3BKCH

Crystal structure of anti-amyloid beta fab wo2 (p21, formb)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
224
structure length
224
Chain Sequence
VTLKESGPGLLKPSQTLSLTCSFSGFSIRTSKVGVSWIRQPSGKGLEWLAHIYWDDDKRYNPSLESRLTISKDTSRDMVFMKITSVDTADTATYYCARRGFYGRKYEVNHFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSESITCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords WO2 IgG2a Fab fragment Light Chain Kappa
publication title Amyloid-beta-anti-amyloid-beta complex structure reveals an extended conformation in the immunodominant B-cell epitope.
pubmed doi rcsb
total genus 44
structure length 224
sequence length 224
ec nomenclature
pdb deposition date 2007-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bkcH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bkcH01
4Z7NF 4ISVA 4M6OL 4XAWL 3S34H 1AXTL 2CQVA 5LQBL 1HWHB 1UM5L 3IFPA 3OTTA 4EXKA 3M1BB 5DRWB 5IGXL 3HPJA 3J8F7 1EFXD 4HMCA 4HULB 2WUBL 1ZMYA 4X6BB 2BVEA 3FQRB 5F7NC 3QDME 3WIHL 3OBAA 4PRAB 4H1LB 2Z91B 2HRPL 4X6DF 1UG9A 1CXEA 2D7TL 5DD1H 3QUZD 5DVNA 3WNKA 2YSSA 4HDIA 5J6GA 5C0CE 4RMWA 3EYSH 3TBSA 5J0BA 2V7NA 1S7TA 1AQDB 2XNAB 4KK5D 4D0DB 1CD8A 5C0BD 1CLOL 1B88A 2GJ6B 1JPST 1MCQA 3IF1B 4LPCA 3CU1A 3TPUA 5E7BA 3FO9B 1MCLA 4XZUA 1IQWL 3JWOL 12E8H 2H32H 4TQEH 3CFJA 1I9JH 2VXUH 2FL5B 1A1NB 1ED3B 3EFFB 1KN2H 2HFGL 5C0IB 2ZZUT 3KPMB 4GOSA 1FO0L 4K3GA 2AXHA 5IFJA 1JNHA 2R2EB 1RJCA 2ZP0T 4NP4L 5E24E 1MFAL 3ARXA 4H5SB 2UWEA 5B4MC 1KB5A 1RUKL 3VXQB 1CICD 3ILQC 3TCLB 5F8QC 4Z6AT 4PRNB 1RHHB 1KYOK 1UQSB 5EPMA 4MX7B 4JJ5A 2X70A 2WP3T 5HY9A 1HHJB 4HC1L 4M1CD 3S88H 4W70A 3MLSL 3HRPA 4MDJB 4Q0XH 4HUMB 4XPHH 1PG7X 2OQJB 3FT3A 3QDJD 3TJEH 5D1XC 4WI8A 3OJ2C 2AW2A 1VEPA 3B5HA 5T1LA 1FFPA 3UAJD 4HUXA 1NL0H 3KJ6H 1JWUB 4JPKL 3SGDI 1JHKH 4JQXA 2F53D 5HVWA 2VDOL 3SJVB 3HZMB 1DUZA 4MS8D 3FTGB 3MQIA 3QUXC 2R9HD 5BOZG 2VZTA 3IS1X 3IS0X 2WMPA 4P49A 3UC0H 5DS8B 4MD0B 4I1NB 1PEZA 4LPTA 4M1DL 3CZFA 3JWNC 5J3HD 3CSYA 4X4ZA 1AY1H 2A2QT 3GJEB 3FMGH 4YGVA 3WKNA 1CLZL 1SYVA 4R2GC 3HAEA 3RY6C 5LCVH 1AGFA 3ARVA 2L7UA 3CH1B 2C4XA 4F37K 3NAAL 4FXLA 3CXHK 1XGPA 2PR4H 4F7CA 1KSRA 4R97C 5HBBA 3HNVH 2BVTA 2ED7A 2HP4A 4QRSB 3MCLL 5DFVD 2OTPA 3IGAB 3PP3H 3VRLF 3F6IA 1BVLB 1HHHB 2AI0H 1B4JH 1TZIA 3DYPA 4PJAB 4BFBD 4KRMB 1JHTA 3QUXB 4YEFA 3JWDL 2XN9E 3ALWA 5IW6A 1DN0A 3FO1B 4XVSH 2F74B 5F1NA 4KAQH 4YDVA 4RAHA 3RKDC 3L3IB 5DRZA 4F33B 5C0AB 2EDFA 4WWKA 4P2OA 1FORL 1L7IH 4R2GB 3EO9H 1N8ZB 3KYKH 3WFBH 5GS0L 1RZ7H 4ENEC 4OV5B 1WQVT 4ZFOB 5HYSB 4ZUVA 5CZXC 2APVA 2G5BA 3UO1H 1LO2H 4N0YL 1JF1A 4NRYA 1F3RB 1KENL 2GJZA 1FP5A 3T1WA 1WVZA 4WEBL 4JHWL 2P4AB 3QQ4A 1U8JB 2BVOA 2YRLA 3EJYC 4Q9BA 2OZ4L 4HEPG 4PG9A 3B3IB 3O2DA 3IJHA 5H37H 1F3JA 3LRSB 4HGKC 3S36H 5GJTH 2VDNH 3QDMA 2A1WH 1XR8B 3TT1H 3JV4A 3NFPA 3ARBB 3O3AA 2CRIA 3UJJL 3PQYD 2H3NB 1MIEL 4MCYB 1IGFL 1JNLH 4MQTB 3D18B 3MXWH 2P8PB 3WD5L 1EEUA 3QUYD 1T2QL 2FCBA 3KGRA 4I77L 2WM0A 2IMNA 3QQ3B 4FQ2L 2CKBL 3MV11 1H8SA 4XMPH 3GSWA 3ABZA 2Z35A 3RVWC 3QIBB 4WV1C 4KK8D 3L5XL 5DSCB 1BZQK 5JORA 5DRXB 4LQFL 4LNRA 1ZANL 4X7TB 4PGEA 3GMMB 1QRND 3I75B 5CIPA 3VJ6A 1G9MH 1G6RH 4RBPH 2Y5TA 2XZQH 3T04D 5E6IB 1UZ8A 5IESH 1NDGB 1LE9B 4LIQH 5IKCA 4KQ4H 2EE9A 1MAML 3RWGA 4MNGB 4PJFA 3O4OB 2VUOA 5EOTA 1A6AB 3ZYOA 5HPOA 3CUPA 1TENA 2YUVA 1KBGL 2Z0BA 3QIWB 3AREA 4N8VB 4WTZG 1YECH 4QCIB 1RJLA 1RZKC 2LU4A 2OL3A 4U6HA 1A3QA 3PL6C 4DVRH 5IMLA 3D9AL 4JFOA 2B4CL 2PYFB 4QRUA 1A9BB 2VC2L 4P2YA 5EO0B 2FHBA 5IJKC 5T5FL 1ZE3C 4U1HB 1KXVC 3UTOA 3VFOA 4MQXD 4K71C 2UVFA 2QBWA 4PV8B 3UYOD 1OGTA 4MNQE 2CMRL 5EUOB 1GZPB 5DEFA 3UXFA 4ELKB 2QSCH 4YDLC 5HHXL 3PUCA 3UEZA 2R1XA 4GUPB 3MRGB 4F7MA 2QJDA 3F7VB 1P7QA 5ALBL 5D1ZA 5SV3A 4R8WH 2F5AL 3QWQB 1MFBH 4JHZA 3MGOA 2VN7A 4YPGA 5DO2D 4PRPD 1T6VN 1TQCC 1UWEH 5FV1L 2RCSL 2YEZA 1F58H 2R2BB 4YGAB 3ZDZF 1U2HA 2Y36L 3PL6B 2AJUL 3ARGC 4FQPA 4AMKL 2LV4A 1X7QA 3DTXA 4KGLA 2F8XC 2FEDC 4NQCB 2B1HL 1EEYB 3E6FB 1OSPH 5IM7A 1T0MB 3LCYA 2QHLA 1VGEL 2H26B 2KDGA 1I3RA 4XP9L 3QDGE 5KVDH 2Z31D 3PE9A 3DLQR 4GT7A 4HWUA 2MHAB 4YDLB 5E8DL 1ONQA 1K5NA 4QRRE 5BJTA 3BMWA 1KJMA 4OLUL 5GRJH 4E42A 5CSBA 5JZ7C 3PWPA 3A6BL 4OF6A 3RUGB 3MUGB 3MXVH 4M5YH 4Z7VB 3C08L 2XN9A 3OR6B 1VFOA 1F2XK 2PN5A 5L0QC 5EB9A 4PGBA 3MLXL 1ZHKA 6CGTA 3KPRD 2VXVL 2IFGA 1Z5LA 2VL5B 3KPQB 4K94L 1NCBH 4JFFD 1BFTA 1TQCB 2FGWL 1LK2A 2HKHH 3HS0B 4LHUD 1FNSH 1XGYH 3DX8A 3ILPB 5I19H 3ARGB 3BQUD 1K4CB 4YR6B 1JWMA 1DFBH 4P46B 4LSRL 4PTUB 5KS9F 1WGOA 1YEKL 1OGAB 3GKWL 2ICEA 3R1GL 5HHME 4NPYB 3VWKB 5L8JB 5TDNB 4OBSA 5FKAA 1A3LL 7FABL 3TN0D 4N90E 1HILB 3N9GH 4U1LB 1C08A 5KSAC 3NPZB 3PP4L 1QBLH 1AQKH 2D7QA 4P57A 2JCCA 4AIOA 1E28B 1KCSH 1TETH 3MSPA 1QR4A 4ZS6D 4XNYL 4XCYB 3SDYL 1J88A 4NN7B 1FHGA 5I8CA 4NKIH 5DJ6A 2VMFA 3PHOA 3WSQL 1G7JB 5ADPL 4DW2H 1JF6A 4JDTH 4RZCB 1YJDC 1RK1A 3KPOA 5FB8A 4LRNL 4Z8FH 5C09B 3TLRA 4BQ9A 5C8JB 1HKLH 1EJOH 4HCRH 5HJ3A 1KEML 3L6FA 4H20L 2FX7H 4N0UB 5ESAB 4Y4KC 4EDXB 3PWUB 1MHEB 1OWRM 4U6TA 1MHHA 5DDHA 5CCKL 5AWNL 3KS0H 3KDMB 4JRYD 4CJ0A 4XVUD 3V0WH 4AIZA 4WI5A 4UQ3B 1L0YA 1RIVH 3O2WH 5AZEH 4D9RE 3DJ9A 5I18H 3MZTA 