3BKHA

Crystal structure of the bacteriophage phikz lytic transglycosylase, gp144
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
268
structure length
268
Chain Sequence
HHHHHGSIMKVLRKGDRGDEVCQLQTLLNLCGYDVGKPDGIFGNNTFNQVVKFQKDNCLDSDGIVGKNTWAELFSKYSPPIPYKTIPMPTANKSRAAATPVMNAVENATGVRSQLLLTFASIESAFDYEIKAKTSSATGWFQFLTGTWKTMIENYGMKYGVLTDPTGALRKDPRISALMGAELIKENMNILRPVLKREPTDTDLYLAHFFGPGAARRFLTTGQNELAATHFPKEAQANPSIFYNKDGSPKTIQEVYNLMDGKVAAHRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords lytic transglycosylase
publication title Structure of the bacteriophage phi KZ lytic transglycosylase gp144.
pubmed doi rcsb
source organism Pseudomonas phage phikz
molecule tags Hydrolase
total genus 77
structure length 268
sequence length 268
ec nomenclature
pdb deposition date 2007-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01464 SLT Transglycosylase SLT domain
A PF01471 PG_binding_1 Putative peptidoglycan binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.101.10 Mainly Alpha Orthogonal Bundle Muramoyl-pentapeptide Carboxypeptidase; domain 1 PGBD-like superfamily/PGBD 3bkhA01
1.10.530.10 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 3bkhA02
1LMAA 1LJEA 4LYTA 4UWUA 3WW6A 1REXA 1B2KA 1GBWA 5I4XA 1LZTA 1JKBA 1ZVHL 3AZ5A 4DD2A 4H9EA 2YDGA 1JSEA 1WQQA 1YAPA 3QE8A 4G4BA 1HMKA 4YEMA 1IOSA 1BQLY 1LZYA 3W6CA 1LMNA 4FDYA 3D3DA 1FLYA 1GFUA 1YL0X 3M3UA 5KXSA 2H9KA 1GBYA 2CDSA 1IP3A 3ATNA 1IP7A 3LYMA 1GXXA 4HJVA 1H87A 1TBYA 1OQMA 1CKHA 1LJFA 3BKHA 4OOTA 4OW1A 1RFPA 2CGIA 4KXIA 4N1CC 1LZDA 1B9OA 1D0LA 5LVGA 1QTEA 1LZ6A 1VDPA 4M6DA 4DC4A 2D4KA 1LYYA 3HBEX 2FBDA 1VDTA 4J1BA 1NQIA 1OUIA 1LSMA 3P66A 4HPEA 3A3QA 1GFVA 153LA 4ZFPA 3FE0A 1UICA 1CNSA 1XGRC 4B0DA 3MGWA 4LGKA 1LSCA 1FKQA 2ZNXY 3D9AC 1VFBC 1DI5A 3B72A 3EXDA 4DD7A 4MSTA 4LYCA 1KIRC 3HBHA 2ZILA 2W1YA 3LZTA 4EMNA 1LZEA 4XJGA 1IP5A 4YOPA 4IATA 2A7DA 1LZGA 3AW6A 3GXRA 5LVJA 1GB6A 2PC2A 3AJNA 3WU8A 1JJ0A 1D6QA 4ET9A 5ILFA 1B7QA 3AZ7A 3P64A 4PPOA 1IR7A 1T3PA 4II8A 4XADA 1DI4A 1IP6A 1HSWA 1ZV5L 1GFAA 2Z37A 3J4GA 4KT3A 1YKXX 3HFMY 4B49A 2BQHA 2LYZA 2XBRA 1YL1X 2BQJA 4NHSA 4WO6A 1LSYA 2W1LA 3W6BA 2YBIA 1UIEA 1C08C 1FDLY 1JKAA 5APDA 4DD3A 3KAMA 1JTPL 4NSGA 4N1EI 3A6CY 1B5VA 4HTKA 1ZVYB 4LYOA 4H90A 1NDMC 1JHLA 1NBZC 2GV0A 2BQMA 2HEAA 4XJHA 3TXKA 4ANRA 3A6BY 1LZ1A 1OUGA 1E8LA 3CSZA 1GFKA 4IASA 4FJRA 3AZ6A 1IORA 3QNGA 4PHIA 135LA 4BAFA 1OUEA 2FYCA 5B05A 5I4YA 5LYTA 1LMCA 1BGIA 1OUAA 4BPAA 4OWBA 5K7OA 1GE2A 1KXWA 1D9UA 1GBSA 4WLXA 4AXTA 4J1AA 1OUHA 4EOFA 1LZCA 1NDGC 3B0IA 4TX7A 1A2YC 4H8XA 4ETDA 1AT5A 4H9HA 1LJ4A 1QIOA 1KXYA 1W6ZA 4C3WA 1QQYA 5IELA 3RZ4A 4HPIA 4QEQA 5KXZA 2BQOA 5APFA 4WM1A 1TDYA 1GWDA 1G7MC 1LZ4A 2I26L 1LHJA 1I56A 3E3DA 3N9AA 5F14A 1UUZC 1NBYC 1MELL 3CT0A 5A3EA 3CQLA 5I4WA 4NG1A 2G4QA 2D6BA 4OWAA 1REZA 4H9BA 4YM8A 3TMXA 4NHPA 1GEVA 5LIOA 3FI7A 1F10A 3QY4A 2CJLA 5KXOA 1WTMA 1IOTA 1XSFA 1YANA 1D0MA 1L6JA 4WG1A 4LT0A 4NSJA 2BH7A 1LHLA 4YENA 5M1YA 1B5YA 3WW5A 1GBZA 4GN4A 1GFGA 1GHLA 1GF8A 1UIGA 1INUA 1DQJC 154LA 2FBBA 7LYZA 4GLAA 5B07A 3WULA 5JENB 4TTDA 4M4OA 3B6LA 4GCBA 2G4NA 1GE1A 133LA 2HU3A 4PRQA 4H93A 4GLVA 5KXRA 4NGVA 5E4PA 1KXXA 5F16A 3A91A 5LINA 4RLMA 4GN3A 2XTHA 1GDWA 1YIKA 1LHMA 3CSQA 4N0JA 2HEBA 2Q0MX 3ZVQA 5FCPA 4WM4A 3W3EA 4G9SA 1EQEA 1GFEA 4WM3A 4DWXA 6LYZA 5IHGA 5KXXA 1GE0A 1BVKC 1UBZA 9LYZA 1LYOA 4TSBA 1FKVA 4RLNA 2BQCA 1FLWA 1LZ8A 5APEA 1BB3A 5B1GA 1OUFA 2LZTA 1B7SA 1LHIA 1FLUA 4H8ZA 2F4AA 2BQKA 1DPWA 1F0WA 2BQGA 4HP0A 3D2YA 2MEAA 2F4GA 3IJUA 3VWOA 1OUBA 1CJ8A 4IJ4A 4NGWA 1GFHA 3ULRA 4H9CA 1IP4A 4BADA 5L3IA 1LYZA 3A90A 1BB7A 4GCCA 2YVBA 5HMVA 4LYMA 4H1PA 1LSFA 1LMPA 5D5CA 3ZEKA 1H6MA 4GCDA 4H9FA 2BQFA 4ML7A 1UC0A 4LYBA 3RU5A 1RE2A 1GFRA 5F9XA 5FDJA 3RW8A 4W96A 1JIYA 1IWYA 1GBOA 1LSZA 5FELA 2D91A 1IOQA 4DYGA 4Z41A 1BWIA 1LKRA 1CJ7A 3LYTA 2YBNA 4QDNA 2EQLA 1YAQA 1RCMA 1GF3A 4GCFA 1G7IC 4N9RA 2EKSC 2MECA 1LZSA 5AMYA 4G49A 5DN5A 4XYYA 1J1XY 2Z19A 1GB9A 4NGZA 1GAZA 4G54A 4OWCA 5APCA 1IIZA 2N5ZA 1GF9A 1JPOA 4BS7A 1TEWA 4NEBA 3A94A 3W6AA 4LPQA 2WKXA 2F2NA 5KJ9A 1OUJA 4NHIA 5LAGA 2G4PA 4WOAA 2EPEA 1REMA 4J0LA 3AGHA 2B5ZA 4Z46A 1V7TA 4WMGA 4P2EA 5I53A 5HLLA 1G7LC 1A4VA 1LMOA 1OP9B 4DDAA 1JWRA 4LYZA 3TMUA 1IWXA 1YROA 3G3AB 1YILA 3LHMA 3T36A 3ATOA 4HTNA 1GF7A 1AT6A 3CB7A 3A96A 1UA6Y 1C45A 5HMJA 4BAPA 1B5XA 1EAKA 1PZYA 1B7MA 1LCNA 2HUBA 1LMTA 4OWEA 3K3TA 4XENA 4WG7A 1FLQA 1UIFA 1PS5A 2ZQ4A 4NHTA 2X0AA 1CKFA 2BQIA 1NHEA 1OUDA 4B1AA 2MEBA 4NSIA 2BQDA 3IJVA 5L9JA 1IWZA 3WL2A 4NY5A 3TXHA 2LZ2A 4PJ2C 4HV1A 1KIQC 1GD6A 1XGQC 2VB1A 1IY3A 3OK0A 4B4JA 1XEKA 1N4FA 2HEEA 4DD1A 3WVYA 5FEKA 1IOCA 1AM7A 4X3BA 1WQPA 1QDRA 1VDSA 2HEDA 1BB5A 5F9UA 194LA 2Z18A 6LYTA 1LJNA 5II3A 1ALCA 5B06A 1IWTA 1IP2A 2BQLA 1GXV2 1NMMA 1QUSA 2BQEA 1WQRA 4OWHA 3T6UA 2CWIA 3W6FA 1JJ1A 1GB2A 3F6ZA 4BXJA 3WVXA 1EQ4A 4Z98A 5FHWA 3WXUA 4E3UA 4YF2A 3AW7A 207LA 1IO5A 2IFFY 1WQMA 1GB5A 1XEJA 2WARA 3AGIA 2MEGA 2ZYCA 4R0FA 3SP3A 3W6EA 1LSGA 1LYSA 5KKIA 1DI3A 2HTXA 1UACY 1GFJA 2ZIJA 2MEDA 4DDCA 5IDDA 3EBAB 3LYOA 4BJ4A 1IC7Y 3GXKA 4NGJA 1BWHA 4KL7A 3WUMA 1B5UA 1SQ2L 4TSCA 3TMWA 1LSAA 1V7SA 3TXBA 4DDBA 1HERA 2XJWA 4BOLA 2YSSC 5B59A 2BLXA 1UIBA 3M18B 1RI8B 1G7HC 3WUAA 4R6CA 1LBUA 1NWGA 4NGOA 5I54A 4WM2A 4CGEA 1B5ZA 5DLAA 3A3RX 5HQ1A 1J1PY 1FBIX 4H94A 4CFPA 5LAFA 3WPLA 5J7CA 5C6JA 5LA5A 1BB4A 2YBHA 2DQDY 3HBDA 1GEZA 4HTQA 1IC4Y 1LJIA 1LZ5A 8LYZA 1YAMA 3RT5X 3B0KA 1JSFA 4U3XB 2DQIY 1DXJA 1YAOA 4WLYA 4UWNA 4GN5C 4BXEA 2HU1A 4H8YA 2YBMA 5L3HA 5D5FA 1HENA 4RDSA 3WU9A 5KKJA 1SLYA 1GDXA 1GPQC 4YEOA 3CT1A 1AKIA 4HJYA 1TAYA 4LFPA 1LKSA 1LZ9A 1GB3A 2Z2EA 3TXGA 4WM6A 3TMVA 2C8OA 1B5WA 3W6DA 4TUNA 1LSEA 5LVIA 3P4ZA 5A3ZA 1HMLA 5HNLA 1VAUA 2W1MA 4NHQA 2YBLA 4WO9A 4I0CA 1QDTA 3G3BB 1CJ9A 1JITA 1EL1A 1ZMYL 3A93A 1P2CC 3OJPA 1GF4A 4QY9A 5KXMA 1BB6A 4I8SA 4LT2A 4MCKA 4N8ZA 3A95A 5HNCA 1F6SA 1LMQA 3P65A 1CKDA 3TXFA 1B7PA 1C46A 4MR1A 4N5RA 1BVXA 1C10A 193LA 1IEEA 1LZAA 4O34A 4ZIXA 5KXKA 5I5QA 2AUBA 1LOZA 1WTNA 4QGZA 3AB6A 2BLYA 2DQGY 4ETEA 2IHLA 2A7FA 2FYDA 4NFVA 5LVKA 4UWVA 1IX0A 1LHHA 1WQOA 1CKCA 1BWJA 2YBJA 4WL7A 4B4EA 1B7RA 4ETBA 4WM5A 5ILCA 5F81A 4HSFA 1LJKA 2BQBA 1B7NA 1LSBA 1XGUC 2BAAA 1IY4A 4NIJA 4H9IA 4NWEA 2H5ZA 4J7VA 3LYZA 1B7LA 4LFXA 1EQ5A 5KXNA 3WUNA 3EMSA 4XJFA 1G7JC 1GB8A 3AGGG 2MEHA 3CT5A 4LZTA 5DL9A 3WPKA 4ET8A 3N9CA 1LZNA 1LAAA 5B1FA 4NGYA 4GCEA 3AYQA 1T6VL 4HJZA 2BQAA 4LT3A 5LA8A 4CFOA 4WLDA 1YKYX 2D4IA 1XFPL 1QSAA 4NG8A 1IWUA 1HNLA 4B4IA 2Z38A 5KXWA 1D0KA 5KXTA 1HC0A 1GE3A 2DBTA 4WL6A 1JJ3A 3B0OA 4L41A 4LT1A 1VDQA 1UIDA 1W08A 4DT3A 4BXDA 1JISA 1HHLA 5KXPA 3WXTA 2RSCA 2LYMA 4ETAA 1DKKA 2ZWBA 4RW1A 1IWVA 5EBHA 1LSDA 1LJ3A 2H9JA 1HEPA 3WYHA 208LA 2DQFC 1LJHA 2Z39A 1LZBA 1F6RA 2DQCY 3A92A 1YQVY 4KPMA 4NGKA 2F30A 1UIHA 4NSHA 1JUGA 1LZRA 1HFYA 3A8ZA 1QTKA 4OOOA 3RNXA 2HECA 4ZEEA 2I6ZA 4ETCA 2DKVA 4HV2A 1FN5A 2NWDX 1JEFA 2D4JA 4XJDA 1B7OA 1WVVA 1IVMA 1TCYA 1CKGA 1KIPC 1UCOA 1IR9A 1WQNA 1GF0A 2W1XA 2LYOA 1C7PA 4RW2A 4XJIA 4PRUA 4TWSA 1C43A 4XJBA 1IR8A 2DQHY 4CHXA 1QUTA 2XBSA 1GB0A 1J1OY 2DQJY 2C8PA 4D9ZA 1LPIA 1LTMA 3WPJA 1NF5A 1HEOA 4C5FA 1RJCB 2DQAA 1REYA 3D2ZA 5FSTA 4G4CA 1HEWA 3N9EA 2LHMA 1IC5Y 1Z55A 1XEIA 1JKDA 1GE4A 5E9RA 5KXYA 1LHKA 5LYZA 2ZQ3A 1LSNA 1JKCA 3WH1A 2EIZC 1GBXA 1IWWA 2HEFA 5KY1A 4XN6A 5DM9A 4PGJB 1LJJA 4NGIA 1B0DA 1DKJA 3WU7A 1GB7A 1VATA 3P68A 1XGTC 2ZYPA 4H92A 2DQEY 3A67Y 3BKVA 5T3FA 3ZVQB 5KXLA 1XGPC 1MLCE 1HFXA 2ZIKA 4NGLA 4A7DA 1DPXA 5LVHA 5LXWA 1I1ZA 1LSPA 3IWRA 3A34A 3AZ4A 3TXIA 4W94A 4H91A 4AGAA 1BHZA 2Y8PA 3TXJA 2Z2FA 2MEFA 3WMKA 2MEEA 4G4HA 4H9AA 4NWHA 3TXDA 1LJGA 1VEDA 1AZFA 1JTTL 5DN4A 3TXEA 4Z3MA 1IP1A 2BQNA 1GF6A 1HF4A 1HSXA 2Z12A 1I20A 4DD9A 1HEQA 1NKHA 5C6LA 132LA 1WVUA 1JTOL 3LN2A 1D6PA 5C6IA 1UIAA 1CJ6A 4WLTA 1O23A 1HFZA 2MEIA 1DZBX 2ZNWY 4DD0A 2BPUA 3EO5A 2I25L 3LZ2A 1HEMA 1QSWA 1YKZX 4CJ2A 1GFTA 3CSRA 1HELA 1GF5A 1GAYA 134LA 3J6KA 5LYMA 1OUCA
chains in the Genus database with same CATH superfamily
