 5MHSD 4YBLB 5C1MB 3R1GH 4FTVD 4M6ML 4XB8A 2GUOA 4ZPTA 1DQDL 2QQLL 4NFBA 3IFLH 4OZGF 4YPGB 2OK0H 4LMQI 5AYUH 3X3FL 4G8FB 3P0YH 3UTOA 3GJEB 1HQ4A 4C4KT 4IRSA 1S9XA 1MY5A 6CGTA 4X7TA 3KYKL 5ALBH 4YHZL 1XGUA 4MDIB 4OI7A 3WHXB 5GS1A 1O7SA 1KJMA 2IMMA 2VC2L 3IXAA 2EDWA 4ZFZA 5I1DB 3IDXL 3PNWB 4OF0A 4HH9B 4LCYA 2NY0C 2DYPB 4ZYKA 1M1SA 4K7FA 3GSNL 4D9QE 5D71H 2FX9H 4CU7A 1WJ3A 3K4ZA 4NZUL 5CZXC 2EDLA 1HKLH 4PLJC 1BM3L 4X6EB 3UPCA 3ZDYE 4DQOH 1DBJH 5J56B 5JHLL 5DZNA 1MFCL 3BXNB 4F7TA 3LMJL 2FLBT 3DMMA 4GG8B 2HKHH 4YQXH 3KR3L 1YNKH 5HYSG 3P4OA 1BZ7A 4F9LC 1T03H 4ONHA 4ALAL 1G7JB 1OSPL 1N6VA 4PJ5D 4XH2B 3QIWA 5C0EA 3EZJB 3DV4A 1CQKA 1A4JB 1JPST 1W72H 1VACA 4ELMA 1H3GA 2AJXH 5F6HI 3W2DL 4KUCD 4FQ1H 2HJLB 4POUB 3GO1L 1MIMH 3QCTH 3QEUA 4R0LA 3VFRB 3ZKXC 1J1PL 1I9RH 2D7TL 1A6VL 3INUH 4AEIH 3ROOB 2NQCA 3MCKA 1MCBA 2IQ9L 3ARXA 5C09A 3KWWB 4WFFD 2V2XB 3SKMB 1G7PB 1HKFA 2B39A 3KPLB 1PQZA 4I48A 1FIGH 2A1WL 3T0EE 4OCLC 5I18L 4WIQA 5J1SC 3BRGC 5SWQA 1NL0L 1OTTC 5E1AA 5TE4H 1C5CL 3ILPB 2VABB 1A6AA 2V5TA 5FHAL 2AV7B 3H3PH 5E8EA 1L6ZA 3EYQC 2YMXH 4JLRA 4M7ZC 4U33A 4PGEA 5HYSB 2VWEE 5HYJB 1U8JB 3HAEA 5MEQA 2QQNL 2XFXA 4Z7WA 5EA0L 5HDLA 1A7QL 4RISH 1U8KA 1RV6X 4AIZB 3RIFF 1VEMA 4C59B 2CDGB 3VXUB 3DVGA 3MOAL 2Y07L 5AD0B 5GXBB 3BKYH 5BRZB 3LD8C 1SJHB 1B0WA 2H2PD 4MJID 5EBWA 1AGDB 3WE6A 4XP5H 1K3ZA 5KSAC 2G60L 1EZVX 1OAYL 3MXWL 4AIOA 1OARL 3Q5TA 5HGBB 3FN0H 3DX7A 3G6AB 3LH2L 4NQCD 2FHFA 1QFUL 3P4NB 1KB5A 4OQ1A 3V6ZA 5HYFA 5HHOE 2ESVA 3GRWA 4OCRH 3WFEL 2Y06H 2BVEA 3GKWL 4KGJA 4YC2B 3HE7C 3AS3A 2WZPD 3MV9B 2HT4C 5BV7C 5J1AB 2G60H 5EU6B 4PJFB 5F89A 1XF3A 3BD4A 4P4KD 3V4UL 4UIMA 3WD5H 1HI6A 2W0LA 2NCMA 3GIVA 4NN7C 1E4KA 4K2UL 1HH6B 3C8HA 3L3KB 3MACH 4RA3A 1S9VB 3C5SA 4LEXL 2R1XB 1NCUA 4C83B 2Q20A 5I2IA 2YPKB 3VG9B 2N7AA 3FQXB 5F9DC 3ECBA 4M6OL 1K8IA 4JPVL 5EBMB 3SGJA 3U9UA 3CUPB 1NCDH 4S0SD 4OF7A 1I7RA 1CK0H 4PJIB 3QEHB 25C8H 1BOGB 2HVJB 4C54A 3NACL 2AV1A 3MCKB 4NQEB 5F7EH 3LQAC 1MH5B 1F58L 3UTTE 1FIGL 1Q94B 3D2UB 4IRZH 1P4IH 2FNBA 5JPNB 2XN9D 1A7BA 4GAJH 4N0FA 2VZSA 1BQSA 4JKWA 4ODUB 4F8QA 2HH0H 4LARL 4JDVB 5EFIA 3FOLA 3GKZA 1ZEAL 2NZIA 3RUGB 4ZUSA 3VWKB 3IJHB 3MLZH 3DLQR 3DPBA 1BF2A 1YJDL 3HR5B 1KELH 2CK2A 4EN3D 1OTSD 5CLTA 2VXTL 2I07A 2XFXB 3P30H 4K23H 1SY6H 4FQLH 3HKFA 3O2VL 4G43B 5GS1B 2CKBL 2MJWA 4LVHC 4YIQA 4U49A 2NY5L 1D5ZA 2XT1B 3RWFB 3CCHA 1URLA 3ZDZE 1KIQB 1MEXL 1XZ0A 5DWUL 3V0VA 1BHGA 2YD8A 4Z7QE 3DX7B 1LP9E 1W0YT 1TVBA 1ULVA 3TBYB 1FVEB 3BHBA 4KK6D 5A1AA 2AK4A 5D2LA 4GRMA 5IEKA 5DI8B 1C12B 1GVIA 4OM0H 3RUGF 5K9OA 1Z9LA 1CICD 3QDJB 4LCWE 1A4JA 5CJ8A 1B90A 3N85H 4PY8J 2ORBH 3C60C 3VXQB 2R56H 4ZUTA 3VJ6A 1SEBB 3GMPA 5GGVL 3ZT5A 5FUOL 4BH8A 4HBQA 4ODHH 4U1IB 1K85A 5BRZD 1AO7E 4OKDA 3O4OC 3BH8A 1F3JB 1S7QA 4GBXC 5I9QB 3Q6FA 5C0BE 3WNLA 4PB0H 4PJAA 5LCVH 2PYED 4NJ9H 4QYOA 3S4SG 2VLKD 4JVPA 1M6OA 2OM5A 4ODVL 1IARB 5HYEA 5E1AB 4N8VB 2JF1A 1RK1A 1FNGA 2GT9A 2OXGA 4Z95L 5EOQH 5FCUH 3U9UB 4GRWF 4U6YA 5CGYD 1F4XL 2WWMC 2AKRB 1HSBB 2OP4L 3B8YA 4WI7A 5GIRA 2HT2C 4CJ0A 3TBVB 1B3JA 4APQC 4IHOA 4XCCH 3SCMB 1YEGL 2UWEB 4M7KL 5A16A 4R4BA 1J0YA 3PWUB 4P23D 4JHAL 1WLHA 3CFKA 4PJFA 3OB8A 1C5CH 1CG9B 2RFXA 5E8PA 4G7VL 1JYWA 2JJSC 5GGVH 1HWGB 1JGVL 4QTHA 4GW4A 2ZSWB 5SX4I 3OAZK 2W65A 3Q3GB 5J9PA 5B38A 4F3FB 1IEBB 3O45A 4NQCA 3LPGA 5BZDA 1MAMH 1DE4B 4ETYA 4ZFFA 4OFPA 1PGRB 3G08A 3RWHA 4H1LH 3H9HA 3TYGL 3VA2C 3NTCH 4FP8L 4Y8DC 5IW6A 3BKYL 2F19H 2HLAB 2J5LB 5IVXA 3MV9A 5CJBA 3BSZH 5FDWA 1Z5LB 4FNLL 4HZAA 5KOVC 1XCQB 1ZGLP 3O4OB 3C6SA 2FR4B 3L9RA 4YNYA 4DKEH 3QFJB 2GW5A 5J6GA 4YDIL 4X4MA 2QLVB 1A7OL 4LVOB 4XB7A 4YWGH 4NSKA 5B8CB 3BI9X 3CXHJ 4LCWA 4WUUB 