3BKCH

Crystal structure of anti-amyloid beta fab wo2 (p21, formb)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
224
structure length
224
Chain Sequence
VTLKESGPGLLKPSQTLSLTCSFSGFSIRTSKVGVSWIRQPSGKGLEWLAHIYWDDDKRYNPSLESRLTISKDTSRDMVFMKITSVDTADTATYYCARRGFYGRKYEVNHFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSESITCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Amyloid-beta-anti-amyloid-beta complex structure reveals an extended conformation in the immunodominant B-cell epitope.
pubmed doi rcsb
molecule tags Immune system
molecule keywords WO2 IgG2a Fab fragment Light Chain Kappa
total genus 44
structure length 224
sequence length 224
ec nomenclature
pdb deposition date 2007-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bkcH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bkcH01
4MA1B 3IT8D 4XNQB 1WZLA 4KV5F 2ADGB 5FM8A 4YK4C 5A1AA 1F00I 4QF1A 2D2OA 2H26A 3KLHC 5KSBE 4PY8J 4W6YB 3UJIL 5C2BH 1A6AA 3TO4C 2W9DL 4U7KA 5D1ZA 5EU7C 3T0EE 3KXFE 4FQJH 4NUJB 3AREC 1AC0A 3D3VD 2YA1A 5SX5H 3IFLL 3KDMB 3JVGA 1MCQA 1GXEA 1RAMA 1I7UA 2VQ1B 3B2VL 1AQKL 4M43L 4MMZC 4PD4J 2EC8A 1KIUA 3OHXB 3DPBA 1JL8A 3HPJA 2V5SA 1BZQK 2YPLE 1JI2A 1A1NA 3HB3C 5EG6C 1KB5A 1X5HA 3MYJA 4OZGA 4M6OL 5CD3A 2YUZA 5FUCC 2IAMA 1AR2A 1WC7A 3VXUD 4NOBA 1K6QH 4HAFA 4PJAB 1XR8B 2UZIH 2V2XA 5C0BB 3SGJA 4PJGA 5ILTL 1VFMA 4IMLB 3MLUH 5L8KB 4IOIA 3Q3GB 3KJ6L 4IRSA 1OM3H 2E9IA 4UUJB 5GS2D 1UVQB 3T8XB 5FB8A 4NC1C 1WQVT 1YEDB 4GKZB 4I2XB 5A40E 1K5NA 2O5YH 2E7LC 4Q58C 2YD1A 3MODL 4UV7L 1A7PH 2NY4D 4F33B 1JE6A 3RVUC 4A2LA 4G8GB 2R0KL 3MODH 2OS7A 2OBGA 4HIJA 4M6ML 5E9DB 4X9GA 1ES0B 4NBYB 3ULUL 4F7MA 3AMKA 4J3XA 3VRIB 1X5YA 4ODVL 1QD0A 3P11L 4OV5A 1Q72L 4GRWB 2DQUH 1BZ9A 4R4BB 1BX2B 3ROLA 3QG7H 1JPGB 3FOMA 3V0AC 4EUPB 2WUBL 3V4UH 1E4KA 4M4PA 1DQQB 1MHPH 2F54A 4NQVA 3MLTB 4RMTA 3RI5F 4HJGA 4LHUB 4FQQA 3NIDE 5D5MB 5H35B 1QHOA 4JQVC 3WKMH 1ZGLB 5FYJU 1PG7L 4X7SL 3MA7B 1F58H 3R06A 4MMXC 4X5XB 2NLJB 4IOFD 4NNYB 3OAUH 4N1HB 3RUGE 5FGCB 3H0TA 3CVIL 4QF1B 1L7IL 3MLSH 3O3EA 1GGYA 1UADC 1VDGA 5F9AC 5AD0B 2AJYL 5L2KD 5I66B 4GW4B 1OARH 2FZ3B 3I2CH 1PD6A 2OMBA 1J8HD 1WBYA 4OZFH 4PJFA 3S36H 1T66C 4LLWB 4RAHA 3E6FB 3GMPA 4RSVA 1XGQB 1FNLA 4KRMB 4U0RC 5D93C 1JRHH 3GIZL 4LSRH 5BZDB 4S10A 3KPNB 4EBQH 4MVBD 2PYED 4P2QE 5GGQH 3EO1A 3IGAB 1RIVH 3HCVA 2X9XA 4UDUA 3DGGA 2ZSVB 4HX1B 1U91A 3QHFL 5L2KE 1UGNA 3RWGB 2QSCL 4WENB 5ADOH 1MCBA 1QLRA 4DCQB 5FKAB 5IMMB 3VWKD 4DKDC 4LKXB 3P9LB 1XIWB 1H15B 3DSFL 1YN7B 4UT6H 4LSTL 2V9QA 3QDMB 3K1DA 3RU8H 1IAIL 2NY0C 3WN5C 5C8JB 3KLSA 1MCIA 1CICB 5CEZD 1NKOA 2X9YA 4F2MA 4ZO9A 4TVPH 2YMXH 1YMMD 5CZXD 1JYNA 1QO3B 3DXAD 1QLFA 5JQHC 1KSRA 5DC4B 4Z95H 5JNYA 4OGXL 5C1MB 4ZD3L 1D9KC 5DT1L 1A6VH 3V0VA 3BP7A 4NRZB 2AXGB 5EUKA 1INEH 2MHAA 4D3CL 4NKQB 4KRNA 3RWHA 3LQAL 2XA3A 4NFCA 4CADB 4YDKH 4HFUH 1RFDL 4WY7L 4HS3B 1LP9F 3UDWA 2NPLX 2ZOKA 3NPSC 4A6YA 4JCLA 4MD4B 5F7YC 1XIWA 2BMKB 1Q1JH 3C60D 4KZEL 1A4JA 2VZ1A 4U05A 1F3RB 1LD9B 5FO8A 1J5OL 1P1ZB 1FAIH 2QHLA 2VXUL 4ENEC 3BGMB 4OCWH 4X6EB 3TT3H 1DQMH 4M62H 3D9AH 1A1MB 1DSFL 5HYQB 5IK3A 4RGNC 1A22B 5CJOH 5DJAB 15C8H 1FORH 3RZCC 4UIMB 3VXOA 4POUB 2F8OA 4NUGL 3TF7C 3UYRL 4WW1B 1FFPA 1QLFB 3EKCA 3OXRB 3IKCA 1MWAH 1LEGA 4WW1A 4MAYA 4UI2A 2D7OA 5DQDH 5CINL 4D8PB 2IPTL 3NIGE 2AV7A 2NY5C 5EO9B 4L4VB 3GO1H 4HZLA 3HUJF 5ETUA 3CFBB 3VXSE 1PLGL 1R5IA 5FUOH 1NFIA 3ARSA 3VGAC 3G6JF 4ZFFB 3S35H 3TN0A 2DLTA 1FIGH 4ZUUB 1DE4A 1VKXA 2ZNXA 3VFVB 4TSAH 1S78D 5ERWA 2BMKA 4XB8A 5JHDE 4JKMA 2NY5L 2FBJH 5FCUH 1FJ1A 5I1AA 5AAWA 5F9WB 4ZTOL 1C08A 1TQCB 1IL1B 3MRNA 1WJ3A 3PGCB 2EDEA 5EFIB 2W0FB 2BCKA 3MV9E 1Q0XL 3KPSD 4ZO8A 3IDIB 2J5LB 4K9EL 3P30H 3A6CH 4DGYL 1T22A 5CLWA 3LKRA 4NM8L 5DC9B 4PBWD 3DO7B 1MI5B 2FO1A 4XMKH 4GMSH 4Y5VA 3L3GB 3WS6A 5T3XE 1CLYH 4MHHG 4X6DA 1U8IB 2E6JA 2D9QB 3MV8A 3OJDA 1BBDH 1CGYA 1JJUA 1MCHA 2O5XH 2AJUL 1KCRH 4P2CG 3W5NA 4OD2B 3V5DB 3OR7A 4Y88A 4G8GA 5EOCH 4LPXA 3LN4A 1CDIA 3FB6A 4GG6A 5FA3A 2YS4A 4R4FH 1GGBH 2M1KA 1ONQB 5C6TL 1T04A 1QR1B 3BQUC 3IJYA 4M7KL 1HQ4A 2JK5B 1U8HA 1VFBA 2HJFB 4X0KB 2GCYA 1TTUA 4IHOA 4NQDE 1HILB 3LMJH 2EE3A 4TUOB 4JFYA 3K8KA 1IJ9A 1C16A 4TUJB 1REIA 4JFYB 3VG9B 1FE8H 4QGTA 5IG7A 6FABL 3UTZA 1E6JL 2AK1H 4X99B 1JNLL 5F1OB 4D9LL 4WI9A 4MJ6A 4EN3B 2I07B 1E28A 1ZHLA 5DTFB 4Y19A 3MBEB 4JPIA 3WS3A 1U42A 2WIMA 1T1YB 4X7EC 2JJTC 2RFXB 5KSVA 3TNMB 4WCYH 1LQSR 3OSKA 4JFZL 3SE8H 2ZUXA 5I1EL 4MD0A 3DVGA 2YD4A 2G9HB 4EJ1C 1N3NB 2CIKA 3IJSA 4J1UB 2ED8A 1BZ7A 5KZCD 4RA0C 5HYJA 1IILE 1J0JA 1S9XA 4HFUL 4NZUH 5FM5M 3W9DA 3ZL4L 3TBVB 1NCWL 4PRPA 5KANG 3RI5K 3MLRH 2YKLL 3B9KB 4JLRB 2PW1B 2NY1D 1WUNT 4PBXA 3PP3K 3BEWB 2OZ4H 5DMYA 4NQCE 3IXAA 5HGAB 3AMLA 5D6DC 5TDNA 3EHBD 1EFXB 5KTEH 1ZANH 1CZ8H 1K4DB 2X4NB 3MREA 2YPVL 3UJJH 3MRNB 3OTTA 1UH3A 3EJZC 1FFNA 3DVFA 3Q0HA 3MGOA 3MNVA 4R4NC 1BIIB 2FL5A 4BZ2L 1SQ2N 3K4ZA 4DGIL 2VDPH 1YY9C 3MRRA 3T0AA 1S7RB 2P5EE 1OP5H 4M8VA 4OZFB 2GW5A 3S88L 4KRPD 4EXPX 1N3NA 2Q8BH 2P5EB 2H9GB 2RQ8A 3O2WL 4NNXA 4KV5E 1JPFB 1KCRL 3DRTA 2MWCA 3WFDL 1NL0L 2E9JA 1W8OA 2R2EB 4LRIA 1DUYA 5DD0L 3NOIA 2HN7A 3LB6D 