5I4XA 212LA 4DD2A 1JTMA 1JSEA 1WQQA 4YEMA 1BQLY 1LMNA 1FLYA 1L83A 3M3UA 2H9KA 2CDSA 1IP3A 1GXXA 4HJVA 3HTDA 1OQMA 258LA 4KXIA 4N1CC 1LZDA 1D3MA 5LVGA 2D4KA 4J1BA 3EMLA 1UICA 1L01A 1FKQA 2ZNXY 1VFBC 3B72A 3EXDA 4LDLA 2ZILA 2W1YA 1LZEA 4XJGA 1IP5A 4IATA 5LVJA 3AW6A 2PC2A 3F9LA 3WU8A 3SB7A 163LA 5ILFA 3AZ7A 3P64A 4PPOA 1IP6A 3J4GA 2LYZA 2XBRA 4NHSA 1LW9A 1C08C 1JTPL 4NSGA 4H90A 2HEAA 2GV0A 2BQMA 4I7TA 140LA 1LZ1A 4IASA 1L10A 4FJRA 5B05A 5LYTA 114LA 2F47A 4OWBA 1GE2A 4AXTA 1L97A 4J1AA 1OUHA 150LA 1SSWA 1LZCA 4H8XA 1W6ZA 1KXYA 1QQYA 3SBBC 4HPIA 1TDYA 218LA 3C7ZA 3E3DA 3N9AA 1UUZC 5A3EA 3CT0A 3CQLA 4NG1A 4I7KA 2G4QA 2D6BA 4OWAA 4H9BA 3HUKA 3TMXA 1LYIA 5KXOA 1L71A 1D0MA 1CX7A 1G0QA 5M1YA 1P2RA 1GFGA 1GF8A 1INUA 1DQJC 4EKSA 3WULA 5B07A 115LA 4TTDA 3B6LA 1LPYA 1KXXA 4GN3A 1YIKA 4N0JA 177LA 2QB0B 4DWXA 4G9SA 1GE0A 1L45A 1LYOA 5APEA 1OUFA 1B7SA 1LHIA 145LA 1DPWA 2MEAA 3IJUA 3VWOA 3HDFA 4NGWA 4H9CA 1IP4A 4GCCA 3QAKA 5HMVA 1LSFA 4GCDA 4ML7A 5FDJA 5FELA 4DYGA 1BWIA 3GUPA 3LYTA 2YBNA 2EQLA 1RCMA 1LLHA 143LA 4N9RA 4G49A 5DN5A 4XYYA 1J1XY 4NGZA 4OWCA 1IIZA 3HT6A 4BS7A 174LA 3L2XA 4WOAA 176LA 1G7LC 1A4VA 230LA 4W58A 4LYZA 4EXMA 1L46A 2Q9EA 4W51A 1L11A 3ATOA 1GF7A 1B7MA 254LA 3OE8A 4WG7A 1FLQA 4B1AA 1L19A 2O7AA 4HV1A 1KIQC 1XGQC 2VB1A 1IY3A 1L66A 3OK0A 1XEKA 1N4FA 3HTFA 1VDSA 2HEDA 1LGXA 122LA 5II3A 2BQLA 149LA 1NMMA 2BQEA 4OWHA 3T6UA 4BXJA 1EQ4A 4Z98A 1WQMA 2HTXA 5IDDA 3EBAB 3LYOA 4BJ4A 1C6KA 3WUMA 1B5UA 3TMWA 1LSAA 1LI6A 4DAJA 3WUAA 4NGOA 4WM2A 4CGEA 120LA 3A3RX 5DLAA 235LA 239LA 4EJ4A 3HBDA 2DQDY 1LJIA 104LA 3B0KA 3NYAA 1QSBA 1DXJA 231LA 4BXEA 5L3HA 2O4WA 4RDSA 3WU9A 1QS9A 4YEOA 1L02A 3TXGA 5A3ZA 186LA 1SWZA 255LA 3HTBA 2RB1X 4DKLA 1F6SA 1LMQA 3TXFA 1BVXA 193LA 1IEEA 1LZAA 3F8VA 1WTNA 3AB6A 2IHLA 3C8RA 4NFVA 4UWVA 109LA 1L47A 1NHBA 3EMSA 1GB8A 232LA 3JR6A 171LA 2O79A 2OU8A 4B4IA 182LA 5KXWA 1G0GA 1PQIA 4WL6A 4LT1A 1UIDA 1W08A 3HWLA 4E97A 1LYDA 1L35A 2H9JA 208LA 2DQFC 1L61A 1L12A 1YQVY 4KPMA 4NSHA 1JUGA 1OVJA 1WTHA 4OOOA 220LA 4HV2A 1QT6A 261LA 2B6WA 4XJDA 1WVVA 3C7YA 3C81A 1GF0A 2W1XA 144LA 4RW2A 4TWSA 1D9WA 1QTBA 4W54A 3GUIA 205LA 1CV1A 4I7RA 1QUTA 2XBSA 7LZMA 1J1OY 1LPIA 1NF5A 3N9EA 237LA 1C64A 1JKDA 1L22A 1LHKA 107LA 2EIZC 5KY1A 1DKJA 1C6DA 3BKVA 1QT3A 5KXLA 1XGPC 173LA 196LA 1MLCE 2B6ZA 2ZIKA 4A7DA 211LA 1LSPA 229LA 3A34A 4W94A 4H91A 4AGAA 2Y8PA 2Z2FA 2MEFA 3WMKA 2B6XA 2MEEA 4G4HA 1LJGA 4YXCA 3G3XA 1IP1A 2BQNA 4I7JA 2Z12A 1OYUA 1L54A 1WVUA 1JTOL 260LA 3CDVA 187LA 1HFZA 1DYCA 4DD0A 1I6SA 1L79A 3LZ2A 172LA 3G3VA 1L20A 2OTZX 134LA 4PK0A 161LA 1XGTC 1REXA 1ZVHL 3AZ5A 3QE8A 1L59A 4G4BA 1C61A 224LA 2RAYX 1IOSA 3W6CA 3D3DA 1GFUA 2CUUA 1YL0X 1H87A 1LJFA 4OW1A 1RFPA 1L06A 2RBOA 3C7WA 1D0LA 1L82A 1LZ6A 3HBEX 2FBDA 1OV7A 1D3FA 190LA 1QTVA 3P66A 4HPEA 1L42A 4ZFPA 195LA 1CNSA 4B0DA 2B7XA 3D9AC 1C62A 3LZTA 4YOPA 1L98A 1L48A 3AJNA 1JJ0A 1D6QA 4ET9A 3DN1A 4ARQB 1L64A 1T3PA 4XADA 1HSWA 1ZV5L 1GFAA 3GUKA 3HFMY 2BQHA 1YL1X 1L00A 228LA 2W1LA 3W6BA 2B70A 5APDA 4DD3A 4ARMA 1CU0A 3KAMA 4N1EI 1ZVYB 4LYOA 1JHLA 1NBZC 4ANRA 165LA 4EPIA 1GFKA 5I4YA 4PHIA 1OUEA 2FYCA 1LMCA 138LA 5K7OA 1L29A 198LA 233LA 1L50A 4TX7A 4H9HA 1KS3A 1QT5A 2BQOA 1QUDA 1GWDA 1LHJA 5F14A 1KY1A 1C6EA 1L80A 1GEVA 5LIOA 3QY4A 2CJLA 1CV0A 1IOTA 1YANA 1QT8A 1L6JA 4LT0A 2BH7A 1L96A 1L60A 2LCBA 2FBBA 7LYZA 256LA 3HU8A 4M4OA 4NGVA 5F16A 1L90A 1C6PA 2B73A 2XTHA 1LHMA 3CSQA 3ZVQA 2Q0MX 4WM4A 3W3EA 1EQEA 1GFEA 1OWYA 1UBZA 3HH4A 9LYZA 1OVHA 1FKVA 146LA 221LA 4RLNA 1L63A 4H8ZA 4LZMA 2BQGA 1F0WA 1OUBA 1CJ8A 1EPYA 1GFHA 1DYBA 3ULRA 1SX7A 2RBQA 4LYMA 5D5CA 253LA 2BQFA 3CDTA 223LA 5F9XA 3RW8A 4W96A 1JIYA 1IWYA 4Z41A 1IOQA 1T8FA 130LA 4GCFA 236LA 1LZSA 1PQKA 5AMYA 178LA 1GAZA 3W6AA 2WKXA 102LA 1DYFA 4J0LA 3AGHA 2B5ZA 1V7TA 201LA 4DDAA 1YROA 3LHMA 4HTNA 4BAPA 1B5XA 4ARPA 1LMTA 1T97A 3DMZA 155LA 2ZQ4A 2BQIA 1LGUA 1OUDA 2MEBA 5L9JA 2BQDA 3WL2A 2LZ2A 2HEEA 1L14A 3WVYA 5FEKA 1AM7A 194LA 2Z18A 6LYTA 1IP2A 1G07A 240LA 3F6ZA 1C69A 4E3UA 4YF2A 3AW7A 207LA 1IO5A 2IFFY 2WARA 4R0FA 1LSGA 1UACY 4I7PA 2MEDA 2RBNA 1QSQA 4KL7A 4GBRB 1SQ2L 3GUOA 1C6CA 244LA 4DDBA 1UIBA 3SB5A 1RI8B 216LA 1NWGA 1KNIA 1G1VA 1J1PY 1FBIX 5J7CA 1IC4Y 1LZ5A 8LYZA 1JSFA 1YAOA 3V2WA 1L89A 4UWNA 2HU1A 5D5FA 1HENA 1SLYA 1KW5A 1L27A 4LDEA 3P4ZA 5HNLA 2W1MA 2YBLA 1L40A 1JITA 1EL1A 3OJPA 1P2CC 5KXMA 2QARC 4MCKA 3A95A 1L33A 227LA 1ZURA 4O34A 5I5QA 4ZPUA 1L44A 2BLYA 2DQGY 4I7SA 1CKCA 1LYGA 2YBJA 1L72A 1CV4A 1C6TA 5ILCA 137LA 5F81A 1L81A 1C66A 1LSBA 2BAAA 1IY4A 1L67A 4NWEA 4J7VA 4LFXA 3WPKA 1L69A 5DL9A 4ET8A 1LAAA 2BQAA 4CFOA 2D4IA 3L64A 4NG8A 1IWUA 249LA 1HC0A 125LA 126LA 1GE3A 2DBTA 1JJ3A 4BXDA 1JISA 1HHLA 1OV5A 4ETAA 4RW1A 2ZWBA 5EBHA 3CDRA 1LJ3A 1CVKA 2NTGA 3A92A 3SN6R 1UIHA 1LZRA 1L55A 128LA 1KW7A 3DN3A 3RNXA 2HECA 2I6ZA 2DKVA 1FN5A 2NWDX 1JEFA 1TCYA 111LA 4XJIA 2DQHY 3V2YA 1GB0A 2DQJY 219LA 2C8PA 3WPJA 4C5FA 3D2ZA 162LA 1XEPA 1Z55A 5KXYA 1GE4A 1JTNA 2ZQ3A 1IWWA 1VATA 170LA 2ZYPA 3A67Y 169LA 1HFXA 4W52A 1QS5A 1I1ZA 3TXIA 1BHZA 3TXJA 3TXDA 3G3WA 234LA 3TXEA 215LA 4EKPA 1L76A 1HSXA 238LA 1HEQA 2OE9X 1L85A 3LN2A 1L18A 1UIAA 242LA 2MEIA 1DZBX 2ZNWY 2I25L 1QSWA 4CJ2A 1GFTA 1GF5A 1GAYA 1L21A 248LA 3FADA 1L51A 1OUCA 1LMAA 1LJEA 1GBWA 250LA 1LZTA 1JKBA 1G1WA 2YDGA 1QTZA 160LA 1G0MA 1L56A 3SB9A 5KXSA 1GBYA 4W57A 3ATNA 1IP7A 2HUKA 159LA 214LA 1TBYA 1L04A 1XJTA 1B9OA 1VDPA 4DC4A 1LYYA 1OUIA 103LA 3A3QA 3MGWA 3GUNA 4DD7A 4LYCA 3HBHA 2A7DA 1LZGA 3GUJA 1C6MA 1B7QA 1CTWA 1DI4A 4KT3A 4B49A 2B74A 2Z37A 1YKXX 2BQJA 4WO6A 3SB8A 1KY0A 2YBIA 1FDLY 3HDEA 1L93A 1B5VA 4HTKA 3A6BY 1L34A 1OUGA 1C6HA 1E8LA 3CSZA 2Q9DA 3AZ6A 3HUQA 3DMXA 1D2YA 1BGIA 1OUAA 1TLAA 1L26A 1D9UA 119LA 1GBSA 4WLXA 2XQOA 4W53A 1QTHA 4EOFA 3B0IA 1A2YC 4ETDA 5IELA 2OE4X 5KXZA 4QEQA 142LA 1LZ4A 2ANVA 2I26L 4EPFA 1NBYC 1MELL 5I4WA 3C80A 209LA 4NHPA 1C67A 1WTMA 1XSFA 1P36A 4WG1A 4ARLA 4NSJA 4YENA 2L78A 1B5YA 1GBZA 1L68A 166LA 4GLAA 5JENB 2RBPA 1GE1A 2HU3A 4PRQA 4H93A 4GLVA 5KXRA 5LINA 5E4PA 3A91A 4RLMA 1GDWA 1OWZA 5KXXA 4WM3A 1C6LA 5IHGA 1C65A 243LA 1L88A 2BQCA 1FLWA 5B1GA 206LA 1BB3A 3DMVA 2F4AA 3D2YA 3C8SA 5L3IA 4BADA 1LYZA 3A90A 4GRVA 2YVBA 3FI5A 1LMPA 1B6IA 1L58A 4H9FA 3FA0A 1CV5A 1LWKA 1RE2A 1T8GA 225LA 257LA 4EKRA 2D91A 5LZMA 1K28A 1LKRA 1CJ7A 4QDNA 3GUMA 1G7IC 2IGCA 1L07A 2Z19A 4G54A 1TEWA 4NEBA 3A94A 185LA 1OUJA 4NHIA 5KJ9A 247LA 1REMA 4Z46A 5HLLA 5I53A 1LMOA 1OP9B 1DYDA 1JWRA 3TMUA 3G3AB 1YILA 1L73A 1L38A 1C6AA 1P5CA 5HMJA 3CB7A 3A96A 1C45A 1EAKA 1PZYA 1LCNA 2HUBA 2A4TA 3K3TA 4XENA 113LA 1P2LA 3OE6A 1PS5A 4NHTA 2NTHA 1CKFA 1NHEA 2RAZX 1CU5A 1T8AA 3IJVA 3TXHA 4I7NA 3RUNA 1GD6A 4B4JA 4DD1A 199LA 2B72A 4OO9A 217LA 1SWYA 1LJNA 1L32A 1ALCA 1ZYTA 5B06A 1GXV2 1QUSA 1WQRA 4ARQA 2CWIA 1GB2A 3WVXA 1L15A 3D4SA 1P64A 1XEJA 3C83A 3AGIA 3SP3A 2ZYCA 1LYSA 241LA 192LA 1DI3A 2ZIJA 1GFJA 4DDCA 1CUQA 1IC7Y 1BWHA 4TSCA 1LYJA 3TXBA 1QUGA 2BLXA 1G7HC 4R6CA 4YXAC 1LBUA 5I54A 108LA 129LA 2OU9A 5HQ1A 4H94A 4CFPA 5LAFA 5C6JA 1BB4A 4HTQA 1YAMA 2DQIY 164LA 2RB2X 2YBMA 4H8YA 3HTGA 1LYFA 189LA 2RH1A 3CT1A 1AKIA 3LZMA 4AQNA 1TAYA 1LKSA 1LZ9A 3C82A 2OE7X 3OE9A 2C8OA 3W6DA 4TUNA 1LSEA 5LVIA 1VAUA 4NHQA 4WO9A 4I0CA 1QDTA 3G3BB 3HU9A 1CJ9A 1G0KA 1ZMYL 3A93A 1GF4A 1BB6A 4I8SA 4LT2A 3P65A 4N5RA 1C10A 1L05A 5KXKA 1G0PA 245LA 2AUBA 4QGZA 191LA 2OTYX 4ETEA 5LVKA 1L36A 2FYDA 1IX0A 1BWJA 4B4EA 1B7RA 4WM5A 4HSFA 1LJKA 1QTDA 4H9IA 5KXNA 2H5ZA 3WUNA 1G7JC 3CT5A 2MEHA 4LZTA 1LZNA 4NGYA 4GCEA 1PQJA 3AYQA 4LT3A 4WLDA 200LA 1XFPL 1QSAA 1LGWA 1L03A 1HNLA 4K5YA 5KXTA 1L53A 4L41A 1VDQA 1LI3A 123LA 5KXPA 2LYMA 1L16A 1DKKA 3PDSA 1IWVA 1L77A 112LA 3PBLA 2Z39A 1LJHA 1LZBA 1F6RA 2DQCY 2F30A 1HFYA 259LA 3A8ZA 3K2RA 4ZEEA 3OE0A 1CKGA 252LA 1IR9A 2LYOA 1C7PA 4XJBA 1IR8A 1DYGA 3HH3A 4D9ZA 1LTMA 1HEOA 5FSTA 1XEIA 1JKCA 3WH1A 1CU6A 251LA 1C6NA 4IAPA 3WU7A 1L94A 3P68A 5T3FA 157LA 1OVKA 4NGLA 5LXWA 5LVHA 3IWRA 3AZ4A 1L57A 4H9AA 1VEDA 1AZFA 5DN4A 1GF6A 1I20A 5C6LA 1L13A 5C6IA 1O23A 1L87A 3EO5A 3DN6A 1C6IA 3VW7A 3HT8A 1CV6A 1D3JA 4LYTA 4UWUA 3WW6A 1B2KA 4H9EA 1L25A 1DYEA 1YAPA 110LA 1HMKA 1LZYA 4FDYA 2LZMA 3DN2A 1G06A 1L43A 3LYMA 1CKHA 3BKHA 3CDOA 4OOTA 2CGIA 1QTEA 4M6DA 1L0KA 1VDTA 1NQIA 1LSMA 1GFVA 153LA 131LA 3FE0A 1XGRC 4LGKA 1LSCA 5I14A 1SX2A 1DI5A 3SBAA 4MSTA 1KIRC 4EMNA 118LA 3GXRA 1GB6A 188LA 1C6FA 1IR7A 4II8A 1L75A 139LA 1L09A 2RB0X 158LA 1LSYA 4W55A 1UIEA 1C6GA 1JKAA 148LE 3A6CY 1NDMC 3TXKA 4XJHA 4LDOA 1IORA 3QNGA 4BAFA 135LA 1SSYA 1L84A 1L37A 246LA 262LA 4BPAA 222LA 3C8QA 1KXWA 152LA 1NDGC 1AT5A 1LJ4A 1QIOA 4C3WA 3RZ4A 5APFA 4WM1A 1G7MC 1I56A 156LA 4DQJA 1ZWNA 1REZA 4YM8A 3FI7A 1F10A 1CX6A 1L08A 3ODUA 1LHLA 3DKEX 1QUOA 1G0LA 3WW5A 4GN4A 1UIGA 1CU2A 1GHLA 4ARJA 154LA 2F2QA 1G0JA 3HUAA 4GCBA 2G4NA 133LA 1L74A 4I7MA 3HH6A 2HEBA 5FCPA 6LYZA 1LYEA 1L52A 1BVKC 4TSBA 1LZ8A 2LZTA 1FLUA 2BQKA 4I7OA 1L17A 4HP0A 2F4GA 3HT7A 4IJ4A 1BB7A 3ZEKA 4H1PA 1H6MA 3HH5A 1L62A 1UC0A 3HT9A 4LYBA 3RU5A 1GFRA 1GBOA 1LSZA 1YAQA 1GF3A 141LA 1QTCA 2EKSC 2MECA 1GB9A 5APCA 2N5ZA 1GF9A 1C6BA 1JPOA 1L30A 4LPQA 2F2NA 5LAGA 2G4PA 2EPEA 4I7LA 4WMGA 4P2EA 2LC9A 1C6JA 210LA 1IWXA 2HULA 3T36A 1AT6A 3DN0A 1UA6Y 3SB6A 3DN4A 197LA 1P3NA 4OWEA 1UIFA 1QT4A 2X0AA 4NSIA 3NY9A 1IWZA 4NY5A 4PJ2C 2RBRA 6LZMA 1IOCA 4X3BA 1WQPA 1QDRA 3DN8A 1L24A 1BB5A 2B6TA 1C63A 1JQUA 1IWTA 3W6FA 1JJ1A 3GULA 4EKQA 5FHWA 3WXUA 1D2WA 1GB5A 1L92A 2MEGA 1QUHA 3W6EA 5KKIA 1L41A 3GXKA 1P7SA 4NGJA 1L95A 1QT7A 1V7SA 1P37A 1HERA 2XJWA 4BOLA 2YSSC 5B59A 3M18B 1PQMA 1B5ZA 213LA 127LA 3WPLA 2F32A 5LA5A 2YBHA 1CUPA 1GEZA 3NY8A 3RT5X 3CDQA 1C68A 4U3XB 1L39A 1L70A 4WLYA 4GN5C 3UONA 5KKJA 1GDXA 1GPQC 4HJYA 4LFPA 1GB3A 2Z2EA 4WM6A 3TMVA 1B5WA 1DYAA 1HMLA 1CV3A 4QY9A 1PQDA 4DJHA 4N8ZA 5HNCA 1CKDA 1B7PA 1C46A 151LA 4MR1A 1CU3A 2B75A 1L91A 4ZIXA 1LOZA 2A7FA 1LHHA 1WQOA 1P56A 4WL7A 4ETBA 1L23A 2BQBA 1B7NA 1XGUC 3RZEA 4NIJA 4DQ7A 3LYZA 1B7LA 1EQ5A 4XJFA 3AGGG 147LA 183LA 3N9CA 5B1FA 5LA8A 1T6VL 4HJZA 4W59A 1YKYX 4PJZA 2Z38A 2ANXA 1D0KA 4ARMB 4YX7C 226LA 3B0OA 4DT3A 180LA 1L0JA 2OEAX 3WXTA 2RSCA 1LSDA 2Z6BA 1HEPA 3WYHA 4NGKA 1P46A 1QTKA 1LI2A 1T6HA 167LA 1L31A 4ETCA 4S0WA 2D4JA 1B7OA 1L86A 1IVMA 1D3NA 1KIPC 1UCOA 1WQNA 4PRUA 4DQ5A 1C43A 4CHXA 1XJUA 1L99A 4I7QA 1RJCB 2DQAA 1REYA 4G4CA 1HEWA 1L28A 2LHMA 2RBSA 1IC5Y 5E9RA 5LYZA 1LSNA 1GBXA 175LA 2HEFA 4XN6A 5DM9A 4PGJB 1LJJA 4NGIA 1B0DA 1LYHA 1GB7A 4H92A 2DQEY 3DNAA 3ZVQB 4W56A 1DPXA 1PQOA 1L49A 181LA 4NWHA 1JTTL 4Z3MA 1HF4A 184LA 4DD9A 1NKHA 2OU0X 132LA 2HUMA 1L65A 1D6PA 1C6QA 2B6YA 1CJ6A 4WLTA 1LWGA 2BPUA 1HEMA 1YKZX 3CSRA 1C60A 1HELA 168LA 1P6YA 3J6KA 5LYMA 5F9UA
