3BKJH

Crystal structure of fab wo2 bound to the n terminal domain of amyloid beta peptide (1-16)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
224
structure length
224
Chain Sequence
VTLKESGPGLLKPSQTLSLTCSFSGFSIRTSKVGVSWIRQPSGKGLEWLAHIYWDDDKRYNPSLESRLTISKDTSRDMVFMKITSVDTADTATYYCARRGFYGRKYEVNHFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSESITCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Amyloid-beta-anti-amyloid-beta complex structure reveals an extended conformation in the immunodominant B-cell epitope.
pubmed doi rcsb
molecule tags Immune system
molecule keywords WO2 IgG2a Fab fragment Light Chain Kappa
total genus 46
structure length 224
sequence length 224
ec nomenclature
pdb deposition date 2007-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bkjH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bkjH01
1YEHH 4XPTH 1T22A 2D03L 5D7JA 1GIGH 3LKOA 4MNHB 5E2VH 5C0GA 4CVWA 2UY6A 4PREA 4W68A 3I75B 4K55A 2I5YL 3S8WA 3FAXA 4PGJA 2HT4C 3JBG7 4NNPH 3G6JF 1TPXB 3LV3B 1CTNA 5JPMB 4FQJH 4KAQL 5LGHL 4PRNB 1WZKA 4OCXL 1WTLA 2CDGB 3MRDB 4P5KA 1B0RB 2WP3O 5I2IB 3MOAL 3VE0B 4X4ME 3TPUB 1TVBB 5I1HL 2APTA 4IOFC 5HYSG 4A6YB 2YEZA 3MRBA 2DDQH 1GAFH 2BRQA 1RU9H 3RTQC 2J6EL 3HZKB 4EUPG 4NQDD 4WW1B 2YD1A 4BH7B 2YK1H 2B4CH 4ZNEA 1BF8A 3GGWB 4XNYH 2XTJB 4CVXA 5M95B 4WFGD 3AS3A 5D7KE 3L3HA 3GJEB 3DROB 2BOCA 1N26A 2PCPA 1PYWB 2IG2H 4FXGB 1JGEA 4ZUUB 1C12B 1FFRA 1CFBA 5EOTA 4J4PA 2OJZL 3SGJC 2EYTA 2BSRA 1NGWB 4YC2C 1A6VH 1HQ4A 4YHNA 2AEPH 2ADJB 2Z91B 3ALPA 2VDLH 2DI9A 1ZA3B 4BELD 3OTTA 3HFML 3ALWA 4LPYA 2HMIC 5E00A 4Y4KD 1T6WA 2ZUTA 1ZLWH 3WS3A 4ZUSB 3MBXL 4AM0B 4Q9RH 1IEHA 1XF4B 5B21A 3HC0A 2VL4A 1XGUA 4JY5L 5J0BA 1S7WA 3P0GB 2ZCLL 2PO6C 4D2NA 4ONHA 3E6HB 1NGPH 1F6AB 1BQHG 1J05B 2D2OA 1FVCB 2N7BA 1VEPA 4HAFA 4P59L 1ZLSL 3IFNH 3RBSA 1GCFA 2XN9D 1RZ8B 4MLIA 4EZMA 2BFVL 3OAUH 4PREB 2MNUA 5JOFB 5HGHB 1QBMH 1XEDA 3TNNB 2G2RA 3TVMD 2X4RB 4HS8L 1T2QL 1X5HA 