3O4LE 3HMXA 4TRPL 3WFHB 2HJFB 2DWEB 3LEYL 4KI1A 4X6EB 2WIIB 3AS3A 4JDVB 4LHUG 5KJRL 3AFLA 1HSAB 4AH2B 1U8HB 2XIDA 4U2ZA 2YUWA 5DI8B 4NKOA 3Q48A 1ZVSB 4W4NA 2HMID 3DI3B 4ONGL 2VQTA 1R5IB 1Q0YH 3TT3H 2MWCA 1HN1A 3MRDB 3K74B 4Y4KB 3HCVB 3DVNB 4NO0B 4YE4L 2E27H 3D69B 1QHPA 3QXDA 4MA1B 1S5HA 4MNQA 2XKNB 3NH7H 3KXFB 3SDXB 3SDCC 4XPTL 3LQAH 3KLHD 1U41A 2Q7YA 5B38B 1NGYB 4MZ2A 3AGVA 2GUOA 1BMGA 4TVPD 2VLJB 3PGDA 4OZ4B 3L7FB 3HZKA 4I0KA 3QHZH 2I25N 2ZOLB 4OD3L 1UVQB 2BRRL 3WKML 3TIDA 4HS8H 3TJHC 4NUJB 4OZGE 4PYGA 4PY7A 4F7EB 1J7VR 2CLZB 4LL9A 1KPRB 3T2NH 2Z92A 2EXYC 4MSWB 5IBLC 1SY6H 4OQTA 4UV4L 5CEYA 5JIHA 3PDGA 1S7XB 3LAFA 3WHE1 3OKEB 4R90L 1CGUA 1X4XA 1A6TB 2CK2A 3E3QC 1AXSB 2JB6A 1BGXH 3LB6C 4ODTL 3UYRH 2H2SC 3RIFF 3BKMH 1NFKA 4RAVA 4KJYB 1D5ZB 1EIBA 5TE7H 3QDGA 2BDNH 3ARDC 2RBLA 3SCMD 4QRRA 4KVCH 3PWNA 3DRQB 1IGCL 1E4XH 1MHPL 3JV6A 4J6RL 1XF1A 1T3FA 5FUCE 3OGCB 4F2MB 2DN7A 2YPLB 3T0XA 1JGEB 3LV3A 2P5WB 1OLLA 1KCRL 3FJTA 3CK0H 4Z7OF 4HUUA 2YRZA 5F9OH 1KELH 4ZUWB 5I8KL 5IW1A 4JFDD 5IR1B 3G6JB 3GIZH 3N85L 3HNTH 1PGRB 4H88L 4TNVK 3NOIA 1ZT1B 2WUCH 5CJQH 2IAMC 3VMOA 3WHE0 3ZSSA 2W0LA 3QPQC 2BVYA 4EQ2A 5SX4H 4I48A 1U8NB 2NY2B 1GIGH 2NY6C 2X89A 2AJ3B 1JHLL 4X6DB 4PGDA 1XF2B 1ITCA 3ARDB 1DUYA 3WIFB 2PXYB 2AV7B 1CDBA 3QPXL 4MJID 1BF2A 5K59F 1N64H 4DTGL 2KQNA 1GPOL 4OT1L 1A1MA 4M7LH 1CT8B 3BZFA 4FFZH 1LDPH 2F54E 3BESR 4Z7NE 5IMKA 4JFED 3FRPA 4JFZH 3CFEB 1G0DA 4G7VH 1CZ8H 1SJHA 5BO1H 3LRGA 2H41A 2XACC 4LSSL 4TUKL 5FOBA 3O45B 1I8LA 3H7LA 4Y1AD 4YWGL 5LVEA 4HWZB 3NCYS 1QBML 5F7DB 3WLBB 3ZKND 4U1MA 3IDNB 1R3KA 2JJTC 5E99H 3O9WC 4PB0L 1NC4B 3SE3A 1VB9A 1ZLWK 1H3GA 3GBMH 1WICA 1OW0C 3IKCA 3MCG1 4NQEE 5DWUH 5L2JA 5F3HA 5D93C 2HLFD 1MJ7L 3MLWH 3H8NA 4OCLC 3SDAD 5BW7C 4R6UA 3FAWA 1FNLA 1QPXA 4OM0L 3TA3C 4ZFOL 1TJIH 5IHLB 1VFAA 4J1UA 5KTEH 1U8LA 1SEQL 4OFKA 1PJ9A 4JAMA 5EC1A 5MEOA 2E3VA 2VNCA 1OTSC 4GG6F 2EH8H 3ZDYE 4TTGA 1N5YH 4EOWH 3V5DB 5I1EH 3VGDA 5C3LD 3K46A 3MACH 2DQJH 4DKAA 5HYJE 2VLRD 1YQ2A 1QYGL 4OZFH 1BZ7A 2CO6B 5ADOL 1CFTA 2J8UE 4U1IA 4JZJA 4KKAD 1W8NA 1JI1A 1DLHA 4PJ5B 4M03A 4LCUA 1DL7L 5D93B 4NO2B 4G42A 1J8HE 2VXTH 2BNQE 2H32B 1HXYB 1F4AA 3DYMA 5I1JL 3MR9B 5ESVA 1QSFB 3T0DA 4OAWA 1UZ6E 4KV5F 3I2CL 1TZHA 3MJ9H 4NZRH 1QLFB 1FFOA 4JPVH 1F8TH 3BN9D 4XH2B 3O3BA 4ZS7H 1J11A 4OZHB 3I02B 3UJIL 3V0VA 1DVFA 1MCOH 4RDQG 5A2IH 1QRKA 3G9AB 5IQ9B 2W9DH 3JTSB 2AXGA 3H0TB 1IC7H 5DT1H 4OZGA 4HWEL 4UT7H 1A14H 4UUJB 4NM4H 1JZ4A 3MODL 2EYRB 5CHNA 4O2FB 3MRRB 4IRZH 4TSAH 2I9TA 4CDHA 5C07B 5IIEB 1JGLH 3AB0B 1I8IB 4LASH 5I8EA 3FCTA 5TDOA 5A16B 3KYNB 3QIUD 4P23D 5ECJE 1FGVH 2FIKA 3INUL 1EO5A 1S5IL 3FQTA 4HIJB 1LEKA 3MFFA 1D5BB 3F7QA 4Q6IB 1ACYL 1WBYB 1YQVH 5L88H 4DUVA 3A0OA 4I2XB 1W72A 3FZUC 5IF0B 3M45A 3S5LA 3TGXA 5CEXB 2E6QA 2HJKB 3OGOE 1RULH 3NTCH 5DHYA 5DRNB 1DJSA 1PG7L 5GQBA 3TPKA 5CILL 1EHNA 4FG6C 4MWFB 4ELME 5DGQA 1JV5A 4QRPB 2CPCA 5ISZB 3FRUB 1FJ1A 2VITB 5SWSA 2O5YL 5IBUB 5ICYA 3TO2A 1Q9KA 4X7EC 4YFLI 3VG0H 4WU7A 1LE5A 5F89A 1DBBL 2ADJB 3D85B 1FZKA 2IPKA 1BQHG 4M61A 2IAND 4G6KL 3V5HA 1ZGLA 4MQ7A 2CUMA 4N9OB 1UYWL 4JO2H 4C59B 4HKXB 4OCRH 1DN2A 2X9WA 3G5ZB 3N1FC 3V95A 4PLNC 5ANME 3MJ6A 2DBLH 2HFFB 2R56H 1CXLA 1XT5A 3ARFA 3HC4H 4TVPH 4GBXB 1RZKL 2AEPL 1J0ZA 4Z5RA 5EZOL 3RX7A 1IVLA 5B39G 1EBPA 2AJVL 1T7YA 4XNQB 4PIRF 5EA0H 5FA4B 3U2SB 1Q8MA 3L5IA 5H35B 3ZHLA 3PDDA 2Y7QA 4R4BB 5D7IE 2F54A 5CEZH 4G9FB 2E7HA 2QADD 3OHXB 4M6ML 5DGRA 3QRGL 4PUBH 3WIIH 3L3KA 5EZJB 1ZLUH 1ULVA 5B8CC 4UU9A 1WCBB 2D0FA 4KZDH 15C8H 1Y18A 3VD3A 3TBWA 2H2PD 4K8RD 4JM2B 3C60D 3KPTA 2PW1B 5FOJA 1OAZH 1ORSA 3FKUS 3P4OB 3BEVB 1TIUA 3F7YB 1AIFA 2ZSVB 1HHIB 5C08B 3DXAE 3D2UA 4XPAL 1IKNA 4IRJC 3BKYH 4URTB 4NQEA 1R3JA 3ZYJA 1ZT4A 3LN5A 5DMGD 3SY0B 1I1AA 3MLZH 3IKKA 1F42A 4P5TD 3CLFH 1HQ4A 3RAJL 5IQ7L 3RBGA 5SX5H 4M48L 5GISH 2LABA 1SM3H 3ULVH 3AU1A 5I71C 4EN3D 3IDJB 3I6LD 5B8CB 1QVOA 5CWSA 1RZFH 1JPSL 5DTFA 3RWCA 4GAYB 1MAJA 4WI9A 4Q9RL 4PJ9C 5HYJA 4PRHA 3QH3A 3K3QA 1C5BL 3GB7A 5GRUH 5D6CA 5F9DC 4AIXA 4LCWE 1EEZB 4GRWF 4K9EL 4BK5A 3V79C 1A7QL 2X4RB 3LIZH 2J8UA 3C2SA 5C0EA 2IADB 1RIUL 5JW4Q 4QYOA 4PJCB 3PGCA 1FO0A 2XTJB 3RIAK 1VERA 3MPCA 4RMVA 5CD3A 3IYLW 1J8HA 1IAOB 2BNQA 1QSED 1LQSR 2WBJD 1CL7H 3B43A 1MFDH 4EI5B 4IMKA 4PJGF 5E8OB 4LSTL 1CFQB 3OKDB 3GMOB 5D6DA 4ALAL 1DBKH 5LBSL 3L5WB 5ENWA 2X1WL 3NZ8A 1X5FA 2GY7B 2DM3A 5SWZD 3W82A 1J05B 1MCSA 4HKZB 1EAJA 1GSMA 4X99B 1FQ9C 3CFBA 3LDBC 3SHSA 1BJ1J 4IBLT 5MEPB 1U91B 5FYJD 2J4WL 2C4FT 2GKIA 2IH1A 4OD2A 4PJ9B 4XC1L 1EMTH 1NEZG 3S97C 5DD5H 4AK1A 2Y6SD 4PLKC 4KK5C 4H8WC 2DMKA 1H3XA 1KC5L 4C58B 1QLRB 1A22B 1GOFA 2R69H 4IIQA 5GGRA 1EV2E 2QKIA 5KN5B 4TUOB 4HPYH 4ODUA 5DQ9B 1WC7B 2DJ4A 2GIYA 3PG2A 2J7LA 1G7MA 3QUKB 4CJ1A 2VDQH 3UPCA 1YUHA 3SGEH 3O2VH 2GAZB 3C5JB 1EFXB 4L8CA 1VACB 3QJHB 5KS9B 1CFNB 4PJEE 1NFIB 3DUHA 4DAGL 4ELMA 1I9RL 3ME0A 4L8BA 5CJXA 4R4ND 4Y5YA 4P4KD 4YEEA 2XWBB 1U92A 3VCLA 1J1PH 4YK4C 3QUZB 4HJJL 1A0QL 2HFTA 3R0MA 3BGAA 4M1CC 4UV7H 2DLGA 2QEJA 2YXMA 3EYOB 1U3HA 2NY0D 3LKPA 3OX8B 5C0BB 2P8MA 4ONFH 2DLIA 3MBXL 2NW2A 4WFGD 2P5ED 3WFZA 4RDQF 4GKOA 4HPOH 3EO0A 5I1DA 3WMSA 