chains in the Genus database with same CATH topology
5I4XA 212LA 4DD2A 1JTMA 1JSEA 1WQQA 4YEMA 1BQLY 1LMNA 1FLYA 1L83A 3M3UA 2H9KA 2CDSA 1IP3A 1GXXA 4HJVA 3HTDA 1OQMA 258LA 4KXIA 4N1CC 1LZDA 1D3MA 5LVGA 2D4KA 4J1BA 3EMLA 1UICA 1L01A 1FKQA 2ZNXY 1VFBC 3B72A 3EXDA 4LDLA 2ZILA 2W1YA 1LZEA 4XJGA 1IP5A 4IATA 5LVJA 3AW6A 2PC2A 3F9LA 3WU8A 3SB7A 163LA 5ILFA 3AZ7A 3P64A 4PPOA 1IP6A 3J4GA 2LYZA 2XBRA 4NHSA 1LW9A 1C08C 1JTPL 4NSGA 4H90A 2HEAA 2GV0A 2BQMA 4I7TA 140LA 1LZ1A 4IASA 1L10A 4FJRA 5B05A 5LYTA 114LA 2F47A 4OWBA 1GE2A 4AXTA 1L97A 4J1AA 1OUHA 150LA 1SSWA 1LZCA 4H8XA 1W6ZA 1KXYA 1QQYA 3SBBC 4HPIA 1TDYA 218LA 3C7ZA 3E3DA 3N9AA 1UUZC 5A3EA 3CT0A 3CQLA 4NG1A 4I7KA 2G4QA 2D6BA 4OWAA 4H9BA 3HUKA 3TMXA 1LYIA 5KXOA 1L71A 1D0MA 1CX7A 1G0QA 5M1YA 1P2RA 1GFGA 1GF8A 1INUA 1DQJC 4EKSA 3WULA 5B07A 115LA 4TTDA 3B6LA 1LPYA 1KXXA 4GN3A 1YIKA 4N0JA 177LA 2QB0B 4DWXA 4G9SA 1GE0A 1L45A 1LYOA 5APEA 1OUFA 1B7SA 1LHIA 145LA 1DPWA 2MEAA 3IJUA 3VWOA 3HDFA 4NGWA 4H9CA 1IP4A 4GCCA 3QAKA 5HMVA 1LSFA 4GCDA 4ML7A 5FDJA 5FELA 4DYGA 1BWIA 3GUPA 3LYTA 2YBNA 2EQLA 1RCMA 1LLHA 143LA 4N9RA 4G49A 5DN5A 4XYYA 1J1XY 4NGZA 4OWCA 1IIZA 3HT6A 4BS7A 174LA 3L2XA 4WOAA 176LA 1G7LC 1A4VA 230LA 4W58A 4LYZA 4EXMA 1L46A 2Q9EA 4W51A 1L11A 3ATOA 1GF7A 1B7MA 254LA 3OE8A 4WG7A 1FLQA 4B1AA 1L19A 2O7AA 4HV1A 1KIQC 1XGQC 2VB1A 1IY3A 1L66A 3OK0A 1XEKA 1N4FA 3HTFA 1VDSA 2HEDA 1LGXA 122LA 5II3A 2BQLA 149LA 1NMMA 2BQEA 4OWHA 3T6UA 4BXJA 1EQ4A 4Z98A 1WQMA 2HTXA 5IDDA 3EBAB 3LYOA 4BJ4A 1C6KA 3WUMA 1B5UA 3TMWA 1LSAA 1LI6A 4DAJA 3WUAA 4NGOA 4WM2A 4CGEA 120LA 3A3RX 5DLAA 235LA 239LA 4EJ4A 3HBDA 2DQDY 1LJIA 104LA 3B0KA 3NYAA 1QSBA 1DXJA 231LA 4BXEA 5L3HA 2O4WA 4RDSA 3WU9A 1QS9A 4YEOA 1L02A 3TXGA 5A3ZA 186LA 1SWZA 255LA 3HTBA 2RB1X 4DKLA 1F6SA 1LMQA 3TXFA 1BVXA 193LA 1IEEA 1LZAA 3F8VA 1WTNA 3AB6A 2IHLA 3C8RA 4NFVA 4UWVA 109LA 1L47A 1NHBA 3EMSA 1GB8A 232LA 3JR6A 171LA 2O79A 2OU8A 4B4IA 182LA 5KXWA 1G0GA 1PQIA 4WL6A 4LT1A 1UIDA 1W08A 3HWLA 4E97A 1LYDA 1L35A 2H9JA 208LA 2DQFC 1L61A 1L12A 1YQVY 4KPMA 4NSHA 1JUGA 1OVJA 1WTHA 4OOOA 220LA 4HV2A 1QT6A 261LA 2B6WA 4XJDA 1WVVA 3C7YA 3C81A 1GF0A 2W1XA 144LA 4RW2A 4TWSA 1D9WA 1QTBA 4W54A 3GUIA 205LA 1CV1A 4I7RA 1QUTA 2XBSA 7LZMA 1J1OY 1LPIA 1NF5A 3N9EA 237LA 1C64A 1JKDA 1L22A 1LHKA 107LA 2EIZC 5KY1A 1DKJA 1C6DA 3BKVA 1QT3A 5KXLA 1XGPC 173LA 196LA 1MLCE 2B6ZA 2ZIKA 4A7DA 211LA 1LSPA 229LA 3A34A 4W94A 4H91A 4AGAA 2Y8PA 2Z2FA 2MEFA 3WMKA 2B6XA 2MEEA 4G4HA 1LJGA 4YXCA 3G3XA 1IP1A 2BQNA 4I7JA 2Z12A 1OYUA 1L54A 1WVUA 1JTOL 260LA 3CDVA 187LA 1HFZA 1DYCA 4DD0A 1I6SA 1L79A 3LZ2A 172LA 3G3VA 1L20A 2OTZX 134LA 4PK0A 161LA 1XGTC 1REXA 1ZVHL 3AZ5A 3QE8A 1L59A 4G4BA 1C61A 224LA 2RAYX 1IOSA 3W6CA 3D3DA 1GFUA 2CUUA 1YL0X 1H87A 1LJFA 4OW1A 1RFPA 1L06A 2RBOA 3C7WA 1D0LA 1L82A 1LZ6A 3HBEX 2FBDA 1OV7A 1D3FA 190LA 1QTVA 3P66A 4HPEA 1L42A 4ZFPA 195LA 1CNSA 4B0DA 2B7XA 3D9AC 1C62A 3LZTA 4YOPA 1L98A 1L48A 3AJNA 1JJ0A 1D6QA 4ET9A 3DN1A 4ARQB 1L64A 1T3PA 4XADA 1HSWA 1ZV5L 1GFAA 3GUKA 3HFMY 2BQHA 1YL1X 1L00A 228LA 2W1LA 3W6BA 2B70A 5APDA 4DD3A 4ARMA 1CU0A 3KAMA 4N1EI 1ZVYB 4LYOA 1JHLA 1NBZC 4ANRA 165LA 4EPIA 1GFKA 5I4YA 4PHIA 1OUEA 2FYCA 1LMCA 138LA 5K7OA 1L29A 198LA 233LA 1L50A 4TX7A 4H9HA 1KS3A 1QT5A 2BQOA 1QUDA 1GWDA 1LHJA 5F14A 1KY1A 1C6EA 1L80A 1GEVA 5LIOA 3QY4A 2CJLA 1CV0A 1IOTA 1YANA 1QT8A 1L6JA 4LT0A 2BH7A 1L96A 1L60A 2LCBA 2FBBA 7LYZA 256LA 3HU8A 4M4OA 4NGVA 5F16A 1L90A 1C6PA 2B73A 2XTHA 1LHMA 3CSQA 3ZVQA 2Q0MX 4WM4A 3W3EA 1EQEA 1GFEA 1OWYA 1UBZA 3HH4A 9LYZA 1OVHA 1FKVA 146LA 221LA 4RLNA 1L63A 4H8ZA 4LZMA 2BQGA 1F0WA 1OUBA 1CJ8A 1EPYA 1GFHA 1DYBA 3ULRA 1SX7A 2RBQA 4LYMA 5D5CA 253LA 2BQFA 3CDTA 223LA 5F9XA 3RW8A 4W96A 1JIYA 1IWYA 4Z41A 1IOQA 1T8FA 130LA 4GCFA 236LA 1LZSA 1PQKA 5AMYA 178LA 1GAZA 3W6AA 2WKXA 102LA 1DYFA 4J0LA 3AGHA 2B5ZA 1V7TA 201LA 4DDAA 1YROA 3LHMA 4HTNA 4BAPA 1B5XA 4ARPA 1LMTA 1T97A 3DMZA 155LA 2ZQ4A 2BQIA 1LGUA 1OUDA 2MEBA 5L9JA 2BQDA 3WL2A 2LZ2A 2HEEA 1L14A 3WVYA 5FEKA 1AM7A 194LA 2Z18A 6LYTA 1IP2A 1G07A 240LA 3F6ZA 1C69A 4E3UA 4YF2A 3AW7A 207LA 1IO5A 2IFFY 2WARA 4R0FA 1LSGA 1UACY 4I7PA 2MEDA 2RBNA 1QSQA 4KL7A 4GBRB 1SQ2L 3GUOA 1C6CA 244LA 4DDBA 1UIBA 3SB5A 1RI8B 216LA 1NWGA 1KNIA 1G1VA 1J1PY 1FBIX 5J7CA 1IC4Y 1LZ5A 8LYZA 1JSFA 1YAOA 3V2WA 1L89A 4UWNA 2HU1A 5D5FA 1HENA 1SLYA 1KW5A 1L27A 4LDEA 3P4ZA 5HNLA 2W1MA 2YBLA 1L40A 1JITA 1EL1A 3OJPA 1P2CC 5KXMA 2QARC 4MCKA 3A95A 1L33A 227LA 1ZURA 4O34A 5I5QA 4ZPUA 1L44A 2BLYA 2DQGY 4I7SA 1CKCA 1LYGA 2YBJA 1L72A 1CV4A 1C6TA 5ILCA 137LA 5F81A 1L81A 1C66A 1LSBA 2BAAA 1IY4A 1L67A 4NWEA 4J7VA 4LFXA 3WPKA 1L69A 5DL9A 4ET8A 1LAAA 2BQAA 4CFOA 2D4IA 3L64A 4NG8A 1IWUA 249LA 1HC0A 125LA 126LA 1GE3A 2DBTA 1JJ3A 4BXDA 1JISA 1HHLA 1OV5A 4ETAA 4RW1A 2ZWBA 5EBHA 3CDRA 1LJ3A 1CVKA 2NTGA 3A92A 3SN6R 1UIHA 1LZRA 1L55A 128LA 1KW7A 3DN3A 3RNXA 2HECA 2I6ZA 2DKVA 1FN5A 2NWDX 1JEFA 1TCYA 111LA 4XJIA 2DQHY 3V2YA 1GB0A 2DQJY 219LA 2C8PA 3WPJA 4C5FA 3D2ZA 162LA 1XEPA 1Z55A 5KXYA 1GE4A 1JTNA 2ZQ3A 1IWWA 1VATA 170LA 2ZYPA 3A67Y 169LA 1HFXA 4W52A 1QS5A 1I1ZA 3TXIA 1BHZA 3TXJA 3TXDA 3G3WA 234LA 3TXEA 215LA 4EKPA 1L76A 1HSXA 238LA 1HEQA 2OE9X 1L85A 3LN2A 1L18A 1UIAA 242LA 2MEIA 1DZBX 2ZNWY 2I25L 1QSWA 4CJ2A 1GFTA 1GF5A 1GAYA 1L21A 248LA 3FADA 1L51A 1OUCA 1LMAA 1LJEA 1GBWA 250LA 1LZTA 1JKBA 1G1WA 2YDGA 1QTZA 160LA 1G0MA 1L56A 3SB9A 5KXSA 1GBYA 4W57A 3ATNA 1IP7A 2HUKA 159LA 214LA 1TBYA 1L04A 1XJTA 1B9OA 1VDPA 4DC4A 1LYYA 1OUIA 103LA 3A3QA 3MGWA 3GUNA 4DD7A 4LYCA 3HBHA 2A7DA 1LZGA 3GUJA 1C6MA 1B7QA 1CTWA 1DI4A 4KT3A 4B49A 2B74A 2Z37A 1YKXX 2BQJA 4WO6A 3SB8A 1KY0A 2YBIA 1FDLY 3HDEA 1L93A 1B5VA 4HTKA 3A6BY 1L34A 1OUGA 1C6HA 1E8LA 3CSZA 2Q9DA 3AZ6A 3HUQA 3DMXA 1D2YA 1BGIA 1OUAA 1TLAA 1L26A 1D9UA 119LA 1GBSA 4WLXA 2XQOA 4W53A 1QTHA 4EOFA 3B0IA 1A2YC 4ETDA 5IELA 2OE4X 5KXZA 4QEQA 142LA 1LZ4A 2ANVA 2I26L 4EPFA 1NBYC 1MELL 5I4WA 3C80A 209LA 4NHPA 1C67A 1WTMA 1XSFA 1P36A 4WG1A 4ARLA 4NSJA 4YENA 2L78A 1B5YA 1GBZA 1L68A 166LA 4GLAA 5JENB 2RBPA 1GE1A 2HU3A 4PRQA 4H93A 4GLVA 5KXRA 5LINA 5E4PA 3A91A 4RLMA 1GDWA 1OWZA 5KXXA 4WM3A 1C6LA 5IHGA 1C65A 243LA 1L88A 2BQCA 1FLWA 5B1GA 206LA 1BB3A 3DMVA 2F4AA 3D2YA 3C8SA 5L3IA 4BADA 1LYZA 3A90A 4GRVA 2YVBA 3FI5A 1LMPA 1B6IA 1L58A 4H9FA 3FA0A 1CV5A 1LWKA 1RE2A 1T8GA 225LA 257LA 4EKRA 2D91A 5LZMA 1K28A 1LKRA 1CJ7A 4QDNA 3GUMA 1G7IC 2IGCA 1L07A 2Z19A 4G54A 1TEWA 4NEBA 3A94A 185LA 1OUJA 4NHIA 5KJ9A 247LA 1REMA 4Z46A 5HLLA 5I53A 1LMOA 1OP9B 1DYDA 1JWRA 3TMUA 3G3AB 1YILA 1L73A 1L38A 1C6AA 1P5CA 5HMJA 3CB7A 3A96A 1C45A 1EAKA 1PZYA 1LCNA 2HUBA 2A4TA 3K3TA 4XENA 113LA 1P2LA 3OE6A 1PS5A 4NHTA 2NTHA 1CKFA 1NHEA 2RAZX 1CU5A 1T8AA 3IJVA 3TXHA 4I7NA 3RUNA 1GD6A 4B4JA 4DD1A 199LA 2B72A 4OO9A 217LA 1SWYA 1LJNA 1L32A 1ALCA 1ZYTA 5B06A 1GXV2 1QUSA 1WQRA 4ARQA 2CWIA 1GB2A 3WVXA 1L15A 3D4SA 1P64A 1XEJA 3C83A 3AGIA 3SP3A 2ZYCA 1LYSA 241LA 192LA 1DI3A 2ZIJA 1GFJA 4DDCA 1CUQA 1IC7Y 1BWHA 4TSCA 1LYJA 3TXBA 1QUGA 2BLXA 1G7HC 4R6CA 4YXAC 1LBUA 5I54A 108LA 129LA 2OU9A 5HQ1A 4H94A 4CFPA 5LAFA 5C6JA 1BB4A 4HTQA 1YAMA 2DQIY 164LA 2RB2X 2YBMA 4H8YA 3HTGA 1LYFA 189LA 2RH1A 3CT1A 1AKIA 3LZMA 4AQNA 1TAYA 1LKSA 1LZ9A 3C82A 2OE7X 3OE9A 2C8OA 3W6DA 4TUNA 1LSEA 5LVIA 1VAUA 4NHQA 4WO9A 4I0CA 1QDTA 3G3BB 3HU9A 1CJ9A 1G0KA 1ZMYL 3A93A 1GF4A 1BB6A 4I8SA 4LT2A 3P65A 4N5RA 1C10A 1L05A 5KXKA 1G0PA 245LA 2AUBA 4QGZA 191LA 2OTYX 4ETEA 5LVKA 1L36A 2FYDA 1IX0A 1BWJA 4B4EA 1B7RA 4WM5A 4HSFA 1LJKA 1QTDA 4H9IA 5KXNA 2H5ZA 3WUNA 1G7JC 3CT5A 2MEHA 4LZTA 1LZNA 4NGYA 4GCEA 1PQJA 3AYQA 4LT3A 4WLDA 200LA 1XFPL 1QSAA 1LGWA 1L03A 1HNLA 4K5YA 5KXTA 1L53A 4L41A 1VDQA 1LI3A 123LA 5KXPA 2LYMA 1L16A 1DKKA 3PDSA 1IWVA 1L77A 112LA 3PBLA 2Z39A 1LJHA 1LZBA 1F6RA 2DQCY 2F30A 1HFYA 259LA 3A8ZA 3K2RA 4ZEEA 3OE0A 1CKGA 252LA 1IR9A 2LYOA 1C7PA 4XJBA 1IR8A 1DYGA 3HH3A 4D9ZA 1LTMA 1HEOA 5FSTA 1XEIA 1JKCA 3WH1A 1CU6A 251LA 1C6NA 4IAPA 3WU7A 1L94A 3P68A 5T3FA 157LA 1OVKA 4NGLA 5LXWA 5LVHA 3IWRA 3AZ4A 1L57A 4H9AA 1VEDA 1AZFA 5DN4A 1GF6A 1I20A 5C6LA 1L13A 5C6IA 1O23A 1L87A 3EO5A 3DN6A 1C6IA 3VW7A 3HT8A 1CV6A 1D3JA 4LYTA 4UWUA 3WW6A 1B2KA 4H9EA 1L25A 1DYEA 1YAPA 110LA 1HMKA 1LZYA 4FDYA 