3BKHA

Crystal structure of the bacteriophage phikz lytic transglycosylase, gp144
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
268
structure length
268
Chain Sequence
HHHHHGSIMKVLRKGDRGDEVCQLQTLLNLCGYDVGKPDGIFGNNTFNQVVKFQKDNCLDSDGIVGKNTWAELFSKYSPPIPYKTIPMPTANKSRAAATPVMNAVENATGVRSQLLLTFASIESAFDYEIKAKTSSATGWFQFLTGTWKTMIENYGMKYGVLTDPTGALRKDPRISALMGAELIKENMNILRPVLKREPTDTDLYLAHFFGPGAARRFLTTGQNELAATHFPKEAQANPSIFYNKDGSPKTIQEVYNLMDGKVAAHRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the bacteriophage phi KZ lytic transglycosylase gp144.
pubmed doi rcsb
molecule keywords lytic transglycosylase
molecule tags Hydrolase
source organism Pseudomonas phage phikz
total genus 77
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2007-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01464 SLT Transglycosylase SLT domain
A PF01471 PG_binding_1 Putative peptidoglycan binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.101.10 Mainly Alpha Orthogonal Bundle Muramoyl-pentapeptide Carboxypeptidase; domain 1 PGBD-like superfamily/PGBD 3bkhA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 3bkhA02
1LSAA 1BWJA 1FDLY 1WQMA 4NGVA 1LMCA 4WL7A 5KXPA 4ETEA 5ILCA 4Z41A 1IY3A 2DQFC 4BAFA 1WQQA 3KAMA 5LA8A 1LJ4A 5I5QA 5LVKA 3ATNA 4XADA 4WG7A 4LYZA 3SP3A 3D3DA 1E8LA 4H9HA 4R6CA 1IR7A 153LA 1QSAA 1GBOA 4H9EA 4KL7A 6LYZA 1QTEA 1VATA 4NG8A 4LT2A 1EQEA 1LJEA 1LHHA 2EKSC 5FDJA 3WU8A 3A94A 2NWDX 2Z12A 2YBMA 4QEQA 1GFRA 4LT1A 3WPKA 1OUBA 1GEVA 2BQOA 2BQGA 1OUGA 3AB6A 1EQ4A 1OQMA 1OUCA 5F14A 4BXDA 3FI7A 5M1YA 3WL2A 3RZ4A 1LZ9A 2XTHA 1GE3A 4PPOA 5A3EA 1REMA 1BB3A 1N4FA 4N1EI 4N8ZA 1D6PA 2ZYCA 4D9ZA 1B7MA 1I56A 4WM2A 5KXKA 4H9IA 4IASA 4XYYA 3LYMA 1IP4A 1LZTA 1HF4A 3CB7A 2HU3A 4WLTA 5APCA 3W6EA 1INUA 4OWBA 1LYZA 1CKGA 1AT5A 1V7SA 3A93A 4XJBA 4NHQA 2Z37A 1LCNA 5AMYA 3W6BA 3WUMA 2MEHA 4DD7A 4H9FA 5F9XA 1IX0A 3GXRA 1QIOA 1VEDA 1RFPA 4H1PA 3TXFA 1GB6A 1NDMC 1WVUA 1LZ1A 1BGIA 1YL1X 1YAQA 5B1GA 1T6VL 4RDSA 2ZWBA 1DI4A 1B7SA 1B7NA 1WTMA 2D6BA 3J4GA 3WW6A 3W3EA 2LYMA 1LSFA 1NMMA 1XGQC 2BQHA 3G3BB 4OWCA 4BXEA 2YVBA 4YM8A 4EMNA 1BVXA 1LJKA 2IHLA 3B0OA 4GCCA 1XEKA 1NHEA 3RU5A 4ETCA 3AGHA 5LIOA 3TMUA 1IOQA 1KXWA 1RE2A 1YL0X 1LSPA 4NGKA 5LAFA 2F4AA 3WW5A 1HFXA 1GFTA 1P2CC 1YAMA 4WO9A 1XEJA 1GF4A 1GHLA 1LJFA 2DQEY 3MGWA 2DQIY 3F6ZA 5HLLA 4PJ2C 5DN4A 5IDDA 3IJUA 4WMGA 3CSZA 1XGPC 4AXTA 3A3QA 1RJCB 3A67Y 1HERA 1ZVYB 1IWWA 1BB7A 1AT6A 1XGTC 5C6JA 1LZAA 1GFEA 1LMQA 4WL6A 4DD1A 4HPIA 1LSEA 5KXRA 2WARA 1B9OA 2MEBA 5KXNA 5LXWA 154LA 1OUAA 1CKHA 4IATA 3LZ2A 1MELL 1F6RA 4GCFA 4N0JA 1LKSA 4WO6A 1GB8A 1FLQA 1GD6A 4XJHA 1SQ2L 1QTKA 2Y8PA 5KXXA 4X3BA 1IC5Y 1BHZA 1JTPL 4QDNA 3AZ4A 2YBIA 3AGIA 1F10A 2ZQ3A 5L3HA 1GE1A 4B4IA 1LJGA 4PRUA 4OOOA 5DLAA 4WM3A 3AW6A 1GE2A 4TSBA 1DXJA 1GF0A 3P65A 4BJ4A 5B05A 1HNLA 1LMOA 4RLNA 2F2NA 4PHIA 1LZBA 3AYQA 1IWTA 2MEFA 1LZ4A 5FEKA 3A34A 4H8ZA 2DQGY 5F9UA 5KXTA 1GE0A 1HMKA 2Z18A 1GB2A 1IWXA 1D0LA 2ZIJA 4FDYA 4LGKA 4P2EA 1DPWA 4MSTA 4NHTA 5APDA 1LZSA 5KXYA 1GF9A 2IFFY 4LYBA 3TXHA 3ZEKA 1GFUA 3IJVA 1GFAA 2DQJY 1MLCE 3A8ZA 5I54A 5KKIA 1LHMA 5LYTA 4LYMA 1LJJA 5LVHA 3ZVQA 1LBUA 3B72A 1FLYA 1LKRA 1LHLA 3HBDA 3EMSA 1IORA 4II8A 1CKDA 2VB1A 4N1CC 1JJ0A 1IVMA 3FE0A 1LJ3A 1Z55A 2Z19A 2HUBA 4H94A 4J1AA 4NIJA 1HEMA 2BQCA 2W1YA 1CNSA 1YANA 1J1OY 1C45A 1GB3A 2D4JA 3E3DA 1GDXA 1SLYA 1JWRA 2W1MA 5DL9A 5HNLA 1JISA 2MECA 4OOTA 3W6FA 1B5WA 2BQJA 4DDAA 4Z3MA 5LYMA 4H93A 4TUNA 3RNXA 4B4EA 4BOLA 1GBYA 4DD0A 1JTOL 1ZVHL 3N9EA 1LJNA 1HEWA 2C8OA 3RW8A 2B5ZA 3LYZA 1CKCA 1AM7A 1L6JA 1XFPL 3CSRA 1LPIA 4KPMA 1LZGA 1GF6A 5E4PA 3WPLA 1LSMA 1LZEA 135LA 2BQDA 3IWRA 4WM6A 4XJDA 3ULRA 1H6MA 1F0WA 1DKKA 4EOFA 1LYYA 3AZ7A 4LFXA 1XEIA 1LSZA 2Z39A 5JENB 1IY4A 4LYCA 3ZVQB 1GBZA 3TXDA 4WM5A 5KXZA 2MEIA 5D5CA 4GN3A 134LA 5LA5A 4NY5A 8LYZA 1I1ZA 2W1LA 1H87A 2DQCY 4RLMA 1VDTA 1VAUA 4J1BA 1HENA 4LPQA 1KXXA 4LT0A 4NWEA 3BKVA 1OUEA 1W6ZA 4BPAA 4H9CA 1GFHA 1JTTL 4RW2A 3WYHA 4BAPA 1PZYA 2DQHY 4W94A 3D2ZA 4B0DA 2Q0MX 2Z2FA 2YBHA 3WU9A 1GAYA 5J7CA 4U3XB 3B0IA 3QY4A 1LMPA 2BPUA 4ETAA 1REZA 1UIGA 2F30A 1NBZC 4GN5C 4HJYA 2I26L 2HEEA 1G7IC 3A96A 1DPXA 4WM4A 2HEFA 3TXJA 1GB0A 3A6BY 4N9RA 4NGYA 3WU7A 1IP1A 4FJRA 1D0KA 4YEOA 4DD3A 2RSCA 2CWIA 4Z98A 4HTKA 5LAGA 1HFZA 1LZCA 1VDSA 4ML7A 1TDYA 1UBZA 5LVJA 3WH1A 1D6QA 1B7OA 2C8PA 2PC2A 4HP0A 5D5FA 4WLXA 2HU1A 1DQJC 3WULA 4OWHA 1FLWA 3B6LA 3AZ5A 1J1XY 3WPJA 4G4HA 1LZDA 1DI5A 4NGLA 1RCMA 4HJVA 1CJ9A 2WKXA 1ALCA 1C7PA 1REYA 1QUSA 4LZTA 4I8SA 3TMXA 1OUIA 2XBSA 3ATOA 4M6DA 4R0FA 4E3UA 4B1AA 5IELA 1IWUA 1PS5A 4NHIA 4YF2A 1G7JC 1OP9B 1B0DA 4OW1A 1V7TA 1LZYA 1JPOA 1IWVA 1WQNA 2HEAA 1C10A 1JIYA 4QY9A 4KXIA 4CJ2A 2I6ZA 1C46A 3OK0A 4CFPA 2DQAA 2ZYPA 1LMNA 4G54A 1EL1A 5KXSA 3GXKA 4ETDA 1HMLA 5APFA 4WG1A 4TSCA 3B0KA 5A3ZA 1B5YA 4MCKA 1LTMA 2BQFA 3WVYA 3TXIA 2EIZC 5LINA 2DQDY 3TXGA 2H9KA 1KIQC 1TAYA 2BLYA 5HMJA 4H8XA 1GXV2 5FELA 3TMVA 2LZ2A 1J1PY 2GV0A 9LYZA 1GDWA 4HPEA 4YENA 1CJ8A 1LJIA 1GEZA 3WXTA 2YDGA 1GF8A 2BQLA 1DKJA 3A3RX 4Z46A 3A6CY 3LN2A 1B7RA 4DDCA 2BQNA 3EBAB 3WXUA 2G4PA 2ZIKA 3TMWA 5I4XA 3TXBA 2LYOA 1BQLY 4DT3A 5I53A 2XJWA 4UWVA 1UACY 1WQRA 1YKXX 1GF5A 1D9UA 1FKQA 1KIPC 1ZMYL 2W1XA 3T36A 5KY1A 1UCOA 3HFMY 4ZIXA 1BWIA 2MEAA 4HTNA 4NSHA 1OUDA 1HELA 4NSJA 5FSTA 4ANRA 2X0AA 1BB5A 4XENA 2XBRA 4GCBA 5KXOA 1CJ6A 1LHJA 5EBHA 4J0LA 1LHKA 4PRQA 1IC7Y 3EO5A 4N5RA 5E9RA 4QGZA 1G7MC 1BB6A 4A7DA 4H90A 3HBEX 1IR8A 3LYTA 2BH7A 1NF5A 1IIZA 1FKVA 1GBXA 3LZTA 4H92A 3M18B 3TXKA 1RI8B 2F4GA 2YBJA 1LSNA 5LVGA 2CJLA 5DN5A 1HSWA 3LHMA 132LA 1XGRC 2G4QA 1WVVA 1QUTA 1LSYA 1GWDA 208LA 2BQBA 4TWSA 4NHPA 2HECA 1QSWA 4ET8A 2BQIA 5II3A 4HV2A 133LA 1JSFA 4HSFA 4XN6A 1T3PA 4C3WA 2BQAA 3D9AC 4NEBA 1YKZX 1D0MA 1LMAA 2A7DA 1OUFA 2D4IA 193LA 2CGIA 4H91A 4NHSA 3A92A 1YAOA 4L41A 1LSGA 5F81A 4UWUA 4OWEA 3T6UA 2FBDA 2G4NA 1GFVA 2EPEA 1GFKA 1LJHA 1XGUC 4TX7A 4H8YA 5F16A 3VWOA 1GE4A 1IWZA 1BB4A 1B5ZA 4WLDA 4CHXA 2ZNXY 3N9CA 4C5FA 1LZ8A 1WQOA 1C43A 1IOSA 1GB7A 1UA6Y 5C6LA 1AKIA 2ZQ4A 1BWHA 3G3AB 1YKYX 1KXYA 4ZFPA 4LT3A 1HFYA 4HTQA 4OWAA 1WQPA 5L3IA 2BAAA 3N9AA 5DM9A 1JHLA 1IEEA 1CJ7A 1FLUA 1NBYC 1LHIA 1UIHA 5FCPA 1LZRA 5I4WA 4GCDA 6LYTA 1EQ5A 1GFJA 4GCEA 2DBTA 3D2YA 1LMTA 3CSQA 1VDPA 1AZFA 1UIFA 2MEEA 1G7LC 2YSSC 2BQMA 4G4BA 4M4OA 1HSXA 1G7HC 2BQEA 5B1FA 4B49A 3P66A 2N5ZA 3M3UA 4GN4A 4WLYA 5APEA 1VFBC 2MEGA 1TCYA 1LYSA 4G9SA 5KXMA 1B5XA 1UICA 1LZ5A 1GAZA 1IP7A 3WUAA 4DWXA 4G49A 1WTNA 194LA 3CT0A 1QDTA 4DYGA 2D4KA 1DZBX 3P64A 4DD9A 5HNCA 3A91A 5ILFA 3AW7A 4TTDA 2Z2EA 3AGGG 5KJ9A 2AUBA 1JEFA 4NWHA 5C6IA 1JKBA 1UIDA 4DC4A 1GXXA 4UWNA 1LZNA 1DI3A 2Z38A 4NGJA 1GB5A 3W6CA 2I25L 1NQIA 4BADA 1TEWA 1UIAA 4KT3A 5HMVA 2D91A 2FBBA 1GBWA 2H9JA 4GLVA 207LA 4PGJB 1LOZA 4LYTA 4NGOA 5FHWA 1BVKC 5LYZA 5K7OA 2LHMA 1HHLA 3AZ6A 1UUZC 1REXA 5KXLA 1B7QA 1NKHA 4ETBA 4MR1A 3P68A 1HEQA 2MEDA 2ZNWY 1B5UA 4H9AA 1B7PA 3K3TA 4CFOA 1C08C 2HEDA 4NFVA 5IHGA 3BKHA 1JKDA 1TBYA 1JJ3A 1FN5A 1QQYA 3A90A 1YILA 4J7VA 4IJ4A 2FYCA 1B7LA 4WM1A 7LYZA 2HEBA 1LSDA 1HC0A 2ZILA 1OUJA 2BLXA 3WMKA 4G4CA 4NGZA 1CKFA 1LZ6A 1JJ1A 3W6DA 1LSBA 1GB9A 1ZV5L 1IR9A 1XSFA 1I20A 1IP3A 4LFPA 1IO5A 4ZEEA 4YOPA 2EQLA 3J6KA 5I4YA 2FYDA 3CT1A 3QNGA 1JUGA 4HV1A 2CDSA 4XJFA 1YROA 3A95A 4HJZA 2LYZA 5L9JA 4WOAA 3W6AA 1OUHA 2DKVA 1IOCA 3AJNA 1UC0A 4NG1A 1B5VA 3TXEA 1LAAA 1FBIX 1YIKA 3EXDA 1IOTA 1GFGA 1HEPA 4LYOA 4DD2A 3CQLA 3RT5X 4CGEA 1YAPA 4B4JA 1EAKA 1VDQA 2A7FA 2BQKA 4NGIA 3HBHA 4BS7A 4DDBA 1IP5A 4NSGA 1GF3A 3WUNA 3CT5A 4W96A 2YBLA 1UIEA 1IWYA 4XJGA 1GBSA 1IC4Y 1JKAA 1LYOA 1F6SA 1YQVY 1KIRC 1JKCA 3P4ZA 4YEMA 1NDGC 5B07A 5KXWA 5B06A 3LYOA 4XJIA 1A4VA 1IP6A 3WVXA 1JSEA 1GPQC 1W08A 4AGAA 4GLAA 1A2YC 4NGWA 1QDRA 1UIBA 1B2KA 1JITA 1HEOA 4BXJA 5LVIA 1GF7A 3QE8A 4H9BA 1IP2A 4I0CA 5T3FA 4NSIA 5KKJA 2H5ZA 4ET9A 4RW1A 2HTXA 2LZTA 5B59A 4O34A 3OJPA 1NWGA 1O23A 5HQ1A 2YBNA 1LSCA
chains in the Genus database with same CATH superfamily
