3BK9A

H55a mutant of tryptophan 2,3-dioxygenase from xanthomonas campestris
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
277
structure length
277
Chain Sequence
b'LRDLEPGIHTDLEGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQAQTSELWLKLLAHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQQYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVMRVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan 2,3-dioxygenase
publication title Histidine 55 of tryptophan 2,3-dioxygenase is not an active site base but regulates catalysis by controlling substrate binding
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Oxidoreductase
total genus 106
structure length 277
sequence length 277
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.13.11.11: Tryptophan 2,3-dioxygenase.
pdb deposition date 2007-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03301 Trp_dioxygenase Tryptophan 2,3-dioxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.480 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3bk9A00
2V7IA 4PK6A 2D0TA 3E08A 2NWBA 2NW7A 4PW8A 5EK2A 2NW8A 2D0UA 4HKAA 2V7KA 2X66A 1YW0A 2X68A 2V7JA 5EK4A 2NOXA 2V7LA 4U72A 3BK9A 5ETWA 2NW9A 5EK3A 2X67A 1ZEEA 2V7MA 4PK5A 4U74A
chains in the Genus database with same CATH superfamily
3AE8A 1M62A 3ZMTB 5HEHA 3TLTA 5DABA 2B76A 2WCAA 4TNWA 2X9WA 5HEOA 1T7SA 5FL1A 1NENA 2CHOA 2V7JA 2V6XA 4HEAA 3RQUA 2DHRA 4WNKA 3QUJA 2XSBA 3AE7A 4H9QC 4ILAA 5JQGE 4GKKT 4B3ST 1HNXT 3Q9DA 2H3RA 2LRKA 3PURA 5AQNB 2GK9A 5HCMA 3C4XA 1T72A 3HKCE 4Z8XA 3O1JA 3RPUA 4DR6T 2QGSA 4NXNT 5LBQB 3ZCIA 1KNPA 3N9NA 4ZI7E 4YHJA 1HNZT 4AIUA 2D9DA 5LBMA 2JIWA 3E22E 5CFBA 3K3NA 3FBZA 1Z0PA 2M6BA 3OYXA 4B3TT 2Q9QA 4ZOLE 2PBIA 2VWAA 3AE5A 3RKGA 2CWYA 3RGLA 2E5VA 2XM1A 2WZIA 3H37A 3PTRB 3ZSTA 5JDQA 2BBJA 3CQCB 5LA6E 2R6GF 3DJBA 4HWFA 5C8YE 2EHOA 4ZI3C 2HN2A 3OYZA 3ESLA 4U7YA 4H9OC 4JI2T 3N9LA 2XQ8A 3MJXA 4L9IA 1OEDA 5AQTB 5JR9C 3AVSA 1HNWT 5CA0E 2A3DA 3DP7A 4WBOA 2XY8B 2WU2A 4ILBA 3OPCA 3PDYA 3UUNA 2WB5A 3A8YC 3AE2A 3L39A 3N2GE 3EI0A 3LJCA 4MLKA 3ZEFB 2HPLA 5FNVE 3OKQA 3ONJA 3ZSSA 4KMCA 4DV1T 5AQKB 3C64A 3M65A 5F8PA 4X65T 4HFBA 2FJEA 5AQFB 4A56A 1UX5A 2D5UA 2DLRA 3D0TA 2BKOA 2RP4A 5GONE 5LOVE 4QXHB 3C98B 2KNDA 5CA1E 1IBMT 2HN1A 3AEGA 2NW9A 2FJBA 3PUSA 1S35A 1SHZC 3ZN0B 3B5MA 4QH4A 5CGMA 2N2NA 4IDZA 3EABA 2K3WA 3ABVA 3ANWA 2XUEA 4ASKA 1D1BA 1MMAA 2MYSA 3IF8B 3C4WA 4OK0A 1FMVA 3OJAA 2JRKA 2UXXB 2CBIA 3U78A 5F3JA 4C90A 3CVRA 4EGWA 4U33A 3FZFB 2BG9C 3JAEA 5JH7E 1ZEEA 3MZKB 3ANWB 2LSJA 2HHHT 2XQYA 3AXJA 2V1DB 3KBUA 3VKHA 3LSVA 2XM2A 2KWHA 4O4IE 3KV6A 4PFPA 2XQ6A 3RI5A 3FBLA 3P4SA 4UV8B 3UT5E 1L0VA 2UXDT 2KSRA 4NIQA 5F5WA 5FKYA 4PK6A 1LKXA 4Z91A 2BG9E 3KV9A 2UUBT 5LGTB 4V1Av 2FUPA 4YJ3E 4ANJA 5C2TA 4DO0A 3BK9A 1IJ5A 3AXJB 4O4JE 3FHNA 5KXJA 2W4XA 3B57A 4YLHA 5FY0A 4DV6T 4L0RA 1W0BA 4LMLA 4ILUA 1UCUA 5HXRA 1UGOA 4GK5E 3L3PA 4B3RT 3V5UA 5C3JA 3L8RA 2K24A 5AQRB 3I1AA 4PW8A 4DV4T 2LHNA 1Y64B 1LVFA 5L3EB 3PE0A 2CLYB 3EVYA 4IDNA 4A98A 3AEDA 2Z6EA 1CUNA 3LK2B 4TN7B 2XJ7A 3P4PA 5FXZA 1G73A 3AA7B 4AQFA 1VCSA 3WAKA 4O2BE 3RYIE 1QSDA 3C50A 5EZYE 4I0UA 4DUYT 4XAXB 3KINB 3B13A 4PK5A 1YQ4A 4K0KT 4E7SA 2OA5A 2YU1A 4EOZB 4FI5A 5JRCB 1VOMA 3ZC0A 5HWXA 4DUZT 4QXBB 1XMQT 4HFDA 1ZV4X 1W9RA 2BBHA 1YKHB 5TAOA 2LSGA 5L3GB 2WQYA 2QRXA 4DVDA 1ZP0A 2LOSA 3PUQA 3HKBE 3AEFA 4HKAA 3TLUA 4JYAT 3NBXX 2WAUA 2NP9A 1WLXA 3SRZA 5LJMA 4LMKA 3VR8A 4YXDA 3VRAA 4DNDA 5JTGA 3J7Yq 1KNZA 1LRZA 2WU5A 2H7VC 4X5TA 2JMHA 1JNZA 2V8SV 4ZS2A 4EAHA 2PG8A 5JDMA 2V7KA 4DR5T 1D1CA 1MMGA 1E2AA 4IHJE 2JMKA 1WRDA 4HGAA 1SE7A 4WYVA 1KNRA 3N9MA 2AXDS 2NWBA 4HWIB 2E9XA 4IGUA 4LF9T 2CM0A 2CE7A 1T98A 2IHR1 2QA7A 1IBKT 2CHNA 2I0MA 3CMLA 1OWAA 1NAFA 5JDHA 4ZHQE 3QNUA 5HYAA 3T8OA 3CWZB 2IIUA 3FXDB 2AE9A 3ONLC 4HWCA 5KMGP 2X0HA 1KF6A 3O9XA 2W00A 4MFRA 2BDEA 1IBLT 5L4EA 4JLEA 4IDQA 4EB6E 4GKJT 3AE1A 2XAJB 4LF4T 4HFEA 3TLVA 1MNEA 3ZC1A 3CPZA 4IL4A 4DR2T 5AQLB 3VRBA 4ZS3A 4LFCT 1YQ3A 1MMDA 4O8SA 4IE4A 2W66A 2CCQA 4X1KE 1WFDA 4TV9E 3NVOA 4YSZA 3JADA 1S94A 4JI5T 4AI6A 5L47A 4UVBB 5AQIB 5ABHA 5E0OA 3ETUA 5KX5E 2Q9QC 3O4XE 4YJ2E 4CXYA 4PJNA 5AQHB 2W0GA 2A9UA 2OV9A 2KXPB 4EZHA 3LK42 3I0OA 3A7MA 1D0ZA 2IMLA 2VASA 5HEUA 4LF6T 2XAQB 2EHOC 2CXLA 2JQQA 4KP3C 3RX6A 1OEDC 2DWGA 5AQVB 3ZKRA 3CX8B 3JC6C 4H9NC 3PUAA 4PAGA 4ZI3D 2XSAA 4Z90A 2X67A 3UU5A 