5FUCE 4YHYC 5IB4B 4ODTH 3HNVH 4P46D 4ZSOE 4GUPB 2OXGA 5LAXA 2WUBH 3TT1H 1Q9KA 3QXAA 4YHML 1UCBH 4JHAL 3VXOB 2BC4B 1JHLH 2YD6A 3PXHA 3S9DB 1J7VR 2VLRA 4MD5A 2A9NL 4CJ0A 1T6VN 1NGXB 4PJBA 4IHOB 3C5ZC 4N9GA 4YGVB 4PG2A 1RZJH 5FYLD 3RL1B 2G75B 3DV6A 4FQIH 1ONQA 1DE4B 1KELL 1B0RA 4I48B 2VOTA 1HDMA 1B4JH 4L9LA 5GS1A 4MD4A 3MUHL 4KPHL 2EXWC 5J1SC 3SGKC 3WHXB 1MUJA 2OL3A 2DLFL 4LVOC 3AY4C 2J12B 3DSNA 4S1DC 1OAQL 2J4WL 3IDNA 1I9JL 2AJSL 3HC4H 3WLBA 3CX2A 3DO7A 2COQA 3T08A 4P23B 3NMEA 1CL7H 2ATPB 1JPST 2VLRD 1A3QA 5DJXA 5DRWA 3G5XB 3NZ8A 4P2RE 1B6DA 1VFUA 4FRWA 2BNQD 2QQKH 5C0CE 5LVEA 3IKKA 3BKYL 2FATL 4LU5H 1NMBH 5J13C 4PJ9B 3WIHH 5CS7A 3TM6A 4U1IB 2VITB 3FRPA 2FATH 2YN3A 4WWID 3ARQA 1TJGL 4OCWL 1HN1A 3BGAA 2P48B 3NFPB 3MOAL 4JR9L 1BJ1H 3VFVA 1ETZB 2AJZB 5F7HA 4ZSOB 4GKSA 1H3UA 3OPZH 1U2CA 3EOBB 1MCNA 1RUPH 1CD1A 2EEBA 4C56A 3ARYA 5E94A 1H3VA 4QRSB 3U30B 3VRJA 1A6WH 2Z31B 4N5ED 5JA9A 4BSVA 2APVA 5EBMB 2D7QA 3TVMA 1CGSH 4H8WL 4P48A 3IGAA 3EYFA 5CEZL 3IDXH 2CLVB 4O2FB 3ZDXE 5H94B 4PRNB 3EDJA 4PJ9C 1LO3L 3OV6A 2IH3A 4XHJD 5T1KD 4LIQE 3ZDZE 4L4VE 5D7LA 4WTWA 1IM9B 2HRPL 3ET9F 5CBAB 3U0PA 4PJEE 2NY1B 3MFFB 4L8CA 1OAXL 4JPVH 4OZIF 5ADPH 4L4TA 1S7WA 4XMPH 5J06A 2VLLA 4H1LH 3HHRB 1Y0LB 4Y16D 5DJ2B 1U0QA 1OLLA 4G6JL 4CNIB 4LKXA 3MCLL 3W2DH 1EH9A 2MCPH 3KJ4B 5DD1L 4N0UA 4ZYKA 3ULVL 1YEKH 2DQIH 1UZ6E 1CLZH 3H0TB 2IJ0C 2XFXB 5LCVL 4JFQA 2ZG1A 3NFSH 3O2VL 3BUYB 2GYSA 1MFEH 1MH5B 2HJKB 4PG9A 1FFNB 1I9IL 2UV3A 1KEGL 4L3EA 4DK3A 1GZPA 4PJ8A 5EWIL 5GGVH 1HSAB 1G7MA 1ZWIA 4MXWH 4NNPH 4X6CB 3DHMA 4FABL 2EE6A 2P44B 4LSQH 3VA6A 1WWAX 3ESUF 3ECBA 2APBA 2ZJSL 3QNXA 1Q9OA 1S78C 3U79A 3JTTB 2I9TB 2N56A 4M1CC 2VISA 2NR6C 2MOVA 5JOPE 2JELH 4WV1A 5KVEL 2B1AH 4AIZB 1N26A 1QA9A 5GRUH 4WFFD 4PJHF 5DGRA 1HHKA 1T21A 1S7VB 1NEZA 3AXLA 5LCVH 3BIAX 4JKPH 4Z7QF 3O4LB 1NBZA 1FC2D 1S7XB 3DUUB 4H26A 2F53D 3P3YA 2P1YA 2FWOA 1KXTB 3EYVB 3W0WA 2WK2A 3RWJA 3QUML 2XKNA 1QFWI 4XHJC 5SWSE 3VXUE 2QADC 1A3LL 1A6ZB 2P5WA 5CFHA 4IOIB 1I1AB 2IPUG 4I48A 4R90H 2A77L 2X41A 4P59L 3E6HA 3SDAA 3ARBA 1URLA 1V7ML 4N9GB 2DWEA 3CSBA 4YLQT 4K94H 5CMAA 5IFAH 1CFNA 1DVFB 3HZVA 3I02A 2DD8H 4GBXB 1GZQA 3GNML 3RUGA 4X8XA 4TSCH 1MNUH 1EA9C 5IBLD 2WBJD 1DLFL 3LN5A 4CAGA 5ICZA 3J8F7 1F4YH 4QRUA 3QJFB 1BBJA 4KUZH 4KRPB 2AEPL 1B2WL 2V2WA 4PJCB 1N2RA 5HVGB 5GS0C 1BWWA 4KDVA 4ONFH 1HNFA 3Q6FB 4WFEE 5C0AB 2NW3A 3FB5B 3P77A 2JTDA 5GZOD 5D7IB 5E8OB 3H6JA 3FFCD 1HHKB 1T21B 4LPVA 4U1MB 4Z78B 5CZXC 3VXTA 2G5BB 2UYLA 3QIUC 3KJ6H 1OP3H 4F9LA 5KG9A 3F58H 4HS6B 2HJLA 4C58B 5IB5B 1QP1A 1QVOA 5HHOB 1NAMB 1NC2A 1YN6B 1T2JA 3F7VA 4LHQB 3S4SG 2ZCHL 1NC2B 1MRFL 5TE7L 3X11A 1IAIM 4S1DD 4K9EC 4BSWB 4TULL 5CMAB 3RTQA 2Q86A 3DX7A 2OSLB 5DSCA 4YDVB 4U6VL 3RIFF 3QHZH 5JXAH 4L3EB 4KK5C 1P2CB 4KDTA 3MRPA 1IGFH 1AGDA 3X14B 3QIBA 1QBAA 4X5LA 3GM0A 4F15C 1FYTB 3IFLH 2BSTA 4J7RA 1WSST 3OKEA 4MNGB 4ACPA 1RZIA 5I1IL 2J6EL 3BH8A 1NGQL 4X5WB 2D7MA 4Z76A 4PPTA 3O4LA 4WU7A 3WFEH 1ZHBA 3MROA 4GLRH 1IC7H 1DQDL 3GFUA 1FNHA 1X5GA 4PRHB 2E7BA 2NYYD 4Y4HB 4L8SC 3EYUL 4WIQA 2EH8L 4KROC 4JANA 4JKLA 2EYTA 5C0BA 1SMAA 2D3VA 1O5DT 1VADB 3QEHA 1FC1A 1HZHL 3PHQA 2DTML 5C3LD 3HAEH 4MA3B 4O51A 1AO7E 1I3GH 1CWVA 1PYWB 4RMRA 4HIXL 4LCCA 1OD7A 2GSGA 4FFZH 5E1AB 5DUPL 5IB1B 5C0CD 1R3JB 2ERJB 3L5XL 3MLWL 4HT1L 3NN8B 1SEQH 4P49A 1YY9D 2R1WA 2XKNB 1I7UB 2LAAA 5BS0B 3H7BB 3PE9A 4I2XE 3DIFA 4WHDA 1SYSB 4Z7UA 3P0YH 1INQB 3WCYA 3R8BB 4XP5H 3RDTB 3MRQB 4Z7VE 4LGRB 3UTQA 1A6AB 2QHRL 3FB6B 2X4TB 3DI3B 3B5GA 3WJLA 4M1DL 2K1MA 4H20L 1V3MA 3CC5A 3M8OL 4MNGE 3L7FA 3WIHA 3EBAA 4ELME 5BRZB 1LO5B 4ZAKB 2XICA 4KZEH 1Q9WA 1DEDA 2WQ8A 2H2PC 4GG8A 4XZUA 2ZKHH 1YEHL 3CMGA 5I1IH 1CZ8L 2R9HD 4XNYL 3AGVA 4PBVC 4Z7VB 5FV2A 4S2SB 1JTPA 3C5ZA 3QWRD 1MEXH 1VA9A 4LKCB 5DFVC 3G5VB 4Y2DB 4MWFB 5TDPA 4YGAB 5ITFB 3GMNB 4S1RL 2DLIA 1RZFL 3SOBH 3PL6D 1MWAL 1FJ1B 3ETBF 5LGJB 3WSQH 3O2DL 3HS0B 5LGJA 4QTHA 1T1ZB 4JFDE 4TVPL 3X3FH 3HUJA 5KSAD 4L3ED 5FECA 5E9DD 4LSPL 2AI0L 4OAWB 1H8SA 1HH9B 2A6DA 1AC6A 1P69B 3RU8L 4PLKD 5IUSA 1L7TL 3TH2T 4YGVA 4WFHD 5GRWA 3CSGA 1T2QL 3ZTNH 1YEJL 4FQ1L 4LRNH 5D96B 1ITCA 2ZWLT 4TTDC 3I6LE 5CKGA 5E00A 5SWZD 4ZUWA 2BRQA 2AGJH 5C0DB 4YNYB 1AD0B 3D1MC 2D7TL 4LSSH 1A3LH 3L95A 2J8OA 2FIKA 3DX9A 3KPOA 3X13A 1F02I 5DI8B 1FNSH 1ZVHA 3WXWL 4XBEH 4XPBH 2VZUA 1N64H 5HYQA 3QUYA 5FDWB 3SQBA 3TJEL 4RNRB 3K4AA 4K7PY 1UXSA 3IDYB 3GMNA 2A0LC 1RZ8A 3RVTC 4EIZC 5LXGL 4LOUD 2P24B 4ETQA 4WRLA 4ISVB 4M61B 3SEPA 2V2TA 4JG0L 4HS3A 3U0TB 5D8JH 3WO4C 5MEND 1N7MH 1CXFA 3CPLB 2O5ZL 5DHXB 1TIUA 3DXAB 4EVNB 5I8EA 2XNAB 4OLVH 5F1NA 4BFGA 4EI5A 4YBQD 1K4DA 2X4NA 3MREB 1PX3A 4K3DL 1YEEH 3UZEA 5TQ2H 3QUXA 3AY4A 4BFIB 5L0QC 2VIRB 3MJ7B 2DJUA 4JEGB 1YC8A 3BEWA 4TSBH 4V1DA 1EZVY 3QDGD 3ZSSA 5CKAA 1IKNA 4RDQF 4AY0A 3QHFH 1ZKAA 5ANMA 3QIUD 1ADQH 4NKIL 1LGVA 5J9PB 3QEGH 5ISZE 2AJVH 3LH2H 1XGPB 5ALCH 4AL8H 5IGXH 4KQ3L 3GMMB 1E4WH 1QYGL 1ORQB 5JA8B 1XFPA 3IDJA 5EBWB 2ICWB 1YDPA 2APXA 3OXSB 2XI9A 3LEVH 3W5MA 1ROWA 3WNPA 4U1JA 4XVJH 5BMFL 3TJHD 1MJ8H 1AO7D 1IGTA 4O51B 1J1OH 1A7PL 4EN3A 2PKDA 2AEIT 4FTVB 1R3IL 4EOWL 2BNUA 2ZSVA 3QCUL 4K7FA 1NGXA 