3GUJA 236LA 1IY3A 4BAFA 4WG7A 4LYZA 1L42A 1G1WA 1GBOA 3DN3A 1VATA 3WU8A 1CV3A 3A94A 2NWDX 1GFRA 4LT1A 1GEVA 2Z6BA 180LA 4W56A 1L14A 3WL2A 1LZ9A 2XTHA 1GE3A 1REMA 1QS5A 4IASA 3CB7A 3JR6A 1D3FA 226LA 3C82A 1L00A 4H9FA 1JTMA 1QIOA 3TXFA 1PQIA 1LZ1A 1BGIA 1YL1X 1YAQA 2ZWBA 1B7SA 4K5YA 1C6EA 3J4GA 1L46A 1XGQC 2BQHA 4OWCA 4YM8A 1BVXA 1LJKA 3B0OA 1T6HA 5LIOA 4WO9A 1GF4A 2O4WA 237LA 3F6ZA 5HLLA 1XJUA 1XEPA 5DN4A 3IJUA 2RBQA 3A3QA 177LA 4DD1A 1LMQA 1D3JA 5KXRA 2WARA 4IATA 2HULA 205LA 1F6RA 1LKSA 4WO6A 1SQ2L 3HT7A 4QDNA 1L43A 5L3HA 3EMLA 1KY0A 175LA 1L26A 1LMOA 3HTFA 2F2NA 1LZBA 1LYDA 242LA 3HUAA 1IWTA 3A34A 1LI6A 5KXTA 1DYFA 1GE0A 1D0LA 4P2EA 4NHTA 4MSTA 245LA 5APDA 1LZSA 2IFFY 3TXHA 3ZEKA 1GFAA 2DQJY 4EKQA 1G07A 2A4TA 1LHMA 4LYMA 3ZVQA 1FLYA 3HBDA 223LA 4NIJA 1L49A 1HEMA 1QT7A 3G3XA 3DMVA 1B5WA 4DDAA 3PDSA 3RNXA 2C8OA 150LA 1CKCA 1L6JA 5E4PA 1LLHA 1GF6A 2OTYX 1LSMA 2BQDA 1PQKA 4EOFA 1CX6A 1GBZA 125LA 5KXZA 3DN6A 8LYZA 2DQCY 3DN4A 1OWZA 1VAUA 4BPAA 4RW2A 1L60A 1C6GA 238LA 2DQHY 3D2ZA 4B0DA 4I7MA 1GAYA 191LA 4ZPUA 4ETAA 1NBZC 235LA 1DPXA 1G0JA 1B6IA 1VDSA 1CV5A 1KS3A 2OE7X 1TLAA 4HP0A 4WLXA 1C6AA 231LA 1J1XY 3WPJA 4ARPA 1RCMA 4HJVA 210LA 1C7PA 4LZTA 4I8SA 141LA 2RBPA 129LA 3OE6A 103LA 1IWUA 5IELA 1B0DA 4OW1A 176LA 142LA 1L19A 2I6ZA 1SSWA 4CFPA 2DQAA 3GXKA 4ETDA 241LA 1L05A 5A3ZA 1LWKA 3TXIA 2DQDY 1KIQC 1L47A 4H8XA 3TMVA 4EKSA 128LA 1LPYA 3OE9A 1LJIA 4GBRB 1GEZA 3WXTA 1NHBA 3A6CY 2QARC 3LN2A 2BQNA 1DYBA 1L15A 2G4PA 3TMWA 5I4XA 3TXBA 1UACY 1D9UA 1KIPC 113LA 2W1XA 2MEAA 4ANRA 1OUDA 1HELA 4XENA 1LHJA 5EBHA 4PRQA 4QGZA 4ARLA 1NF5A 1IIZA 1P56A 3TXKA 1LSNA 1L01A 132LA 1XGRC 148LE 1CX7A 4TWSA 4NHPA 4HV2A 2NTHA 1T3PA 1L13A 2CGIA 119LA 4NHSA 1LSGA 4OWEA 1GFVA 1C6QA 247LA 2EPEA 1LGXA 5F16A 1GE4A 3HT9A 1WQOA 2B7XA 3GUPA 1BWHA 1YKYX 1KXYA 4W59A 4OWAA 3N9AA 5DM9A 1UIHA 5I4WA 6LYTA 173LA 1QTBA 1GFJA 1LYHA 2RBRA 3C8QA 1C61A 4ARQB 1C63A 1L81A 2BQEA 5B1FA 3P66A 3M3UA 4GN4A 5APEA 3ODUA 206LA 4G9SA 1C6BA 1C6JA 1L41A 4EPIA 194LA 3CT0A 3G3WA 1SWZA 2D4KA 3P64A 2B6ZA 3AW7A 5KJ9A 4DKLA 1DYDA 3SB6A 5C6IA 4DC4A 1L34A 4UWNA 3F9LA 3HDFA 4KT3A 104LA 2H9JA 4GLVA 207LA 221LA 1L52A 2QB0B 1LYEA 4YXCA 1DYGA 2RBNA 1REXA 5KXLA 2OTZX 1EPYA 4CFOA 4NFVA 5IHGA 3BKHA 1L18A 222LA 4YXAC 4IJ4A 2FYCA 1P37A 4WM1A 7LYZA 1QTVA 1P46A 1KNIA 3DN0A 3WMKA 4NGZA 1CKFA 1ZYTA 209LA 3W6DA 1LSBA 1ZV5L 4LFPA 1I20A 1IO5A 4YOPA 120LA 1T97A 3C7WA 3NYAA 1L40A 4XJFA 1YROA 3A95A 5L9JA 3W6AA 1B5VA 4NGIA 2A7FA 2BQKA 1L30A 1IP5A 1L86A 1IWYA 1L51A 1KW7A 1GBSA 1JKAA 111LA 1L98A 1YQVY 1NDGC 3FADA 4W55A 5KXWA 149LA 256LA 160LA 1HEOA 1L76A 5T3FA 4I0CA 1L45A 2H5ZA 4ET9A 4RW1A 1C6MA 5B59A 4O34A 1O23A 5HQ1A 1LSCA 1LSAA 1BWJA 1WQMA 1LMCA 5KXPA 4ETEA 5ILCA 2DQFC 1WQQA 5I5QA 5LVKA 3ATNA 1CU5A 1IR7A 1C67A 4H9EA 6LYZA 1L73A 2EKSC 1QTZA 5I14A 3WPKA 1L35A 3AB6A 5F14A 1OQMA 3FI7A 5M1YA 4PPOA 2ZYCA 1I56A 109LA 1L32A 5KXKA 4XYYA 3LYMA 1IP4A 158LA 1LZTA 2HU3A 1L90A 1INUA 4OWBA 127LA 165LA 1L99A 4NHQA 186LA 1P2LA 5AMYA 3WUMA 2MEHA 4OO9A 137LA 5F9XA 255LA 1IX0A 1VEDA 1C6FA 1L07A 1NDMC 1L44A 156LA 4RDSA 1WTMA 2D6BA 1L61A 169LA 1LSFA 3CDRA 2IHLA 4GCCA 1XEKA 3RU5A 1RE2A 1PQOA 2F4AA 1P2CC 1C62A 1L64A 1XEJA 1QTDA 1GHLA 2DQEY 1XGPC 4AXTA 147LA 1HERA 1L65A 1IWWA 225LA 1LZAA 1GFEA 1OUAA 5ILFA 1MELL 1GB8A 1GD6A 219LA 1IC5Y 1P2RA 3AZ4A 3AGIA 2ZQ3A 1LJGA 1D9WA 4PRUA 4TSBA 1CV1A 4RLNA 4PHIA 3HWLA 3RUNA 4H8ZA 1HMKA 2Z18A 3C7YA 2ZIJA 4FDYA 4LGKA 4ARMB 1GFUA 3C80A 1MLCE 162LA 3SB9A 1LBUA 1LHLA 2RB0X 3FE0A 1Z55A 2RH1A 1L74A 2BQCA 2W1YA 2XQOA 1SLYA 2B72A 1JWRA 3DN1A 1CU0A 5DL9A 5HNLA 2RB1X 3W6FA 4Z3MA 2BQJA 5LYMA 243LA 1GBYA 1JTOL 1L62A 1HEWA 2B5ZA 107LA 3LYZA 4KPMA 3WPLA 1LPIA 135LA 1L39A 1XEIA 2Z39A 1IY4A 4LYCA 4WM5A 4GN3A 200LA 4J1BA 1HENA 4LPQA 1W6ZA 1G0PA 4BAPA 3WU9A 4W57A 1CTWA 3B0IA 3QY4A 1UIGA 4HJYA 1G7IC 4WM4A 4N9RA 1IP1A 4FJRA 2CWIA 1LZCA 1TDYA 3HTDA 5LVJA 3WH1A 1D6QA 4DDCA 2HU1A 1DQJC 1LZDA 2WKXA 1ALCA 3V2WA 3TMXA 1OUIA 3ATOA 4M6DA 4YF2A 1D3MA 192LA 1LZYA 1HMLA 4DJHA 3WVYA 2BLYA 2RBSA 1J1PY 1L03A 1GDWA 4HPEA 2YDGA 1GF8A 4DQJA 1L02A 250LA 4DT3A 3DN2A 2XJWA 1QT6A 1SSYA 1UCOA 2ANVA 1BWIA 1L21A 4I7TA 1BB5A 5KXOA 1CJ6A 1IC7Y 1G06A 3EO5A 1G7MC 151LA 2BH7A 3LZTA 1JQUA 1OVKA 2F4GA 3HTGA 1HSWA 2G4QA 2HECA 1QSBA 6LZMA 4XN6A 4C3WA 2BQAA 1YKZX 2A7DA 1LMAA 1OUFA 1G0GA 1LYGA 3T6UA 2G4NA 1GFKA 182LA 4H8YA 1C6DA 138LA 1T8FA 4C5FA 1IOSA 1UA6Y 5C6LA 1C66A 1AKIA 3G3AB 2HUKA 234LA 1L28A 2O7AA 1IEEA 1FLUA 229LA 1LHIA 4S0WA 4DQ5A 1LZRA 1L27A 4GRVA 3D2YA 1AZFA 1G7LC 2YSSC 4M4OA 2RAYX 2N5ZA 4LDEA 4WLYA 1VFBC 1LYSA 5KXMA 1UICA 1LZ5A 253LA 1WTNA 4DYGA 1DZBX 2O79A 4DD9A 5HNCA 3A91A 4TTDA 1JEFA 1QT8A 2Z38A 1NQIA 2FBBA 1GBWA 3W6BA 4LYTA 5LYZA 5FHWA 257LA 1P6YA 2B6YA 2LHMA 1UUZC 167LA 3P68A 2ZNWY 1B7PA 217LA 3K3TA 190LA 261LA 1TBYA 4J7VA 1QQYA 1YILA 1L72A 1C68A 4ARMA 1JJ1A 1CV0A 1L66A 3GUIA 240LA 3QNGA 4W52A 212LA 230LA 2LYZA 1CVKA 1DYCA 1DYAA 1OUHA 1IOCA 1UC0A 1YIKA 3EXDA 4B4JA 2B70A 4DDBA 1GF3A 1QUDA 2HUMA 1L95A 1L88A 1F6SA 3P4ZA 4YEMA 2B74A 183LA 3LYOA 155LA 1QT5A 4XJIA 4I7PA 3WVXA 3L64A 1GPQC 1W08A 123LA 1QDRA 1GF7A 216LA 1IP2A 188LA 5KKJA 2HTXA 1L79A 2LZTA 1L77A 4NGVA 4WL7A 1L36A 5LA8A 1L71A 1LJ4A 3SP3A 185LA 3D3DA 4R6CA 1QUOA 4I7RA 4KL7A 1LI3A 1QTEA 195LA 1T8AA 4LT2A 5FDJA 2Z12A 2YBMA 4QEQA 1OUBA 2OE9X 2BQGA 1OUGA 1EQ4A 1L08A 1L10A 3SBAA 3DN8A 1N4FA 4N1EI 4N8ZA 1D6PA 4WM2A 227LA 4H9IA 1HF4A 3RZEA 5APCA 3W6EA 2B75A 1CKGA 3A93A 1CU6A 4LDLA 181LA 1C6PA 2Z37A 249LA 1CV4A 130LA 3C8SA 1RFPA 1WVUA 161LA 1L80A 1B7NA 1L06A 3W3EA 2YVBA 4ETCA 3TMUA 1IOQA 1KXWA 1YL0X 5LAFA 3WW5A 1HFXA 1LJFA 3HH3A 3MGWA 2DQIY 4PJ2C 5IDDA 4W54A 4WMGA 3CSZA 1C69A 3UONA 1BB7A 1XGTC 5C6JA 4WL6A 4HPIA 5LXWA 5KXNA 154LA 1CKHA 4N0JA 4GCFA 3QAKA 1FLQA 4XJHA 1G0KA 2Y8PA 5KXXA 1L23A 1L04A 5DLAA 3AW6A 3P65A 3HU8A 1HNLA 170LA 2IGCA 5F9UA 144LA 1QT3A 1GB2A 1G0MA 4W58A 4EKRA 3A8ZA 5I54A 5KKIA 3GUNA 2OU8A 1LJJA 3B72A 4PJZA 4II8A 4I7KA 4N1CC 1JJ0A 1LJ3A 2Z19A 2HUBA 4J1AA 2RBOA 189LA 1P64A 4I7LA 1C45A 1GB3A 2RAZX 4I7JA 7LZMA 2MECA 3L2XA 112LA 4H93A 4B4EA 1ZVHL 3N9EA 1LJNA 3GUMA 1AM7A 1XFPL 232LA 1LZEA 3IWRA 1F0WA 1DKKA 1LYYA 3AZ7A 1SWYA 4LFXA 1LSZA 5JENB 3ZVQB 3TXDA 5D5CA 134LA 5LA5A 4NY5A 4RLMA 1VDTA 1KXXA 4LT0A 4NWEA 3BKVA 4H9CA 1GFHA 1JTTL 3WYHA 1PZYA 196LA 5J7CA 4U3XB 1CU3A 220LA 4GN5C 2I26L 2HEEA 3A96A 2HEFA 3A6BY 4NGYA 3WU7A 2B6WA 4DD3A 4YEOA 1D0KA 2RSCA 4ML7A 214LA 3DKEX 5D5FA 3WULA 4OWHA 3AZ5A 1D2WA 4G4HA 1L55A 171LA 3HTBA 1REYA 3C83A 197LA 2XBSA 1PS5A 4NHIA 1L69A 3SN6R 1L70A 1V7TA 1IWVA 1WQNA 1C10A 1JIYA 4KXIA 4G54A 1EL1A 178LA 5APFA 4EPFA 152LA 1LTMA 2BQFA 254LA 2EIZC 198LA 3TXGA 2H9KA 1TAYA 5FELA 3SB5A 4EJ4A 4YENA 1CJ8A 1L38A 2BQLA 143LA 3A3RX 4Z46A 1B7RA 3EBAB 3WXUA 2ZIKA 2LYOA 5I53A 1WQRA 1YKXX 3T36A 1L63A 3HFMY 260LA 4HTNA 4EXMA 1CV6A 1L24A 2X0AA 2XBRA 126LA 4GCBA 2F47A 1D2YA 122LA 4J0LA 1LHKA 4N5RA 5E9RA 1BB6A 3NY9A 1IR8A 1GBXA 1FKVA 2YBJA 3HDEA 259LA 2CJLA 1L97A 3LHMA 1LSYA 1GWDA 1P3NA 1T8GA 2BQBA 1QSWA 2BQIA 184LA 1JSFA 3D9AC 4ARQA 1D0MA 1LGUA 4H91A 3A92A 1L85A 1LW9A 2OEAX 1XGUC 1IWZA 1BB4A 4WLDA 4CHXA 1L59A 2ZNXY 3N9CA 4LZMA 1LGWA 1LZ8A 1C43A 1L68A 2ZQ4A 4ZFPA 4LT3A 1WQPA 5L3IA 2BAAA 1JHLA 252LA 1CJ7A 1NBYC 1K28A 4GCDA 1EQ5A 1P7SA 159LA 1L11A 2DBTA 1LMTA 3CSQA 1VDPA 2BQMA 4G4BA 1C6LA 1G7HC 3CDTA 1OV5A 4B49A 2MEGA 1TCYA 163LA 1GAZA 1DYEA 1QDTA 2AUBA 4NWHA 1JKBA 1GXXA 1LZNA 1GB5A 2LC9A 3W6CA 3HT6A 2I25L 4EKPA 4BADA 4PGJB 1LOZA 4PK0A 1BVKC 5K7OA 1HHLA 3AZ6A 3CDVA 1B5UA 1L31A 4H9AA 1L87A 1C08C 2HEDA 1CUPA 1JKDA 1JJ3A 1FN5A 213LA 1HC0A 115LA 2BLXA 4G4CA 3CDOA 1IR9A 1XSFA 2B6TA 4IAPA 3J6KA 2FYDA 4HV1A 1L25A 3DMZA 2DKVA 3AJNA 1IOTA 1GFGA 4LYOA 4DD2A 3CQLA 3RT5X 1L0KA 1YAPA 3HU9A 1EAKA 1VDQA 3CT5A 1L33A 1UIEA 2YBLA 1SX7A 4XJGA 3HUQA 1IC4Y 1C6CA 1JKCA 5B07A 1A4VA 1IP6A 4AGAA 4ARJA 4GLAA 1A2YC 1UIBA 3SB8A 4BXJA 233LA 228LA 5LVIA 3QE8A 3D4SA 1NWGA 2YBNA 3FI5A 1FDLY 3G3VA 4Z41A 3KAMA 4XADA 1E8LA 4H9HA 1PQMA 153LA 1QSAA 3C8RA 3DMXA 3NY8A 4NG8A 1EQEA 1LJEA 1LHHA 2B73A 3GULA 2BQOA 4W51A 1OUCA 3V2YA 4BXDA 3HT8A 4DQ7A 3RZ4A 4I7QA 5A3EA 1L75A 1BB3A 4D9ZA 1B7MA 172LA 1L53A 244LA 4WLTA 5LZMA 1LYZA 1AT5A 1V7SA 1OVHA 4XJBA 1LCNA 1L96A 139LA 4DD7A 3GXRA 4H1PA 1GB6A 4W53A 5B1GA 1T6VL 1DI4A 3WW6A 2LYMA 1NMMA 3G3BB 4BXEA 2F2QA 4EMNA 5KY1A 1NHEA 3AGHA 4I7SA 1LYIA 1OV7A 1LSPA 4NGKA 1LI2A 1GFTA 1YAMA 2LCBA 2CUUA 3A67Y 1RJCB 1ZVYB 1AT6A 1LSEA 1B9OA 2MEBA 3LZ2A 1JTNA 1C6KA 1QTKA 1P36A 4X3BA 1BHZA 1JTPL 1QT4A 2YBIA 1F10A 1L20A 1GE1A 4B4IA 1LYJA 4OOOA 4WM3A 1L50A 1GE2A 1L94A 224LA 1DXJA 1GF0A 1PQJA 4BJ4A 5B05A 146LA 3HH5A 1ZWNA 3AYQA 2MEFA 5FEKA 1LZ4A 2DQGY 3TXEA 1IWXA 1DPWA 5KXYA 1GF9A 4LYBA 199LA 3IJVA 3FA0A 3PBLA 5LYTA 5LVHA 1LKRA 1ZURA 3EMSA 1IORA 1SX2A 1CKDA 2VB1A 1IVMA 3K2RA 108LA 4H94A 1CNSA 3F8VA 1YANA 1J1OY 1C65A 2D4JA 3E3DA 1GDXA 1L29A 2W1MA 201LA 1JISA 4OOTA 4TUNA 4BOLA 4DD0A 3RW8A 164LA 4DAJA 3CSRA 1LZGA 1L16A 1OYUA 4WM6A 4XJDA 4LDOA 3ULRA 1H6MA 2MEIA 1QS9A 1I1ZA 2W1LA 1H87A 1C6IA 1OUEA 1C6TA 4W94A 2Q0MX 2Z2FA 2YBHA 1I6SA 1LMPA 2BPUA 1REZA 2F30A 3HUKA 1L92A 102LA 3TXJA 1GB0A 4Z98A 4HTKA 5LAGA 1HFZA 1UBZA 1B7OA 1QUGA 2C8PA 2PC2A 1G0QA 1FLWA 3B6LA 140LA 1DI5A 4NGLA 1CJ9A 3LZMA 187LA 2Q9DA 1QUSA 1LWGA 2L78A 1L09A 4R0FA 4E3UA 4B1AA 1L22A 114LA 1G7JC 1OP9B 3SBBC 1C64A 1L89A 1JPOA 2HEAA 4QY9A 4CJ2A 145LA 1C46A 211LA 3OK0A 2ZYPA 1LMNA 5KXSA 2OE4X 3OE0A 4TSCA 3B0KA 4WG1A 3SB7A 1B5YA 1G0LA 4MCKA 5LINA 5HMJA 168LA 1GXV2 1WTHA 2LZ2A 2GV0A 9LYZA 1OWYA 1L93A 1PQDA 1DKJA 1BQLY 4UWVA 3VW7A 1GF5A 1FKQA 1ZMYL 4ZIXA 4NSHA 4AQNA 4NSJA 5FSTA 1QTCA 174LA 4A7DA 1OVJA 3HBEX 4H90A 4I7NA 166LA 1P5CA 3LYTA 1L58A 4H92A 3M18B 1RI8B 5LVGA 5DN5A 118LA 1WVVA 1QUTA 208LA 4ET8A 5II3A 133LA 4HSFA 1L83A 4NEBA 2D4IA 193LA 1YAOA 4L41A 1L37A 5F81A 4UWUA 2FBDA 2B6XA 1LJHA 4TX7A 1L17A 3VWOA 1C6HA 1B5ZA 3DNAA 1QTHA 1GB7A 1CUQA 251LA 1KY1A 2OU0X 1HFYA 4HTQA 157LA 1QSQA 246LA 5FCPA 218LA 131LA 215LA 4GCEA 1UIFA 1L56A 2MEEA 1HSXA 1L84A 2F32A 1L91A 2NTGA 2LZMA 1B5XA 1IP7A 1L0JA 3WUAA 4DWXA 4G49A 2Z2EA 3AGGG 1UIDA 1DI3A 4NGJA 239LA 1TEWA 1UIAA 5HMVA 2D91A 1L82A 4NGOA 1L48A 1L57A 1LYFA 1B7QA 248LA 1NKHA 4ETBA 4MR1A 1HEQA 2MEDA 3GUOA 1QUHA 1KW5A 1C60A 3A90A 1B7LA 2Q9EA 4I7OA 1L67A 2OU9A 2HEBA 1LSDA 2ZILA 1OUJA 1LZ6A 1D3NA 4E97A 1GB9A 4ZEEA 1IP3A 2EQLA 5I4YA 3CT1A 1JUGA 2CDSA 3HH6A 4HJZA 1L54A 4WOAA 4NG1A 1LAAA 1FBIX 1HEPA 3C81A 1XJTA 4CGEA 3OE8A 1L12A 3HBHA 4BS7A 4NSGA 3WUNA 4W96A 3GUKA 1G1VA 3C7ZA 1LYOA 1KIRC 2ANXA 5B06A 1JSEA 4NGWA 1B2KA 1C6NA 1JITA 262LA 3CDQA 4YX7C 110LA 4H9BA 4NSIA 1CU2A 3HH4A 3OJPA 2RB2X 258LA
