3BIJA

Crystal structure of protein gsu0716 from geobacter sulfurreducens. northeast structural genomics target gsr13
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
278
structure length
265
Chain Sequence
PKGIALALGLNAVDPKHYGGWAGKLNACEADAEDMAAIAAERGFAVTTLMTKAATRAKVIDAIGKAAKALGKGDIFMLSYSGHGGQVPDTSNDEPDGVDETWCLFDGELIDDELYALLGKFAAGVRVLVFSDSCHSGTVVKMAYYNGIRYRAMPQSVAMRTYRANREFYDTIQQKTKKVDLADVKASILLISGCQDNQLSQDGAFNGAFTGQLLRVWKNGLYKGSYRSFHKAIVRRMPPDQTPNFFTAGTPDPAFLKQRPFTVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein GSU0716
publication title Crystal structure of protein GSU0716 from Geobacter sulfurreducens.
rcsb
source organism Geobacter sulfurreducens pca
molecule tags Structural genomics, unknown function
total genus 81
structure length 265
sequence length 278
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00656 Peptidase_C14 Caspase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3bijA00
3V4OA 1RWXA 5I9TA 4AW9A 4FXOA 4ZVPA 4QUJA 3R6LA 5IASA 4IEFB 1BMQA 3D6FA 4N6GA 4LSZA 4QUEA 3IBCA 4EHNA 4NOJA 5IBCA 2C2MA 2QL7A 2FQQA 2XZDA 3GJQA 5IARA 2P2CA 5IABA 1RHJA 4HQ0A 2AR9A 3KJQA 3QNWA 5H0IA 1NMEA 4NOMA 4N7MA 4QUIA 5IAKA 4AWBA 4EHHA 3EDQA 3DEKA 1NMSA 3DEHA 4N5DA 2CNKA 3ITNA 2QLJA 4QU0A 4D3XA 1NW9B 4NOKA 2CJXA 3S8EA 4JR0A 4DCJA 1JXQA 4JR1A 3R7SA 1RWWA 3V55A 3H0EA 3V3KA 3UOAB 5IANA 1SC1A 5IAGA 2Y0BA 4PS0A 1F1JA 3V6MA 5IC4A 1I4EB 4QUAA 4FEAA 2J32A 4N7JA 4AWAA 1PAUA 4JJ7A 4IYRA 5IAJA 4EHFA 4QULA 2C1EA 1CP3A 1QTNA 3DEJA 3H11A 3H1PA 3NKFA 1SC4A 4JQZA 1IBCA 5I9BA 1I4OA 4QTYA 3R5KA 4QU9A 3P45A 4ZVOA 3R5JA 2H4WA 4I1PA 4QUDA 2QL9A 5LUBA 4NBKA 4D3ZA 3R6GA 4ZVRA 1K86A 1KMCA 1RWNA 4ZVUA 5K20A 2QL5A 2FUNB 3DEIA 2J33A 5IAEA 5LUAA 1QDUA 3OD5A 3V4LA 4EHAA 2XYGA 4DCPA 4NBNA 1RWVA 4JQYA 2CNLA 3SIPA 1RWOA 4EHLA 4D3YA 2CJYA 2C2OA 2QLFA 2H65A 4JB8A 4I1RA 4N6OA 4QU8A 4EJFA 1RWPA 3GJSA 1RHQA 4QTXA 1GQFA 2QLBA 4QU5A 1K88A 2CNOA 4ZVSA 5IBPA 2DKOA 4ZVTA 4FDLA 4JJ8A 4N6NA 2CNNA 1F9EA 3R7NA 4FGUA 2HBQA 3NS7A 5LU9A 4PRZA 3UO8B 2H5IA 4HQRA 3SIRA 5IBRA 1SC3A 2Y1LA 3S70A 1CVRA 2H4YA 2C2ZA 4QUGA 4NBLA 3K7EA 2CDRA 3PD1A 1RE1A 5IC6A 2XZTA 3E4CA 2HBYA 4QUBA 2H48A 1RHRA 5LU8A 3D6HA 2K7ZA 1RWMA 4JJEA 2XYHA 3NR2A 2HBRA 1NMQA 1PYOA 4HVAA 1QX3A 3H13A 2FP3A 3IBFA 2H54A 3BIJA 3KJFA 1SHJA 2J30A 3RJMA 1M72A 3D6MA 3R7BA 2H5JA 3PCXA 3EDRA 3KJNA 4EHDA 2C2KA 2HBZA 2NN3C 3V6LA 4JR2A 2J31A 3GJRA 3PD0A 1I3OA 1RWKA 1RHKA 1I51A 4M9RA 4ZVQA 3P4UA 1RHMA 4EHKA 4PS1A 5JFTA 1ICEA 4QUHA 4PRYA 4DCOA 1SHLA 2WDPA 3GJTA 1RHUA 2H51A 2XYPA 4NOLA 1GFWA 3H11B
chains in the Genus database with same CATH superfamily
2HF7A 5A4KA 2HK7A 4GBMA 1SK8A 3A9VA 4XVQA 2GT1A 2P62A 1NMZA 1P6XA 2RHRA 3SFTA 1PRYA 3WIBA 3DNMA 2ZBFA 4EY7A 3GLUA 2OCGA 1O5IA 5IYZB 1DFIA 3WGUA 1L3IA 2DP4E 1X13A 3OBIA 1X1TA 3DE5X 2HI0A 1RDFA 4QBHA 3AUAA 4OX9Y 2R65A 2VJQA 4G0QA 4LCEA 4MHSA 3D1JA 4PSKA 2AFRA 2ES4A 2H2HA 3HV0A 4UBOA 2HRRA 4B3HA 3TFOA 4FOPA 4HB4A 1V7QA 1X7XB 1QZTA 2DBYA 3FJ1A 3T38A 5LLDA 3VA7A 1G2IA 2ZROA 1FTNA 4NI5A 3WK5A 3QBVA 5F3RA 1QFZA 2B5VA 4KVAA 3C98A 4ERNA 4JJAA 4QRDA 2FVXA 2XKAA 1WKCA 2IXTA 3KPUA 3PXXA 1XAGA 5FULA 3ES9A 3RC8A 3CO0S 5G1NA 3FOFC 5B4UA 2OYCA 4ZO8A 4X62B 2BEVB 2WSMA 3C70A 4MW0A 4EY3A 1E64A 3K6RA 4ZPJA 1GAEO 3K0CC 4CETA 3I23A 1JIKA 2EW2A 1AS3A 1BN7A 2ZR9A 2WWFA 3T3HA 3MJRA 4GR9A 3RRJA 3RU3A 5CITA 2Q2QA 5HZMA 3AIMA 4P81A 4MA4A 2WIKA 2DBZA 3OTIA 4JLOA 1OB5A 3RSSA 4EB6B 2HJHA 2QTGA 4MGEA 3SZ3A 3HSSA 1Z26A 2XYGA 3VSBA 1IC6A 3QKUA 1OZFA 5DDIP 4J0KA 1X2EA 3QF7A 1DWQA 2CMDA 4B80A 1ZN2A 3CRVA 3DVAB 3NC0C 3K1TA 5DTMA 2FG6C 3VU3A 3OZVA 4PZLA 1R5OA 2OBYA 4YRSA 3RS7A 1QF9A 2DB3A 5BRAA 1RWPA 2TYSB 2PH7A 3F5FA 4I0WB 4TWRA 1N2CE 2AF3C 3OJCA 4MV0A 2PUAA 4C2BA 2CNOA 1VPVA 2WQ7A 2H4XA 3HLYA 4QC2A 1AGPA 2AZMA 1E92A 4K5QA 3OG9A 4QAJA 1KFCB 3K6KA 2QM7A 2RARA 5THKA 3LNTA 3NUGA 2IYUA 2W2KA 3VNBA 2R47A 3K73O 3REGA 3ZHRA 4ZYZA 4DCGA 3ZD6A 3M1LA 1SD5A 4JC0A 4WK2B 2I7DA 1O77A 5FT9A 4DJJA 4XGIA 2CSXA 1UMCB 4EEZA 5CDYA 3IDZA 3QVMA 1P44A 3HPRA 2NO5A 1JHAA 3AUTA 3PYXA 1J0AA 2HZ7A 2L42A 2ZU6A 3D02A 4G8JA 1V1JA 3IESA 3INTA 4KMMA 5TX7A 1GPH1 3REOA 2FMUA 6YASA 2J67A 5BSHA 3DMDA 1I0LA 1VC2A 2B2XA 1P31A 2Q3EA 1SXJE 5H80A 4XUGB 1LVUA 4IDEA 5K0BA 1OI3A 1BQ4A 3N8NA 1KI7A 4DC9A 1B15A 1HLDA 2XUAA 3E05A 1RC1A 3JVUA 1HNWB 1JDSA 1RRVA 3FHCB 3KQMA 3TSWA 5AVJA 1K5GA 1Y5IA 4YRZA 1E2DA 5H83A 5LP6F 3QOYA 4C0LA 3OICA 1RKBA 3R0XA 4HNGA 2ZRPA 4DXDA 1KTVA 1CJKC 3SX2A 4NV0A 2V8BA 5EVCA 2XMRA 3O0DA 3SHWA 3VDRA 4E3ZA 4FEEA 4YJFA 3MD0A 3B12A 1R8XA 1LPSA 1QOPB 4OQQA 5CA0A 3M4YA 1L4NA 3A9WA 4UATA 1R16A 4NENA 5EZ5A 3AU8A 4PZ9A 1LDGA 3U39A 1DTEA 1G0NA 4I46A 3DBHA 5PGMA 3MN1A 1UM9B 3RIHA 1JHXA 1OXSC 1QC5A 1YNOA 3OIGA 4BVGA 2GHRA 3J7AC 1U0FA 4MUFA 4LZAA 2WA2A 1KK2A 4N5DA 4JLWA 2Y99A 5C8VA 1XMJA 5F1YA 1X7YA 4PPQA 2XEXA 3HB5X 1GN8A 2J08A 5EXTA 1OH5A 1NXSA 2QVBA 1U3WA 1XTUA 2BFEB 3U7GA 4LNHA 3KVYA 2LCIA 5LP1A 16PKA 1II9A 5GJCA 2YWJA 3QU2A 3LG2A 2GUWA 4R83A 5EPUA 2VYFA 1RNLA 5F21A 2G8NA 3AR4A 1A1VA 2QVLA 1NT4A 1RZRA 3GLHE 2WIJA 2HJSA 4HYQA 3PKZA 4AZ0B 2P78A 1UUFA 4WOBA 5DLDA 4IXNA 1R9JA 1TF5A 2B7BA 2GS9A 