4PJBB 3SDCA 4IM8A 1IFHH 4KMTH 5KVDH 1F6FB 1GOHA 3CZFB 4PRIE 5EZJA 2W9EL 1I1FA 3OAYK 2JIXA 4X8JB 5LAXB 2FR4A 3MLUL 4TNVK 3MCLH 3W2DL 1JZ3A 1C5CH 4LLUB 1H3WM 4TPRH 5F93C 2BVPA 5F7KC 2W65A 3I50L 12E8L 2Q76B 2UZIL 2YUVA 4QHKI 3PGFH 3ZT5A 3MRBB 5BXFA 4KKBD 5D7KE 1KTKE 2FGZA 4LHUD 4Z77A 3MUGB 4OCMC 4KXZI 4XC3H 2X1QA 2NMSA 5EOCJ 2F54D 3IAPA 1ZLSH 3MX0A 4NQCD 3SPVB 1JHTB 2I9TA 1T3FA 4FTVD 4WTXA 1VENA 3L5IA 2YKLH 4M43H 4PJIA 3V6FA 2FX8L 3MNWA 2OTUA 5D7IE 1YJDC 3ULUH 5KSVB 5HD8D 4YX2L 3O6FB 4KJQD 3WYRA 5MP6H 3CLFH 4RFNC 2NY0D 5DK2B 5K59F 2NR6D 4ZDHB 1QFOA 3FKUS 5T1KB 5D7JB 4CN4A 1Q0YH 1HHGB 2EH7L 5I1EH 4JRXA 2V17L 1MFDL 4OSUH 1GIGH 2F74B 4NHUA 1HOCB 3O45B 3HG1D 4U6YB 4BQ8A 1LO0H 3U9PL 1AGEB 5I19L 5K9OA 2OP4H 5HHQA 1Z3GL 3RWJB 4JQIL 4M5YH 5D4QA 3Q6FA 5JORB 4C83B 4E0RA 5DJ0A 1VFOA 1BZ7B 3BKYH 4FTVE 1KIRB 3ISWA 4RBPH 3AU1A 5MEQA 5SWQA 3TYFA 2NNAB 4N8VA 4M6NL 1ZS8B 1OGTB 1G9ML 4GSDL 4ZUVA 1YNTA 2BNRD 3TLRA 4NN7B 3UC0L 3OKMA 5IMOA 3ULUE 5KBNC 3UJIH 1EERB 1P7QB 5DK0B 2W65B 2YD5A 1T83C 3LRGA 4Z7QE 1II4E 5HHNB 4F37F 4PRHD 4WJ5B 1UWEH 2JIXB 1G6RL 2EC9T 3QA3B 4HIEB 4NBXB 3S88H 1X7QA 5E6IB 2AJSH 3HC4L 2R0WH 3I75A 1WIOA 4YXHH 1AXSA 2Q6WB 2BVOB 3E3QC 4WHYH 3EJJX 4G3YH 3DYOA 2W0FA 2DQCH 1F6LL 4OLZH 1F42A 2E9WA 3I2CL 2BNRE 5JW5B 3C8HA 4J4PA 2WP3T 4NO0B 2IPKA 5DD0H 5HI4D 2IFFH 4JFQB 3WFCH 3I85A 3BP5B 3C8KA 3TZVC 4PB9L 3MUZ1 4HMEA 3ZKXC 5B39A 2X40A 4X6DB 2ORBL 4LIQH 1OL0A 5GISL 1WTGT 4OQ1A 4HS8L 3QQ4B 3CVHL 5ETUB 2PYFA 5C9KA 4UNVA 4UZGA 5F6IB 4LSUL 5C0NC 5CEYB 5KSAB 4MJIE 2NTSP 1FN4B 5F7MC 3VG0H 2W60B 4GAGH 1Y18B 5C71A 3CDGA 1MY5A 3DURA 4WNQA 4G8EA 4YH6A 3VGGA 2XY2A 3BI9X 4BSVB 3VXUA 4HQQH 5F1IB 4J6RH 1Q38A 4HF5L 2E8ZA 1RZ7H 2XWJA 3QNZB 2ITDB 5DJYA 3FO2B 4HJJH 5DEZA 3PWPB 2Y06L 3HZMA 5F9DC 3TA3B 2VZ3A 3W39B 3CD4A 5TF0A 1S9WA 2A83A 2WIIA 1M6OA 3BYYA 2C3HA 4FG6D 1JGUL 3QSKB 1GVIA 2JJSC 3PGDB 3MBXH 5LWYH 4U3HA 1KJ3H 5BRZE 4L4TB 3BAEH 4ODUB 2WLYA 5L0QB 5SX5K 4I3RH 3OWEA 1NANI 4JN2A 5I6XB 3RY4A 2IGFH 3PWJB 1QBLL 3GJEB 4Y4KC 4NRYB 1AD0A 1CLCA 2J8UF 3IF1B 1XR9A 1WWWX 2Y25A 2XYCA 5I1HH 1Z5LA 5I18H 3DLQR 3GSOA 1JWMB 3SOBL 1X44A 3ARED 2YPLD 1WBYB 5I17A 3WNKA 1AKJD 5DJAA 4JPKL 5DRNB 3VXPA 2DMCA 3AAZA 2LVEA 2VLJD 5C0CB 4C55A 2DD8L 2X44D 3ARDD 4NHCH 5GS3A 3FO2A 4Z0XA 3QO1A 3KLAA 4PRIB 4AEFA 1A5FL 4QOKD 5HXMA 4PUBL 1QEWA 2F9BT 2PN5A 5JTWA 2W9DH 1JHKH 4L9LB 1IC5L 3MGOB 3MNVB 2FX7L 5DFWH 5EU4B 2V5YA 3WO3B 3VI3F 5ID1A 4HSQA 1WBZA 3N06B 1G7LA 3GBLA 4EN3D 3UBXG 2DBLL 3FTGB 2FO4B 4YHNA 1SBSL 4PJDF 1FIGL 4PY7B 5E7FA 2VLJE 4P5TB 4M7JH 1MVUA 4XCCL 4P3WA 3JZ7A 3C09C 2VLME 4FZEL 3VGEA 1XR9B 3RQ3A 4G6FD 4M7ZB 1VFAB 4ELKB 4Q2ZA 5FGRA 5TDOA 3H9HA 4FXKA 5KSBB 2H8PB 4PD4K 2IADB 3NFNB 2MMXA 4YQXL 4DQOH 4NSKA 3O4LE 2BZDA 5I73C 4PRDA 4WW2A 4YQXH 3G6AB 3GSRB 5IFHH 3PG2A 1KJ2L 4XNMA 2DLHA 1JFQL 4K7PH 5GRJH 3CFEA 1GH7A 5FKPA 1YPZE 1ZHLB 5DTFA 2GJZB 4I77L 1JVKA 3K3QA 1MIEL 2PO6D 4NQDB 5FEBA 5E2WH 3NN8A 3DGGB 4I1NB 4WW2C 3GSUA 1A1OB 4EZMA 2EE2A 1TVBB 32C2B 2Y36H 2WUCH 4C4KT 3DURB 5DMKB 4HXBL 4R2GD 4YDVA 1DBJL 4M6NH 1A21A 4HIEA 2BP3A 1IGYA 4KGJA 3S35L 4MDIA 3QQNA 2VC2L 5MEOA 2C3VA 4S2SA 3QFDA 4YXLH 1YPZA 3EYOA 1BZ9B 1V3JA 1NJ9B 4P2YA 2GHWB 2CIIA 4G9DB 4K2UH 5FIEA 3QQ3A 3RIAK 3HAEA 3RNQB 1FCCA 3CLEL 4MS8D 5DQDL 1U6AL 3IDGA 2A38A 1W0VB 5HVHB 5TE4H 5AYQA 5JQ6L 3RGHA 2VLKD 5TGBB 3TBWB 1I3RA 1QSED 1WGOA 2O26U 3NH7H 3EFFA 4X5XA 1CVSC 2NLJA 1T20A 2P7TB 4YEEA 3QEQB 2AEQL 3P11H 3PQYA 3WUWA 4Z7UB 2VXTL 4GKZA 2HTKD 1FH5L 1R0AL 1U8QB 4NO3A 1ZAGA 2Q86B 2DBLH 5GGTA 3LS4H 4AMKH 3S5LA 4IDJL 3HC3H 1W72L 4JDZB 4Q9QL 3FN0L 3QHTC 3I50H 3FOMB 2PTTA 5IKCB 3ROLB 2FEDC 3L3IA 5IVXA 4FQPA 5HI5D 3QFJD 2UYLB 3CIQA 4I4WB 5B8CC 4MXVE 1FYHB 5HYFA 4L3CB 5D71H 3QIBC 1QACA 4QOKB 4APQC 3FQRA 4KY1H 2HT3D 2AV1A 3HNTL 4YHKH 3RL2A 4GRLC 2MQ3A 1U8IA 2QLVB 4HCRH 1TXKA 4WI4A 1RZGA 2VDLH 3EDDA 1RK0A 3FFDA 1EIBA 1X5LA 5TDOB 1I1FB 3BHBA 5IVXE 1CD0A 1T22B 4L8BB 4Y1AA 4YHIB 2NXYD 4N90E 1AGDB 3QCTL 3X14A 4FXLA 4APQA 2V5RA 4V1DD 1UKQA 3QEQE 3VH8A 4JY6A 3I02B 5IHUH 4Z8FH 2ICWJ 4LFHG 1UWGH 3CFCH 4LQ1A 3QB7C 5ISZD 3VFTB 4UOW1 1OAKL 1YY8A 5E6ZA 4OCNC 1U8KB 4JY5L 4QGYA 2V2TB 2XN9A 4OZGB 5CD3B 1AY1L 3TA3C 2EIZA 4TPRL 5FF6B 3BSZL 3G6JB 3VXRE 3SPVA 1EUUA 5J7CC 5GGQL 1KOAA 3QUKB 2A9NH 2VQ1A 4P9HH 4ZUUA 4OKDA 3NA9H 4OGYL 5J89A 1TZHA 1UWEL 4PJ8C 4GQ9H 1FSKB 1HKLL 3RPKA 4DGVL 4B5EA 1CFBA 2ED7A 1BFVH 4NFDA 1CS6A 4LVEA 3GSQB 5EIIB 3ROOB 2PYEA 3CVHH 5C0DA 3B9DA 4NN6C 4DGVH 4ELMF 1TZIB 3B2UC 2R4SH 4YPGA 4LIQL 5GISH 3SDAD 1H5BA 5HJ3B 4U1GB 4MXQD 5EO0A 3MJ9H 3KPRD 5GS1C 3NCJH 5DO2C 4LARH 2Q8BL 1AGBA 1CIUA 4YXKL 1FNGA 4X4XA 5AYUH 1W0WA 1A6UH 3G08B 5I19H 4JGMA 1XF4A 1EUTA 1A7QL 1GIGL 3RNKB 5L2KB 1AXTH 4HUVB 4J4PC 2Y7QA 4F7EB 1EXUA 4EEEA 3W39A 1OGAA 4NP4H 4HKJA 3S97C 4ZPVA 4MDJB 2CKBA 1CCZA 3ULVC 2P5WB 3AREA 5DF0A 1GGIH 4BJLA 1GGCH 1HIML 4HUNB 4O9HL 2L7JA 1MFAH 4WWKB 1C5DA 2R4RL 1OWWA 1ZV5A 3B9KC 4YFDB 1R3KB 5KS9B 1KCLA 5C0JB 1CGXA 1DEEA 2DOCA 1AJ7H 2A1WL 3LRHA 4NN5C 1CR9H 3LY6A 1OAYH 1W0YT 5A2KH 3BP4A 5J11B 4OI9A 3B8YA 1N59B 5IFJB 3MR9B 4X6DE 4OIAA 2D7NA 2VO5A 3AS0A 1IM3B 3LKSA 4JO3L 