2LZMA 3DN2A 1G06A 1L43A 3LYMA 1CKHA 3BKHA 3CDOA 4OOTA 2CGIA 1QTEA 4M6DA 1L0KA 1VDTA 1NQIA 1LSMA 1GFVA 153LA 131LA 3FE0A 1XGRC 4LGKA 1LSCA 5I14A 1SX2A 1DI5A 3SBAA 4MSTA 1KIRC 4EMNA 118LA 3GXRA 1GB6A 188LA 1C6FA 1IR7A 4II8A 1L75A 139LA 1L09A 2RB0X 158LA 1LSYA 4W55A 1UIEA 1C6GA 1JKAA 148LE 3A6CY 1NDMC 3TXKA 4XJHA 4LDOA 1IORA 3QNGA 4BAFA 135LA 1SSYA 1L84A 1L37A 246LA 262LA 4BPAA 222LA 3C8QA 1KXWA 152LA 1NDGC 1AT5A 1LJ4A 1QIOA 4C3WA 3RZ4A 5APFA 4WM1A 1G7MC 1I56A 156LA 4DQJA 1ZWNA 1REZA 4YM8A 3FI7A 1F10A 1CX6A 1L08A 3ODUA 1LHLA 3DKEX 1QUOA 1G0LA 3WW5A 4GN4A 1UIGA 1CU2A 1GHLA 4ARJA 154LA 2F2QA 1G0JA 3HUAA 4GCBA 2G4NA 133LA 1L74A 4I7MA 3HH6A 2HEBA 5FCPA 6LYZA 1LYEA 1L52A 1BVKC 4TSBA 1LZ8A 2LZTA 1FLUA 2BQKA 4I7OA 1L17A 4HP0A 2F4GA 3HT7A 4IJ4A 1BB7A 3ZEKA 4H1PA 1H6MA 3HH5A 1L62A 1UC0A 3HT9A 4LYBA 3RU5A 1GFRA 1GBOA 1LSZA 1YAQA 1GF3A 141LA 1QTCA 2EKSC 2MECA 1GB9A 5APCA 2N5ZA 1GF9A 1C6BA 1JPOA 1L30A 4LPQA 2F2NA 5LAGA 2G4PA 2EPEA 4I7LA 4WMGA 4P2EA 2LC9A 1C6JA 210LA 1IWXA 2HULA 3T36A 1AT6A 3DN0A 1UA6Y 3SB6A 3DN4A 197LA 1P3NA 4OWEA 1UIFA 1QT4A 2X0AA 4NSIA 3NY9A 1IWZA 4NY5A 4PJ2C 2RBRA 6LZMA 1IOCA 4X3BA 1WQPA 1QDRA 3DN8A 1L24A 1BB5A 2B6TA 1C63A 1JQUA 1IWTA 3W6FA 1JJ1A 3GULA 4EKQA 5FHWA 3WXUA 1D2WA 1GB5A 1L92A 2MEGA 1QUHA 3W6EA 5KKIA 1L41A 3GXKA 1P7SA 4NGJA 1L95A 1QT7A 1V7SA 1P37A 1HERA 2XJWA 4BOLA 2YSSC 5B59A 3M18B 1PQMA 1B5ZA 213LA 127LA 3WPLA 2F32A 5LA5A 2YBHA 1CUPA 1GEZA 3NY8A 3RT5X 3CDQA 1C68A 4U3XB 1L39A 1L70A 4WLYA 4GN5C 3UONA 5KKJA 1GDXA 1GPQC 4HJYA 4LFPA 1GB3A 2Z2EA 4WM6A 3TMVA 1B5WA 1DYAA 1HMLA 1CV3A 4QY9A 1PQDA 4DJHA 4N8ZA 5HNCA 1CKDA 1B7PA 1C46A 151LA 4MR1A 1CU3A 2B75A 1L91A 4ZIXA 1LOZA 2A7FA 1LHHA 1WQOA 1P56A 4WL7A 4ETBA 1L23A 2BQBA 1B7NA 1XGUC 3RZEA 4NIJA 4DQ7A 3LYZA 1B7LA 1EQ5A 4XJFA 3AGGG 147LA 183LA 3N9CA 5B1FA 5LA8A 1T6VL 4HJZA 4W59A 1YKYX 4PJZA 2Z38A 2ANXA 1D0KA 4ARMB 4YX7C 226LA 3B0OA 4DT3A 180LA 1L0JA 2OEAX 3WXTA 2RSCA 1LSDA 2Z6BA 1HEPA 3WYHA 4NGKA 1P46A 1QTKA 1LI2A 1T6HA 167LA 1L31A 4ETCA 4S0WA 2D4JA 1B7OA 1L86A 1IVMA 1D3NA 1KIPC 1UCOA 1WQNA 4PRUA 4DQ5A 1C43A 4CHXA 1XJUA 1L99A 4I7QA 1RJCB 2DQAA 1REYA 4G4CA 1HEWA 1L28A 2LHMA 2RBSA 1IC5Y 5E9RA 5LYZA 1LSNA 1GBXA 175LA 2HEFA 4XN6A 5DM9A 4PGJB 1LJJA 4NGIA 1B0DA 1LYHA 1GB7A 4H92A 2DQEY 3DNAA 3ZVQB 4W56A 1DPXA 1PQOA 1L49A 181LA 4NWHA 1JTTL 4Z3MA 1HF4A 184LA 4DD9A 1NKHA 2OU0X 132LA 2HUMA 1L65A 1D6PA 1C6QA 2B6YA 1CJ6A 4WLTA 1LWGA 2BPUA 1HEMA 1YKZX 3CSRA 1C60A 1HELA 168LA 1P6YA 3J6KA 5LYMA 5F9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LMA A;  1LJE A;  4LYT A;  4UWU A;  3WW6 A;  1REX A;  1B2K A;  1GBW A;  5I4X A;  1LZT A;  1JKB A;  1ZVH L;  3AZ5 A;  4DD2 A;  4H9E A;  2YDG A;  1JSE A;  1WQQ A;  1YAP A;  3QE8 A;  4G4B A;  1HMK A;  4YEM A;  1IOS A;  1BQL Y;  1LZY A;  3W6C A;  1LMN A;  4FDY A;  3D3D A;  1FLY A;  1GFU A;  1YL0 X;  3M3U A;  5KXS A;  2H9K A;  1GBY A;  2CDS A;  1IP3 A;  3ATN A;  1IP7 A;  3LYM A;  1GXX A;  4HJV A;  1H87 A;  1TBY A;  1OQM A;  1CKH A;  1LJF A;  3BKH A;  4OOT A;  4OW1 A;  1RFP A;  2CGI A;  4KXI A;  4N1C C;  1LZD A;  1B9O A;  1D0L A;  5LVG A;  1QTE A;  1LZ6 A;  1VDP A;  4M6D A;  4DC4 A;  2D4K A;  1LYY A;  3HBE X;  2FBD A;  1VDT A;  4J1B A;  1NQI A;  1OUI A;  1LSM A;  3P66 A;  4HPE A;  3A3Q A;  1GFV A;  153L A;  4ZFP A;  3FE0 A;  1UIC A;  1CNS A;  1XGR C;  4B0D A;  3MGW A;  4LGK A;  1LSC A;  1FKQ A;  2ZNX Y;  3D9A C;  1VFB C;  1DI5 A;  3B72 A;  3EXD A;  4DD7 A;  4MST A;  4LYC A;  1KIR C;  3HBH A;  2ZIL A;  2W1Y A;  3LZT A;  4EMN A;  1LZE A;  4XJG A;  1IP5 A;  4YOP A;  4IAT A;  2A7D A;  1LZG A;  3AW6 A;  3GXR A;  5LVJ A;  1GB6 A;  2PC2 A;  3AJN A;  3WU8 A;  1JJ0 A;  1D6Q A;  4ET9 A;  5ILF A;  1B7Q A;  3AZ7 A;  3P64 A;  4PPO A;  1IR7 A;  1T3P A;  4II8 A;  4XAD A;  1DI4 A;  1IP6 A;  1HSW A;  1ZV5 L;  1GFA A;  2Z37 A;  3J4G A;  4KT3 A;  1YKX X;  3HFM Y;  4B49 A;  2BQH A;  2LYZ A;  2XBR A;  1YL1 X;  2BQJ A;  4NHS A;  4WO6 A;  1LSY A;  2W1L A;  3W6B A;  2YBI A;  1UIE A;  1C08 C;  1FDL Y;  1JKA A;  5APD A;  4DD3 A;  3KAM A;  1JTP L;  4NSG A;  4N1E I;  3A6C Y;  1B5V A;  4HTK A;  1ZVY B;  4LYO A;  4H90 A;  1NDM C;  1JHL A;  1NBZ C;  2GV0 A;  2BQM A;  2HEA A;  4XJH A;  3TXK A;  4ANR A;  3A6B Y;  1LZ1 A;  1OUG A;  1E8L A;  3CSZ A;  1GFK A;  4IAS A;  4FJR A;  3AZ6 A;  1IOR A;  3QNG A;  4PHI A;  135L A;  4BAF A;  1OUE A;  2FYC A;  5B05 A;  5I4Y A;  5LYT A;  1LMC A;  1BGI A;  1OUA A;  4BPA A;  4OWB A;  5K7O A;  1GE2 A;  1KXW A;  1D9U A;  1GBS A;  4WLX A;  4AXT A;  4J1A A;  1OUH A;  4EOF A;  1LZC A;  1NDG C;  3B0I A;  4TX7 A;  1A2Y C;  4H8X A;  4ETD A;  1AT5 A;  4H9H A;  1LJ4 A;  1QIO A;  1KXY A;  1W6Z A;  4C3W A;  1QQY A;  5IEL A;  3RZ4 A;  4HPI A;  4QEQ A;  5KXZ A;  2BQO A;  5APF A;  4WM1 A;  1TDY A;  1GWD A;  1G7M C;  1LZ4 A;  2I26 L;  1LHJ A;  1I56 A;  3E3D A;  3N9A A;  5F14 A;  1UUZ C;  1NBY C;  1MEL L;  3CT0 A;  5A3E A;  3CQL A;  5I4W A;  4NG1 A;  2G4Q A;  2D6B A;  4OWA A;  1REZ A;  4H9B A;  4YM8 A;  3TMX A;  4NHP A;  1GEV A;  5LIO A;  3FI7 A;  1F10 A;  3QY4 A;  2CJL A;  5KXO A;  1WTM A;  1IOT A;  1XSF A;  1YAN A;  1D0M A;  1L6J A;  4WG1 A;  4LT0 A;  4NSJ A;  2BH7 A;  1LHL A;  4YEN A;  5M1Y A;  1B5Y A;  3WW5 A;  1GBZ A;  4GN4 A;  1GFG A;  1GHL A;  1GF8 A;  1UIG A;  1INU A;  1DQJ C;  154L A;  2FBB A;  7LYZ A;  4GLA A;  5B07 A;  3WUL A;  5JEN B;  4TTD A;  4M4O A;  3B6L A;  4GCB A;  2G4N A;  1GE1 A;  133L A;  2HU3 A;  4PRQ A;  4H93 A;  4GLV A;  5KXR A;  4NGV A;  5E4P A;  1KXX A;  5F16 A;  3A91 A;  5LIN A;  4RLM A;  4GN3 A;  2XTH A;  1GDW A;  1YIK A;  1LHM A;  3CSQ A;  4N0J A;  2HEB A;  2Q0M X;  3ZVQ A;  5FCP A;  4WM4 A;  3W3E A;  4G9S A;  1EQE A;  1GFE A;  4WM3 A;  4DWX A;  6LYZ A;  5IHG A;  5KXX A;  1GE0 A;  1BVK C;  1UBZ A;  9LYZ A;  1LYO A;  4TSB A;  1FKV A;  4RLN A;  2BQC A;  1FLW A;  1LZ8 A;  5APE A;  1BB3 A;  5B1G A;  1OUF A;  2LZT A;  1B7S A;  1LHI A;  1FLU A;  4H8Z A;  2F4A A;  2BQK A;  1DPW A;  1F0W A;  2BQG A;  4HP0 A;  3D2Y A;  2MEA A;  2F4G A;  3IJU A;  3VWO A;  1OUB A;  1CJ8 A;  4IJ4 A;  4NGW A;  1GFH A;  3ULR A;  4H9C A;  1IP4 A;  4BAD A;  5L3I A;  1LYZ A;  3A90 A;  1BB7 A;  4GCC A;  2YVB A;  5HMV A;  4LYM A;  4H1P A;  1LSF A;  1LMP A;  5D5C A;  3ZEK A;  1H6M A;  4GCD A;  4H9F A;  2BQF A;  4ML7 A;  1UC0 A;  4LYB A;  3RU5 A;  1RE2 A;  1GFR A;  5F9X A;  5FDJ A;  3RW8 A;  4W96 A;  1JIY A;  1IWY A;  1GBO A;  1LSZ A;  5FEL A;  2D91 A;  1IOQ A;  4DYG A;  4Z41 A;  1BWI A;  1LKR A;  1CJ7 A;  3LYT A;  2YBN A;  4QDN A;  2EQL A;  1YAQ A;  1RCM A;  1GF3 A;  4GCF A;  1G7I C;  4N9R A;  2EKS C;  2MEC A;  1LZS A;  5AMY A;  4G49 A;  5DN5 A;  4XYY A;  1J1X Y;  2Z19 A;  1GB9 A;  4NGZ A;  1GAZ A;  4G54 A;  4OWC A;  5APC A;  1IIZ A;  2N5Z A;  1GF9 A;  1JPO A;  4BS7 A;  1TEW A;  4NEB A;  3A94 A;  3W6A A;  4LPQ A;  2WKX A;  2F2N A;  5KJ9 A;  1OUJ A;  4NHI A;  5LAG A;  2G4P A;  4WOA A;  2EPE A;  1REM A;  4J0L A;  3AGH A;  2B5Z A;  4Z46 A;  1V7T A;  4WMG A;  4P2E A;  5I53 A;  5HLL A;  1G7L C;  1A4V A;  1LMO A;  1OP9 B;  4DDA A;  1JWR A;  4LYZ A;  3TMU A;  1IWX A;  1YRO A;  3G3A B;  1YIL A;  3LHM A;  3T36 A;  3ATO A;  4HTN A;  1GF7 A;  1AT6 A;  3CB7 A;  3A96 A;  1UA6 Y;  1C45 A;  5HMJ A;  4BAP A;  1B5X A;  1EAK A;  1PZY A;  1B7M A;  1LCN A;  2HUB A;  1LMT A;  4OWE A;  3K3T A;  4XEN A;  4WG7 A;  1FLQ A;  1UIF A;  1PS5 A;  2ZQ4 A;  4NHT A;  2X0A A;  1CKF A;  2BQI A;  1NHE A;  1OUD A;  4B1A A;  2MEB A;  4NSI A;  2BQD A;  3IJV A;  5L9J A;  1IWZ A;  3WL2 A;  4NY5 A;  3TXH A;  2LZ2 A;  4PJ2 C;  4HV1 A;  1KIQ C;  1GD6 A;  1XGQ C;  2VB1 A;  1IY3 A;  3OK0 A;  4B4J A;  1XEK A;  1N4F A;  2HEE A;  4DD1 A;  3WVY A;  5FEK A;  1IOC A;  1AM7 A;  4X3B A;  1WQP A;  1QDR A;  1VDS A;  2HED A;  1BB5 A;  5F9U A;  194L A;  2Z18 A;  6LYT A;  1LJN A;  5II3 A;  1ALC A;  5B06 A;  1IWT A;  1IP2 A;  2BQL A;  1GXV 2;  1NMM A;  1QUS A;  2BQE A;  1WQR A;  4OWH A;  3T6U A;  2CWI A;  3W6F A;  1JJ1 A;  1GB2 A;  3F6Z A;  4BXJ A;  3WVX A;  1EQ4 A;  4Z98 A;  5FHW A;  3WXU A;  4E3U A;  4YF2 A;  3AW7 A;  207L A;  1IO5 A;  2IFF Y;  1WQM A;  1GB5 A;  1XEJ A;  2WAR A;  3AGI A;  2MEG A;  2ZYC A;  4R0F A;  3SP3 A;  3W6E A;  1LSG A;  1LYS A;  5KKI A;  1DI3 A;  2HTX A;  1UAC Y;  1GFJ A;  2ZIJ A;  2MED A;  4DDC A;  5IDD A;  3EBA B;  3LYO A;  4BJ4 A;  1IC7 Y;  3GXK A;  4NGJ A;  1BWH A;  4KL7 A;  3WUM A;  1B5U A;  1SQ2 L;  4TSC A;  3TMW A;  1LSA A;  1V7S A;  3TXB A;  4DDB A;  1HER A;  2XJW A;  4BOL A;  2YSS C;  5B59 A;  2BLX A;  1UIB A;  3M18 B;  1RI8 B;  1G7H C;  3WUA A;  4R6C A;  1LBU A;  1NWG A;  4NGO A;  5I54 A;  4WM2 A;  4CGE A;  1B5Z A;  5DLA A;  3A3R X;  5HQ1 A;  1J1P Y;  1FBI X;  4H94 A;  4CFP A;  5LAF A;  3WPL A;  5J7C A;  5C6J A;  5LA5 A;  1BB4 A;  2YBH A;  2DQD Y;  3HBD A;  1GEZ A;  4HTQ A;  1IC4 Y;  1LJI A;  1LZ5 A;  8LYZ A;  1YAM A;  3RT5 X;  3B0K A;  1JSF A;  4U3X B;  2DQI Y;  1DXJ A;  1YAO A;  4WLY