1E3EA 2Q5LA 3UFBA 3TM5A 3L1IA 2R8BA 2QR2A 4CMKA 3ML1A 4C0BA 2O2DA 3QEMA 2OGUA 3ZDDA 2ERYA 2AKEA 4MWDA 1U2DC 2IEYA 2BI4A 4LI3X 4Z9XA 3T9CA 3EPPA 4KR9A 1IZ9A 2O1XA 4RORA 2D1SA 3ZHBA 3UMBA 2WUGA 4XYLA 4OHWA 3CUTA 3HA3A 3QVGA 4HGZA 4O4HA 3IULA 2H1SA 4L4XA 4KKXB 3T15A 4ALJA 1V3UA 4GP7A 2FCAA 4W5NA 4ER6A 3SSMA 1NGSA 1XNJA 7GPBA 1N57A 4PPYA 4RABA 4LYDA 3UWKA 1XVVA 1FW8A 5BYJA 4FC6A 2GILA 1VB5A 3H4MA 3NI2A 3PE3A 1MQSA 3JAKA 1PJCA 5BQFA 4PYMA 2VHXA 3GXBA 2BEUB 3BCHA 3DMYA 5GOTA 3GZTB 5GIPE 1BXZA 3R2JA 2EX4A 1GFZA 3C6BA 1DXQA 1E4EA 1HT0A 3GUZA 3OO1A 1BE1A 4KAFA 4X44A 3ZUPA 4H3KB 5ILQA 1P7ZA 4ZGGA 4F5YA 3PE4A 1P18A 3BMQB 3K7EA 2JIMA 5BYKA 2RJOA 1Z35A 4PC2A 3ECCA 2J1LA 2VJPA 4YRJA 4AM8A 5BMVF 3ICPA 4J2HA 4NPHA 5G0VA 2EP7A 1IATA 1XTJA 3IE1A 3NASA 2GZRA 2DFLA 2P6RA 3QYFA 5JDIC 1JSLA 5EESA 2NV2B 4RIHA 2CFRA 1M2NA 2NZJA 2GLTA 4JP3A 1ISGA 2DFPA 1ODTC 2WLSA 4D2IA 5B2FA 1JV2B 1Y37A 1AOXA 2FXVA 2JCGA 4UFOA 1KE1A 1G66A 4TLEA 2FX3A 5KWVA 1OE0A 4MQFB 4DS3A 3EVNA 3F71A 3FPFA 3KO8A 1EM6A 1YDHA 3OFKA 1KJ8A 3TR6A 3OZ7A 3K9LA 5AM0A 2PO7A 4B81A 1XRLA 4BWYA 4WLEA 2ZB2A 2YV3A 1YA6A 1E0AA 2JFUA 4ILEA 1RBZA 3BKXA 3BWBA 2NPFA 4CMAA 2UKDA 4R8SA 3THXA 1AKVA 2H4FA 4H60A 3AO0B 3C15C 3IOEA 1N6KA 2XMDA 3O38A 4H7HA 4TYWA 1WEKA 1ACJA 3KALA 3BD7A 2RK4A 1F6WA 4Y2HA 3UGQA 2J0SA 3RRXA 2HF8A 2PQ0A 4F12A 4ZI2A 1OROA 4KRXA 5JANA 2WM8A 3KK0A 3DMPA 1Y1KE 4WKGA 4QEKA 5GQSA 2OT3B 3KJEA 1U7TA 6NULA 3H3FA 1KI3A 2VQDA 2AMVA 4XZ3A 4F06A 2Z83A 1Q0PA 4PYKA 1Z73A 4QUKA 3ZDXB 5LVAA 4RTRA 4OO3A 1XD9A 2QE7A 2XUKA 2PGIA 1CHNA 2XIQA 3K0CA 4ZCPA 2V9PA 3UANA 4FM9A 2H2DA 3HABA 4CKBA 3ODPA 4EBFA 3VR2A 4RESA 3ICEA 1CDOA 3I05A 3G1TA 4D57A 4ZIRA 4DSUA 1LA2A 3ROQA 4UM7A 4X1YA 5FWYB 2XUGA 1B2LA 3VR4A 2YHIA 3NIFB 1KAGA 2XE8A 5B30A 2OYSA 3A9RA 1RQ2A 2NSLA 2YWFA 3H6HA 3KXIA 2B69A 3I37X 4G1UC 1M10A 3WNBA 4DGSA 1PKEA 1C9EA 1UFVA 2IOFA 3C8MA 4D9MA 3BIOA 5E6SA 4DM7A 3KOOA 2O8VA 1NAIA 3Q3IA 2CKDA 4IDGA 4LJ9A 4P8RA 4UXHA 4OX9B 5T57A 3L0DA 2Z30A 1TQDA 4YAOA 1OOEA 2XY4A 4PONA 1ZHHA 3W0LB 2HQRA 2DZDA 4L4ZA 4B84A 5L9AA 4P58A 2P79A 2ZI7A 1S2NA 1AUVA 5JDCA 4KRFA 1KIFA 2V4MA 5LXTF 2PUFA 2I7TA 1MAVA 2VYVD 4D3YA 2PMBA 1VGRA 3GFRA 3GGJA 4I1VA 1EDBA 5GWXA 4U6NA 4IUDS 5H70A 3IOBA 2BBWA 3H2ZA 3ZQUA 4A16A 4Q4JA 2VPXA 3I2IA 2QQFA 5KTSA 4BX0A 4O4IA 4JI3B 4EAAA 4HN4B 3C16C 4G25A 1W2HA 4U9HS 4DABA 2XXAB 2XDQA 1YB1A 2IA5A 1C3LA 3EQ7A 4IINA 2AWNA 1B8VA 1KVSA 1QH8B 1IFXA 4CDGA 3X2EA 4ALLA 4KQ9A 4A15A 1MH9A 2WYWA 4BLQA 3QX8A 5DTJA 3RJTA 1ZJJA 3AM4A 3OJEA 4O2BF 2H4YA 1NN3A 4CTOA 3PYLA 1J5EB 2OBMA 1HFKA 1CQZA 1S3GA 1DQPA 3QI7A 4JI8B 1LZLA 3KD3A 2GBFA 1G8JA 4QM7A 1N7IA 2CUKA 2XODA 5EP4A 5B7GA 3M0EA 4MPDA 3M6XA 1CS0B 1P9RA 2JB9A 3I2FA 4Y9TA 1IBRA 5LD2C 4CDNA 1NNI1 4JQSA 3UN1A 3NALA 1ZD2P 3C85A 1NVBA 4A9AA 4NR0A 1XF9A 4UPDA 4EW3A 3OE7D 1NNUA 2C7GA 2NIPA 2QAJA 4W6QA 3Q1KA 1Q7TA 1K1EA 2AG5A 4L4RA 3VO9A 2G1AA 4MCHA 1H9CA 3TNJA 5JPDA 3T7CA 4N03A 1Y42X 1C9JA 2PUBA 4LF9B 1PZEA 3V1TC 3GJRA 5LB4A 3UIEA 5EIWA 3THWA 4S0ZA 1P9NA 4F4UA 4PLTA 2OAGA 1E3JA 3FTQA 3BGSA 1BX3A 1UT5A 1Z82A 1H23A 1HZJA 3ONFA 1ZK1A 1I0ZA 2RC5A 5BQPA 2QTCA 3OZBA 4DLTA 4MS3A 4JIGA 4EX7A 2C20A 4LJ7A 3VRHA 4JIMA 3FCAA 5F5NA 3TYXA 4C5BA 4EHNA 4ZRMA 1YC5A 3KHKA 1HE8B 1RZ3A 1NUPA 3ER8A 3QA9A 2FPOA 3WGKA 4BWGA 1Q6ZA 3CRMA 3DE2X 2ZJYA 4EARA 2H08A 2ZI4A 3TQTA 2D06A 4J6FA 4ZC8A 1XTPA 4BFTA 3LKBA 2XRMA 3C97A 4YONB 5CFPA 2Y0DA 2OKGA 3BL6A 3PDHA 2G25A 2HY7A 3HMQA 3PLRA 1NMYA 4G5RA 2J5XA 4JK3A 1QFJA 4KGDA 2VJYA 4TM8A 3T4UA 4DG5A 4WBNA 4QG3A 2ACKA 2A0XA 1NAHA 3TVDA 3R6DA 3KUUA 3TOXA 3UWDA 3V3KA 3QPCA 4D4HA 2VF7A 4UREA 1KSJA 2UDPA 2FWNA 2WJIA 5LP6C 3ZCQA 1YJQA 5E4FA 3ZGZA 2Q07A 3BJEA 4IV0A 2HM7A 2ZWAA 5MHTA 5C52B 4R8KA 5ICMA 2FX5A 5TMPA 1LF0A 1YIDA 4MUHA 3MWDB 5M2QA 1IBCA 3W7AA 1VJ0A 4JLBA 3WIDA 5K8VA 2VJDA 1BCRB 1TYZA 3LPNA 3LCRA 4KJXA 4KKVA 5FNVF 5K51A 3WMGA 5FLKA 1OPXA 2QP3A 5ALGA 4JVLA 2Q1TA 3QX9A 4PWYA 1FRQA 4LE2A 5JT1A 5TMDA 1D1QA 2Q2WA 1F8GA 1NN5A 3AK4A 3C5CA 3MTAA 5A2GA 2IEAA 2XVZA 1R0BA 2C2XA 2ZBDA 2A1TR 2I2CA 4HDNA 5HWSA 1O0BA 3VZDA 3FPLA 3BICA 1RQGA 5E0KB 4FOTA 1ZVMA 2DT8A 1L7EA 1C9DB 2RHDA 5ECDA 4XJXA 4EJFA 1HRDA 2I4NA 3TZQA 4F2WA 5B12A 2BF4A 2QV7A 3K8OE 1AZLA 1Q0HA 4ZEOA 5JWHA 2JFNA 3DOJA 2BKXA 1WUJS 2V45A 2OO7A 3BCSA 4PAWA 2F3TA 4YTEA 4RLFA 2JAXA 3IHWA 3EEBA 1SUAA 3D1VA 4X6UA 4LSMA 4MLDA 5E6UA 3ZE9A 4DSZA 5U9CA 3IVCA 4AIIA 1U6JA 2E82A 4OA8A 2PX8A 4YRDA 4AKHA 3STVA 4QQRA 3R9WA 2ZUEA 3OQPA 4DEXA 2WMDA 3MWFA 4UHDA 3CIOA 1G7CA 1RQLA 4QEZA 221PA 2VLIA 3GO4A 1UKAA 2ZR8A 1EJ0A 3RAGA 1H1TA 1XKLA 2BSAA 2Y1GA 1HSOA 3KU4A 3HUTA 4GW3A 2XZOA 1EUYA 1WDLA 2ZRAA 3M6VA 1G8HA 1OFTA 1Y4AE 2N0SA 1OIXA 4LXXA 1U9ZA 4X8OA 2O5RA 4ER3A 1U4NA 1MABB 1PK9A 1R7RA 2WR8A 3B3AA 3PFNA 5BN3A 1JQBA 4WH0A 5DNYB 1U3DA 4JC5A 3LU1A 5B1IA 3KR9A 1TCUA 2OD9A 2F3PA 1IULA 2IXBA 2FLKA 3G1WA 3ONEA 4PICA 5FNZA 3UNXA 3GEIA 4CT4B 1J21A 4NATA 4EYOA 5K0FA 1E79A 2WDPA 1G9XA 4KDRA 2PMEA 1KS9A 5IMBA 1UQRA 2JD1A 4J1TA 3ROEA 1G1MA 4F84A 2VKQA 1NLYA 1U2EA 5AR1A 2Y0EA 5JV5A 3OZCA 1OX6A 2XNDA 1ZKMA 3E84A 5CFOA 3ABZA 1N3YA 3N3AC 1EU1A 3B2EA 5IK2D 1P3Y1 2YS6A 5CVCA 5CBKA 1FZTA 5ICCA 