1IM3A 1XGUA 4ZS6D 2VLKB 4JHBA 4U6HB 1ULVA 3L7FB 3OGCB 1T66D 1LD9A 1NMBL 1A7QH 2ADIA 5D2LF 4WI3A 1FV1A 3GGWB 3QZWG 4HPYL 3UTQB 4HH9A 3QUYC 3CXHK 3PF2A 2NX5A 3DETC 4YAQA 1VB9A 1ZT1A 5INDA 4FQCH 1S8DB 2R0ZH 2FJFB 1CL7L 2QJDA 1XGTA 3O3BA 2R1WB 2FSEB 4OM1L 4XCNB 2SEBB 4OLWL 5DI8A 5ACLA 1TQBB 4Y0GA 2W59A 1L7TH 3SCMD 1OD9A 3VFSB 3H3PH 1PYWA 5GIRA 3INUL 1EEUA 4HKXB 2VXVH 1YYMH 4ODXA 5TE4L 5A3IC 2DI8A 4JANB 1NFDF 3QUXC 3G6DL 4MD5B 3QULB 5EBLB 3SKOB 4G42B 4BK5A 1DANU 3BP4B 1S9VB 4WUUB 2DM7A 3T0WA 5F9JB 4QEGA 4WU7B 2NNAA 3LEXA 2R2BA 1YEDA 3GK8H 2E6QA 4WFED 3FN3A 3C6LD 4GMTH 1D6VL 4NN5B 4P3DB 2EXYD 4CMMA 1SY6L 3LZFH 1QNZH 1FBIL 3ARDA 4QRPB 5D2LA 2ENYA 4UIKH 1ETZA 1SMOA 3JBG7 1BEYH 3K1KC 5JW3L 1OP9A 4TVPD 1MJJA 1YEFL 1JUFB 5BVPL 2XN9B 4KHTL 4XPBL 5B8CB 4OV5B 4HWNA 2FB4H 4JRYA 4PJXA 1KJ2B 2X4QB 1JGDA 5DUBB 2FH8A 3CCHB 4XXCC 1HYSD 5HGAA 2YSSB 3MRGB 4IRJB 2BOCA 4MJIB 5DQJB 1A7NL 2MCG1 5A2JH 4QWWC 5CJBA 5T5NF 3VW3H 2EDNA 1CGVA 1LO4L 2B8OT 3VE0A 4F3FA 1U3HA 1L9MA 1WFNA 5GS0H 3LKPA 2DYPB 3IFNH 5AG9A 5T3ZH 1WZKA 3MRKB 4ZQKA 5SWSB 2R2HA 1PKOA 2X42A 3U4BH 4K3DH 1YQVH 1SBSH 3B6SB 5E70A 5JIHA 3WFHA 5IB1A 2BY0A 2JCCA 5F3BA 1BWMA 7CGTA 5CCKH 3QFDB 4ONFL 4PGZA 4UDTA 3OJ2C 5L6YH 4XNXL 3HMXL 5DJ6B 1QFWL 4QXUH 1C8PA 5DQ9B 3BN3B 4ETYA 1XIWC 3LKOB 4A2MA 3BD3A 2OJEB 1X5IA 3NIDF 4HHAA 1NCBH 3T4YB 1FDLL 2VZTA 4XP9H 3QXAB 1UM4L 5IROA 3LPGA 1N64L 2JK5A 2VABA 4YHLH 2ZCKH 4U3XA 1KLGA 1K8IB 2GFBA 5CBEB 3MACL 4ONOA 3IFOB 4LDLB 5BZWA 3U48A 1Z0NA 1XGYL 4FQXB 1JPFA 3KPPB 4IDJH 1E4KC 1JPSL 4K3EL 1V3KA 2G2RA 1YQVL 5E2WL 1BAFH 2EO9A 4PP2A 3PJSA 4PGDB 5DURB 4B53A 4MQ7B 1C7TA 1UA6L 1EEZA 2CR3A 1JGUH 4G6KH 3MRRB 2YOCA 3L3IB 5IVXB 4FQHB 5DJ6A 1L4IA 5SWZB 4KDTC 1PQZA 3AS1A 3MBXL 43CAA 5K9OB 1GJIA 3MLVL 3SGEH 5GGRB 4P4KB 3WBDA 1MSPA 3RVXC 5JW4M 4GRMA 3RTQC 1OWRM 1CBVH 1YUHA 5IP4A 1U8HB 1VFBB 3BJLA 4X0KA 2NY3B 5T33H 1HSAA 1ZWIB 4EI6B 5IIEB 4KKLD 3CFKA 4QRPA 1NLBL 2D7PA 3JUYA 2ARWA 2YXMA 4XWGL 5FM5O 4K9EH 1HNGA 3TN0C 2XQYK 3OKDB 5JLZB 1P7QD 4DGYH 1G6RH 1UZ8A 2DTMH 4P2QD 3ILPA 3MBEC 4HUXB 3CFDB 3QFJA 4PB0L 3OKNA 5EORH 3BWAB 3SE3C 4CNIA 4WV1B 4WEBH 1MJUL 5I8OH 3ARDC 3STLA 1IC7L 4YIQA 5F6HI 3SHSA 4F7PB 1NC4B 3QPQC 3QULA 3RVWC 4R97B 5MENE 2AXJA 3CU7A 4DTGH 1IGYB 1ACYL 3IDMB 2DWEB 4X80L 4GXUM 1GHFL 5H94A 1IGML 2VDRH 2XA8H 1UWXK 1NCDH 1RD6A 4B0MM 1N6QL 1QZ1A 4UQ3B 3EOTL 4J3OC 1E27B 3VI3E 4F58H 1MCPL 5GSRA 3O41B 5I9QC 3QEUB 4KJWC 3MLWH 4KHXL 1YNKH 1AKJB 4R97C 4X6BB 5INDB 1CLOH 4WU5B 4FG6C 3G6DH 5IVNA 5EZOH 4JRYD 5IHZB 1EGJA 3BKCL 3BRGC 3JWOC 1S7VA 1D9KB 4HLZG 1SVCP 1PY4A 4OIBA 4YO0A 3VXUB 1FGNL 5I1CL 4PY8I 1KPVA 4LPCA 1FAIL 2X1WL 5DMGC 1QOKA 2EIEA 1M7DB 1XGRB 2QQNH 3PIQA 4OQTA 2OYPA 3FT3B 4AH2A 3RBGA 2FECL 4UOW0 5BJTB 2J3SA 4HJJL 3C60A 4E42A 5LG1A 5ACZA 4LGPB 2XTJD 5IOPA 3FQXB 1TPXB 2CLZB 2BSRB 3CMOL 1KIQA 4L29A 4YDKL 4G5ZL 5CJ8A 2DQDL 5I8EB 1A2YA 1FIEA 3C5JB 1CU4H 2FJFA 3MTRA 4O58H 3SJVB 2Y5EA 5ID1B 5BQ7A 5HPOA 5E8DL 3GMRB 5CP7B 1T03H 4PRBB 1I4FB 4TN9A 4AM0B 4KZDH 2H1PL 3QDME 4YE4H 2CKNA 3DHJA 3MQIA 3I3EA 4D0DB 5L6YL 1OCWL 4Y4HC 4K71C 5HTSA 1HDMB 5I75C 1J87A 4MAYC 3BPNC 5HHMD 2F19L 5HI3D 2DTSA 5DXWA 5M94B 4OBRA 3H3BC 2X70A 4YC2C 4WI8A 1ED3A 5F96H 1OY3B 3CDGB 2IFGA 3OPZL 1DL7L 1RURH 3U9UB 3MMEB 1MQKL 5TE6H 5CWSB 2F5BL 1MFBL 4Z76B 3ZKMC 4F7CB 4KI5E 5HHVH 4HF5H 5C0BD 4JAMB 4ZMAT 1F4YL 5FGBC 5LQBL 5DEFB 3EZJB 5KVEH 4NRXB 1YMHB 1UKSA 4RAUB 4D94A 1TMCB 2WIIB 4XBPB 1JWSB 1ORSB 3RWCB 3MGTA 2ICEA 1OP5K 3MV7A 4W70A 3PDOA 2LAGB 3FONB 4HGMA 5FKAA 3U7YH 5BOZG 1R3IH 4D9QD 5D96C 1WITA 4DOHB 4UNUA 5LXGH 3ILQC 3B9VA 3V7MA 2L0DA 1RJZA 4MSWB 1FFQA 5JR1H 3OAZK 4UIKL 1O7VA 2NY6C 1BFVL 2MQ0A 4OI7A 1I9JH 3IS0X 2FCBA 3ZSTA 1CD9B 2GEEA 4KQ3H 4XVSL 5C0IB 3FRPG 1EFXA 1XF3B 3ARTA 4GG6F 4PJ7E 1JF6A 5ACMA 5CEYA 5JPMA 4KPHH 1GOGA 3D2UA 2H3NA 4AEHH 5LQBH 2F53A 3DX6B 3QQ4A 3I3DA 1EEYB 1MCEA 3O6LH 3STLB 4HC1A 1OAUL 2P47B 5HGDB 4OZIE 1WICA 2MNUA 2XZCH 4QXTA 2YEZA 4NN6B 4PJEF 5JXED 5E9DA 4AEHL 5B3JE 3D6GA 1SM3L 4KJWD 3VG9C 3WD5H 3G6JA 1DBBL 3IU3B 5I1DB 4LSDA 4TVPE 3BEVB 4CBPA 2BVPB 2FHCA 3S3PA 3NPZB 4QCIA 4Y4FD 4FOMA 4LEXH 5JW5A 5CILL 2NX5E 4HWBL 3ARXA 2PCPA 3PWNB 5E2UL 5JR1L 2OL3L 1LP9B 4Y2DD 3UTZB 1MAML 3HA0A 4FNLH 3T4YA 3SDYL 1GAFH 2BC4A 4WCYL 4Y16B 3C5SA 5F96L 2R1XB 3FQWB 5FHAH 5E08H 1NUGA 2CO6B 1MHEA 3IU4L 3QI9A 4MNQE 4XCYB 3TJEH 5B38B 2BNQE 2VJXA 4NDMB 2OI9B 4P2OD 1IM9D 1OM3L 4M5YL 5KANI 5ILTH 3MV9B 3TVMC 2EKJA 2J8HA 4FFVC 4RMUA 1DQTA 4U49A 1CL7I 5ESAB 3KPPA 5D1ZC 3GHEH 4YHPB 1W72H 3IAQA 4FZ8H 4JO4L 3BWAA 1RULL 4U1HA 4EOWH 3MV8B 1M71A 2R1YB 1N4XH 3LRSB 3ZTNL 4DN3L 2FX8H 5D2NB 1FZOA 2DQEH 3NABL 4HZAA 5LBSL 5MEOB 2XG4A 1FO0H 5FYKH 1JGDB 5DUBA 3KPQA 4HAGA 3T0EC 4QY8A 1ZA3B 1T5XB 2GITB 4LSVH 4G7VL 5DK2A 4PREA 3RDTD 1FNEB 2AK4D 3O11B 5GRVL 1IZJA 4S1RH 1P4IH 3D87B 1NC4D 1KBGL 1EEQA 2HJLB 2GJZA 3HMWL 1S3KL 4NJ9H 1NCCH 1E6JH 4P23D 2A0LD 1N8ZA 3HNVL 5D7IA 4YHPA 4FFYH 1DQDH 2Q76A 2X1OA 2W0KA 3SDXB 5I17B 1MJUH 2N7BA 1UJTA 3SGEI 1LNUA 3GBNL 2EDWA 3C9NB 2NW2B 1JF1A 1CE6A 3NFNA 1IAMA 3DARA 1KLUB 4ODBD 1EAPB 4H20H 2OR8A 1T6WA 1G0YR 4OIIL 3TFKC 4X80H 4HHAB 5CIPH 