A;  4UWN A;  4GN5 C;  4BXE A;  2HU1 A;  4H8Y A;  2YBM A;  5L3H A;  5D5F A;  1HEN A;  4RDS A;  3WU9 A;  5KKJ A;  1SLY A;  1GDX A;  1GPQ C;  4YEO A;  3CT1 A;  1AKI A;  4HJY A;  1TAY A;  4LFP A;  1LKS A;  1LZ9 A;  1GB3 A;  2Z2E A;  3TXG A;  4WM6 A;  3TMV A;  2C8O A;  1B5W A;  3W6D A;  4TUN A;  1LSE A;  5LVI A;  3P4Z A;  5A3Z A;  1HML A;  5HNL A;  1VAU A;  2W1M A;  4NHQ A;  2YBL A;  4WO9 A;  4I0C A;  1QDT A;  3G3B B;  1CJ9 A;  1JIT A;  1EL1 A;  1ZMY L;  3A93 A;  1P2C C;  3OJP A;  1GF4 A;  4QY9 A;  5KXM A;  1BB6 A;  4I8S A;  4LT2 A;  4MCK A;  4N8Z A;  3A95 A;  5HNC A;  1F6S A;  1LMQ A;  3P65 A;  1CKD A;  3TXF A;  1B7P A;  1C46 A;  4MR1 A;  4N5R A;  1BVX A;  1C10 A;  193L A;  1IEE A;  1LZA A;  4O34 A;  4ZIX A;  5KXK A;  5I5Q A;  2AUB A;  1LOZ A;  1WTN A;  4QGZ A;  3AB6 A;  2BLY A;  2DQG Y;  4ETE A;  2IHL A;  2A7F A;  2FYD A;  4NFV A;  5LVK A;  4UWV A;  1IX0 A;  1LHH A;  1WQO A;  1CKC A;  1BWJ A;  2YBJ A;  4WL7 A;  4B4E A;  1B7R A;  4ETB A;  4WM5 A;  5ILC A;  5F81 A;  4HSF A;  1LJK A;  2BQB A;  1B7N A;  1LSB A;  1XGU C;  2BAA A;  1IY4 A;  4NIJ A;  4H9I A;  4NWE A;  2H5Z A;  4J7V A;  3LYZ A;  1B7L A;  4LFX A;  1EQ5 A;  5KXN A;  3WUN A;  3EMS A;  4XJF A;  1G7J C;  1GB8 A;  3AGG G;  2MEH A;  3CT5 A;  4LZT A;  5DL9 A;  3WPK A;  4ET8 A;  3N9C A;  1LZN A;  1LAA A;  5B1F A;  4NGY A;  4GCE A;  3AYQ A;  1T6V L;  4HJZ A;  2BQA A;  4LT3 A;  5LA8 A;  4CFO A;  4WLD A;  1YKY X;  2D4I A;  1XFP L;  1QSA A;  4NG8 A;  1IWU A;  1HNL A;  4B4I A;  2Z38 A;  5KXW A;  1D0K A;  5KXT A;  1HC0 A;  1GE3 A;  2DBT A;  4WL6 A;  1JJ3 A;  3B0O A;  4L41 A;  4LT1 A;  1VDQ A;  1UID A;  1W08 A;  4DT3 A;  4BXD A;  1JIS A;  1HHL A;  5KXP A;  3WXT A;  2RSC A;  2LYM A;  4ETA A;  1DKK A;  2ZWB A;  4RW1 A;  1IWV A;  5EBH A;  1LSD A;  1LJ3 A;  2H9J A;  1HEP A;  3WYH A;  208L A;  2DQF C;  1LJH A;  2Z39 A;  1LZB A;  1F6R A;  2DQC Y;  3A92 A;  1YQV Y;  4KPM A;  4NGK A;  2F30 A;  1UIH A;  4NSH A;  1JUG A;  1LZR A;  1HFY A;  3A8Z A;  1QTK A;  4OOO A;  3RNX A;  2HEC A;  4ZEE A;  2I6Z A;  4ETC A;  2DKV A;  4HV2 A;  1FN5 A;  2NWD X;  1JEF A;  2D4J A;  4XJD A;  1B7O A;  1WVV A;  1IVM A;  1TCY A;  1CKG A;  1KIP C;  1UCO A;  1IR9 A;  1WQN A;  1GF0 A;  2W1X A;  2LYO A;  1C7P A;  4RW2 A;  4XJI A;  4PRU A;  4TWS A;  1C43 A;  4XJB A;  1IR8 A;  2DQH Y;  4CHX A;  1QUT A;  2XBS A;  1GB0 A;  1J1O Y;  2DQJ Y;  2C8P A;  4D9Z A;  1LPI A;  1LTM A;  3WPJ A;  1NF5 A;  1HEO A;  4C5F A;  1RJC B;  2DQA A;  1REY A;  3D2Z A;  5FST A;  4G4C A;  1HEW A;  3N9E A;  2LHM A;  1IC5 Y;  1Z55 A;  1XEI A;  1JKD A;  1GE4 A;  5E9R A;  5KXY A;  1LHK A;  5LYZ A;  2ZQ3 A;  1LSN A;  1JKC A;  3WH1 A;  2EIZ C;  1GBX A;  1IWW A;  2HEF A;  5KY1 A;  4XN6 A;  5DM9 A;  4PGJ B;  1LJJ A;  4NGI A;  1B0D A;  1DKJ A;  3WU7 A;  1GB7 A;  1VAT A;  3P68 A;  1XGT C;  2ZYP A;  4H92 A;  2DQE Y;  3A67 Y;  3BKV A;  5T3F A;  3ZVQ B;  5KXL A;  1XGP C;  1MLC E;  1HFX A;  2ZIK A;  4NGL A;  4A7D A;  1DPX A;  5LVH A;  5LXW A;  1I1Z A;  1LSP A;  3IWR A;  3A34 A;  3AZ4 A;  3TXI A;  4W94 A;  4H91 A;  4AGA A;  1BHZ A;  2Y8P A;  3TXJ A;  2Z2F A;  2MEF A;  3WMK A;  2MEE A;  4G4H A;  4H9A A;  4NWH A;  3TXD A;  1LJG A;  1VED A;  1AZF A;  1JTT L;  5DN4 A;  3TXE A;  4Z3M A;  1IP1 A;  2BQN A;  1GF6 A;  1HF4 A;  1HSX A;  2Z12 A;  1I20 A;  4DD9 A;  1HEQ A;  1NKH A;  5C6L A;  132L A;  1WVU A;  1JTO L;  3LN2 A;  1D6P A;  5C6I A;  1UIA A;  1CJ6 A;  4WLT A;  1O23 A;  1HFZ A;  2MEI A;  1DZB X;  2ZNW Y;  4DD0 A;  2BPU A;  3EO5 A;  2I25 L;  3LZ2 A;  1HEM A;  1QSW A;  1YKZ X;  4CJ2 A;  1GFT A;  3CSR A;  1HEL A;  1GF5 A;  1GAY A;  134L A;  3J6K A;  5LYM A;  1OUC A; 
#chains in the Genus database with same CATH topology
 5I4X A;  212L A;  4DD2 A;  1JTM A;  1JSE A;  1WQQ A;  4YEM A;  1BQL Y;  1LMN A;  1FLY A;  1L83 A;  3M3U A;  2H9K A;  2CDS A;  1IP3 A;  1GXX A;  4HJV A;  3HTD A;  1OQM A;  258L A;  4KXI A;  4N1C C;  1LZD A;  1D3M A;  5LVG A;  2D4K A;  4J1B A;  3EML A;  1UIC A;  1L01 A;  1FKQ A;  2ZNX Y;  1VFB C;  3B72 A;  3EXD A;  4LDL A;  2ZIL A;  2W1Y A;  1LZE A;  4XJG A;  1IP5 A;  4IAT A;  5LVJ A;  3AW6 A;  2PC2 A;  3F9L A;  3WU8 A;  3SB7 A;  163L A;  5ILF A;  3AZ7 A;  3P64 A;  4PPO A;  1IP6 A;  3J4G A;  2LYZ A;  2XBR A;  4NHS A;  1LW9 A;  1C08 C;  1JTP L;  4NSG A;  4H90 A;  2HEA A;  2GV0 A;  2BQM A;  4I7T A;  140L A;  1LZ1 A;  4IAS A;  1L10 A;  4FJR A;  5B05 A;  5LYT A;  114L A;  2F47 A;  4OWB A;  1GE2 A;  4AXT A;  1L97 A;  4J1A A;  1OUH A;  150L A;  1SSW A;  1LZC A;  4H8X A;  1W6Z A;  1KXY A;  1QQY A;  3SBB C;  4HPI A;  1TDY A;  218L A;  3C7Z A;  3E3D A;  3N9A A;  1UUZ C;  5A3E A;  3CT0 A;  3CQL A;  4NG1 A;  4I7K A;  2G4Q A;  2D6B A;  4OWA A;  4H9B A;  3HUK A;  3TMX A;  1LYI A;  5KXO A;  1L71 A;  1D0M A;  1CX7 A;  1G0Q A;  5M1Y A;  1P2R A;  1GFG A;  1GF8 A;  1INU A;  1DQJ C;  4EKS A;  3WUL A;  5B07 A;  115L A;  4TTD A;  3B6L A;  1LPY A;  1KXX A;  4GN3 A;  1YIK A;  4N0J A;  177L A;  2QB0 B;  4DWX A;  4G9S A;  1GE0 A;  1L45 A;  1LYO A;  5APE A;  1OUF A;  1B7S A;  1LHI A;  145L A;  1DPW A;  2MEA A;  3IJU A;  3VWO A;  3HDF A;  4NGW A;  4H9C A;  1IP4 A;  4GCC A;  3QAK A;  5HMV A;  1LSF A;  4GCD A;  4ML7 A;  5FDJ A;  5FEL A;  4DYG A;  1BWI A;  3GUP A;  3LYT A;  2YBN A;  2EQL A;  1RCM A;  1LLH A;  143L A;  4N9R A;  4G49 A;  5DN5 A;  4XYY A;  1J1X Y;  4NGZ A;  4OWC A;  1IIZ A;  3HT6 A;  4BS7 A;  174L A;  3L2X A;  4WOA A;  176L A;  1G7L C;  1A4V A;  230L A;  4W58 A;  4LYZ A;  4EXM A;  1L46 A;  2Q9E A;  4W51 A;  1L11 A;  3ATO A;  1GF7 A;  1B7M A;  254L A;  3OE8 A;  4WG7 A;  1FLQ A;  4B1A A;  1L19 A;  2O7A A;  4HV1 A;  1KIQ C;  1XGQ C;  2VB1 A;  1IY3 A;  1L66 A;  3OK0 A;  1XEK A;  1N4F A;  3HTF A;  1VDS A;  2HED A;  1LGX A;  122L A;  5II3 A;  2BQL A;  149L A;  1NMM A;  2BQE A;  4OWH A;  3T6U A;  4BXJ A;  1EQ4 A;  4Z98 A;  1WQM A;  2HTX A;  5IDD A;  3EBA B;  3LYO A;  4BJ4 A;  1C6K A;  3WUM A;  1B5U A;  3TMW A;  1LSA A;  1LI6 A;  4DAJ A;  3WUA A;  4NGO A;  4WM2 A;  4CGE A;  120L A;  3A3R X;  5DLA A;  235L A;  239L A;  4EJ4 A;  3HBD A;  2DQD Y;  1LJI A;  104L A;  3B0K A;  3NYA A;  1QSB A;  1DXJ A;  231L A;  4BXE A;  5L3H A;  2O4W A;  4RDS A;  3WU9 A;  1QS9 A;  4YEO A;  1L02 A;  3TXG A;  5A3Z A;  186L A;  1SWZ A;  255L A;  3HTB A;  2RB1 X;  4DKL A;  1F6S A;  1LMQ A;  3TXF A;  1BVX A;  193L A;  1IEE A;  1LZA A;  3F8V A;  1WTN A;  3AB6 A;  2IHL A;  3C8R A;  4NFV A;  4UWV A;  109L A;  1L47 A;  1NHB A;  3EMS A;  1GB8 A;  232L A;  3JR6 A;  171L A;  2O79 A;  2OU8 A;  4B4I A;  182L A;  5KXW A;  1G0G A;  1PQI A;  4WL6 A;  4LT1 A;  1UID A;  1W08 A;  3HWL A;  4E97 A;  1LYD A;  1L35 A;  2H9J A;  208L A;  2DQF C;  1L61 A;  1L12 A;  1YQV Y;  4KPM A;  4NSH A;  1JUG A;  1OVJ A;  1WTH A;  4OOO A;  220L A;  4HV2 A;  1QT6 A;  261L A;  2B6W A;  4XJD A;  1WVV A;  3C7Y A;  3C81 A;  1GF0 A;  2W1X A;  144L A;  4RW2 A;  4TWS A;  1D9W A;  1QTB A;  4W54 A;  3GUI A;  205L A;  1CV1 A;  4I7R A;  1QUT A;  2XBS A;  7LZM A;  1J1O Y;  1LPI A;  1NF5 A;  3N9E A;  237L A;  1C64 A;  1JKD A;  1L22 A;  1LHK A;  107L A;  2EIZ C;  5KY1 A;  1DKJ A;  1C6D A;  3BKV A;  1QT3 A;  5KXL A;  1XGP C;  173L A;  196L A;  1MLC E;  2B6Z A;  2ZIK A;  4A7D A;  211L A;  1LSP A;  229L A;  3A34 A;  4W94 A;  4H91 A;  4AGA A;  2Y8P A;  2Z2F A;  2MEF A;  3WMK A;  2B6X A;  2MEE A;  4G4H A;  1LJG A;  4YXC A;  3G3X A;  1IP1 A;  2BQN A;  4I7J A;  2Z12 A;  1OYU A;  1L54 A;  1WVU A;  1JTO L;  260L A;  3CDV A;  187L A;  1HFZ A;  1DYC A;  4DD0 A;  1I6S A;  1L79 A;  3LZ2 A;  172L A;  3G3V A;  1L20 A;  2OTZ X;  134L A;  4PK0 A;  161L A;  1XGT C;  1REX A;  1ZVH L;  3AZ5 A;  3QE8 A;  1L59 A;  4G4B A;  1C61 A;  224L A;  2RAY X;  1IOS A;  3W6C A;  3D3D A;  1GFU A;  2CUU A;  1YL0 X;  1H87 A;  1LJF A;  4OW1 A;  1RFP A;  1L06 A;  2RBO A;  3C7W A;  1D0L A;  1L82 A;  1LZ6 A;  3HBE X;  2FBD A;  1OV7 A;  1D3F A;  190L A;  1QTV A;  3P66 A;  4HPE A;  1L42 A;  4ZFP A;  195L A;  1CNS A;  4B0D A;  2B7X A;  3D9A C;  1C62 A;  3LZT A;  4YOP A;  1L98 A;  1L48 A;  3AJN A;  1JJ0 A;  1D6Q A;  4ET9 A;  3DN1 A;  4ARQ B;  1L64 A;  1T3P A;  4XAD A;  1HSW A;  1ZV5 L;  1GFA A;  3GUK A;  3HFM Y;  2BQH A;  1YL1 X;  1L00 A;  228L A;  2W1L A;  3W6B A;  2B70 A;  5APD A;  4DD3 A;  4ARM A;  1CU0 A;  3KAM A;  4N1E I;  1ZVY B;  4LYO A;  1JHL A;  1NBZ C;  4ANR A;  165L A;  4EPI A;  1GFK A;  5I4Y A;  4PHI A;  1OUE A;  2FYC A;  1LMC A;  138L A;  5K7O A;  1L29 A;  198L A;  233L A;  1L50 A;  4TX7 A;  4H9H A;  1KS3 A;  1QT5 A;  2BQO A;  1QUD A;  1GWD A;  1LHJ A;  5F14 A;  1KY1 A;  1C6E A;  1L80 A;  1GEV A;  5LIO A;  3QY4 A;  2CJL A;  1CV0 A;  1IOT A;  1YAN A;  1QT8 A;  1L6J A;  4LT0 A;  2BH7 A;  1L96 A;  1L60 A;  2LCB A;  2FBB A;  7LYZ A;  256L A;  3HU8 A;  4M4O A;  4NGV A;  5F16 A;  1L90 A;  1C6P A;  2B73 A;  2XTH A;  1LHM A;  3CSQ A;  3ZVQ A;  2Q0M X;  4WM4 A;  3W3E A;  1EQE A;  