3BH8A 3OG6B 1UEMA 5ANMA 3MLUL 1FIGH 5F8RC 2CDEA 4QRQA 5HGHA 3N1MC 3UAJC 4J3TA 2ARJA 1YPZF 1IT9L 1K3IA 3OZ9H 3KPPB 1RZJH 1UGNA 3P0YL 5IB3A 3BPOC 1ZXQA 1B2WL 1GOHA 5ERWA 1A6VH 2CUHA 2Q76B 4MS8C 3DYOA 4LVOB 2R9HC 5D7IA 4ZNCD 1CICB 3UTTE 2FLRT 1ZEAL 3NPSB 4YK4B 2PW2A 5C0DB 1BOYA 4OLXH 2Q3AA 3VWJC 1DR9A 3W2DH 1U0QA 5I76B 1GL4B 3FT4B 3MRCB 4X6FA 2CIKA 2MPAH 2Z93A 4MNHB 2FD6H 3QDJB 2I07B 2G2RA 3T4AB 3HMWH 5EU6E 1FNFA 3MLTB 4YHOH 1FNEA 1SBSL 5FECB 3BP6B 1X5HA 1BOGA 3RRQA 5J13C 1FN4A 3W0WE 4MVBD 5MEQA 4BQ8A 3DXAA 2X6MA 1LVEA 3MOBL 2DLTA 4I3RL 1J1OL 4ORGB 4ZFZA 1BD2D 3BPOB 2F53B 5DJ8A 3HG1A 4L5FL 3GIVA 4WW1B 3U0WH 4D2NA 2RFXA 3RZCC 4XC3H 3REVB 2BC4A 2EIEA 1ZHLB 3BHBA 3OMZA 3OJDA 2CDGB 1ETZB 4HV8B 1UM4L 2E7MA 3IDIB 4HS6A 2AVGA 4JHAL 4PJ7E 4ZO9A 1WSST 1KV3A 3BYTA 3T08A 2IMMA 2C7UB 3QB7C 2YD1A 1NQBA 4ZAKA 4BYHA 3JVGA 2XWJA 4YDKL 5IJVA 1F4YH 3HRZB 2XPGB 5J13B 1IGYB 2HH0H 1UB5B 3V52H 1FFNA 4Z7QE 3OKKB 3BP7A 3VFGH 3ZTNH 4MZ3A 5CMAA 4I4WA 2XWTB 3VFNA 5GGVH 4S1SH 4OGXL 4C54A 5EZLB 5T3XD 3T1FB 1JN6A 5IG7A 5I17B 4K8RH 4M7KL 1TVBB 3BGMB 1UB6B 4ONHB 4JFHE 5CP3A 3QEGL 3RDTA 3QEQD 2AGJL 2XY2A 1YNKH 3MCKB 2ZJSH 4PFEA 1KIPA 2W92A 4NJAL 3ULUD 5MENA 2CRZA 1N26A 1AO7E 3WS3A 3QCVL 2OBGA 4KTEH 3QUYC 4O5LL 2AQ2A 5D2NB 5K33A 1AE6L 4I0PD 1MI5D 3MOAL 3MJ8B 5GPRA 1A4JB 2HT2D 3GSRA 3S34L 3BKCH 25C8L 4HIHA 5IB1A 2DQDH 2V2WB 2H9GA 1I1YA 3KAAA 5GIRA 4K07A 4NQSB 2P24A 2DDQH 1IEBA 3QXVA 4WU5A 5BRZE 2OXHA 1RZGB 3P4MB 4C55A 1RZ8A 4JFPA 1OHQA 2OTUA 4D0BB 5DD1L 1HI6A 3B5GA 4I18C 4XNUH 4PJEA 3DIFB 3BISA 3G04A 2MCG1 3QCUH 1Z0MA 5E2VH 5I30H 3PQYB 1P53A 4QRTB 3AMLA 3NCMA 4JRXD 2V17H 4OZIB 3IT8D 5HGBA 12E8L 4TQEL 1LK3L 5EBLB 1ZWIA 4YO0A 5F97E 3DSFH 3QUYB 2XXMB 1A6UH 1Z9OA 2VXUL 4NC1E 3KJ4C 3EDJA 3GSUB 1CD0A 1KN2L 4TULH 3TNNA 3SKOA 1EAPA 1MJ8H 1F11B 2KZ1B 2PYEE 4JVWA 4RGNE 4X4XA 1YN6B 4YZFE 5FO9A 4GSDH 4YHLH 1YMMB 2ZG1A 5JXEC 4JB9H 3O6FD 4EEEA 3AMKA 4NKMA 2NMSA 1QRNB 3CZJA 5EU7E 4EZMA 2NQCA 2EDWA 4KXZI 4Z7WB 3Q1SH 3M8OH 3BZ4A 5FYJH 5FKPA 3C6SB 2NLJB 5I2IA 3CDGA 3FN0H 3S88L 2FJHB 3UTTA 3RNQA 2A0LD 1MFCL 3R0NA 4L3AA 3VH8A 4FABH 2JLLA 4H26B 5DO2C 1T21B 2UZXB 5C9JB 5CD5C 1TVDA 4F57H 1QQDA 2NY5C 2HYMA 1E27B 4GW4A 3KJ4B 4ODWA 4POZD 1ADQL 4BZYA 2FO1A 3D0LB 5EU6A 3FB7B 4BKLA 2ERJC 5DK2B 3FQUA 1NL0L 3KJ6L 2Q8BL 2ZWLT 1JHKL 1O7SA 5HDQH 3W0WA 1WF5A 3RWDA 2RHEA 1VEMA 3RTQB 1D5MB 2QQQA 2VERN 4HGMA 4L8SC 4Y5VA 3LQZA 3SKJH 1JMZA 2Z31C 3DGGA 1FC2D 1HQRB 3DARA 1I7UB 1BVKB 3UC0L 2WANA 2JKXA 3RWHA 2K7QA 4WFHE 3MRFB 2J6EH 4M7JH 3TH4T 4QHMB 3T0BA 1AY1L 4NRXB 4KMTH 3TO4D 1MCFA 1HSBA 2L4OA 1BFSA 3FMGL 4FQXD 3EOAA 2JIXA 5EBWA 3VI4E 5E5RB 5GGVY 3U4AA 5CGMA 4PRPB 2A6IA 1KPVB 4X5WB 3N1GC 2EDQA 2IF7A 3I6KB 3D39E 1FLTX 4PJ7A 3H7BA 2PR4L 4ZDHA 1CDJA 1NLDL 3BQUC 4R9HA 3HNVL 1DE4B 5J1AB 3CFDA 1N3NA 4JO1H 4L29A 4BH7A 2DLEA 4LGRB 2RR3A 3UPRA 1NGQH 3SE9H 3TN0C 2X4UA 4J8RA 2CRMA 4Y4FD 4DGIH 3KNBA 1RUMH 4L8SB 1NCAH 1R0AL 3C5SA 2Z31B 4PJXE 4N5ED 3RVXD 4XVSL 5J6HB 4UMGA 3PIQA 1F4XH 3ROOA 4HUWA 1P9MA 1T1ZB 4Z7UE 3WE6B 5KANI 5C0GA 4XNZC 3DO3A 3VRIA 4D0CA 1PKQE 3CNKA 1UKSA 3NCJH 4HGWB 2AJZA 4AEIH 3WNMA 1L7IL 1HH9B 2R0ZH 3KPRB 3EO9L 3KYKL 4JRWA 3WFBL 4TPRH 1RZ7L 3T65B 5E08H 4JFFB 4S2SB 1XGTB 1Q1JH 4LVNC 3PWJB 2C3GA 5GGTH 1TFHA 4KV5E 3UO1L 3GHEH 5DUPH 1EGJA 1LO2L 3BQUB 1AO7A 2ATKB 1JPTH 3FQRA 4PRAA 5DK3A 4H1LA 4QHKI 1PX4A 3FN3A 4F9PC 2R1WB 4OBRA 3IETB 3TN0B 2DM7A 1JNNH 4GRLA 3T8XB 2XNAA 5IT2H 1AQDA 5ICXB 3VGHA 4HH9A 3IF1A 2VDNL 1MUJB 2OSLB 2A1WL 3TT1L 1E4JA 3FO9A 1PDKA 2VYRE 5HGGS 5E1AB 4PREB 4NT6B 4RWYH 3AAZB 3MRMA 1JNLL 2X4NA 4OB5L 1NGZB 2FL5A 4FQHB 2HT4D 1A1NA 3EFFA 5D7SH 4YIQA 1A6ZB 1T1WB 2JJSA 1KTDA 3BPNB 1T20A 5E8PB 2KBGA 4NQDE 1UJ3A 1FZMB 4RFEB 3J7HA 4N68A 1NGWB 4HIXH 4H5SA 2KQMA 2RGSA 5EOCH 4UIKH 2HMIC 3FOMA 4KK9D 3TM6A 1JMXA 2I26N 1RHHA 1UQSA 5A3IC 1G9ML 1JWSA 1V3KA 2PYEA 4Y5XC 1E4WL 3OPZL 2VOTA 1HHJA 5T3XH 4KROD 5IESL 4QOKE 3O8XD 4MDJA 2YD3A 3AM8C 2OQJA 3V2AR 4JRYB 1KG0A 1TDQA 1P69B 2AK4D 1T83A 1FVEB 5AUMB 3KLHC 3T4YB 3ULUH 2P43B 5FUOH 1YECL 5GS1B 3EDEA 3QHFH 3EOTL 1INQB 3VGEA 3NN8B 3VFSA 1JWUA 2V5SA 1RSFA 5ILTL 5DURD 1VFBB 4PB9L 4WI2A 1OY3B 3MRPB 3FTGA 1GXEA 3CPLA 1AFVH 1XZ0B 2XFXA 3Q2CA 2YD8A 4MD0A 3LN4B 5ACMA 3GRWH 1T7XA 4Y5XB 2ENYA 4D8PB 2AKRA 1DEDA 3ZTJG 4JJHA 4LEOA 3E6HA 3RL2B 3Q0HA 4ESKA 4UDTB 1NBVH 3GSNH 2EO9A 1HK6A 4X83A 1TVHA 1FYHB 1UWEL 3H9ZA 3BPCA 1F58L 2VWEE 4FFVC 1VKXB 3KYOB 1RUPH 4QHKJ 5I16A 4GRWB 2NNAB 3UZEA 4P3DA 3IGAA 3V0AC 4TN9A 3OF6A 3QFDB 4IHOA 1XF5B 2V2TB 1HHHA 1PBYA 5I75C 1ZHBB 1CGWA 1S9XA 5DLMH 1OSPL 1KCUH 3RUGE 2VIRB 4Z7VE 1G9EA 1XF4B 5IVXB 4KK6D 5BXFA 1PSKH 5KVDL 5E8NB 3ZDXF 4LSVH 2MQCA 1KLGB 3I84A 2ZUSA 4IS6B 4O02H 4L3CB 3L3IA 1NBZA 1NANH 5C0AA 5FYKD 3TYFB 3QFJE 4DGVH 4AQOA 3MXVL 4M5YL 3TCXA 3W5NA 1KB9K 4OV5A 4ZFOA 1OGAE 3SCMB 5HYSA 2ID5A 4Z7UA 3H3PL 4UDUA 2GK0B 5EU3B 4JGJA 5F21B 1LO0L 4PJIF 1KOAA 4C56D 1PKQA 1J0HA 1FNSL 1XGYL 4DVBB 5I19L 1R5VB 4J3SA 1U8KB 3ZE0E 4Y16B 1DFBL 1U8JA 1EEQA 2ICES 5I75B 4JFDB 5LXGL 3QEHA 1Q72H 1UXWB 2LAAA 1NJ9B 2XKUA 3B3IA 4V2CB 4GMTH 1ZA6B 1IRAY 4UNVA 4L1HA 1XR8A 4AQ1B 2D3VA 3ZKNC 