3WKNA 4P2QB 1CE1H 3QSKB 3MYJA 3W9EA 4PJBE 3V52H 4QXTB 4MQ7B 4UQ3B 1I9JH 5KSBF 2FX9L 4YBHA 4NKOB 4GKZB 4KDTA 4U6XB 3RUGA 4YX2H 3ZHDA 4F9PA 3ARDA 2F5AL 4RX4A 4EBQL 1INQB 4G3YL 5DYOA 1CFQA 4DZBA 2A38A 3TJEL 4S1RL 1LO3L 5CWSB 15C8H 2CIIA 4FXKB 2EKSB 4I3SL 2ZUVA 5D5ME 4X6DF 3TPUB 1MHPH 3MPCA 4WWKA 4M62L 3X17A 5ABDE 1W72L 4JFPA 4HMEA 1Z2KA 1NCBH 5E5RB 3V0WH 5D7KD 3C5ZA 4XVTL 4JQIH 5HHNB 1OP3K 3GUTB 5D7SH 5EFIB 3NFNB 2EDOA 5DRZA 1F6AB 2DLTA 4HPOL 4MCZB 3NIGF 3RJQB 3QPQD 3EYFA 1MFCH 5D7LB 3HMXH 4JPVH 1DBJL 1MWAH 4OCWL 1TJGL 1A47A 2EKJA 3UYOD 4HUXB 2AJSH 5EU3B 4PY7A 2FGWH 4MNGE 3X13A 3F7PC 4S1QH 4LHQB 4ZTPH 3U4EA 3RIAK 5IGXH 3BAEL 1DBMH 4L8CA 2H6PA 3WIFB 4NQED 4KZDL 4Y5YC 1N26A 3WSQL 3C5ZD 5DRXB 5EPMA 2C3HA 4XX1G 3HNSH 1UZ8A 5DUPH 5HDBF 3C9NA 3ROLA 3T3ME 4A6YL 2XQYG 3DJ9A 3B2UD 3CJJA 4ACPA 1OAXH 3D85D 4RBPH 2HT3C 3IS1X 1RFDH 1YN7B 4ZFFB 4TNWK 3BP5B 2NW2A 4HS3A 3S34L 1FNAA 3PP3H 5C09B 2XRAH 5GZOD 1XIWA 1OT1A 3KGRA 5CJOH 3U1SH 1Q0YH 2YR3A 5FO8A 1OB1B 5DT1H 2V2WB 5C2BH 2OS7A 4RSVA 3AY4C 5C0DB 5C0BA 1IKFL 2ICWB 3OB0K 3MLUH 4FFVD 3TBVA 1JUFA 3FT3B 3JVGA 3SDCB 3CAFA 1A6ZB 1HILA 5DEFA 4E42A 4BQ8A 3MLRH 3QWOB 5GHWL 3T0VA 5IVNA 2ZCKL 4L5FL 4Z7VB 4KVCH 5IEHB 4GAGL 1CE1L 4TVPE 5EUOE 3S35H 4NKIL 1WBZA 4AQOA 1A3RL 4XPTL 3NCFB 2OI9B 4GS7B 1XH3B 4GAGH 4TNVK 1F8TL 2W9EL 1S8DA 4JM2C 3U4BH 5DJZA 3LQZA 1YDPB 4XXDB 4JG0L 4BFGA 4Z0XB 4H20L 4YUEH 4NHCH 3G5YB 1HHGA 3SCMA 2LFGA 1JPGB 3PP4H 4JFXA 5JW4Q 4XMPH 1IM9D 3MRKB 1YC8A 4D0BA 5IBLD 5L2KA 5C8JB 2IQAB 4R0LC 1UB5A 1Q0XL 2Q76B 1UWGL 5J9PB 1BLNA 4V1DD 4XP6L 1IT9L 1FNEB 1SYSA 3E8UH 2EDEA 3EJYD 4LLUA 4L3EA 3L5HA 3VFNB 3WL9B 3B2UC 5I1HL 5DO2D 4TRPL 1CR9H 3D3VE 1FORH 1OAXL 3WLWD 3MRMA 3PWVB 1RIHL 3ES6B 3FB5B 4Z7OE 5HHME 1WAAA 1B4RA 4JFOB 4KROD 1FO0L 3CFDB 5CAYB 2GCYB 4N0UA 4LRIC 5C3LD 3K1DA 5AYQA 5CWSA 3NCYS 3SDAC 5IVOA 5ICXB 3GSRA 2GK0A 3QJFB 1MIEH 4L4VE 1LP9B 1KJ2H 4XGZA 4PJIA 1F97A 2P1YA 2XA8H 1IKFH 1KCLA 3GSOA 2XXCB 1OAQL 3DHMA 3O11B 2ED7A 4J3OC 4HUVA 1BAFL 5TQ0L 1X5JA 5IIEB 1T4KB 4TOYH 4Y4KC 1FZKB 3CC5A 3EYSL 1E6OH 5DYOB 4X5WA 1W8NA 1MQ8A 1FG2B 4G6KH 2XY1A 3G5XB 4I4WB 5HYQA 5A2FA 1BVLA 1NCBL 3MRBA 1DQDH 2E7LC 2E6PA 2NXYB 5C92A 1JRHI 4GLRH 1AIFA 4XAKD 3QFDA 1P1ZB 4JHWH 4DAGL 4NRYB 1IKNA 1SJEB 2EIZB 2IAMB 4K3GA 5TQ0H 1FAKT 4PJGF 5C07A 3F7YB 4P57B 4ZAKD 5ANMA 2X4UB 5MERA 5MEOB 3Q5YA 3MSPA 3U0PA 3HC3H 1UWXK 4JZOB 3PL6B 4A6YA 1V5JA 1DBML 1X5GA 3MTRA 5ADPH 5D7LA 3S37H 3G6JA 1FFPA 2EC9U 5E95B 2WUCL 1OWWA 1FRGL 3AXLB 3ZDYF 2DTML 4J3WA 4ISVB 3CVHH 1QP1A 1CDBA 4U2ZA 1YN6B 4FXLA 5M7QA 2PTTA 4H88H 1N7MH 2VR9A 3LOWA 3Q5OA 1G7QA 1MRDH 2XTJD 3KPPB 4WFGE 2OJZH 4HD9A 1E6JL 5ESAB 3VU2A 3OMZA 2FBJL 4XPGH 2XWJA 3K1KC 1UH2A 4MX7B 3UTSB 1I8KA 3W39B 3LKSB 2ZUXA 4O5LL 1KOAA 2F19L 3BZ4A 2XZAL 3RTQB 4Q6YA 3FQUA 1R24B 3NCYP 1V3KA 3DVNA 2ARJB 5F96H 4F37K 2Y5EA 1UACH 1FFNA 1OCWH 2VLRA 1XGRB 3RRQA 4L29A 4MD4A 2YSSA 4XMKH 4Y4KD 2VLLA 1E27A 3VGGA 4NBXB 4PRAB 2Y36H 5SWSB 1V3JA 3JV5A 3ARED 4BQ9A 5KAQF 5D1XC 4HIHA 5DK2B 4HFUL 1NC2B 1MFDH 4E5XB 1MHEA 3EOTH 1TTFA 4LSVL 3KLAB 4Q2ZB 5DHVH 3KYAA 4KMLB 5EZJA 3CLEL 4WNQA 1B0RB 2EZ0D 3OKKA 5BV7H 5C0BD 5IHUL 3MLUL 3OJ2C 1X5LA 1NCWL 4G8GE 5CFHA 1C5BL 1WC7B 1FNEA 1SYSB 1DQTA 4ODVH 4Y4HC 2JK5B 5T3ZE 4L8BA 3TYFA 1GYAA 3RDTB 2BX5A 3E6FA 3WLBB 3PQYD 3S88L 4XC3H 1U58A 2HWZH 1L0XA 3H9ZA 5MEOA 1WQVT 3LN5B 1ZHLB 3MRIB 3DWTA 3STLB 1CICA 3PDDA 2IAMD 1GGYA 4FQIL 1MLCA 3ARQA 1YEGH 3O9WC 2F54E 1Z5LA 1AGEB 3IETB 5DMGC 2NTFB 3MCLL 3O6MH 3RVWC 1J87A 3GIZH 3GSOB 3VXOA 1KG0B 2GTWB 3GZKA 3R0NA 1JZ4A 5HHMB 3RY6A 4LASL 1RZ8B 3RNQA 3C5JA 3BEWA 3S36H 5D7JA 2XN9B 1MJ7H 4G9FD 3O3DB 2CO7B 3QBTB 4CAGA 3HNVL 3WN5C 