1GFE A;  1OWY A;  1UBZ A;  3HH4 A;  9LYZ A;  1OVH A;  1FKV A;  146L A;  221L A;  4RLN A;  1L63 A;  4H8Z A;  4LZM A;  2BQG A;  1F0W A;  1OUB A;  1CJ8 A;  1EPY A;  1GFH A;  1DYB A;  3ULR A;  1SX7 A;  2RBQ A;  4LYM A;  5D5C A;  253L A;  2BQF A;  3CDT A;  223L A;  5F9X A;  3RW8 A;  4W96 A;  1JIY A;  1IWY A;  4Z41 A;  1IOQ A;  1T8F A;  130L A;  4GCF A;  236L A;  1LZS A;  1PQK A;  5AMY A;  178L A;  1GAZ A;  3W6A A;  2WKX A;  102L A;  1DYF A;  4J0L A;  3AGH A;  2B5Z A;  1V7T A;  201L A;  4DDA A;  1YRO A;  3LHM A;  4HTN A;  4BAP A;  1B5X A;  4ARP A;  1LMT A;  1T97 A;  3DMZ A;  155L A;  2ZQ4 A;  2BQI A;  1LGU A;  1OUD A;  2MEB A;  5L9J A;  2BQD A;  3WL2 A;  2LZ2 A;  2HEE A;  1L14 A;  3WVY A;  5FEK A;  1AM7 A;  194L A;  2Z18 A;  6LYT A;  1IP2 A;  1G07 A;  240L A;  3F6Z A;  1C69 A;  4E3U A;  4YF2 A;  3AW7 A;  207L A;  1IO5 A;  2IFF Y;  2WAR A;  4R0F A;  1LSG A;  1UAC Y;  4I7P A;  2MED A;  2RBN A;  1QSQ A;  4KL7 A;  4GBR B;  1SQ2 L;  3GUO A;  1C6C A;  244L A;  4DDB A;  1UIB A;  3SB5 A;  1RI8 B;  216L A;  1NWG A;  1KNI A;  1G1V A;  1J1P Y;  1FBI X;  5J7C A;  1IC4 Y;  1LZ5 A;  8LYZ A;  1JSF A;  1YAO A;  3V2W A;  1L89 A;  4UWN A;  2HU1 A;  5D5F A;  1HEN A;  1SLY A;  1KW5 A;  1L27 A;  4LDE A;  3P4Z A;  5HNL A;  2W1M A;  2YBL A;  1L40 A;  1JIT A;  1EL1 A;  3OJP A;  1P2C C;  5KXM A;  2QAR C;  4MCK A;  3A95 A;  1L33 A;  227L A;  1ZUR A;  4O34 A;  5I5Q A;  4ZPU A;  1L44 A;  2BLY A;  2DQG Y;  4I7S A;  1CKC A;  1LYG A;  2YBJ A;  1L72 A;  1CV4 A;  1C6T A;  5ILC A;  137L A;  5F81 A;  1L81 A;  1C66 A;  1LSB A;  2BAA A;  1IY4 A;  1L67 A;  4NWE A;  4J7V A;  4LFX A;  3WPK A;  1L69 A;  5DL9 A;  4ET8 A;  1LAA A;  2BQA A;  4CFO A;  2D4I A;  3L64 A;  4NG8 A;  1IWU A;  249L A;  1HC0 A;  125L A;  126L A;  1GE3 A;  2DBT A;  1JJ3 A;  4BXD A;  1JIS A;  1HHL A;  1OV5 A;  4ETA A;  4RW1 A;  2ZWB A;  5EBH A;  3CDR A;  1LJ3 A;  1CVK A;  2NTG A;  3A92 A;  3SN6 R;  1UIH A;  1LZR A;  1L55 A;  128L A;  1KW7 A;  3DN3 A;  3RNX A;  2HEC A;  2I6Z A;  2DKV A;  1FN5 A;  2NWD X;  1JEF A;  1TCY A;  111L A;  4XJI A;  2DQH Y;  3V2Y A;  1GB0 A;  2DQJ Y;  219L A;  2C8P A;  3WPJ A;  4C5F A;  3D2Z A;  162L A;  1XEP A;  1Z55 A;  5KXY A;  1GE4 A;  1JTN A;  2ZQ3 A;  1IWW A;  1VAT A;  170L A;  2ZYP A;  3A67 Y;  169L A;  1HFX A;  4W52 A;  1QS5 A;  1I1Z A;  3TXI A;  1BHZ A;  3TXJ A;  3TXD A;  3G3W A;  234L A;  3TXE A;  215L A;  4EKP A;  1L76 A;  1HSX A;  238L A;  1HEQ A;  2OE9 X;  1L85 A;  3LN2 A;  1L18 A;  1UIA A;  242L A;  2MEI A;  1DZB X;  2ZNW Y;  2I25 L;  1QSW A;  4CJ2 A;  1GFT A;  1GF5 A;  1GAY A;  1L21 A;  248L A;  3FAD A;  1L51 A;  1OUC A;  1LMA A;  1LJE A;  1GBW A;  250L A;  1LZT A;  1JKB A;  1G1W A;  2YDG A;  1QTZ A;  160L A;  1G0M A;  1L56 A;  3SB9 A;  5KXS A;  1GBY A;  4W57 A;  3ATN A;  1IP7 A;  2HUK A;  159L A;  214L A;  1TBY A;  1L04 A;  1XJT A;  1B9O A;  1VDP A;  4DC4 A;  1LYY A;  1OUI A;  103L A;  3A3Q A;  3MGW A;  3GUN A;  4DD7 A;  4LYC A;  3HBH A;  2A7D A;  1LZG A;  3GUJ A;  1C6M A;  1B7Q A;  1CTW A;  1DI4 A;  4KT3 A;  4B49 A;  2B74 A;  2Z37 A;  1YKX X;  2BQJ A;  4WO6 A;  3SB8 A;  1KY0 A;  2YBI A;  1FDL Y;  3HDE A;  1L93 A;  1B5V A;  4HTK A;  3A6B Y;  1L34 A;  1OUG A;  1C6H A;  1E8L A;  3CSZ A;  2Q9D A;  3AZ6 A;  3HUQ A;  3DMX A;  1D2Y A;  1BGI A;  1OUA A;  1TLA A;  1L26 A;  1D9U A;  119L A;  1GBS A;  4WLX A;  2XQO A;  4W53 A;  1QTH A;  4EOF A;  3B0I A;  1A2Y C;  4ETD A;  5IEL A;  2OE4 X;  5KXZ A;  4QEQ A;  142L A;  1LZ4 A;  2ANV A;  2I26 L;  4EPF A;  1NBY C;  1MEL L;  5I4W A;  3C80 A;  209L A;  4NHP A;  1C67 A;  1WTM A;  1XSF A;  1P36 A;  4WG1 A;  4ARL A;  4NSJ A;  4YEN A;  2L78 A;  1B5Y A;  1GBZ A;  1L68 A;  166L A;  4GLA A;  5JEN B;  2RBP A;  1GE1 A;  2HU3 A;  4PRQ A;  4H93 A;  4GLV A;  5KXR A;  5LIN A;  5E4P A;  3A91 A;  4RLM A;  1GDW A;  1OWZ A;  5KXX A;  4WM3 A;  1C6L A;  5IHG A;  1C65 A;  243L A;  1L88 A;  2BQC A;  1FLW A;  5B1G A;  206L A;  1BB3 A;  3DMV A;  2F4A A;  3D2Y A;  3C8S A;  5L3I A;  4BAD A;  1LYZ A;  3A90 A;  4GRV A;  2YVB A;  3FI5 A;  1LMP A;  1B6I A;  1L58 A;  4H9F A;  3FA0 A;  1CV5 A;  1LWK A;  1RE2 A;  1T8G A;  225L A;  257L A;  4EKR A;  2D91 A;  5LZM A;  1K28 A;  1LKR A;  1CJ7 A;  4QDN A;  3GUM A;  1G7I C;  2IGC A;  1L07 A;  2Z19 A;  4G54 A;  1TEW A;  4NEB A;  3A94 A;  185L A;  1OUJ A;  4NHI A;  5KJ9 A;  247L A;  1REM A;  4Z46 A;  5HLL A;  5I53 A;  1LMO A;  1OP9 B;  1DYD A;  1JWR A;  3TMU A;  3G3A B;  1YIL A;  1L73 A;  1L38 A;  1C6A A;  1P5C A;  5HMJ A;  3CB7 A;  3A96 A;  1C45 A;  1EAK A;  1PZY A;  1LCN A;  2HUB A;  2A4T A;  3K3T A;  4XEN A;  113L A;  1P2L A;  3OE6 A;  1PS5 A;  4NHT A;  2NTH A;  1CKF A;  1NHE A;  2RAZ X;  1CU5 A;  1T8A A;  3IJV A;  3TXH A;  4I7N A;  3RUN A;  1GD6 A;  4B4J A;  4DD1 A;  199L A;  2B72 A;  4OO9 A;  217L A;  1SWY A;  1LJN A;  1L32 A;  1ALC A;  1ZYT A;  5B06 A;  1GXV 2;  1QUS A;  1WQR A;  4ARQ A;  2CWI A;  1GB2 A;  3WVX A;  1L15 A;  3D4S A;  1P64 A;  1XEJ A;  3C83 A;  3AGI A;  3SP3 A;  2ZYC A;  1LYS A;  241L A;  192L A;  1DI3 A;  2ZIJ A;  1GFJ A;  4DDC A;  1CUQ A;  1IC7 Y;  1BWH A;  4TSC A;  1LYJ A;  3TXB A;  1QUG A;  2BLX A;  1G7H C;  4R6C A;  4YXA C;  1LBU A;  5I54 A;  108L A;  129L A;  2OU9 A;  5HQ1 A;  4H94 A;  4CFP A;  5LAF A;  5C6J A;  1BB4 A;  4HTQ A;  1YAM A;  2DQI Y;  164L A;  2RB2 X;  2YBM A;  4H8Y A;  3HTG A;  1LYF A;  189L A;  2RH1 A;  3CT1 A;  1AKI A;  3LZM A;  4AQN A;  1TAY A;  1LKS A;  1LZ9 A;  3C82 A;  2OE7 X;  3OE9 A;  2C8O A;  3W6D A;  4TUN A;  1LSE A;  5LVI A;  1VAU A;  4NHQ A;  4WO9 A;  4I0C A;  1QDT A;  3G3B B;  3HU9 A;  1CJ9 A;  1G0K A;  1ZMY L;  3A93 A;  1GF4 A;  1BB6 A;  4I8S A;  4LT2 A;  3P65 A;  4N5R A;  1C10 A;  1L05 A;  5KXK A;  1G0P A;  245L A;  2AUB A;  4QGZ A;  191L A;  2OTY X;  4ETE A;  5LVK A;  1L36 A;  2FYD A;  1IX0 A;  1BWJ A;  4B4E A;  1B7R A;  4WM5 A;  4HSF A;  1LJK A;  1QTD A;  4H9I A;  5KXN A;  2H5Z A;  3WUN A;  1G7J C;  3CT5 A;  2MEH A;  4LZT A;  1LZN A;  4NGY A;  4GCE A;  1PQJ A;  3AYQ A;  4LT3 A;  4WLD A;  200L A;  1XFP L;  1QSA A;  1LGW A;  1L03 A;  1HNL A;  4K5Y A;  5KXT A;  1L53 A;  4L41 A;  1VDQ A;  1LI3 A;  123L A;  5KXP A;  2LYM A;  1L16 A;  1DKK A;  3PDS A;  1IWV A;  1L77 A;  112L A;  3PBL A;  2Z39 A;  1LJH A;  1LZB A;  1F6R A;  2DQC Y;  2F30 A;  1HFY A;  259L A;  3A8Z A;  3K2R A;  4ZEE A;  3OE0 A;  1CKG A;  252L A;  1IR9 A;  2LYO A;  1C7P A;  4XJB A;  1IR8 A;  1DYG A;  3HH3 A;  4D9Z A;  1LTM A;  1HEO A;  5FST A;  1XEI A;  1JKC A;  3WH1 A;  1CU6 A;  251L A;  1C6N A;  4IAP A;  3WU7 A;  1L94 A;  3P68 A;  5T3F A;  157L A;  1OVK A;  4NGL A;  5LXW A;  5LVH A;  3IWR A;  3AZ4 A;  1L57 A;  4H9A A;  1VED A;  1AZF A;  5DN4 A;  1GF6 A;  1I20 A;  5C6L A;  1L13 A;  5C6I A;  1O23 A;  1L87 A;  3EO5 A;  3DN6 A;  1C6I A;  3VW7 A;  3HT8 A;  1CV6 A;  1D3J A;  4LYT A;  4UWU A;  3WW6 A;  1B2K A;  4H9E A;  1L25 A;  1DYE A;  1YAP A;  110L A;  1HMK A;  1LZY A;  4FDY A;  2LZM A;  3DN2 A;  1G06 A;  1L43 A;  3LYM A;  1CKH A;  3BKH A;  3CDO A;  4OOT A;  2CGI A;  1QTE A;  4M6D A;  1L0K A;  1VDT A;  1NQI A;  1LSM A;  1GFV A;  153L A;  131L A;  3FE0 A;  1XGR C;  4LGK A;  1LSC A;  5I14 A;  1SX2 A;  1DI5 A;  3SBA A;  4MST A;  1KIR C;  4EMN A;  118L A;  3GXR A;  1GB6 A;  188L A;  1C6F A;  1IR7 A;  4II8 A;  1L75 A;  139L A;  1L09 A;  2RB0 X;  158L A;  1LSY A;  4W55 A;  1UIE A;  1C6G A;  1JKA A;  148L E;  3A6C Y;  1NDM C;  3TXK A;  4XJH A;  4LDO A;  1IOR A;  3QNG A;  4BAF A;  135L A;  1SSY A;  1L84 A;  1L37 A;  246L A;  262L A;  4BPA A;  222L A;  3C8Q A;  1KXW A;  152L A;  1NDG C;  1AT5 A;  1LJ4 A;  1QIO A;  4C3W A;  3RZ4 A;  5APF A;  4WM1 A;  1G7M C;  1I56 A;  156L A;  4DQJ A;  1ZWN A;  1REZ A;  4YM8 A;  3FI7 A;  1F10 A;  1CX6 A;  1L08 A;  3ODU A;  1LHL A;  3DKE X;  1QUO A;  1G0L A;  3WW5 A;  4GN4 A;  1UIG A;  1CU2 A;  1GHL A;  4ARJ A;  154L A;  2F2Q A;  1G0J A;  3HUA A;  4GCB A;  2G4N A;  133L A;  1L74 A;  4I7M A;  3HH6 A;  2HEB A;  5FCP A;  6LYZ A;  1LYE A;  1L52 A;  1BVK C;  4TSB A;  1LZ8 A;  2LZT A;  1FLU A;  2BQK A;  4I7O A;  1L17 A;  4HP0 A;  2F4G A;  3HT7 A;  4IJ4 A;  1BB7 A;  3ZEK A;  4H1P A;  1H6M A;  3HH5 A;  1L62 A;  1UC0 A;  3HT9 A;  4LYB A;  3RU5 A;  1GFR A;  1GBO A;  1LSZ A;  1YAQ A;  1GF3 A;  141L A;  1QTC A;  2EKS C;  2MEC A;  1GB9 A;  5APC A;  2N5Z A;  1GF9 A;  1C6B A;  1JPO A;  1L30 A;  4LPQ A;  2F2N A;  5LAG A;  2G4P A;  2EPE A;  4I7L A;  4WMG A;  4P2E A;  2LC9 A;  1C6J A;  210L A;  1IWX A;  2HUL A;  3T36 A;  1AT6 A;  3DN0 A;  1UA6 Y;  3SB6 A;  3DN4 A;  197L A;  1P3N A;  4OWE A;  1UIF A;  1QT4 A;  2X0A A;  4NSI A;  3NY9 A;  1IWZ A;  4NY5 A;  4PJ2 C;  2RBR A;  6LZM A;  1IOC A;  4X3B A;  1WQP A;  1QDR A;  3DN8 A;  1L24 A;  1BB5 A;  2B6T A;  1C63 A;  1JQU A;  1IWT A;  3W6F A;  1JJ1 A;  3GUL A;  4EKQ A;  5FHW A;  3WXU A;  1D2W A;  1GB5 A;  1L92 A;  2MEG A;  1QUH A;  3W6E A;  5KKI A;  