chains in the Genus database with same CATH topology
3GUJA 236LA 1IY3A 4BAFA 4WG7A 4LYZA 1L42A 1G1WA 1GBOA 3DN3A 1VATA 3WU8A 1CV3A 3A94A 2NWDX 1GFRA 4LT1A 1GEVA 2Z6BA 180LA 4W56A 1L14A 3WL2A 1LZ9A 2XTHA 1GE3A 1REMA 1QS5A 4IASA 3CB7A 3JR6A 1D3FA 226LA 3C82A 1L00A 4H9FA 1JTMA 1QIOA 3TXFA 1PQIA 1LZ1A 1BGIA 1YL1X 1YAQA 2ZWBA 1B7SA 4K5YA 1C6EA 3J4GA 1L46A 1XGQC 2BQHA 4OWCA 4YM8A 1BVXA 1LJKA 3B0OA 1T6HA 5LIOA 4WO9A 1GF4A 2O4WA 237LA 3F6ZA 5HLLA 1XJUA 1XEPA 5DN4A 3IJUA 2RBQA 3A3QA 177LA 4DD1A 1LMQA 1D3JA 5KXRA 2WARA 4IATA 2HULA 205LA 1F6RA 1LKSA 4WO6A 1SQ2L 3HT7A 4QDNA 1L43A 5L3HA 3EMLA 1KY0A 175LA 1L26A 1LMOA 3HTFA 2F2NA 1LZBA 1LYDA 242LA 3HUAA 1IWTA 3A34A 1LI6A 5KXTA 1DYFA 1GE0A 1D0LA 4P2EA 4NHTA 4MSTA 245LA 5APDA 1LZSA 2IFFY 3TXHA 3ZEKA 1GFAA 2DQJY 4EKQA 1G07A 2A4TA 1LHMA 4LYMA 3ZVQA 1FLYA 3HBDA 223LA 4NIJA 1L49A 1HEMA 1QT7A 3G3XA 3DMVA 1B5WA 4DDAA 3PDSA 3RNXA 2C8OA 150LA 1CKCA 1L6JA 5E4PA 1LLHA 1GF6A 2OTYX 1LSMA 2BQDA 1PQKA 4EOFA 1CX6A 1GBZA 125LA 5KXZA 3DN6A 8LYZA 2DQCY 3DN4A 1OWZA 1VAUA 4BPAA 4RW2A 1L60A 1C6GA 238LA 2DQHY 3D2ZA 4B0DA 4I7MA 1GAYA 191LA 4ZPUA 4ETAA 1NBZC 235LA 1DPXA 1G0JA 1B6IA 1VDSA 1CV5A 1KS3A 2OE7X 1TLAA 4HP0A 4WLXA 1C6AA 231LA 1J1XY 3WPJA 4ARPA 1RCMA 4HJVA 210LA 1C7PA 4LZTA 4I8SA 141LA 2RBPA 129LA 3OE6A 103LA 1IWUA 5IELA 1B0DA 4OW1A 176LA 142LA 1L19A 2I6ZA 1SSWA 4CFPA 2DQAA 3GXKA 4ETDA 241LA 1L05A 5A3ZA 1LWKA 3TXIA 2DQDY 1KIQC 1L47A 4H8XA 3TMVA 4EKSA 128LA 1LPYA 3OE9A 1LJIA 4GBRB 1GEZA 3WXTA 1NHBA 3A6CY 2QARC 3LN2A 2BQNA 1DYBA 1L15A 2G4PA 3TMWA 5I4XA 3TXBA 1UACY 1D9UA 1KIPC 113LA 2W1XA 2MEAA 4ANRA 1OUDA 1HELA 4XENA 1LHJA 5EBHA 4PRQA 4QGZA 4ARLA 1NF5A 1IIZA 1P56A 3TXKA 1LSNA 1L01A 132LA 1XGRC 148LE 1CX7A 4TWSA 4NHPA 4HV2A 2NTHA 1T3PA 1L13A 2CGIA 119LA 4NHSA 1LSGA 4OWEA 1GFVA 1C6QA 247LA 2EPEA 1LGXA 5F16A 1GE4A 3HT9A 1WQOA 2B7XA 3GUPA 1BWHA 1YKYX 1KXYA 4W59A 4OWAA 3N9AA 5DM9A 1UIHA 5I4WA 6LYTA 173LA 1QTBA 1GFJA 1LYHA 2RBRA 3C8QA 1C61A 4ARQB 1C63A 1L81A 2BQEA 5B1FA 3P66A 3M3UA 4GN4A 5APEA 3ODUA 206LA 4G9SA 1C6BA 1C6JA 1L41A 4EPIA 194LA 3CT0A 3G3WA 1SWZA 2D4KA 3P64A 2B6ZA 3AW7A 5KJ9A 4DKLA 1DYDA 3SB6A 5C6IA 4DC4A 1L34A 4UWNA 3F9LA 3HDFA 4KT3A 104LA 2H9JA 4GLVA 207LA 221LA 1L52A 2QB0B 1LYEA 4YXCA 1DYGA 2RBNA 1REXA 5KXLA 2OTZX 1EPYA 4CFOA 4NFVA 5IHGA 3BKHA 1L18A 222LA 4YXAC 4IJ4A 2FYCA 1P37A 4WM1A 7LYZA 1QTVA 1P46A 1KNIA 3DN0A 3WMKA 4NGZA 1CKFA 1ZYTA 209LA 3W6DA 1LSBA 1ZV5L 4LFPA 1I20A 1IO5A 4YOPA 120LA 1T97A 3C7WA 3NYAA 1L40A 4XJFA 1YROA 3A95A 5L9JA 3W6AA 1B5VA 4NGIA 2A7FA 2BQKA 1L30A 1IP5A 1L86A 1IWYA 1L51A 1KW7A 1GBSA 1JKAA 111LA 1L98A 1YQVY 1NDGC 3FADA 4W55A 5KXWA 149LA 256LA 160LA 1HEOA 1L76A 5T3FA 4I0CA 1L45A 2H5ZA 4ET9A 4RW1A 1C6MA 5B59A 4O34A 1O23A 5HQ1A 1LSCA 1LSAA 1BWJA 1WQMA 1LMCA 5KXPA 4ETEA 5ILCA 2DQFC 1WQQA 5I5QA 5LVKA 3ATNA 1CU5A 1IR7A 1C67A 4H9EA 6LYZA 1L73A 2EKSC 1QTZA 5I14A 3WPKA 1L35A 3AB6A 5F14A 1OQMA 3FI7A 5M1YA 4PPOA 2ZYCA 1I56A 109LA 1L32A 5KXKA 4XYYA 3LYMA 1IP4A 158LA 1LZTA 2HU3A 1L90A 1INUA 4OWBA 127LA 165LA 1L99A 4NHQA 186LA 1P2LA 5AMYA 3WUMA 2MEHA 4OO9A 137LA 5F9XA 255LA 1IX0A 1VEDA 1C6FA 1L07A 1NDMC 1L44A 156LA 4RDSA 1WTMA 2D6BA 1L61A 169LA 1LSFA 3CDRA 2IHLA 4GCCA 1XEKA 3RU5A 1RE2A 1PQOA 2F4AA 1P2CC 1C62A 1L64A 1XEJA 1QTDA 1GHLA 2DQEY 1XGPC 4AXTA 147LA 1HERA 1L65A 1IWWA 225LA 1LZAA 1GFEA 1OUAA 5ILFA 1MELL 1GB8A 1GD6A 219LA 1IC5Y 1P2RA 3AZ4A 3AGIA 2ZQ3A 1LJGA 1D9WA 4PRUA 4TSBA 1CV1A 4RLNA 4PHIA 3HWLA 3RUNA 4H8ZA 1HMKA 2Z18A 3C7YA 2ZIJA 4FDYA 4LGKA 4ARMB 1GFUA 3C80A 1MLCE 162LA 3SB9A 1LBUA 1LHLA 2RB0X 3FE0A 1Z55A 2RH1A 1L74A 2BQCA 2W1YA 2XQOA 1SLYA 2B72A 1JWRA 3DN1A 1CU0A 5DL9A 5HNLA 2RB1X 3W6FA 4Z3MA 2BQJA 5LYMA 243LA 1GBYA 1JTOL 1L62A 1HEWA 2B5ZA 107LA 3LYZA 4KPMA 3WPLA 1LPIA 135LA 1L39A 1XEIA 2Z39A 1IY4A 4LYCA 4WM5A 4GN3A 200LA 4J1BA 1HENA 4LPQA 1W6ZA 1G0PA 4BAPA 3WU9A 4W57A 1CTWA 3B0IA 3QY4A 1UIGA 4HJYA 1G7IC 4WM4A 4N9RA 1IP1A 4FJRA 2CWIA 1LZCA 1TDYA 3HTDA 5LVJA 3WH1A 1D6QA 4DDCA 2HU1A 1DQJC 1LZDA 2WKXA 1ALCA 3V2WA 3TMXA 1OUIA 3ATOA 4M6DA 4YF2A 1D3MA 192LA 1LZYA 1HMLA 4DJHA 3WVYA 2BLYA 2RBSA 1J1PY 1L03A 1GDWA 4HPEA 2YDGA 1GF8A 4DQJA 1L02A 250LA 4DT3A 3DN2A 2XJWA 1QT6A 1SSYA 1UCOA 2ANVA 1BWIA 1L21A 4I7TA 1BB5A 5KXOA 1CJ6A 1IC7Y 1G06A 3EO5A 1G7MC 151LA 2BH7A 3LZTA 1JQUA 1OVKA 2F4GA 3HTGA 1HSWA 2G4QA 2HECA 1QSBA 6LZMA 4XN6A 4C3WA 2BQAA 1YKZX 2A7DA 1LMAA 1OUFA 1G0GA 1LYGA 3T6UA 2G4NA 1GFKA 182LA 4H8YA 1C6DA 138LA 1T8FA 4C5FA 1IOSA 1UA6Y 5C6LA 1C66A 1AKIA 3G3AB 2HUKA 234LA 1L28A 2O7AA 1IEEA 1FLUA 229LA 1LHIA 4S0WA 4DQ5A 1LZRA 1L27A 4GRVA 3D2YA 1AZFA 1G7LC 2YSSC 4M4OA 2RAYX 2N5ZA 4LDEA 4WLYA 1VFBC 1LYSA 5KXMA 1UICA 1LZ5A 253LA 1WTNA 4DYGA 1DZBX 2O79A 4DD9A 5HNCA 3A91A 4TTDA 1JEFA 1QT8A 2Z38A 1NQIA 2FBBA 1GBWA 3W6BA 4LYTA 5LYZA 5FHWA 257LA 1P6YA 2B6YA 2LHMA 1UUZC 167LA 3P68A 2ZNWY 1B7PA 217LA 3K3TA 190LA 261LA 1TBYA 4J7VA 1QQYA 1YILA 1L72A 1C68A 4ARMA 1JJ1A 1CV0A 1L66A 3GUIA 240LA 3QNGA 4W52A 212LA 230LA 2LYZA 1CVKA 1DYCA 1DYAA 1OUHA 1IOCA 1UC0A 1YIKA 3EXDA 4B4JA 2B70A 4DDBA 1GF3A 1QUDA 2HUMA 1L95A 1L88A 1F6SA 3P4ZA 4YEMA 2B74A 183LA 3LYOA 155LA 1QT5A 4XJIA 4I7PA 3WVXA 3L64A 1GPQC 1W08A 123LA 1QDRA 1GF7A 216LA 1IP2A 188LA 5KKJA 2HTXA 1L79A 2LZTA 1L77A 4NGVA 4WL7A 1L36A 5LA8A 1L71A 1LJ4A 3SP3A 185LA 3D3DA 4R6CA 1QUOA 4I7RA 4KL7A 1LI3A 1QTEA 195LA 1T8AA 4LT2A 5FDJA 2Z12A 2YBMA 4QEQA 1OUBA 2OE9X 2BQGA 1OUGA 1EQ4A 1L08A 1L10A 3SBAA 3DN8A 1N4FA 4N1EI 4N8ZA 1D6PA 4WM2A 227LA 4H9IA 1HF4A 3RZEA 5APCA 3W6EA 2B75A 1CKGA 3A93A 1CU6A 4LDLA 181LA 1C6PA 2Z37A 249LA 1CV4A 130LA 3C8SA 1RFPA 1WVUA 161LA 1L80A 1B7NA 1L06A 3W3EA 2YVBA 4ETCA 3TMUA 1IOQA 1KXWA 1YL0X 5LAFA 3WW5A 1HFXA 1LJFA 3HH3A 3MGWA 2DQIY 4PJ2C 5IDDA 4W54A 4WMGA 3CSZA 1C69A 3UONA 1BB7A 1XGTC 5C6JA 4WL6A 4HPIA 5LXWA 5KXNA 154LA 1CKHA 4N0JA 4GCFA 3QAKA 1FLQA 4XJHA 1G0KA 2Y8PA 5KXXA 1L23A 1L04A 5DLAA 3AW6A 3P65A 3HU8A 1HNLA 170LA 2IGCA 5F9UA 144LA 1QT3A 1GB2A 1G0MA 4W58A 4EKRA 3A8ZA 5I54A 5KKIA 3GUNA 2OU8A 1LJJA 3B72A 4PJZA 4II8A 4I7KA 4N1CC 1JJ0A 1LJ3A 2Z19A 2HUBA 4J1AA 2RBOA 189LA 1P64A 4I7LA 1C45A 1GB3A 2RAZX 4I7JA 7LZMA 2MECA 3L2XA 112LA 4H93A 4B4EA 1ZVHL 3N9EA 1LJNA 3GUMA 1AM7A 1XFPL 232LA 1LZEA 3IWRA 1F0WA 1DKKA 1LYYA 3AZ7A 1SWYA 4LFXA 1LSZA 5JENB 3ZVQB 3TXDA 5D5CA 134LA 5LA5A 4NY5A 4RLMA 1VDTA 1KXXA 4LT0A 4NWEA 3BKVA 4H9CA 1GFHA 1JTTL 3WYHA 1PZYA 196LA 5J7CA 4U3XB 1CU3A 220LA 4GN5C 2I26L 2HEEA 3A96A 2HEFA 3A6BY 4NGYA 3WU7A 2B6WA 4DD3A 4YEOA 1D0KA 2RSCA 4ML7A 214LA 3DKEX 5D5FA 3WULA 4OWHA 3AZ5A 1D2WA 4G4HA 1L55A 171LA 3HTBA 1REYA 3C83A 197LA 2XBSA 1PS5A 4NHIA 1L69A 3SN6R 1L70A 1V7TA 1IWVA 1WQNA 1C10A 1JIYA 4KXIA 4G54A 1EL1A 178LA 5APFA 4EPFA 152LA 1LTMA 2BQFA 254LA 2EIZC 198LA 3TXGA 2H9KA 1TAYA 5FELA 3SB5A 4EJ4A 4YENA 1CJ8A 1L38A 2BQLA 143LA 3A3RX 4Z46A 1B7RA 3EBAB 3WXUA 2ZIKA 2LYOA 5I53A 1WQRA 1YKXX 3T36A 1L63A 3HFMY 260LA 4HTNA 4EXMA 1CV6A 1L24A 2X0AA 2XBRA 126LA 4GCBA 2F47A 1D2YA 122LA 4J0LA 1LHKA 4N5RA 5E9RA 1BB6A 3NY9A 1IR8A 1GBXA 1FKVA 2YBJA 3HDEA 259LA 2CJLA 1L97A 3LHMA 1LSYA 1GWDA 1P3NA 1T8GA 2BQBA 1QSWA 2BQIA 184LA 1JSFA 3D9AC 4ARQA 1D0MA 1LGUA 4H91A 3A92A 1L85A 1LW9A 2OEAX 1XGUC 1IWZA 1BB4A 4WLDA 4CHXA 1L59A 2ZNXY 3N9CA 4LZMA 1LGWA 1LZ8A 1C43A 1L68A 2ZQ4A 4ZFPA 4LT3A 1WQPA 5L3IA 2BAAA 1JHLA 252LA 1CJ7A 1NBYC 1K28A 4GCDA 1EQ5A 1P7SA 159LA 1L11A 2DBTA 1LMTA 3CSQA 1VDPA 2BQMA 4G4BA 1C6LA 1G7HC 3CDTA 1OV5A 4B49A 2MEGA 1TCYA 163LA 1GAZA 1DYEA 1QDTA 2AUBA 4NWHA 1JKBA 1GXXA 1LZNA 1GB5A 2LC9A 3W6CA 3HT6A 2I25L 4EKPA 4BADA 4PGJB 1LOZA 4PK0A 1BVKC 5K7OA 1HHLA 3AZ6A 3CDVA 1B5UA 1L31A 4H9AA 1L87A 1C08C 2HEDA 1CUPA 1JKDA 1JJ3A 1FN5A 213LA 1HC0A 115LA 2BLXA 4G4CA 3CDOA 1IR9A 1XSFA 2B6TA 4IAPA 3J6KA 2FYDA 4HV1A 1L25A 3DMZA 2DKVA 3AJNA 1IOTA 1GFGA 4LYOA 4DD2A 3CQLA 3RT5X 1L0KA 1YAPA 3HU9A 1EAKA 1VDQA 3CT5A 1L33A 1UIEA 2YBLA 1SX7A 4XJGA 3HUQA 1IC4Y 1C6CA 1JKCA 5B07A 1A4VA 1IP6A 4AGAA 4ARJA 4GLAA 1A2YC 1UIBA 3SB8A 4BXJA 233LA 228LA 5LVIA 3QE8A 3D4SA 1NWGA 2YBNA 3FI5A 1FDLY 3G3VA 4Z41A 3KAMA 4XADA 1E8LA 4H9HA 1PQMA 153LA 1QSAA 3C8RA 3DMXA 3NY8A 4NG8A 1EQEA 1LJEA 1LHHA 2B73A 3GULA 2BQOA 4W51A 1OUCA 3V2YA 4BXDA 3HT8A 4DQ7A 3RZ4A 4I7QA 5A3EA 1L75A 1BB3A 4D9ZA 1B7MA 172LA 