2MHAA 4UT6H 4KKLC 5EOCJ 4DGIL 3B6SA 5K9JL 4RMSA 1A8JH 4X8XA 2R4RH 5B38G 3MV7B 4YFLF 3LRSB 1OLLA 4O02L 1HWHB 5FHAH 3IFOB 4OSUH 1IARB 3CVHH 3IRZA 5E4EB 5DHYB 1G0XA 1ZTXL 4YXKL 1UADC 3QPXH 1MHPL 4DUWA 1SJHA 1S8DA 3OAYH 1HXMB 2OTPA 5DVOA 2PW2A 1TTFA 3RHWF 5ESAB 2NYYD 4OCWL 5CD5C 3EO9L 4NHCH 1BZ9B 1S8DB 1R5IB 4JJ5A 2E27H 3BUYB 3JV4B 2OQJB 2E9BA 1PKQB 2VWEE 1XGTB 3QXAB 4PRPB 4K7PX 4A2MA 4DUVA 3C09C 4OV6F 1ED3B 1TXKA 3WD5H 5IEHA 3KPPB 5HVFB 5B8CA 3KDMB 5ACLA 1UA6L 4F7PA 2J8UE 3BKYL 4OLYH 3BSZH 3DIFB 5K9JH 5ICZA 3HI5L 3NN8B 2DJSA 4XAKD 5BRZE 3GM8A 2D9CA 2R29L 1I7RB 1MY7A 2VDKL 1E6JL 1FSKC 1T89C 2BHZA 4UV4H 3O2WH 2DQGL 2X9XA 4NKOB 4YBLB 3B4NA 5FO9B 3F6LA 1Y6MR 3FQNB 1S5IH 4PJCF 1LNUB 2GJ6D 4YHKH 1I7ZB 1F6AA 1DQDL 3TGXA 1J10A 4OTXH 5KSAD 1CE6B 3MUGB 2V9RA 3SDDB 4LNRB 4ZUSA 4L8CA 5JIKA 2A77L 2P8PA 4MDJA 1CDGA 5HD8D 1DLFH 2NY1C 3H3BC 1D5XB 1NH6A 2F19H 1UWGH 1NKRA 4K07A 4RGMC 1YMHB 4D0CA 1U8NB 3SJVE 1A6VL 1P69B 3DRTA 2PXYC 3SO3B 2PR4H 4P3WA 2PR4L 4P2QE 1AKJA 2Q76A 5EG6C 3O6FB 4V1DD 4XBPA 4AEIH 5JW5B 4KKAD 3MJ9A 1X7QA 4JFFD 4K7FA 4YDKH 3OHXA 3UZVB 2IG2L 5DFTA 3WDJA 1EFXB 1FPTH 1VPOL 3V0WL 1SYVB 5DRXA 3T09A 3V4PH 2YS4A 3CDGB 5C0EA 3N06B 4UQ2B 1S78D 3QUZA 2PF6A 3G08A 4AY0A 4X99A 2P5EB 3SCMC 4KKCD 1DDHA 4FN0A 4X7EC 4JDVB 1XZ0A 4IIQB 2FIKA 3ARDA 2VDPH 4CMHB 4X7TA 1WC7B 2DQGH 4PJDB 4HFUL 3C6LD 1DUYA 3B43A 1G7LB 5CILL 4QHUA 1SBSL 4R0LA 3RFZC 3RVUD 2Z35B 3BEVA 1YC8A 5I1LB 3QEGL 4OCXH 2Y5EA 5CZKA 5KAQF 1MRDH 3QPQC 1FNLA 5IWLA 1LGVA 3L6FB 5A1AA 4K23L 3NFSH 2GJZB 2F5BH 5IMLA 1RQ5A 1OWWA 2LAAA 4U1JB 2EKSA 5GGVL 3CSBA 4IS6A 4NN7B 3S34H 5HYFA 1GIGL 3TN0D 4JFEE 1LD9B 4W6WB 4GXUM 4QT5B 4HWEL 5GPRA 2BNQA 3V6FB 4NHCL 3UTQB 3VFOA 1GZPA 4LNVA 5IJKC 3P4NB 5FFLA 5HPOA 3D69A 1H3XA 1MNUL 4LVHC 2H2PC 2APWA 2XZQH 1PKOA 1YN6A 4HWZB 2YKLH 3D85A 3EO0A 4Q2ZA 4KQ4L 4OCLC 2HKHL 3NPSC 4U1NB 4Y2DB 3CSYB 2H2PD 4XMLL 2IWGA 4W4NA 4I77L 4HS8H 4C56E 5E03A 3BRFA 2F53A 5JHLL 4X8JA 2DM3A 3EJJX 3O6LH 1QBML 4IEFB 