3HMXL 2Q7YA 5FGRA 2VQ1B 4X8JA 4QLRA 3MREB 4WFGD 2ZG3A 2UZIL 2CO6B 3FQNA 1QQDA 4BKLB 4K71B 3G04B 1L9MA 4N0YH 2JJVA 1UZ6F 3ARFA 4OTXL 4Y5YB 4UTBH 1JYXA 3VFSA 3MJ8A 1CFSB 1IGMH 4QHNA 3O0RH 2BNRE 1FQ9C 3LEYL 3RFZC 2NMSA 3INUL 2HKFL 1LK2A 5F7NC 3QO0A 4I9WD 3RY4A 1W8OA 3WFZA 2ZJSL 5SWSA 1FVDB 2CDFA 2SEBA 3VXRB 4KVNL 4MD0B 2JE8A 4V1DB 3DHJA 3O3AA 1IAIL 4M3JA 1FZJA 3QHFL 3W82A 3P11L 4P4KB 2D03L 5IOPB 4LLMA 2ZCHL 2BP3A 3FT2A 2Z8RA 1XGUB 3GGWB 3F12A 4ZUWB 3D3VD 2R2HA 1VEOA 4RQQA 5LGJA 3GHBL 5JHDD 4ONHB 4Z7VE 1GXEA 3JWDL 1BQLL 3OG4B 4WJ5B 2ZNWA 5D7LE 5J89A 3QIWC 5IR1A 1YNLL 1Q9WB 1IM3A 4G80A 2PO6B 2KQNA 1PFCA 5KANG 3BZ4B 4JCMA 5L0QB 1NSNH 2AJYL 1S7WA 2D7OA 5TH2A 3HE6B 2J2ZA 4HKJB 1YY8A 4RFNC 1SBSL 3TVMD 4KK9C 1OGAD 2NY6D 1Z9MA 1T7VA 2X9XA 4ELMB 1H3PL 3LKOA 3QDJD 4P3DA 4AM0A 3D0VB 1UXSA 1ODAA 4XCFL 3PWLB 4NO0A 5L88H 1UCBH 4UTAH 5JQ6L 1JPFB 4MA7L 3SGKC 4I3RH 4Y4FB 3LB6C 4LPUA 5GSVA 2B1HL 3GSWB 4PUBH 2OK0L 2HJLA 2FX8L 1S5IL 2Q1EA 4EIZC 4XMLH 4R7NA 5F1SA 1X5XA 2JCCB 1GH7A 5DK3A 3IVKA 1ETZA 2X4TA 3TC9A 1MJJA 4Z7WB 4MB5A 3RVVD 4IRJB 4PRBA 1JNJA 1WT5C 3GMLA 4XBPB 4P9ML 4HHAB 1ZSDA 1OP5K 4YDJA 3L3OB 2AV7A 1XGRA 3VFUB 3L7EA 4Q9RH 2XA8L 3L3IB 4P2CG 5EO0A 2HVKB 4PRDA 2AEQL 1MIEL 2WINA 4QCIA 3RNKA 1F4XH 1P2CB 4MJ5A 3ARBC 5JHDA 3OV6A 5TF1L 4AMKH 5JIKA 1OHQA 2VDQL 5ELIA 3D39B 5FK9B 3LB6D 3BUTA 4M00A 3ARRA 1H8SA 3C6LB 5K59F 1NCTA 1MLBB 3TO4A 4NO5A 5DUMH 2VL4A 5AUMB 5DD0H 3GKWH 1G7MA 1ZOXA 4D9RE 4KJYB 5KJRH 3WCYA 1L7TL 1KB9K 3V6ZB 2I60L 5JDSA 2X40A 3VGHA 1QSEA 3BGMA 4KFZC 3IKCA 3KJ6H 1KG0A 5DD5L 3VXTA 1HOCB 3TV3L 5C0GA 4YHNB 3DI2B 2A77H 4F15C 4PGCB 3EYVA 4R4FH 1G7IA 1AR1D 5IMLB 3S3JA 5LQBL 2LU7A 5GGRA 4PTUB 2UVFA 1CXIA 4NHCL 1LK3H 3EFDL 2DQEH 1S78C 3I50L 4P2QE 5J1AA 4YDVA 2YD3A 4N0UB 5GS2D 4LGPB 4P2RA 3FN9A 1GGIL 4JPWH 5I1LB 1FGVL 1T03L 4XPTH 1HI6B 1R3LB 4FMFA 1T2QH 5EBGA 4DEPC 4Y88A 1JGEB 4G42A 1ZLUH 3NN8B 3QQ3B 5D93B 4NZUH 5D96C 1U3HB 5I6XC 2FEDC 4G6JL 4NCC2 4Y1AE 1NMCB 2BHYA 1P9MA 3JWOL 5JA9A 3QDJE 2YN3A 3IDXH 3ULUL 5F96L 4Z76B 2J6EL 3W0WA 5FGBA 5F1IB 4DUXA 1TQBC 5FYJL 3LKRB 4RGNB 2CH8A 4JDVA 1J5OH 3VXSE 6FABL 5LAXB 2X5PA 4H25B 5ETUB 3NABH 1RURL 1JGLH 1YMMB 2DQJL 4JFQA 3UROR 2ATKB 1KN2L 4YE4L 3DX9A 3O8XD 4O02H 5IMOA 3M45A 3EDKA 1M05A 4R90H 4NCC1 5J6HA 3UJIL 35C8L 2P5EB 4IIQC 5IMMB 4PJDF 1IFHL 3MV8A 3DGGA 4JZOA 4PJCB 5KZCB 3S9DB 3SDCD 2HKHL 5JHDB 3I9GH 3OAYH 4ETQB 5IQ9A 1U8IA 1QLRB 4JPKH 3QUKB 5SV3A 2VZ1A 5HHQA 1PD6A 2QSCL 3W9DB 4AEFA 3MA7B 1IAOA 2BSRA 1G9NH 2L0DA 2EH8L 3BAEH 4JDZB 4OD3L 3HAEG 3GFUA 4PS4L 5IBLC 3DIFA 2EH7H 4HFWA 3DSFL 1CIUA 2QTEA 5FO7A 3RL1A 1BGXH 2OTPA 1CU4H 4LSTL 4X6FB 3VFWB 4DVBA 5DJ0A 5ALBL 4PJ9C 3VCLB 3GMNA 4XPBL 2DDQL 1IEBA 4EKXA 4RMQA 1G9EA 4O51A 4DKFH 3VFRA 5CD5D 3LKPA 4YXLH 4HHAA 2DBJA 4S1DC 2E3VA 3MYZA 3VGAC 1VPOL 5ID1B 4AEEA 2CUMA 3GMPB 3HTLX 2P5ED 1N8ZA 3M8OL 4N90E 1RIVH 2C4XA 2R2EB 1QBBA 4O58H 3VE0A 1C7SA 4HEPG 4LP5A 3PWJA 3IDYC 2HTKD 2EIEA 1MPAH 3B5HA 4HC1H 3QG7L 2RCSL 3JWNC 5B8CA 4ODSL 3M1BB 4CW1B 4HJJL 3QXDA 2QSCH 5KS9F 3L3JB 1CTNA 1YEIH 2XZCH 3BPOB 3MO1B 2IBBA 3BO8A 4DKDC 1JHLL 5ERWB 4E5XA 3NN8A 1ZAGA 1MSPA 1T0MA 3V8CA 4P2RD 2P5WD 5LGKA 3ME0A 3QNZB 4LRNH 5T1DL 5HYSA 5BW7C 1GGBH 4GG6A 5IBUB 4GQPH 5L2KE 1VKXB 1Q9OB 1KIUA 1IGFH 1QSEB 5I0ZA 4YH6A 4F57L 4KK8D 1CLZH 2FCBA 5ESVA 1U3HC 3P40A 4NO3B 5JNYB 4JM2D 1CLYH 3DX6A 3P9WB 4Y2DB 5EU4A 2D3VA 2Y25A 1JWMA 1YPZE 4FP8H 4OAWA 2NZ9D 2VDKL 5B39A 2ZUQB 2D7TH 4P2QD 4NPYB 4DK6A 2W0FA 5CILL 3HE7D 4XRCA 5JOPD 4LPTA 5IW6B 3FQRB 4GW1A 3UBXA 4PJIE 4PYGA 2A9ML 4XP1H 5DJDB 5A3ID 4OGAD 5FDWB 1S78D 4PJ5A 3H9SE 3CFJB 3QIBB 5KBNC 2GFBB 2AEIT 4JPWL 5IWLA 1DL7H 4KDTC 5CJXC 