3ARBA 3N9GL 2H3NA 2D31B 2GCYB 4PJBE 4OF5A 1MCPH 5JDJA 4DCQB 3BI9X 1AQKL 5JXAH 1NLBH 1L7TH 1N4XH 4W81A 5L7XL 1KCSL 1TETL 3BP5B 2V5RA 1F6AB 2HLFC 1AR2A 3SDAC 4X0KA 4LSQH 4NNPH 4NKIL 4MJIB 2YHGA 1NMCC 3QIBA 2BNRD 1GVIA 4DW2L 2OM5A 5DRXA 3TH2T 1MEXH 3IJYA 5B3JF 1CXHA 1WZLA 4JDTL 1Z9MA 4P9ML 4X7TA 4JFEB 4Z8FL 5I1LA 2DMCA 3I75A 5IB2B 2PETA 3FB6B 4NQDA 1VADA 3QQ9D 4JPIB 1HKLL 5BZWB 3EYQC 1KF9B 1EJOL 4HCRL 2MCPH 3U4EB 5E6IA 3RGVC 1LE9A 1NH6A 3QR2A 4MNGA 4Y1AB 1OF2A 5K93A 4AL8H 4HJ0D 1HZHH 2VZOA 2W60B 2EKSA 1A6AA 3PWVB 5FEBA 3QIWA 2VLLB 4N8VA 4XP4H 4KKAC 3MNZB 4O58L 2QTEA 2J8HA 4M6OH 1TJHH 4WI4A 4OM1H 1H8OA 3VDAA 2A74A 5AG8A 5I8OH 1D5XB 1OWWA 1RIVL 3O2WL 5IGXH 3SDAB 3GMNB 3CD4A 4U1HA 1AI1L 4I5BB 1KJ2A 3QO0B 3UX9B 3WIHH 2VDMH 4O00A 3BN9C 1T89C 4PV8A 1ZVHA 2HRPH 5IHBA 2X5PA 1HEZB 5EUOA 1GZPA 3BDXA 1YPZE 2EH7H 4E5XA 5EOQH 4ZQKB 5MHSD 1Q0YL 3HTLX 2F19H 3QNXB 3GSXA 4GUPA 5F1SA 3MRGA 3F7VA 4ZXBD 4ERSH 3F5WA 2VLRB 5CZVH 2IH3B 2YBRB 1YMHA 2E27L 4HZAA 4FS0A 2UUDK 2RQ8A 4OCNC 4PJDF 5T1LD 2GFBB 3CVHH 3ZE1E 2HFGH 4L3EE 1AD9A 4JFXB 2JJUA 4X9HA 5D2LF 1CTOA 2YPVL 2AAVA 2W0FA 3IDGB 2BOCB 3QHZL 1MSPA 4NP4H 2EO1A 1EEYA 4HS8L 3SDDC 3NCBB 4HIEB 2WBKA 2H26A 1RUKH 5HYQB 2NY1D 3T2NL 3IFLH 1SY6L 4G6FD 5I6XC 2R0KH 2MHAA 5BV7C 1JVKA 4X9FA 1MCKA 4HC1H 1HNFA 3LPGA 4WI7A 3RUGA 3MUGA 4Z7VA 5HPMB 3UYRL 4MA7H 3OR6A 3QDAA 3BKML 5I0ZA 1CQKA 5TE7L 3KPQA 3MREB 1FCCA 3BUYB 3UTPE 1F97A 3QIUB 3QI9A 4P23B 4I9WE 2H6PA 4N0FB 1MJJA 3ILPA 4M3KB 2DIJA 3ARGA 4WHYG 1OOAA 1K4CA 4P46A 1MCWM 4PTUA 5GSVB 2MMXA 1QSZA 4ZFFB 5F9OL 2A83B 1OGAA 3VXSD 5IEKA 3VWKA 2FB4H 4XCFL 2YK1L 1S8DA 1NAKL 1U3ZA 5FM5O 1SMAA 1BLNA 3LSOB 1HWGB 1G7IB 3GIZL 3RWEB 3TBYA 4LPUA 2QADC 5I6XB 4U1LA 3DUUA 5BV7B 5CJQL 2MTPA 1CE6A 5FYLH 2EEAA 5DJDB 4P2OD 3RU8L 4AENB 2GHWB 4Y2DA 5HXMA 3V4VH 4U1SB 3FT2B 5EDXA 3PHSA 2WWMD 1RMFL 4NC0B 1E28A 4YHNB 2H2PC 1GIGL 3DOSA 4XCYA 3C60C 4HD9A 4GKNB 3NAAH 1XCQB 2O5XH 2X2YA 4HF5H 2WLZA 4PJBA 2ZSWB 4RZCA 4GS7C 4R0LB 1N64L 4WJ5B 5C09A 4ZUUB 2FIRT 4FFZL 1LDPL 5C8JA 3IAPA 1NGXA 3P2TA 2P42B 4C83A 1P2CA 3B2UD 4G80A 4JFZL 4XHQA 5DMGC 3JWDH 4RFNC 1ZLWH 1CZ8L 3QDMD 4N0UA 5BO1L 4P5TC 5ESAA 2Q20A 3HUJF 4EDXA 3PWUA 1MHEA 4WNQB 4QXWA 2QADB 2RAMA 1HINH 2D7MA 2HG5A 3KDMA 2Y4SA 4MXVF 5D5MF 4EN3C 3S4SB 5C0CD 2I9LB 3HAEG 3VGAC 5E99L 2EE2A 1GGUA 2FECI 4UQ3A 4FXGA 4MAUH 3FO2B 5DQJB 3C60B 2LQRA 4TNVF 3GBML 3WFHA 2HJFA 2DWEA 4X6EA 5DWUL 1WT5A 2WIIA 4ZMAT 1NFDE 3MLWL 1A6WL 4AH2A 1HSAA 1U8HA 3R4DA 4NQVA 1J8KA 2DI7A 2ICCA 3QG6A 1UWXH 4WEBH 1TJIL 5TE6H 1ZVSA 3F7PC 4BFIA 2OZ4H 3QXAB 2E9BA 3OJMB 4RFNB 1DANU 3MRDA 3MV8D 4P5TB 3GMPB 2EH8L 2X4QB 4NDMB 4Y4KA 3HCVA 4EOWL 5I1EL 4NO5A 1JTPA 1CXKA 1E6JH 2X4TB 3UJJH 1T1XB 1MIEH 2DQJL 3MACL 4EN3B 3ARED 3DX9B 2XKNA 5ITFB 4K3EH 1YZZA 2OI9C 1BQLL 3KXFA 3VGAB 5EO9A 4KKBC 5B38A 4NCC1 1G7LB 1NGYA 1XIWD 4XBPB 1HDMB 4LLVB 1T2QH 4I77H 5ALCH 4OZHE 5E9DD 4FQ2H 2Y6SC 2CKBH 2ZOLA 3G9VA 1UVQA 3IVKA 4N9GA 5EUKB 4XRCB 5DHVH 4NUJA 4JG0H 4F7EA 3D3VE 3UBXB 1UXSB 3VD7A 1KJVA 4L3EA 4MSWA 1EH9A 2XA3A 3MJ9L 3B9KB 4JPVL 1F8TL 4ZS7L 1C7TA 1S7XA 1DQTA 5D96C 3OKEA 4MYWB 1MCOL 3LEVL 1QSEB 2WP3O 1CDIA 1AXSA 2WBJB 5I1AA 1IC7L 5IV2B 4XWOC 4TSCH 4UT7L 4LFHD 4QTIH 1A14L 4NM4L 2R2HB 5SWZB 4IRZL 4WUKL 1PD6A 2OI9B 1JGLL 1SJEB 1S9VB 4R4NC 4P4KC 1QFWH 4LASL 3DRQA 3SBWC 3VFWB 4NHCH 3OGCA 4F2MA 1JGEA 3D9AH 2NXZD 2P5WA 5TPWL 2V2XB 1FGVL 4ZUWA 4QRPE 5ISZE 4WHYH 5E8EB 4MJ2A 1A7OH 5L88L 1WFOA 1YQVL 2C1OB 5IR1A 3AS1A 2ZUVA 1G9NC 3ORJA 5JLZB 1U8OB 1ND0A 43C9A 5E5MA 5B4MD 1S7UA 2CMRH 1RULL 3NTCL 5T1MB 1WBXB 1ZT1A 3ILQD 3LEXB 5D96B 1L6XA 5JNYA 1HCFX 2W9EL 4CMMB 1IMHC 5HHXH 3VA2C 3U30C 3PJSB 2YRPA 1CDUA 1XH3B 5ALBH 3V4PL 1P4LB 4X6CB 4P2RE 4U3CA 3VG0L 4R7NA 2F5AH 3LVEA 1V7NH 3BSZH 4OFYA 5KOVC 5GGSB 4RAUB 3PV6A 4UQ2B 4P4KB 2D2OA 5D1XD 2PXYA 4HJGB 3MOQA 1QD0A 2IG2L 2YN5A 3D0VB 4AMKH 2NY0B 3GMQB 1EZVY 2BK8A 2DBLL 3D1MC 1NKOA 2R56L 3HC4L 4TVPL 4XCNB 1IGJA 3CFEA 2P5EB 5JHLH 3ZE2E 4JREC 5JO5B 4GJTB 4XWGH 5MP6H 4XP9H 3VDCA 3RX8A 4RQQB 3O45A 3KYMA 3T77B 1PAMA 1XAUA 1YEJL 2DS4A 4HWZA 5F7DA 4R96A 4K3DH 3WLBA 4YBLC 5CEZL 5GGUB 3IDNA 3U30B 4OLUH 1LNUB 5F88B 4PUBL 3WIIL 1QHOA 3QXTA 2D7PA 1OLZA 1NC4A 5JIPA 4LFHG 5C08E 2ICWA 5GXBB 2IEPA 4FP8H 15C8L 3MLXH 2Y25A 2J2ZA 4BQCA 1GGBH 1S7SB 2DWDB 4KH2A 4OJFL 1OAZL 1A2YA 1HE7A 5GGQH 1NCTA 4YHIB 3EO1A 2UWEF 4N5UA 2YC1B 1ORQB 3STZB 3SQBA 4BZ2H 4LSPH 3GKWH 2FBJH 5JOPD 1FYTE 3BKYL 3SKNA 3CSPA 4HKJB 5AYUL 1YY8B 3OKMA 4LF3B 1C5DB 5DA4A 2D4FA 1QR1B 4LKXA 1KIQA 1KCVH 5GISL 4LDOB 4C4KO 4KZEH 4CDGC 4XP1H 2JJTA 1N7ML 3ULVL 1P7KB 1BD2B 4YHMH 3ROLB 4DN4H 1RZFL 4PJCE 3EKCA 2XTJE 4MB5A 1INEL 1Q9LA 4ENED 5ADPH 5D72H 3WHXB 2A38A 2H32A 1JTOA 4QT5B 2VAAB 3ULUC 5LKNA 1QLFA 4OCXL 4XH2A 3LKOA 2D9QB 4OZHA 2IGFH 1T4KA 5IQ9A 4H20H 4I0PC 4JANB 1GYAA 3W9EB 3D3VA 4LIQE 1FNGA 4FMKA 4HKBB 3FFDA 1U8IB 5FGCE 4MNQD 1CL7L 1EO7A 5D4QA 1MFDL 1Y0LB 3P77A 4O2FA 3MRRA 1KTKE 5IIEA 3MRLB 5C07A 1QBAA 3ARWA 3D87B 1T0NB 3LKRA 4NRZB 1S7WA 5E94A 3AC0A 1HXMB 5A16A 3KYNA 1FZJB 4KMQA 4ZOAA 5ID0B 4M62L 2C1PA 3U83A 4HIJA 1D5BA 1EMTL 1JI2A 4OCWH 4Q6IA 4Q9QH 5DD5L 5KJRH 