4CI1B 2WDQA 2VQFT 3N5LA 3OVUA 3ZJ2A 4DR3T 4O2AE 3CKDA 3RF1A 3FZLB 1OXZA 2YK0A 2UXNB 4HFIA 2VL0A 2E8IA 4YTMA 1X79A 2WS3A 2KMFA 1OEDE 3OBVE 3IA3A 3CQGB 3CX6B 1E1HB 4YSYA 2MOZA 2JJ9A 3VR9A 2C5IT 4E7ZA 2ZM6T 4I55E 1I6ZA 4KHZF 3AAEB 2UXCT 4UVAB 4IL9A 2KLQA 5LB7B 5LHHB 3ZYMA 3AA6B 3NZQA 3AA0B 2DL1A 2XASB 4YT0A 2JPFA 2I6HA 2BVMA 4LF7T 2QVAA 2ZM8A 2LSYA 3SWHA 1NWMX 3M3ZB 2J62A 3N9QA 4PNIA 4GYRA 2V7IA 3N9PA 2IAKA 3NRYA 4LFBT 5ABEA 2CMRA 3Q5XA 5LGNB 4NXMT 4AKGA 5FYMA 1U4QA 1IZNB 1BR0A 2LRLA 2VKDA 5JDLA 2IW5B 4CI3B 5DQVA 4KUMB 3ZMZB 1WYBA 1VCTA 3RQWA 1NEKA 2H7OA 4UV9B 1IAPA 1WYCA 3AB3B 3PU3A 2XHEB 2J1DG 4TWDA 1LVKA 2MAWA 2I59A 3ZPOA 4F6RC 4H9RC 3AAIA 1J5WA 3RKOA 4JI3T 2CXDA 5JR9A 4IE6A 2NOXA 3AEEA 3I9WA 2BKPA 4DV3T 2LOPA 4F8HA 2J47A 5IYZE 1ZKEA 2NW7A 1E7PA 3JAFA 3I0QA 2W62A 4HTEA 4HFHA 2ZMAA 3QB5A 1HS7A 3KDSE 1SUMB 5J1GA 3QC9A 2VURA 5JR9B 5LMNT 5ABFB 5HXCA 3RYFE 2NR4A 2OLTA 2CRBA 3LK3B 1XZYA 2RA1A 5HXEA 1ZOYA 3N9OA 3BQKA 3FXEB 2W2UA 1U5PA 2VQET 4BJNA 4DR1T 3SS1A 3AE9A 1N32T 4OX9T 2DWKA 4B3MT 4YY3T 3VKGA 5HWYA 3NKZA 4JI0T 3C4ZA 4N78D 2BZBA 2V7LA 3CX7B 1WR0A 3AE3A 3BQLA 4AQFC 4ZI2C 2H88A 1B7TA 3LFMA 2XAFB 4DR7T 4IREA 2B1EA 4U2YA 2D0UA 4X64T 3ZMUB 5CJ5A 4DMWA 1SA0E 3AECA 3TKLB 2BS3A 5FMNA 3WAJA 3LG7A 4C91A 2LHRA 3ZLIA 3F2EA 3P8CD 3V5SA 1BR4A 5KDMC 3T1HT 3QOFA 3UUMA 1D1AA 3KV4A 2SPCA 4X62T 2VVSA 4IE0A 3P4WA 2BVLA 3JCFA 3RYCE 3RH3A 5HEGA 2LSKA 5JRCA 5LXTE 5J2TE 2XAGB 3CK6A 2X9HA 5DJQC 4LF8T 1WCRA 1HG5A 1VRBA 1J5ET 2LLYA 3PUWF 4YSXA 2WZHA 2LM2A 4CZZB 4OFZA 4NPPA 2BG9B 1XMOT 4EYYR 2V5CA 3FZKB 3TLWA 4JBWF 2A2FX 2W67A 3LBXA 3RIFA 5A1LA 2YEVC 5EK4A 4TV8E 4EXTA 2ZM2A 2VK9A 2CBJA 4AKIA 2G0UA 2LKGA 2E9XC 2WBLA 4UF0A 5ABGA 2PTFA 3C51A 1Y01A 3UU6A 1DU2A 3QB5K 5AQMB 2ODUA 3H3AA 5AQPB 1FMWA 5FXXA 2YN6A 4JEHB 2DNXA 5HAXA 3T1YT 2K5BB 3LBXB 5HCJA 2KT9A 4TZ4C 1HG2A 1HTJF 4UXNB 4DIDB 3CIRA 5FY7A 2LT3A 3O1IA 2XTLA 2WWUA 4UF0B 2CPTA 4ILCA 2XQ7A 3RRCA 3KBTA 4IE7A 2L3LA 4LFAT 2ES0A 5LCYA 2VKHA 4COFA 3ETVA 2DI4A 4EIWA 4TNVA 2E2AA 3ZJ1A 3PUZF 4YTNA 2BS2A 4EV6A 3AAAB 1HX8A 2V6YA 3K1SA 3PV0F 3OTOT 4IE5A 3R84B 4B6XA 2X66A 3U3IA 3PUVF 3MA9A 1FIOA 1UK5A 2LKHA 1MNDA 5EK3A 3P50A 3UUXB 4MBQA 2VKOA 4CI2B 3RRWA 2Q9QD 4ADZA 3RLFF 5LP6E 3SOLA 1YKEB 4EYUA 2VB6A 2WMOA 1XDOA 2V6YB 3A5XA 2HPJA 2LSIA 3N2KE 4P0AA 1HCIA 3UFGA 2LJLA 4MALA 1Z8UA 3H3MA 2WP9A 2CEAA 5L4HA 5EK2A 4KI0F 3MK7C 2EHOD 3KVBA 2KZ7B 4UR9A 3UTKA 4CXXA 4XZCA 2YINA 3EDUA 4HFVA 3MKDA 3Q5WA 3UU4A 5AQGB 5LG4A 1IJ6A 5FXWA 2XPKA 3P4RA 4P09A 3JC6D 2P9BA 5AQJB 3RIUA 3UUBA 4IDOA 1D0XA 2JQHA 2XQ5A 4JV5T 3CQXC 3TLSA 3UQ4A 2Y8DA 4H9PC 4OYJA 4CXWA 2N1GA 2UUCT 4AXPA 4AQYT 1HF8A 3FB2A 3FZHB 4PJJA 3PJAA 2MBGA 1KK7A 4QH5A 5L3DB 2NTXA 2XAHB 1XNRT 4EEBA 2FJAA 4A97A 3NZPA 1XNQT 5BR8T 3UQ7A 4GK0E 2BKNA 3GA8A 2LM9A 1BR1A 4HWHA 4WBNE 2WM9A 2YKSA 3ZN1B 4U72A 4DMVA 2X0LB 5HXHA 2YOEA 4H9SE 4YTPA 2XQ9A 5JDGA 4GIWA 3VHLA 4BJMA 4J2CA 4JI4T 2ZM0A 3UULA 2F4VT 3E0ZA 2X9XA 2C0SA 3K3QC 3HA4A 5ADXL 4O4LE 2ODVA 2PJQA 3E08A 3F31A 3K8PC 3P7IA 2UXBT 2UUAT 4CN6A 4GYSA 3GWHA 2WY2A 4TWFA 4H63H 2A72A 3UU3A 2YDSA 3IBPA 3KFWX 2Y48B 2HH7A 4U3CA 5HXSA 4YHHT 4BA9A 2Q9QB 3GN5A 1FJGT 3AA1B 2NW8A 2YU2A 3NWIA 4G2AA 3LDQB 1MMNA 3ZT6A 2QYWA 2FBWA 4HFCA 3HI2A 4QWNB 3ZYLA 4AISA 2VVNA 1KFYA 2EHOB 2Y6XA 4X66T 3ZMSB 1HFAA 4OYKA 4UIGA 4U31A 1OEDB 3GN5B 4HE8A 3MACA 3PUGA 4AQGA 5L3CB 2X51A 2ACZA 3Q5DA 3AEBA 2UU9T 2E5LT 3PJAJ 1N36T 4YFSA 4X1YE 1G8XA 3HL6A 1AJ3A 2WSSV 5M4YA 3SFEA 1MIVA 2W61A 1XDPA 5ABFA 5LG3A 2X9YA 4KHPT 4DBQA 4ISTA 4QH1A 5FVLA 2WDVA 4DV7T 4TX5A 2CLYC 4AKHA 3HKDE 4QHOA 4AKLA 2L9QA 3Q2MA 5LHGB 2V7MA 1US7B 2PFVA 4IDPA 1CHUA 2K9AA 4ZI2D 2XQAA 4PJLA 1KEYA 2CA5A 3RC3A 4TUYE 2LE8A 3VU7H 4QX7B 5LHIB 5FXVA 5IHYA 2K48A 5H6RB 2C5JA 2ACXA 3ZMVB 3KVAA 3PU8A 2WMNA 1HR0T 2RPAA 4JUYA 5IWAT 4WW0A 1M7KA 4IT4A 3G06A 5AQQB 3EUHA 2VL8A 2YDQA 2J4GA 1BR2A 4JI1T 4FJOA 3RHWA 5FP3A 3GMIA 3DTOA 2XQ4A 4K0UA 4I43B 4ZZBA 5L3FB 1H7CA 2D0TA 1X9BA 3AEAA 1N33T 1QUUA 2BS4A 5FY1A 5AQUB 4XBFB 4JI6T 2FJDA 2N9DA 5IUXA 1V9DA 4PK4A 4AKRB 3O1HA 1T8BA 2H89A 4DV0T 3ZYKA 1J1JA 4QKNA 2JQKA 4ERRA 2BG9A 4ZZCA 1UUSA 4LMJA 3PUYF 4HWDA 5LGUB 1GQEA 4UELA 4U2ZA 3ZCJA 3NRXA 4CN1A 1R8IA 5DQWA 3W15B 4PFOA 5JDFA 5JREA 4KX6A 1QLBA 1D0YA 4X20E 2E9XD 2LEHA 1W09A 4KBMB 1O3XA 4JEUB 5LYJE 3EHZA 2CXFA 1UURA 4BAYB 2V26A 4GOUA 3J9X1 4I50E 3K3OA 5FL0A 2JQ9A 4CQIA 2X68A 2DCFA 4HN9A 