1Q44A 4WCDA 5KBYA 1P45A 1XL1A 2O3SA 4FKMA 3UAGA 3A6PC 1GEEA 3ZGLA 5DI9A 4U7DA 3DMRA 4B9AA 2XBLA 1CDZA 1WMSA 1ZCBA 4D9CA 1LK0A 4E5SA 1JDUA 1XJ5A 1XU9A 1U8CB 3IDFA 4FFDA 3TZLA 4BQIA 1QRTA 1UDWA 3EZXA 4G89A 4YGXB 3HB7A 5JCJA 1E8NA 1VIAA 1FNDA 1PSZA 4U1RA 4ZYYA 1NM5C 3AEUB 3T3EA 3TIXB 3JQQA 3S3TA 1N5JA 1XNGA 1CQWA 2ZJFA 4I7EA 4UXIA 5CX1A 1M1YA 5CYPA 3NBYC 4XUDA 1B0AA 5KTOA 3NM5A 1ZU4A 3TKAA 4UUNA 1H6AA 3BTOA 4GZ5A 3JCZA 3L46A 4U7JA 1PZGA 4ER5A 1KAQA 5EI5A 1W44A 1YB7A 3VX3A 1XD8A 4J0JA 1NPYA 5JLJA 2JI4A 4IDHA 1VHTA 4DV7B 4ZEWA 1T3ZA 1WPXA 4G5FA 4RKFA 1SD1A 5EP3A 5GIOE 2I0FA 2WU1A 4JFRA 3RARA 1R50A 2IU4A 1XZBA 2F1RA 3NBMA 4YJ2B 1A95A 1WDMA 2WOOA 5HYVA 1HG0A 1PT7A 2PT5A 3EIWA 2XRFA 3E9NA 3HA2A 4QOGA 4MQ6A 2GF0A 4YV7A 3Q8WA 5ALVA 2AR0A 1F2DA 1V8DA 1X80A 4J43A 4M1EA 5BQ5A 1K8ZB 2EDCA 1TMYA 3MQ4A 1YB4A 3DEYX 1KK3A 5BUCA 3V9AA 2HO5A 3N76A 2JJ2D 3P9PA 5SZHB 1JWBB 2VYND 1SO8A 1LD3A 3C6KA 3PZRA 2CWWA 1N5LA 1Y7PA 2ONKA 3CUYA 4XGNA 5EE3A 3O4IA 2WUVA 4C7OB 5AQ1A 4Q16A 2RHCA 3PKJA 4P4GA 1DJOA 1VG0B 3BREA 1ZRHA 1N75A 5KDLA 1CP2A 4HTAA 2HNBA 2IYEA 3AERA 1FJGB 4PRZA 3GQBB 4OBEA 2HW8A 4DT1A 4WMLA 3EIEA 4HG2A 1GJRA 3D3JA 3AFMA 1D2GA 4L27A 5DBFA 4B4DA 1G7RA 5LYYA 4EPVA 1NVDA 1W75A 4K87A 4D80A 3EISA 4Z9AA 1JT9A 4N1AA 3GFOA 2G04A 3F1KA 2Q7OE 3WDKA 3C7KA 4A10A 2J07A 4BLOA 4C3VA 1W36C 1KRXA 4OXKA 1Z15A 3TSYA 4IRXA 3E4CA 3OT5A 4KIWA 1GP2A 2REQA 1F5SA 4RD4A 2WIDA 1YKSA 2CF5A 3OFNA 1PYDA 2A0WA 4O59O 4A03A 1HYGA 1XZHA 2SCUA 5L4LA 3U6KA 4LFBB 1NNSA 3KELA 4LYAA 1F3LA 2HBRA 2JIRA 3MWLA 5D84A 2XRZA 2ISQA 5AI0A 2RI0A 2FJUA 3ZW7A 4R6XA 4UC0A 1YFZA 3T3GA 2J30A 4QDTA 4YP6A 3S1AB 2O8CA 2FN9A 1I7QB 4D74A 3HHPA 3M3PA 4YJ3A 1H2ZA 1NRJB 5KNCA 1DKUA 1V71A 4LC1A 1SG0A 2DBRA 3BH6A 3HCNA 2QLLA 1TK3A 1DQNA 4JYPA 4KPUA 1P74A 2GFHA 4LJ4A 4Y2TA 1Y9ZA 3RT7A 2O20A 3L04A 3TO5A 2ZVJA 3AFIA 3N8KA 4EPXA 2QG4A 2Y0CA 5AICA 3EGXB 5J5AA 2WYIA 3C8UA 4RZ2A 3VISA 1NPDA 5JSZB 3DB1A 2VHVA 1N7GA 2CZQA 1ZA2A 3M5WA 3NTLA 3QXXA 4G1CA 5JALA 5BSGA 3IQDB 2FZVA 1BMQA 3P9ZA 3QNMA 2VPZA 4PLYA 3ZJYA 4C0HA 4RKEA 1SBHA 3I6MA 2ZJAA 1RI3A 4QBKA 3R3HA 2OM6A 3Q9UA 1WBJB 1RS0A 4RAOA 1M8KA 2DR0A 2P9TA 1HKUA 1XEWX 1R27A 1LC3A 1Q1QA 2QMOA 3PWKA 4UHEA 4URWR 1I3NA 2J7PA 3UK2A 4RDHA 4C76A 5T4HA 3QXSA 4U39A 1J97A 1U8YA 1X70A 2VHQA 4KQ1A 2ORVA 3RYCA 5EUCA 2YVLA 2HSJA 3ZBTA 3TOVA 4PZYA 4QT0A 1GGHA 2G71A 4DMMA 3TR5A 1HOTA 1YMUA 3T8YA 4RVUA 2COEA 4OLHA 3N6RA 1CFJA 4FSHA 3RIYA 4DNQA 3R5TA 5IHPA 1ORTA 1IZ0A 1QWOA 2QZ4A 3EAQA 1XP5A 1C7JA 1ECBA 1W46A 1OLXB 1PYGA 1Y1PA 1KMMA 3PBKA 3G8CA 3PK0A 3IV7A 3GPBA 2XVMA 3FW1A 2Q9UA 3P45A 1L4FA 4IX1A 4IO0A 2AFHB 1K7FB 2Z43A 3FVVA 3KV3O 1NBWB 5IP5A 4TVSA 3NOXA 1ZFNA 2EX1A 3RVKA 3T1YB 1MHPA 4LTMA 3I0MA 2HRCA 5DK4A 3ADOA 1NVXQ 2XCIA 4M99A 4CW7A 4ECEA 3IVMA 2JEOA 2WPDD 1CE8B 1IBSA 1WXHA 3IR6A 4X6XA 3JD1A 2H29A 5I3ZA 3AWIA 2BIFA 4GKBA 2QDKA 4OYHA 4U2FA 1EVLA 2ZBEA 4XB6B 1P4RA 4YT4A 5E4YA 1K63A 3G82C 1T0PA 3H86A 1C0KA 1E9BA 1Z4PX 2PUJA 1KY5A 4UE6A 3R3WA 1JH9A 4EIWA 3VSAA 2CF6A 1Q11A 3BAZA 1P75A 4HUJA 5ESXA 4J7AA 3NG1A 5BWNA 1M0TA 5I01A 5HTOA 2P9ZA 1Z74A 4N6NA 1Q14A 2JIBA 3OPVA 3GRZA 4LYGA 5CT5A 3WRYA 4ACBA 3IURA 4KYUA 5ALFA 3AKCA 1JHUA 1LVHA 4P86A 4DRXB 4JYAB 2B99A 1V26A 2EFYA 3KQKA 1EB9A 2R8PA 4JKIA 2J85A 2PPVA 3SXUA 3JWJA 4TKZA 3TSCA 2PR2A 5BNTA 4BP9A 2D7DA 2IFTA 1FFDA 1KAOA 2OGSA 2OHJA 3HSKA 1MKYA 3GDHA 1EK1A 3FBWA 1JIJA 1PTKA 1TC1A 3GT0A 3LLSA 3NHWA 5E7MA 3RC1A 2K7FA 4UMVA 2DUMA 3PHHA 1KOFA 5EEHA 4D99A 3H8SA 3L7IA 4IOLA 3M6IA 5H82A 1W1WA 3TBFA 2PQ6A 4RGBA 3RC7A 4BJ5A 3VJKA 4Y18A 3WG9A 1E66A 1E62A 1RBYA 3DAOA 4R1PA 1M34A 3RS3A 4DILA 1T1GA 2P9FA 2FP3A 2YVAA 2BFMA 4MCJA 1A8HA 1G19A 2I4MA 3ITEA 1C0PA 2VRBA 5F7JA 4MRVA 1XRMA 3RJMA 4XWKA 1JSCA 2A30A 3PITA 4R31A 1GAXA 2UZ3A 2EZ4A 1I3KA 4R8RA 2Z2KA 2HBZA 4C06A 1J1UA 2E5FA 5L8VA 1M6EX 2WF9A 3DP9A 4MCAA 2MU1A 5CNKA 1YZVA 4IZOA 4R01A 5KC9A 2EJCA 3L7MA 2JVIA 1RHUA 1N2OA 1XHFA 2HPHA 2NWQA 2XCOA 4JOQA 3MIZA 1KU6A 2OY0A 2WSIA 1J23A 1HF3A 1UJBA 2P4HX 3GFQA 3U26A 2GN1A 4MW6A 3WGMA 1KBQA 4QUJA 4F3CA 2C5BA 2AN9A 2P6NA 3OZFA 1SU6A 4M8SA 3ZWWA 1U8AA 2E48A 4A36A 1QZZA 4K40A 5EP2A 2VATA 1UL1X 2GM3A 3DVSX 3HZOA 2F1KA 2UYOA 3MJHA 2WIGA 3G5MA 4KXUA 1IQRA 4UBKA 1U2ZA 3ROXA 5YASA 2IYOA 2NAPA 2VHEA 1ZIXA 2HWUA 5FPYA 1SB9A 3DMTC 5A62A 3RWBA 4KR3A 1B2RA 2VPPA 1OH7A 1KI4A 3DP7A 3NDJA 1U3TA 2QMZA 1EESA 4WV3A 2Q1SA 1C1XB 3A4TA 2FFHA 1QO7A 2BEKA 3G17A 5EJGA 3U4GA 1PL8A 1VXOA 2Z04A 2QTNA 3EF3A 4L0MA 5KUTA 1QYRA 4DMLA 2PLWA 2QTVA 2VHJA 5FUYA 1QSGA 4MVJF 4EQ6B 3CWQA 1RCFA 2VDPB 3NBFA 2PZFA 4C7VA 2LKDA 2OFOA 2I3BA 4L8LA 1EVEA 4EHIA 2J9YB 4ZZIA 1RJFA 3R5KA 1FXWF 1T3GA 2AKYA 5TPZD 5HQJA 4BNIA 3T7RA 4KMSA 4G56A 4MVXA 1R4NA 3OI7A 3M5PA 4FCCA 4AZSA 5B58T 4ESVA 1GPWB 4MUXA 4ND4A 1QKKA 3C1UA 2C9BA 4ID3A 4RMJA 4ZJZA 1N34B 1CRWG 1EFUA 4QXRA 3EZ6A 3R7WA 1NOJA 1G8PA 1Y8RB 1QFSA 3KQOA 4I8XA 2JHFA 4RF4A 3OA2A 1HDEA 5LA6F 3H84A 5CT4A 2CC2A 1EVIA 3ANYB 5FTNA 1KYQA 4RTOA 1Y8QB 2VTVA 4I4NA 4JB8A 4JGGA 4DIMA 1SCUA 1NHWA 1SKYB 4U6QA 3PC4A 4TUYF 4HFJA 2JIPA 2DR3A 2IYSA 3H2SA 4II2A 3E2MA 4GYKA 5G4KB 2OILA 5HPYB 4CV1A 5I7UA 3WFIA 1YBFA 3OPYB 4BNKA 