4XWOC 3GMNB 1XGQB 3QJFB 5E6IA 4OB5H 1F13A 4YFEA 4KV5E 3OG4B 3SDCC 4Z76B 4JO1H 3QH3B 3IFNL 4KK9D 4ZPVB 1U6AL 4Y5VC 1NLBL 2OL3L 3FRPG 3IETA 4JY5H 2C4XA 4U0RC 3PGCA 3FB8A 4IMKA 3D3VA 4JKWA 4C56B 1J8HE 4QHMB 4XP5L 4OJFL 3U4EA 4JM2A 3PJSB 3ZTJH 3LY6A 4XVUD 3D2UB 4XGZA 1XCTB 3JUZA 1R3HA 5EFIA 4POZD 4P2QD 4MWFB 1P7QD 3RDTB 4JFDB 3DRQA 2D7PA 4XZUB 1SBBA 3QQ9D 4RFNB 1JP5A 4FFYL 3DX9A 5EU4A 3TPKA 3MNWB 4QRRD 3FRUB 4XPHH 3ZKMC 1QSZA 1MI5D 4X9HA 3C2AL 4DGYL 2QQLL 4F7TA 5IVXA 4P4RB 1ZHLB 4M43H 1Z9SA 5HHVL 1HILB 3FT3A 1QKZL 1U8JB 2D0FA 3PG2A 5FDWA 5EO1B 1R3KB 1DCLA 3IJSB 3QDGB 3P4OA 4F37F 1H8SA 5J8OA 4GW5A 1OGAD 3EYUL 3V4VL 1KCSH 3IT8D 1NEZB 5I1LA 4PJ9C 3CIQA 1FBIL 3UO1L 2B4CC 4AG4H 5CWSA 2IBGA 2O5XL 4G6FB 2Y4SA 2CSPA 5E1AA 3WKML 2NLJB 1L6ZA 3GSUB 4L3ED 2F8XC 2NY6D 2R8SL 4MMZC 2XZCL 3HNVL 3VFNA 1B2WH 4KAQH 1NDMA 2WUBH 1RJZA 4WWKA 5SWQA 3QIUD 4BFIA 5FYLL 2Y7QB 4PJ7F 5IR1A 3W0WB 3LS4H 4OLZH 5DD5L 2HLFD 2R56L 3KLHD 5CZVH 1VGEL 2CGRL 1MCHA 5C0AB 3OGCB 4R4ND 3PWPE 4JM2C 3KS0J 4OLWL 5IB2A 2YRPA 3UAJD 2R1WA 3PWJA 3GHBH 1TETL 3KPRA 2DQHH 2VLRE 2JB5H 1T80A 2XWBA 1IEAB 2A6DB 3BDBA 4Z6AT 4PLJD 3ZKXC 1YMHA 2NTFA 4PJBF 1CGSL 1TPXC 5IHZB 3RZCD 2C1PB 4S1QH 3QDMB 4ELMF 4JG1H 4JN2B 3HMXA 4NO0A 3QO1B 5HGDA 3NFPA 5F8QC 4ERSL 2BY3A 3VFMA 4RAVA 3VXTB 4ETYA 1NFDA 4HDIB 4PJFE 4FOMA 3G5VB 3ARBD 1F4YL 4CMMA 4JG1L 4QRTA 1FSKB 3UROR 5HYQB 3GI8L 4JRYB 4XVJH 5EU3B 3WFZA 4LOUD 4U1GB 3CLEH 2BVYA 3KPOB 5D72H 2VO5A 2VDOH 1TETH 3FB8B 4WHYG 1YNTA 3U79A 5BZDB 4HGWB 3MA9L 5C08B 1YY9C 3IETB 5DD1L 3PABA 4D9LL 4HXAL 3ES6B 2Z8SA 1U8OB 2XN9A 4G6JL 4RDQG 2IQAB 1A7PL 2PTVA 5DHVB 4ZTOL 1N5YL 3OZ9H 4HGMA 1DZBA 4PUBL 4EI5C 3CMOH 3ZKQD 4N0RA 1KBGL 5F89B 5I66B 5CINL 1WUNT 3HR5B 1N59B 2EIZB 3TIEA 4EI6B 1CLOH 3ARUA 7CGTA 2L4OA 4NN7C 4LMQI 3RP1A 4EN3A 2ADIA 1OPGL 3BDXA 4MXQD 2VDNL 4IOIB 5AWNH 3QAZC 3QEQB 4NQED 3ESVF 4PRPD 1RIVL 1J0ZA 3UCRA 5F9OL 4XXDA 5DMIH 3IF1B 2KPNA 3AREB 1A6WH 4ZG1A 2NW3A 3ZKNC 1BD2B 3B2VL 3QQ4A 