1WR6A 1HX1B 4QX8B 5JDNA 3P4QA 4DR4T 4DBRA 3AE4A 4H63V 3ZT5A 3BQIA 4EEDA 1W0AA 2NTYA 2W63A 4L5GA 3MXZA 2WWVA 1ZHCA 4O4HE 4CN4A 4P1NA 2M67A 5LJNA 4OHFA 3X1DA 4A5XA 2IC9A 4PJMA 5AQOB 2X0YA 2MPKA 5ETWA 2VKJA 2KINB 4ISSA 5BMVE 5LMUT 1MIWA 3AVRA 3UU8A 5CB4E 4EZ4A 1UX4A 4M1PA 4WZXA 5JVDE 1I94T 3WI3A 1JNRA 4X1IE 3F57A 2XZEA 4ZXLA 3HKEE 2YDRA 3EAMA 3ONXA 3RYHE 2D2SA 3Q5EA 1YW0A 2IC6A 4JI7T 2IDOB 1XWMA 4Q25A 5L3BB 2C5KT 2MTQA 1FEWA 3KV5A 4DV5T 3IEEA 3FZMB 4P0BA 4MHCA 3HR0A 4QXCB 5H6QB 5AQSB 4I4TE 4G63A 3S4UA 4DV2T 2V5DA 1EZ3A 3RIUC 5HEJA 1YD8G 4ZEYA 5FVKA 3AE6A 3RC8A 3L09A 4LF5T 3PUXF 2CWOA 4UVCB 3N2OA 5J2UE 3UFEA 5LNKA 3ZT7A 4NUUA 2L8KA 5AFUL 2E9XB 4U74A 2IUBA 5J0ZA 1N34T 2WDRA 2ZLYA 1MIYA 1YXRA 3IHRA 2M6IA 3RIAA 4UEMA 3SFDA 3QK6A 4TWHA 4U7IA 2KWIB 4IIJE 3EDVA 5L2LA 4NUVA 4JI8T 3R6NA 2XQ3A 3I9YA
chains in the Genus database with same CATH topology
3ZMTB 3AA1B 2LOSA 3PUQA 5DABA 2NW8A 2YU2A 3HKBE 4G2AA 2X9WA 4HKAA 1MMNA 2DWKA 3NBXX 2WAUA 3VKGA 2NP9A 1WLXA 5HWYA 2V7JA 3C4ZA 4N78D 3SRZA 2BZBA 3HI2A 2V7LA 5LJMA 3CX7B 4QWNB 3ZYLA 4HEAA 3BQLA 4AQFC 4ZI2C 2DHRA 4WNKA 2EHOB 4DNDA 1B7TA 3J7Yq 3LFMA 1KNZA 2XAFB 3QUJA 1LRZA 2Y6XA 2H7VC 4H9QC 5JQGE 2JMHA 4ZS2A 2B1EA 3ZMSB 2D0UA 4EAHA 2PG8A 3ZMUB 3Q9DA 5JDMA 2V7KA 2H3RA 1HFAA 4OYKA 4UIGA 3PURA 1D1CA 4DMWA 1MMGA 1SA0E 3GN5B 3TKLB 2GK9A 4IHJE 4HE8A 2JMKA 3C4XA 1WRDA 3MACA 3PUGA 3HKCE 5FMNA 4AQGA 3WAJA 4Z8XA 4HGAA 3LG7A 3O1JA 4C91A 5L3CB 3RPUA 2LHRA 3ZLIA 2QGSA 2X51A 3N9MA 3F2EA 5LBQB 3P8CD 3V5SA 3ZCIA 1BR4A 2NWBA 5KDMC 4YFSA 3UUMA 1D1AA 4X1YE 2E9XA 1G8XA 3KV4A 4IGUA 3HL6A 2SPCA 1AJ3A 3N9NA 2CM0A 2CE7A 4IE0A 1T98A 2QA7A 2WSSV 4ZI7E 2BVLA 4YHJA 5M4YA 3RYCE 3RH3A 1MIVA 5LBMA 2W61A 2LSKA 3CMLA 5JRCA 1OWAA 2X9YA 3E22E 5LXTE 1NAFA 3K3NA 3FBZA 5J2TE 4DBQA 5JDHA 1Z0PA 2XAGB 3OYXA 2X9HA 5DJQC 4ZHQE 1HG5A 5HYAA 3T8OA 1VRBA 3CWZB 4ISTA 2Q9QA 4ZOLE 2PBIA 2VWAA 2CWYA 4TX5A 3FXDB 2CLYC 4AKHA 4CZZB 3H37A 3HKDE 4QHOA 4AKLA 2L9QA 4OFZA 5KMGP 3O9XA 3Q2MA 5LHGB 3PTRB 2W00A 4MFRA 2BDEA 2V7MA 5JDQA 2PFVA 1US7B 4EYYR 2K9AA 4JLEA 3CQCB 4EB6E 5LA6E 2XAJB 4ZI2D 4PJLA 3DJBA 2A2FX 2CA5A 3RC3A 4TUYE 3LBXA 5C8YE 2LE8A 2EHOA 4ZI3C 3VU7H 1MNEA 4QX7B 5A1LA 3ZC1A 3OYZA 3ESLA 2YEVC 4H9OC 5EK4A 3N9LA 4TV8E 4EXTA 3CPZA 2ZM2A 5LHIB 2VK9A 5FXVA 5IHYA 2K48A 4ZS3A 3MJXA 4L9IA 2G0UA 4AKIA 5H6RB 1MMDA 4O8SA 2C5JA 2ACXA 2E9XC 3ZMVB 4IE4A 2WBLA 4UF0A 3KVAA 3PU8A 5JR9C 2WMNA 3AVSA 5CA0E 2A3DA 3C51A 4JUYA 2CCQA 4X1KE 4WW0A 3DP7A 2ODUA 3H3AA 4TV9E 4WBOA 1FMWA 1S94A 4AI6A 5FXXA 3EUHA 4UVBB 2VL8A 1BR2A 4JEHB 2DNXA 5HAXA 5E0OA 4FJOA 3ETUA 5KX5E 5FP3A 2K5BB 3DTOA 3GMIA 3LBXB 3UUNA 3PDYA 2Q9QC 4K0UA 4I43B 3O4XE 4YJ2E 5L3FB 4CXYA 1H7CA 2D0TA 2KT9A 4PJNA 2W0GA 4TZ4C 1HG2A 3N2GE 1QUUA 3LJCA 2KXPB 5FY1A 4MLKA 1HTJF 4UXNB 3ZEFB 4EZHA 4XBFB 3LK42 3I0OA 5FY7A 2LT3A 2HPLA 5FNVE 3OKQA 2N9DA 1D0ZA 2XTLA 3O1IA 2WWUA 1V9DA 4PK4A 4AKRB 3O1HA 4KMCA 4UF0B 2VASA 3RRCA 2XAQB 3C64A 3M65A 3KBTA 2EHOC 4IE7A 2CXLA 5F8PA 3ZYKA 2JQQA 2L3LA 4QKNA 4ERRA 4A56A 1UX5A 2ES0A 5LCYA 2VKHA 2D5UA 2DLRA 3D0TA 4KP3C 3ETVA 2DI4A 4EIWA 3RX6A 2RP4A 5LGUB 5GONE 3ZJ1A 2DWGA 5LOVE 4QXHB 3C98B 2KNDA 4UELA 5CA1E 3CX8B 3JC6C 4H9NC 3PUAA 4PAGA 4ZI3D 2NW9A 3ZCJA 3NRXA 5DQWA 2X67A 3PUSA 1S35A 4CI1B 3W15B 1SHZC 4PFOA 3ZN0B 3AAAB 3N5LA 3ZJ2A 5JDFA 5JREA 1HX8A 4O2AE 2N2NA 4IDZA 1D0YA 3CKDA 4IE5A 4X20E 2E9XD 3R84B 1OXZA 2LEHA 3ANWA 2XUEA 4B6XA 2YK0A 2X66A 4ASKA 2UXNB 1D1BA 3U3IA 4KBMB 1O3XA 1MMAA 4JEUB 2MYSA 3MA9A 1FIOA 2E8IA 3IF8B 1X79A 1MNDA 5LYJE 5EK3A 2CXFA 2KMFA 3C4WA 4OK0A 3UUXB 4BAYB 3OBVE 1FMVA 2V26A 3OJAA 4GOUA 2JRKA 3CQGB 3CX6B 2UXXB 4MBQA 3J9X1 1E1HB 2VKOA 2MOZA 4I50E 3U78A 2JJ9A 3RRWA 4CI2B 5F3JA 3K3OA 2C5IT 4E7ZA 4I55E 4C90A 3CVRA 2Q9QD 4ADZA 3AAEB 4UVAB 4CQIA 2KLQA 5LP6E 2X68A 2DCFA 4HN9A 3SOLA 1YKEB 5LHHB 4EYUA 1WR6A 2VB6A 2WMOA 3A5XA 4QX8B 2HPJA 2LSIA 3N2KE 5JDNA 4P0AA 1HCIA 3ZYMA 5JH7E 1ZEEA 3MZKB 4DBRA 3AA6B 3NZQA 2LJLA 3ANWB 2LSJA 4H63V 4MALA 3BQIA 3AA0B 2NTYA 2W63A 4L5GA 2CEAA 3MXZA 2XQYA 2XASB 1ZHCA 2V1DB 3KBUA 3VKHA 5EK2A 3MK7C 4O4HE 5LJNA 2EHOD 2M67A 2KWHA 2JPFA 4O4IE 4OHFA 3KV6A 3KVBA 4PFPA 2BVMA 2KZ7B 3UTKA 4CXXA 4XZCA 2IC9A 4PJMA 2YINA 2ZM8A 3FBLA 2LSYA 3EDUA 4HFVA 4UV8B 3SWHA 3UT5E 1NWMX 3MKDA 3Q5WA 5ETWA 2VKJA 2KINB 5LG4A 1IJ6A 3N9QA 4PNIA 5FXWA 4P09A 4ISSA 4GYRA 5BMVE 1MIWA 2V7IA 3AVRA 1LKXA 3JC6D 4PK6A 3N9PA 5CB4E 2P9BA 2IAKA 3NRYA 