1L53A 244LA 4WLTA 5LZMA 1LYZA 1AT5A 1V7SA 1OVHA 4XJBA 1LCNA 1L96A 139LA 4DD7A 3GXRA 4H1PA 1GB6A 4W53A 5B1GA 1T6VL 1DI4A 3WW6A 2LYMA 1NMMA 3G3BB 4BXEA 2F2QA 4EMNA 5KY1A 1NHEA 3AGHA 4I7SA 1LYIA 1OV7A 1LSPA 4NGKA 1LI2A 1GFTA 1YAMA 2LCBA 2CUUA 3A67Y 1RJCB 1ZVYB 1AT6A 1LSEA 1B9OA 2MEBA 3LZ2A 1JTNA 1C6KA 1QTKA 1P36A 4X3BA 1BHZA 1JTPL 1QT4A 2YBIA 1F10A 1L20A 1GE1A 4B4IA 1LYJA 4OOOA 4WM3A 1L50A 1GE2A 1L94A 224LA 1DXJA 1GF0A 1PQJA 4BJ4A 5B05A 146LA 3HH5A 1ZWNA 3AYQA 2MEFA 5FEKA 1LZ4A 2DQGY 3TXEA 1IWXA 1DPWA 5KXYA 1GF9A 4LYBA 199LA 3IJVA 3FA0A 3PBLA 5LYTA 5LVHA 1LKRA 1ZURA 3EMSA 1IORA 1SX2A 1CKDA 2VB1A 1IVMA 3K2RA 108LA 4H94A 1CNSA 3F8VA 1YANA 1J1OY 1C65A 2D4JA 3E3DA 1GDXA 1L29A 2W1MA 201LA 1JISA 4OOTA 4TUNA 4BOLA 4DD0A 3RW8A 164LA 4DAJA 3CSRA 1LZGA 1L16A 1OYUA 4WM6A 4XJDA 4LDOA 3ULRA 1H6MA 2MEIA 1QS9A 1I1ZA 2W1LA 1H87A 1C6IA 1OUEA 1C6TA 4W94A 2Q0MX 2Z2FA 2YBHA 1I6SA 1LMPA 2BPUA 1REZA 2F30A 3HUKA 1L92A 102LA 3TXJA 1GB0A 4Z98A 4HTKA 5LAGA 1HFZA 1UBZA 1B7OA 1QUGA 2C8PA 2PC2A 1G0QA 1FLWA 3B6LA 140LA 1DI5A 4NGLA 1CJ9A 3LZMA 187LA 2Q9DA 1QUSA 1LWGA 2L78A 1L09A 4R0FA 4E3UA 4B1AA 1L22A 114LA 1G7JC 1OP9B 3SBBC 1C64A 1L89A 1JPOA 2HEAA 4QY9A 4CJ2A 145LA 1C46A 211LA 3OK0A 2ZYPA 1LMNA 5KXSA 2OE4X 3OE0A 4TSCA 3B0KA 4WG1A 3SB7A 1B5YA 1G0LA 4MCKA 5LINA 5HMJA 168LA 1GXV2 1WTHA 2LZ2A 2GV0A 9LYZA 1OWYA 1L93A 1PQDA 1DKJA 1BQLY 4UWVA 3VW7A 1GF5A 1FKQA 1ZMYL 4ZIXA 4NSHA 4AQNA 4NSJA 5FSTA 1QTCA 174LA 4A7DA 1OVJA 3HBEX 4H90A 4I7NA 166LA 1P5CA 3LYTA 1L58A 4H92A 3M18B 1RI8B 5LVGA 5DN5A 118LA 1WVVA 1QUTA 208LA 4ET8A 5II3A 133LA 4HSFA 1L83A 4NEBA 2D4IA 193LA 1YAOA 4L41A 1L37A 5F81A 4UWUA 2FBDA 2B6XA 1LJHA 4TX7A 1L17A 3VWOA 1C6HA 1B5ZA 3DNAA 1QTHA 1GB7A 1CUQA 251LA 1KY1A 2OU0X 1HFYA 4HTQA 157LA 1QSQA 246LA 5FCPA 218LA 131LA 215LA 4GCEA 1UIFA 1L56A 2MEEA 1HSXA 1L84A 2F32A 1L91A 2NTGA 2LZMA 1B5XA 1IP7A 1L0JA 3WUAA 4DWXA 4G49A 2Z2EA 3AGGG 1UIDA 1DI3A 4NGJA 239LA 1TEWA 1UIAA 5HMVA 2D91A 1L82A 4NGOA 1L48A 1L57A 1LYFA 1B7QA 248LA 1NKHA 4ETBA 4MR1A 1HEQA 2MEDA 3GUOA 1QUHA 1KW5A 1C60A 3A90A 1B7LA 2Q9EA 4I7OA 1L67A 2OU9A 2HEBA 1LSDA 2ZILA 1OUJA 1LZ6A 1D3NA 4E97A 1GB9A 4ZEEA 1IP3A 2EQLA 5I4YA 3CT1A 1JUGA 2CDSA 3HH6A 4HJZA 1L54A 4WOAA 4NG1A 1LAAA 1FBIX 1HEPA 3C81A 1XJTA 4CGEA 3OE8A 1L12A 3HBHA 4BS7A 4NSGA 3WUNA 4W96A 3GUKA 1G1VA 3C7ZA 1LYOA 1KIRC 2ANXA 5B06A 1JSEA 4NGWA 1B2KA 1C6NA 1JITA 262LA 3CDQA 4YX7C 110LA 4H9BA 4NSIA 1CU2A 3HH4A 3OJPA 2RB2X 258LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LSA A;  1BWJ A;  1FDL Y;  1WQM A;  4NGV A;  1LMC A;  4WL7 A;  5KXP A;  4ETE A;  5ILC A;  4Z41 A;  1IY3 A;  2DQF C;  4BAF A;  1WQQ A;  3KAM A;  5LA8 A;  1LJ4 A;  5I5Q A;  5LVK A;  3ATN A;  4XAD A;  4WG7 A;  4LYZ A;  3SP3 A;  3D3D A;  1E8L A;  4H9H A;  4R6C A;  1IR7 A;  153L A;  1QSA A;  1GBO A;  4H9E A;  4KL7 A;  6LYZ A;  1QTE A;  1VAT A;  4NG8 A;  4LT2 A;  1EQE A;  1LJE A;  1LHH A;  2EKS C;  5FDJ A;  3WU8 A;  3A94 A;  2NWD X;  2Z12 A;  2YBM A;  4QEQ A;  1GFR A;  4LT1 A;  3WPK A;  1OUB A;  1GEV A;  2BQO A;  2BQG A;  1OUG A;  3AB6 A;  1EQ4 A;  1OQM A;  1OUC A;  5F14 A;  4BXD A;  3FI7 A;  5M1Y A;  3WL2 A;  3RZ4 A;  1LZ9 A;  2XTH A;  1GE3 A;  4PPO A;  5A3E A;  1REM A;  1BB3 A;  1N4F A;  4N1E I;  4N8Z A;  1D6P A;  2ZYC A;  4D9Z A;  1B7M A;  1I56 A;  4WM2 A;  5KXK A;  4H9I A;  4IAS A;  4XYY A;  3LYM A;  1IP4 A;  1LZT A;  1HF4 A;  3CB7 A;  2HU3 A;  4WLT A;  5APC A;  3W6E A;  1INU A;  4OWB A;  1LYZ A;  1CKG A;  1AT5 A;  1V7S A;  3A93 A;  4XJB A;  4NHQ A;  2Z37 A;  1LCN A;  5AMY A;  3W6B A;  3WUM A;  2MEH A;  4DD7 A;  4H9F A;  5F9X A;  1IX0 A;  3GXR A;  1QIO A;  1VED A;  1RFP A;  4H1P A;  3TXF A;  1GB6 A;  1NDM C;  1WVU A;  1LZ1 A;  1BGI A;  1YL1 X;  1YAQ A;  5B1G A;  1T6V L;  4RDS A;  2ZWB A;  1DI4 A;  1B7S A;  1B7N A;  1WTM A;  2D6B A;  3J4G A;  3WW6 A;  3W3E A;  2LYM A;  1LSF A;  1NMM A;  1XGQ C;  2BQH A;  3G3B B;  4OWC A;  4BXE A;  2YVB A;  4YM8 A;  4EMN A;  1BVX A;  1LJK A;  2IHL A;  3B0O A;  4GCC A;  1XEK A;  1NHE A;  3RU5 A;  4ETC A;  3AGH A;  5LIO A;  3TMU A;  1IOQ A;  1KXW A;  1RE2 A;  1YL0 X;  1LSP A;  4NGK A;  5LAF A;  2F4A A;  3WW5 A;  1HFX A;  1GFT A;  1P2C C;  1YAM A;  4WO9 A;  1XEJ A;  1GF4 A;  1GHL A;  1LJF A;  2DQE Y;  3MGW A;  2DQI Y;  3F6Z A;  5HLL A;  4PJ2 C;  5DN4 A;  5IDD A;  3IJU A;  4WMG A;  3CSZ A;  1XGP C;  4AXT A;  3A3Q A;  1RJC B;  3A67 Y;  1HER A;  1ZVY B;  1IWW A;  1BB7 A;  1AT6 A;  1XGT C;  5C6J A;  1LZA A;  1GFE A;  1LMQ A;  4WL6 A;  4DD1 A;  4HPI A;  1LSE A;  5KXR A;  2WAR A;  1B9O A;  2MEB A;  5KXN A;  5LXW A;  154L A;  1OUA A;  1CKH A;  4IAT A;  3LZ2 A;  1MEL L;  1F6R A;  4GCF A;  4N0J A;  1LKS A;  4WO6 A;  1GB8 A;  1FLQ A;  1GD6 A;  4XJH A;  1SQ2 L;  1QTK A;  2Y8P A;  5KXX A;  4X3B A;  1IC5 Y;  1BHZ A;  1JTP L;  4QDN A;  3AZ4 A;  2YBI A;  3AGI A;  1F10 A;  2ZQ3 A;  5L3H A;  1GE1 A;  4B4I A;  1LJG A;  4PRU A;  4OOO A;  5DLA A;  4WM3 A;  3AW6 A;  1GE2 A;  4TSB A;  1DXJ A;  1GF0 A;  3P65 A;  4BJ4 A;  5B05 A;  1HNL A;  1LMO A;  4RLN A;  2F2N A;  4PHI A;  1LZB A;  3AYQ A;  1IWT A;  2MEF A;  1LZ4 A;  5FEK A;  3A34 A;  4H8Z A;  2DQG Y;  5F9U A;  5KXT A;  1GE0 A;  1HMK A;  2Z18 A;  1GB2 A;  1IWX A;  1D0L A;  2ZIJ A;  4FDY A;  4LGK A;  4P2E A;  1DPW A;  4MST A;  4NHT A;  5APD A;  1LZS A;  5KXY A;  1GF9 A;  2IFF Y;  4LYB A;  3TXH A;  3ZEK A;  1GFU A;  3IJV A;  1GFA A;  2DQJ Y;  1MLC E;  3A8Z A;  5I54 A;  5KKI A;  1LHM A;  5LYT A;  4LYM A;  1LJJ A;  5LVH A;  3ZVQ A;  1LBU A;  3B72 A;  1FLY A;  1LKR A;  1LHL A;  3HBD A;  3EMS A;  1IOR A;  4II8 A;  1CKD A;  2VB1 A;  4N1C C;  1JJ0 A;  1IVM A;  3FE0 A;  1LJ3 A;  1Z55 A;  2Z19 A;  2HUB A;  4H94 A;  4J1A A;  4NIJ A;  1HEM A;  2BQC A;  2W1Y A;  1CNS A;  1YAN A;  1J1O Y;  1C45 A;  1GB3 A;  2D4J A;  3E3D A;  1GDX A;  1SLY A;  1JWR A;  2W1M A;  5DL9 A;  5HNL A;  1JIS A;  2MEC A;  4OOT A;  3W6F A;  1B5W A;  2BQJ A;  4DDA A;  4Z3M A;  5LYM A;  4H93 A;  4TUN A;  3RNX A;  4B4E A;  4BOL A;  1GBY A;  4DD0 A;  1JTO L;  1ZVH L;  3N9E A;  1LJN A;  1HEW A;  2C8O A;  3RW8 A;  2B5Z A;  3LYZ A;  1CKC A;  1AM7 A;  1L6J A;  1XFP L;  3CSR A;  1LPI A;  4KPM A;  1LZG A;  1GF6 A;  5E4P A;  3WPL A;  1LSM A;  1LZE A;  135L A;  2BQD A;  3IWR A;  4WM6 A;  4XJD A;  3ULR A;  1H6M A;  1F0W A;  1DKK A;  4EOF A;  1LYY A;  3AZ7 A;  4LFX A;  1XEI A;  1LSZ A;  2Z39 A;  5JEN B;  1IY4 A;  4LYC A;  3ZVQ B;  1GBZ A;  3TXD A;  4WM5 A;  5KXZ A;  2MEI A;  5D5C A;  4GN3 A;  134L A;  5LA5 A;  4NY5 A;  8LYZ A;  1I1Z A;  2W1L A;  1H87 A;  2DQC Y;  4RLM A;  1VDT A;  1VAU A;  4J1B A;  1HEN A;  4LPQ A;  1KXX A;  4LT0 A;  4NWE A;  3BKV A;  1OUE A;  1W6Z A;  4BPA A;  4H9C A;  1GFH A;  1JTT L;  4RW2 A;  3WYH A;  4BAP A;  1PZY A;  2DQH Y;  4W94 A;  3D2Z A;  4B0D A;  2Q0M X;  2Z2F A;  2YBH A;  3WU9 A;  1GAY A;  5J7C A;  4U3X B;  3B0I A;  3QY4 A;  1LMP A;  2BPU A;  4ETA A;  1REZ A;  1UIG A;  2F30 A;  1NBZ C;  4GN5 C;  4HJY A;  2I26 L;  2HEE A;  1G7I C;  3A96 A;  1DPX A;  4WM4 A;  2HEF A;  3TXJ A;  1GB0 A;  3A6B Y;  4N9R A;  4NGY A;  3WU7 A;  1IP1 A;  4FJR A;  1D0K A;  4YEO A;  4DD3 A;  2RSC A;  2CWI A;  4Z98 A;  4HTK A;  5LAG A;  1HFZ A;  1LZC A;  1VDS A;  4ML7 A;  1TDY A;  1UBZ A;  5LVJ A;  3WH1 A;  1D6Q A;  1B7O A;  2C8P A;  2PC2 A;  4HP0 A;  5D5F A;  4WLX A;  2HU1 A;  1DQJ C;  3WUL A;  4OWH A;  1FLW A;  3B6L A;  3AZ5 A;  1J1X Y;  3WPJ A;  4G4H A;  1LZD A;  1DI5 A;  4NGL A;  1RCM A;  4HJV A;  1CJ9 A;  2WKX A;  1ALC A;  1C7P A;  1REY A;  1QUS A;  4LZT A;  4I8S A;  3TMX A;  1OUI A;  2XBS A;  3ATO A;  4M6D A;  4R0F A;  4E3U A;  4B1A A;  5IEL A;  1IWU A;  1PS5 A;  4NHI A;  4YF2 A;  1G7J C;  1OP9 B;  1B0D A;  4OW1 A;  1V7T A;  1LZY A;  1JPO A;  1IWV A;  1WQN A;  2HEA A;  1C10 A;  1JIY A;  4QY9 A;  4KXI A;  4CJ2 A;  2I6Z A;  1C46 A;  3OK0 A;  4CFP A;  2DQA A;  2ZYP A;  1LMN A;  4G54 A;  1EL1 A;  5KXS A;  3GXK A;  4ETD A;  1HML A;  5APF A;  4WG1 A;  4TSC A;  3B0K A;  5A3Z A;  1B5Y A;  4MCK A;  1LTM A;  2BQF A;  3WVY A;  3TXI A;  2EIZ C;  5LIN A;  2DQD Y;  3TXG A;  2H9K A;  1KIQ C;  1TAY A;  2BLY A;  5HMJ A;  4H8X A;  1GXV 2;  5FEL A;  3TMV A;  2LZ2 A;  1J1P Y;  2GV0 A;  9LYZ A;  1GDW A;  4HPE A;  4YEN A;  1CJ8 A;  1LJI A;  1GEZ A;  3WXT A;  2YDG A;  1GF8 A;  2BQL A;  1DKJ A;  3A3R X;  4Z46 A;  3A6C Y;  3LN2 A;  1B7R A;  4DDC A;  2BQN A;  3EBA B;  3WXU A;  2G4P A;  2ZIK A;  3TMW A;  5I4X A;  3TXB A;  2LYO A;  1BQL Y;  4DT3 A;  5I53 A;  2XJW A;  4UWV A;  1UAC Y;  1WQR A;  1YKX X;  1GF5 A;  1D9U A;  1FKQ A;  1KIP C;  1ZMY L;  2W1X A;  3T36 A;  5KY1 A;  1UCO A;  3HFM Y;  4ZIX A;  1BWI A;  2MEA A;  4HTN A;  4NSH A;  1OUD A;  1HEL A;  4NSJ A;  5FST A;  4ANR A;  2X0A A;  1BB5 A;  4XEN A;  2XBR A;  4GCB A;  5KXO A;  1CJ6 A;  1LHJ A;  5EBH A;  4J0L A;  1LHK A;  4PRQ A;  1IC7 Y;  3EO5 A;  4N5R A;  5E9R A;  4QGZ A;  1G7M C;  1BB6 A;  4A7D A;  4H90 A;  3HBE X;  1IR8 