1U8KB 5INCA 4EXKA 2NZ9C 3MV8D 1U95A 3OPZH 3FONB 4K94L 5FIEA 1U3ZA 5T1LB 4OT1H 3NFNB 5BS0B 5IMLB 3PIQB 3JVGA 4M9OA 4UV7H 5JHDD 3QDJA 1LEKB 2Y9RT 2BY2A 5B8CC 4NBXB 4JZNB 1NL0L 1LEIA 4GG8B 3ALXA 4NC2B 1FNGA 1YMMB 2KBGA 3RBGA 4FQCH 3GIZL 3BISA 3SDYL 3BD5A 3QISA 1R6VA 5CJBA 4P9ML 1EGJL 3F7VB 1ORQA 5DFWH 4AEEA 4IOSD 4H8WC 2WP3T 3OR6A 3LKSA 5F89A 5I66A 2Y1VA 4MMXC 1ZVHA 1SYVA 3MLUL 5DRXB 3ME0A 3ARZA 3RDTC 4RA3A 2HN7A 5I8CA 4K8RL 1YY8B 4LPUA 3O3BA 4XAWH 3T4YA 3HZYA 1KSRA 4PRDA 3TV3L 4RFOL 3OHXB 2C26A 2LU4A 5E8PA 4QRRA 2VQ1B 3RWCA 1LE9B 5GJTL 5GS0C 3RTQA 4UOW1 1CE1L 3LPGA 2Q76B 1WIPA 3DURB 4MNQE 1BZ7B 1FV1B 3BWAA 4G80B 1CT8A 4Y5YC 1FQ9C 3KYAA 5EIVA 4IRJC 3OR7A 4KK8C 1CXLA 2BJML 4QRTB 2CR3A 5HI3D 3H9SB 4UIMA 2Q6WA 4LPXA 3WNPA 1KLUA 1FGNH 4QEGA 5C3LD 3OKDA 1M4KA 4MB3A 3R8QA 3Q1SH 3H3PL 5AEAA 3J7HA 3NA9L 1EBAA 3K4ZA 3BN9C 4PJBE 4JR9L 4WUUD 1E28B 3NAAH 4V1DB 5EH1A 3DV6A 4ZFGH 2HVKB 1LNUA 3LV3A 5IEKA 2FSEB 1NLDH 1FFNA 1NMCC 2F5BL 4MA1B 1KTDB 3SPVA 2DOCA 5JO5B 3MJGX 1QFPA 3ARDC 1FNEB 3C9NA 3CZJA 2P5ED 3LSOB 1CLZH 2JJTC 4WGVB 1KIQA 1RULH 1V5JA 4LAQH 5CILH 3VWKD 3LEYH 1BLNA 1XIWB 2Z92A 5SX4I 3MJ9H 3EJZD 4QCIB 3EO1B 5D1XA 5IBUB 2DQTH 1DBJH 3WO3B 5F7NC 5I74C 3ULUD 1T1ZB 4WU5A 3VXME 3B5HA 4Y4HC 2OMBA 1B88A 1SHMA 2XOTA 1AIFB 2XFXA 3GBNH 1VEMA 3DSNA 5H8DA 5AUMA 4PLKC 1A6AA 2ICWB 2ADFH 5IVNA 3I6GB 3PNWA 1T2JA 2X4NB 3TIDB 2FIRT 1LO3H 5E6YA 1A6AB 1QSEA 4WI9A 4PG2A 1S7VA 1MFEH 4X98A 5DUPL 2VAJA 2GK0A 5DHVA 3GSRA 1X6LA 3IYLW 3FQXA 4M6OL 1JPGB 4LP4A 1J8HD 2M1KA 3T2NL 5TQ0L 1INQA 1ZT1A 4HAGA 5HHOD 4X6EB 3BP5A 4JAMA 1KCRH 2FEEL 4LCIL 3VXUB 1I3RA 5EU4B 1WVZA 3IS0X 4IMLA 2NY7H 2WQRA 2D7MA 5GZOC 5KSAA 1DQDH 2DQFA 5DJDA 5EC1B 3G5VA 4P4KB 3HMXH 4EEEA 1MHEA 5DR5L 4LK4A 1I8IA 5DJCA 5D70H 5L2KA 1MJUH 1UVQA 3P77B 5DFVC 1W2KT 1TVHA 1E6JH 4C56A 4OZHF 1UZ6F 2Z91A 2R29H 3QHFL 4QRUA 4HSQA 5HGBA 2DAVA 5GGRA 5KG9A 3HI5H 2ADGB 4N0YH 3PWPA 4M1CD 7FABL 3WFBL 2BSRB 1KUMA 4LSRH 5F3HB 5EBGA 4L4TB 3HNTH 2V2TA 