3KV9A 5LGTB 4V1Av 4YJ3E 4ANJA 1D0XA 3CQXC 4EZ4A 4DO0A 1UX4A 2CMRA 4M1PA 3Q5XA 5JVDE 5LGNB 3BK9A 1IJ5A 2Y8DA 4AKGA 4H9PC 4OYJA 5FYMA 1U4QA 4CXWA 3WI3A 2N1GA 4O4JE 4X1IE 1IZNB 3F57A 3FHNA 1BR0A 2VKDA 4AXPA 5JDLA 1HF8A 3FB2A 3HKEE 2IW5B 4CI3B 3B57A 5DQVA 4KUMB 4PJJA 3ONXA 3ZMZB 2MBGA 1KK7A 1WYBA 4YLHA 3RYHE 5FY0A 2D2SA 5L3DB 4L0RA 1YW0A 2IC6A 2NTXA 2XAHB 5L3BB 2H7OA 4UV9B 4ILUA 1IAPA 1WYCA 1UCUA 2C5KT 2MTQA 3AB3B 5HXRA 4GK5E 1FEWA 3L3PA 3PU3A 2XHEB 2J1DG 3KV5A 3NZPA 3V5UA 1LVKA 2K24A 4GK0E 3I1AA 4PW8A 2I59A 3GA8A 3ZPOA 2LHNA 3IEEA 1Y64B 1LVFA 4F6RC 4P0BA 4H9RC 3AAIA 2LM9A 4MHCA 3HR0A 4QXCB 3RKOA 5L3EB 1BR1A 5H6QB 4I4TE 4G63A 2CXDA 3PE0A 2CLYB 5JR9A 4IE6A 3S4UA 2WM9A 4WBNE 3EVYA 2NOXA 3I9WA 3ZN1B 4U72A 1EZ3A 2Z6EA 1CUNA 3LK2B 4DMVA 4TN7B 2X0LB 5HXHA 1YD8G 5FXZA 1G73A 2LOPA 3AA7B 4H9SE 5IYZE 1ZKEA 2NW7A 4AQFA 3WAKA 4O2BE 5JDGA 4GIWA 3RYIE 1QSDA 3RC8A 3L09A 3I0QA 3VHLA 3C50A 2W62A 4HTEA 2CWOA 5EZYE 4BJMA 4J2CA 4UVCB 3N2OA 5J2UE 3UFEA 2ZMAA 4XAXB 5LNKA 2ZM0A 1HS7A 3UULA 4NUUA 3E0ZA 3KINB 2X9XA 2L8KA 3B13A 3KDSE 5AFUL 2C0SA 2E9XB 3K3QC 3HA4A 4PK5A 4U74A 5ADXL 4O4LE 5J1GA 2ODVA 2PJQA 3QC9A 3E08A 5JR9B 3F31A 2ZLYA 4E7SA 1MIYA 3K8PC 3P7IA 2OA5A 2YU1A 4EOZB 3IHRA 4UEMA 4FI5A 5HXCA 3RYFE 5JRCB 3QK6A 3GWHA 1VOMA 4GYSA 3ZC0A 4H63H 5HWXA 2KWIB 3LK3B 2A72A 4IIJE 4QXBB 3EDVA 2RA1A 4NUVA 5HXEA 5L2LA 3IBPA 3N9OA 3BQKA 3FXEB 3KFWX 1ZV4X 2Y48B 2HH7A 5TAOA 1YKHB 5HXSA 2LSGA 5L3GB 1U5PA 4BJNA 4BA9A 2Q9QB 4DVDA 3R6NA 3SS1A 3GN5A 3I9YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V7I A;  4PK6 A;  2D0T A;  3E08 A;  2NWB A;  2NW7 A;  4PW8 A;  5EK2 A;  2NW8 A;  2D0U A;  4HKA A;  2V7K A;  2X66 A;  1YW0 A;  2X68 A;  2V7J A;  5EK4 A;  2NOX A;  2V7L A;  4U72 A;  3BK9 A;  5ETW A;  2NW9 A;  5EK3 A;  2X67 A;  1ZEE A;  2V7M A;  4PK5 A;  4U74 A; 
#chains in the Genus database with same CATH topology
 3AE8 A;  1M62 A;  3ZMT B;  5HEH A;  3TLT A;  5DAB A;  2B76 A;  2WCA A;  4TNW A;  2X9W A;  5HEO A;  1T7S A;  5FL1 A;  1NEN A;  2CHO A;  2V7J A;  2V6X A;  4HEA A;  3RQU A;  2DHR A;  4WNK A;  3QUJ A;  2XSB A;  3AE7 A;  4H9Q C;  4ILA A;  5JQG E;  4GKK T;  4B3S T;  1HNX T;  3Q9D A;  2H3R A;  2LRK A;  3PUR A;  5AQN B;  2GK9 A;  5HCM A;  3C4X A;  1T72 A;  3HKC E;  4Z8X A;  3O1J A;  3RPU A;  4DR6 T;  2QGS A;  4NXN T;  5LBQ B;  3ZCI A;  1KNP A;  3N9N A;  4ZI7 E;  4YHJ A;  1HNZ T;  4AIU A;  2D9D A;  5LBM A;  2JIW A;  3E22 E;  5CFB A;  3K3N A;  3FBZ A;  1Z0P A;  2M6B A;  3OYX A;  4B3T T;  2Q9Q A;  4ZOL E;  2PBI A;  2VWA A;  3AE5 A;  3RKG A;  2CWY A;  3RGL A;  2E5V A;  2XM1 A;  2WZI A;  3H37 A;  3PTR B;  3ZST A;  5JDQ A;  2BBJ A;  3CQC B;  5LA6 E;  2R6G F;  3DJB A;  4HWF A;  5C8Y E;  2EHO A;  4ZI3 C;  2HN2 A;  3OYZ A;  3ESL A;  4U7Y A;  4H9O C;  4JI2 T;  3N9L A;  2XQ8 A;  3MJX A;  4L9I A;  1OED A;  5AQT B;  5JR9 C;  3AVS A;  1HNW T;  5CA0 E;  2A3D A;  3DP7 A;  4WBO A;  2XY8 B;  2WU2 A;  4ILB A;  3OPC A;  3PDY A;  3UUN A;  2WB5 A;  3A8Y C;  3AE2 A;  3L39 A;  3N2G E;  3EI0 A;  3LJC A;  4MLK A;  3ZEF B;  2HPL A;  5FNV E;  3OKQ A;  3ONJ A;  3ZSS A;  4KMC A;  4DV1 T;  5AQK B;  3C64 A;  3M65 A;  5F8P A;  4X65 T;  4HFB A;  2FJE A;  5AQF B;  4A56 A;  1UX5 A;  2D5U A;  2DLR A;  3D0T A;  2BKO A;  2RP4 A;  5GON E;  5LOV E;  4QXH B;  3C98 B;  2KND A;  5CA1 E;  1IBM T;  2HN1 A;  3AEG A;  2NW9 A;  2FJB A;  3PUS A;  1S35 A;  1SHZ C;  3ZN0 B;  3B5M A;  4QH4 A;  5CGM A;  2N2N A;  4IDZ A;  3EAB A;  2K3W A;  3ABV A;  3ANW A;  2XUE A;  4ASK A;  1D1B A;  1MMA A;  2MYS A;  3IF8 B;  3C4W A;  4OK0 A;  1FMV A;  3OJA A;  2JRK A;  2UXX B;  2CBI A;  3U78 A;  5F3J A;  4C90 A;  3CVR A;  4EGW A;  4U33 A;  3FZF B;  2BG9 C;  3JAE A;  5JH7 E;  1ZEE A;  3MZK B;  3ANW B;  2LSJ A;  2HHH T;  2XQY A;  3AXJ A;  2V1D B;  3KBU A;  3VKH A;  3LSV A;  2XM2 A;  2KWH A;  4O4I E;  3KV6 A;  4PFP A;  2XQ6 A;  3RI5 A;  3FBL A;  3P4S A;  4UV8 B;  3UT5 E;  1L0V A;  2UXD T;  2KSR A;  4NIQ A;  5F5W A;  5FKY A;  4PK6 A;  1LKX A;  4Z91 A;  2BG9 E;  3KV9 A;  2UUB T;  5LGT B;  4V1A v;  2FUP A;  4YJ3 E;  4ANJ A;  5C2T A;  4DO0 A;  3BK9 A;  1IJ5 A;  3AXJ B;  4O4J E;  3FHN A;  5KXJ A;  2W4X A;  3B57 A;  4YLH A;  5FY0 A;  4DV6 T;  4L0R A;  1W0B A;  4LML A;  4ILU A;  1UCU A;  5HXR A;  1UGO A;  4GK5 E;  3L3P A;  4B3R T;  3V5U A;  5C3J A;  3L8R A;  2K24 A;  5AQR B;  3I1A A;  4PW8 A;  4DV4 T;  