4IRMA 3WIUA 4B79A 4CEIA 3F5SA 4Q47A 2QYHA 1R6TA 3VYRB 2GN2A 5LXTA 1D6NA 3S70A 1SZPA 3LBFA 4MVWA 3TE6A 3U4MA 4TM7A 4RIIA 3ILXA 4CMJA 2ZATA 5FWNA 1U1FA 2QZPA 1N0UA 3CGGA 1GG2A 3Q41A 4LYYA 1W5FA 1Y8ZA 1YACA 4UDYX 3N86A 4ZT4A 3EASA 1MP0A 3R4CA 2YYAA 1JPJA 4WXYB 5K3OA 3Q7TA 4XFJA 4YMSA 1SK9A 2I78A 5FYDA 1D3AA 1E2FA 3DFZA 3ZLTA 3EVEA 3DLHA 4EZIA 5AKIA 3Q4GA 4OB7A 5B57C 2BSQA 3AVVA 1EUCB 2ATCA 1C80A 3I09A 3LX4A 4RNCA 3EGIA 5HIMA 2JIOA 4GG1A 4I99A 1G55A 1WU7A 4E4YA 5K3EA 2AG6A 3LC2O 1M2GA 4DANA 2B25A 1MFPA 2XCRB 3LYUA 2DQYA 2HV8A 2P3LA 2Z5GA 3IAM6 3TEMA 4M86A 1EHCA 1HEUA 3SICE 5IM4A 1S1MA 5ALOA 3N2YA 3ZZ1A 1OH8A 3MWEA 1KQNA 3JZDA 3FFTA 2FN3A 2H3HA 5HF9A 4K9SA 4YLGA 2IYAA 2XMSA 2H8KA 3MGGA 3KPJA 1T8YA 1EJBA 3LUPA 4ARSA 3DLAA 2GAFA 4TXNA 1U4OA 1L6RA 2QBYB 1VBNA 5LDGA 2HV9A 4MGIR 1ADCA 1W6RA 2OCAA 2PX6A 4KQXA 3D6AA 1F6BA 1COWA 1EFPA 1XFDA 2YJZA 4OKNA 4TZ0A 3QXGA 1XDUA 3PTLA 1I1HA 4I2NA 4ETWA 5JFOA 1VE3A 1UKEA 4U5XA 2QD2A 4RTMA 4Y9SA 3IE0A 3FF1A 5I7RA 1OC4A 1PS0A 2ZS9A 1YDGA 5FTKA 5LZ9A 1Y9AA 5CD1A 2F17A 1QNLA 3ESXA 4Q12A 1J0EA 4P22A 4Q4AB 1C9YA 2FETA 1AMOA 2AS0A 5LMNB 2HCRA 3BZBA 2P6OA 4XCQA 3ZK7A 4DYDA 3VQTA 5KYWB 1RLOA 1GTZA 1S3SA 2QAGC 4R0MA 2WNHA 1UIMA 1W93A 1CUXA 1HE4A 3EXIB 5KO2A 1QP7A 3FGOA 1XPUA 1M0WA 3INRA 3T5MA 1XEXB 2ZBPA 3I76A 2OUKA 3CPSA 3INNA 1ZD8A 5DIFA 5FO1A 5BN4B 1XP8A 4MQ4A 5TXGA 4UCWA 1TB4A 3AI7A 1BXGA 4RIFA 3REFA 3S2UA 3VTAA 2JDID 2O8NA 2IOFK 3A6HA 4IDFA 3UJCA 3BCUA 7AT1A 1JQAA 5KVCA 5L7WA 3PF9A 4LHXA 4TXHA 3TL6A 2I80A 5EIBC 2O48X 1EDOA 1GU0A 1QHIA 1Z6YA 5EVJA 1X3LA 1NBMD 5FQNA 2BDUA 3A14A 1K6EA 3I1YA 1BU8A 4E15A 5A03A 1P73A 2H7CA 4J16A 4G0NA 4Z4GA 3QW2A 4BNMA 1L9XA 4A26A 4OQZA 2WM2A 3ECSA 3ZY4A 2W5UA 1EWYA 5CJ2A 1XO1A 1H3NA 1X77A 3PT9A 3MWYW 4GPD1 4OBBA 2H52A 5KC8A 4EKYA 2PCJA 4JD5A 1VSVA 3EXG1 4UVIA 1L7BA 2BM0A 4KB5A 3QE0A 1YDFA 4LVNA 1W34A 4OL0A 3V8NA 1W0KD 3QF4A 1RYMA 1U0OC 1AUQA 4E09A 5T67A 1OWOA 1TXGA 4Y98A 2Q1YA 2Z0MA 3H19A 4PBTA 4IIBA 4RQUA 4NCXA 4GQBA 1C29B 4P83A 1A4RA 4D3SA 1T2NA 1Q0TA 4PTYA 5L3SA 4TQ9A 4DHWA 4RY8A 3PQ5A 4BU0A 5EIHA 3D4NA 4HS9A 5C34B 5FWXB 2ERCA 2WG1A 3LLMA 1G2OA 3UG6A 13PKA 3PNMA 5IJ0B 3GDFA 3B48A 3ZU3A 5JZMA 3KX2A 5KSOA 3OIWA 3ZTWA 1SKUA 2ASVA 4LBVA 1EG2A 1ZOSA 2QD4A 4Q00A 3KAQA 3TVTA 1IHOA 2P68A 1I14A 1LRJA 3KUCA 4DMKA 3HCEA 1DEHA 2FWPA 3D3KA 3HCOA 2JLWA 2OBFA 1HZZA 2BP7B 5GONF 1VPWA 5LBIA 1FRVA 2B3DA 2OZEA 2Z3VA 2W00A 1E0DA 1XQ1A 2EFJA 4ZDJA 2IZ0A 1XZGA 3DV9A 1DB3A 4IDBA 3I9V1 1JBQA 4RQTA 4UASA 2XA2A 1V3QE 1DLJA 3EBOA 3G0IA 3ELUA 1AQJA 1F48A 4BQEA 1KDRA 1W59A 1Z3IX 3FUCA 3MWGA 3ORRA 4HUQA 4Z5XA 1IVSA 1GCOA 2QENA 2QUBA 3S7TA 3GLGE 3LD9A 2BZSA 1LLUA 2OXCA 2ZR7A 4D4GA 1ZJ5A 4TROA 4UUMA 3I9OA 4QATA 4RPHA 4J7XA 3DO5A 3VR5H 1EXVA 3WA7A 1J25A 5EFZA 4QG7A 1JLRA 2PG3A 3QUSA 1Z06A 1AZSC 1ZISA 2Q3CA 3ZBPA 2FPIA 3I1JA 2GDJA 4L8WB 2Q4BA 3NIGB 4JLVA 3I3OA 1QQBA 3AZPA 4UBMA 4NIMA 2R25B 4TMVA 3K2BA 4W7SA 3T54A 3THRA 1H42A 3FVWA 1CLEA 2QGZA 2RGEA 1E6KA 2JBHA 4AJLA 2M1XA 4YT8A 4DR2B 2F6RA 1O96A 3OCVA 4ICIA 3RSFA 4XWYA 3F7NA 1U1EA 5GINE 4MR7B 3GEEA 1T2UA 2WJ3A 4K9LA 4UTXA 1CY6A 1SBTA 1XXLA 4Q03A 5D8DA 3ZWCA 1E9FA 3AHGA 3SR0A 3AVOA 4J1QA 1A2OA 3LLUA 4KFSA 2H2WA 3ZCTA 2PZJA 1R4MA 3PVCA 4QO7A 4TKUB 5JRDS 3UG7A 3JD0A 5HJ5A 3HEAA 1TAGA 1ECCA 5IC4A 2AJDA 1YCGA 1J0XO 1Y6QA 2C98A 3FMGA 4QOHA 5IJXA 5ECYA 3VKGA 4AXBA 2H59A 3GWGA 4I55F 4XAQA 4HY3A 4BUZA 1SKMA 2AG8A 3WL3A 3HYRA 4RTLA 4Q1VA 5AI6A 3TWOA 3O7MA 3R6GA 4KFUA 1G60A 2QX6A 3TINA 4E31A 4JI6B 1ADBA 1C9NA 1T3HA 1E3WB 3MMSA 3OWOA 4YJDA 5IVDA 3O8QB 1PWZA 2EKZA 1PE0A 2J9RA 3LT1A 2CHEA 2DVMA 2JIZA 3QKSA 5TQJA 3NHLA 1XZNA 1KFJB 3KTDA 3NCTA 4RSGA 3ICOA 4FZVA 4ZKEA 1T5IA 3GRYA 3E6AA 1Q0RA 3AR7A 3K9NA 1QIFA 2JPDA 3EGCA 2EOAA 2WTEA 3AVQA 1LFDB 4PSCA 4HKTA 3TX2A 4NNOA 4H7JA 3A58B 1Z47A 4HYEA 5KSPA 4AC9A 4BMZA 2WD7B 3EGDB 2VK1A 1UKYA 2WWWA 2DPYA 1GQFA 2HDWA 2J3HA 4C2TA 4TV9A 1RJGA 3I9NA 3I9V6 3A6JA 3TZBA 4CTJA 1XK6A 2IH5A 4G1MB 2Z2ZA 1LVGA 2ZRDA 3Q2KA 4NFYA 3BRCA 1PIWA 3G7SA 4RIEA 4Y6PA 2Z58A 1W87A 2JH9A 4OXXA 3NWEA 4QUGA 3UJ9A 1DEAA 2EWVA 1TO6A 4WLVA 5M5BA 2GJ4A 2Y4NA 3KTAA 4C6HA 2I33A 4RM3A 3DDUA 1I2MA 3H18A 1E6UA 4KI7A 1NU6A 2CJFA 4PLVA 5KTKA 1PR0A 2AB0A 2O52A 3ENKA 1KFEB 1Y7HA 1T9KA 2J4DA 2Q6IA 2QAIA 4O8ZA 3TAHA 3HBJA 3X1YA 4Y30A 1KVUA 4HDKA 1V8BA 2XKBA 1CY1A 5B6IA 1UZLA 2D2EA 2CCJA 1GRCA 2AFIB 3EA4A 1G8AA 2GM9A 3P9XA 4B3FX 4EYSA 1S2LA 2GBLC 5DYYA 4UEOA 4P93A 1IZZA 2DU8A 3W8NA 2WILA 3QITA 2QN9A 3DD5A 4E1AA 4LECA 4MRRA 4ENSA 2BGIA 4BN4A 2OG1A 3L4KA 4J9UE 4G67A 1BVRA 1Q50A 1XPJA 2OAQ1 3PNYA 3DA8A 4TVOA 5DGDA 4RDCA 3R7DA 1JR3A 4DCOA 5CB4F 4FR2A 8OHMA 2VZ9A 5IRCD 4C2AA 2GZSA 2YVQA 3CO5A 3EAFA 2FWJA 2G6BA 5AKKA 1W47A 2PWZA 5B37A 4JODA 7ABPA 2FSPA 4M46A 3REQB 5K0TA 1WZEA 4Q4LA 4RVDA 5DXAA 3ER9A 1O6CA 2O05A 2FV8A 2PVCA 3D2AA 3AZQA 3L7AA 2ONYA 3JWHA 2FPPB 1P17A 1EGAA 1XWWA 2FQXA 2HK9A 2IGTA 2QAGA 2ZDGA 2H0AA 1Z07A 4HWGA 4V38A 1NQXA 2NQTA 5AKGA 3RRBA 4PPNA 2YRWA 2QGFA 1E1LA 3QE2A 2OCYC 1PJQA 1KMNA 3GB9A 1SOWA 2B4KA 5B3LA 3R0VA 1TQ4A 3A1TA 1GCUA 1GQYA 1S2GA 3CLTC 1A9QA 4QDJA 1K7YA 4EB8A 5A9SB 5FX2A 1OVMA 1II8B 1ZXBA 3H5TA 2V7WA 