2GUOA 1T0NA 3D48R 3F58L 4G6ML 5IFJB 4OGAC 4X80L 4JFPA 4OM0L 5IBTH 5JORA 4GS7B 4Y1AD 4TNWF 1PZUB 3W0WA 3FO1A 3REVB 4JN1L 5B39G 3ULUH 5I1EL 2DICA 4G8IB 4N8VB 3CFKA 3OPZL 1R5VB 2IANB 5IW6B 3W5NA 4O02H 1DBAL 2NY2C 3T0XA 3QA3B 3GJFK 4DGIH 5JW4Q 1PJ9A 1X5AA 3MXWH 5FYKU 5GSVB 3BGMB 4XCEA 5DJAA 3TYGL 1DBKL 1LD9A 2C3XA 1VDGA 2FWOA 5FYJD 4PJXF 1U8MB 2OS7A 4FXLA 4U1JA 2R9HD 4EOWH 1UH3A 1LE5A 5EBMA 2COQA 5JIIA 2IFFL 2IBBA 5EO1A 4HW6A 3VMOA 2DWDA 4MZ2A 1ORSB 3CPLB 4XPAH 4Y16B 3FQWB 4N0FB 4YBQC 1IGML 2VWEC 4CADA 3MBXH 3LEXA 2CUHA 1JIBA 5GRYA 5T1DL 3WLWC 3ZO0A 3G6JB 4BZ1L 4WTZA 4G6JH 1RUQL 1MCLA 2EXYD 3QA3A 5HYJA 4Q0XL 2IANA 5DJ8B 4HLZH 4M61B 2PXYA 4XGZB 4FFVC 4JJHA 1W8OA 1OTTD 5DWUL 1N64L 4HIEB 5D72L 3MFFA 4XXCA 4LSUH 2HFEA 1ZKAA 3IJHB 4ODTL 4IBLT 4WW2F 1CBVH 1RUAL 1W0WA 1YUHB 1S78C 4G9DB 3RJQB 1VFOA 1SJEB 2Y06H 4D8PA 1YYML 1MCEA 3M1BB 4ZPVA 2F53E 5D7JD 3EYSL 3H9ZA 5IQ7H 1J1XL 1CFVL 1OAQH 3FHQA 1NANI 4U6VL 5ETUA 3TIEB 2YK1L 1CL7L 2ZG3A 3MBEB 3UTPD 1N0XL 1HEZA 4KI5C 3MR9B 5IQ9B 5D96B 2QADC 1A14L 4GXVL 1LO2H 3QI9D 1MCQA 2PYEB 1AC0A 5BRZA 5I1HH 4MS8C 3G5ZB 4OV5A 1A7NL 2Q3ZA 2M8XA 2NY3B 5FGCE 3MOBL 4ZUTB 3GUTA 5M94B 2J8UA 3DVFA 1IILE 2UZYB 2XG5A 4S1RL 4Z7UA 1A4JA 2C1OA 4KK6C 5C71A 4QYOB 4BSWA 3IU4H 4N8CL 2JK5B 1FC1A 2CR6A 4HG4K 3N9GL 2VB5A 1FZKB 4U2YA 2EIDA 3ECBA 3S4SA 3HC3L 4XTRC 5GIRB 5IJKA 5JZ7D 5K93A 4Q9BA 4DGVH 1S9WB 5D7IE 3CVHA 1HSBB 1LO2L 1QLEL 4M48L 2FEEI 3GSNL 4YWGL 1FBIH 1JPSH 1DVFB 4UU9B 1A3QA 1AGBA 5DHVH 2OQJA 3ARTA 1UWXH 3N1GC 5C6WH 3PDOB 3DVNB 3CVIL 5MEOB 1J1XH 4U3CA 1W0VA 3A67H 3QXUA 5IBUG 2CDFB 3Q5YA 1KTKE 1ZWIB 4F15C 4RMTA 1HINL 3G08B 1EO5A 1Q9WB 3FN9A 1NBYB 4QY8A 3LRSA 3KPMA 5B3JF 1E4XH 4RMUA 1IGTA 1F90H 4NRXB 3NIGF 3B6SB 4L1DA 4HC1L 3ZHKA 1QUNA 2LVCA 3R1GL 3ARFD 4QRPB 5HHOA 5ENWA 4WY7L 3PWVB 2HVJB 1U8QB 3KWWA 5I0ZA 3AROA 3QXTA 2DWEB 5KZCB 3PV7A 4S0TD 2VITB 1M05A 2AJSL 3DV6B 4PR5A 4JFZL 4KV5F 3HE7B 1XGUB 35C8L 4OZ4A 4HK0B 3SDAD 2X1WL 4G9FE 3PQYE 3S5LA 3GMMA 