2LHN A;  1Y64 B;  1LVF A;  5L3E B;  3PE0 A;  2CLY B;  3EVY A;  4IDN A;  4A98 A;  3AED A;  2Z6E A;  1CUN A;  3LK2 B;  4TN7 B;  2XJ7 A;  3P4P A;  5FXZ A;  1G73 A;  3AA7 B;  4AQF A;  1VCS A;  3WAK A;  4O2B E;  3RYI E;  1QSD A;  3C50 A;  5EZY E;  4I0U A;  4DUY T;  4XAX B;  3KIN B;  3B13 A;  4PK5 A;  1YQ4 A;  4K0K T;  4E7S A;  2OA5 A;  2YU1 A;  4EOZ B;  4FI5 A;  5JRC B;  1VOM A;  3ZC0 A;  5HWX A;  4DUZ T;  4QXB B;  1XMQ T;  4HFD A;  1ZV4 X;  1W9R A;  2BBH A;  1YKH B;  5TAO A;  2LSG A;  5L3G B;  2WQY A;  2QRX A;  4DVD A;  1ZP0 A;  2LOS A;  3PUQ A;  3HKB E;  3AEF A;  4HKA A;  3TLU A;  4JYA T;  3NBX X;  2WAU A;  2NP9 A;  1WLX A;  3SRZ A;  5LJM A;  4LMK A;  3VR8 A;  4YXD A;  3VRA A;  4DND A;  5JTG A;  3J7Y q;  1KNZ A;  1LRZ A;  2WU5 A;  2H7V C;  4X5T A;  2JMH A;  1JNZ A;  2V8S V;  4ZS2 A;  4EAH A;  2PG8 A;  5JDM A;  2V7K A;  4DR5 T;  1D1C A;  1MMG A;  1E2A A;  4IHJ E;  2JMK A;  1WRD A;  4HGA A;  1SE7 A;  4WYV A;  1KNR A;  3N9M A;  2AXD S;  2NWB A;  4HWI B;  2E9X A;  4IGU A;  4LF9 T;  2CM0 A;  2CE7 A;  1T98 A;  2IHR 1;  2QA7 A;  1IBK T;  2CHN A;  2I0M A;  3CML A;  1OWA A;  1NAF A;  5JDH A;  4ZHQ E;  3QNU A;  5HYA A;  3T8O A;  3CWZ B;  2IIU A;  3FXD B;  2AE9 A;  3ONL C;  4HWC A;  5KMG P;  2X0H A;  1KF6 A;  3O9X A;  2W00 A;  4MFR A;  2BDE A;  1IBL T;  5L4E A;  4JLE A;  4IDQ A;  4EB6 E;  4GKJ T;  3AE1 A;  2XAJ B;  4LF4 T;  4HFE A;  3TLV A;  1MNE A;  3ZC1 A;  3CPZ A;  4IL4 A;  4DR2 T;  5AQL B;  3VRB A;  4ZS3 A;  4LFC T;  1YQ3 A;  1MMD A;  4O8S A;  4IE4 A;  2W66 A;  2CCQ A;  4X1K E;  1WFD A;  4TV9 E;  3NVO A;  4YSZ A;  3JAD A;  1S94 A;  4JI5 T;  4AI6 A;  5L47 A;  4UVB B;  5AQI B;  5ABH A;  5E0O A;  3ETU A;  5KX5 E;  2Q9Q C;  3O4X E;  4YJ2 E;  4CXY A;  4PJN A;  5AQH B;  2W0G A;  2A9U A;  2OV9 A;  2KXP B;  4EZH A;  3LK4 2;  3I0O A;  3A7M A;  1D0Z A;  2IML A;  2VAS A;  5HEU A;  4LF6 T;  2XAQ B;  2EHO C;  2CXL A;  2JQQ A;  4KP3 C;  3RX6 A;  1OED C;  2DWG A;  5AQV B;  3ZKR A;  3CX8 B;  3JC6 C;  4H9N C;  3PUA A;  4PAG A;  4ZI3 D;  2XSA A;  4Z90 A;  2X67 A;  3UU5 A;  4CI1 B;  2WDQ A;  2VQF T;  3N5L A;  3OVU A;  3ZJ2 A;  4DR3 T;  4O2A E;  3CKD A;  3RF1 A;  3FZL B;  1OXZ A;  2YK0 A;  2UXN B;  4HFI A;  2VL0 A;  2E8I A;  4YTM A;  1X79 A;  2WS3 A;  2KMF A;  1OED E;  3OBV E;  3IA3 A;  3CQG B;  3CX6 B;  1E1H B;  4YSY A;  2MOZ A;  2JJ9 A;  3VR9 A;  2C5I T;  4E7Z A;  2ZM6 T;  4I55 E;  1I6Z A;  4KHZ F;  3AAE B;  2UXC T;  4UVA B;  4IL9 A;  2KLQ A;  5LB7 B;  5LHH B;  3ZYM A;  3AA6 B;  3NZQ A;  3AA0 B;  2DL1 A;  2XAS B;  4YT0 A;  2JPF A;  2I6H A;  2BVM A;  4LF7 T;  2QVA A;  2ZM8 A;  2LSY A;  3SWH A;  1NWM X;  3M3Z B;  2J62 A;  3N9Q A;  4PNI A;  4GYR A;  2V7I A;  3N9P A;  2IAK A;  3NRY A;  4LFB T;  5ABE A;  2CMR A;  3Q5X A;  5LGN B;  4NXM T;  4AKG A;  5FYM A;  1U4Q A;  1IZN B;  1BR0 A;  2LRL A;  2VKD A;  5JDL A;  2IW5 B;  4CI3 B;  5DQV A;  4KUM B;  3ZMZ B;  1WYB A;  1VCT A;  3RQW A;  1NEK A;  2H7O A;  4UV9 B;  1IAP A;  1WYC A;  3AB3 B;  3PU3 A;  2XHE B;  2J1D G;  4TWD A;  1LVK A;  2MAW A;  2I59 A;  3ZPO A;  4F6R C;  4H9R C;  3AAI A;  1J5W A;  3RKO A;  4JI3 T;  2CXD A;  5JR9 A;  4IE6 A;  2NOX A;  3AEE A;  3I9W A;  2BKP A;  4DV3 T;  2LOP A;  4F8H A;  2J47 A;  5IYZ E;  1ZKE A;  2NW7 A;  1E7P A;  3JAF A;  3I0Q A;  2W62 A;  4HTE A;  4HFH A;  2ZMA A;  3QB5 A;  1HS7 A;  3KDS E;  1SUM B;  5J1G A;  3QC9 A;  2VUR A;  5JR9 B;  5LMN T;  5ABF B;  5HXC A;  3RYF E;  2NR4 A;  2OLT A;  2CRB A;  3LK3 B;  1XZY A;  2RA1 A;  5HXE A;  1ZOY A;  3N9O A;  3BQK A;  3FXE B;  2W2U A;  1U5P A;  2VQE T;  4BJN A;  4DR1 T;  3SS1 A;  3AE9 A;  1N32 T;  4OX9 T;  2DWK A;  4B3M T;  4YY3 T;  3VKG A;  5HWY A;  3NKZ A;  4JI0 T;  3C4Z A;  4N78 D;  2BZB A;  2V7L A;  3CX7 B;  1WR0 A;  3AE3 A;  3BQL A;  4AQF C;  4ZI2 C;  2H88 A;  1B7T A;  3LFM A;  2XAF B;  4DR7 T;  4IRE A;  2B1E A;  4U2Y A;  2D0U A;  4X64 T;  3ZMU B;  5CJ5 A;  4DMW A;  1SA0 E;  3AEC A;  3TKL B;  2BS3 A;  5FMN A;  3WAJ A;  3LG7 A;  4C91 A;  2LHR A;  3ZLI A;  3F2E A;  3P8C D;  3V5S A;  1BR4 A;  5KDM C;  3T1H T;  3QOF A;  3UUM A;  1D1A A;  3KV4 A;  2SPC A;  4X62 T;  2VVS A;  4IE0 A;  3P4W A;  2BVL A;  3JCF A;  3RYC E;  3RH3 A;  5HEG A;  2LSK A;  5JRC A;  5LXT E;  5J2T E;  2XAG B;  3CK6 A;  2X9H A;  5DJQ C;  4LF8 T;  1WCR A;  1HG5 A;  1VRB A;  1J5E T;  2LLY A;  3PUW F;  4YSX A;  2WZH A;  2LM2 A;  