3PQFA 1BS9A 1N8NA 1R9MA 1LS1A 4TTTS 5DGIA 2FH5B 3RAJA 1KPGA 5IANA 1SVLA 1GQQA 2KI5A 3DE7X 2VDMB 2ECPA 1M1ZA 4IIHA 1LKZA 1Z4OA 4R0NA 5CTJA 4YWJA 3E7FA 3X1WA 3SKYA 1SUCA 1SVMA 4F3KA 3A3PA 1T5TA 4KQCA 5KTYA 3L0SA 5CH5A 2A5GA 5GVSA 5K1ZA 3ZWKA 1J90A 2RI6A 4RZUA 1CEEA 3N2IA 3UUEA 3HN7A 3RAEC 4CT0A 3RYTC 1FU7A 4RFLA 3LOQA 3B60A 3LMKA 2C5SA 3SC2A 3VR5D 4YRMA 1DFGA 1EI9A 1I7SB 3PF8A 4N8DA 3LIPA 4MQ5A 2V0GA 1Y3FE 2B3TA 1I5RA 1M54A 1ZBQA 2DYKA 2AOUB 3PQ7A 4JP5A 4X1KB 5HOEA 1BOFA 3FYUA 2GVZC 2WKRA 2PYDA 2AXQA 2QNIA 2OV3A 2PRYA 5K8LA 4P54A 1GZ3A 4ZI5A 1J8VA 1SQ0A 1WW3A 4X95A 2OZKA 3FZQA 3NDIA 3WQQA 3GRCA 2R6CA 4HADA 4D42A 5CMLA 3P5BA 4KPGA 1Y7LA 1OVGA 2M9MA 1PVOA 2JBAB 3STUA 5IS2A 4XQ9A 1OB2A 3UW3A 3CM0A 4GD3Q 2ZSEA 3O8BA 1Z37A 4LRXA 4NX2A 3AR3A 4PLWA 1XA0A 2OWEA 2FUG1 3GCXA 1RYDA 4KU4A 1FNSA 3DMNA 2E3JA 1P1RA 1DTWB 1KZ4A 2NO4A 3K1ZA 3FWPA 3TRKA 4ZEXA 1JHRA 5MGNA 4FW9A 1LC0A 1MG5A 3P4YA 3H83A 1GRRA 2JCSA 4K9OA 2ZQYA 1W4ZA 2PMWB 2QR3A 3EZ9A 4JLUA 4PYQA 5ARDA 4BZQA 4DKJA 1V5IA 2DLDA 2E21A 1CD5A 2P3QA 2PKEA 4DJDC 1B74A 1U8TA 1S2OA 2AD1A 2H9IA 3HDHA 1X1QA 3KT8A 2KMLA 1UBKS 1TM3E 1IQ0A 3P7MA 5DXJA 1J49A 4G63A 2UU9B 3GUHA 3HJGA 2CLOB 3L79A 4FMDB 1BA3A 3GLVA 3OLWA 2CB9A 5CURA 1RYBA 2GNAA 2FTKE 4BQNA 3RHTA 3CKMA 3TXYA 3P0EA 4Z4QA 1VL1A 1GPLA 4DA6A 1ZKDA 5DHPA 5CDFA 5ITVA 1Z7WA 3UKOA 3DVLA 1AGXA 6PFKA 1O4VA 1OHHA 3IMFA 4YO8A 2OBLA 1AO0A 3FSGD 1WBDA 3B5IA 1BEUB 1RKVA 3E35A 1ZD5A 3BUSA 4BUJA 1XV5A 2NP7A 1J0BA 1RP7A 2IUYA 4R8MA 1YB2A 4BO9A 1XNHA 3DC2A 3AQIA 1Z0KA 3HFJA 2FSFA 2KLHA 3VKWA 3ZGYA 1SHTX 3NGLA 2IU6A 3C4QA 2YDXA 5CA1B 3KJQA 3GBPA 4ITUA 1GTJ1 1YZUA 2H0QA 4Z4CA 1V16B 2ZSFA 1Z6XA 1M67A 4XQCA 4IHJF 1CERA 1Q0ZA 2HRZA 3NJ8A 4BV9A 8MHTA 1SVKA 4JAVC 4UPEA 4DDWA 3KQQA 1LGYA 4BEWA 4GYWA 2M2IA 4KUHA 5KZMB 4ARAA 2PZ8A 3K0FB 2BLLA 1H2FA 2V74B 3L7OA 4PWZA 3WXBA 2OB2A 3O84A 4HATA 3K0BA 4LHSA 4WGFA 3RU9A 2WV9A 1L5YA 3Q88A 4IYRA 3L9WA 3TR0A 2FI1A 2G9NA 2QZZA 2A2ZA 1GARA 3D43A 3LO5A 2D1RA 2FUG6 1GGNA 3MA0A 5A71A 3SNHA 4V0RA 3IOCA 4ON9A 5LFAA 3SDSA 4DLUA 4AICA 2MHCA 2Q4TA 4E08A 1CY0A 2GZ1A 4PQGA 3FUTA 3HCPA 1SG9A 1RWNA 3DZHA 4DLNA 3JYOA 3LBAA 3Q15C 3NW9A 3CWCA 1KVTA 5FLYA 1ETUA 1IDN1 1U1DA 4G5HA 4BNDA 2G0NA 5DW3A 1M7BA 1P7WA 1E2GA 2MIIA 4K9KA 1PZHA 1U28A 4HAIA 2WY2D 4DWVA 5JD6A 1S7GA 4N5LA 5F33A 1NQAO 5HQTA 2A5LA 5B36A 2OQIA 4G0PA 1PUXA 1K27A 2YC4C 3E48A 4WJZA 5EPEA 4CMIA 1VIMA 3AHJA 3ZI7A 5A4DA 4GZLA 2W4MA 1C4OA 3DYVA 1CUGA 4KTVE 1EP1B 1CJTC 1Q0UA 3CW2A 5I8WA 1MENA 3HBMA 3JZMA 3T7AA 1UPFA 1UWLA 2OXIA 1J0CA 2QVYX 5IM5A 2I2WA 4CIBA 4HS4A 3VDXA 4LQDA 2ALJA 2ZIAA 2YN4A 3VR0A 4G0MA 5BVHA 2GBLA 3ZDYB 4U9IS 2R8RA 1QIEA 3EPRA 2FAXA 4PINA 4B2LA 3RVRA 5FLEX 3BL5A 2EEZA 4UMDA 3VNSA 5AVUA 4KOEC 3D6JA 3KKNA 2NU6A 1XT6A 3ICQB 2VQEB 1VJCA 1SUSA 1C1HA 1EP3B 2IYXA 3GLSA 2AZTA 3P9RA 1SKYE 2W0SA 2XYHA 4J4TA 3INYA 4ETNA 4BVLA 2WFZA 3VJRA 4G2TA 1ECJA 2N42A 1ZINA 5JLAA 3PDJA 2P11A 3VC3A 3KJFA 1UMBA 4YPFA 4BKRA 2X9VA 1T9ZA 5SY6A 3W9SA 2HNKA 2B8TA 2A9FA 2P1DA 2GTIA 2VPQA 3EDCA 4KN9S 1FYXA 1UANA 3RROA 4G01B 3ZYCA 1QXSA 4F6RB 3AB7A 1O54A 4NAHA 5BQOA 4YR7A 1XLVA 4ZJYA 4GXNA 4LOAA 3MINA 4US0R 3SIWA 3PHBE 4MKHA 3U3MA 1V5EA 5IAJA 1BH6A 4I5IA 4MVCA 3W1VA 3B2QA 5JH7F 1F1BA 5EWLA 1OFUX 3JR7A 2Z08A 2RJNA 4U0KA 2NU8B 2WU4A 4KC0A 4R3UC 5J5VA 4OAQA 3HV2A 4M54A 4JLPA 1I0IA 2X9NA 4XW2A 3FWZA 3NOQA 2JI6A 1QE3A 4KACA 4BPRA 4E1BA 3BSSA 5DNWA 3P19A 5L7YA 1GUFA 1WU8A 2EKQA 3U3OA 4EHHA 4E0BA 3SOZA 1QTRA 4R4JA 3GMDA 3CZCA 3H4IA 1CT9A 2J9FA 1ZNXA 4TT8A 2NVOA 4J0CA 4D3XA 5DT9A 1GZUA 1DO2A 2C57A 4LQCA 2CV0A 4OHYA 3EFOA 3RFXA 2NUTB 1N6IA 2WUEA 1KYXA 2EKDA 3LUKA 5BW6B 3T1QA 4F4CA 1TEZA 2P4EA 3U7QA 4K0RA 2JGMA 3ZE2B 3WK9A 1IWOA 1EQ2A 4WPGA 3WMFA 2CZGA 3BRWD 4G97A 4GH5A 5KYXB 2OKCA 1IXZA 4JI1B 3ZHCA 1KJWA 4DCVA 3VPAA 3L8GA 2NVUB 4Z9BA 2FZ5A 4NG4A 4EPRA 4YMVA 2J4FA 3STYA 5KQSA 1G5FA 1WSWA 2C1EA 4H16A 2QR5A 5EHNA 2NPOA 3U3XA 4D7AA 2R4QA 3SFZA 1J2EA 3DOFA 3C3DA 3IP3A 2W71A 4Q19A 3H9EO 3RGGA 5KREA 5HJEA 1QP0A 5BSMA 4KG7A 3SF8B 3CLTD 4Y2YA 3WQHA 3WYAA 3E70C 4V0SA 3IXQA 3RUCA 4BY9E 1NLZA 1WCWA 1UIRA 3CBQA 1YFJA 1RPZA 1YTUA 3K4HA 3M4NA 2C7VA 1JTEA 1TX4B 2MSEB 1IEQA 1V1RB 2XWSA 1GY8A 3B5EA 2W8BA 5F7ZA 2XOKA 3OKAA 4CZ2A 3TW6A 5E1BA 1YR7A 5K8UA 2Z9CA 3KKQA 3GGSA 4PLZA 4HBZA 4BGDA 2YVKA 1G9SA 2PRSA 3B8EA 1D5CA 1K5DA 1TAHA 2D2XA 3KPVA 5JAOA 1MZVA 5IJ9A 4X65B 2WFMA 4FFNA 4PANA 4WA7A 2W6QA 2IEDA 1S6YA 1N6RA 4YRTA 6GPBA 2G4LA 1S3IA 1MVLA 2ACWA 2DAPA 4IIJB 5HM8A 2Q99A 4E2YA 1E1MA 4ZICA 3FKSD 2ICAA 1C7QA 3SYMA 1JYFA 4I19A 2WB4A 4QLAA 3W04A 1ACMA 3PHLA 4L0CA 5I7EA 1RYEA 2GEJA 1GLGA 2R7MA 1NJ2A 3DQZA 1R0KA 4YI3A 4BNVA 5HXAA 3L0YA 3VR4H 1Z63A 2O8EB 4MULA 1RW4A 1KETA 1FTQA 1XRJA 3HZHA 5PNTA 2VDWA 1U0EA 4CMEA 3R7BA 1D4OA 2G9ZA 3SVLA 3H99A 1VKJA 5BSVA 4RELA 1L4YA 1RJEA 5KB3A 3QP9A 1N32B 1Z5WA 2C96A 4IKPA 3L4BA 3LZDA 1ADGA 1ZGBA 1E3SA 2P75A 5LNK1 5DKFA 2UXDB 1KP9A 1Z5GA 3OCZA 4KR7A 2B1JA 4JJKA 2NO1A 3UJ7A 3UJHA 5JMTA 4NE7A 5I9TA 5HMLA 1AB6A 1KI8A 4JQOA 5B7QA 5J23A 1UEIA 1ESNA 1DT5A 1PZXA 2BR5A 5HIIA 1TUBA 4YRKA 3HKEB 3UAZA 3ENVA 1INLA 4CJXA 1UBRS 1Z22A 4WWHA 5A9TA 4EW6A 4UEQA 1LI4A 