2VDRL 2VLJD 4ELKA 4P0DA 4ENEC 2PXYB 3PWNA 4YQXL 1NH6A 3IFPB 2H2PC 5J7CC 1KEGH 1KULA 4PLKC 3JWOC 4UT9L 2VJXA 3C6SB 4U3HA 5BZWA 2BOBA 3ROLB 3F7RA 3UDWA 2IH1A 5IP4A 1MFAH 5FV1L 4HWBA 3DUHA 2P8PB 2AGJL 4X80L 1CGSH 3QIUC 4NRXB 3TPUA 4GUPB 2Y7QB 1NGQH 1TDQA 3IJSA 3MREA 1MCPH 3RTQD 4Z95H 2DB8A 4QGYA 1CFQB 1FVCA 3CVIL 2ARJQ 3BWUC 3T1FB 1ZLSL 3WFCH 4CADA 4FFVC 3MRPB 3U1SL 1CZ8L 3AS1A 4LCUB 4XI5D 2C1PB 3IGAA 3NZ8B 2DQHL 5FOBA 1IM9A 2LE9A 3UO1L 3QUKA 4P5TA 3VFOA 1VERA 1VHPA 5E8OA 4TN9A 5T5NF 5GGVY 2DQUL 3FT3A 2OXHA 3VI3F 1XGQA 3NFNA 4LQFL 1NAKH 4QF1B 2VIRB 3HMWH 4JO4H 4GAYB 1FIEA 4JY6A 4ZUUB 1GOHA 3OSKA 5BRZE 1ZHKB 2G75B 1GCFA 5GRXG 5LWYL 2CRYA 3FT2B 4MWFA 5DTFA 3V79C 4D0CB 3Q0HA 2XWTA 2IBGA 4R97B 2YD1A 2PYEB 1G1YA 2KPNA 4G43A 1KBGL 3MLSH 1HH9B 4KMTH 4QT5B 3SE4A 1T5XB 5DRZB 4JREC 1OSZB 4CUCA 1BPVA 1NGZA 2D0FA 1EEYA 4YHYC 3PIQA 5EO9B 2X4RA 4HIEB 5L8JB 1I1YB 3FONB 4TVPL 4O51B 2JIXD 4HWEH 4D8PA 3LEXB 3TM6A 2AK1H 3SJVD 3C08H 1LEGB 2FZ3A 5HI5D 2A83B 1GL4B 2R8SH 1XIWC 4A2MA 1FE8L 3HI5H 4JKPH 1SMOA 2CQVA 3TH2T 5HI4D 1YYLH 2UUDH 3EYUH 2GTZB 4MA7H 3OR7B 2UZYB 1CWVA 4YBQC 1HYRC 5L0QC 4NPYA 1YZZA 3RJDA 5KVEL 5L2KB 3O4LE 5EZIL 3UPAA 3I3BA 3M1BA 3BN9C 4M6NH 1CT8A 3TEUA 2C3XA 5GSVB 3BRDA 5DJAA 3BGFB 1F02I 3UTPE 3WIIL 3SKNB 2VXQH 3LEVH 4Z8FH 4Y19E 4YO0B 1QSFE 1T3FA 3NPSB 4I8DA 3AMKA 4AG4H 5DEGB 4JDTH 3JSSA 1FL6A 2VQUA 1I3GL 5DJ8A 5BXFB 4HKZB 4AZ8A 5IEHA 3IFPA 1T66D 5LBSL 1EEZB 3ZT6A 1J8HA 3CPLA 1WBZB 4LKXA 2YRLA 4FFZL 3CH8A 1BJ1H 4XNQA 3IU4H 1KLUB 2VLJE 4FMKA 4PJXA 5MP6H 5C0FA 2VH5L 3EHBD 1OAZH 4KPHH 3PGFL 4NUJB 3SDDD 1FSKC 3QDGE 3RL2B 3TT1H 4P2OC 2ENYA 4ODUA 1D9KC 1JPGA 3RWJA 2UY6A 1KYOJ 1WFTA 3GM8A 1ES0B 5HVFB 2Q8BH 4BFIB 4Z8FL 1LO2H 2WIIB 1B2WH 5JDJA 1HHKB 3H7BA 4L9DA 4Z0XA 5HDQH 2YUZA 4HULB 5FOBB 5I73C 2EO1A 5IF0A 3SQOH 1XF1A 4JHBA 4ZFOL 2ZOKA 5L2KD 2HFEA 1PAMA 3WDIA 5C6TL 4RRPA 2NLJB 1CF8H 4LP4A 2GJZA 5ANMB 5CEXA 4KJPD 5IB2B 5KSVA 1GSMA 1JWMB 3SGEH 4PJCE 2FJGB 3I02A 3DXAB 5EC2B 2HJFB 2GCYA 1F45A 3PJSB 2DLIA 1R3KA 5FO9B 1QFPA 4XCCL 4QNPF 5F71A 1KCRH 1XGYH 4N90D 3TBYA 1CGUA 3SQBA 4KMTL 5B3JF 3O9WD 2E7MA 3VXSB 3WL9A 4LDEB 3FFCE 1EO5A 2Z0BA 3BGAA 3CSYB 4OFYD 1HHIB 5IUSA 1T0NA 2ICES 5FYKD 4U1JB 1AC0A 2LAAA 1G7QB 2GJ6E 1FAIH 4NQDA 4P2QA 2BVOB 5FGCE 2JIXA 1NJ9B 1MCLA 2W60B 1W0WA 4OD1L 5KSUB 1YEJL 3TBSB 4JRXE 4EUPB 5IB4B 3DROB 5JW5B 5C09D 3L5XH 4JY6B 2VLKA 1A0QL 4G8FA 2B8OT 5DMIL 3S88H 3MOBH 3S35X 1IAKB 1ZVSB 3MFGB 3KS0H 1QHPA 1NL0H 1UFUA 1R3IL 4FXKA 3HC4L 1HIMH 1KTLA 5JIIA 1JPSL 5D1XB 2R56L 4U6YB 1ND0B 1T6VN 3RX5A 4PBVC 4ENED 5GGTA 5DFWH 3W5NA 1XGPB 3PIQB 4M43H 4YGVB 4X80H 4WEMB 3MX0A 1JZ2A 5J6HB 1FFPB 1LO2L 4LPXA 5D7JD 4Z7QF 4KROC 3I6KA 2MNUA 4APQD 1X44A 3QXAB 5HTSA 1BBJB 4XPFL 4HXAH 1KEGL 2F53D 1CL7H 3IT8D 4XP9H 5D2NA 1KTDB 2WP3T 1OP5H 3ARGC 3QQ9D 2BNQE 1XF5A 5IVZA 3RTQC 5C07B 3GSVB 4OF6A 1MCOL 4Z18A 4WU7A 3KPPA 1I3VA 4AENA 1HH9A 4HUMB 3TO4D 5EN2B 4JFDB 4UQ2B 2YKLH 1U41A 4Q0XL 1BM3H 3GJFA 4I2XA 5HHOA 2H41A 3P30L 2M1KA 3G08B 3RWHB 4NC1E 4DCQA 1U58B 4S11A 1C5DA 3EGSA 3KWWA 4M5YH 1DN0A 5DJ8B 1FYTB 4RNRA 4OD2B 1II4E 1EUUA 4J3TA 1KPUA 5ICZA 1BF8A 3L95B 4QHLA 2Q8AH 1GOGA 3OKYA 4HXBL 2AS5M 1A3QA 3MRQB 5D7IF 1OTUC 5ISZD 1N7ML 3B5TA 3X3FH 1N5AB 4EDWH 2O93L 3EJZD 4ZOBA 3SKNA 1FO0B 3K4DA 4KH2A 3IFLL 3WN5B 2HTKC 2KQMA 3HR6A 3NACH 4HF5L 2ZSVA 1W2KT 4KI1A 4ZD3H 5T1DH 1CGWA 4EXKA 2ZUTA 2Y1VA 3JV6A 5ISZA 2WUCH 1Y6NR 1A6UH 3MJ7B 3FQTB 1D5MB 4P46A 1OLLA 4QXUL 4C83A 4LSDA 2XICA 5I8KL 3TNNB 5AD0A 4URTB 3VRIB 2FJFA 4DTGL 5J8OA 1XFPA 1OW0A 5ISZE 5DFVD 4Y16D 4IOIA 4H8WL 3RBGA 4ELME 3LRSB 4MCYA 2P7TB 3P4LA 3OGOE 3V7MA 3RDTA 2A9NL 2I26N 1UQSB 1RZGA 3OKNA 