4MAUL 4XMLH 4MNQB 3QDJB 1LP9A 2VZOA 1LK2A 5IR1A 3U7AA 5EDXA 3ZHLA 3HAEG 1WBZB 4W4OC 1IGTB 2VH5L 3GEWB 4JFDD 3MV7B 3G04A 1P1ZA 4E41A 3EOTH 2VZSA 1MPAH 3TNNB 1MLBA 1ORQA 3CX5J 3SE9H 3X12A 1K3ZA 2GK0B 4X4YA 3X17A 5C6PB 4CVXA 1R5WB 2A73A 5GRVK 4PTUA 2IQAB 2UWEE 4MGXA 4DTGL 5ANMB 1HYSC 2F19H 4Z7VF 4PJBE 3QCTH 5J9PA 5FDWA 4JO2H 3OXRA 1SJXA 4L4JA 4NZUL 4P2QA 4DKEL 4L1DA 5DRWB 3FQXA 3D0LA 4P4RA 1VGEL 2FJGA 4ZNEA 2A9MH 1LDPL 3RX8A 1G7JB 1Y6MR 3QXVA 1T03L 4RFEB 5EZLA 5C0IA 1RFDH 1UACL 1UC6A 3MLVH 3QDAA 3T0BA 4H25A 5F1NB 4ZUWB 2GI7A 1FL3A 1TZGH 2ED9A 3V52L 1JV5A 1NFDB 4M7LL 2V7HB 4WFFE 3DO3A 1U8MB 2ENSA 3ZHDA 1DQJB 3C09B 1X9QA 4YK4B 5DT1H 2YD8A 1RUAL 1MRCL 1FDLH 3MRHB 4OLUL 1B6UA 3WHXA 4G6FB 1MLBB 1ZVSA 2AK1L 1FSKC 4LLVA 1ZE3C 3PDOB 4KK6D 2QADB 1G9NH 1BD2E 4IBLT 5K9QG 1KT2B 5J8OA 1CFVH 2DQGH 4N90D 1U91B 4WO4A 4P0DA 2IQ9L 3WN5A 1IGIL 3UTSB 4DW2H 4MDJA 3DV4A 4N0CC 3WIFA 2CR6A 4HKJB 5IOPB 2CRMA 4PFEA 1C5BL 4I3RL 4XWOC 5BW7C 5E4IA 2H32B 5CWSA 5EUOF 1P6AB 2VZVA 2DQGL 2OQJB 2PXYA 2Y5TA 4P5MA 4Z7WA 4R0LA 2WWKO 4FFVD 4J3TA 1K8DB 5FO9B 3E6FA 1ZEAL 4N1CA 5E2TL 1S7UB 1LK3H 5FO9A 4OF0A 3T0EA 1FVCA 1BFOA 1EVUA 4NQEA 4Y5XA 5EO0B 4DAGH 2V6HA 4ENED 2EC9U 4X4ME 1HCVA 3VG0L 4JG1H 2WLZA 4OF8A 4PJXF 2HT2C 2I25N 3U4BL 5IBTL 4PP1C 2GIYA 4QRPD 5DD6B 25C8H 3ES6A 4Y2DC 4IIQB 2ZUWA 1JNLH 1FVEB 1XCQB 4P2RB 3V7AG 2EZ0C 4MCYB 2BK8A 1AGEA 3BE1H 3O6ML 1I8IB 4O5LH 5H8DA 5J4MA 4OLYL 4PJHA 1FAKT 4XP4H 3MV8E 1D9KD 3NFSL 4RDQG 1MHCA 3V0VB 5EULV 4P4KA 3TA3D 3PWPD 4QHNA 5C0AE 3U82B 2WINB 1CF8H 4LCYB 5MEPB 4F15B 5DEGB 5DRXA 4ALAH 1H0DA 4PJIB 4R8WH 1DUZA 1U95A 3GK8L 3MRJB 1EEZB 3V4PH 3CSYA 4DKFH 5B39B 1KYOJ 5E24E 2E27H 2OCFD 5DVOA 2IALB 1WZMA 1RIVL 1MFNA 4NKDA 1KJMB 4H88L 2VLJB 1FPTH 1JPTL 4U4BA 4QYOA 3TO4B 1NLDH 2PR4L 3WFBH 1FL5B 1GC1L 5A16A 2YPLB 1UT9A 2XZQH 2CO7B 3CFKB 4ODVH 4Y19E 2V2WB 4EDXA 3LAFA 1G6VK 3ILQD 3H3PL 5F71A 1KBGH 4MXWL 4NNPL 4GRMB 4NQUA 3BUTA 3DX8A 4FABH 1KXQE 5C0RL 2WBJC 3NAAL 1T89A 2BNRA 1BOGB 4ZUTA 4MCZA 2IBGA 5IBLC 3RY5A 2FBJL 5FCUL 4F7EA 1DVFA 3C2AL 3HZVB 2XV6B 4G8GE 1VADA 3RVVC 4KUZL 1TETL 1NGWB 2ESVB 4HWEL 4CDGC 4U2YA 2VYRE 4JE4B 4QT5B 5CEXA 2Z8RA 1CICC 2ADJB 4KRLB 1I1CA 3KPSE 1GYAA 5J6HB 3DMMB 5SWSA 1FFRA 3P9MB 3MJGX 4M8QA 2HTKC 1CFSA 4JZNB 4OT1L 3LKPB 1K6QL 1A7RL 1KPUA 3SDXA 4WFGE 4QYOB 3F12B 4HULB 1TQCC 4RX4D 5L7XL 3BO8A 3MC0A 4HWBH 1PVHA 3MRGA 4IRJA 2HT4D 3B83A 5JPMB 3EDEA 4FQQB 1PX4A 2WP3O 3LKOA 1ZHKB 3RZWA 3RRQA 4N9OB 5E08L 1DQML 4M62L 3QG6A 2XNAA 2FL5B 5JHDD 4MQSB 3NACL 1A6WL 4ZS7H 1IQDB 3A67L 3GRWH 4YDJA 3LIZL 5KS9E 4UV7H 3Q48A 5DJ8A 2CRIA 3EYSH 5LGKA 1A7NH 1JHTA 4Y8DC 3SDAB 1ADQA 2Z35B 5EU6B 1SBBA 4MCZB 4X6CA 2JELL 1KGCD 2NY4C 3QJHA 5CD5C 4GAJL 2VDKL 3H42H 5F7FA 1YMMB 2A74B 1KPUB 4HWZB 5BZWB 3S36X 3BPCA 3QCUH 3SKJH 2R2BB 3UJTL 4LCIH 1QKZH 2JJUA 4QRUB 4NQED 1NGYA 1X5KA 4PJCA 5FYJD 4BSJA 4MX7B 1GPOL 3F7YB 4F58L 5E8EA 5EOQL 3CSPA 1HCFX 1QSFA 1CDHA 4IJ3C 1MRDH 4NM4H 1I85A 2Z0BA 4OB5L 2R15A 5ECJE 35C8H 2AKRB 4UT6L 4OGYH 1QLEH 3VXME 2NQCA 5EA0L 2BNRB 1P4BH 1UB6B 5BS0E 3PV7A 4BKLB 4Q9RH 4IRJD 1DLHA 3NCFB 3SY0B 4BQBA 5FO8B 3U6RB 3KAAA 2F58L 3SDDD 4LASL 3MSPA 4OLEA 5FUZH 4NP4L 2AJ3B 5TE6L 4WEBL 3VRJB 3MCKB 1P4BL 3MOBH 1M7IA 3AVEA 4N5EC 1T04B 3RVWD 4RNRA 3MLPA 1T80A 3S3SA 2HKHL 3UBXB 3TEUA 1IEAB 1F4XL 5D1XD 5FK9B 4JG0H 2HWZL 3REVA 4WW2B 5C09E 1P7KA 2NY0B 4TNWK 3G5ZB 4OM1H 2YEZB 4U1SB 2XWBA 3SJVD 3MBED 1BQUA 3VXQA 1CBVL 4OFYD 5KAQF 1KFAH 2WV3A 1S7WB 3PWUA 4LCYA 3D2UB 1DVFC 4ZFGH 4OLXL 3QBTB 2YRZA 2XTJB 5D7IF 3TPUA 3FB7B 1YN7A 4LAQL 4DZ8A 4HUWB 4D9LH 4XBEL 2H41A 5DYOA 3SGDH 3U36A 1AP2A 1N5AB 3UTTA 2IBZY 4PTUB 3MV9D 2AXHA 3F8UB 2DF3A 3UAJC 4Q0XL 1RURL 5EOTA 4DWHA 4Z7UF 3CK0H 3H3KA 4W68A 3ELAT 4ORZC 1IC4H 4NFBA 3PP3H 1T7ZA 1BP3B 5IHUL 4G8GD 3P0VL 4JREC 2WWMC 2YBRB 5TH2A 3EJYC 2HP4A 2YN5A 5DRNA 1MI5D 1R5IB 3V52H 3I3BA 4GRWF 5HPMA 1M05B 5CBAA 1BFOB 1JTOA 1DQJA 4PGJA 1PSKH 3MFFA 4L8CB 2C7UA 1M05A 1JI1A 1HIMH 1CGWA 1HXMB 5FO7A 1Z5LB 3VI4F 5ALBH 1VGEH 1TZIA 4UQ2A 1WFOA 1RZFH 2E8YA 1KB5L 2ATPA 4P5TA 3GI8L 2DDQH 2AQ3A 5FHBH 3VWJC 4LLDB 2E7LA 3PQYE 4X7DC 3HS0A 2X4SA 3MJ8A 4WO4B 3RWFA 5BV7H 3QIBB 1NGPH 2HFGH 1J11A 2GSIA 3P4NA 1NANH 5T1MA 1VEPA 1S7SB 4TQEL 1N0XH 5FGSA 2R4SL 4EI6A 3D85B 3EFDH 1OSPH 3MLTA 4LQFH 3QUMB 4NQCB 2J8UA 4KRPC 2EIZB 4BQ9A 2VR5A 3AB0C 4UB0L 4JDTH 5E1AA 1BD2D 5K93A 4F57H 5HI4C 3FMGH 5GRJL 1L0YA 4AIOA 4WWKD 4PJ9A 3SKNA 4JFPB 4G8FA 4F8TA 3N50A 3B5TA 1BM3H 3P2TA 2GITA 3S34H 4AYFA 1H5BB 4PRPD 5HJ3A 2AXGA 3W11C 5EOCL 1I85C 4L29B 3PDGA 5E5MA 1ES0A 5DJXB 4WHYG 3KYAA 3VDCA 1PDKA 3QXUA 4L8BA 3ALPA 2ATKA 4DQOL 2HG5B 2XQBH 2X9WA 2I60H 3GHBH 5T1LB 2KL6A 1X5JA 4O5LL 3NCEB 4Z0BL 5L88H 3GUTA 2I9LA 4W6XB 1W72B 3UEZA 3T3PE 1HK6A 1MQ8A 5EH1A 3FT2B 1KCUL 4PTTB 3EYUH 3DRQA 2EDHA 4LNVA 1S3KH 1EAJA 1Y6NR 1M4KA 3GI8H 3TYFB 5SWQB 1IKFL 4HC1H 4LLYA 2P42B 2EDYA 3BKJL 4YBHA 2V2XB 2GJ6A 5E4EB 1R5VB 1JCKA 5CD5D 4XAKD 5K9JH 1EMTL 4DKFL 2HLAB 3H2WA 3ZO0A 5C07D 3S5LB 3NIFE 1AXSB 3OKOB 5DMIL 4JKWA 1K2DA 1U8QA 1D5IL 1RIHL 1EAPA 3CVHA 3M1BA 4HUMB 1F4WH 2YPLA 2XZZA 3UO1L 1MF2H 1RZIB 4F7PA 1B9ZA 2P5WE 1ZT4A 2D0HA 