2OR8A 3V9FA 3VXTA 3QEQB 5IF0A 1F00I 2OJEB 3CMGA 3L95B 4P5MA 1A7BA 2HJKA 4XTRD 2R69L 3RIFK 5BQ7B 5DRNA 4O2EB 1JUFA 1XFPA 4MWFA 1JZ7A 3QWOB 4HPYL 4QRPA 4I0PB 5ISZA 1MI5B 3VD5A 2X1XR 5GSRA 2VITA 3Q5YA 2NX5E 2HLAB 4PJIB 5FO8A 4YE4H 3QDGD 3HC3H 4CW1B 2ADJA 3D85A 3VXME 2E7LA 3O2VL 3RIAF 5C0BE 3C5ZB 4QRRD 3ZKXC 1NUNB 4GKZA 3G5ZA 1J1PL 4HLZH 5ITBL 2E9WA 2HFFA 4P2RA 4XI5D 2BRRH 1X3DA 2BSSB 3GSNB 4UV7L 4GBXA 3ULSB 3LD8B 5F7KC 4LP5A 2A0LC 3LS4H 4CU6A 4ONFL 2K7PA 4JRXB 1EFQA 4S0TD 4XNQA 1CXFA 4O9HH 5FA4A 3U2SA 4HPOL 1ZSDB 5H35A 3QCTH 5HHMD 4POZC 4AY0A 1CYGA 1CR9H 5EZJA 2DM4A 1AGCA 1S9WB 2X89D 5ICZB 4OCSH 2QSTA 4OI8A 1WCBA 3OZ9L 3RL1B 4OGAD 4ODXB 1V3JA 5FFLA 3MLYL 4QXUH 1A6VL 4JM2A 2EKJA 3HR5B 3O6FB 1KCLA 4JGMA 2PW1A 4W4OC 3ZKXB 1IGCH 3QZWA 2EIZA 1ES0B 3BEVA 1KTLB 4YNYB 3UROR 5IB4B 1HHIA 5C08A 4OLXL 3FB5B 5SWQB 1BF8A 4PGJA 5F96H 5HHQB 5I8KH 3W2DL 1A4KA 3TO4C 4FQXC 2FEDD 3P9LB 1S7RB 2MPAL 1CDGA 3HMWL 4MXWH 2XRAH 1K8DA 3EJJX 4RX4D 2W1NA 3N85H 2LU3A 1EJ6A 1IE5A 1KNOB 3VGBA 5B3JE 4LCCC 4B53A 3KPSE 1X5IA 5FM4A 1C16A 4OLYH 3QULB 4ZO7A 3SE8H 2XT1B 1DDHB 1VSCA 1FV1A 3EZ8A 4H25B 3PHQB 1QTYT 3C9NA 3U0WL 4M43L 3EGSB 1XCTB 2R23B 2BSRA 5FGRA 3RVXC 1B6UA 4G5ZH 1EEZA 2ADGB 4HFWB 5DQDL 2JB5L 2X4RA 2EDJA 1GPOH 3VA6A 1KLUB 3H3KA 4LLWA 4U0QB 4D9RD 4PJCA 1BJ1H 3O4LD 5AD0B 4XNXH 4MLSA 35C8L 4FQXB 4PJDB 4WY7L 3TC9A 4XCCH 4AEEA 4XBGB 5D7KE 5CAYB 1QP1A 5FO7B 1OAYH 4TUKH 1XGQA 3HI6H 1R5WA 1CFSA 5D2LB 4EI5A 2XG5A 5EBMB 1H8NA 1EZVX 1F4YL 5KW9L 4UZGA 4LCCB 3I85A 4OCMC 5D9SB 3L5WA 2HH0L 3Q3GB 2WZPD 1X5GA 4FZEL 3L7EA 5KSAD 1XF3B 5DJZB 1JYXA 1G6RA 2VR9A 1RD6A 2R39A 4P0DA 3BJLA 1J05A 3ZTNL 4DFHA 4X99A 43CAA 1U91A 5JW4M 5GGVL 4Y4FB 1YEHH 5JDSA 4GKSB 4S1SL 3N0PB 1OAQH 3WUWA 1MJ7H 3KPNA 3HZVB 3TVMA 2XQBH 4K8RL 5HHOB 1JZ5A 4OM0H 4Q6YA 3VFVB 2X7LA 2EE3A 3UTQB 3FRPG 4J3OC 4ZNEE 1DVFD 1YNKL 4FQCH 2ZJSL 3WS6A 2HT4C 5DQ9A 1WC7A 1WISA 1H5BB 4O51B 3QUKA 4KTEL 4OF7A 4WEUD 1XR9B 2NCMA 5FDWA 4KU1A 5EG6C 2E6PA 1CIUA 4YFLF 2GAZA 2X4PB 1JFQH 2NY7H 1OCWH 1VACA 3QJHA 4WDIB 2DKUA 1NFIA 3BKCL 3V6OE 1S3KH 5I9QB 4G6JH 1U6AH 2DQDL 2NY3D 4KK9C 3PQYE 1X44A 3CCHB 4G8GD 4NFBA 2Q7NA 1FG9C 1SHMA 2DDQL 2NX5A 3QUZA 4YAQB 4OZIE 4LSDA 1DL7H 2ESVD 3EYOA 3VXMA 3O8XC 5C0BA 4PD4J 4XNUL 4K3HA 3UDWC 5I1JH 4GRMA 3CVHB 3T3ME 5E2VL 5I30L 2N7AA 4M8QB 4N1EA 3B6SB 1KN4L 2V17L 1YMME 4J12A 4XNMB 3UJIH 5MI0C 1FNAA 4GG8B 4U7MA 5JPMB 1X4ZA 1KT2A 3DSFL 3TFKC 5JQHC 3CGTA 1ZA3B 2YWZA 4TULL 4LSUH 3GUTA 4ZO8A 2JCCF 4Z7WE 1MJ8L 3C8HA 3HE6A 4NJ9H 4NSKA 4YXKL 2Q76A 4YHLL 4X7CC 1MRFH 1CICA 1T03H 1JIBA 2NXYC 4XAKE 3SDCD 1U3JA 3IDUA 3INUH 4P9HC 5T1DH 3MO1A 4KROB 5I76A 3MRCA 3Q1SL 2XG4A 3M8OL 3O8XB 5D5MB 5FYJL 4MNHA 3QDJA 2I07A 4HK3N 3FN0L 4PJHE 3E0GA 2AK4B 2Y1VA 4OFPA 5HYIA 2C3VB 4FABL 5FECA 2F54D 1I1RA 1PG7H 1MVUB 5IBLD 3U0PB 4F57L 1MLCB 1IQDB 1I7ZB 1J86A 3AUVA 2F53A 2ICWI 1J1XL 4WW1A 1T7VA 3LB6D 5DURB 1V3LA 2IQ9L 4P4RB 2H2SD 4U05A 3REVA 3W39A 2QHRH 5CP7A 1ZHLA 4S11A 1A5FL 5F71A 1Z0NA 5HDQL 1NCNA 3KPSA 5K9KA 3WFEH 4PRPE 1K4DB 2ATPA 3GEWB 3SKJL 2A6KB 2B1AH 4MXVE 2BY2A 4Y19D 1GZQA 3QQNA 4HV8A 3SKMA 1U8PB 3IDIA 2BX5A 4NQED 2O61B 1AC6A 1QFWM 1NCCL 3NGBC 3S5LG 1RZKH 1X9QA 4JO3L 3BW9B 1J5OL 1TZGL 5EZOH 2C7UA 4M7JL 2M26A 3TZVA 1T80A 1I1AD 3CIQA 2AJVH 1BIHA 4ODSH 3LMJL 3OJVC 4FFWC 1SYSA 3X13A 2XPGA 1FL5B 1IGYA 1UH2A 3RWFB 2JJVA 2O26U 2HN7A 1J9CT 2J5LC 4PGCA 4HCRA 2IAMD 1IM9D 3V8OA 4CBPA 5DMYA 3D5OF 1N5AA 2FJFB 5HYJD 3ECBB 5EZLA 3W9DB 2NY6D 1YY9C 4LAQH 1QFUH 3T1FA 1NGQL 3SE9L 3LHPH 1LP9E 5HYEA 5I17A 4J23A 2PF6A 4DGIL 4KQ3H 3BGMA 1RUML 1NCAL 1M4KA 1YC8A 2BVQA 5EU4B 5L8LB 3NACH 5C0FA 1F4XL 3MCKA 3BVNA 2NZ9D 4XPAH 4OI9A 2W07A 1UH4A 3NGBB 3OXRB 4L9LB 1J8HD 2BNQD 1WBZA 4IM8A 3IXAB 5DHXB 5D2NA 4FXKB 1INDL 4M4PA 1MCEA 3MBEA 4X4YA 2R0ZL 2HTKD 3G5XA 3EDFA 4TPRL 3RAJH 2P46B 5E08L 4ZNEA 4C56B 3HLAA 1XGUB 2R8SH 5GGTL 1C5CH 4LCIL 5LAXB 3O11B 3GHEL 5AZ2H 2NTFB 3LKQB 4LLYA 1LEIB 4NQSA 1JPTL 4V1DB 4PD4K 1RZGA 3O9WD 3P4MA 3QQ9C 5HHNB 3T0EE 3KLAA 3OKNA 3OWEA 5E95B 3RA7H 2DMBA 5DVOA 4KTDL 3DV4B 1ZT7B 3DIFA 3V6OA 5A2KH 1JNNL 5IROC 2WWKO 5EORL 1B90A 5IT2L 3PQYA 3BAEH 2I60H 4IDJH 4LKCA 4KRLB 4DKEH 3TA3D 4OZIA 4LEXH 4ZSOE 5LGHH 4RWYL 5C1MB 5CBAB 4RGMC 4GQ9L 5D7SL 1I8MA 2ICWJ 3CFCL 1K6QH 2APFA 2GY5A 3DURB 3S37H 1F11A 3WNNA 2I27N 1KXQE 2BNRB 1J12A 1YN6A 1SY6A 4N8CL 3OKLA 1HH6B 3WL9A 1YMMA 3HA0A 3HNSH 4W6WB 4IOIA 3UCRA 4E41D 5EO1A 2YSSB 1IAKB 4UIKL 1OT2A 1X5XA 1B0WA 1U3HD 3MGTA 2K3TA 1M05A 3GNMH 2VQ1B 4WUUD 5F44A 4Z7WA 4M8VA 3MLRL 4JG1L 3GJFK 3C6SA 1M6OB 5T3XL 2FJHA 2Q87A 3CFJB 3H9YA 5KANG 4PP1C 3CJJA 5C0RH 1T21A 2VABA 4M5ZL 5GRYA 3B8SA 1SQ2N 2F9BT 3GGWB 3P0GB 3NFSH 1ZOXA 1YJDH 1E27A 2FNBA 3ULUL 5IFJB 2AJYH 5CGTA 5FUOL 2HWZH 4KKCD 1AGBB 4JQXC 3F8UB 3D0LA 4PJHA 1QFPA 1U42A 3QHFL 1Y6NR 3FB7A 5DK2A 3FONB 4WO4D 3ZYIA 1BX2A 3QXUA 4LPYA 3HN3A 4DAGH 4YHKH 2NY1C 1I9RH 4IDLA 3RTQA 1D5MA 1PY9A 4JDZA 2X70B 1HQRA 5HY9B 1AFVL 1TPXC 5GS0D 1MCRA 1I7UA 2AEWA 3OB0H 3K7UA 3MRFA 1KCKA 4TVPE 4LHJB 4ZXBB 3X12A 4QHMA 2CH8A 1J0KA 4HBCH 5T1KB 2YD7A 1W8OA 3OKYA 3FZUD 4PRPA 1KPVA 1NBVL 3GSNL 5T1LB 2NTSP 3BD5A 3I6KA 