1Y18B 1ZGLA 4PG9A 5EU7C 1FYTD 3P77B 4G9FA 4LSUL 2E7HA 5IT2L 3G6AA 3G04A 3ZKMC 1I9IL 3B9KB 2MHAA 3GRWH 4NO3A 3ZDXF 1HWHB 3QXUA 5HGAB 4DKFL 4OV5A 3MOBL 4K9EH 4WHTB 4JO2H 1A7NH 4OLXL 5E00A 4LSPL 2J8UA 2Z31C 4JG1H 3P0VH 1OWRM 1P7KB 1EDQA 4QRPB 4N8CH 3OKMA 3P4NA 3CVIH 2WLYA 4P23C 4BK5A 4PY7B 5C0CA 4QY8B 1CXLA 4G6AD 3VXOB 4WHYH 5FYLH 3MJ9H 4ZDHA 1Q1JH 3L7FA 4PJAE 2UWEF 1MHHA 1WZLA 5SWSD 1GIGL 4YHMH 4MNQD 3D39E 1S9VA 4CVZB 3RWGB 4P3WA 4JFFA 1SBBA 43C9A 3L6FB 2PO6A 1AR1C 1U8QB 3V4VH 5H35A 2A6IA 5KZCD 1NGYA 5CD3A 3I6LD 1P53A 2RIKA 2BOBB 3EDEA 1V05A 3S3SA 1RU9L 2VISA 3QUXB 3EOBB 5J12B 5D6CB 2R1XA 1WBYA 3LS4H 3MBEC 4NN5C 2HG5A 3HC0B 4O02L 5D6DA 3H0TA 5TDOB 5AAWA 3B9VA 1N0XL 2AK4B 5D2LB 5DQJB 3HRZA 4OGZA 3E2HB 4BZ1L 2ERJB 4M7JL 3FFCD 2JELH 2HN7A 1W0WB 2PKDA 5IG7B 1N2RA 2QBWA 3IU3A 5C0CE 2EXYC 1FH5L 3GMOB 3WEXB 3EO1A 2DI8A 1A6ZA 5I71B 1MNUL 1CGTA 4GH7B 1I8MA 1DQQA 4L4JA 3H9SA 4Y2DD 4F7EA 1XGQB 4WU7B 1DLFH 1UH4A 2ZUUA 3QDMA 4KRNA 5GGTL 3DYOA 1KEMH 4HQQH 1ZTXH 3RX8A 1NFDE 3X14B 3VXMA 2J12B 4V1DA 4Y8AA 1NUDA 2BSSA 4FQXB 4FQPA 5HI3C 2YBRA 3KG5A 3T3PF 1FL5B 3LRSA 2DLFH 4L9LB 4J7RA 4W4NA 1OSZA 3UEZA 1MAJA 2XZQH 1OGAE 4NC0B 3EFDH 3EO0B 5FOJA 2XZZA 4OZ4A 3A6OA 1FPTL 3X3GH 3DO7B 1F4AA 1QR4A 2AVGA 2K9UA 2BY2A 1TCRB 3MRNB 4YHPA 5DA4A 3T0WA 2R9HC 4QHUA 3D6GA 5F7UA 5GGSY 5CKAA 3LCYA 4PGBA 4XBGB 4OGYH 3VFVA 3UDWC 3FO9A 3J8F7 3S97C 4OZIA 2VC2H 3B9KC 4PRNB 3T4YB 4WUKH 4I5BB 3MMEA 3SDAA 3BMWA 4Z7UA 3S34H 1F42A 4MXVE 3MV7E 2ENSA 2IC2A 1IGYA 3RVWD 1QLEL 2ADGB 2VXUH 1HQRB 5EDXA 5AYUL 3MJ7A 1B0GA 3D25B 1OTUD 1I1RA 1C08A 4YAQA 3HB3C 3L3OA 2WAHA 4KK8C 1G6RA 4EVNA 1ZE3C 4N8VA 5DDHA 3EOAA 2J4WL 2VTFA 4KZDH 4HCRL 1U95A 4P5TC 3GMQB 2NPLX 1P2CA 1C1EL 4M48L 4UT7H 3MUGB 4OLUH 5CP7A 1Y6KR 4NO0D 1KN4H 1CXFA 3UC0L 5GRUH 4PJ8C 1U92B 3V7AG 1UB6B 3L7EB 4RMRA 2NTSP 5DD3H 5T3XD 4CJ1A 3QEGL 2D31A 4HPOH 3WUZA 1Y6MR 3VFUA 3EIFA 3QWRA 5K9QI 3QG6B 3QUZC 3CIQA 2OJEA 3QXWA 2X05A 2IANB 4AJ0A 3BWAB 4KKBC 3B83A 3CFEB 3L1OL 4KMQA 4HAGA 1JWUB 1ZA3A 1Z3GH 8FABA 2Y4SA 3EFFA 1TQCC 6FABH 2R39A 3ULVF 4QRRB 4JFZL 4P46D 1PBYA 3FZUC 3H9HB 3KPTA 4TNWF 2MOVA 4ZPVA 3TVMB 3DTXA 2DOCA 2F5AH 3WJJA 1E0OB 5FIEA 1U8QA 4IBLT 4NWUH 2V7HB 1R5VA 3JWOH 4YDVB 3VI4E 4ISVA 3U7WL 2MPAL 4JB9H 4G8GB 1ZT4A 2YUXA 2A74B 3AAZA 1DE4A 2WIMA 3OGCA 3K81A 4U1NA 5IMLA 5J3HD 1BX2A 5F44A 2ADJA 2FD6L 4HUXA 5E08L 2XZQL 1UEYA 5JORA 2HJKA 2APBA 4GRWH 5HHPA 3CGTA 3WLWC 2CKBB 3FO0L 1D5XB 2DQFB 2DMKA 2A2QT 5DO2C 1P9MC 4MX7A 3UTSA 4DWHA 3SEPA 5I19H 2DWDA 1UJ3B 4JANA 5H2BB 1LK3L 4AYFA 1F6LL 5E7FA 4OI8A 4TPRH 4M1DH 3UTTD 1FBIH 1J1XH 5D8JL 4W68A 1U3JA 1NQBA 3PWPB 4CNIB 3UYRL 4ZXBC 2FO4B 1IEAA 4NZRH 1LGVA 3QIWB 2K3TA 5DGQA 4GKZA 1V7NH 4I48B 2BHZA 4J3SA 2A77L 3SDAD 5HD8D 3QIUD 1TXKA 1IAII 2BVQB 3QUYC 1JPSH 4FQXA 4EVNB 1GAFL 3NMEA 2HLFC 1DUZA 3D0LB 1XF2B 4U7SA 4O2EA 4BSWB 4DGIL 3RKDD 2OR9L 3NGBC 3L5XL 1BJ1J 2V5MA 4MD5B 1SQ2N 5C0IA 4K8RL 1I1FB 2H9GB 3BJLA 1I3RB 1MF2H 3KLAA 1EO7A 5FB8B 5I76A 4LMQE 4XVUD 5ECJE 2VDQH 1X4XA 3MRGA 5K9KB 5TFSL 3U6RB 4WHYG 5IOPA 4ZXBD 1CFNA 1MCDA 4KWUA 5DD3L 2M26A 3I3EA 3QO1B 4OSUL 2FIKA 5EWIL 1Y0LB 5F7DA 3TZVA 5TF0A 2VKXA 3CFCH 2FSEB 1U8JA 1MVUB 1CDGA 2VR4A 2NY0D 2M2DA 4MXWL 3U0WH 3NA9L 2BNQA 1I85C 4HDIB 5BQ7A 5DJ2B 1A1NB 5FYLL 3BMVA 4WW2B 5EZLB 2WW8A 5DURB 2ZZUT 1CD1B 4IRSC 2R1YA 2J8UF 3V5HA 1JN6A 4D9LL 1UZ8B 1CLCA 1U8MB 1PYWA 3JTSB 1BD2D 1XGTA 3RU8L 3T0EA 2XTJC 4A2LA 3NFSH 3ELAT 4RMUA 3SY0B 4AEHL 5I1AA 2V2XA 3SOBH 1X5FA 2R29L 5SX5H 4DKAA 5M94B 3AY4A 3ULUD 4NWTL 1FSKB 4JZJC 3HG1E 3WS3A 4LDOB 4JRYA 4WO4D 2BXYA 2PR4L 5DLML 2R23B 5F97E 5I1EL 2BVUA 3RVTC 3AS0A 4S0TD 2FATL 1Q72H 5ACZB 1EERB 4HFUH 1A8JH 