3QP3A 1FYTA 4IS6B 4L3EE 4L3CA 1MCOH 1F13A 4ZUVB 2IGFL 4LFHD 3ZT7A 1A9BB 5H37G 2WZPD 1U8LA 5IEKA 4X4MA 2X4RB 3CUPB 2CDEB 4NHCL 3ZYZA 3BP5A 3CDYA 3BZFA 4NO5A 1IRAY 1J05A 4PREB 4J8RB 4O2CA 5BRZD 3VD5A 4NO2B 5JHDB 1CICD 1F6AB 2NTFB 4OD1H 3EZ8A 3ULUD 1GCFA 5J12B 2Y07L 4BFBD 4JO1L 4AENB 1D5BB 2HFEA 4L8SB 5E2JA 4JFXB 4BH8B 4JN1H 5EU6D 3T1WA 3TBVA 4YXLL 1LMKA 3KR3H 1EHLL 1L0QA 3LRSA 3Q5YA 2ESVE 1M71B 3IFPA 1N2RB 4FP8L 1A9BA 1BQHG 1MCOL 5DK0A 3ZKNC 4OCRL 1N5YH 1QPPA 5DMGD 4LLQA 3CFIC 3WNMA 3RGVD 1BJ8A 2Q7YA 2VAAB 2VH5H 3QWQB 3HMXH 3LVEA 2VWEC 3HLAA 6CGTA 3ORJA 1J0ZA 4AIZA 3QUMH 1J18A 4HEPG 1MCFA 2HRLA 5HVHC 5D7LB 4F7CA 5IQ9A 1CFQA 1VACA 3O81A 4PLNC 3PL6B 5C86A 4WUUD 4HLJA 4LSTH 4KDWA 2IC2A 1NUDA 1GRWA 2F15A 3DV4B 4LMQI 4I0PA 3N85H 5E99H 3KPRE 1D5BA 2HKFH 4UAOB 5FYKE 3LPFA 1MHPL 1A1MA 1NCAH 1RVFH 3B3IB 4XPHH 3NCBB 1MH5A 2HJKA 3VU2A 4L4VD 1AHWC 1KTRL 4LLAA 4O4YL 3SKJL 5JO5B 1FVEA 1D6VH 1LEKB 3BJ91 1OT1A 2AXFA 4JPWL 3SDAC 3FAWA 4HDIA 1W0VA 4GO6B 1QEWB 3NA9L 4HBCL 2KQNA 1WAAA 4Z0XB 3VFMA 4XNZB 4AT6A 2GJ6D 4OTXL 3REWA 3RPIA 3GJFA 2XWTB 1AHWA 1OARL 2F54E 5HHOD 3T0EB 4LSVL 1DQLL 1Q9OB 2DQHL 4XPAH 2F53B 2YRPA 3FT4A 4ERSH 2EDLA 2NZ9D 5EA0H 4E41D 3GB7A 1GOFA 4GW1B 5I1JL 2VXVL 4WTZA 3HE7C 4ODHL 1QPXA 1MHCB 5DD1H 1C08B 4PGBA 4QLRA 2FYYB 5TPWL 4OSUL 4HGKC 1ND0A 3WN5B 2XZAL 3GMOB 1RJZB 1XZ0A 1WFTA 1LO0L 3U9PH 4KMQA 4ZPTA 3MV11 5D2LE 4HV8A 1TCMA 2A6JB 1HHJB 1OOAA 3MFGB 1M6OB 1OAXH 2CKBB 1R3LB 4XCEA 2D03L 2FX9L 4XCEB 1JZ5A 3U1SL 1T4KB 4M48H 4QRQA 4ZO6A 3V8OA 4LAJH 1T1ZA 4MA7L 3NVQA 4A6YB 3LV3A 4XPFL 1CR9L 4OGZA 1S7UA 3O9WD 3D25B 5MHSD 4LPYA 3VMNA 2HT3C 4OLWH 4OUUA 2N7AA 3QDMD 1WAAF 4NZJA 4GW1A 2EICA 5IB4A 3FT4B 5KAQG 1Q1JL 1CE6B 1ZSDA 4FHBD 4R0LC 3MRMA 1G0XA 3A6OA 3D48R 1OTSD 3GSXA 3UTSA 4LOUC 5TFSH 3VDAA 3ZDYF 2UVFA 4GAFB 4RBPK 1AJ7L 4WEUD 2JJTA 4XGZB 3CAFA 4NQXB 4YHOL 3EIFA 4FQLH 2FIRT 4G80B 5B39G 1F11B 4MJID 1MVFA 2BHZA 1PY9A 4M48L 1G6RB 3RZCB 2W07A 4MA7H 2D03H 2D0FA 1JN6A 4HLZH 1GGCL 3RZCA 3C87A 4ELMA 3U1SH 2DMKA 3GMOA 5JO5A 4KHXH 5FOJA 4XVJL 3FFCB 3W11D 1XF2B 3VXRA 3CNKA 3RWHB 3RWGA 1MCWM 2B5IB 5C70A 2IF7A 4J3UA 3TGXA 1JWMA 2MPAH 2GSGB 4ZFGL 1ZSDB 4RGOL 4PGCB 3TH3T 2VC2H 1ZA6B 1HI6A 3PHOA 4OF7A 3FHQA 1QO3A 3FT3A 5I1JH 3TFKD 5E2VH 1PEWA 5JIIA 4LLWA 5C2BL 4S1SH 3LOWA 4J3VA 3VFMB 3O6LL 2C1PB 1PFCA 12E8H 2C3GA 5KSAC 4JFEE 3QO0B 4DKAA 2E6PA 1FL6B 2VAAA 2MJWA 3OKMB 5C0BE 3EAKA 4R2GC 3ZT6A 3MV7D 2O5ZH 2Y1VA 3WS3B 5KVGH 1D5ZA 2A6JA 4PV8B 5E56A 1IAKA 4F7TA 3MJ9L 1RUKL 1UKTA 2HMID 4QTIL 4HX1A 4W4NA 3OKDA 4R6UA 2ERJC 3HRZB 3MOQA 3MA7A 1HEZA 3VXNA 4DEPB 2F5BH 2GTZA 5IQ7H 3K4DA 1NMAL 3O4LD 1HHGA 3QQ9C 4EI5C 1BLNB 1D3CA 1G9NC 3SCMB 5HYEA 3SQOH 2CK0H 3T2QA 5C08B 4ZDHA 3RDTC 2MPAL 1H3PL 3D69A 1JGEB 3VXSA 1NKRA 4NM4L 4EUPA 2R0LL 1JF5A 2W38A 5SWZA 4OZIB 3TO2B 2ZUTA 4WI6A 1JMXA 5DD3H 1S7TB 3HB3D 5GSVB 3B6SA 3IDUA 3N1QC 3L3OA 4TTGA 5B22A 3SGKA 1MFBH 1U8LB 5DC0A 3CC5B 4GXVL 2XKSA 4OCRH 3HNTH 3BISA 2IAND 3OKKB 5I15H 5GRXG 4I5BA 5FK9A 4I0KA 4YR6A 1HXYB 3SCMC 5D2NE 1G7IB 4U7MA 3MV9A 2JB5L 3OKYA 4Q6IA 3TBTA 3ZL4H 3H42L 2GTWA 3D0VB 4H8WH 2ARJB 1E28B 3MLRL 3Q6GL 3L3HB 4AENA 4JB9H 5J6HA 4M6MH 4UAOC 5C08A 4JM2A 4DOHE 3P4LA 3RWEA 5CEXB 2R0KH 5B8CA 1UB5B 4TUOA 2Q6WA 1A7RH 5F1KC 2CDGB 5KSUA 1ZT7A 2DLGA 4MSWA 5K9JL 1BX2A 1ZXQA 4AMKL 4FQHA 2HYMA 3KWWA 4E5XB 3R1GH 2Y07H 4PJFE 1NBQA 3RY6C 2VUYA 3IRZA 4Y2OA 3IETB 1ZHKA 3JXAA 2XRAL 4FA8A 4N0FB 5C6WH 4CVZB 2Q7YB 1N6VA 2OTWB 3F6LA 3DRQB 1KTLB 3RX5A 3GIVA 3G6AA 3GSRA 3LD8B 4PRAA 5CBEA 1XGPA 2XTLA 4YEFA 2I5YH 4HZLB 3OJDB 2YA0A 5KSBF 1B0GB 4JFOB 3NAAH 3P40A 2DKMA 3VXRD 3P4MB 5J6GB 2H32H 4K2UL 1MJ8L 2EEDA 4X9HA 2HH0H 1UVQA 3P9MA 3QT2A 5CJ5A 2VABB 4XCFH 2VUOA 2XT1B 4CMHC 3QH3B 3BDXA 3MLZL 1BQSA 1MEXL 4Z7NE 1GZQB 3ULVD 3KPMB 3K46A 2HJFA 3RGVC 3ZKND 1GL4B 3E6HB 5DEGA 1EO8L 3FFCA 1CDJA 2J88L 5FA4A 3RWEB 1WFUA 3QG6B 4LDOB 1RZ8B 2NY6D 1JN6B 5F7LB 3D18B 1D6EB 1PKQA 3QISA 5DO2D 1EJ6A 5AWNL 4N0RA 5IBTH 1GC1H 3RWIA 3L5WA 3OMZA 5D7SL 3C5JA 1HZHH 5DHYA 4HBCH 2DYPA 2DDQL 3TESA 1QFUL 1HHIA 2CKBH 3L3GA 4P99A 5J3HD 3ULUC 5EIQA 3TH4T 5GRYA 3SE4A 3FFCE 3DX9B 5IEHB 1A9EA 3IRPX 3LQAC 3GSOB 1YEGH 3QUXB 4BFIA 2NXYB 1NGQH 3AUVA 4KK9C 4PB0H 1MIEH 3BWUC 4Z5RB 4LMQE 1VGKB 2QHRH 4FFWD 4ALAL 4XRCA 3T09A 4K3HA 3PP4H 4NIKB 3S34L 1DP0A 2IH3B 2XTJE 3MLZH 2RHEA 4AZ8A 4K3EH 4KAQL 2C4FU 1SEQL 1F45A 2DQTH 3CXDH 3PWPA 2R23A 3EFDL 3P0GB 3HZYA 4L9DA 4KVCL 1C5DB 4PTTA 4FFZL 4PJDA 1JK8B 4C59B 4KK9D 4NGHL 3GJFK 4B41A 1F4AA 1XGTB 3AC0A 1UM5H 4URTB 5JMOC 5T5FH 3HCVB 4WFHE 3QZWB 4GT7A 4ZSOA 2I9LB 5FHBL 2X5PA 4ZFOB 1FZKA 5TDPB 4KTYA 4HXAL 1I8LA 3KYNB 3T1FA 2IALA 2VITA 5HDQH 2EDOA 4BA8A 1KFAL 4MA1C 4X4XB 3VFWA 2R29H 5I18L 2BVQA 3E0GA 4OD1L 2C1OA 1ZEAH 3H9HB 4FXKB 1N0LA 4HQQL 1CICA 4G6KL 2AABH 5JXEA 2XWBB 3GNMH 4KI5F 3V9FA 1T83A 4P23A 4HDIB 4HCRA 4JPKH 4LEOB 3FCTA 2JB5H 4RIRB 1Q8MA 4FQ2H 1G7LB 3R06B 4RWYL 3PV6A 2X89D 3PV6B 5JDSB 4OZGE 4NCC2 2PW2B 2AJ3A 5IHLB 2DICA 2JJSA 1YZZA 4OFIA 4JVWA 2XFXA 5EU3B 1G1YA 3FB8B 4HK0B 1CG9B 3OKLB 4Z7UE 5GS1B 3DI2B 1K9TA 5HDLA 2MKWA 2BXZA 5C0CA 4M7LH 4Y4KA 3C60B 4E42B 5LWYL 2MSPA 