3HR6A 4HUXB 3HE7A 5CEZE 1B0RB 2F5BH 4FG6D 1RJYA 5J1AA 2IPTL 1DBJH 3DUSB 1RUPL 1MFEL 2UY7A 1B2WH 1CGSH 4ODBD 4MAYD 2NY1B 1X6NA 5DLML 3S96A 1KCUL 4KPHH 2ZUYA 4G6FB 5FHAL 5J6HA 3SPVB 1FVDA 3K8KA 4NN6B 5JW5B 4YGVB 4WWKC 4UT9H 1PSKL 4MA3B 1T1ZA 4P2OC 5FAAA 1SYVB 4LSVL 3WE6A 2WWMC 4HGWA 3CU7A 3ZT6A 1LP9A 4LCWD 2QSVA 3PGFL 4DGVL 1I1CA 3JSSA 2HKFH 4OZGF 4JFDE 1U36A 2CR3A 4TSBL 4JFFA 4S2SA 3PWJA 3RNKA 3ULVE 2ATKA 4I3RH 4U3XA 1TZIB 1JHTB 3VXSB 3DV6B 5IW6B 4P48A 3IETA 5F1NB 1Q72L 3RDTD 5DRZB 3T8XA 4OZFA 4KI5E 4NCDA 1EUUA 1ZGLP 1HNGA 2EYSB 1UM4H 1MUJA 3BKJL 4FHBD 4P2OB 4MJIE 5E00B 1H15A 5IEHB 1A64A 5IVNA 5E1AA 2ZKHH 4PREA 4NT6A 3AAZA 3K4DA 4WWID 3GSOB 4FQHA 1MCPL 4IRJD 4ZUVB 4JVPA 5HHPB 2G5BB 4JFEE 1T1WA 5F7FA 5JXAL 3QT2A 1N4XL 2EC9T 4YDKH 3NFNB 2GJZB 4RFEA 3MJ9A 2AK1L 4NNPL 2HJLA 1B4RA 3OAYK 1FNHA 1L0XA 2A6DA 2BVOB 4ZSOA 1T0PB 2VDKH 1MEXL 1OB1B 4PG9B 5EC2B 1QBBA 1CE1H 3IJHB 1TTUA 5L8KB 1BFOA 4OGXH 3CX2A 4DWHA 3QDMB 2MCPL 4OF0A 5JR1H 4M9OA 1G84A 1F2QA 2R4RL 5F6HI 2ZUQB 3EYFB 3X3GH 5KZCD 2B5IC 4PG2A 3LZFH 4AL8L 1HZHL 4JRYA 3AREC 1T66D 3O0RH 5C0CB 3T2PA 9CGTA 1FVEA 3TNMB 5IOPA 2AS5M 4KHXH 2J3SA 4XP4L 1OAKH 4GW5A 5GS1A 1AE6H 3GSWB 1TJHL 4OFVA 3MOAH 4AT6B 4OM1L 1FPTH 4UNUA 1FVCA 3NN8A 5I8OL 4LNRB 4XVJH 25C8H 5J57B 1AKJA 3MRPA 5D71L 5DA0B 2XTLA 5KSVA 2Y5TB 1XZ0A 2VDML 1H0DB 1UZ8B 2FX8L 3BWUC 4OGZA 2UUDH 4Y4HA 3LN4A 1BM3L 3RWGB 2HVJB 5D1ZC 4D8PA 2EH7L 3MV8B 1T04B 1UCBH 4XVTH 5DJ0A 2BSED 5EOQL 3UTTD 5E2JA 3CUPB 3JZ7A 2F19L 4WTXA 2B5IB 4PLKD 1I85A 1DQML 5A2FA 4UDTA 5DD6B 3AREB 4ERSL 2N4IA 5CZVL 1DQDL 3MRHB 5JUEH 1LK3H 1JPGA 1XIWB 1U58B 5IMLB 1A47A 1CGYA 1M1SA 2R29H 3CVHL 4QRUB 2XQYG 2YWYA 5E9DB 2NXZC 2B7DT 2ZG3A 3KYOA 2IALB 3DPBA 2A6JB 3ZDYF 3TIEB 4ZUTA 3W0WD 2IBGA 5BMFH 5I1IL 4QY8B 4PJFE 3LKNB 4WEMB 4X8XA 1XF4A 5IVXA 1I3GH 1LO3H 3IFLL 2R1XB 4F7PA 2J8UF 1BBDL 1CLCA 2L0DA 2R0KL 1IC1A 4IRSA 2IBZY 2OXGA 4MB3A 4YPGB 1MFCH 4WI6A 4KFZC 4DK6A 4EVNA 4MA7L 2M2DA 2YEZB 1ROWA 2DYPA 3SCMA 1P5VA 1W0VB 1UZ6F 2ZUTA 2CDFB 2E7BA 2GK0A 3MRIA 4RGOH 5EU3A 4YUEH 3STBA 2D9CA 1ADQH 2NXZB 2FYYA 1I7TB 4DVBA 5E2TH 1R5VA 3ZKSD 4U1JB 4Y16A 4H0GA 2Q8BH 4I0CC 4LBEB 4U6YB 4JFDA 1I3RB 1UXWA 4UILL 5L9DH 1NJ9A 5TDPB 5F6HJ 2FB4L 1TNMA 1ZA6A 4UT6H 3UTSE 4QWWD 1ONQB 1KIRA 3ZKMD 1KJMB 2GSIB 4HMDA 3ALPA 3VWJD 5FYLL 4GO6B 3VH8G 1JZ8A 3V4VL 4CVXA 1WIUA 3L3HB 1S7QA 4TUJB 2ZOKA 3IFOA 1LK2B 1HHGB 1VA9A 1V5JA 4OIIH 5EIIA 5M95B 4X8JA 3MRKA 5D1XB 4QGTA 1AO7D 4G8EA 4MJIA 2O5XL 3TESA 1NLDH 4HF5L 1YN7A 4M7ZC 2ICEB 2H1PL 4ELMF 4JFEA 4JZOB 5FKAB 4HIIB 3SE4A 5IB2A 4DZ8B 4WHTA 1U93B 4JPIA 3MRQB 5BZWA 2R0LH 4RFOH 3MNVA 3U4EA 4GRLD 5FM5M 3RZCD 3PWPE 3U79A 5H8DA 1C08B 1R0AH 1OD7A 4R3SB 5BRZD 3SGJA 1YEDA 4P57B 1HINL 3H3BC 3PWVA 1VPOH 2GJJA 2R4SL 1YEIL 2VLLA 5T5NG 4AEHL 3MNZA 3EFDH 2FDBP 2VLKD 1FGNH 2SEBA 3PHOB 1MRCH 4MAUL 2X09A 5EN2B 4MJ6B 5FB8B 3KPOB 4PYHA 4NC2B 2VRAA 4Q74A 1FAKT 5K9JL 5EU5A 5DEGB 4R97B 4I5BA 2MSPA 3QO0A 5TH2B 4M7ZB 1S9KC 5HJ3B 5D7IF 4EUPG 4EI6B 1Q9WA 5HVFB 2PYED 5TE6L 4RGND 5KSBE 4HLJA 3QUMH 4HW6A 3MYJA 2R1YB 3F12A 5DDHB 1JPFB 4ZQKA 2JCCE 3QNXA 1VGKB 1KJ3H 1YEGH 4TNWK 3QJFA 2NR6C 1QLEL 2IH3A 2YBRA 1L6ZA 1E6JL 1VEOA 4WI3A 4AIZB 1E4XI 1A1OA 3F62A 4C4KT 4OB5H 2GFBA 1EUTA 4K3EL 5C92A 5JW4N 4F80A 4HXAL 2VN4A 3VFMA 3EDDA 3S37X 5BVJA 5F7HA 5ALCL 3RWIA 3GHBH 2V9QA 4NKOB 3EYUH 1SBBA 1ERNA 4H1LG 3KS0J 4JG0L 4XTRC 4HIEA 5CSZB 4LDEB 5HYQA 1MVFA 4WFFE 1I4FB 1RK0B 3O3DB 5SWZE 5SX4I 4D9QE 3BGFC 1E4WH 3ARPA 5FV2A 3OPZH 1S5HB 4FQQB 4ZPTA 1R3IL 4MNQB 2GITA 4RIRA 5HPMA 1Q9OB 2X40A 4TSCL 3ZT7A 4QTIL 4LOUC 1I7RB 2GUOB 4JY5H 3MREA 3PGDB 3HZKB 3QIUA 1QFWL 4P23A 4XBEL 1U3YA 4N0FA 3ARRA 3EOTH 4G43B 2V5YA 3OF6D 4NHCL 4AM0B 4XI5C 2KKQA 4PY7B 3LH2H 4LDLB 2XKSA 3GMRB 2Z92B 4F9LC 2AXFB 1RY7B 3FQWB 5ILTH 1OVZA 3D39D 4JQVA 4MJ5B 3U7YL 4PB9H 3H9HB 4WV1B 1A7OL 4HH8A 1EPFA 3MNWB 3S3PA 5JXED 1IL1B 5BZDA 3LSOA 2G75A 1QKZL 3BGFB 3OV6A 1SEBA 5DJDA 4LVHC 4RAVB 4BSVA 1F45A 4U1SA 3QDGB 5L2KE 4OGAC 3TBTB 4YHNA 1D5IH 5E03A 3UTSA 4QRRB 5F1KC 4Z77A 1V7NL 3BSZL 4YBQD 4GKNA 3X11B 3MZGB 4H8WH 1XCQA 4RISL 2JTDA 3LV3B 3IU4H 5B21A 4XPBH 5CD5D 4ORZC 4POUB 4HUUB 2ZSWA 2DKMA 1N2RB 4R0LA 4WJ5A 5IW1B 2FH6A 5GZOC 4ZUUA 5C0JA 2XI9A 1QOKA 2GYSA 1I8LC 4NKQB 4K71B 4QLRA 5JHLL 4PJEF 4WNQA 4XWGL 5MP6L 1T1YA 1GGYA 5HHMB 3SGKA 1FSKC 3SE3C 4LVHB 4K3DL 3S4SA 4YHYC 1NUGA 1DQQB 3RQ3A 3OAUL 1M7XA 4PS4H 1DUYB 5DQJA 3TP4A 1OTTC 4FP8L 4QHLB 5HVHC 3H3PH 2D4DA 1GGBL 1A1MB 1LO0H 2IBZX 4HUKB 3UTZA 5GGQL 1FZOA 5TQ0H 4NQDD 4YDJA 1SJHB 4EUPH 5LXGH 4PJ8A 3QXAA 2LTQC 3LRHA 4BZ2L 4LSPL 2FBJL 4N1CA 3BRGC 3GI9H 2PO6A 2DI8A 2ZUUA 4L4TE 2X4QA 4NDMA 3W5MA 2YUZA 1N6VA 1RIHL 3O6LH 1T1XA 1FSKB 3V7AG 3PABB 4JZJC 5CZKA 1KCVL 3QA3A 4U6XA 5KSBA 4YHYB 4KZEL 4NZTH 4XP1L 3IKCB 5DJCB 4QOKD 4RSVA 3H9SE 5L2JB 4YHML 4DN4L 5F3HB 4LLVA 5L7XH 3BIKB 5L0QB 5HVHB 5E56A 4XRCA 5D72L 3UBXA 1NSNH 5MEOB 4JAMB 5EC1B 1WAAE 2ITDB 4KKLC 1DVFC 4P9MH 3MRNB 3O4LB 4M00A 4JFYA 4XPGH 3B9KA 1RFDH 2IGFL 2GW5A 1V05A 1UENA 3T09A 3ZL4H 2WBJA 5IV2A 3VRJB 3L3JB 1BZ7B 1N59B 3OXSA 4MD5B 3K4AA 5JHDD 4TOYL 5INCA 5T5NF 2R2HA 5KSAB 4JZJB 5SWZA 