3ZL4L 2VWEC 4P46B 2EYTA 4JQVA 1T22A 5ERWA 1ORQB 2CKBH 3DGCR 1S7UA 1VADB 4DVRL 4CW1A 4J8RB 9CGTA 3ARFB 2P7TA 5FA3B 1R5IB 1F3DH 4WCYL 1PZUB 3O2WL 1CGXA 3D3VB 3G6DH 4NQXA 3HS0A 4XHJC 4Y1AD 2DF3A 3OXSB 1NUNB 3ZTNL 5DVMA 3VXPB 2K1MA 3V95A 4YXHL 4BSWA 3TA3A 1NBZB 3L3DB 1JNNH 3RWIA 2VXSL 1TETH 4NHUA 1EPFA 3VH8G 5E6IA 2J6EH 4LLVA 3CH1A 4OTXH 2XNAA 1F58H 4HKXB 3PHOB 4K71C 5F70A 1D6EA 3U9PL 1XF3B 4U6HA 25C8L 5CJXA 4MA3B 4Q0XH 1ONQA 2W0FB 2OYPA 3DNKA 1RZJH 1UM6H 1KSRA 1UT9A 2X9WA 3B9KD 3CFDA 3D1MC 3CVHL 5CUSL 4JFFB 4QXGL 5TE6H 4XAKE 1M7DA 4PJ5B 2IH1B 1VFBB 2WWMD 4KDVA 4MXQD 2YPLA 3F5WA 1KJ2A 4EUPG 1N6QL 5KSAA 1YY9D 5C0CD 1AY1H 4OLZL 4G6FB 4MJ2A 2BVPA 4GRLC 3QNXB 1S7VA 4RMWA 3BXNA 4Y89A 3PWPE 2PNDA 4U1MB 4R4FL 4KRLB 2JJWA 4NQEA 1BZ7B 4OGXH 5IIEA 1DUYA 1T83A 1SYVB 3FRUB 3T0DA 1E4WH 3TV3H 3VXUD 1GC1H 2OL3B 5FYJD 4WENB 5FUZH 3PWPA 3UO1H 3OXRA 3QUYD 5T1KD 2VDLL 1X5KA 3QZWG 4KHTH 1FVCB 1UM4L 3DURB 5DMIH 2E7LA 2UUDK 2VITA 3P0VL 3QT2A 2NY3B 1QG3A 3FB6A 2OR9H 3OKDB 1I1AD 4FZ8H 4R4NC 3V8OA 4KRMB 4XC3L 4WEBH 4GKNA 1T1WB 4FRWA 1BAFH 2FYYA 3O3EB 4M93C 5DJ6B 5J13B 3TO4C 3ULVD 4JFYB 1JNHA 4WTZA 3L5JA 3WHXA 1BJMA 1F11A 3GHEH 5I8EA 4B50A 4CADB 2NZ9C 5DURD 5CEYA 3S7GA 2VERN 5KW9H 3PGDA 2HFTA 1L7IL 5BV7L 4YHKL 5GGQH 1IC7H 4FXGA 2NY4C 1CLOL 4QYOB 1IL1B 1ADQA 4D9QD 5I0DA 2AEQH 1H5BA 2EDDA 1NBQA 2Q8BL 2LAGB 4QRQA 1RULL 2QHRH 2OMBA 1TZHA 4LAJH 5DSCA 4NO5B 3HS0B 1YQ2A 4NDMB 4QT5A 3SO3B 1M71A 3HUJB 3VFMA 4WCYH 2VUOA 3DMMB 4GG8A 2CLVA 3OZ9H 4MQXC 5ITBL 1SM3H 3S98A 4OLVL 1TCRA 2AK4D 3AS2A 5I1HH 1NC2D 3H6JA 1YUHB 4XP6H 2V7NB 2ADFL 1K2DA 5CP3A 1H8NA 1LEGA 2FZ3B 5DS8B 1SJHA 1WCBB 4I3RL 3JV4A 1BVKA 4G9DB 4EQ2A 3SKJL 1A9BB 4MAYC 1CXHA 5T3ZD 4D8PB 4LDLB 4XCFH 2VXQL 3V5HB 3HI6L 3DVNB 4XVSL 1MJUL 5JXED 2B1AL 3KPLA 1LD9B 3BPLC 1F2QA 3KLSA 3S3PA 2V9TA 3OR7A 4YNYB 1JYVA 4NNYA 2X42A 4R0LB 2W9EH 2APWA 1QSVA 3ILPA 4R6UA 2YD6A 3R8BB 3VE0B 4F57H 4OF3A 5I74B 2QHLA 1J8HE 2ADFH 1D9KA 4ZS7L 4P9HL 4GKOA 2R4SL 2V5YA 1JRHH 4KTYA 1P5VA 1UVQB 3OPZH 3O4LD 1DLHB 1FFOA 3W0WD 2Z4QB 1YQVH 4CL7A 1OTSC 4XCNB 1OM3L 4HBCL 2VN4A 4IMLA 4LLVB 2I27N 2BFVH 4X7EC 4XTRC 5A16B 4MHHG 3ARTA 2DRUA 4Y2DC 3VGBA 2A6JB 2X70B 5DUBA 5JZ7C 4PJEE 5IMOB 3EYQD 1H3UA 1OGAB 5HHOD 1R6VA 3RWJB 1AGFA 3FCTA 4ODTL 3DXAA 4UB0L 1S7TA 3SDXB 1RFDL 2EXYD 4FN0A 1IGTA 4P3CH 3AGVA 2X1WL 4ETQA 3PUCA 4RRPG 2V9RA 2F58L 2I9TA 3VXNB 3I2CL 3IETA 3BPCB 1MQKL 5TDNA 3EHBC 1BMGA 2CGRL 3RZCD 4YIQB 1UENA 4BM7A 4MXWH 3U0WL 4APQA 3B6SB 4GXVL 2HJKB 5FO7B 3RL1B 1EK3A 4PJHB 2EE2A 5EPMB 5HI3D 4LNVA 4M1GH 4XNZB 4Z7NF 5EN2A 5F93C 2QQKH 3CSPA 1QFOA 3WXWL 4GRLD 1WTGT 3BDYH 3QULB 5M95B 3HRPA 1AO7D 2EO9A 2X4QB 1H15A 2CDEB 1INQA 4TNVF 4NYLB 4PJFF 1WIUA 1YMHA 5E6ZA 2DQJH 1JTTA 2H32H 2B5IB 4MAYB 4G8EA 1BBDL 5DI8A 4YGVA 4J12A 5DRNA 1BOGA 4KXZI 3TF7C 5FM8A 4O2CA 4GAFB 1F5WA 3X12A 1CFBA 2F54A 1D5BB 1FNSL 2VITB 1ZT7A 3VJ6B 2AEPH 1AQKL 1P4BL 1PG7H 4U1IA 4MNGA 4JFYA 3UYRH 3VXMD 3DVFA 4ZUWA 4QRTB 5TPWL 2XA3A 1I8LC 4KGLA 1A3RH 3LV3A 3UJJL 3O2WH 2D0GA 4AIXA 5E56A 3KPRB 4DUWA 3OKEB 4Q6IA 2W38A 1OAZL 5HHOB 2I07B 1G7HB 4GG6F 1UWEL 1P5UA 4LU5H 4OJFL 1OTTD 2CKNA 1CTOA 1MUJA 3UBXG 2X4RB 2C3VA 5D96B 5CZVL 2A6KB 1XH3A 2VOTA 3MJ9A 4KQ4H 3RDTD 4NKMB 4ODWB 2OR8A 1FLRL 1U8MA 4V2BA 1T7XA 3VXUE 2Q87A 1G7MB 4LCCC 3I3DA 3GDBA 4EIGB 1LDSA 3CK0L 3RUGE 1CLYL 2ICWJ 3IDNA 2GAZB 1QRNB 4M8QA 2LVCA 5HYJE 2G5RA 2W9DH 4LLDB 4Z7UF 3U7YL 3PABB 1BFSA 2I25N 4YGAB 3UZVB 4F3FA 3MNWA 3BPNB 1JK8B 4PRIB 3EYVB 5GGUA 1WIOA 1T1ZA 2EYSA 4M1CD 1M7XA 3VFNA 4P5KB 3MZGB 4HWEL 4QGTA 4AMKL 1JFQL 2HFGL 3OHXB 4K3EH 3E3QE 3FJTA 1AGCA 2X70A 2J1KA 4Z7VF 5GRUL 4NSKB 3F58L 4Y19B 2X4PA 4GW5B 2NX5B 