4ZSOE 1U0QA 3T65B 1G0YR 2KZ1B 3HZMB 4G8FA 3VRIB 3PGFH 1P1ZA 4R90H 3MXWL 4AK1A 3O2DH 1HQ4B 4L4JA 1ZT7A 3MO1B 4TSBH 4JDZB 5ICXB 5DJXA 4MWFA 4KMLB 4ZUTA 5T33L 1FYTE 4P9HH 2RFXA 5T3XL 32C2B 4E42A 3GNMH 2BXYA 1MNUH 3C09B 4DGVL 3HNSH 2Z93B 3SY0A 4PG9B 4I3SL 4APQA 2DMKA 1FL3A 2PCPB 4HHAA 3CX5K 5AYQA 1A9EB 5IEHB 2AXFA 2ICCA 4W4OA 5HHNB 1A6PA 4LSPL 2ATPA 4D0BA 3NIDF 3PV6B 3V9FA 1ZVYA 2ICES 2EDHA 3F58H 4G6MH 4L4VA 4XX1E 5CD3A 1VA9A 3DX7B 4Y7MA 4XCYA 1MRFL 1E4XI 5CHNB 3GRWA 5IG7B 1CICD 3QJHA 3MLTA 4N0YL 4G7YH 3QEGH 4R26H 2XY1A 4ZAKC 1W0WB 3VGHA 3MOBH 3MOQA 3RZCC 1FFPB 1A9BA 1D5ZB 2QSVA 3IFOA 3S88L 1KPVA 5I8OH 1YNKH 3BPLC 1P6AB 5D70L 3MRNB 4MSWA 4HLJA 5IFHL 3S5LG 4YEFA 2NXZB 3UX9B 3ZDXF 5C0CD 2OI9B 1SMOA 2ZJSH 1U58A 5BZWA 3SGEI 4ONFH 2H3NB 2D7QA 5JW4M 3MRFB 1PKQE 3NCMA 4LDOB 1J05A 1R3IL 5FGSA 5TQ0H 3H0TB 1BWWA 1CDBA 1A4KA 3QFJD 5EZLA 4AEIL 1G9MH 3MBEC 2JLLA 1MWAB 1JRHI 3STLA 2H6PB 3BE1L 4GKSA 1XCQA 4POUB 1I7TA 3QIUB 1MFEL 5DYOA 5LAXA 3QCUH 1JZ8A 4H26B 1A6ZB 1UJ3B 4CU8A 1NFDF 5CGMA 3O6KL 3SDXB 3NA4A 4NJ9H 5DUMH 1OAZL 3JVGC 3L5WB 3RY5A 2ADFL 4M8QA 1IAMA 4BZ1H 3I84A 1S7UB 1BEYH 2HH0L 2VYRE 4I0PD 4TUOB 5ICYA 5IB5B 1NEUA 3D0VA 1CD1A 5CP3H 1IGYB 3BH8A 1AY1H 4O9HL 1IM9D 4QOKA 1UM6L 4LSVL 1AO7A 3DX6B 1CZ8H 1NCTA 1A1NB 5C0EB 1I1AC 3BN3B 4RMVA 4ZS7H 3AAZA 4JO3L 1RULL 1CLZL 2H26B 4HUWB 5GGSY 4I4WB 3QQ3B 4NN6C 4X4MA 5DF0A 5F72S 2EDWA 1G1CA 1G1YA 1P7KB 5T5NG 1C08A 4K3HA 1I4FB 3B3IB 1UA6H 1RV6X 4QRQA 4OCNC 2ADGA 4GLRH 1P1ZB 2V5MA 1Q8MA 4PD4J 3H8NA 3HRZB 3RY4A 1SY6H 1QO3B 1TVHB 3D87B 4G6KH 4EN3D 3GMMB 4KKAC 5E7FA 3RX7A 5SWSB 3HS0A 1G7HA 1TVDA 1Y0LA 3QIBC 3MMEA 4KKBC 3UEZA 4P2RE 3HMWL 5EU7E 3HTLX 4UINL 1T22B 1BJMA 1KOAA 4KUCD 4YHIA 1PBYA 3VXUA 4KKCC 4NRXA 5DQDL 1EJ6A 3VXMB 3BP5B 3C8KA 1IC7H 1BBJA 5E4IA 1MLBA 5B38A 3AAZB 1CE1H 2JELL 4PJXA 4X7CC 4KHTH 1OGAA 2CK0H 5E8OA 5BXFA 1PSKL 4WI3A 3TA3D 3PP4H 4XNQB 3UZEA 6CGTA 1W0VB 3QDJD 5CFHA 2CO7B 1Q9WA 2DQEH 1CFNB 1KJMB 4FABH 1DVFC 3SKNB 