35C8L 2EEAA 1DBAL 2OK0H 4OLXH 4A6YL 5I8KL 5D72H 4TYUA 3VRIA 2LU7A 1KC5L 4OGAC 5C3TA 4FXGA 3D3VA 3SDYH 1V7MH 3QDJD 4NZDA 5KW9H 1KLFA 1I3UA 2FJGB 1X6LA 3ARGD 2A9ML 3HNSH 5GRUL 2CUHA 4RGNE 3OX8A 2HTLD 5IHZA 1HHHB 3LB6C 3O3UN 4WTZG 5CZVL 3GIZH 4OAWA 1K5NB 2Q20A 3HTLX 1IAII 3LKQA 4X6BA 5FB8B 1MNUL 4JY4B 1RUML 2WSKA 3IAGC 4H5SA 3HC0A 4P4KC 2J5LC 4LVOB 5KVMC 3ZE1F 4PJ7B 3S6CA 4K8RD 3U6RA 1FG2B 3QCVL 4GKSB 1EO7A 4NT6B 2BY2A 3HZKA 4AG4L 4L8SA 3ARWA 5L2KA 4LCWD 2Y4SA 3NFPA 2OSLA 4MWFA 3AFLA 5D7JA 3D18A 1CGTA 1EO8H 2PTTB 3QPXH 1SY6H 4ZFOL 3VWKB 2UZXB 1P84J 1SJEA 3CZJA 3O8XB 2VXSH 4LCCC 5LJYH 2WWKT 3QIWD 1N6UA 1X3DA 4KK6C 4RX4A 3QAZC 4HS6A 2KBGA 4OLVL 2VB5A 1A47A 1AH1A 3FQUA 1YEFH 4G7YL 5DVKA 3GMQB 1UWXH 2HRPH 1AGFA 2HFFB 5D1ZB 1KEGH 1TZHB 1RZKC 3TBWA 1YYLH 5JLZA 4C57C 1QRNA 3B8SA 2B0SL 3L5WB 5IB3A 5CP3A 2DQUL 5DHYB 2P5EA 1FGVH 1MFCL 3ABZA 4M3JA 4X8JA 4F9PC 1Z3GH 2AXFB 3KPSA 4GRWH 3TNNA 4S1QH 3O6KH 3K8MA 3U4EB 4NDMA 4R3SA 5C09D 5ADPL 3A67H 3T3ME 2BNQB 5ALBL 5T5NG 5DURD 3U2SA 3HZKB 4Z6AT 4LEXL 1BOGA 1VESA 2O5YL 3G5YB 2QBWA 4ODWA 2VLRB 3NABH 4RWHA 4ZUTB 2XXCB 3O6KL 5LBSH 4EDWH 5HGBA 4I0CC 2Z93A 4HKZB 1QSFB 1IAOA 3UCRA 1U8OA 4ZOEA 4OCSH 2IANE 5T3XH 1RZGB 4X5WA 3SDDC 3FFDB 3AS2A 4Q6IB 3KJ4C 5IM7A 3MNZA 3VFOB 5FYJL 5IB2B 3O3DB 3CH1A 4X9IA 5BO1H 3AXLB 5AUMB 2A77H 3ZYIA 4ODSL 2RFXA 3UTTD 5EUOB 4JKKA 3CSYB 2EDBA 4QWWD 5EO1B 4PJAE 2CUMA 4QRRB 5T1LD 1AE6L 1K4CB 1U92B 4HIHA 1FLRL 4V2CB 2P43B 1CTOA 4QHNB 1UG9A 1BJ1J 1NBYA 2X2YA 4NYLA 5MEPA 4PGEA 2R69H 5GGSY 1M7XA 1T5XA 5C0RH 5CUSH 3RY6A 4NO3B 4PJ5A 2BHYA 3C2AH 4CVUA 3HRPA 3U7YL 2NTFA 3IXAB 1HKLH 2GTWB 3D0VA 2YWZA 2HKHH 3P73B 4U1NA 4YFLI 3PQYB 3WUWB 5JUEL 2VLJA 1G7IA 1T3FB 2YR3A 5GGTL 3V5KB 3D39A 1S9XB 3W9DB 3KNBB 2X4RA 5EZOL 2R1YA 3TC9A 3RNQA 3V5DA 5JUEH 2B2XH 3H9SE 2QKIB 1T1XB 3RAJL 2XZCL 4HWUA 1VPOL 3SKMB 3D5OF 3H9SB 3VXPB 3EDFA 3ARZA 1OAKH 4NQEE 2P8MA 4JCMA 4X98B 5C07B 1N59A 2EDTA 4GFTB 2VDRL 2DWDB 4JHWH 5HY9B 5JHLH 1I1YA 4X6FB 3WHE0 1JGEA 2AK4E 1K85A 1G7HA 4LCWB 5SX4I 3QUXD 4MQTB 1NCNA 4JHWL 5IG7B 3PGCA 1BAFL 1CE1L 4B7IA 4EQ2A 1F8TH 2X4UB 1PZUB 4WWKA 1TVDA 5CHNB 4GRLB 3ARFC 5J12C 4KKAC 3ZE2F 2VR4A 2EDXA 4PJCE 4KY1L 3BH9A 4R7NB 4RFOL 3V4UL 1AXIB 1ZT1B 3MV8D 1D5ZB 5A16B 4NPYB 3BE1L 3O6MH 2ICEB 3RVVD 3C60C 4GAJH 3G9VA 4LLVB 4PLJD 4P9HL 3TIDB 5CEZH 2ZSWB 8FABA 4OD2A 3C5ZB 3K7UA 3ARFB 5EBLA 5CZVH 3SKOA 3T2PA 2AABL 1J0HA 1DR9A 3WE6A 4TNWF 3X3FL 5E2TH 4LGSB 4M9PA 4ODXB 1CDYA 2H45A 2CRZA 4JFEA 1IC1A 5HDQL 2ADFH 1YA5A 1QSZA 4J3SA 2QSVA 4U1SA 1G7JA 4KQ4L 4YHYB 1UWGL 1BD2B 3JVGC 5M7QA 3QI9C 1QBMH 1ED3B 3GKZA 1I75A 2EYRA 4ONGH 1DEEB 4NJAH 3BAEL 3DYMA 5FYKD 4YHZL 3IVKB 3G6JE 3VXRB 3WXWH 1AO7B 2XACC 1J1PL 4J23A 3QZWA 4M4RA 2BOBA 4NGHH 3HI6H 4NZTH 4UNTA 5F7UA 1UH4A 4UU9A 4QO1A 1E4XH 5C9JB 8CGTA 4CVXB 5E03A 1E0OB 5HYSB 3WSQL 2DQTL 3CXDL 3ES6B 3NPSB 1AD9A 1T7XA 3RGVA 5HD8C 1AGCA 3SN6N 4PV9B 4BZ1H 1EXUB 1FHGA 1U8KA 2CLRA 3TN0B 1DBKL 1UB6A 1RUQH 3AAZB 4MNHB 2BJMH 4XGZA 2VTFA 4FQLL 3C6SB 4RFEA 4UDUB 1VGKA 5GGUB 3RFZC 2E7MA 1MCRA 4MVBC 3VFUA 3DWTA 3JV0A 3MRMB 5BZDA 4XC1L 1LO2L 5ENWA 1WT5A 2C4FT 1EVTC 4M7ZC 4K7PX 2WUCL 2BDNL 3LS4L 4LRIC 2R29L 2DWDA 3QUZD 3EYFB 3WE6B 5IVXF 4S1QL 5DHVA 3MZTA 5MENB 3VWJA 4HWBA 3FQRB 4YIQB 4HJ0C 3GIVB 4PRAB 2A74A 4HWZA 5HDBF 3VXMB 1DTUA 1PGRB 2ID5A 4NNXB 3MRPB 4DVBA 1KN2L 3CFDA 4PV9A 2DBJA 4JKPL 5EU6A 3C8DA 3DX7B 4R7NA 1HHJA 5DJ0B 4QTHB 1CGUA 1I3VA 2ZKHL 3MRHA 4H88H 4OF6A 3HR5B 1XF4B 2XQBL 5BCAA 5CP7A 2XN9E 5TQ0L 3BZEB 1CK0H 1L6ZA 5E8PB 3ULSB 4G43A 5KW9L 4N0CD 4G8EB 2GUOB 4G7YH 1FL3B 3GZKA 3MRLB 1JBJA 4AEEA 2NY3D 4GS7B 5IHBA 5EB9A 2P5WD 3V6OC 2J1KA 4UOJA 3P4OA 5JNYB 2NX5D 3B9KA 5EC2A 5ACZB 4XPTL 2VDPL 4U6VH 4JFEB 4P3CL 2LABA 1CFTA 2NXYC 3MACH 1LO2H 3WNLA 5CLTA 3VRLF 3BXNA 4F37K 5JOFB 2NY7L 4QXWA 3STZB 1KJVA 4KXZH 4Z7NF 2B39A 2Z91B 3MRQA 5BV7L 3V5HA 3HPLB 4HIIB 4XX1G 1NCWH 2X09A 4XWGH 5BS0A 3T77A 2BRRH 1SHMA 3Q3GA 4IRSB 5I1HL 4YDIH 2OMNA 5HGBB 5GGSA 5D70L 2I5YL 4M9OA 3TYGH 4JQXA 1KEMH 2PW1A 5GGSB 3OR6A 4NWTL 5CILH 4XBGA 3NTCH 2PXYD 5DQ9A 3R0NA 4R4BA 5FYLL 4MYWB 2K9UA 5J6GA 5IQ9B 4U6TA 1IE5A 1CFVL 1S7XA 4H26B 5CSZA 2RB8A 4CU7A 1Z9OA 6FABH 5FA3B 3S98A 1U3HC 3BXNB 4JQXC 4MA8H 4XTRC 5J1TC 3MGAA 3VJ6B 4PJEA 5EN2A 5I15L 3ULUF 3AB0B 1KTDB 3AU1B 4QXTB 5MEQB 2YD3A 4OZFA 4JPIB 4PLKC 1NQBA 2IAMD 2Q1EA 2DYPD 3BPCB 4OFYA 4OJFH 3TO4D 5BW7A 5I1LA 4IJ3B 1HI6B 4RAVA 4NQSA 1F4WL 4JFHE 1TFHA 2OR9L 5EU5B 5KZCB 5EZIL 3KLHD 1MHHB 4MB4A 5FAAA 3WLWD 1D5IH 2R0LH 1WCBB 2XPGA 2YSSA 4ONGL 1I1RA 1VCAA 1ZMYA 4XP9L 1NMCC 2VXUH 1RK1B 4R7DA 3ZE1E 4DFIA 4KJPD 5D70H 2KZWA 1UCTA 4HS8H 4NO2A 2ARJA 3EUUA 4MB5A 1G84A 3FRUB 4FQXC 1J8HA 5F7DB 1BHGA 1I7ZA 3O9WA 5DFVD 1ODAA 3LHPL 4M7LT 3BPOB 3EOAA 3V6FB 3X3GL 2IEPA 2BERA 5TGBA 4PV8A 3ZDXF 4DZBA 4MQ7A 4I5BB 2LTQB 2X6MA 3VFPB 4KTEL 4ZYKB 4J1UA 2B20A 4TRPL 4U1HB 3V95A 5HBBA 4UT7L 3KDMA 2H2PD 1H8NA 2X4PA 1X4XA 3DMMD 3DOSA 4FQXA 2H6PB 3EJYD 5FUZL 2CDFB 2OZ4A 3OAZH 1ZLWH 1ZT4B 3GSXB 2H3NB 4KTDH 1LE5A 3VMOA 1K8IA 2BOCB 2ADGA 2AJYH 3QIWA 4L4TE 1F8TL 1KULA 4Z8FL 5I75B 4YBLB 3ARGB 3RWDA 4I3SL 3U83A 3O4OB 2Y72A 1NC2D 1JZ7A 