1PZFA 3T9BA 3CPHA 3P9QA 1BN6A 3UK1A 2AXNA 3S27A 3RFVA 2RKOA 4M21A 1R66A 1RQNA 2GEBA 2QWXA 3B78A 3PENA 4PTZA 4DR3B 5E2BA 1T1EA 3KJIA 7MDHA 4RJIA 4CT5A 2C78A 2QIOA 4M1QA 5CB6A 3E1GA 3AU9A 4RBNA 1MCZA 3MQ2A 2D2FA 4OF4A 1R9NA 5ALNA 4M38A 1GD1O 1RZRD 4RK1A 1H8EA 4IM7A 4KUGA 4TKVA 1M75A 5EQTA 1U0BB 3OJFA 1IJEA 4NICA 3H9GA 1PFQA 2DETA 1DRUA 2O3JA 4N5MA 1AIPA 2E1RA 3A05A 3D2CA 5E6RB 2YJ6A 1T8RA 2QN6A 4QPPA 3RSHA 1DE0A 3F2IA 5TJ9A 1FNCA 3DLPX 5DXFA 1AQ6A 2B7CA 2V54A 5JQGB 1J8FA 1DHRA 1GILA 1D4FA 1OX4A 2RGGA 1KNQA 3G0BA 3MAJA 4KO1S 1NW5A 4EA9A 4ZCIA 1I13A 1U3UA 4XI9A 4F2DA 2PS3A 1U9YA 4R8VA 1AA6A 2MSLA 1YVUA 2VTKA 1TA4A 1KA9H 1DX4A 1PEKE 1CQPA 2XGOA 4WESB 5AIBA 5MFPA 2Z6AA 3M4XA 1QDUA 4CM8A 1E2HA 3SLRA 3AB8A 4JQYA 4RAQA 1U8EA 1V5GA 3I2YX 1NVWQ 4C4YA 1IN7A 2O1SA 3GAFA 3TCXB 3OQIA 3FFAA 3OBBA 4NMMA 2XUPA 5T3YA 1ZK3A 1CETA 1TZCA 2G80A 3V7WA 1NJ5A 1KEZA 1K9VF 2Y9PB 3RQIA 3L0CA 3LVBA 2X0DA 3ISTA 1EXNA 2Z2XA 3F90A 3W8RA 1X1AA 2V6JA 2W0MA 3C3XA 3CNHA 2Q3LA 4DSTA 4KR2A 1VDZA 3AHHA 2BFOA 4PCLA 4UHHA 4MJLA 4RM2A 4DL9A 4LOLA 1IPHA 2QP4A 1ANKA 2QRGA 5CFMA 1VCHA 1B16A 3GG9A 4G86A 1D1TA 1V8FA 3LCMA 1M8PA 2Q1UA 4Q4HA 2EJVA 1TU0A 2J4CA 3I53A 3NHUA 4W6ZA 1YVEI 3DT8A 5CCEA 3JYLA 4RA6A 1M33A 1L0BA 1PJSA 4TWAA 4CQJA 2JLCA 4EELA 3BXZA 3D4BA 3TUIC 4X20A 2Z9BA 2IYQA 4UZSA 2XT6A 4FS3A 5SV2A 2NVWA 2C7QA 5D3MB 1KJYA 1QQAA 4IIFA 1A4IA 1AZTA 3ITDA 1ZESA 1G6KA 1W88A 2Z4SA 1REQB 3SJUA 4GKJB 1NSFA 3JZFA 1TVKA 1GNLA 4FUQA 3RIMA 1FX0A 4R7ZA 1I51A 5EWJA 3U1TA 3UQZA 3PE6A 1AK1A 4FJ0A 1MLDA 2WFLA 1SVWA 2XDAA 4IRUB 4PXYA 1OFHA 2ZWVA 2FFJA 5DGXA 5ARCA 4AY5A 5K8JB 3H7IA 5TMBA 3OOHA 3WLSA 3NTUA 4RU1A 3PDIB 1VBMA 4LHWA 4LZWA 1MQAA 2D4AA 3T9EA 1L5HB 3P96A 1PJ3A 1QORA 3GOQA 4DLYA 2N47A 4TTJA 4RS3A 2XB9A 1DJQA 1FFYA 1CRPA 1E0SA 1QQ5A 1E9RA 1OFVA 4QJ5A 4RWZA 4Q9KA 2QE7D 4AWBA 3L0PA 4QJIA 4I5EA 3U9SA 4D96A 1XQ6A 2JGKA 1DVRA 2R6HA 3GRAA 2AVDA 4AUMA 1AXEA 3PGXA 1GUAA 1NW8A 5AO9A 4MTCA 3VR2D 5A1JA 2G1UA 1K5HA 4F9EA 2FN7A 4FBMA 3EH1A 1S96A 3SBOA 3DPUA 3K0AB 4DUPA 3PUHA 1YJ8A 3VR4D 4DR6B 1L8QA 5EZYB 1P60A 2XKJE 1C4WA 2QTHA 3HXKA 4WXHA 2F8SA 5ISMA 1FSPA 1XI2A 1I4WA 1PG2A 1U2GA 2GEFA 3ZE1B 1ZCAA 2R1VA 2R8YA 3FIJA 3ENNA 3QEJA 5C1PA 1B3RA 3TRDA 1TRKA 4TLCA 8ABPA 1D2MA 1AKUA 1C30B 2D5AA 2YTZA 4MR9A 3V8QA 3WAKA 2VCEA 5TGZA 4BNNA 4RH0A 3V7YA 2HL6A 4EECA 4UOQA 4MZDA 1FSGA 2GCOA 2XLBA 1FFWA 1NJ8A 3JPYA 3N6XA 4OCZA 4RY9A 4RKQA 5DEOA 3PGMA 1GG9A 2JCVA 5IXSA 5K0EA 1Z6GA 1RAGA 5CU7A 4D9NA 1T34A 3VPHA 3ZDRA 5C8YA 4BASA 3OHPA 2ISSD 2FSHA 3QLJA 3IKTA 4MS4A 2IH2A 3DM5A 5ELXA 4BNUA 4DTIA 4HNAB 2OPHA 1Q74A 1YK1A 5HIKA 2ZP1A 2Y1OA 1TIPA 3IILA 1V2HE 3V7FA 1EX1A 1ECPA 5EKXA 3NYWA 2WICA 1CVIA 2NGRA 1V37A 1Z39A 3G79A 1OH6A 1OLUA 4O2AF 1CEXA 4KODA 3RBXA 2JD2A 3COYA 4DV1B 3S2YA 1SUPA 4IPTA 4EYGA 2X4DA 1MNAA 4WXEA 1ENYA 4DQ0A 3B1FA 1IXSB 3FVTA 3HVJA 3LIIA 1WVIA 1YZKA 3QBTA 4LRUA 2ZT7A 4RTJA 2JA2A 2YV1A 4HNSA 3FHTA 3L6CA 4YCLA 4YIHA 2HLHA 4Q39A 3RC3A 2ZJ8A 5HP4A 3UO8B 4D3FA 2R8XA 1IPEA 2K87A 3SBEA 1PS8A 1BRTA 1JFRA 3TLZA 1TZJA 2RH5A 3PQ6A 1ZVVA 3HDJA 1NXWA 3B89A 1DBIA 1PUJA 1B0ZA 3CE6A 3M6LA 4OGLA 4A4DA 3KQHA 1K0FA 5EWMA 2VSNA 5CP8A 4EOGA 1GPBA 4JJGA 1WB5A 3KSAC 2QUJA 3FI9A 2AMJA 5JZ9A 2ZDQA 4C0XA 1BQEA 1Z7EA 2G17A 3E7WA 1X1SA 4XCXA 5C3UA 3AW8A 1NKSA 1MJ5A 3UJAA 3OFSA 4PNEA 2SKCA 1BYIA 1FTYA 4RF5A 2ZSIA 2FWRA 5CHEA 3M7IA 1AV7A 4C0QC 4FN5A 5HOQA 1M72A 1WSBA 2IX9A 2WU8A 3A2LA 3EZGA 3LI2A 4P0PB 4LY9A 2P9JA 3AEZA 2XCQA 1P6QA 4KMRA 3VHQA 3D7NA 2DSTA 2VUIB 4YFYA 4GOKA 2OM2A 4TTIA 3RK1A 1Y4UA 3RABA 2B6HA 4S24A 2Q9BA 4MW9A 2YY7A 4A3SA 2BJWA 4RDIA 5B58C 5GJBA 1IBLB 4OHMA 3K9WA 1SBIA 4IZIA 4S35A 3ET4A 4XPIA 4P2BA 2WWRA 1RXWA 3V7NA 5JO0A 3DTNA 1B6GA 2XRYA 2WZDA 3ZE7A 5HFNA 4BP3A 2PZBA 3GJ5A 5IAKA 3E5MA 1G21A 4UVEA 4V2UA 1DADA 4DIEA 1EIWA 1KO5A 3VOBA 2FX2A 1E2EA 2A9OA 3GXOA 4Q18A 5AHRA 1VM6A 2ZWMA 4E5KA 2E5WA 1NW3A 3DZFA 1QTIA 1TM4E 4ER7A 4CEIB 4S1NA 1BTOA 1JR6A 1XF1A 3V33A 2VNKA 2GZ3A 1AS0A 1IG0A 5BOSA 1ZNYA 1JVBA 2VZ8A 3JYNA 1D7OA 4QDKA 1TI7A 3IUJA 5T4FA 3G23A 1IE3A 2DFKB 1JW9B 5IAGA 4JEMA 1NX6A 2D54A 3ESZA 1RYYA 3OZAA 4LC0A 4DADA 3BIXA 4X97A 2QN8A 4IHJA 4N7JA 4IBOA 1B6SA 3LHDA 5BSTA 1JG2A 3TLJA 1D07A 1GPMA 3L84A 4DNFA 1VGVA 2W2KB 3CZAA 3C8ZA 2Y1FA 1K6XA 1WW8A 3UMCA 2WIAA 5C7OO 4YRCA 2DUNA 2NPIA 2Z8ZA 3EMDA 3CBGA 3E2PA 4YXWA 4R84A 4D92A 4EPTA 2O8DA 5HX7A 5AKJA 3MF4A 3BWCA 4FE7A 4X7BA 3VUFA 1Z4QA 2E4UA 4J3NA 3A6ZA 2H1RA 2CK3A 1Z08A 2XXJA 3CZ9A 3G89A 3RK0A 2HT6A 2ENUA 2F3UA 2JFVA 2P4UA 5EHXA 2FZEA 1HETA 5C51B 2Z1MA 2IYPA 1VKOA 3OY7A 1DU4A 2DWUA 1HT1E 3EHEA 1EFAA 1O95A 4R71A 4AJKA 4GKKB 3UXYA 2P5YA 4ZVLA 4IJVA 1B8NA 2ORIA 1VYUA 5IC5A 1L6IA 1GV0A 1WNFA 1WUYA 2X22A 3N8GA 4IAOA 1MJGA 4UFNA 3MHTA 1HT3A 2GH1A 4RY2A 4RFSA 1DEKA 3IPLA 2GN6A 1VZ2A 4Q37A 1GITA 4H9GA 1GQ2A 4BZPA 3W6OA 4U2EA 3KQLA 4M1MA 1KI9A 3HPQA 3FNGA 1ZD3A 4MINA 4RPIA 2PXHA 4RV5A 4YCSA 4YJFB 5LBTA 2ODEA 4WOPA 2ON6A 5DPMA 3QFSA 3ZHZA 2B9VA 2A5FA 2JATA 3GFFA 4FCTA 5CA0B 3LC7O 5HHTA 4FX5A 1XB2A 2QD3A 4NENB 2HFJA 1HFEL 1E2NA 3G2KA 4AMZA 3RYIA 3T3PB 3DBHB 3KOMA 2OK7A 1QC5B 1QIGA 2RHWA 1OIWA 4M4SA 1XIVA 3VMMA 3WGLA 4KBFA 