A;  3LYT A;  2BH7 A;  1NF5 A;  1IIZ A;  1FKV A;  1GBX A;  3LZT A;  4H92 A;  3M18 B;  3TXK A;  1RI8 B;  2F4G A;  2YBJ A;  1LSN A;  5LVG A;  2CJL A;  5DN5 A;  1HSW A;  3LHM A;  132L A;  1XGR C;  2G4Q A;  1WVV A;  1QUT A;  1LSY A;  1GWD A;  208L A;  2BQB A;  4TWS A;  4NHP A;  2HEC A;  1QSW A;  4ET8 A;  2BQI A;  5II3 A;  4HV2 A;  133L A;  1JSF A;  4HSF A;  4XN6 A;  1T3P A;  4C3W A;  2BQA A;  3D9A C;  4NEB A;  1YKZ X;  1D0M A;  1LMA A;  2A7D A;  1OUF A;  2D4I A;  193L A;  2CGI A;  4H91 A;  4NHS A;  3A92 A;  1YAO A;  4L41 A;  1LSG A;  5F81 A;  4UWU A;  4OWE A;  3T6U A;  2FBD A;  2G4N A;  1GFV A;  2EPE A;  1GFK A;  1LJH A;  1XGU C;  4TX7 A;  4H8Y A;  5F16 A;  3VWO A;  1GE4 A;  1IWZ A;  1BB4 A;  1B5Z A;  4WLD A;  4CHX A;  2ZNX Y;  3N9C A;  4C5F A;  1LZ8 A;  1WQO A;  1C43 A;  1IOS A;  1GB7 A;  1UA6 Y;  5C6L A;  1AKI A;  2ZQ4 A;  1BWH A;  3G3A B;  1YKY X;  1KXY A;  4ZFP A;  4LT3 A;  1HFY A;  4HTQ A;  4OWA A;  1WQP A;  5L3I A;  2BAA A;  3N9A A;  5DM9 A;  1JHL A;  1IEE A;  1CJ7 A;  1FLU A;  1NBY C;  1LHI A;  1UIH A;  5FCP A;  1LZR A;  5I4W A;  4GCD A;  6LYT A;  1EQ5 A;  1GFJ A;  4GCE A;  2DBT A;  3D2Y A;  1LMT A;  3CSQ A;  1VDP A;  1AZF A;  1UIF A;  2MEE A;  1G7L C;  2YSS C;  2BQM A;  4G4B A;  4M4O A;  1HSX A;  1G7H C;  2BQE A;  5B1F A;  4B49 A;  3P66 A;  2N5Z A;  3M3U A;  4GN4 A;  4WLY A;  5APE A;  1VFB C;  2MEG A;  1TCY A;  1LYS A;  4G9S A;  5KXM A;  1B5X A;  1UIC A;  1LZ5 A;  1GAZ A;  1IP7 A;  3WUA A;  4DWX A;  4G49 A;  1WTN A;  194L A;  3CT0 A;  1QDT A;  4DYG A;  2D4K A;  1DZB X;  3P64 A;  4DD9 A;  5HNC A;  3A91 A;  5ILF A;  3AW7 A;  4TTD A;  2Z2E A;  3AGG G;  5KJ9 A;  2AUB A;  1JEF A;  4NWH A;  5C6I A;  1JKB A;  1UID A;  4DC4 A;  1GXX A;  4UWN A;  1LZN A;  1DI3 A;  2Z38 A;  4NGJ A;  1GB5 A;  3W6C A;  2I25 L;  1NQI A;  4BAD A;  1TEW A;  1UIA A;  4KT3 A;  5HMV A;  2D91 A;  2FBB A;  1GBW A;  2H9J A;  4GLV A;  207L A;  4PGJ B;  1LOZ A;  4LYT A;  4NGO A;  5FHW A;  1BVK C;  5LYZ A;  5K7O A;  2LHM A;  1HHL A;  3AZ6 A;  1UUZ C;  1REX A;  5KXL A;  1B7Q A;  1NKH A;  4ETB A;  4MR1 A;  3P68 A;  1HEQ A;  2MED A;  2ZNW Y;  1B5U A;  4H9A A;  1B7P A;  3K3T A;  4CFO A;  1C08 C;  2HED A;  4NFV A;  5IHG A;  3BKH A;  1JKD A;  1TBY A;  1JJ3 A;  1FN5 A;  1QQY A;  3A90 A;  1YIL A;  4J7V A;  4IJ4 A;  2FYC A;  1B7L A;  4WM1 A;  7LYZ A;  2HEB A;  1LSD A;  1HC0 A;  2ZIL A;  1OUJ A;  2BLX A;  3WMK A;  4G4C A;  4NGZ A;  1CKF A;  1LZ6 A;  1JJ1 A;  3W6D A;  1LSB A;  1GB9 A;  1ZV5 L;  1IR9 A;  1XSF A;  1I20 A;  1IP3 A;  4LFP A;  1IO5 A;  4ZEE A;  4YOP A;  2EQL A;  3J6K A;  5I4Y A;  2FYD A;  3CT1 A;  3QNG A;  1JUG A;  4HV1 A;  2CDS A;  4XJF A;  1YRO A;  3A95 A;  4HJZ A;  2LYZ A;  5L9J A;  4WOA A;  3W6A A;  1OUH A;  2DKV A;  1IOC A;  3AJN A;  1UC0 A;  4NG1 A;  1B5V A;  3TXE A;  1LAA A;  1FBI X;  1YIK A;  3EXD A;  1IOT A;  1GFG A;  1HEP A;  4LYO A;  4DD2 A;  3CQL A;  3RT5 X;  4CGE A;  1YAP A;  4B4J A;  1EAK A;  1VDQ A;  2A7F A;  2BQK A;  4NGI A;  3HBH A;  4BS7 A;  4DDB A;  1IP5 A;  4NSG A;  1GF3 A;  3WUN A;  3CT5 A;  4W96 A;  2YBL A;  1UIE A;  1IWY A;  4XJG A;  1GBS A;  1IC4 Y;  1JKA A;  1LYO A;  1F6S A;  1YQV Y;  1KIR C;  1JKC A;  3P4Z A;  4YEM A;  1NDG C;  5B07 A;  5KXW A;  5B06 A;  3LYO A;  4XJI A;  1A4V A;  1IP6 A;  3WVX A;  1JSE A;  1GPQ C;  1W08 A;  4AGA A;  4GLA A;  1A2Y C;  4NGW A;  1QDR A;  1UIB A;  1B2K A;  1JIT A;  1HEO A;  4BXJ A;  5LVI A;  1GF7 A;  3QE8 A;  4H9B A;  1IP2 A;  4I0C A;  5T3F A;  4NSI A;  5KKJ A;  2H5Z A;  4ET9 A;  4RW1 A;  2HTX A;  2LZT A;  5B59 A;  4O34 A;  3OJP A;  1NWG A;  1O23 A;  5HQ1 A;  2YBN A;  1LSC A; 
#chains in the Genus database with same CATH topology
 3GUJ A;  236L A;  1IY3 A;  4BAF A;  4WG7 A;  4LYZ A;  1L42 A;  1G1W A;  1GBO A;  3DN3 A;  1VAT A;  3WU8 A;  1CV3 A;  3A94 A;  2NWD X;  1GFR A;  4LT1 A;  1GEV A;  2Z6B A;  180L A;  4W56 A;  1L14 A;  3WL2 A;  1LZ9 A;  2XTH A;  1GE3 A;  1REM A;  1QS5 A;  4IAS A;  3CB7 A;  3JR6 A;  1D3F A;  226L A;  3C82 A;  1L00 A;  4H9F A;  1JTM A;  1QIO A;  3TXF A;  1PQI A;  1LZ1 A;  1BGI A;  1YL1 X;  1YAQ A;  2ZWB A;  1B7S A;  4K5Y A;  1C6E A;  3J4G A;  1L46 A;  1XGQ C;  2BQH A;  4OWC A;  4YM8 A;  1BVX A;  1LJK A;  3B0O A;  1T6H A;  5LIO A;  4WO9 A;  1GF4 A;  2O4W A;  237L A;  3F6Z A;  5HLL A;  1XJU A;  1XEP A;  5DN4 A;  3IJU A;  2RBQ A;  3A3Q A;  177L A;  4DD1 A;  1LMQ A;  1D3J A;  5KXR A;  2WAR A;  4IAT A;  2HUL A;  205L A;  1F6R A;  1LKS A;  4WO6 A;  1SQ2 L;  3HT7 A;  4QDN A;  1L43 A;  5L3H A;  3EML A;  1KY0 A;  175L A;  1L26 A;  1LMO A;  3HTF A;  2F2N A;  1LZB A;  1LYD A;  242L A;  3HUA A;  1IWT A;  3A34 A;  1LI6 A;  5KXT A;  1DYF A;  1GE0 A;  1D0L A;  4P2E A;  4NHT A;  4MST A;  245L A;  5APD A;  1LZS A;  2IFF Y;  3TXH A;  3ZEK A;  1GFA A;  2DQJ Y;  4EKQ A;  1G07 A;  2A4T A;  1LHM A;  4LYM A;  3ZVQ A;  1FLY A;  3HBD A;  223L A;  4NIJ A;  1L49 A;  1HEM A;  1QT7 A;  3G3X A;  3DMV A;  1B5W A;  4DDA A;  3PDS A;  3RNX A;  2C8O A;  150L A;  1CKC A;  1L6J A;  5E4P A;  1LLH A;  1GF6 A;  2OTY X;  1LSM A;  2BQD A;  1PQK A;  4EOF A;  1CX6 A;  1GBZ A;  125L A;  5KXZ A;  3DN6 A;  8LYZ A;  2DQC Y;  3DN4 A;  1OWZ A;  1VAU A;  4BPA A;  4RW2 A;  1L60 A;  1C6G A;  238L A;  2DQH Y;  3D2Z A;  4B0D A;  4I7M A;  1GAY A;  191L A;  4ZPU A;  4ETA A;  1NBZ C;  235L A;  1DPX A;  1G0J A;  1B6I A;  1VDS A;  1CV5 A;  1KS3 A;  2OE7 X;  1TLA A;  4HP0 A;  4WLX A;  1C6A A;  231L A;  1J1X Y;  3WPJ A;  4ARP A;  1RCM A;  4HJV A;  210L A;  1C7P A;  4LZT A;  4I8S A;  141L A;  2RBP A;  129L A;  3OE6 A;  103L A;  1IWU A;  5IEL A;  1B0D A;  4OW1 A;  176L A;  142L A;  1L19 A;  2I6Z A;  1SSW A;  4CFP A;  2DQA A;  3GXK A;  4ETD A;  241L A;  1L05 A;  5A3Z A;  1LWK A;  3TXI A;  2DQD Y;  1KIQ C;  1L47 A;  4H8X A;  3TMV A;  4EKS A;  128L A;  1LPY A;  3OE9 A;  1LJI A;  4GBR B;  1GEZ A;  3WXT A;  1NHB A;  3A6C Y;  2QAR C;  3LN2 A;  2BQN A;  1DYB A;  1L15 A;  2G4P A;  3TMW A;  5I4X A;  3TXB A;  1UAC Y;  1D9U A;  1KIP C;  113L A;  2W1X A;  2MEA A;  4ANR A;  1OUD A;  1HEL A;  4XEN A;  1LHJ A;  5EBH A;  4PRQ A;  4QGZ A;  4ARL A;  1NF5 A;  1IIZ A;  1P56 A;  3TXK A;  1LSN A;  1L01 A;  132L A;  1XGR C;  148L E;  1CX7 A;  4TWS A;  4NHP A;  4HV2 A;  2NTH A;  1T3P A;  1L13 A;  2CGI A;  119L A;  4NHS A;  1LSG A;  4OWE A;  1GFV A;  1C6Q A;  247L A;  2EPE A;  1LGX A;  5F16 A;  1GE4 A;  3HT9 A;  1WQO A;  2B7X A;  3GUP A;  1BWH A;  1YKY X;  1KXY A;  4W59 A;  4OWA A;  3N9A A;  5DM9 A;  1UIH A;  5I4W A;  6LYT A;  173L A;  1QTB A;  1GFJ A;  1LYH A;  2RBR A;  3C8Q A;  1C61 A;  4ARQ B;  1C63 A;  1L81 A;  2BQE A;  5B1F A;  3P66 A;  3M3U A;  4GN4 A;  5APE A;  3ODU A;  206L A;  4G9S A;  1C6B A;  1C6J A;  1L41 A;  4EPI A;  194L A;  3CT0 A;  3G3W A;  1SWZ A;  2D4K A;  3P64 A;  2B6Z A;  3AW7 A;  5KJ9 A;  4DKL A;  1DYD A;  3SB6 A;  5C6I A;  4DC4 A;  1L34 A;  4UWN A;  3F9L A;  3HDF A;  4KT3 A;  104L A;  2H9J A;  4GLV A;  207L A;  221L A;  1L52 A;  2QB0 B;  1LYE A;  4YXC A;  1DYG A;  2RBN A;  1REX A;  5KXL A;  2OTZ X;  1EPY A;  4CFO A;  4NFV A;  5IHG A;  3BKH A;  1L18 A;  222L A;  4YXA C;  4IJ4 A;  2FYC A;  1P37 A;  4WM1 A;  7LYZ A;  1QTV A;  1P46 A;  1KNI A;  3DN0 A;  3WMK A;  4NGZ A;  1CKF A;  1ZYT A;  209L A;  3W6D A;  1LSB A;  1ZV5 L;  4LFP A;  1I20 A;  1IO5 A;  4YOP A;  120L A;  1T97 A;  3C7W A;  3NYA A;  1L40 A;  4XJF A;  1YRO A;  3A95 A;  5L9J A;  3W6A A;  1B5V A;  4NGI A;  2A7F A;  2BQK A;  1L30 A;  1IP5 A;  1L86 A;  1IWY A;  1L51 A;  1KW7 A;  1GBS A;  1JKA A;  111L A;  1L98 A;  1YQV Y;  1NDG C;  3FAD A;  4W55 A;  5KXW A;  149L A;  256L A;  160L A;  1HEO A;  1L76 A;  5T3F A;  4I0C A;  1L45 A;  2H5Z A;  4ET9 A;  4RW1 A;  1C6M A;  5B59 A;  4O34 A;  1O23 A;  5HQ1 A;  1LSC A;  1LSA A;  1BWJ A;  1WQM A;  1LMC A;  5KXP A;  4ETE A;  5ILC A;  2DQF C;  1WQQ A;  5I5Q A;  5LVK A;  3ATN A;  1CU5 A;  1IR7 A;  1C67 A;  4H9E A;  6LYZ A;  1L73 A;  2EKS C;  1QTZ A;  5I14 A;  3WPK A;  1L35 A;  3AB6 A;  5F14 A;  1OQM A;  3FI7 A;  5M1Y A;  4PPO A;  2ZYC A;  1I56 A;  109L A;  1L32 A;  5KXK A;  4XYY A;  3LYM A;  1IP4 A;  158L A;  1LZT A;  2HU3 A;  1L90 A;  1INU A;  4OWB A;  127L A;  165L A;  1L99 A;  4NHQ A;  186L A;  1P2L A;  5AMY A;  3WUM A;  2MEH A;  4OO9 A;  137L A;  5F9X A;  255L A;  1IX0 A;  1VED A;  1C6F A;  1L07 A;  1NDM C;  1L44 A;  156L A;  4RDS A;  1WTM A;  2D6B A;  1L61 A;  169L A;  1LSF A;  3CDR A;  2IHL A;  4GCC A;  1XEK A;  3RU5 A;  1RE2 A;  1PQO A;  2F4A A;  1P2C C;  1C62 A;  1L64 A;  1XEJ A;  1QTD A;  1GHL A;  2DQE Y;  1XGP C;  4AXT A;  147L A;  1HER A;  1L65 A;  1IWW A;  225L A;  1LZA A;  1GFE A;  1OUA A;  5ILF A;  1MEL L;  1GB8 A;  1GD6 A;  219L A;  1IC5 Y;  1P2R A;  3AZ4 A;  3AGI A;  2ZQ3 A;  1LJG A;  1D9W A;  4PRU A;  4TSB A;  1CV1 A;  4RLN A;  4PHI A;  3HWL A;  3RUN A;  4H8Z A;  1HMK A;  2Z18 A;  3C7Y A;  2ZIJ A;  4FDY A;  4LGK A;  4ARM B;  1GFU