2NY3C 1DLHB 1L0QA 1MNUH 4O58H 1CLYH 4X7SH 3FB8B 4JQIH 5LWYH 2BMKA 4PJ7F 3VFWA 3VFPA 3VXRD 4JEGB 5FM8A 4DEPC 4F8TA 4G42B 4JZNA 2YZ8A 3ZSTA 1NUFA 4JN1H 2LAGB 4P2QD 4MMZC 5E8EA 5D7JD 4OCWL 1FFOB 5FUCC 1AI1H 4Q9QL 1BVZA 1QPPA 1ZV5A 2DQUH 3OKOA 4Y89A 3V0VB 1DVFB 5I1HH 1MWAH 5JLZA 1U8OA 2AXGB 4Z7QF 4OQ1A 4OZGB 5T1MA 1WBXA 2NPLX 4CMMA 3O81A 1NC2D 5CHNB 5A3ID 5JOEA 2W65B 3P9MB 1P4LA 3P9WB 4MDIB 4X6CA 3VW3H 2E7CA 3HC3L 4OFIA 4JN2A 4NO3A 4N8VG 4RAUA 3HFMH 1RI8A 1GH7A 3QI9D 4UQ2A 4G8GB 4HHAB 4OGYL 1UC6A 3QFJD 4DEPB 1LEKB 3ARFC 3MFFB 4P46D 2ESVB 3WFDH 3K4ZA 2J6EA 2C3XA 2YPVH 4DN3H 5L2KA 4G8FA 3KPLA 1ZK9A 3DGCR 5H2BB 5F7LB 1WTGT 1II4E 1ZHNB 5DMKA 3LS4L 3IDXH 1JV5B 4HXBH 1CQYA 1AHWC 4RQQA 4O9HL 2FZ3B 1NCWH 1V7MH 4Y8DC 5C86A 4Y2DD 3QCTL 3IDYC 2C5DC 4WU7B 1FZKB 3RJDA 1CR9L 4BSJA 1B3JA 3V5HB 4OCSL 1ZGLB 4MQ7B 1JZ2A 1EHXA 1IBGL 4QXUL 3W11D 1AGEA 3WYRA 1HOCB 2DWDA 3SDCB 4L4VD 2Y72A 4K7FA 1H3UA 3MX0A 3HC0A 1IKNC 4OKDA 4YHIA 3N1QC 1A7NH 4LCYB 4FFYH 2GTZB 4FFVD 2PNDA 1ORQA 5IVZA 1BREA 1YNTA 5F96L 1CL7I 1I1AC 5DJYB 3DNKA 5SWSE 5BS0E 4XCFH 5GRXG 4HKJA 1YY8A 2YK1H 4RA3A 5GGTA 1NAKH 2F58H 4YZFF 4MD4A 1CD9B 1AHWB 2BOBA 4MXWL 2XRAL 1C5DA 4FQ1H 3IDYB 1NBYA 1NMAL 3C87A 3RU8H 3G5YB 1N6UA 4KDTA 1EBAA 1P7KA 4OLYL 3TBWB 4DUWA 1RMFH 3SE8L 4L4TA 3JWOC 1ORSB 4U49A 1Q94A 4IMLA 1AIFB 3WHXA 1T5XA 2VXSH 2WIMA 3I9GH 4Y19B 4YH6A 3BT2H 4GXVH 3CMOL 4QT5A 4G5ZL 1Y6MR 2VAAA 4NQEB 1JRHH 1WIOA 1R3JB 3H9SA 2NZ9C 2NY5H 1RJZA 4XXCA 3LN5B 4AG4L 5HYFA 1I1AB 4XNXL 3SGEI 1HQ4B 4IMKC 4XCCL 4P3CH 5JPNB 5D6DC 5D7LD 2HTKC 3MRJB 5T33L 1OAYL 4HKBA 1WAAA 3HI6L 1U8IA 5KOMC 4FQLH 2VH5H 4KC3B 1Y0LA 1H3PH 3CC5B 1QVOB 1JNJA 3MRLA 2IAMB 4NRZA 5HHOE 4GXUM 1IM9B 4DZBA 4NNXB 1FZJA 1R3LB 5AAMA 5HYJB 5ID1A 5TF0A 4EKXA 2NY6B 5ID0A 3GB7B 4OIBA 1AP2A 4S1RL 5D6CB 1YEHL 3VI4F 1OAQL 4IIQC 5C0EB 1A6WH 4M1GH 4KUCD 4QYOB 3PGCB 4U6VL 1QEWA 2DM2A 2XQBL 4L3ED 3L95A 4Z76A 5BQ7A 1J87A 5DUBA 5CD3B 2BNQB 4O2EA 4CVUA 1U95B 1AD0B 4FQCL 4GMSH 4LLDA 1IM3B 4CADB 3EYQD 3JBG7 2GSGB 3QEUB 3PF2A 3RGVD 4CMHC 4ZFGH 3NZ8B 4CW1A 2Q86B 5F1IA 1UADC 4U3HA 1KULA 4PJXF 1JFQL 2NY7L 3DETD 4PRHE 2Y23A 1OCWL 5KAQG 3C5ZA 5LGJB 3CFBB 1BQLH 1S3KL 3GRWA 4G6JL 5DMIH 1U6AL 5CKAA 3JV0A 3O9WB 2IH1B 4Z7UF 1OL0A 1U3HC 5K9QI 4Z18A 3GSNA 3HMXL 1TTGA 2YD4A 2UZIH 4OUUB 1BPVA 1CK0H 4I9WD 4YC2C 2WWKT 4ODUB 3TA3B 3WJLA 3AY4A 1ZSDA 3P4NB 5I73C 1YUHB 3LEVH 1QO3B 3U82B 4KKCC 4WW2A 1UACH 4RNRB 2Z4QB 1S9WA 3NABH 2BNUA 4WFED 2YS4A 4WO4C 4ELMB 5E6ZA 4LSUL 4ODXA 4L8BB 4NJ9L 2BHZA 3VCLB 1MF2L 4WUKH 3O6FA 5B38G 3JTTB 3S35H 3ZLQC 4E41B 1MRFL 2HFEA 5GS0C 1T03L 4LRIA 1U3HB 4JLRA 3LKPB 1ES0A 4WUUB 5LJYH 1KTLA 5IB4A 5TPWH 4BFGA 3FB5A 2NW2B 4Z9KB 5HHQA 3CX5J 5T1DL 4B41A 3MA9H 3EO0B 4A6YH 5I1DB 3BH8B 3P9LA 1S7RA 5ANMB 3RX5A 3QO1A 3RVTD 3EOYG 1I1FA 1PFCA 5J4MA 3SDDD 5I1GH 4QRQB 4XT1C 3HHRB 2WW8A 5IHZB 2ARJB 4YDIH 5D1QD 2W9EH 1AGDA 5DJXA 3H2WA 5FYLE 3LS5H 5FGBA 4QHUA 5BS0A 5J1TC 3V4PH 1MLBB 1IEAA 3DX6B 3PHQA 4WO4B 4HUVA 2G9HA 5D7IB 1CDHA 4MAYC 3EGSA 1E6OH 3MLVH 1T2JA 2PW2B 2R23A 4ETQA 2QHRL 5JIIA 1BJMA 2ADGA 4HFWA 3WFEL 1I8KB 1DBAL 2Y5EA 4NKDA 2IG2H 5HHVH 2CIKB 2B1AL 3MYZA 3PWLB 4ZTPH 2Z93B 4R4FH 2G2RB 5FF6B 1PEWA 4ZAKC 1EO8H 1WK0A 4XCEB 5EUOF 3JVGC 2RJMA 4GRWH 2R0WH 4OV6F 4XBGA 1G7HB 3M07A 1FN4B 1D6VL 2C3HA 5FO7A 5MEQB 5FK9B 5JIKA 4ODSL 3MFGB 3OAZK 3P4LA 3MV9D 1YEJH 4NUGL 1PQZB 3WJJC 4ZFZB 1K8IA 4LCCA 4U2YA 5DJ8B 2ZCKH 3Q3GA 1MIMH 1XF3A 2CK0H 2RFXB 3EYVB 5DJZA 4ZYKA 1GC1C 2BC4B 3BHBB 2XXCB 2A73A 2ZCHL 4MAYB 2QR0B 4QEGA 4Y4FA 3BN3B 3BH9A 1FAIH 3RDTC 2EXWD 4LAQL 1QFUL 3HZVA 4U7SA 1D9KA 1IAIH 3MJ7A 3LHPL 4PR5A 4OJFH 2GEEA 3QSKB 4KQ3L 5HHOA 1TITA 3UBXI 2KPNA 3MROB 2B4CC 4YJZL 5CUSL 2C4FU 1LMKA 3NACL 5HDBE 3SOBH 2XWJB 4LCWB 1CVRA 5IJVB 4UAOC 1H5BA 2FHCA 3D3VD 5AYUH 3WN5A 4V1DE 4RMRA 2VSCA 3HG1E 3GSVA 3DWTA 3RUGF 1FFNB 1A7PH 4Z7VF 3WIHA 3FQXB 2ADIB 3BP7B 1RVFH 3P0VH 5J9PB 1PLGH 4WDIA 1OSZA 5CMAB 4I4WB 1N7MH 2R8SL 1C5CL 4ACPA 3LN9A 4WRLA 5AZ2L 3QUMB 1ZS8B 1JN6B 3FFCE 5IG7B 4HS3B 4YAQA 3NMEA 3CFKB 1INEH 3GBNH 1T5WB 3RDTB 3VXPA 4OTXH 4OIAA 3RA7L 3M17A 5M94B 5GRVK 1TJGH 4K2UH 2XA8L 1GRWA 3HI1B 1T66C 3RPKA 3CVHA 2QQKH 4KVNL 2BNRE 1KGCD 4OCXH 3PXJA 3BAEL 2I60L 1TMCB 4IDJL 4DKEL 3Q6FB 5F3BA 5ISZD 4XNMA 4IRJB 4LEXL 3GSRB 4GG8A 5DXWA 3ZE0F 5JPMA 5LGHL 3AS0A 4HIHB 1CIDA 4HK3J 4GH7B 1K6QL 1I1YB 3U4BH 3S37L 1IZJA 1CBVL 3GJFH 4XMLL 5J8OA 4KJWD 5I71B 4JFPB 2OTUB 3HNSL 1CXIA 1HI6B 1Q0XL 3RGHA 2Z9TA 4HC1A 2B39A 4NZJA 4P2RD 4PJBF 4KKBD 2VQUA 5MENE 3L1OH 3C6LA 4K94C 2EZ0D 3GNML 4M62H 5DK0B 2DQCH 2DL2A 3NIDE 2EEDA 3T2OA 3O8XA 5KZCB 5L6YH 2FSEA 1NCUA 5HGBB 2P45B 2AK4A 2QQNL 2C3VA 5C0RL 5IWLA 1MVUA 4P2CG 3TNNB 3U0PA 2Q8AL 2FEEI 3NFSL 1IKFL 4X5XA 1YJDL 3FL7A 4Y7MA 1I7ZA 3ET9F 4X4XB 1IC5H 2Q6WB 2AJYL 4LPXA 2OR9L 2HWZL 1WWBX 4Q2ZA 4HUNB 2CKNA 2X4SA 5KAQF 2VDRH 4E0RB 2IQAA 4XWOD 3CDYA 5FA3B 3CAFA 4Y5VC 3PDOB 5HVGB 2NZIA 3MRBB 4NN5C 4YHKL 4UTAH 5CBEB 4AYFA 3WXVH 1K4DA 2A6KA 4WHDA 3LDBB 2E5EA 5DZNA 5ITBH 1E4KC 3TWCH 3VH8B 3BW9A 2VISB 4KKNA 4HBCL 1NKRA 2XV6B 2FR4B 4NHUA 4GW4B 2APXA 1FL5A 4M93C 1FYTD 5IBUG 2VZUA 4BKLB 2VTFA 5K9OA 2F5BL 