1X4ZA 4HLZG 4M48H 3TH4T 3B3IA 1MWAA 1OGTB 3AVEA 5FUCE 4G8EB 3IDGB 1MCNA 3P4MB 2DWEB 1EJ6A 2HFGH 3UTSD 5JZ7D 1ES0A 5HSFA 2DQUH 1PJ9A 4P23A 3DV6B 4K7PL 4RAUA 4FS0A 4L4VD 5GS3A 2MQ3A 2AJ3A 3MV7A 2VB5A 1BREA 1UZ6E 3GK8L 4D0CA 5JXAL 4Y5XB 1QBLL 3JVGC 4H25A 4CRPA 2MHAB 3T0EC 1LO3H 5MI0C 5HVHC 3V4PH 3X14A 1F6AA 3DBXA 3MRBB 3OAUH 4PTUA 4Q97A 2OSLA 1F4YL 4XPAH 1PKOA 2V2TA 4OD3H 4PD4K 4U1KB 1G9NL 2J88H 3VRJA 1EXUB 1OAUL 2EEBA 3LS5L 3RGVA 4QY8A 1DANT 2O5XH 3MBEA 5KVMC 1S3KH 3FO2A 4ZAKB 2AI0L 4M61A 5JIPA 4FA8A 1H3VA 3DXAD 5DD6A 3C2SA 3QUYB 3LS4L 5T1KB 4LU5L 5B38G 4F7PB 4QXTA 1MCOH 3ZKMD 4XGZB 4WI2A 4MZ2A 2I5YH 2H8PA 3MXVH 4N8PA 4JY4A 5IQ7H 1OP3H 4PLKD 1NGPH 4PGZA 5FGCB 4RMSA 3T0ED 5DFVC 5GGTH 1S5HA 1ZHBA 4ONFH 1S3KL 3RZCA 5CILH 2WBJB 5F8QC 2ZJSH 1JZ5A 3M07A 3W5MA 2E27L 4POYA 3LKRA 3N1PC 1OAUH 2VDNL 1KC5L 1XIWB 2BRQA 4LVHB 3GBMH 5GGQL 1QFWM 2ZOLB 3FT4A 4X4ME 3OAUL 5E6IC 1MAKA 3U36A 2O5ZH 1ZVHA 3BDBA 4POZD 3S5LG 4JG1L 1JUFB 2W0KA 2FWOA 4LQ1A 1NMBH 2F9BT 3AFLA 1YJDC 2BDNL 3MLPA 2YPLE 3QDHA 2NY4D 4KY1L 1MY7A 3L3JA 4PBWD 1FGVH 1DBBH 3H9SB 4F7CA 5ITFB 5DC9B 5F7FA 3WUWA 5E4EC 4QHUB 5GHWH 5TQ2L 4HS6B 1LMKA 5L9DL 1J0KA 4GBXA 1RJYB 1TQCB 2CLVB 3E6HA 1KTRL 1WFOA 2D7PA 2B4CC 3LQAL 2X7LA 4HJJH 3OQ3B 1NLDL 3MCLH 1RHFA 3HAEH 1VFOA 1C1EH 4ONGH 2AJVL 4UT7L 4XNUL 4N9GB 2VDPH 1DANU 1TJHL 3MLWH 5F3HB 4YZFE 3LIZH 5T5NG 1B0GB 4J2XA 4PJGB 5EBWB 3S96A 4J6RH 4W6YB 1E4XH 1RZJL 4JAMA 2YUWA 3EGSB 3ILQD 4OLYH 3KXFA 4PUBL 5FO9A 5B39G 1FL3A 4JO2L 3FQWA 5IB1A 3FB7A 4UZGA 4PRNA 4XBEH 1F4WL 4I1NB 1QRNA 4M8QB 3MBXH 1QSFA 4RCAA 5GPRA 2HTLC 1CICB 3U7AA 5BVPH 2YD4A 3L5WB 3T09A 5DJDA 1JP5A 3CDGB 3EJJX 4WV1C 4L9LC 2NNAA 4Z5RB 2VABA 1IGIH 4L4TA 3RZWA 1D7FA 1CVSC 4X4ZA 1U3HD 2F15A 3MGOB 4K07A 1JWSA 2V2WA 4U1LA 3ECBB 3O4LB 4Z7VA 1AH1A 2AJSL 2XQBH 3DRTA 3VWJD 1ZKAA 3N0PB 3TT1L 3QISA 1K4DA 1P69B 2DJ4A 3QA3B 5I15H 1HH6A 2IPTH 3O2VH 2EICA 1IFHH 4PRHA 4MJ6A 2X4PB 2ZWLT 5DHVB 2I9LB 2AEWA 1KLFA 2E7BA 3C60B 2KL6A 1ZGLB 3FAWA 2NXZD 1ZLUK 4LIQE 4JDTL 4MMZC 1JGLL 3TIDA 4ZOEA 3IKKA 1QRNE 1NGWB 4PLOB 3VXRA 1MIML 2IFFL 3GSNA 4MS8C 1U3YA 3LQZB 3KPSE 2BXZA 3C8KB 2QV2A 3QUZB 3WFHA 1IGML 4NO2A 3WNNA 2C9AA 5BJTB 2GJJA 2B2XL 3NA4A 5DRWA 2ZP0T 5EH1A 4WHDA 2E9IA 3X11B 3U0PB 1CFVH 3OKOB 3SOBL 1K8DB 5D72H 3SKJH 3MRRB 3G6JE 3PNWA 4NRYA 1AHWA 1RJCA 3DTXB 4UQ2A 3RAJL 3HI5L 5E4IA 1GHFH 4JN2B 1ZS8B 1WVZA 4U1GB 1NUFA 4G8IA 2DTMH 1OF2A 1GGCH 4X6EA 2R2HB 5LGJB 3IXTA 3U0TB 3L6FA 2DYPD 1JGDA 4HKJA 4PRPD 2Q6WA 3Q6GL 5IHZB 2E9JA 3P11H 4RNRB 4WW2A 4EEEA 1CXKA 3S96B 1RSFA 3R8QA 3P3YA 2DS4A 1MHCB 2Z31B 5FM5O 1ACYH 3D0VA 4XPFH 4GRMB 5IEKB 3QHZL 3BOVA 4FQJL 4M1GL 4YJZL 1A7PH 2YD9A 2CR6A 3ETBF 5HGDA 3WXVH 4CNIA 4KU1A 3T1FA 4RDQG 1FN4B 3QUXC 1DJSA 2VXVH 5KW9L 4NRXA 3GSRB 3QJFA 4GO6B 1CICC 5F1NA 2VE6A 4Y5YA 1I1AB 1ZANH 4JFHE 4YZFF 3BQUC 3BPOC 3W39A 3PL6C 3MUHL 5A43C 4GMTH 3FN0L 2F53E 4DGIH 4POZC 4TVSa 1P1ZA 4KHTL 4KK5D 4L29B 4R8WH 5FKAB 1EHLH 3B8SA 3D0LA 1XF2A 2BSTB 2IWGA 3RPIB 1JNLL 3N9GL 2WLZA 5A40E 1WWBX 2GKIA 5D7JC 5I66A 4G5ZL 5C0IB 4EN3A 1FZMA 1WFNA 3FFDB 1UXWB 3CLEH 5GRZA 3P9LA 3WKML 1EVTC 2C1OA 5FFLA 4UU9A 3WDHA 4IS6B 3BISA 4UIKH 3MRHA 5I8CB 3VI4F 2YMXL 1PLGH 1FCGA 5ILTL 4P9MH 1OL0A 5HYJD 4NC1C 4TUOB 5DHXB 3V0AC 3ARFC 3BZEB 4JQXC 1GGCL 5IHLB 5T3XL 4QXGH 5JUEH 1TVBB 3KJ4C 5IB5B 3E6FB 4TSBH 1AJ7H 4BUGA 5A2JH 4OCSL 3BZFA 5DJ2A 4LCWD 1FP5A 2F74A 5JQ6H 1PVHA 4HIIA 4JCLA 3NIGE 5CS7A 2DBLH 5GISH 2YZ1A 4PJEB 5JQHC 1DQLH 5C9KA 4OT1L 3QH3B 1NAMA 3IVKB 2B1AH 4BH8B 2XKNB 5F89B 3T04D 1SBSH 4H20H 4ELMF 3L9RB 5FF6A 1T22B 3MRDA 1RMFH 2CLZB 2W92A 1MRDL 1E27B 1N4XH 5E2TL 2EE3A 4M1CC 4WW2F 3EOTL 3F6IA 2WUBH 4H0GA 