A;  3C80 A;  1MLC E;  162L A;  3SB9 A;  1LBU A;  1LHL A;  2RB0 X;  3FE0 A;  1Z55 A;  2RH1 A;  1L74 A;  2BQC A;  2W1Y A;  2XQO A;  1SLY A;  2B72 A;  1JWR A;  3DN1 A;  1CU0 A;  5DL9 A;  5HNL A;  2RB1 X;  3W6F A;  4Z3M A;  2BQJ A;  5LYM A;  243L A;  1GBY A;  1JTO L;  1L62 A;  1HEW A;  2B5Z A;  107L A;  3LYZ A;  4KPM A;  3WPL A;  1LPI A;  135L A;  1L39 A;  1XEI A;  2Z39 A;  1IY4 A;  4LYC A;  4WM5 A;  4GN3 A;  200L A;  4J1B A;  1HEN A;  4LPQ A;  1W6Z A;  1G0P A;  4BAP A;  3WU9 A;  4W57 A;  1CTW A;  3B0I A;  3QY4 A;  1UIG A;  4HJY A;  1G7I C;  4WM4 A;  4N9R A;  1IP1 A;  4FJR A;  2CWI A;  1LZC A;  1TDY A;  3HTD A;  5LVJ A;  3WH1 A;  1D6Q A;  4DDC A;  2HU1 A;  1DQJ C;  1LZD A;  2WKX A;  1ALC A;  3V2W A;  3TMX A;  1OUI A;  3ATO A;  4M6D A;  4YF2 A;  1D3M A;  192L A;  1LZY A;  1HML A;  4DJH A;  3WVY A;  2BLY A;  2RBS A;  1J1P Y;  1L03 A;  1GDW A;  4HPE A;  2YDG A;  1GF8 A;  4DQJ A;  1L02 A;  250L A;  4DT3 A;  3DN2 A;  2XJW A;  1QT6 A;  1SSY A;  1UCO A;  2ANV A;  1BWI A;  1L21 A;  4I7T A;  1BB5 A;  5KXO A;  1CJ6 A;  1IC7 Y;  1G06 A;  3EO5 A;  1G7M C;  151L A;  2BH7 A;  3LZT A;  1JQU A;  1OVK A;  2F4G A;  3HTG A;  1HSW A;  2G4Q A;  2HEC A;  1QSB A;  6LZM A;  4XN6 A;  4C3W A;  2BQA A;  1YKZ X;  2A7D A;  1LMA A;  1OUF A;  1G0G A;  1LYG A;  3T6U A;  2G4N A;  1GFK A;  182L A;  4H8Y A;  1C6D A;  138L A;  1T8F A;  4C5F A;  1IOS A;  1UA6 Y;  5C6L A;  1C66 A;  1AKI A;  3G3A B;  2HUK A;  234L A;  1L28 A;  2O7A A;  1IEE A;  1FLU A;  229L A;  1LHI A;  4S0W A;  4DQ5 A;  1LZR A;  1L27 A;  4GRV A;  3D2Y A;  1AZF A;  1G7L C;  2YSS C;  4M4O A;  2RAY X;  2N5Z A;  4LDE A;  4WLY A;  1VFB C;  1LYS A;  5KXM A;  1UIC A;  1LZ5 A;  253L A;  1WTN A;  4DYG A;  1DZB X;  2O79 A;  4DD9 A;  5HNC A;  3A91 A;  4TTD A;  1JEF A;  1QT8 A;  2Z38 A;  1NQI A;  2FBB A;  1GBW A;  3W6B A;  4LYT A;  5LYZ A;  5FHW A;  257L A;  1P6Y A;  2B6Y A;  2LHM A;  1UUZ C;  167L A;  3P68 A;  2ZNW Y;  1B7P A;  217L A;  3K3T A;  190L A;  261L A;  1TBY A;  4J7V A;  1QQY A;  1YIL A;  1L72 A;  1C68 A;  4ARM A;  1JJ1 A;  1CV0 A;  1L66 A;  3GUI A;  240L A;  3QNG A;  4W52 A;  212L A;  230L A;  2LYZ A;  1CVK A;  1DYC A;  1DYA A;  1OUH A;  1IOC A;  1UC0 A;  1YIK A;  3EXD A;  4B4J A;  2B70 A;  4DDB A;  1GF3 A;  1QUD A;  2HUM A;  1L95 A;  1L88 A;  1F6S A;  3P4Z A;  4YEM A;  2B74 A;  183L A;  3LYO A;  155L A;  1QT5 A;  4XJI A;  4I7P A;  3WVX A;  3L64 A;  1GPQ C;  1W08 A;  123L A;  1QDR A;  1GF7 A;  216L A;  1IP2 A;  188L A;  5KKJ A;  2HTX A;  1L79 A;  2LZT A;  1L77 A;  4NGV A;  4WL7 A;  1L36 A;  5LA8 A;  1L71 A;  1LJ4 A;  3SP3 A;  185L A;  3D3D A;  4R6C A;  1QUO A;  4I7R A;  4KL7 A;  1LI3 A;  1QTE A;  195L A;  1T8A A;  4LT2 A;  5FDJ A;  2Z12 A;  2YBM A;  4QEQ A;  1OUB A;  2OE9 X;  2BQG A;  1OUG A;  1EQ4 A;  1L08 A;  1L10 A;  3SBA A;  3DN8 A;  1N4F A;  4N1E I;  4N8Z A;  1D6P A;  4WM2 A;  227L A;  4H9I A;  1HF4 A;  3RZE A;  5APC A;  3W6E A;  2B75 A;  1CKG A;  3A93 A;  1CU6 A;  4LDL A;  181L A;  1C6P A;  2Z37 A;  249L A;  1CV4 A;  130L A;  3C8S A;  1RFP A;  1WVU A;  161L A;  1L80 A;  1B7N A;  1L06 A;  3W3E A;  2YVB A;  4ETC A;  3TMU A;  1IOQ A;  1KXW A;  1YL0 X;  5LAF A;  3WW5 A;  1HFX A;  1LJF A;  3HH3 A;  3MGW A;  2DQI Y;  4PJ2 C;  5IDD A;  4W54 A;  4WMG A;  3CSZ A;  1C69 A;  3UON A;  1BB7 A;  1XGT C;  5C6J A;  4WL6 A;  4HPI A;  5LXW A;  5KXN A;  154L A;  1CKH A;  4N0J A;  4GCF A;  3QAK A;  1FLQ A;  4XJH A;  1G0K A;  2Y8P A;  5KXX A;  1L23 A;  1L04 A;  5DLA A;  3AW6 A;  3P65 A;  3HU8 A;  1HNL A;  170L A;  2IGC A;  5F9U A;  144L A;  1QT3 A;  1GB2 A;  1G0M A;  4W58 A;  4EKR A;  3A8Z A;  5I54 A;  5KKI A;  3GUN A;  2OU8 A;  1LJJ A;  3B72 A;  4PJZ A;  4II8 A;  4I7K A;  4N1C C;  1JJ0 A;  1LJ3 A;  2Z19 A;  2HUB A;  4J1A A;  2RBO A;  189L A;  1P64 A;  4I7L A;  1C45 A;  1GB3 A;  2RAZ X;  4I7J A;  7LZM A;  2MEC A;  3L2X A;  112L A;  4H93 A;  4B4E A;  1ZVH L;  3N9E A;  1LJN A;  3GUM A;  1AM7 A;  1XFP L;  232L A;  1LZE A;  3IWR A;  1F0W A;  1DKK A;  1LYY A;  3AZ7 A;  1SWY A;  4LFX A;  1LSZ A;  5JEN B;  3ZVQ B;  3TXD A;  5D5C A;  134L A;  5LA5 A;  4NY5 A;  4RLM A;  1VDT A;  1KXX A;  4LT0 A;  4NWE A;  3BKV A;  4H9C A;  1GFH A;  1JTT L;  3WYH A;  1PZY A;  196L A;  5J7C A;  4U3X B;  1CU3 A;  220L A;  4GN5 C;  2I26 L;  2HEE A;  3A96 A;  2HEF A;  3A6B Y;  4NGY A;  3WU7 A;  2B6W A;  4DD3 A;  4YEO A;  1D0K A;  2RSC A;  4ML7 A;  214L A;  3DKE X;  5D5F A;  3WUL A;  4OWH A;  3AZ5 A;  1D2W A;  4G4H A;  1L55 A;  171L A;  3HTB A;  1REY A;  3C83 A;  197L A;  2XBS A;  1PS5 A;  4NHI A;  1L69 A;  3SN6 R;  1L70 A;  1V7T A;  1IWV A;  1WQN A;  1C10 A;  1JIY A;  4KXI A;  4G54 A;  1EL1 A;  178L A;  5APF A;  4EPF A;  152L A;  1LTM A;  2BQF A;  254L A;  2EIZ C;  198L A;  3TXG A;  2H9K A;  1TAY A;  5FEL A;  3SB5 A;  4EJ4 A;  4YEN A;  1CJ8 A;  1L38 A;  2BQL A;  143L A;  3A3R X;  4Z46 A;  1B7R A;  3EBA B;  3WXU A;  2ZIK A;  2LYO A;  5I53 A;  1WQR A;  1YKX X;  3T36 A;  1L63 A;  3HFM Y;  260L A;  4HTN A;  4EXM A;  1CV6 A;  1L24 A;  2X0A A;  2XBR A;  126L A;  4GCB A;  2F47 A;  1D2Y A;  122L A;  4J0L A;  1LHK A;  4N5R A;  5E9R A;  1BB6 A;  3NY9 A;  1IR8 A;  1GBX A;  1FKV A;  2YBJ A;  3HDE A;  259L A;  2CJL A;  1L97 A;  3LHM A;  1LSY A;  1GWD A;  1P3N A;  1T8G A;  2BQB A;  1QSW A;  2BQI A;  184L A;  1JSF A;  3D9A C;  4ARQ A;  1D0M A;  1LGU A;  4H91 A;  3A92 A;  1L85 A;  1LW9 A;  2OEA X;  1XGU C;  1IWZ A;  1BB4 A;  4WLD A;  4CHX A;  1L59 A;  2ZNX Y;  3N9C A;  4LZM A;  1LGW A;  1LZ8 A;  1C43 A;  1L68 A;  2ZQ4 A;  4ZFP A;  4LT3 A;  1WQP A;  5L3I A;  2BAA A;  1JHL A;  252L A;  1CJ7 A;  1NBY C;  1K28 A;  4GCD A;  1EQ5 A;  1P7S A;  159L A;  1L11 A;  2DBT A;  1LMT A;  3CSQ A;  1VDP A;  2BQM A;  4G4B A;  1C6L A;  1G7H C;  3CDT A;  1OV5 A;  4B49 A;  2MEG A;  1TCY A;  163L A;  1GAZ A;  1DYE A;  1QDT A;  2AUB A;  4NWH A;  1JKB A;  1GXX A;  1LZN A;  1GB5 A;  2LC9 A;  3W6C A;  3HT6 A;  2I25 L;  4EKP A;  4BAD A;  4PGJ B;  1LOZ A;  4PK0 A;  1BVK C;  5K7O A;  1HHL A;  3AZ6 A;  3CDV A;  1B5U A;  1L31 A;  4H9A A;  1L87 A;  1C08 C;  2HED A;  1CUP A;  1JKD A;  1JJ3 A;  1FN5 A;  213L A;  1HC0 A;  115L A;  2BLX A;  4G4C A;  3CDO A;  1IR9 A;  1XSF A;  2B6T A;  4IAP A;  3J6K A;  2FYD A;  4HV1 A;  1L25 A;  3DMZ A;  2DKV A;  3AJN A;  1IOT A;  1GFG A;  4LYO A;  4DD2 A;  3CQL A;  3RT5 X;  1L0K A;  1YAP A;  3HU9 A;  1EAK A;  1VDQ A;  3CT5 A;  1L33 A;  1UIE A;  2YBL A;  1SX7 A;  4XJG A;  3HUQ A;  1IC4 Y;  1C6C A;  1JKC A;  5B07 A;  1A4V A;  1IP6 A;  4AGA A;  4ARJ A;  4GLA A;  1A2Y C;  1UIB A;  3SB8 A;  4BXJ A;  233L A;  228L A;  5LVI A;  3QE8 A;  3D4S A;  1NWG A;  2YBN A;  3FI5 A;  1FDL Y;  3G3V A;  4Z41 A;  3KAM A;  4XAD A;  1E8L A;  4H9H A;  1PQM A;  153L A;  1QSA A;  3C8R A;  3DMX A;  3NY8 A;  4NG8 A;  1EQE A;  1LJE A;  1LHH A;  2B73 A;  3GUL A;  2BQO A;  4W51 A;  1OUC A;  3V2Y A;  4BXD A;  3HT8 A;  4DQ7 A;  3RZ4 A;  4I7Q A;  5A3E A;  1L75 A;  1BB3 A;  4D9Z A;  1B7M A;  172L A;  1L53 A;  244L A;  4WLT A;  5LZM A;  1LYZ A;  1AT5 A;  1V7S A;  1OVH A;  4XJB A;  1LCN A;  1L96 A;  139L A;  4DD7 A;  3GXR A;  4H1P A;  1GB6 A;  4W53 A;  5B1G A;  1T6V L;  1DI4 A;  3WW6 A;  2LYM A;  1NMM A;  3G3B B;  4BXE A;  2F2Q A;  4EMN A;  5KY1 A;  1NHE A;  3AGH A;  4I7S A;  1LYI A;  1OV7 A;  1LSP A;  4NGK A;  1LI2 A;  1GFT A;  1YAM A;  2LCB A;  2CUU A;  3A67 Y;  1RJC B;  1ZVY B;  1AT6 A;  1LSE A;  1B9O A;  2MEB A;  3LZ2 A;  1JTN A;  1C6K A;  1QTK A;  1P36 A;  4X3B A;  1BHZ A;  1JTP L;  1QT4 A;  2YBI A;  1F10 A;  1L20 A;  1GE1 A;  4B4I A;  1LYJ A;  4OOO A;  4WM3 A;  1L50 A;  1GE2 A;  1L94 A;  224L A;  1DXJ A;  1GF0 A;  1PQJ A;  4BJ4 A;  5B05 A;  146L A;  3HH5 A;  1ZWN A;  3AYQ A;  2MEF A;  5FEK A;  1LZ4 A;  2DQG Y;  3TXE A;  1IWX A;  1DPW A;  5KXY A;  1GF9 A;  4LYB A;  199L A;  3IJV A;  3FA0 A;  3PBL A;  5LYT A;  5LVH A;  1LKR A;  1ZUR A;  3EMS A;  1IOR A;  1SX2 A;  1CKD A;  2VB1 A;  1IVM A;  3K2R A;  108L A;  4H94 A;  1CNS A;  3F8V A;  1YAN A;  1J1O Y;  1C65 A;  2D4J A;  3E3D A;  1GDX A;  1L29 A;  2W1M A;  201L A;  1JIS A;  4OOT A;  4TUN A;  4BOL A;  4DD0 A;  3RW8 A;  164L A;  4DAJ A;  3CSR A;  1LZG A;  1L16 A;  1OYU A;  4WM6 A;  4XJD A;  4LDO A;  3ULR A;  1H6M A;  2MEI A;  1QS9 A;  1I1Z A;  2W1L A;  1H87 A;  1C6I A;  1OUE A;  1C6T A;  4W94 A;  2Q0M X;  2Z2F A;  2YBH A;  1I6S A;  1LMP A;  2BPU A;  1REZ A;  2F30 A;  3HUK A;  1L92 A;  102L A;  3TXJ A;  1GB0 A;  4Z98 A;  4HTK A;  5LAG A;  1HFZ A;  1UBZ A;  1B7O A;  1QUG A;  2C8P A;  2PC2 A;  1G0Q A;  1FLW A;  3B6L A;  140L A;  1DI5 A;  4NGL A;  1CJ9 A;  3LZM A;  187L A;  2Q9D A;  1QUS A;  1LWG A;  2L78 A;  1L09 A;  4R0F A;  4E3U A;  4B1A A;  1L22 A;  114L A;  1G7J C;  1OP9 B;  3SBB C;  1C64 A;  1L89 A;  1JPO A;  2HEA A;  4QY9 A;  4CJ2 A;  145L A;  1C46 A;  211L A;  3OK0 A;  2ZYP A;  1LMN A;  5KXS A;  2OE4 X;  3OE0 A;  4TSC A;  3B0K