3JVVA 4FN4A 4E88A 1XOIA 3O8OA 3T5PA 5I9NA 1X7YB 5DF1A 3PIRA 1OMOA 1JHPA 2UUOA 2XUFA 1MJNA 4JYBA 4IGKA 3RRNA 3R4VA 4L02A 1RQ7A 1XX6A 1ZP6A 2GAOA 4ONEA 1NE2A 1E79D 3U62A 2CL0X 2QJOA 4W5JA 2LDXA 3B1XA 1RD4A 4J3JA 4X85A 5KJFA 3O21A 1PV2A 1U0RA 2XNDD 3A26A 4H6PA 5LL6P 1RFLA 1FCJA 3DWIA 5GM2A 1O5OA 3KHTA 2NOAA 2OG2A 4GM4A 1DWUA 4G6ZA 4PPFA 1TTQB 3DBOB 3WGIA 4AS2A 2FVYA 2HYDA 2X5JO 1SXPA 2FG7C 4IEFB 2O54A 3QEMB 2MSNA 3I6QA 3O3NB 2AK3A 3ZIDA 4ZOLF 2C2YA 5HS6A 3S68A 4FLMA 3V7UA 1AC5A 2ZULA 2AW3A 3HA5A 3QUTA 4XSVA 3MRVA 2YYZA 5H0IA 5CYFA 5EE0A 4FMPA 4KIFA 2BAGA 1D2AA 2HPAA 1RADA 4BX3A 4INAA 2HRDA 5AW5A 3FWHA 5JCJD 3QVGB 2YNMC 1P5HA 4O4HB 2TMYA 5KIAA 1JYEA 1OXTA 3ENZA 1AD2A 2QW8A 2X19A 1ZWLA 3SVTA 3I9FA 2IZ7A 5EIAA 3NP7A 1Y48E 3C5WP 1HR0B 1NC3A 2WT8A 3CRRA 3OWXA 5A5GA 3TFWA 5ERYA 2YWHA 2HJ9A 5TB5A 1DJLA 5JU6A 1SB8A 2V7VA 5A7FA 2OOKA 2NYAA 1GRNA 1YAHA 1GPKA 1XCLA 4I1IA 3JAKB 2CNWA 1LJUA 1GGKA 1Q7BA 4PS0A 1A8SA 1O6GA 3MLBA 3RAFC 2OORA 4GOLD 5GGYA 2HB6A 4JJ7A 3CKYA 3ANNA 2X3UA 1E4EB 4J9VA 2NM0A 5CJPA 4ZAVA 4BCBA 1WZIA 4GPAA 1ETHA 4W5HA 2JNWA 2WAAA 3VZCA 3WBKA 1U2PA 2AA3A 2J0EA 2CXSA 3K96A 5JYDA 6AT1A 5JXWA 1UXKA 4QVGA 3RUFA 3A3KA 4YJGA 5HUQA 2XECA 4UCFA 4TWJA 2H9AA 4UU7A 1UBCA 2CUTA 1XDSA 5A3QA 3DGEC 3EQ2A 3G5AA 5D7NA 8ATCA 3MRSA 1KFKB 3RVLA 3A7DA 4OYRA 4WLUA 1E6LA 2GBGA 3BMOA 4LXIA 1KOLA 4EO4A 3C7DB 3ESBA 5TSDA 3ZJ4A 4PGGA 4XPZA 4RVHA 4EHLA 2O8FA 1SCJA 4Z0TA 2X1HA 4N8SA 4KLCA 2OVBA 3Q8XB 5LQCA 2G9RA 2B94A 4OP3A 2BCEA 3RVJA 1YQ9A 2H2FA 2EBWA 3W5BA 2FY8A 2PRKA 4L75A 2JIQA 3EEFA 4RZ3A 3STWA 3FGZA 1DBWA 5I4IA 3GBVA 3GRKA 1E7RA 2ODPA 3NHAA 1GU1A 4DAOA 1L7XA 1PT9A 1LX6A 2XTZA 3W5SA 3THXB 3FUWA 1U8XX 1ZU5A 3S2EA 1KOJA 2HMVA 3CLRD 1ZGJA 4PC3A 5ER9A 4CL3A 1ZSYA 2FZGA 3GG2A 5AUQA 5DM60 3OTQA 1NI5A 2PKQO 3TXAA 3OFND 3O3OB 3QHAA 3STTA 3I2GA 3M5DA 3V8PA 2Q0QA 1LBSA 3RVDA 2WU3A 2QV0A 4UUQA 3S8MA 3PXDA 1U11A 1N6PA 1SCAA 2C97A 2EIXA 2H1FA 4AN4A 4IGIA 1MVOA 2H00A 4LJLA 3A32A 3IMKA 1M6HA 3E5HA 1LDEA 3QM1A 4IMJB 3BXHA 4DDKA 3AETA 4BJ6A 2G83A 4XWGA 1KK1A 4OD0A 1PFWA 4OQFA 4ZPXA 3ZDQA 3TLGA 1N1GA 5EJMA 8ADHA 4PQYA 3T4PA 4WZAE 4CKBB 4F96A 5AVZA 4Q6BA 4K9PA 4BE7B 4E51A 3SJAA 3JVIA 2PL5A 4RXUA 4ZIRB 1I8TA 2M6KA 4EAQA 4M9RA 5EINA 1RMQA 5BN5A 2R00A 4X1YB 2OBBA 1QHXA 1JR4A 2YHIB 1DKLA 2ZRQA 3LNCA 4H4EA 2JL1A 2NZ8A 4B0OA 2AQIA 2H1VA 1W73A 3CSDA 1UQTA 1BMDA 3KZ1E 4N6GA 2HEIA 1KSFX 1FS4A 1C3EA 4BO6A 2R8EA 3IBCA 4GHWA 3ZXIA 5E6SB 2GYVA 4EY6A 3QE3A 2JFXA 2NZUG 3OLZA 3SQWA 1HLPA 1J2JA 1JR2A 3JX9A 1A2BA 2VDUE 4BYMA 4GQIA 4BMPB 3PT5A 4L4SA 5AJUA 1T25A 2VZ0A 4S2EA 3PQ4A 4NXNB 3KEOA 5DT2A 1KYWA 2QE6A 3A4LA 1HURA 3G2LA 1C0LA 3Q1LA 4EVRA 2X41A 1XWFA 3F0TA 1TJPB 4J7UA 3U40A 3DEZA 3TRIA 3VH1A 3CTMA 5CCXA 3BHNA 4Q4JB 1J2TA 1G8YA 1NURA 4O4IB 2Q0XA 2VAVA 3AEYA 4BS9A 3EG5A 2JLRA 3D54D 3UH0A 1JL3A 3E23A 2XDQB 5KQRA 2DTDA 3WK7A 2ACVA 2TSYB 1DFHA 3Q7EA 3HM9A 1KKMA 1AK9A 2J32A 4R51A 1CBUA 4Y0AA 3VR3A 1HQKA 3SE0A 4C87A 3A6EA 1SC4A 3NC1C 3EVGA 1NXXA 2YZGA 3Q85A 3EMKA 5IH7A 4KLAA 3J81k 4YHBA 3P52A 2FZKA 4Q3NA 2FXIA 3SX0A 1YZQA 4BX8A 3CC8A 2DQSA 2ZI6A 4DCUA 5IDXA 3WHKA 5JC8A 1RC8A 1YI0A 2YH2A 3IUSA 1O0SA 2QTZA 2EZUA 4I14A 4ZT2A 1H1DA 3UAYA 3MB5A 1JE0A 1LSSA 3PC7A 4R2HA 4FB5A 3F2VA 1DC6A 2J5QA 1XJWA 5EZ6B 4MITA 4R2WA 3QW4B 5GAJA 5DNEA 2IV2X 1XTKA 2M32A 1NVEA 4JBNA 1FLAA 1UCFA 2XNKA 4NP6A 4G23A 4KSBA 2B4YA 3OX4A 1RP1A 4JI0B 2LKCA 4HLNA 4UJ5A 1IZYA 1U80A 3KLMX 3TTWA 5JD4A 3AVTA 3SQDA 2PGXA 3SYLA 3PC8A 3ND8A 1JHOA 2YWEA 3LPMA 3VNVA 1Z0ZA 2P5UA 3MFQA 4AJOA 3ABRB 2C77A 1Z4NA 3THWB 2YMPA 3AFHA 3B9RA 2GX6A 3TBHA 4J0GA 1YR2A 1L5WA 1VOTA 1A98A 4MWEA 4MSUA 5LIRA 1CR4A 4Q9LA 1EPUA 1L5VA 3IHTA 5JBNA 3DFFA 5KSZA 1NKTA 1SRRA 3TAUA 5MN4A 4MS3B 3PXGA 1X87A 5HS4A 1QH1A 3PRYA 1V8OA 2Z3ZA 4J7CA 4QECA 1URPA 5DTRA 4LF4B 3SPXA 2VRWA 1SHUX 4WCFA 3SSOA 2H1WA 4K9MA 4JHLA 2Y71A 1ZRSA 2A1TS 3MUOA 5K8CA 2B2NA 3NHMA 2HWKA 3BHMA 4QSMA 4ZANA 1GZ4A 1PBNA 5JYCA 1UJ4A 2P40A 1CQJA 1G20E 4V1CI 1P77A 3RYFA 5I45A 1XA4A 4X61A 2OE2A 2ZTLA 1C8VB 5DHAA 1NJGA 2ZAMA 1Q91A 4BLTA 4DJEC 4E5PA 3JU3A 3OT4A 4G8CA 1Y6RA 1GM5A 3KQYA 1H69A 5IT9A 2NQ2C 2Q2NA 3NIBA 3WYBA 2FMHA 4WBNB 4CG0A 1CLUA 4IDNA 2P27A 2NSDA 1NQOA 3VDMA 4QYIA 2GTHA 4XJVA 2GTPA 1FNMA 3E3MA 3IAFA 3R5HA 1KZHA 4ZFNA 1RHMA 1RCTE 1VA4A 3RYHA 3EGWA 4KXVA 4QT4A 1D4AA 1PT6A 3U0BA 4PFKA 1AO3A 3KVRA 4K3VA 4P3NA 5G0TA 3TTXA 5C81A 1IJFA 3SC6A 4FHZA 5CT6A 3UMFA 2X0EA 3TQIA 1DQYA 1XCJA 1HX7A 2CE7A 1QVRA 2BGKA 3PGA1 3I9JA 1J9ZA 1CXZA 1M2OA 1S2MA 3GHYA 3ZWNA 1XHEA 2M6RA 2PD4A 3TTUA 1AXGA 2GI4A 3OU6A 1W4CA 2WWIA 4DA8A 1JG6A 2HWXA 4IJUA 1G98A 5HUHA 2ZBVA 3FJYA 2BTEA 4HDNB 3SLKA 2RGNC 1G4UR 4F3TA 2HOQA 4KZKA 3NVMB 2FPWA 2SKEA 3TLCA 3PTZA 2QX8A 1AQIA 2HMSA 1VYTA 1SIWA 3OZXA 4AL4A 1LXCA 2YR0A 4TZKA 1HDCA 4WY8A 1OXXK 4TLBA 3KT0A 1C5KA 5A0TA 3Q87B 3URKA 3DBRA 5AKEA 4A5OA 1ZIYA 5LMZA 4QQNA 2JIDA 5TQVA 3N8HA 1TPZA 3UC5A 1G6HA 3BTVA 4GP6A 3RNLA 1XKTA 1MAUA 2HQOA 2CL7X 3FPBA 5JPIA 5L3ZA 4ZI3A 1JTVA 3IIIA 3W5VA 5E6UB 4QE3A 2PUCA 4KW7A 3WJ2A 5C7IO 2II6A 2OQRA 3Q3VA 3QTBA 4G5GA 2BBTA 3ZLBA 1J5PA 1FBTA 2MSCB 3VVMA 3VZPA 2DQZA 1UT8A 1Z0DA 2E4XA 2ZM6B 1P2TA 1W0JA 