1GZQB 1PSKH 2YXMA 5CJQL 4NNXA 5DZNA 1A6ZA 4ZOCA 5CSZB 3U4BL 4ZSOB 1CDJA 2RJMA 2CIKA 2V6HA 4UNVA 3GFUA 4LSSH 3PGDA 3SOBH 3WIIL 2L0DA 3C60C 1NDGB 1OGAB 1F3DJ 1U41A 1I8MB 3IKCB 5C0BA 3VH8A 2HKFL 2G75B 3B2UD 1Q9OB 4AIZB 3C2SA 5FGRA 4OT1L 2R69L 2OTWA 4J2XA 1MLCA 4Z7VF 4MYWB 3TVMB 4BH8A 3MRJA 2DL9A 1BD2D 2EYSA 3D2UA 4M8VA 1KYOK 1OGAE 5D9SB 3FQRA 3SO3C 5KVDH 4L8SB 4LCWA 1J0IA 2OZ4H 3BPOC 4U3HA 3QCVH 4AENB 3RI5K 4N0CC 5H35B 1NCDL 2IH3A 3MRCA 2YMXL 2Z31C 2UWEA 2AK4A 4G3YH 5DZLA 1MWAH 1VEOA 3LEYL 4GBXB 2HT3C 2NX5A 4XCFL 1OT2A 2Y72A 5KAQG 3L3GA 5K9QG 3MR9A 5IQ9A 1HDMB 3BDYL 4HXBH 3OR7B 1UM6H 3MJ7A 3TJEH 2JJVA 4OF3A 1JUFA 1MJ7H 3RL2A 3VXQB 1FZMA 3DUHA 1A1NA 1OY3B 3NZHH 4NT6B 5HDLA 1II4E 1UXSB 4NJ9L 4D9LH 3TCXA 5D6CB 3GMQB 3ZLQC 4JR9H 1AR2A 1FYHB 3L3HB 3IJHA 3VXSE 1D9KD 2OM5A 4GAFB 5ICXA 3HR6A 1YEKL 4B50A 4CNIB 1V7MH 1RFDH 2IQ9H 2W92A 3TZVC 3BJLA 5DRWB 1VFBA 3DXAD 4U2ZA 2VTFA 4GBXC 3TESA 3CFCL 3IDUA 4DKAA 4JHZA 4KUZL 2X44D 1XCQB 4F80A 4HUVB 1T20A 4MB4A 2J88H 2P5EE 3DGGB 1A7OL 3QEQD 1G7JA 1B4RA 1HSAA 1JGLL 4HUUA 4P23D 4ONGH 3TPUA 4WFFE 3O81A 5H94B 1LEIB 4MAYB 3VWKB 3OKLB 2DIAA 3DARA 5FKAA 3TBTB 2P42B 4JPWH 1LO4H 2VZSA 3MRLB 5FKAB 1KG0A 1U8PA 1M7IB 1FAIL 3MRFA 5EUOE 3SKOB 5D4QA 4PLNC 5I76A 1RHHA 4JRYE 1B90A 2VAAA 3WHXB 4XI5C 3MV8B 4XPBH 4LEOB 5M7QA 4BZ2H 3LKOB 4MNHA 5KW9L 3TCLA 2FWOB 2RB8A 2MCPH 5AZ2L 3GSVB 1FVEA 1CD9B 5HDQL 2AJZB 4NQSA 4NDMA 3QO0B 4ZFOL 1U2CA 1HHJA 5JA8B 3QNYB 1KYOJ 3GIZH 4RIRB 4N1CA 4RISL 2CMRH 1JNHA 3QUKA 1NJ9B 3LIZL 4KK5D 3M07A 2Y6SC 3REWA 2ZUUA 5C0RH 4MAYC 1HXYB 3N0PB 4UV7L 5FM5O 2AV1A 5GS3A 4YDIL 2PTTA 3O8XC 2MKLC 2NNAA 3RL2B 3VFSA 3VXQA 4DN4L 4OF5A 1MF2H 5D1QD 5E2JA 4ORGB 4WUKH 4XP9H 1SYSA 3O3DA 4FMFA 1I9JH 5A3ID 1D5XA 2GW5A 2VN4A 3STZB 4WTWA 3WBDA 1HYRC 5I6XC 4IRSA 1E4JA 1YPZB 3B2VH 4GBXA 2VUYA 1C5CH 3EOYG 3Q2CA 1DANT 1UVQB 1MHHB 3MRCB 1HH6B 3GMPA 4PRHA 4RMRA 1MJJA 3V5KA 5ILTL 5MP6L 4RFEA 3MRMA 1TZGL 5F9JB 5DD6B 1LMKA 1YY9D 3HE7D 3FQNA 3HPJA 1Q0XH 