3X14A 3W0WB 1DBJL 1G0XA 1CWVA 1OT1A 2J88H 2FJFA 1WFNA 3VGFA 1CGSL 3MLYH 3ECBA 3LQZB 4OLWL 1M71B 5DZOA 2NW3A 4K3JL 4NN5B 1FLRH 1P9MC 3KLSA 4QWWC 4NQTA 3GMLA 4JKKA 3ZKMC 3WDIA 4KPHL 1X5YA 5EU4A 4M02A 1JYWA 4P5KB 3ZE1F 4KUCF 1LO5A 5FUZH 4UT9L 4XX1E 3EOAB 4L9LA 2Q3ZA 4U1NB 2C26A 4FXKA 1WWWX 4ZD3H 3H7BB 5E6YA 4ZDHB 2HKFL 1J0JA 2XOTA 1XGUA 1CFVH 5LAXA 3O11A 4EUPB 3P11L 2W91A 3D25B 2NTFA 3LKQA 3DSNA 4L29B 3DMMA 5CINH 2OZ4A 3UPRB 3IRPX 4BQBA 3QNZB 4JKMA 4V1DA 3OR7A 5HHNA 5BV7H 4Z78A 4M43H 4F3FB 4GRLC 1WZ1H 3TVMD 2W59A 3PIQB 4KJQD 3G08B 3QZWG 5ETUA 3DV4A 2EDKA 4JR9H 5DQDH 5C0GB 3VRIB 2JB5H 4APQA 4D0CB 3ES6A 3FFCA 3VWJB 1DBML 2AJZB 2E8ZA 2RIKA 3OAYH 2JJSC 35C8H 2ZKHL 4WY7H 1F02I 2CKBA 1UJ3C 5CJOL 5CBAA 1CN4A 3B2VH 5DHVA 4BELD 2FO4B 4Z0XA 3DURA 1AO7B 2BNRA 5KW9H 4NC1C 3RPIA 1FIEA 1HH6A 3IDMB 4FZEH 4QXTA 4MHHI 3C8KB 1NDMA 4J4PD 5H37G 2NX5D 1IAKA 2VDKL 4RGNC 3VXUD 5C2UB 1CE1L 2EECA 4I13B 3VXMD 2EYTA 4GRLB 2VQ1A 3RZCB 2VE6A 4HH9B 3EAKA 4N0CD 5EU7C 5BRZB 3B8YA 4JGUA 5IROA 1M6OA 5JR1L 1T83C 2Q1EA 3GO1H 3X3GL 4N1HB 3VI3E 3MRMB 2X4NB 2WBWB 1WWCA 3LZFL 5EWIH 4MMXC 3VD9A 3O0RL 4YIQB 1RURH 3GGWA 3IFNH 1XGRB 3PNWB 4OLEA 1KTDB 1T20B 4UNTA 1YEFH 2VLKB 3V4UH 1UJ3B 5I1CH 4KHXL 2MKWA 1VDGA 1OAKL 2AQ3A 1AGBA 2LU7A 4KUZL 3RVVD 3HE6D 4NM8H 4HZLB 1FPTL 3FONA 1MWAB 3MV8E 4OD1H 1NEUA 4XVJL 3FOMB 4NNYB 4PRBA 4YQXH 4G8IB 3QRFM 1JWSB 2PYEB 2BXYA 2GJ6E 1NANI 2ITCA 4RGNB 3DO7B 2V7HA 4M6NH 1PZUB 2BSTA 3WUWG 4G9DA 1LEGB 1KG0B 2BCKA 1UCBL 4XVTL 5E9DE 4ZXBA 3ARUA 2DLFL 3V5KA 5T1KA 1RAMA 1NFDF 1KN4H 5EOCJ 3QDHA 2J8OA 4FTVD 4DJMA 3WO4C 4LVEA 5JUEL 3VFSB 1B0RA 1CS6A 4FNLH 3K81A 1K2DB 1BZ9A 1U2CA 2R29L 4Y8AA 4LLUB 3I3EA 3DUSA 4BSWA 3SN6N 1G7QB 1G7PA 3CPLB 4YXKH 3S35X 3SO5A 3KPSD 2XFXB 5EBGA 5BMFL 4L4JA 4GAGH 3NVQA 2AKRB 1UCTA 4FQIH 1PYWB 2GT9B 2PTUA 3SPVA 1I3GL 1LO3L 2EDRA 2Y9RT 5JW5A 4LEOB 1FFRA 3E6HB 4MA3A 3RKPA 3U9UA 3TZVD 3IAGC 2XICA 2P44B 4I18B 4OZHF 1TVHB 1N0XH 3RWJB 1GGTA 4MA8H 1WFTA 1RQ5A 4S1DD 5EIVA 4YBQC 1U8MB 1NCDH 3BPCB 3KR3H 3QISA 3WO4B 3P73A 3SJVE 5I16B 3O3UN 4P3DB 2IC2A 1FRGH 4RGOL 4YUEL 4IHOB 3B4NA 3CH8A 5D7KD 3QWRA 3T3PE 2VR5A 1S9XB 5E2TL 4ODHL 1J1XH 3D39B 2ZNWA 3VXSA 2IQ9H 1CU4H 3DV6A 3U36A 5BXFB 5F7EH 1A5FH 5L9DL 4LLMB 3ARBC 4PV9A 1ZLSL 4GG6B 1NBZB 4UT6L 3S8WA 2VXQH 3FHQA 2DD8H 3KG5A 3MUJA 2EYSA 2XY1A 5MERA 3VFTB 3K8LA 2DKSA 5E00A 5IBTH 5IEHA 1CGXA 1NCCH 1U8QB 5CS7A 4PJXB 4JO3H 1J5OH 1TZGH 3GSOA 4WGVB 3MBED 5T3ZD 5HHPA 3LMJH 4Z7UB 4UDUB 3QIBC 5H94B 3NFNA 4JHBA 1PKQB 4OIIL 2ZCLH 4PJAE 2UYLA 5E4IA 1G9NH 4HWBH 3QEHB 5EC2A 1OB1A 3ZZ1A 5HGDB 3O3EB 1OAXH 1LHZA 5E6IC 1EXUB 2ERJB 3Q6GH 5EFIB 3L3OB 5TF1H 3BEWB 5C0AE 3O4OC 1ITBB 2R0LL 3V7AE 4RFOL 1OQXA 1K85A 3EYFA 4XHJC 3QIWC 5C0CA 1V3MA 4HX1B 3TNMA 4Q7DA 1VPOL 1P4BH 4YXLH 3NCCB 3EFDL 4X0KB 1INDH 1OP5K 5JOPE 1FGNL 4AT6A 2OK0L 2ZG2A 2XZAH 1MRCL 4LGSB 2IPUG 2M8XA 3IJYB 5DYOB 1YMMD 3ZE2F 2WLYA 3M1BA 4KDWA 5DRWA 4EBQL 4LHUB 4LCIH 5I1LB 4JM2F 5HDOA 4NQDB 1VADB 4X6BA 2CXGA 1H0DA 2Z91A 4CAGA 5GHWL 3TYGH 2HVJA 1OF2B 2ZUWA 3MV8A 1GC1L 1T04A 3P40A 3QUML 1BP3B 4KTDH 3BO8B 2EKSB 1DZBA 4RWHA 4XAKD 2HTLD 4NZDA 5EORH 3L9RB 1KJ3L 1YEGL 4PRID 4D0DA 3S98A 5DD6A 2GJ6A 4GXUN 1ZLVK 2HAZA 3MRHA 1IAIM 3K0WA 4XNZB 2CR6A 2A74B 4QOKB 4X9GA 1XIWA 1U58A 2AJXH 3NIGF 4X7DC 1ED3A 5E9DA 4GQ9H 5C0IA 3CFCH 4RRPA 4PLJD 2IALA 3KPMA 1FCGA 1KJ2B 2A6JA 1O0VA 5D7JC 3TIEA 3H6JA 4LVNB 3GHBL 4N8CH 2R2EA 3SEPA 3RTQD 2VWEC 1NMBL 3EYUL 2CLRB 4QY8A 1GGIH 4MNGE 1QG3A 1TQBC 3LKNA 4E5XB 3VXQA 1RPQA 1L9MA 5TFSH 3GSXB 3NCYP 3TCLA 1GGCH 4PRNA 3MLRH 4JG1H 5C71A 2D0HA 4MX7A 4UBDC 3F5WB 3DI2B 4W6YB 4PJCF 1WTLA 1YMHB 2DQIH 4CKVX 1MY5A 3EZJB 5JHDB 1OPGH 3QBTB 2AABH 4M5ZH 3QI9C 1AD9B 2D03H 3HE7D 5F9JB 1O7VA 1AJ7L 1W0VA 4JY5L 2CDFA 4NFCA 3VXRB 3MV7D 4P46C 2W0FB 2VKXA 3VXNB 1BHGA 2V9RA 4TNWF 1I7TA 5GGSY 4A6YB 2YMXH 3TFKD 1WUNT 5EUOE 3VWKC 1Q38A 1QA9B 2AEQH 4P2QB 4U1JA 2APWA 5D7JB 3LH2L 3B5TA 4LBEA 4U6YA 3RFZC 4S0SD 1OAUL 5FYJU 2VJXA 1MPAH 4RMUA 5TDPA 3SJVA 1TQBB 1RZIB 1JJUA 3HZMA 1DQLH 4PP2B 1MCHA 1S78D 1BECA 32C2B 4Y2DC 5FHBH 2NXYD 5DS8A 1CD1B 1NC2B 2VB5A 2GSIA 4ODVH 2ADFL 2DLHA 4K9EC 4NN7C 4XB7A 3GJEA 3L3HA 2GI7A 4TUJA 1IGMH 3PXHA 3DVGB 4KTYA 3WDJA 1D5IL 1HHGA 1NPUA 5TQ2H 3W11C 3QI9B 2DI9A 2H6PB 4NQCE 8FABB 1MJJB 5D1XA 3CH1A 3QFJB 4H8WL 5DJAB 3IU4L 4XPBL 1JP5A 4GAJH 4XP5H 3GI8H 4PGZA 5JOFB 2IPTH 5IEKB 2Y07L 4QRSA 1PKOA 4I3SH 3NA9L 1MFEH 4JZOA 4HIIA 2CGRH 4TTDC 5HGAB 4DZ8A 4HG4J 1S8DB 2B2XL 1U93A 1BVLA 5TE4L 3MRQA 1BLNB 2QL1A 4NFDA 4LK4A 3TBYB 4JO4H 4PJAA 3RVUD 2IFFH 3GFUA 3DUUB 3QUXA 4UI2A 4R3SA 1CE6B 3FO1A 5FHAH 3H42H 2F74A 3TBVB 4Y2DB 3T0ED 4D9LH 3DX7B 3JUZA 5IFAH 4PJGB 4PLOB 4F33A 3GBLA 4YXHH 3PGFH 4JY4B 1WT5C 4LQ1A 1N8ZA 4PS4L 2YR3A 3RY6A 4G7YH 5CKGA 5HD8D 2MFNA 4TSBH 3HB3D 4PJBB 5EN2A 4MJ6A 4FFWD 4L4VB 1OARH 5DEGA 1BQSA 4JCLA 5TH2A 1NGXB 1YYMH 4C83B 1P7HL 4EI6A 1P2CB 2M1KA 1MCCA 3C2AH 4G80B 5TQ0L 1MHCB 2Z8SA 2ZUXA 3SGDH 2R1YA 3FHAA 1JPFA 3GI9L 1YY9D 4MA1C 2JK5B 1VGKA 1R3HB 2HG5B 3DROB 3LRSA 5I74C 2W9LA 1QFWI 3BKJH 4L9DA 4QNPE 3O6LL 4UOW1 4FXGB 1URLA 4F58H 4RCAA 4MCYA 4UIMB 3D18A 4F8QA 4PBXA