4CZZ B;  4OFZ A;  4NPP A;  2BG9 B;  1XMO T;  4EYY R;  2V5C A;  3FZK B;  3TLW A;  4JBW F;  2A2F X;  2W67 A;  3LBX A;  3RIF A;  5A1L A;  2YEV C;  5EK4 A;  4TV8 E;  4EXT A;  2ZM2 A;  2VK9 A;  2CBJ A;  4AKI A;  2G0U A;  2LKG A;  2E9X C;  2WBL A;  4UF0 A;  5ABG A;  2PTF A;  3C51 A;  1Y01 A;  3UU6 A;  1DU2 A;  3QB5 K;  5AQM B;  2ODU A;  3H3A A;  5AQP B;  1FMW A;  5FXX A;  2YN6 A;  4JEH B;  2DNX A;  5HAX A;  3T1Y T;  2K5B B;  3LBX B;  5HCJ A;  2KT9 A;  4TZ4 C;  1HG2 A;  1HTJ F;  4UXN B;  4DID B;  3CIR A;  5FY7 A;  2LT3 A;  3O1I A;  2XTL A;  2WWU A;  4UF0 B;  2CPT A;  4ILC A;  2XQ7 A;  3RRC A;  3KBT A;  4IE7 A;  2L3L A;  4LFA T;  2ES0 A;  5LCY A;  2VKH A;  4COF A;  3ETV A;  2DI4 A;  4EIW A;  4TNV A;  2E2A A;  3ZJ1 A;  3PUZ F;  4YTN A;  2BS2 A;  4EV6 A;  3AAA B;  1HX8 A;  2V6Y A;  3K1S A;  3PV0 F;  3OTO T;  4IE5 A;  3R84 B;  4B6X A;  2X66 A;  3U3I A;  3PUV F;  3MA9 A;  1FIO A;  1UK5 A;  2LKH A;  1MND A;  5EK3 A;  3P50 A;  3UUX B;  4MBQ A;  2VKO A;  4CI2 B;  3RRW A;  2Q9Q D;  4ADZ A;  3RLF F;  5LP6 E;  3SOL A;  1YKE B;  4EYU A;  2VB6 A;  2WMO A;  1XDO A;  2V6Y B;  3A5X A;  2HPJ A;  2LSI A;  3N2K E;  4P0A A;  1HCI A;  3UFG A;  2LJL A;  4MAL A;  1Z8U A;  3H3M A;  2WP9 A;  2CEA A;  5L4H A;  5EK2 A;  4KI0 F;  3MK7 C;  2EHO D;  3KVB A;  2KZ7 B;  4UR9 A;  3UTK A;  4CXX A;  4XZC A;  2YIN A;  3EDU A;  4HFV A;  3MKD A;  3Q5W A;  3UU4 A;  5AQG B;  5LG4 A;  1IJ6 A;  5FXW A;  2XPK A;  3P4R A;  4P09 A;  3JC6 D;  2P9B A;  5AQJ B;  3RIU A;  3UUB A;  4IDO A;  1D0X A;  2JQH A;  2XQ5 A;  4JV5 T;  3CQX C;  3TLS A;  3UQ4 A;  2Y8D A;  4H9P C;  4OYJ A;  4CXW A;  2N1G A;  2UUC T;  4AXP A;  4AQY T;  1HF8 A;  3FB2 A;  3FZH B;  4PJJ A;  3PJA A;  2MBG A;  1KK7 A;  4QH5 A;  5L3D B;  2NTX A;  2XAH B;  1XNR T;  4EEB A;  2FJA A;  4A97 A;  3NZP A;  1XNQ T;  5BR8 T;  3UQ7 A;  4GK0 E;  2BKN A;  3GA8 A;  2LM9 A;  1BR1 A;  4HWH A;  4WBN E;  2WM9 A;  2YKS A;  3ZN1 B;  4U72 A;  4DMV A;  2X0L B;  5HXH A;  2YOE A;  4H9S E;  4YTP A;  2XQ9 A;  5JDG A;  4GIW A;  3VHL A;  4BJM A;  4J2C A;  4JI4 T;  2ZM0 A;  3UUL A;  2F4V T;  3E0Z A;  2X9X A;  2C0S A;  3K3Q C;  3HA4 A;  5ADX L;  4O4L E;  2ODV A;  2PJQ A;  3E08 A;  3F31 A;  3K8P C;  3P7I A;  2UXB T;  2UUA T;  4CN6 A;  4GYS A;  3GWH A;  2WY2 A;  4TWF A;  4H63 H;  2A72 A;  3UU3 A;  2YDS A;  3IBP A;  3KFW X;  2Y48 B;  2HH7 A;  4U3C A;  5HXS A;  4YHH T;  4BA9 A;  2Q9Q B;  3GN5 A;  1FJG T;  3AA1 B;  2NW8 A;  2YU2 A;  3NWI A;  4G2A A;  3LDQ B;  1MMN A;  3ZT6 A;  2QYW A;  2FBW A;  4HFC A;  3HI2 A;  4QWN B;  3ZYL A;  4AIS A;  2VVN A;  1KFY A;  2EHO B;  2Y6X A;  4X66 T;  3ZMS B;  1HFA A;  4OYK A;  4UIG A;  4U31 A;  1OED B;  3GN5 B;  4HE8 A;  3MAC A;  3PUG A;  4AQG A;  5L3C B;  2X51 A;  2ACZ A;  3Q5D A;  3AEB A;  2UU9 T;  2E5L T;  3PJA J;  1N36 T;  4YFS A;  4X1Y E;  1G8X A;  3HL6 A;  1AJ3 A;  2WSS V;  5M4Y A;  3SFE A;  1MIV A;  2W61 A;  1XDP A;  5ABF A;  5LG3 A;  2X9Y A;  4KHP T;  4DBQ A;  4IST A;  4QH1 A;  5FVL A;  2WDV A;  4DV7 T;  4TX5 A;  2CLY C;  4AKH A;  3HKD E;  4QHO A;  4AKL A;  2L9Q A;  3Q2M A;  5LHG B;  2V7M A;  1US7 B;  2PFV A;  4IDP A;  1CHU A;  2K9A A;  4ZI2 D;  2XQA A;  4PJL A;  1KEY A;  2CA5 A;  3RC3 A;  4TUY E;  2LE8 A;  3VU7 H;  4QX7 B;  5LHI B;  5FXV A;  5IHY A;  2K48 A;  5H6R B;  2C5J A;  2ACX A;  3ZMV B;  3KVA A;  3PU8 A;  2WMN A;  1HR0 T;  2RPA A;  4JUY A;  5IWA T;  4WW0 A;  1M7K A;  4IT4 A;  3G06 A;  5AQQ B;  3EUH A;  2VL8 A;  2YDQ A;  2J4G A;  1BR2 A;  4JI1 T;  4FJO A;  3RHW A;  5FP3 A;  3GMI A;  3DTO A;  2XQ4 A;  4K0U A;  4I43 B;  4ZZB A;  5L3F B;  1H7C A;  2D0T A;  1X9B A;  3AEA A;  1N33 T;  1QUU A;  2BS4 A;  5FY1 A;  5AQU B;  4XBF B;  4JI6 T;  2FJD A;  2N9D A;  5IUX A;  1V9D A;  4PK4 A;  4AKR B;  3O1H A;  1T8B A;  2H89 A;  4DV0 T;  3ZYK A;  1J1J A;  4QKN A;  2JQK A;  4ERR A;  2BG9 A;  4ZZC A;  1UUS A;  4LMJ A;  3PUY F;  4HWD A;  5LGU B;  1GQE A;  4UEL A;  4U2Z A;  3ZCJ A;  3NRX A;  4CN1 A;  1R8I A;  5DQW A;  3W15 B;  4PFO A;  5JDF A;  5JRE A;  4KX6 A;  1QLB A;  1D0Y A;  4X20 E;  2E9X D;  2LEH A;  1W09 A;  4KBM B;  1O3X A;  4JEU B;  5LYJ E;  3EHZ A;  2CXF A;  1UUR A;  4BAY B;  2V26 A;  4GOU A;  3J9X 1;  4I50 E;  3K3O A;  5FL0 A;  2JQ9 A;  4CQI A;  2X68 A;  2DCF A;  4HN9 A;  1WR6 A;  1HX1 B;  4QX8 B;  5JDN A;  3P4Q A;  4DR4 T;  4DBR A;  3AE4 A;  4H63 V;  3ZT5 A;  3BQI A;  