5IMLB 4OFVA 5EBMA 3EDKA 5JHLL 4BFEA 4FTVA 1A64A 3WKML 3L6FB 3VFNB 1MRDL 3ARBB 4G8FB 2N4IA 4QCIB 4S1SL 4LP5A 3HE7D 4H8WC 1O0VA 4GG6B 1VPOH 5DGQA 4ZFFA 5GHWH 3FT2A 4PRBA 3BMVA 4FQXD 4FFYL 1NCCL 1WZ1H 5AG8A 1XAUA 4YHOH 4D0BB 2LU3A 2P49B 4MJ5B 1X5AA 3MUY1 5AWNH 4NQXA 2G60L 3D9AL 2P8LB 1NBZB 3FN9A 3GUTB 5DJDB 2IADA 4QHUA 3V6OE 3S36L 5F9OL 4NQDD 2M26A 5F9JA 1HYRC 3F7PC 4XMPL 2AAVA 3UTPD 2VWEE 5C0GB 4RRPG 3NBNA 3VFUB 2Y9RT 4Q9QH 4RFNB 1A14H 1DL7H 1MI5E 5CIPB 5MI0B 4NRYA 4LRNL 3SO3C 1A3RH 5D7LD 1YEKL 1EZVX 3INUH 3MO1A 1I7RB 4XTRD 5BRZA 2YC1A 1AIFA 1INEL 3CDCA 4IRJC 5CJQL 4YO0B 5KVFL 1KN4H 4H0HB 1A6VL 1AD9B 2X05A 3RGVB 3S7GA 4F9LC 4N0YL 3FB8A 1DFBH 3ARRA 5IESL 3EO9L 4ZFOA 2WBJB 1GGIL 3OZ9L 4S11A 1JTTA 5BQ7B 3VXSD 3P4NB 3ZE2E 2PXYC 5JDJA 5E8DH 3HUJB 2YMXL 3RWFB 3ALXA 5L8LB 5EOTB 3I9GH 1NUNB 5F1IA 3H7BA 2HVJA 5GSRB 4LLDA 4YX2H 4I0PB 2G60H 5C0FA 2DI9A 1QRKA 4JRYE 1P9MC 3DYPA 4JM2C 1C7SA 1IQWL 1FGVL 1G7HB 4LCWA 5DJ2A 3B9EA 5GZND 5BJTA 1CXHA 1XGQA 5I71C 3I9GL 1JZ8A 3IF1A 4GUPA 3G5VA 3JTSA 3TPUB 3V7AE 2C7UB 3SQOL 2FX9H 3FN0H 2YK1L 4YDLB 5HYJD 1IM9A 1UQSA 5INCB 2DMBA 3V6ZA 3BVNA 4AG4H 1F4XH 3TIDA 4M7KH 3KYNA 3KYKL 2IH1A 2FZ3A 1KN4L 1JGVH 2Y6SC 2A83B 3BW9B 4ONHA 5HHPA 1I8MA 4CW1A 1E4XI 3B2VH 5FECB 1R3KA 5DJCB 2R2CA 1A4JB 1NLDL 3OKLA 4AM0A 4E0RB 1MELA 1CLOL 1YECH 3L3KA 3BQUD 1U6AH 1EDQA 1MREH 5DJZA 4OF3A 1HQRB 4G6AD 3R0MA 3KPNA 1U41A 1QFHA 1OAUH 4MJ4A 5HI3C 4MLIA 1BQLL 3A6BL 4U1IA 4WGVB 4QNPF 2AVGA 4YXKH 4A6YH 4M7JL 3JWDL 3PWUB 1KB9K 3ZHKA 3BZFB 4JGUA 4C56D 1XF5A 4LK4A 3ZDZF 1OB1A 4MA3A 1NFDE 3H9SA 5D8JL 4ODTL 1IT9L 3BP6B 4GG8B 1DN0B 1PAMA 2G2RB 2PYEB 1KPRB 1MJ7L 1S5HA 5C8JA 2CIKB 1IC5H 4HIJB 3MXVH 1T7YA 5F21B 3ILPB 2VKWA 3P9LA 2IBBA 4TSAL 4OZHB 5K9KB 1N5YL 1HE7A 4U3CA 1INQA 3RDTA 4XNZC 4PJIF 4CN1A 1GSMA 2YPKB 5KS9F 3K0WA 3QUKA 1K2DB 1ADQL 4NKIH 1JZ2A 5GZNC 4IMLA 4DK6A 2Z93B 4HKZA 2OJZH 1A7OH 2FECI 5I1KH 2DIAA 5GS2H 2LU4A 4KI5C 2VDLL 3MYZA 2C5DC 5I6XC 5E6ID 4PJGB 3MXWL 1TTGA 3QRGH 3HG1A 2BNUB 2NY2B 3ZKQD 3RL1A 2ZCHH 3VFRA 5GQBA 1XR8A 3JV6B 1QRND 4JFZH 5JMRA 3QEHB 3TCXA 4U1JB 4Y5YB 1SJHB 4HUUB 4OZ4A 5B3NA 4X98A 3D39E 4Y4HA 1NAMA 1YN6A 3QDJE 4ZUSB 3C2SA 4JM2B 3WFHB 4Y1AB 5A2FA 5FYLH 3STZA 1V05A 1OW0A 1D5MB 4QRTA 2Y23A 4JM4L 3WMSA 1AI1L 3O3EB 4JJHA 1NPUA 1UFUA 4KUCF 4LHUG 4PJ9D 5BO1L 3BO8B 4UTBL 2PYEE 2YWYA 3QI9D 1QKZL 4RMVA 2LVCA 2AEPH 4MA8L 1MRCH 1KJMA 1B90A 1MF2L 2H9GA 1I8LC 3P4OB 4JFXA 3AS3A 4XNQA 1BBJB 4LF3A 1QG3A 3QQ3B 4IIQC 4U0QB 4XX1E 5DD5H 4ZG1A 4PJXB 5DSCB 2D7TH 4S0TD 2X4QA 3OKOA 4EVNA 3X11B 5FF6A 5CSBA 2GAZA 1TCRA 3EYSL 3VD9A 3ALWA 2NXZD 3HE6C 1V7NL 3VWJD 5DWUH 5J1AA 3F7VB 1YEGL 1Q94B 3KPSB 4PLOB 2HLFD 4QY8B 2M2DA 2EECA 1J8KA 5ERWB 1G7PB 4P46B 5C08D 3HG1B 4XPTH 4PRPE 4NM8H 1ZK9A 4WI2A 1HQRA 3LQMA 5BXFB 5D2NA 3ARPA 5IB3B 2GSIB 3HRZA 5FFLA 3TJHC 3BUYA 3QEQA 1IGJA 3CH1B 5L7XH 2AJUH 2IFFL 4LLUA 1FNFA 1MCPH 4UT9H 3T8XA 1BREA 4JZNA 4KVCH 4OZHA 3WIIL 5K9KA 4MAYB 4XNMB 3OX8B 2AS5M 3BPNB 4XAWH 3U9UA 1TITA 2X4OA 3UTSE 4I13B 4XPGH 1KCVH 4OZ4B 1UYWH 2CKBL 3OJVC 3PP4L 3QR2A 4UBDC 5D7SH 2VXSL 2FEEI 4EI5D 1A6TB 3T0DA 1GHFH 4KVNH 5ISZB 4NOFA 4GRLD 5IVOA 4LSUH 3DMMC 3OQ3B 4R3SB 4OQTH 1UH2A 5I0ZA 1U8JA 4LNRA 3C5ZD 4P5TD 2J88H 3OHXA 1ZOXA 3LCYA 2PCPB 4OLYH 3IJYB 5I8OL 3W0WB 3BPLC 4RCAA 4EQ3A 1T1WA 1VEOA 3MRIB 3MRCA 4ZOAA 1NAKH 4PB9H 3DUUA 1H5BC 3CVIH 3GSWB 5L2JA 4GAYA 3PDDA 3MJ8B 1EHAA 3L3KB 3WKNA 4GMTL 1WWCA 3FJTA 4NJ9L 1S9VA 1S5HB 3WLWC 3FQUB 2B4CC 3LEYL 3L3OB 3UYOD 2VISB 4U6HA 2H2SC 5GJSL 1OHQA 3QNXB 4U1GC 2IAMC 5HDBE 3JTTA 1QBLH 5EC2B 2ZUQB 2OX5A 1PSKL 5IWLA 1Q9LA 4XXCA 2A1WH 2IMMA 1PZ5B 2LFGA 1AR1C 2ZSWA 8FABB 3TCLA 1MJJB 4H0IA 3T1FB 4I9WE 1BGXH 2H2SD 3MV7E 4W4OA 5AZ2L 4XVUC 2BJML 2BVUA 3CK0L 2UY6A 2UY7A 5C0JA 4C54A 4MJ5A 3MRIA 3EHBC 3T65A 1INDL 1MIML 4MCYA 4PG9B 1QSEA 2GK0A 4ZNCD 3GGWA 1QSEB 2ZUQC 1XCQA 3FO1A 4P2RA 3WNNA 4M93B 3ULVE 3HZYB 5T3XD 4ZPVB 3QXDA 3OJMB 4YHZH 3VFNA 1T0MA 4P5TC 3VWJB 4JN1L 4P23C 3RBSA 1IFHL 4KMTL 4NKMA 5IMLA 5F97E 2AV7B 4OKVB 4NKMB 5ICXB 3PWLA 2ADFL 4H25B 2YZ8A 5E2UH 1AI1H 1B2WH 4GW4A 1SY6A 3EO9H 3PHOB 4U33A 2JB6B 4KK8C 1NGYB 3GI9L 2IWGA 1FG9C 2FEEL 4C56E 3OKNB 3SJVE 4WFGD 2OI9C 2XQYG 1IKFH 4XCNA 5IW3A 4K23L 3I84A 3DSFH 3T0ED 5KVGL 3UZVB 3P73A 4U1NB 3T65B 3ZKSD 1SYSA 2AJVL 3LH2L 3IDNB 5F3HA 5I16B 1AP2B 1N5AA 3C8KB 5GS0L 3BKMH 5A3ID 2XWJB 5ESQA 4ZNEE 1LO4H 3H8NA 1WEJL 5T3ZE 4HV8B 5HHXL 1AR1D 1ZLVH 1MREL 5GGRY 3RIFK 3DUSB 3D2UD 4XXDA 4G80A 2FB4L 2R8SH 3DV6B 2MHAB 1NCUA 4XVSH 5D1ZD 4XZUB 2AKRA 4WUKL 2EDFA 4K8RC 2APFA 3V6OA 1UACH 1N7ML 3FMGL 4P4KD 3DETD 4LCUA 5HGGS 4DUXA 4YHIA 3S5LG 1MJ7H 1NDGB 5DK3A 1JNNH 4HJ0D 2YD2A 3O2VH 1L6XA 2NYYC 2VLKE 1WLHA 4LDEB 1R5WA 2A73B 5FYJE 3RWIB 3C9NA 2IQAA 1TPXC 1M7IB 4ZS6C 5ICZB 4PJDB 3OAUL 4YUEH 1OSZB 1TVHB 4QOKA 3A6BH 3HE7A 2VDQL 4N0FA 4OB5H 4WI7A 5IMKA 1LP9E 1WIUA 1EHXA 2GK2A 1KIRA 4LBEB 2DL9A 2JJWA 5HHXH 1BQHA 4L5FL 4CJ1A 3JV6A 3IXTB 1I9IH 2EDDA 4G7VH 3NACH 4ZS7L 4UBDD 4X6CF 1MQKH 4JFDA 2J6EA 2X7LA 2UWEB 5DA0B 3L7EB 3Q1SL 1FLRH 1R0AH 4DN3H 3CFCL 1FN4A 3L3HA 2NCMA 1TENA 5D7JD 4WO4C 5TDNB 1P6FA 1XF1A 2R2HB 3ROOA 5EIIA 1DDHB