1FE8H 3MUGA 3QDMD 3VWJC 2NY5H 3C5SB 1AXSA 2Y36L 3OKLB 4F15B 3HLAA 4BK4A 2HN7B 3JWDH 4I9WE 2XN9A 5DZOA 2YS4A 1KLUA 5E5MA 4ERSL 1F4HA 2BNRD 3GSNH 1E28A 3QEGH 3OBAA 3L3DA 3RWIB 5HY9A 1VEPA 3QDAA 5GGSB 1VGKA 5FYKE 2E8ZA 5I1EH 5DRWB 43CAA 3GSXA 1ADQH 5CGMA 2XPGB 3PQYE 5MEQB 5LWYH 1CG9A 4DAGH 4PG2A 4LARH 5CJOL 4F58L 1INDH 1U8KB 4HCRH 4YHKH 3G9AB 4HAFA 1D9KD 4DFIA 1T1YA 1JHTA 2PYFB 4WEUD 4XNXH 5JHDE 3RWDB 1NAKL 1PZ5A 3VD4A 2LVEA 3RWEB 1BD2B 4JM2B 5HBBA 3O2DA 2EKSA 1MCKA 5IK3A 4M02A 4XBEL 2DQHH 4PJ7A 1R3HB 3FRPA 1I8IB 5HHVH 3GB7B 1NCDL 4YFDB 3HZKA 5I17B 3C08L 5EO1A 2E6QA 5GS0L 4WV1B 1A1OB 4YFLI 4YDKH 1BGXL 4LLAA 4RGNE 2BVPB 3VMNA 5I16A 1D6VH 4QTIH 4UDUB 1VFAA 2GK2A 1G9ML 1I3UA 4TSAL 1AHWB 3BD3A 1X5ZA 3HZVB 5BO1L 3ZTJG 4JFDD 2FX7L 3IDIA 4LHUG 3ZE1E 3VA6A 1J1OH 2CR3A 3WMSA 5BMFL 2YA0A 4ZXBB 2DQDL 2VL5B 4PTTA 3CXDL 4GG6E 1T21A 5EWIH 5C0ND 3MRFA 4JN1L 2BNRB 3U4EB 3HE6D 2XTLA 4QWWC 1L6XA 3W0WE 3FFCA 4X99B 4R2GD 3REWA 1MCRA 1OOAA 4QNPE 3O3UN 1C08B 1NKRA 3MBED 4NQUA 1MOEA 5IFHH 3BEWB 5I1KH 1NC4D 4J3UA 4TYUA 4Q9QH 4WW1B 3CFBA 1DFBL 3LH2H 4OZFH 2XTJE 5EBMA 1RZIB 1RURH 5TDPA 4K8RD 2BRRL 5CKGA 3MXWH 1IGJB 1BVZA 2VLMD 4GKNB 1CGVA 2DJUA 4IRJC 2GY5A 3OJDB 1X7QA 2P8LA 4Z77A 2EDTA 2CUIA 3SDCA 1KGCE 5IJKA 1MCPL 2X4SA 1KJ2L 1HILB 3ARSA 4XBPA 12E8L 4NDMA 4RGMC 5DQDH 1ZK9A 5CJ5A 4PRID 3FO1B 2NY2D 3NGBB 4W70A 1CE6A 1WEJH 4F7CB 4P4KC 4PIRF 2IALA 1LK2B 4N68A 2J5LC 3F12B 4I0PB 1UM5L 4LNRA 2HVKA 4PRDB 4M1DL 2MCPL 1N0XH 5ICYB 3QXAA 1MRFH 5EIVA 1U6AL 1NGPL 2JTDA 3AB0C 5INCB 4NKIH 3RGVC 2ESVD 3TP4A 1MRFL 1Y0LA 3MXVL 2F74B 1RUQH 4YDIH 1SMAA 4U7KA 4F9PC 2W1NA 4L5FH 5JO5B 1C7TA 3HZYB 4WVRA 4X5XB 1IT9H 2Z93A 3P77A 4G9FB 2DQTH 2A1WH 2W9LA 4WGVB 5J57B 4HJ0C 4CU6A 4WFED 4PJ8B 5HHMD 4AG4L 4ZFGH 4XMPL 3D48R 1YUHA 3IDUA 3QZWA 1LEIA 2XZAH 4LVOC 5JW4N 2XIDA 3WO4B 3RZCC 4X6CB 1FNFA 4IIQA 4OCNC 3HZKB 4K3JH 3U46A 3M8OH 1CVRA 4CMHB 4OAWB 1B4JL 1JMZA 1UADC 4PP1D 4N5EC 1UWXH 1HYSC 3S4SA 5DVOA 4KDWA 4JEGB 1QLFB 4FZEL 1T80A 3FQRA 2VZTA 3UBXB 5HY9B 4WO4C 3CLFH 3HPJB 4ZO9A 3PXJA 3PDOA 3ZLQC 3GRWL 1RZKH 2FGZA 1NEZG 5JOFB 4EI5C 5E94A 3SGDH 4WWID 1CXEA 4XCYB 5LJYH 1JL8A 1HXMB 3MLRL 4K8RC 2AABL 3BP4B 2A6JA 3ABZA 2HP4A 4TSAH 4Y1AA 2JJTA 2UYLA 3ZE2E 4F7MA 2RCSH 2DTSA 2N4IA 3H9YA 1L9NA 4J8RA 2GHWB 3ZE1F 1U8PB 1SEQH 2H26A 1RUAH 1XR8B 3KXFE 5B4MC 2WINB 3MC0A 2YXMA 1O7VA 3P9MB 1WV7T 2I24N 1I8IA 4JVWA 5IG7A 4PG9B 3IJYA 1P7KA 4XT1C 2DIAA 2VAJA 4HK0A 2ADIB 3S5LB 2AQ2A 1AR2A 3BFOA 4XVTH 5I16B 1KJMB 3IXAB 4XNXL 3GBLA 2C26A 1QBAA 1XIWD 5BJTA 5MEND 4AH2B 3DI3B 4OM0L 3NIDE 4APQB 1RUAL 2IALB 1GC1C 1KT2A 4P5TB 5DUPL 2PYEA 1G7LB 2ATKA 5HVHB 3ZTJH 5TDNB 4HH9A 2R1WB 2ITCB 2B5IC 1FC2D 5CSBA 1NMAH 4H1LG 3CX5K 3WIHA 4S1QL 3ZKND 2AGJH 5BZDB 4WV1A 4OZGE 1R5WA 2EXWC 4N0RA 1BFVL 1FO0H 4UDUA 4QHKI 5ID0A 1JF1A 3H42L 1BQHG 3F5WB 2P8PA 4HT1L 3EO9H 4FQLL 1X4YA 1S7RB 4WTWA 2APFA 1AGBB 1WK0A 3MRFB 1HINH 5HHXL 4LEOA 3U30C 3T8XB 4HFWB 4FOMA 4Y0GA 5JW3L 4WFEE 4C55A 4NQSA 5IESL 2GTZA 3TJHD 1EHXA 4XWOC 4LKCA 1DVFC 1J5OL 2DBLL 1GZPA 1MI5E 4TTDD 1HQRA 1QLFA 3EJZC 5ETUA 3RBSA 3MV01 4L4VB 5FYLD 2VKWA 3F6LA 3F7VA 5SX5K 3X12B 4XXCC 4WWKD 1ZGLM 4IRZL 4PR5A 2B4CH 3HC4H 3ULVC 4LHUD 5C71A 2I60H 2WWKT 3BPNC 3ZZ1A 3DRQB 1OAKL 5CIPB 5D9SA 1MCCA 1YEDA 1Z3GL 3TIEB 1G7PA 1GOFA 1IILE 4LRIA 1F13A 1QBML 4U31A 4Y19D 1LILA 5E8DL 2QKIB 5ADOL 5I1DA 4BSVA 1RVFL 4E9LA 3GUTA 3MO1A 3TA3B 3CD4A 4P5TD 3FB8B 4CU8A 3O6FC 1N59A 2D7QA 2M8XA 2ITDB 3RL2A 4L3CA 4OF8A 4XCEA 4IDJL 4U6VL 1VKXA 1J11A 3RVUD 2C3VB 2AXHA 3G5VB 1P7QA 4R2GC 1QEWB 5CCKH 3CVHB 2KZ1B 1Q9KA 5FM5M 5FV2A 5T1LB 4ZO6A 1NLBL 4XAWL 3VXUA 4GMSH 4YR6B 1XEDA 4X8XA 5DJYA 4XWOD 3SE8H