4EED A;  1W0A A;  2NTY A;  2W63 A;  4L5G A;  3MXZ A;  2WWV A;  1ZHC A;  4O4H E;  4CN4 A;  4P1N A;  2M67 A;  5LJN A;  4OHF A;  3X1D A;  4A5X A;  2IC9 A;  4PJM A;  5AQO B;  2X0Y A;  2MPK A;  5ETW A;  2VKJ A;  2KIN B;  4ISS A;  5BMV E;  5LMU T;  1MIW A;  3AVR A;  3UU8 A;  5CB4 E;  4EZ4 A;  1UX4 A;  4M1P A;  4WZX A;  5JVD E;  1I94 T;  3WI3 A;  1JNR A;  4X1I E;  3F57 A;  2XZE A;  4ZXL A;  3HKE E;  2YDR A;  3EAM A;  3ONX A;  3RYH E;  2D2S A;  3Q5E A;  1YW0 A;  2IC6 A;  4JI7 T;  2IDO B;  1XWM A;  4Q25 A;  5L3B B;  2C5K T;  2MTQ A;  1FEW A;  3KV5 A;  4DV5 T;  3IEE A;  3FZM B;  4P0B A;  4MHC A;  3HR0 A;  4QXC B;  5H6Q B;  5AQS B;  4I4T E;  4G63 A;  3S4U A;  4DV2 T;  2V5D A;  1EZ3 A;  3RIU C;  5HEJ A;  1YD8 G;  4ZEY A;  5FVK A;  3AE6 A;  3RC8 A;  3L09 A;  4LF5 T;  3PUX F;  2CWO A;  4UVC B;  3N2O A;  5J2U E;  3UFE A;  5LNK A;  3ZT7 A;  4NUU A;  2L8K A;  5AFU L;  2E9X B;  4U74 A;  2IUB A;  5J0Z A;  1N34 T;  2WDR A;  2ZLY A;  1MIY A;  1YXR A;  3IHR A;  2M6I A;  3RIA A;  4UEM A;  3SFD A;  3QK6 A;  4TWH A;  4U7I A;  2KWI B;  4IIJ E;  3EDV A;  5L2L A;  4NUV A;  4JI8 T;  3R6N A;  2XQ3 A;  3I9Y A; 
#chains in the Genus database with same CATH homology
 3ZMT B;  3AA1 B;  2LOS A;  3PUQ A;  5DAB A;  2NW8 A;  2YU2 A;  3HKB E;  4G2A A;  2X9W A;  4HKA A;  1MMN A;  2DWK A;  3NBX X;  2WAU A;  3VKG A;  2NP9 A;  1WLX A;  5HWY A;  2V7J A;  3C4Z A;  4N78 D;  3SRZ A;  2BZB A;  3HI2 A;  2V7L A;  5LJM A;  3CX7 B;  4QWN B;  3ZYL A;  4HEA A;  3BQL A;  4AQF C;  4ZI2 C;  2DHR A;  4WNK A;  2EHO B;  4DND A;  1B7T A;  3J7Y q;  3LFM A;  1KNZ A;  2XAF B;  3QUJ A;  1LRZ A;  2Y6X A;  2H7V C;  4H9Q C;  5JQG E;  2JMH A;  4ZS2 A;  2B1E A;  3ZMS B;  2D0U A;  4EAH A;  2PG8 A;  3ZMU B;  3Q9D A;  5JDM A;  2V7K A;  2H3R A;  1HFA A;  4OYK A;  4UIG A;  3PUR A;  1D1C A;  4DMW A;  1MMG A;  1SA0 E;  3GN5 B;  3TKL B;  2GK9 A;  4IHJ E;  4HE8 A;  2JMK A;  3C4X A;  1WRD A;  3MAC A;  3PUG A;  3HKC E;  5FMN A;  4AQG A;  3WAJ A;  4Z8X A;  4HGA A;  3LG7 A;  3O1J A;  4C91 A;  5L3C B;  3RPU A;  2LHR A;  3ZLI A;  2QGS A;  2X51 A;  3N9M A;  3F2E A;  5LBQ B;  3P8C D;  3V5S A;  3ZCI A;  1BR4 A;  2NWB A;  5KDM C;  4YFS A;  3UUM A;  1D1A A;  4X1Y E;  2E9X A;  1G8X A;  3KV4 A;  4IGU A;  3HL6 A;  2SPC A;  1AJ3 A;  3N9N A;  2CM0 A;  2CE7 A;  4IE0 A;  1T98 A;  2QA7 A;  2WSS V;  4ZI7 E;  2BVL A;  4YHJ A;  5M4Y A;  3RYC E;  3RH3 A;  1MIV A;  5LBM A;  2W61 A;  2LSK A;  3CML A;  5JRC A;  1OWA A;  2X9Y A;  3E22 E;  5LXT E;  1NAF A;  3K3N A;  3FBZ A;  5J2T E;  4DBQ A;  5JDH A;  1Z0P A;  2XAG B;  3OYX A;  2X9H A;  5DJQ C;  4ZHQ E;  1HG5 A;  5HYA A;  3T8O A;  1VRB A;  3CWZ B;  4IST A;  2Q9Q A;  4ZOL E;  2PBI A;  2VWA A;  2CWY A;  4TX5 A;  3FXD B;  2CLY C;  4AKH A;  4CZZ B;  3H37 A;  3HKD E;  4QHO A;  4AKL A;  2L9Q A;  4OFZ A;  5KMG P;  3O9X A;  3Q2M A;  5LHG B;  3PTR B;  2W00 A;  4MFR A;  2BDE A;  2V7M A;  5JDQ A;  2PFV A;  1US7 B;  4EYY R;  2K9A A;  4JLE A;  3CQC B;  4EB6 E;  5LA6 E;  2XAJ B;  4ZI2 D;  4PJL A;  3DJB A;  2A2F X;  2CA5 A;  3RC3 A;  4TUY E;  3LBX A;  5C8Y E;  2LE8 A;  2EHO A;  4ZI3 C;  3VU7 H;  1MNE A;  4QX7 B;  5A1L A;  3ZC1 A;  3OYZ A;  3ESL A;  2YEV C;  4H9O C;  5EK4 A;  3N9L A;  4TV8 E;  4EXT A;  3CPZ A;  2ZM2 A;  5LHI B;  2VK9 A;  5FXV A;  5IHY A;  2K48 A;  4ZS3 A;  3MJX A;  4L9I A;  2G0U A;  4AKI A;  5H6R B;  1MMD A;  4O8S A;  2C5J A;  2ACX A;  2E9X C;  3ZMV B;  4IE4 A;  2WBL A;  4UF0 A;  3KVA A;  3PU8 A;  5JR9 C;  2WMN A;  3AVS A;  5CA0 E;  2A3D A;  3C51 A;  4JUY A;  2CCQ A;  4X1K E;  4WW0 A;  3DP7 A;  2ODU A;  3H3A A;  4TV9 E;  4WBO A;  1FMW A;  1S94 A;  4AI6 A;  5FXX A;  3EUH A;  4UVB B;  2VL8 A;  1BR2 A;  4JEH B;  2DNX A;  5HAX A;  5E0O A;  4FJO A;  3ETU A;  5KX5 E;  5FP3 A;  2K5B B;  3DTO A;  3GMI A;  3LBX B;  3UUN A;  3PDY A;  2Q9Q C;  4K0U A;  4I43 B;  3O4X E;  4YJ2 E;  5L3F B;  4CXY A;  1H7C A;  2D0T A;  2KT9 A;  4PJN A;  2W0G A;  4TZ4 C;  1HG2 A;  3N2G E;  1QUU A;  3LJC A;  2KXP B;  5FY1 A;  4MLK A;  1HTJ F;  4UXN B;  3ZEF B;  4EZH A;  4XBF B;  3LK4 2;  3I0O A;  5FY7 A;  2LT3 A;  2HPL A;  5FNV E;  3OKQ A;  2N9D A;  1D0Z A;  2XTL A;  3O1I A;  2WWU A;  1V9D A;  4PK4 A;  4AKR B;  3O1H A;  4KMC A;  4UF0 B;  2VAS A;  3RRC A;  2XAQ B;  3C64 A;  3M65 A;  3KBT A;  2EHO C;  4IE7 A;  2CXL A;  5F8P A;  3ZYK A;  2JQQ A;  2L3L A;  4QKN A;  4ERR A;  4A56 