2E5LB 1NVUQ 2OHIA 1SU7A 4Q5IA 2LUOA 3VDNB 3F73A 2PSEA 1MOPA 1PL7A 1DCMA 1WUHS 1ZA1A 2PGNA 1ZRNA 2EZ9A 1YIOA 2X7JA 4C0KA 1WEHA 2M98A 1F8YA 3L8DA 2PGJA 4PG7A 5BN3B 2XT0A 1CUUA 4BVHA 4DQVA 5AVTA 2J48A 2YWGA 3ZU2A 3R3YA 1VL2A 4G8DA 4F8JA 1JFVA 3UVEA 1DKOA 1FDIA 1BAPA 2CJWA 1E1YA 2FZWA 3WGNA 4BE9A 4EZBA 1I3MA 1PFVA 2PAFA 4H27A 5IZ4A 1EFTA 4PR3A 1GVHA 3B7GA 3SJCA 4NYIR 1O9HA 5A9RA 4UM5A 1RXCA 3FCOA 4JLSA 2PT7A 4FNGA 4E5VA 2ZZMA 1TT7A 1F2VA 2C2HA 5F9MA 5A3VA 1GGEA 1YL6A 3IDOA 3FNQA 3C6XA 4MI1A 4DPMA 2OO5C 3DHNA 4Y2JA 3WDLA 3DFIA 4Q1BA 3TJRA 4DA9A 4PN7A 1H9AA 1AG9A 5K03A 2VP6A 2WU0A 1YIAA 1K8QA 3A04A 1KZ9A 1M8GA 4PFQA 1UFKA 3WOHA 1R5JA 2FKNA 2IV3A 1LLQA 3CCBA 3DLBA 1LW7A 4MVJE 4M0CA 1FP4A 2GEKA 3ZVMA 3HKDA 1NT2A 3ENWA 3F8WA 2PZKA 4X6LA 4WFKA 4C7JA 3G0HA 3BF7A 1WZUA 3ASYA 3M6UA 5CX1B 1M1YB 4ARZA 4MWTA 3R3ZA 1RBQA 1J2YA 2Z2YA 1FFEA 5C1OA 2PS0A 1RVDA 2ZJ2A 4MK4A 5DM4A 3IH5A 1EDEA 2CHFA 2IUFA 1XDBA 4G4GA 3VH3A 1TGYA 2X5KO 5CBPA 4AW9A 3RHZA 1COWD 1STOA 3NUZA 1NG9A 1U6KA 2HRQA 4RZHA 3EXFA 3GEPA 3IA2A 4GVLA 4AKGA 3O26A 3V8MA 3M2TA 2ZWIA 2YMQA 5TMEA 1EEHA 2BUBA 3S4YA 3ZWAA 4R41A 5KX5F 1IVNA 1H5NA 2HQ1A 1OAOC 2ZJ1A 2F3SA 2P0AA 3ROFA 3TNFA 3H5VA 3LC0A 3IELA 1P3JA 1HK7A 2NO0A 3WKCA 3WQRA 2OEPA 4W5OA 4OGKA 3L7DA 4L8GA 1YONA 4KK4A 1R8SA 2CXPA 1X80B 3B7WA 3FYCA 4KJZA 1KZ1A 4X93A 3LLVA 4WA8A 4LJYA 4Y9DA 2Z2JA 3QEOA 4KDEA 2W90A 4JLJA 3SQMA 2A6PA 4IFTA 4DG8A 4YMUA 4U8GA 1A97A 5DN9A 4JEUA 5LLSA 821PA 3O1JC 2ETXA 2VF2A 5I9SA 3PFFA 1JEDA 4JBLA 4MR8A 1IXYA 1X9HA 1X1DA 4DUGA 2W6OA 4OLFA 1XLTC 3D59A 1L5NA 4OXIA 5EMNA 4ABYA 3NRJA 5HUJA 4R1LA 5HKKA 3AERB 5IKOA 2DPHA 4JT4A 4DT1B 4RDXA 2JGDA 1GGVA 2IE8A 2O9JA 3HXMA 5FR1A 3KVOA 2BUAA 4LSGA 1SCKA 4RQAA 1HE5A 1RVV1 1SXJC 2IHTA 5CFNA 1KGSA 2HSGA 2Q2VA 4X24A 2WUFA 1D8AA 3EB9A 2BGMA 1F6DA 2YOGA 4FTWA 5J3JA 2REQB 1AQUA 1XRSB 4EKEA 1V7ZA 3GH3A 4HEQA 4JT2A 1U0LA 2SCUB 3ZIAA 3OZIA 1LY1A 3I01M 4GKAA 2EJTA 1RABA 1OZGA 2ONCA 1CQXA 1E6EA 2ZIUB 3M9XA 5D5HA 5CEFA 2VWHA 1VKHA 1E5QA 1I24A 2ZRHA 2H8GA 4HFRA 1E3QA 1PU2A 2Q3FA 4HJRA 1VHJA 2R6AA 1K0UA 3FY4A 3QY9A 3UENA 4I1RA 4BP1A 2O8CB 4BVBA 2XVYA 5FBLB 4IZHA 3MBOA 3S2SA 1RRMA 4MVJM 1FMCA 4YJ3B 4P4TA 4D82A 3ZGVA 3CR7A 4C4AA 3GPLA 3UT0A 3WHLA 1PHPA 3QJGA 4KPUB 1NUSA 1A04A 4GUAA 2XMCA 3HU3A 2WD8A 4Y67A 1W5SA 2H7XA 3L4JA 3CXUA 1OLOA 3IT0A 4KXWA 2QZ9A 5K0ZA 4GPIB 4Y0NA 1Q7GA 1TL7C 1QP8A 4AAYA 3ZY3A 3KB6A 4CMCA 2ZCJA 3DE1X 4KXXA 2XSZA 4GYJA 5H16A 3LL7A 4CIVA 3GARA 5ADVA 1EDZA 1U0SY 1YE3A 2D3TA 2B78A 3O1HB 4FGKA 5CB8A 5HKAA 4AURA 1YRYE 4BLSA 3TZCA 2P4SA 2IW1A 1DJMA 4LXQA 1PZNA 4JUCA 2RK3A 4FONA 4TYPA 4ZCSA 3I1IA 3JQBC 3QPDA 3V2IA 4NE9A 5IWCA 3CPEA 4BRUA 1O3YA 1ODSA 3K9QO 2FLVA 3PPYA 3ZE6A 3LX5A 2NXJA 4Z51A 4Y2RA 1EYZA 1FFGA 3KZMA 3TMYA 3RYCB 2JGIA 2TMKA 4U7WA 1EAYA 2RCNA 4R68A 1MNQA 1SOUA 3DCJA 3LHKA 1B93A 2EQ5A 2HA6A 4FYKA 5JRJA 2F59A 1DQRA 4M0PA 2PIAA 4G0VA 1KDTA 3W90A 3AUSA 2ZIGA 3CINA 1XTZA 4RL6A 5AVQA 2CE2X 1DC8A 5KU1A 3VPDA 3C4JA 3T1TA 3V8BA 3MJTA 2OHXA 4GL4A 3R6LA 3MM4A 2XD9A 2PFGA 2XR1A 3ESAA 2P8SA 3TQHA 4IVPA 3OQOA 3GT3A 2FK8A 5AJVB 4GMFA 5D1HA 4D3DA 1EK0A 1NVFA 4B3MB 3ND6A 1RPNA 1ST3A 4LJ6A 4O6VA 1T6NA 4ER0A 2RFLA 3SZMA 2CCGA 2X1MA 5K6RA 1SKBA 4EFKA 1UOEA 5DMHA 4CTMA 1HL7A 2I4OA 4JFAA 4KMOA 1X1RA 3FCCA 3L7CA 5E1OA 5ADUS 5F7XA 1OKKA 1TK2A 3ZVKA 1ZM3A 3CF4A 2P91A 4QXQA 2JCBA 2F9MA 3WRXC 2B8JA 1PD1A 3HNOA 3I12A 5C31A 3VPSA 4G26A 5K3BA 1Z29A 4XLTA 1EWQA 2P35A 2OSBA 2WYUA 2XW6A 3ZJVA 3BE4A 4FFVA 5E7JA 3CLHA 3R7AA 4WOJA 5DRYA 3U3JA 3CF2A 4PYIA 2WWXA 4GKVA 5EJ5A 3BM5A 3TPZA 2OGTA 2XHZA 5GY7A 2F90A 2KWIA 3SXUB 1SZDA 4UMEA 2HEGA 5DNCA 1QANA 1Y7TA 4D9BA 3O6VA 3AHFA 3GFTA 4YGYA 2QM0A 3I6YA 1HA3A 3TDNA 1GTSA 2NZXA 5AXAA 1HYEA 1PWEA 1X7WA 1FYEA 1PQPA 4XA8A 2G5PA 4V39A 3V4LA 2FRXA 1HDZA 1V25A 4FYMA 2DBQA 2ZXUA 1RWVA 3AF5A 4MV9A 1M34B 1UBFA 2O7VA 3AEQA 2A3NA 3DZGA 4RW0A 5EJIA 1CYDA 1VDMA 5IYZF 1UEJA 1YS6A 1CWUA 3AV0B 4DLWA 3VVBA 1GN9A 1QE5A 4RH3A 1V7CA 3NBZC 1PTJC 4ZV4A 5C53B 4L28A 5L4SA 2O6HA 4HX2A 3THOA 4N01A 2IZZA 1NQVA 4GSKA 3WGVA 1JDPA 1V3TA 2X9GA 2YZNA 3G6KA 3IFSA 5DEIA 3RPEA 3G0CA 3CUUA 4YRPA 1DRVA 4CPDA 2D5CA 3LWBA 4BFSA 4HWPA 3FH0A 3GRVA 3KTOA 4ZDKA 2E6UX 3O2JA 1ARZA 4LF6B 2O2IA 5E7IA 4G37A 1E6MA 4UAJA 4JUAA 1AKTA 2VOJA 1XMXA 1V45E 2C2BA 1DAOA 1TM7E 1E5LA 2W4QA 3GUVA 1N1EA 2EW1A 2MR6A 3FWYA 3GLRA 3KJGA 4WZ6A 3TZKA 5BW4A 4D0NA 1QU2A 1NA5A 1N2JA 4JL8A 2AJLI 2QVGA 1PF7E 4CV3A 1NMQA 1L4KA 4R40A 1TUEA 3N2KA 3WK6A 3DBVO 3ZCUA 5EHZA 1R8YA 4X1IA 5AM5A 4BMYA 5M7EA 5K2OA 5FPPA 1M5UA 3C41J 2WWTA 3TUZC 2EW8A 2GN9A 4MCIA 1XLUA 3SMVA 4ME6A 5CFQA 2JLAA 2W6PA 1JR3D 2YBEA 3Q0IA 3VYTB 4CUJA 2ZJ0A 4EFMA 2PANA 3L0IB 4RTQA 1M83A 2I5PO 4LZLA 1N2CA 2YV4A 1UZAA 3GJZA 5BOVA 5BT8A 5LZ4A 1R6VA 2QTVB 1Y81A 5ALHA 1Y9EA 2OFWA 1JPUA 4MUJA 4B6SA 4OU4A 2PBLA 5J4HA 4U7GA 4FXOA 1J9GA 2QRZA 3JRNA 1XRRA 3ICWA 4DY4A 1VECA 1JGTA 2Y6UA 2Z57A 3RW9A 1B0UA 1F2UA 2BE9A 3I32A 4GDFA 1PBTA 4KFCA 1VGQA 1R4NB 2R66A 4KIJA 3RG8A 2JH3A 3HDQA 2IPMA 3HWSA 1KQPA 4KN5A 1ODIA 2FMIA 3FBTA 5FBKA 3UAOA 1V8ZA 3U16A 1SELA 2G4CA 1B00A 5KYUA 2ABWA 2XYVA 3R7WB 3CVWA 3OMLA 1JIUA 1SXIA 2HDHA 2ZS8A