1L41 A;  3GXK A;  1P7S A;  4NGJ A;  1L95 A;  1QT7 A;  1V7S A;  1P37 A;  1HER A;  2XJW A;  4BOL A;  2YSS C;  5B59 A;  3M18 B;  1PQM A;  1B5Z A;  213L A;  127L A;  3WPL A;  2F32 A;  5LA5 A;  2YBH A;  1CUP A;  1GEZ A;  3NY8 A;  3RT5 X;  3CDQ A;  1C68 A;  4U3X B;  1L39 A;  1L70 A;  4WLY A;  4GN5 C;  3UON A;  5KKJ A;  1GDX A;  1GPQ C;  4HJY A;  4LFP A;  1GB3 A;  2Z2E A;  4WM6 A;  3TMV A;  1B5W A;  1DYA A;  1HML A;  1CV3 A;  4QY9 A;  1PQD A;  4DJH A;  4N8Z A;  5HNC A;  1CKD A;  1B7P A;  1C46 A;  151L A;  4MR1 A;  1CU3 A;  2B75 A;  1L91 A;  4ZIX A;  1LOZ A;  2A7F A;  1LHH A;  1WQO A;  1P56 A;  4WL7 A;  4ETB A;  1L23 A;  2BQB A;  1B7N A;  1XGU C;  3RZE A;  4NIJ A;  4DQ7 A;  3LYZ A;  1B7L A;  1EQ5 A;  4XJF A;  3AGG G;  147L A;  183L A;  3N9C A;  5B1F A;  5LA8 A;  1T6V L;  4HJZ A;  4W59 A;  1YKY X;  4PJZ A;  2Z38 A;  2ANX A;  1D0K A;  4ARM B;  4YX7 C;  226L A;  3B0O A;  4DT3 A;  180L A;  1L0J A;  2OEA X;  3WXT A;  2RSC A;  1LSD A;  2Z6B A;  1HEP A;  3WYH A;  4NGK A;  1P46 A;  1QTK A;  1LI2 A;  1T6H A;  167L A;  1L31 A;  4ETC A;  4S0W A;  2D4J A;  1B7O A;  1L86 A;  1IVM A;  1D3N A;  1KIP C;  1UCO A;  1WQN A;  4PRU A;  4DQ5 A;  1C43 A;  4CHX A;  1XJU A;  1L99 A;  4I7Q A;  1RJC B;  2DQA A;  1REY A;  4G4C A;  1HEW A;  1L28 A;  2LHM A;  2RBS A;  1IC5 Y;  5E9R A;  5LYZ A;  1LSN A;  1GBX A;  175L A;  2HEF A;  4XN6 A;  5DM9 A;  4PGJ B;  1LJJ A;  4NGI A;  1B0D A;  1LYH A;  1GB7 A;  4H92 A;  2DQE Y;  3DNA A;  3ZVQ B;  4W56 A;  1DPX A;  1PQO A;  1L49 A;  181L A;  4NWH A;  1JTT L;  4Z3M A;  1HF4 A;  184L A;  4DD9 A;  1NKH A;  2OU0 X;  132L A;  2HUM A;  1L65 A;  1D6P A;  1C6Q A;  2B6Y A;  1CJ6 A;  4WLT A;  1LWG A;  2BPU A;  1HEM A;  1YKZ X;  3CSR A;  1C60 A;  1HEL A;  168L A;  1P6Y A;  3J6K A;  5LYM A;  5F9U A; 
#chains in the Genus database with same CATH homology
 5I4X A;  212L A;  4DD2 A;  1JTM A;  1JSE A;  1WQQ A;  4YEM A;  1BQL Y;  1LMN A;  1FLY A;  1L83 A;  3M3U A;  2H9K A;  2CDS A;  1IP3 A;  1GXX A;  4HJV A;  3HTD A;  1OQM A;  258L A;  4KXI A;  4N1C C;  1LZD A;  1D3M A;  5LVG A;  2D4K A;  4J1B A;  3EML A;  1UIC A;  1L01 A;  1FKQ A;  2ZNX Y;  1VFB C;  3B72 A;  3EXD A;  4LDL A;  2ZIL A;  2W1Y A;  1LZE A;  4XJG A;  1IP5 A;  4IAT A;  5LVJ A;  3AW6 A;  2PC2 A;  3F9L A;  3WU8 A;  3SB7 A;  163L A;  5ILF A;  3AZ7 A;  3P64 A;  4PPO A;  1IP6 A;  3J4G A;  2LYZ A;  2XBR A;  4NHS A;  1LW9 A;  1C08 C;  1JTP L;  4NSG A;  4H90 A;  2HEA A;  2GV0 A;  2BQM A;  4I7T A;  140L A;  1LZ1 A;  4IAS A;  1L10 A;  4FJR A;  5B05 A;  5LYT A;  114L A;  2F47 A;  4OWB A;  1GE2 A;  4AXT A;  1L97 A;  4J1A A;  1OUH A;  150L A;  1SSW A;  1LZC A;  4H8X A;  1W6Z A;  1KXY A;  1QQY A;  3SBB C;  4HPI A;  1TDY A;  218L A;  3C7Z A;  3E3D A;  3N9A A;  1UUZ C;  5A3E A;  3CT0 A;  3CQL A;  4NG1 A;  4I7K A;  2G4Q A;  2D6B A;  4OWA A;  4H9B A;  3HUK A;  3TMX A;  1LYI A;  5KXO A;  1L71 A;  1D0M A;  1CX7 A;  1G0Q A;  5M1Y A;  1P2R A;  1GFG A;  1GF8 A;  1INU A;  1DQJ C;  4EKS A;  3WUL A;  5B07 A;  115L A;  4TTD A;  3B6L A;  1LPY A;  1KXX A;  4GN3 A;  1YIK A;  4N0J A;  177L A;  2QB0 B;  4DWX A;  4G9S A;  1GE0 A;  1L45 A;  1LYO A;  5APE A;  1OUF A;  1B7S A;  1LHI A;  145L A;  1DPW A;  2MEA A;  3IJU A;  3VWO A;  3HDF A;  4NGW A;  4H9C A;  1IP4 A;  4GCC A;  3QAK A;  5HMV A;  1LSF A;  4GCD A;  4ML7 A;  5FDJ A;  5FEL A;  4DYG A;  1BWI A;  3GUP A;  3LYT A;  2YBN A;  2EQL A;  1RCM A;  1LLH A;  143L A;  4N9R A;  4G49 A;  5DN5 A;  4XYY A;  1J1X Y;  4NGZ A;  4OWC A;  1IIZ A;  3HT6 A;  4BS7 A;  174L A;  3L2X A;  4WOA A;  176L A;  1G7L C;  1A4V A;  230L A;  4W58 A;  4LYZ A;  4EXM A;  1L46 A;  2Q9E A;  4W51 A;  1L11 A;  3ATO A;  1GF7 A;  1B7M A;  254L A;  3OE8 A;  4WG7 A;  1FLQ A;  4B1A A;  1L19 A;  2O7A A;  4HV1 A;  1KIQ C;  1XGQ C;  2VB1 A;  1IY3 A;  1L66 A;  3OK0 A;  1XEK A;  1N4F A;  3HTF A;  1VDS A;  2HED A;  1LGX A;  122L A;  5II3 A;  2BQL A;  149L A;  1NMM A;  2BQE A;  4OWH A;  3T6U A;  4BXJ A;  1EQ4 A;  4Z98 A;  1WQM A;  2HTX A;  5IDD A;  3EBA B;  3LYO A;  4BJ4 A;  1C6K A;  3WUM A;  1B5U A;  3TMW A;  1LSA A;  1LI6 A;  4DAJ A;  3WUA A;  4NGO A;  4WM2 A;  4CGE A;  120L A;  3A3R X;  5DLA A;  235L A;  239L A;  4EJ4 A;  3HBD A;  2DQD Y;  1LJI A;  104L A;  3B0K A;  3NYA A;  1QSB A;  1DXJ A;  231L A;  4BXE A;  5L3H A;  2O4W A;  4RDS A;  3WU9 A;  1QS9 A;  4YEO A;  1L02 A;  3TXG A;  5A3Z A;  186L A;  1SWZ A;  255L A;  3HTB A;  2RB1 X;  4DKL A;  1F6S A;  1LMQ A;  3TXF A;  1BVX A;  193L A;  1IEE A;  1LZA A;  3F8V A;  1WTN A;  3AB6 A;  2IHL A;  3C8R A;  4NFV A;  4UWV A;  109L A;  1L47 A;  1NHB A;  3EMS A;  1GB8 A;  232L A;  3JR6 A;  171L A;  2O79 A;  2OU8 A;  4B4I A;  182L A;  5KXW A;  1G0G A;  1PQI A;  4WL6 A;  4LT1 A;  1UID A;  1W08 A;  3HWL A;  4E97 A;  1LYD A;  1L35 A;  2H9J A;  208L A;  2DQF C;  1L61 A;  1L12 A;  1YQV Y;  4KPM A;  4NSH A;  1JUG A;  1OVJ A;  1WTH A;  4OOO A;  220L A;  4HV2 A;  1QT6 A;  261L A;  2B6W A;  4XJD A;  1WVV A;  3C7Y A;  3C81 A;  1GF0 A;  2W1X A;  144L A;  4RW2 A;  4TWS A;  1D9W A;  1QTB A;  4W54 A;  3GUI A;  205L A;  1CV1 A;  4I7R A;  1QUT A;  2XBS A;  7LZM A;  1J1O Y;  1LPI A;  1NF5 A;  3N9E A;  237L A;  1C64 A;  1JKD A;  1L22 A;  1LHK A;  107L A;  2EIZ C;  5KY1 A;  1DKJ A;  1C6D A;  3BKV A;  1QT3 A;  5KXL A;  1XGP C;  173L A;  196L A;  1MLC E;  2B6Z A;  2ZIK A;  4A7D A;  211L A;  1LSP A;  229L A;  3A34 A;  4W94 A;  4H91 A;  4AGA A;  2Y8P A;  2Z2F A;  2MEF A;  3WMK A;  2B6X A;  2MEE A;  4G4H A;  1LJG A;  4YXC A;  3G3X A;  1IP1 A;  2BQN A;  4I7J A;  2Z12 A;  1OYU A;  1L54 A;  1WVU A;  1JTO L;  260L A;  3CDV A;  187L A;  1HFZ A;  1DYC A;  4DD0 A;  1I6S A;  1L79 A;  3LZ2 A;  172L A;  3G3V A;  1L20 A;  2OTZ X;  134L A;  4PK0 A;  161L A;  1XGT C;  1REX A;  1ZVH L;  3AZ5 A;  3QE8 A;  1L59 A;  4G4B A;  1C61 A;  224L A;  2RAY X;  1IOS A;  3W6C A;  3D3D A;  1GFU A;  2CUU A;  1YL0 X;  1H87 A;  1LJF A;  4OW1 A;  1RFP A;  1L06 A;  2RBO A;  3C7W A;  1D0L A;  1L82 A;  1LZ6 A;  3HBE X;  2FBD A;  1OV7 A;  1D3F A;  190L A;  1QTV A;  3P66 A;  4HPE A;  1L42 A;  4ZFP A;  195L A;  1CNS A;  4B0D A;  2B7X A;  3D9A C;  1C62 A;  3LZT A;  4YOP A;  1L98 A;  1L48 A;  3AJN A;  1JJ0 A;  1D6Q A;  4ET9 A;  3DN1 A;  4ARQ B;  1L64 A;  1T3P A;  4XAD A;  1HSW A;  1ZV5 L;  1GFA A;  3GUK A;  3HFM Y;  2BQH A;  1YL1 X;  1L00 A;  228L A;  2W1L A;  3W6B A;  2B70 A;  5APD A;  4DD3 A;  4ARM A;  1CU0 A;  3KAM A;  4N1E I;  1ZVY B;  4LYO A;  1JHL A;  1NBZ C;  4ANR A;  165L A;  4EPI A;  1GFK A;  5I4Y A;  4PHI A;  1OUE A;  2FYC A;  1LMC A;  138L A;  5K7O A;  1L29 A;  198L A;  233L A;  1L50 A;  4TX7 A;  4H9H A;  1KS3 A;  1QT5 A;  2BQO A;  1QUD A;  1GWD A;  1LHJ A;  5F14 A;  1KY1 A;  1C6E A;  1L80 A;  1GEV A;  5LIO A;  3QY4 A;  2CJL A;  1CV0 A;  1IOT A;  1YAN A;  1QT8 A;  1L6J A;  4LT0 A;  2BH7 A;  1L96 A;  1L60 A;  2LCB A;  2FBB A;  7LYZ A;  256L A;  3HU8 A;  4M4O A;  4NGV A;  5F16 A;  1L90 A;  1C6P A;  2B73 A;  2XTH A;  1LHM A;  3CSQ A;  3ZVQ A;  2Q0M X;  4WM4 A;  3W3E A;  1EQE A;  1GFE A;  1OWY A;  1UBZ A;  3HH4 A;  9LYZ A;  1OVH A;  1FKV A;  146L A;  221L A;  4RLN A;  1L63 A;  4H8Z A;  4LZM A;  2BQG A;  1F0W A;  1OUB A;  1CJ8 A;  1EPY A;  1GFH A;  1DYB A;  3ULR A;  1SX7 A;  2RBQ A;  4LYM A;  5D5C A;  253L A;  2BQF A;  3CDT A;  223L A;  5F9X A;  3RW8 A;  4W96 A;  1JIY A;  1IWY A;  4Z41 A;  1IOQ A;  1T8F A;  130L A;  4GCF A;  236L A;  1LZS A;  1PQK A;  5AMY A;  178L A;  1GAZ A;  3W6A A;  2WKX A;  102L A;  1DYF A;  4J0L A;  3AGH A;  2B5Z A;  1V7T A;  201L A;  4DDA A;  1YRO A;  3LHM A;  4HTN A;  4BAP A;  1B5X A;  4ARP A;  1LMT A;  1T97 A;  3DMZ A;  155L A;  2ZQ4 A;  2BQI A;  1LGU A;  1OUD A;  2MEB A;  5L9J A;  2BQD A;  3WL2 A;  2LZ2 A;  2HEE A;  1L14 A;  3WVY A;  5FEK A;  1AM7 A;  194L A;  2Z18 A;  6LYT A;  1IP2 A;  1G07 A;  240L A;  3F6Z A;  1C69 A;  4E3U A;  4YF2 A;  3AW7 A;  207L A;  1IO5 A;  2IFF Y;  2WAR A;  4R0F A;  1LSG A;  1UAC Y;  4I7P A;  2MED A;  2RBN A;  1QSQ A;  4KL7 A;  4GBR B;  1SQ2 L;  3GUO A;  1C6C A;  244L A;  4DDB A;  1UIB A;  3SB5 A;  1RI8 B;  216L A;  1NWG A;  1KNI A;  1G1V A;  1J1P Y;  1FBI X;  5J7C A;  1IC4 Y;  1LZ5 A;  8LYZ A;  1JSF A;  1YAO A;  3V2W A;  1L89 A;  4UWN A;  2HU1 A;  5D5F A;  1HEN A;  1SLY A;  1KW5 A;  1L27 A;  4LDE A;  3P4Z A;  5HNL A;  2W1M A;  2YBL A;  1L40 A;  1JIT A;  1EL1 A;  3OJP A;  1P2C C;  5KXM A;  2QAR C;  4MCK A;  3A95 A;  1L33 A;  227L A;  1ZUR A;  4O34 A;  5I5Q A;  4ZPU A;  1L44 A;  2BLY A;  2DQG Y;  4I7S A;  1CKC A;  1LYG A;  2YBJ A;  1L72 A;  1CV4 A;  1C6T A;  5ILC A;  137L A;  5F81 A;  1L81 A;  1C66 A;  1LSB A;  2BAA A;  1IY4 A;  1L67 A;  4NWE A;  4J7V A;  4LFX A;  3WPK A;  1L69 A;  5DL9 A;  4ET8 A;  1LAA A;  2BQA A;  4CFO A;  2D4I A;  3L64 A;  4NG8 A;  1IWU A;  249L A;  1HC0 A;  125L A;  126L A;  1GE3 A;  2DBT A;  1JJ3 A;  4BXD A;  1JIS A;  1HHL A;  1OV5 A;  4ETA