A;  1UX5 A;  2ES0 A;  5LCY A;  2VKH A;  2D5U A;  2DLR A;  3D0T A;  4KP3 C;  3ETV A;  2DI4 A;  4EIW A;  3RX6 A;  2RP4 A;  5LGU B;  5GON E;  3ZJ1 A;  2DWG A;  5LOV E;  4QXH B;  3C98 B;  2KND A;  4UEL A;  5CA1 E;  3CX8 B;  3JC6 C;  4H9N C;  3PUA A;  4PAG A;  4ZI3 D;  2NW9 A;  3ZCJ A;  3NRX A;  5DQW A;  2X67 A;  3PUS A;  1S35 A;  4CI1 B;  3W15 B;  1SHZ C;  4PFO A;  3ZN0 B;  3AAA B;  3N5L A;  3ZJ2 A;  5JDF A;  5JRE A;  1HX8 A;  4O2A E;  2N2N A;  4IDZ A;  1D0Y A;  3CKD A;  4IE5 A;  4X20 E;  2E9X D;  3R84 B;  1OXZ A;  2LEH A;  3ANW A;  2XUE A;  4B6X A;  2YK0 A;  2X66 A;  4ASK A;  2UXN B;  1D1B A;  3U3I A;  4KBM B;  1O3X A;  1MMA A;  4JEU B;  2MYS A;  3MA9 A;  1FIO A;  2E8I A;  3IF8 B;  1X79 A;  1MND A;  5LYJ E;  5EK3 A;  2CXF A;  2KMF A;  3C4W A;  4OK0 A;  3UUX B;  4BAY B;  3OBV E;  1FMV A;  2V26 A;  3OJA A;  4GOU A;  2JRK A;  3CQG B;  3CX6 B;  2UXX B;  4MBQ A;  3J9X 1;  1E1H B;  2VKO A;  2MOZ A;  4I50 E;  3U78 A;  2JJ9 A;  3RRW A;  4CI2 B;  5F3J A;  3K3O A;  2C5I T;  4E7Z A;  4I55 E;  4C90 A;  3CVR A;  2Q9Q D;  4ADZ A;  3AAE B;  4UVA B;  4CQI A;  2KLQ A;  5LP6 E;  2X68 A;  2DCF A;  4HN9 A;  3SOL A;  1YKE B;  5LHH B;  4EYU A;  1WR6 A;  2VB6 A;  2WMO A;  3A5X A;  4QX8 B;  2HPJ A;  2LSI A;  3N2K E;  5JDN A;  4P0A A;  1HCI A;  3ZYM A;  5JH7 E;  1ZEE A;  3MZK B;  4DBR A;  3AA6 B;  3NZQ A;  2LJL A;  3ANW B;  2LSJ A;  4H63 V;  4MAL A;  3BQI A;  3AA0 B;  2NTY A;  2W63 A;  4L5G A;  2CEA A;  3MXZ A;  2XQY A;  2XAS B;  1ZHC A;  2V1D B;  3KBU A;  3VKH A;  5EK2 A;  3MK7 C;  4O4H E;  5LJN A;  2EHO D;  2M67 A;  2KWH A;  2JPF A;  4O4I E;  4OHF A;  3KV6 A;  3KVB A;  4PFP A;  2BVM A;  2KZ7 B;  3UTK A;  4CXX A;  4XZC A;  2IC9 A;  4PJM A;  2YIN A;  2ZM8 A;  3FBL A;  2LSY A;  3EDU A;  4HFV A;  4UV8 B;  3SWH A;  3UT5 E;  1NWM X;  3MKD A;  3Q5W A;  5ETW A;  2VKJ A;  2KIN B;  5LG4 A;  1IJ6 A;  3N9Q A;  4PNI A;  5FXW A;  4P09 A;  4ISS A;  4GYR A;  5BMV E;  1MIW A;  2V7I A;  3AVR A;  1LKX A;  3JC6 D;  4PK6 A;  3N9P A;  5CB4 E;  2P9B A;  2IAK A;  3NRY A;  3KV9 A;  5LGT B;  4V1A v;  4YJ3 E;  4ANJ A;  1D0X A;  3CQX C;  4EZ4 A;  4DO0 A;  1UX4 A;  2CMR A;  4M1P A;  3Q5X A;  5JVD E;  5LGN B;  3BK9 A;  1IJ5 A;  2Y8D A;  4AKG A;  4H9P C;  4OYJ A;  5FYM A;  1U4Q A;  4CXW A;  3WI3 A;  2N1G A;  4O4J E;  4X1I E;  1IZN B;  3F57 A;  3FHN A;  1BR0 A;  2VKD A;  4AXP A;  5JDL A;  1HF8 A;  3FB2 A;  3HKE E;  2IW5 B;  4CI3 B;  3B57 A;  5DQV A;  4KUM B;  4PJJ A;  3ONX A;  3ZMZ B;  2MBG A;  1KK7 A;  1WYB A;  4YLH A;  3RYH E;  5FY0 A;  2D2S A;  5L3D B;  4L0R A;  1YW0 A;  2IC6 A;  2NTX A;  2XAH B;  5L3B B;  2H7O A;  4UV9 B;  4ILU A;  1IAP A;  1WYC A;  1UCU A;  2C5K T;  2MTQ A;  3AB3 B;  5HXR A;  4GK5 E;  1FEW A;  3L3P A;  3PU3 A;  2XHE B;  2J1D G;  3KV5 A;  3NZP A;  3V5U A;  1LVK A;  2K24 A;  4GK0 E;  3I1A A;  4PW8 A;  2I59 A;  3GA8 A;  3ZPO A;  2LHN A;  3IEE A;  1Y64 B;  1LVF A;  4F6R C;  4P0B A;  4H9R C;  3AAI A;  2LM9 A;  4MHC A;  3HR0 A;  4QXC B;  3RKO A;  5L3E B;  1BR1 A;  5H6Q B;  4I4T E;  4G63 A;  2CXD A;  3PE0 A;  2CLY B;  5JR9 A;  4IE6 A;  3S4U A;  2WM9 A;  4WBN E;  3EVY A;  2NOX A;  3I9W A;  3ZN1 B;  4U72 A;  1EZ3 A;  2Z6E A;  1CUN A;  3LK2 B;  4DMV A;  4TN7 B;  2X0L B;  5HXH A;  1YD8 G;  5FXZ A;  1G73 A;  2LOP A;  3AA7 B;  4H9S E;  5IYZ E;  1ZKE A;  2NW7 A;  4AQF A;  3WAK A;  4O2B E;  5JDG A;  4GIW A;  3RYI E;  1QSD A;  3RC8 A;  3L09 A;  3I0Q A;  3VHL A;  3C50 A;  2W62 A;  4HTE A;  2CWO A;  5EZY E;  4BJM A;  4J2C A;  4UVC B;  3N2O A;  5J2U E;  3UFE A;  2ZMA A;  4XAX B;  5LNK A;  2ZM0 A;  1HS7 A;  3UUL A;  4NUU A;  3E0Z A;  3KIN B;  2X9X A;  2L8K A;  3B13 A;  3KDS E;  5AFU L;  2C0S A;  2E9X B;  3K3Q C;  3HA4 A;  4PK5 A;  4U74 A;  5ADX L;  4O4L E;  5J1G A;  2ODV A;  2PJQ A;  3QC9 A;  3E08 A;  5JR9 B;  3F31 A;  2ZLY A;  4E7S A;  1MIY A;  3K8P C;  3P7I A;  2OA5 A;  2YU1 A;  4EOZ B;  3IHR A;  4UEM A;  4FI5 A;  5HXC A;  3RYF E;  5JRC B;  3QK6 A;  3GWH A;  1VOM A;  4GYS A;  3ZC0 A;  4H63 H;  5HWX A;  2KWI B;  3LK3 B;  2A72 A;  4IIJ E;  4QXB B;  3EDV A;  2RA1 A;  4NUV A;  5HXE A;  5L2L A;  3IBP A;  3N9O A;  3BQK A;  3FXE B;  3KFW X;  1ZV4 X;  2Y48 B;  2HH7 A;  5TAO A;  1YKH B;  5HXS A;  2LSG A;  5L3G B;  1U5P A;  4BJN A;  4BA9 A;  2Q9Q B;  4DVD A;  3R6N A;  3SS1 A;  3GN5 A;  3I9Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...