A;  4WG1 A;  3SB7 A;  1B5Y A;  1G0L A;  4MCK A;  5LIN A;  5HMJ A;  168L A;  1GXV 2;  1WTH A;  2LZ2 A;  2GV0 A;  9LYZ A;  1OWY A;  1L93 A;  1PQD A;  1DKJ A;  1BQL Y;  4UWV A;  3VW7 A;  1GF5 A;  1FKQ A;  1ZMY L;  4ZIX A;  4NSH A;  4AQN A;  4NSJ A;  5FST A;  1QTC A;  174L A;  4A7D A;  1OVJ A;  3HBE X;  4H90 A;  4I7N A;  166L A;  1P5C A;  3LYT A;  1L58 A;  4H92 A;  3M18 B;  1RI8 B;  5LVG A;  5DN5 A;  118L A;  1WVV A;  1QUT A;  208L A;  4ET8 A;  5II3 A;  133L A;  4HSF A;  1L83 A;  4NEB A;  2D4I A;  193L A;  1YAO A;  4L41 A;  1L37 A;  5F81 A;  4UWU A;  2FBD A;  2B6X A;  1LJH A;  4TX7 A;  1L17 A;  3VWO A;  1C6H A;  1B5Z A;  3DNA A;  1QTH A;  1GB7 A;  1CUQ A;  251L A;  1KY1 A;  2OU0 X;  1HFY A;  4HTQ A;  157L A;  1QSQ A;  246L A;  5FCP A;  218L A;  131L A;  215L A;  4GCE A;  1UIF A;  1L56 A;  2MEE A;  1HSX A;  1L84 A;  2F32 A;  1L91 A;  2NTG A;  2LZM A;  1B5X A;  1IP7 A;  1L0J A;  3WUA A;  4DWX A;  4G49 A;  2Z2E A;  3AGG G;  1UID A;  1DI3 A;  4NGJ A;  239L A;  1TEW A;  1UIA A;  5HMV A;  2D91 A;  1L82 A;  4NGO A;  1L48 A;  1L57 A;  1LYF A;  1B7Q A;  248L A;  1NKH A;  4ETB A;  4MR1 A;  1HEQ A;  2MED A;  3GUO A;  1QUH A;  1KW5 A;  1C60 A;  3A90 A;  1B7L A;  2Q9E A;  4I7O A;  1L67 A;  2OU9 A;  2HEB A;  1LSD A;  2ZIL A;  1OUJ A;  1LZ6 A;  1D3N A;  4E97 A;  1GB9 A;  4ZEE A;  1IP3 A;  2EQL A;  5I4Y A;  3CT1 A;  1JUG A;  2CDS A;  3HH6 A;  4HJZ A;  1L54 A;  4WOA A;  4NG1 A;  1LAA A;  1FBI X;  1HEP A;  3C81 A;  1XJT A;  4CGE A;  3OE8 A;  1L12 A;  3HBH A;  4BS7 A;  4NSG A;  3WUN A;  4W96 A;  3GUK A;  1G1V A;  3C7Z A;  1LYO A;  1KIR C;  2ANX A;  5B06 A;  1JSE A;  4NGW A;  1B2K A;  1C6N A;  1JIT A;  262L A;  3CDQ A;  4YX7 C;  110L A;  4H9B A;  4NSI A;  1CU2 A;  3HH4 A;  3OJP A;  2RB2 X;  258L A; 
#chains in the Genus database with same CATH homology
 3GUJ A;  236L A;  1IY3 A;  4BAF A;  4WG7 A;  4LYZ A;  1L42 A;  1G1W A;  1GBO A;  3DN3 A;  1VAT A;  3WU8 A;  1CV3 A;  3A94 A;  2NWD X;  1GFR A;  4LT1 A;  1GEV A;  2Z6B A;  180L A;  4W56 A;  1L14 A;  3WL2 A;  1LZ9 A;  2XTH A;  1GE3 A;  1REM A;  1QS5 A;  4IAS A;  3CB7 A;  3JR6 A;  1D3F A;  226L A;  3C82 A;  1L00 A;  4H9F A;  1JTM A;  1QIO A;  3TXF A;  1PQI A;  1LZ1 A;  1BGI A;  1YL1 X;  1YAQ A;  2ZWB A;  1B7S A;  4K5Y A;  1C6E A;  3J4G A;  1L46 A;  1XGQ C;  2BQH A;  4OWC A;  4YM8 A;  1BVX A;  1LJK A;  3B0O A;  1T6H A;  5LIO A;  4WO9 A;  1GF4 A;  2O4W A;  237L A;  3F6Z A;  5HLL A;  1XJU A;  1XEP A;  5DN4 A;  3IJU A;  2RBQ A;  3A3Q A;  177L A;  4DD1 A;  1LMQ A;  1D3J A;  5KXR A;  2WAR A;  4IAT A;  2HUL A;  205L A;  1F6R A;  1LKS A;  4WO6 A;  1SQ2 L;  3HT7 A;  4QDN A;  1L43 A;  5L3H A;  3EML A;  1KY0 A;  175L A;  1L26 A;  1LMO A;  3HTF A;  2F2N A;  1LZB A;  1LYD A;  242L A;  3HUA A;  1IWT A;  3A34 A;  1LI6 A;  5KXT A;  1DYF A;  1GE0 A;  1D0L A;  4P2E A;  4NHT A;  4MST A;  245L A;  5APD A;  1LZS A;  2IFF Y;  3TXH A;  3ZEK A;  1GFA A;  2DQJ Y;  4EKQ A;  1G07 A;  2A4T A;  1LHM A;  4LYM A;  3ZVQ A;  1FLY A;  3HBD A;  223L A;  4NIJ A;  1L49 A;  1HEM A;  1QT7 A;  3G3X A;  3DMV A;  1B5W A;  4DDA A;  3PDS A;  3RNX A;  2C8O A;  150L A;  1CKC A;  1L6J A;  5E4P A;  1LLH A;  1GF6 A;  2OTY X;  1LSM A;  2BQD A;  1PQK A;  4EOF A;  1CX6 A;  1GBZ A;  125L A;  5KXZ A;  3DN6 A;  8LYZ A;  2DQC Y;  3DN4 A;  1OWZ A;  1VAU A;  4BPA A;  4RW2 A;  1L60 A;  1C6G A;  238L A;  2DQH Y;  3D2Z A;  4B0D A;  4I7M A;  1GAY A;  191L A;  4ZPU A;  4ETA A;  1NBZ C;  235L A;  1DPX A;  1G0J A;  1B6I A;  1VDS A;  1CV5 A;  1KS3 A;  2OE7 X;  1TLA A;  4HP0 A;  4WLX A;  1C6A A;  231L A;  1J1X Y;  3WPJ A;  4ARP A;  1RCM A;  4HJV A;  210L A;  1C7P A;  4LZT A;  4I8S A;  141L A;  2RBP A;  129L A;  3OE6 A;  103L A;  1IWU A;  5IEL A;  1B0D A;  4OW1 A;  176L A;  142L A;  1L19 A;  2I6Z A;  1SSW A;  4CFP A;  2DQA A;  3GXK A;  4ETD A;  241L A;  1L05 A;  5A3Z A;  1LWK A;  3TXI A;  2DQD Y;  1KIQ C;  1L47 A;  4H8X A;  3TMV A;  4EKS A;  128L A;  1LPY A;  3OE9 A;  1LJI A;  4GBR B;  1GEZ A;  3WXT A;  1NHB A;  3A6C Y;  2QAR C;  3LN2 A;  2BQN A;  1DYB A;  1L15 A;  2G4P A;  3TMW A;  5I4X A;  3TXB A;  1UAC Y;  1D9U A;  1KIP C;  113L A;  2W1X A;  2MEA A;  4ANR A;  1OUD A;  1HEL A;  4XEN A;  1LHJ A;  5EBH A;  4PRQ A;  4QGZ A;  4ARL A;  1NF5 A;  1IIZ A;  1P56 A;  3TXK A;  1LSN A;  1L01 A;  132L A;  1XGR C;  148L E;  1CX7 A;  4TWS A;  4NHP A;  4HV2 A;  2NTH A;  1T3P A;  1L13 A;  2CGI A;  119L A;  4NHS A;  1LSG A;  4OWE A;  1GFV A;  1C6Q A;  247L A;  2EPE A;  1LGX A;  5F16 A;  1GE4 A;  3HT9 A;  1WQO A;  2B7X A;  3GUP A;  1BWH A;  1YKY X;  1KXY A;  4W59 A;  4OWA A;  3N9A A;  5DM9 A;  1UIH A;  5I4W A;  6LYT A;  173L A;  1QTB A;  1GFJ A;  1LYH A;  2RBR A;  3C8Q A;  1C61 A;  4ARQ B;  1C63 A;  1L81 A;  2BQE A;  5B1F A;  3P66 A;  3M3U A;  4GN4 A;  5APE A;  3ODU A;  206L A;  4G9S A;  1C6B A;  1C6J A;  1L41 A;  4EPI A;  194L A;  3CT0 A;  3G3W A;  1SWZ A;  2D4K A;  3P64 A;  2B6Z A;  3AW7 A;  5KJ9 A;  4DKL A;  1DYD A;  3SB6 A;  5C6I A;  4DC4 A;  1L34 A;  4UWN A;  3F9L A;  3HDF A;  4KT3 A;  104L A;  2H9J A;  4GLV A;  207L A;  221L A;  1L52 A;  2QB0 B;  1LYE A;  4YXC A;  1DYG A;  2RBN A;  1REX A;  5KXL A;  2OTZ X;  1EPY A;  4CFO A;  4NFV A;  5IHG A;  3BKH A;  1L18 A;  222L A;  4YXA C;  4IJ4 A;  2FYC A;  1P37 A;  4WM1 A;  7LYZ A;  1QTV A;  1P46 A;  1KNI A;  3DN0 A;  3WMK A;  4NGZ A;  1CKF A;  1ZYT A;  209L A;  3W6D A;  1LSB A;  1ZV5 L;  4LFP A;  1I20 A;  1IO5 A;  4YOP A;  120L A;  1T97 A;  3C7W A;  3NYA A;  1L40 A;  4XJF A;  1YRO A;  3A95 A;  5L9J A;  3W6A A;  1B5V A;  4NGI A;  2A7F A;  2BQK A;  1L30 A;  1IP5 A;  1L86 A;  1IWY A;  1L51 A;  1KW7 A;  1GBS A;  1JKA A;  111L A;  1L98 A;  1YQV Y;  1NDG C;  3FAD A;  4W55 A;  5KXW A;  149L A;  256L A;  160L A;  1HEO A;  1L76 A;  5T3F A;  4I0C A;  1L45 A;  2H5Z A;  4ET9 A;  4RW1 A;  1C6M A;  5B59 A;  4O34 A;  1O23 A;  5HQ1 A;  1LSC A;  1LSA A;  1BWJ A;  1WQM A;  1LMC A;  5KXP A;  4ETE A;  5ILC A;  2DQF C;  1WQQ A;  5I5Q A;  5LVK A;  3ATN A;  1CU5 A;  1IR7 A;  1C67 A;  4H9E A;  6LYZ A;  1L73 A;  2EKS C;  1QTZ A;  5I14 A;  3WPK A;  1L35 A;  3AB6 A;  5F14 A;  1OQM A;  3FI7 A;  5M1Y A;  4PPO A;  2ZYC A;  1I56 A;  109L A;  1L32 A;  5KXK A;  4XYY A;  3LYM A;  1IP4 A;  158L A;  1LZT A;  2HU3 A;  1L90 A;  1INU A;  4OWB A;  127L A;  165L A;  1L99 A;  4NHQ A;  186L A;  1P2L A;  5AMY A;  3WUM A;  2MEH A;  4OO9 A;  137L A;  5F9X A;  255L A;  1IX0 A;  1VED A;  1C6F A;  1L07 A;  1NDM C;  1L44 A;  156L A;  4RDS A;  1WTM A;  2D6B A;  1L61 A;  169L A;  1LSF A;  3CDR A;  2IHL A;  4GCC A;  1XEK A;  3RU5 A;  1RE2 A;  1PQO A;  2F4A A;  1P2C C;  1C62 A;  1L64 A;  1XEJ A;  1QTD A;  1GHL A;  2DQE Y;  1XGP C;  4AXT A;  147L A;  1HER A;  1L65 A;  1IWW A;  225L A;  1LZA A;  1GFE A;  1OUA A;  5ILF A;  1MEL L;  1GB8 A;  1GD6 A;  219L A;  1IC5 Y;  1P2R A;  3AZ4 A;  3AGI A;  2ZQ3 A;  1LJG A;  1D9W A;  4PRU A;  4TSB A;  1CV1 A;  4RLN A;  4PHI A;  3HWL A;  3RUN A;  4H8Z A;  1HMK A;  2Z18 A;  3C7Y A;  2ZIJ A;  4FDY A;  4LGK A;  4ARM B;  1GFU A;  3C80 A;  1MLC E;  162L A;  3SB9 A;  1LBU A;  1LHL A;  2RB0 X;  3FE0 A;  1Z55 A;  2RH1 A;  1L74 A;  2BQC A;  2W1Y A;  2XQO A;  1SLY A;  2B72 A;  1JWR A;  3DN1 A;  1CU0 A;  5DL9 A;  5HNL A;  2RB1 X;  3W6F A;  4Z3M A;  2BQJ A;  5LYM A;  243L A;  1GBY A;  1JTO L;  1L62 A;  1HEW A;  2B5Z A;  107L A;  3LYZ A;  4KPM A;  3WPL A;  1LPI A;  135L A;  1L39 A;  1XEI A;  2Z39 A;  1IY4 A;  4LYC A;  4WM5 A;  4GN3 A;  200L A;  4J1B A;  1HEN A;  4LPQ A;  1W6Z A;  1G0P A;  4BAP A;  3WU9 A;  4W57 A;  1CTW A;  3B0I A;  3QY4 A;  1UIG A;  4HJY A;  1G7I C;  4WM4 A;  4N9R A;  1IP1 A;  4FJR A;  2CWI A;  1LZC A;  1TDY A;  3HTD A;  5LVJ A;  3WH1 A;  1D6Q A;  4DDC A;  2HU1 A;  1DQJ C;  1LZD A;  2WKX A;  1ALC A;  3V2W A;  3TMX A;  1OUI A;  3ATO A;  4M6D A;  4YF2 A;  1D3M A;  192L A;  1LZY A;  1HML A;  4DJH A;  3WVY A;  2BLY A;  2RBS A;  1J1P Y;  1L03 A;  1GDW A;  4HPE A;  2YDG A;  1GF8 A;  4DQJ A;  1L02 A;  250L A;  4DT3 A;  3DN2 A;  2XJW A;  1QT6 A;  1SSY A;  1UCO A;  2ANV A;  1BWI A;  1L21 A;  4I7T A;  1BB5 A;  5KXO A;  1CJ6 A;  1IC7 Y;  1G06 A;  3EO5 A;  1G7M C;  151L A;  2BH7 A;  3LZT A;  1JQU A;  1OVK A;  2F4G A;  3HTG A;  1HSW A;  2G4Q A;  2HEC A;  1QSB A;  6LZM A;  4XN6 A;  4C3W A;  2BQA A;  1YKZ X;  2A7D A;  1LMA A;  1OUF A;  1G0G A;  1LYG A;  3T6U A;  2G4N A;  1GFK A;  182L A;  4H8Y A;  1C6D A;  138L A;  1T8F A;  4C5F A;  1IOS A;  1UA6 Y;  5C6L A;  1C66 A;  1AKI A;  3G3A B;  2HUK A;  234L A;  1L28 A;  2O7A A;  1IEE A;  1FLU A;  229L A;  1LHI A;  4S0W A;  4DQ5 A;  1LZR A;  1L27 A;  4GRV A;  3D2Y A;  1AZF A;  1G7L C;  2YSS C;  4M4O A;  2RAY X;  2N5Z A;  4LDE A;  4WLY A;  1VFB C;  1LYS A;  5KXM A;  1UIC A;  1LZ5 A;  253L A;  1WTN A;  4DYG A;  1DZB X;  2O79 A;  4DD9 A;  5HNC A;  3A91 A;  4TTD A;  1JEF A;  1QT8 A;  2Z38 A;  1NQI A;  2FBB A;  1GBW