A;  4RW1 A;  2ZWB A;  5EBH A;  3CDR A;  1LJ3 A;  1CVK A;  2NTG A;  3A92 A;  3SN6 R;  1UIH A;  1LZR A;  1L55 A;  128L A;  1KW7 A;  3DN3 A;  3RNX A;  2HEC A;  2I6Z A;  2DKV A;  1FN5 A;  2NWD X;  1JEF A;  1TCY A;  111L A;  4XJI A;  2DQH Y;  3V2Y A;  1GB0 A;  2DQJ Y;  219L A;  2C8P A;  3WPJ A;  4C5F A;  3D2Z A;  162L A;  1XEP A;  1Z55 A;  5KXY A;  1GE4 A;  1JTN A;  2ZQ3 A;  1IWW A;  1VAT A;  170L A;  2ZYP A;  3A67 Y;  169L A;  1HFX A;  4W52 A;  1QS5 A;  1I1Z A;  3TXI A;  1BHZ A;  3TXJ A;  3TXD A;  3G3W A;  234L A;  3TXE A;  215L A;  4EKP A;  1L76 A;  1HSX A;  238L A;  1HEQ A;  2OE9 X;  1L85 A;  3LN2 A;  1L18 A;  1UIA A;  242L A;  2MEI A;  1DZB X;  2ZNW Y;  2I25 L;  1QSW A;  4CJ2 A;  1GFT A;  1GF5 A;  1GAY A;  1L21 A;  248L A;  3FAD A;  1L51 A;  1OUC A;  1LMA A;  1LJE A;  1GBW A;  250L A;  1LZT A;  1JKB A;  1G1W A;  2YDG A;  1QTZ A;  160L A;  1G0M A;  1L56 A;  3SB9 A;  5KXS A;  1GBY A;  4W57 A;  3ATN A;  1IP7 A;  2HUK A;  159L A;  214L A;  1TBY A;  1L04 A;  1XJT A;  1B9O A;  1VDP A;  4DC4 A;  1LYY A;  1OUI A;  103L A;  3A3Q A;  3MGW A;  3GUN A;  4DD7 A;  4LYC A;  3HBH A;  2A7D A;  1LZG A;  3GUJ A;  1C6M A;  1B7Q A;  1CTW A;  1DI4 A;  4KT3 A;  4B49 A;  2B74 A;  2Z37 A;  1YKX X;  2BQJ A;  4WO6 A;  3SB8 A;  1KY0 A;  2YBI A;  1FDL Y;  3HDE A;  1L93 A;  1B5V A;  4HTK A;  3A6B Y;  1L34 A;  1OUG A;  1C6H A;  1E8L A;  3CSZ A;  2Q9D A;  3AZ6 A;  3HUQ A;  3DMX A;  1D2Y A;  1BGI A;  1OUA A;  1TLA A;  1L26 A;  1D9U A;  119L A;  1GBS A;  4WLX A;  2XQO A;  4W53 A;  1QTH A;  4EOF A;  3B0I A;  1A2Y C;  4ETD A;  5IEL A;  2OE4 X;  5KXZ A;  4QEQ A;  142L A;  1LZ4 A;  2ANV A;  2I26 L;  4EPF A;  1NBY C;  1MEL L;  5I4W A;  3C80 A;  209L A;  4NHP A;  1C67 A;  1WTM A;  1XSF A;  1P36 A;  4WG1 A;  4ARL A;  4NSJ A;  4YEN A;  2L78 A;  1B5Y A;  1GBZ A;  1L68 A;  166L A;  4GLA A;  5JEN B;  2RBP A;  1GE1 A;  2HU3 A;  4PRQ A;  4H93 A;  4GLV A;  5KXR A;  5LIN A;  5E4P A;  3A91 A;  4RLM A;  1GDW A;  1OWZ A;  5KXX A;  4WM3 A;  1C6L A;  5IHG A;  1C65 A;  243L A;  1L88 A;  2BQC A;  1FLW A;  5B1G A;  206L A;  1BB3 A;  3DMV A;  2F4A A;  3D2Y A;  3C8S A;  5L3I A;  4BAD A;  1LYZ A;  3A90 A;  4GRV A;  2YVB A;  3FI5 A;  1LMP A;  1B6I A;  1L58 A;  4H9F A;  3FA0 A;  1CV5 A;  1LWK A;  1RE2 A;  1T8G A;  225L A;  257L A;  4EKR A;  2D91 A;  5LZM A;  1K28 A;  1LKR A;  1CJ7 A;  4QDN A;  3GUM A;  1G7I C;  2IGC A;  1L07 A;  2Z19 A;  4G54 A;  1TEW A;  4NEB A;  3A94 A;  185L A;  1OUJ A;  4NHI A;  5KJ9 A;  247L A;  1REM A;  4Z46 A;  5HLL A;  5I53 A;  1LMO A;  1OP9 B;  1DYD A;  1JWR A;  3TMU A;  3G3A B;  1YIL A;  1L73 A;  1L38 A;  1C6A A;  1P5C A;  5HMJ A;  3CB7 A;  3A96 A;  1C45 A;  1EAK A;  1PZY A;  1LCN A;  2HUB A;  2A4T A;  3K3T A;  4XEN A;  113L A;  1P2L A;  3OE6 A;  1PS5 A;  4NHT A;  2NTH A;  1CKF A;  1NHE A;  2RAZ X;  1CU5 A;  1T8A A;  3IJV A;  3TXH A;  4I7N A;  3RUN A;  1GD6 A;  4B4J A;  4DD1 A;  199L A;  2B72 A;  4OO9 A;  217L A;  1SWY A;  1LJN A;  1L32 A;  1ALC A;  1ZYT A;  5B06 A;  1GXV 2;  1QUS A;  1WQR A;  4ARQ A;  2CWI A;  1GB2 A;  3WVX A;  1L15 A;  3D4S A;  1P64 A;  1XEJ A;  3C83 A;  3AGI A;  3SP3 A;  2ZYC A;  1LYS A;  241L A;  192L A;  1DI3 A;  2ZIJ A;  1GFJ A;  4DDC A;  1CUQ A;  1IC7 Y;  1BWH A;  4TSC A;  1LYJ A;  3TXB A;  1QUG A;  2BLX A;  1G7H C;  4R6C A;  4YXA C;  1LBU A;  5I54 A;  108L A;  129L A;  2OU9 A;  5HQ1 A;  4H94 A;  4CFP A;  5LAF A;  5C6J A;  1BB4 A;  4HTQ A;  1YAM A;  2DQI Y;  164L A;  2RB2 X;  2YBM A;  4H8Y A;  3HTG A;  1LYF A;  189L A;  2RH1 A;  3CT1 A;  1AKI A;  3LZM A;  4AQN A;  1TAY A;  1LKS A;  1LZ9 A;  3C82 A;  2OE7 X;  3OE9 A;  2C8O A;  3W6D A;  4TUN A;  1LSE A;  5LVI A;  1VAU A;  4NHQ A;  4WO9 A;  4I0C A;  1QDT A;  3G3B B;  3HU9 A;  1CJ9 A;  1G0K A;  1ZMY L;  3A93 A;  1GF4 A;  1BB6 A;  4I8S A;  4LT2 A;  3P65 A;  4N5R A;  1C10 A;  1L05 A;  5KXK A;  1G0P A;  245L A;  2AUB A;  4QGZ A;  191L A;  2OTY X;  4ETE A;  5LVK A;  1L36 A;  2FYD A;  1IX0 A;  1BWJ A;  4B4E A;  1B7R A;  4WM5 A;  4HSF A;  1LJK A;  1QTD A;  4H9I A;  5KXN A;  2H5Z A;  3WUN A;  1G7J C;  3CT5 A;  2MEH A;  4LZT A;  1LZN A;  4NGY A;  4GCE A;  1PQJ A;  3AYQ A;  4LT3 A;  4WLD A;  200L A;  1XFP L;  1QSA A;  1LGW A;  1L03 A;  1HNL A;  4K5Y A;  5KXT A;  1L53 A;  4L41 A;  1VDQ A;  1LI3 A;  123L A;  5KXP A;  2LYM A;  1L16 A;  1DKK A;  3PDS A;  1IWV A;  1L77 A;  112L A;  3PBL A;  2Z39 A;  1LJH A;  1LZB A;  1F6R A;  2DQC Y;  2F30 A;  1HFY A;  259L A;  3A8Z A;  3K2R A;  4ZEE A;  3OE0 A;  1CKG A;  252L A;  1IR9 A;  2LYO A;  1C7P A;  4XJB A;  1IR8 A;  1DYG A;  3HH3 A;  4D9Z A;  1LTM A;  1HEO A;  5FST A;  1XEI A;  1JKC A;  3WH1 A;  1CU6 A;  251L A;  1C6N A;  4IAP A;  3WU7 A;  1L94 A;  3P68 A;  5T3F A;  157L A;  1OVK A;  4NGL A;  5LXW A;  5LVH A;  3IWR A;  3AZ4 A;  1L57 A;  4H9A A;  1VED A;  1AZF A;  5DN4 A;  1GF6 A;  1I20 A;  5C6L A;  1L13 A;  5C6I A;  1O23 A;  1L87 A;  3EO5 A;  3DN6 A;  1C6I A;  3VW7 A;  3HT8 A;  1CV6 A;  1D3J A;  4LYT A;  4UWU A;  3WW6 A;  1B2K A;  4H9E A;  1L25 A;  1DYE A;  1YAP A;  110L A;  1HMK A;  1LZY A;  4FDY A;  2LZM A;  3DN2 A;  1G06 A;  1L43 A;  3LYM A;  1CKH A;  3BKH A;  3CDO A;  4OOT A;  2CGI A;  1QTE A;  4M6D A;  1L0K A;  1VDT A;  1NQI A;  1LSM A;  1GFV A;  153L A;  131L A;  3FE0 A;  1XGR C;  4LGK A;  1LSC A;  5I14 A;  1SX2 A;  1DI5 A;  3SBA A;  4MST A;  1KIR C;  4EMN A;  118L A;  3GXR A;  1GB6 A;  188L A;  1C6F A;  1IR7 A;  4II8 A;  1L75 A;  139L A;  1L09 A;  2RB0 X;  158L A;  1LSY A;  4W55 A;  1UIE A;  1C6G A;  1JKA A;  148L E;  3A6C Y;  1NDM C;  3TXK A;  4XJH A;  4LDO A;  1IOR A;  3QNG A;  4BAF A;  135L A;  1SSY A;  1L84 A;  1L37 A;  246L A;  262L A;  4BPA A;  222L A;  3C8Q A;  1KXW A;  152L A;  1NDG C;  1AT5 A;  1LJ4 A;  1QIO A;  4C3W A;  3RZ4 A;  5APF A;  4WM1 A;  1G7M C;  1I56 A;  156L A;  4DQJ A;  1ZWN A;  1REZ A;  4YM8 A;  3FI7 A;  1F10 A;  1CX6 A;  1L08 A;  3ODU A;  1LHL A;  3DKE X;  1QUO A;  1G0L A;  3WW5 A;  4GN4 A;  1UIG A;  1CU2 A;  1GHL A;  4ARJ A;  154L A;  2F2Q A;  1G0J A;  3HUA A;  4GCB A;  2G4N A;  133L A;  1L74 A;  4I7M A;  3HH6 A;  2HEB A;  5FCP A;  6LYZ A;  1LYE A;  1L52 A;  1BVK C;  4TSB A;  1LZ8 A;  2LZT A;  1FLU A;  2BQK A;  4I7O A;  1L17 A;  4HP0 A;  2F4G A;  3HT7 A;  4IJ4 A;  1BB7 A;  3ZEK A;  4H1P A;  1H6M A;  3HH5 A;  1L62 A;  1UC0 A;  3HT9 A;  4LYB A;  3RU5 A;  1GFR A;  1GBO A;  1LSZ A;  1YAQ A;  1GF3 A;  141L A;  1QTC A;  2EKS C;  2MEC A;  1GB9 A;  5APC A;  2N5Z A;  1GF9 A;  1C6B A;  1JPO A;  1L30 A;  4LPQ A;  2F2N A;  5LAG A;  2G4P A;  2EPE A;  4I7L A;  4WMG A;  4P2E A;  2LC9 A;  1C6J A;  210L A;  1IWX A;  2HUL A;  3T36 A;  1AT6 A;  3DN0 A;  1UA6 Y;  3SB6 A;  3DN4 A;  197L A;  1P3N A;  4OWE A;  1UIF A;  1QT4 A;  2X0A A;  4NSI A;  3NY9 A;  1IWZ A;  4NY5 A;  4PJ2 C;  2RBR A;  6LZM A;  1IOC A;  4X3B A;  1WQP A;  1QDR A;  3DN8 A;  1L24 A;  1BB5 A;  2B6T A;  1C63 A;  1JQU A;  1IWT A;  3W6F A;  1JJ1 A;  3GUL A;  4EKQ A;  5FHW A;  3WXU A;  1D2W A;  1GB5 A;  1L92 A;  2MEG A;  1QUH A;  3W6E A;  5KKI A;  1L41 A;  3GXK A;  1P7S A;  4NGJ A;  1L95 A;  1QT7 A;  1V7S A;  1P37 A;  1HER A;  2XJW A;  4BOL A;  2YSS C;  5B59 A;  3M18 B;  1PQM A;  1B5Z A;  213L A;  127L A;  3WPL A;  2F32 A;  5LA5 A;  2YBH A;  1CUP A;  1GEZ A;  3NY8 A;  3RT5 X;  3CDQ A;  1C68 A;  4U3X B;  1L39 A;  1L70 A;  4WLY A;  4GN5 C;  3UON A;  5KKJ A;  1GDX A;  1GPQ C;  4HJY A;  4LFP A;  1GB3 A;  2Z2E A;  4WM6 A;  3TMV A;  1B5W A;  1DYA A;  1HML A;  1CV3 A;  4QY9 A;  1PQD A;  4DJH A;  4N8Z A;  5HNC A;  1CKD A;  1B7P A;  1C46 A;  151L A;  4MR1 A;  1CU3 A;  2B75 A;  1L91 A;  4ZIX A;  1LOZ A;  2A7F A;  1LHH A;  1WQO A;  1P56 A;  4WL7 A;  4ETB A;  1L23 A;  2BQB A;  1B7N A;  1XGU C;  3RZE A;  4NIJ A;  4DQ7 A;  3LYZ A;  1B7L A;  1EQ5 A;  4XJF A;  3AGG G;  147L A;  183L A;  3N9C A;  5B1F A;  5LA8 A;  1T6V L;  4HJZ A;  4W59 A;  1YKY X;  4PJZ A;  2Z38 A;  2ANX A;  1D0K A;  4ARM B;  4YX7 C;  226L A;  3B0O A;  4DT3 A;  180L A;  1L0J A;  2OEA X;  3WXT A;  2RSC A;  1LSD A;  2Z6B A;  1HEP A;  3WYH A;  4NGK A;  1P46 A;  1QTK A;  1LI2 A;  1T6H A;  167L A;  1L31 A;  4ETC A;  4S0W A;  2D4J A;  1B7O A;  1L86 A;  1IVM A;  1D3N A;  1KIP C;  1UCO A;  1WQN A;  4PRU A;  4DQ5 A;  1C43 A;  4CHX A;  1XJU A;  1L99 A;  4I7Q A;  1RJC B;  2DQA A;  1REY A;  4G4C A;  1HEW A;  1L28 A;  2LHM A;  2RBS A;  1IC5 Y;  5E9R A;  5LYZ A;  1LSN A;  1GBX A;  175L A;  2HEF A;  4XN6 A;  5DM9 A;  4PGJ B;  1LJJ A;  4NGI A;  1B0D A;  1LYH A;  1GB7 A;  4H92 A;  2DQE Y;  3DNA A;  3ZVQ B;  4W56 A;  1DPX A;  1PQO A;  1L49 A;  181L A;  4NWH A;  1JTT L;  4Z3M A;  1HF4 A;  184L A;  4DD9 A;  1NKH A;  2OU0 X;  132L A;  2HUM A;  1L65 A;  1D6P A;  1C6Q A;  2B6Y A;  1CJ6 A;  4WLT A;  1LWG A;  2BPU A;  1HEM A;  1YKZ X;  3CSR A;  1C60 A;  1HEL A;  168L A;  1P6Y A;  3J6K A;  5LYM A;  5F9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...