A;  3W6B A;  4LYT A;  5LYZ A;  5FHW A;  257L A;  1P6Y A;  2B6Y A;  2LHM A;  1UUZ C;  167L A;  3P68 A;  2ZNW Y;  1B7P A;  217L A;  3K3T A;  190L A;  261L A;  1TBY A;  4J7V A;  1QQY A;  1YIL A;  1L72 A;  1C68 A;  4ARM A;  1JJ1 A;  1CV0 A;  1L66 A;  3GUI A;  240L A;  3QNG A;  4W52 A;  212L A;  230L A;  2LYZ A;  1CVK A;  1DYC A;  1DYA A;  1OUH A;  1IOC A;  1UC0 A;  1YIK A;  3EXD A;  4B4J A;  2B70 A;  4DDB A;  1GF3 A;  1QUD A;  2HUM A;  1L95 A;  1L88 A;  1F6S A;  3P4Z A;  4YEM A;  2B74 A;  183L A;  3LYO A;  155L A;  1QT5 A;  4XJI A;  4I7P A;  3WVX A;  3L64 A;  1GPQ C;  1W08 A;  123L A;  1QDR A;  1GF7 A;  216L A;  1IP2 A;  188L A;  5KKJ A;  2HTX A;  1L79 A;  2LZT A;  1L77 A;  4NGV A;  4WL7 A;  1L36 A;  5LA8 A;  1L71 A;  1LJ4 A;  3SP3 A;  185L A;  3D3D A;  4R6C A;  1QUO A;  4I7R A;  4KL7 A;  1LI3 A;  1QTE A;  195L A;  1T8A A;  4LT2 A;  5FDJ A;  2Z12 A;  2YBM A;  4QEQ A;  1OUB A;  2OE9 X;  2BQG A;  1OUG A;  1EQ4 A;  1L08 A;  1L10 A;  3SBA A;  3DN8 A;  1N4F A;  4N1E I;  4N8Z A;  1D6P A;  4WM2 A;  227L A;  4H9I A;  1HF4 A;  3RZE A;  5APC A;  3W6E A;  2B75 A;  1CKG A;  3A93 A;  1CU6 A;  4LDL A;  181L A;  1C6P A;  2Z37 A;  249L A;  1CV4 A;  130L A;  3C8S A;  1RFP A;  1WVU A;  161L A;  1L80 A;  1B7N A;  1L06 A;  3W3E A;  2YVB A;  4ETC A;  3TMU A;  1IOQ A;  1KXW A;  1YL0 X;  5LAF A;  3WW5 A;  1HFX A;  1LJF A;  3HH3 A;  3MGW A;  2DQI Y;  4PJ2 C;  5IDD A;  4W54 A;  4WMG A;  3CSZ A;  1C69 A;  3UON A;  1BB7 A;  1XGT C;  5C6J A;  4WL6 A;  4HPI A;  5LXW A;  5KXN A;  154L A;  1CKH A;  4N0J A;  4GCF A;  3QAK A;  1FLQ A;  4XJH A;  1G0K A;  2Y8P A;  5KXX A;  1L23 A;  1L04 A;  5DLA A;  3AW6 A;  3P65 A;  3HU8 A;  1HNL A;  170L A;  2IGC A;  5F9U A;  144L A;  1QT3 A;  1GB2 A;  1G0M A;  4W58 A;  4EKR A;  3A8Z A;  5I54 A;  5KKI A;  3GUN A;  2OU8 A;  1LJJ A;  3B72 A;  4PJZ A;  4II8 A;  4I7K A;  4N1C C;  1JJ0 A;  1LJ3 A;  2Z19 A;  2HUB A;  4J1A A;  2RBO A;  189L A;  1P64 A;  4I7L A;  1C45 A;  1GB3 A;  2RAZ X;  4I7J A;  7LZM A;  2MEC A;  3L2X A;  112L A;  4H93 A;  4B4E A;  1ZVH L;  3N9E A;  1LJN A;  3GUM A;  1AM7 A;  1XFP L;  232L A;  1LZE A;  3IWR A;  1F0W A;  1DKK A;  1LYY A;  3AZ7 A;  1SWY A;  4LFX A;  1LSZ A;  5JEN B;  3ZVQ B;  3TXD A;  5D5C A;  134L A;  5LA5 A;  4NY5 A;  4RLM A;  1VDT A;  1KXX A;  4LT0 A;  4NWE A;  3BKV A;  4H9C A;  1GFH A;  1JTT L;  3WYH A;  1PZY A;  196L A;  5J7C A;  4U3X B;  1CU3 A;  220L A;  4GN5 C;  2I26 L;  2HEE A;  3A96 A;  2HEF A;  3A6B Y;  4NGY A;  3WU7 A;  2B6W A;  4DD3 A;  4YEO A;  1D0K A;  2RSC A;  4ML7 A;  214L A;  3DKE X;  5D5F A;  3WUL A;  4OWH A;  3AZ5 A;  1D2W A;  4G4H A;  1L55 A;  171L A;  3HTB A;  1REY A;  3C83 A;  197L A;  2XBS A;  1PS5 A;  4NHI A;  1L69 A;  3SN6 R;  1L70 A;  1V7T A;  1IWV A;  1WQN A;  1C10 A;  1JIY A;  4KXI A;  4G54 A;  1EL1 A;  178L A;  5APF A;  4EPF A;  152L A;  1LTM A;  2BQF A;  254L A;  2EIZ C;  198L A;  3TXG A;  2H9K A;  1TAY A;  5FEL A;  3SB5 A;  4EJ4 A;  4YEN A;  1CJ8 A;  1L38 A;  2BQL A;  143L A;  3A3R X;  4Z46 A;  1B7R A;  3EBA B;  3WXU A;  2ZIK A;  2LYO A;  5I53 A;  1WQR A;  1YKX X;  3T36 A;  1L63 A;  3HFM Y;  260L A;  4HTN A;  4EXM A;  1CV6 A;  1L24 A;  2X0A A;  2XBR A;  126L A;  4GCB A;  2F47 A;  1D2Y A;  122L A;  4J0L A;  1LHK A;  4N5R A;  5E9R A;  1BB6 A;  3NY9 A;  1IR8 A;  1GBX A;  1FKV A;  2YBJ A;  3HDE A;  259L A;  2CJL A;  1L97 A;  3LHM A;  1LSY A;  1GWD A;  1P3N A;  1T8G A;  2BQB A;  1QSW A;  2BQI A;  184L A;  1JSF A;  3D9A C;  4ARQ A;  1D0M A;  1LGU A;  4H91 A;  3A92 A;  1L85 A;  1LW9 A;  2OEA X;  1XGU C;  1IWZ A;  1BB4 A;  4WLD A;  4CHX A;  1L59 A;  2ZNX Y;  3N9C A;  4LZM A;  1LGW A;  1LZ8 A;  1C43 A;  1L68 A;  2ZQ4 A;  4ZFP A;  4LT3 A;  1WQP A;  5L3I A;  2BAA A;  1JHL A;  252L A;  1CJ7 A;  1NBY C;  1K28 A;  4GCD A;  1EQ5 A;  1P7S A;  159L A;  1L11 A;  2DBT A;  1LMT A;  3CSQ A;  1VDP A;  2BQM A;  4G4B A;  1C6L A;  1G7H C;  3CDT A;  1OV5 A;  4B49 A;  2MEG A;  1TCY A;  163L A;  1GAZ A;  1DYE A;  1QDT A;  2AUB A;  4NWH A;  1JKB A;  1GXX A;  1LZN A;  1GB5 A;  2LC9 A;  3W6C A;  3HT6 A;  2I25 L;  4EKP A;  4BAD A;  4PGJ B;  1LOZ A;  4PK0 A;  1BVK C;  5K7O A;  1HHL A;  3AZ6 A;  3CDV A;  1B5U A;  1L31 A;  4H9A A;  1L87 A;  1C08 C;  2HED A;  1CUP A;  1JKD A;  1JJ3 A;  1FN5 A;  213L A;  1HC0 A;  115L A;  2BLX A;  4G4C A;  3CDO A;  1IR9 A;  1XSF A;  2B6T A;  4IAP A;  3J6K A;  2FYD A;  4HV1 A;  1L25 A;  3DMZ A;  2DKV A;  3AJN A;  1IOT A;  1GFG A;  4LYO A;  4DD2 A;  3CQL A;  3RT5 X;  1L0K A;  1YAP A;  3HU9 A;  1EAK A;  1VDQ A;  3CT5 A;  1L33 A;  1UIE A;  2YBL A;  1SX7 A;  4XJG A;  3HUQ A;  1IC4 Y;  1C6C A;  1JKC A;  5B07 A;  1A4V A;  1IP6 A;  4AGA A;  4ARJ A;  4GLA A;  1A2Y C;  1UIB A;  3SB8 A;  4BXJ A;  233L A;  228L A;  5LVI A;  3QE8 A;  3D4S A;  1NWG A;  2YBN A;  3FI5 A;  1FDL Y;  3G3V A;  4Z41 A;  3KAM A;  4XAD A;  1E8L A;  4H9H A;  1PQM A;  153L A;  1QSA A;  3C8R A;  3DMX A;  3NY8 A;  4NG8 A;  1EQE A;  1LJE A;  1LHH A;  2B73 A;  3GUL A;  2BQO A;  4W51 A;  1OUC A;  3V2Y A;  4BXD A;  3HT8 A;  4DQ7 A;  3RZ4 A;  4I7Q A;  5A3E A;  1L75 A;  1BB3 A;  4D9Z A;  1B7M A;  172L A;  1L53 A;  244L A;  4WLT A;  5LZM A;  1LYZ A;  1AT5 A;  1V7S A;  1OVH A;  4XJB A;  1LCN A;  1L96 A;  139L A;  4DD7 A;  3GXR A;  4H1P A;  1GB6 A;  4W53 A;  5B1G A;  1T6V L;  1DI4 A;  3WW6 A;  2LYM A;  1NMM A;  3G3B B;  4BXE A;  2F2Q A;  4EMN A;  5KY1 A;  1NHE A;  3AGH A;  4I7S A;  1LYI A;  1OV7 A;  1LSP A;  4NGK A;  1LI2 A;  1GFT A;  1YAM A;  2LCB A;  2CUU A;  3A67 Y;  1RJC B;  1ZVY B;  1AT6 A;  1LSE A;  1B9O A;  2MEB A;  3LZ2 A;  1JTN A;  1C6K A;  1QTK A;  1P36 A;  4X3B A;  1BHZ A;  1JTP L;  1QT4 A;  2YBI A;  1F10 A;  1L20 A;  1GE1 A;  4B4I A;  1LYJ A;  4OOO A;  4WM3 A;  1L50 A;  1GE2 A;  1L94 A;  224L A;  1DXJ A;  1GF0 A;  1PQJ A;  4BJ4 A;  5B05 A;  146L A;  3HH5 A;  1ZWN A;  3AYQ A;  2MEF A;  5FEK A;  1LZ4 A;  2DQG Y;  3TXE A;  1IWX A;  1DPW A;  5KXY A;  1GF9 A;  4LYB A;  199L A;  3IJV A;  3FA0 A;  3PBL A;  5LYT A;  5LVH A;  1LKR A;  1ZUR A;  3EMS A;  1IOR A;  1SX2 A;  1CKD A;  2VB1 A;  1IVM A;  3K2R A;  108L A;  4H94 A;  1CNS A;  3F8V A;  1YAN A;  1J1O Y;  1C65 A;  2D4J A;  3E3D A;  1GDX A;  1L29 A;  2W1M A;  201L A;  1JIS A;  4OOT A;  4TUN A;  4BOL A;  4DD0 A;  3RW8 A;  164L A;  4DAJ A;  3CSR A;  1LZG A;  1L16 A;  1OYU A;  4WM6 A;  4XJD A;  4LDO A;  3ULR A;  1H6M A;  2MEI A;  1QS9 A;  1I1Z A;  2W1L A;  1H87 A;  1C6I A;  1OUE A;  1C6T A;  4W94 A;  2Q0M X;  2Z2F A;  2YBH A;  1I6S A;  1LMP A;  2BPU A;  1REZ A;  2F30 A;  3HUK A;  1L92 A;  102L A;  3TXJ A;  1GB0 A;  4Z98 A;  4HTK A;  5LAG A;  1HFZ A;  1UBZ A;  1B7O A;  1QUG A;  2C8P A;  2PC2 A;  1G0Q A;  1FLW A;  3B6L A;  140L A;  1DI5 A;  4NGL A;  1CJ9 A;  3LZM A;  187L A;  2Q9D A;  1QUS A;  1LWG A;  2L78 A;  1L09 A;  4R0F A;  4E3U A;  4B1A A;  1L22 A;  114L A;  1G7J C;  1OP9 B;  3SBB C;  1C64 A;  1L89 A;  1JPO A;  2HEA A;  4QY9 A;  4CJ2 A;  145L A;  1C46 A;  211L A;  3OK0 A;  2ZYP A;  1LMN A;  5KXS A;  2OE4 X;  3OE0 A;  4TSC A;  3B0K A;  4WG1 A;  3SB7 A;  1B5Y A;  1G0L A;  4MCK A;  5LIN A;  5HMJ A;  168L A;  1GXV 2;  1WTH A;  2LZ2 A;  2GV0 A;  9LYZ A;  1OWY A;  1L93 A;  1PQD A;  1DKJ A;  1BQL Y;  4UWV A;  3VW7 A;  1GF5 A;  1FKQ A;  1ZMY L;  4ZIX A;  4NSH A;  4AQN A;  4NSJ A;  5FST A;  1QTC A;  174L A;  4A7D A;  1OVJ A;  3HBE X;  4H90 A;  4I7N A;  166L A;  1P5C A;  3LYT A;  1L58 A;  4H92 A;  3M18 B;  1RI8 B;  5LVG A;  5DN5 A;  118L A;  1WVV A;  1QUT A;  208L A;  4ET8 A;  5II3 A;  133L A;  4HSF A;  1L83 A;  4NEB A;  2D4I A;  193L A;  1YAO A;  4L41 A;  1L37 A;  5F81 A;  4UWU A;  2FBD A;  2B6X A;  1LJH A;  4TX7 A;  1L17 A;  3VWO A;  1C6H A;  1B5Z A;  3DNA A;  1QTH A;  1GB7 A;  1CUQ A;  251L A;  1KY1 A;  2OU0 X;  1HFY A;  4HTQ A;  157L A;  1QSQ A;  246L A;  5FCP A;  218L A;  131L A;  215L A;  4GCE A;  1UIF A;  1L56 A;  2MEE A;  1HSX A;  1L84 A;  2F32 A;  1L91 A;  2NTG A;  2LZM A;  1B5X A;  1IP7 A;  1L0J A;  3WUA A;  4DWX A;  4G49 A;  2Z2E A;  3AGG G;  1UID A;  1DI3 A;  4NGJ A;  239L A;  1TEW A;  1UIA A;  5HMV A;  2D91 A;  1L82 A;  4NGO A;  1L48 A;  1L57 A;  1LYF A;  1B7Q A;  248L A;  1NKH A;  4ETB A;  4MR1 A;  1HEQ A;  2MED A;  3GUO A;  1QUH A;  1KW5 A;  1C60 A;  3A90 A;  1B7L A;  2Q9E A;  4I7O A;  1L67 A;  2OU9 A;  2HEB A;  1LSD A;  2ZIL A;  1OUJ A;  1LZ6 A;  1D3N A;  4E97 A;  1GB9 A;  4ZEE A;  1IP3 A;  2EQL A;  5I4Y A;  3CT1 A;  1JUG A;  2CDS A;  3HH6 A;  4HJZ A;  1L54 A;  4WOA A;  4NG1 A;  1LAA A;  1FBI X;  1HEP A;  3C81 A;  1XJT A;  4CGE A;  3OE8 A;  1L12 A;  3HBH A;  4BS7 A;  4NSG A;  3WUN A;  4W96 A;  3GUK A;  1G1V A;  3C7Z A;  1LYO A;  1KIR C;  2ANX A;  5B06 A;  1JSE A;  4NGW A;  1B2K A;  1C6N A;  1JIT A;  262L A;  3CDQ A;  4YX7 C;  110L A;  4H9B A;  4NSI A;  1CU2 A;  3HH4 A;  3OJP A;  2RB2 X;  258L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...