1MAML 1HI6A 1K85A 3ZL4H 3WJLA 5DJCB 5FXCH 1ZVSA 1PG7L 5I1KH 4PJAA 4G8FB 2DQFB 4LCUA 2Q8BH 4X9IA 4KRLB 5IP4A 1WEJL 3RU8L 3VD5A 1FZOB 4LIQL 4PUBH 2SEBA 2B1AL 5HHMB 5IB3A 2ZP0T 1A7PH 2W0KA 5C0ND 2XXMB 1NC4B 1U3JA 1BFVH 5DD1H 2E6PA 1QFUH 1ED3A 3T0EC 3MA9H 1K3ZA 5GS1A 5DDHB 1NMBH 5CLTA 2VZ3A 2VH5L 1JYVA 3LKQB 1F90L 5J1SC 2XWBB 2IPUK 5ETUB 2EYRA 2G9HB 1UYWH 4PJIE 2VLME 2GK0B 2HJLA 3BHBB 3CDCA 3L7FA 4X6FA 4EDXA 3PWJB 4F7EB 2YZ1A 3JWOL 4P57B 3SE9L 4XVJL 1IQWL 5D7KD 5C0AA 4LLAA 1TQCB 3O6LL 4JPIA 4LVNC 4YXHL 3RVXC 5BS0E 1T7VA 4G9DA 2B20A 3SHSA 1NJ9A 2FJFB 1OAKL 4I0PB 1EJOL 2QADD 3RVVC 1DBML 4QCIA 2VLJA 2GFBB 1INEL 2ZSVA 3ZE2E 2DM7A 1A22B 1KEGL 5C09E 4HFWB 5I15H 1N8ZA 5T3ZH 1U93A 3DI2B 5F7KC 3CSGA 4AEHH 4BK4A 3F7PC 1P7QB 2F58L 3EO1A 2IPUG 1FE8H 1WSST 5HYJB 1P4IH 3HKFA 2JCCE 2K7QA 2VAAB 3WHXA 4OD3H 1TCRB 3BFOA 3U9UB 1M7IA 2NY5L 4XP6H 3HG1B 4HWEH 4V1DA 4OGYL 3GSOB 4QHNB 3CLFL 2MPAL 4XTRD 3DVIA 1LE5B 3HN3A 4U49A 1U8JA 5F1SA 1KPRA 4OZIB 5ESQA 4HF5L 5CGTA 1U8MA 2WM0A 2IALA 3I6KA 4S1RH 2XTJE 4MD5A 1MIEH 1ES0B 5CEZH 2DS4A 4M6NL 5GSVA 3SBWA 3TO4C 9CGTA 3RUGA 5I1AA 1KTRL 2MQCA 2HFGH 3S36H 1G9NC 5JXEA 3OKDB 1H3PL 3OSKA 4UIMB 2Q6WB 3VFGH 4UZGA 3QQ3A 2RQ8A 4PJDF 3VU2A 4WTXA 1RUMH 3FFCB 2LTQC 3KXFE 4OV5B 3UTTD 3PJSA 5HY9A 3RVWC 5CP3A 1LQSR 3KLAA 1M7XA 4UTBH 3T4YB 3GO1L 1MQKH 5IQ7L 3I9GH 3BOVA 3WNMA 1W8NA 4BFBD 3U9PL 3RWCB 1LE9A 2X70B 2FCBA 1YYLH 5C0AD 1ORQB 3C2AH 3K74B 4DGYH 4BKLB 3ARRA 3HB3C 4ODTH 3TBVB 3E3QE 3X11A 2NY0D 1DQML 4NKIH 4CJ0A 4GMSL 5SWSD 4LLQA 1UKSA 3E1F1 5IMMA 1D6VL 4GO6B 2W0FA 5FO7A 4B5EA 1QBAA 1T0MB 3SN6N 3QDMD 1UWEH 5FYKH 4XP5H 4ZTPH 3I50H 3DUSA 3D85B 2BRRH 1I8IB 5AYUH 4X4XA 4R97C 4XPAL 3KNBB 1QBLL 2VLJE 4YHKL 2BSED 1EH9A 4HKXA 4WWID 3RX5A 4C55A 2IFFH 1JNNL 2WBJC 3MUJA 1TCRA 5DGQA 3VFTB 5MENE 4N90D 4KK8D 4EOWL 4G7VH 4UDUB 5DD0H 3MNZB 2FJGA 2X6MA 2ITCB 2BZDA 3ARFB 2CUMA 1J5OL 3CLFH 3GJFA 4OGYH 1I8MA 1X5JA 2ENYA 2WWMD 3WIHH 3V5HB 3BSZL 1MI5B 1BD2A 2VLJB 2I60L 4JQVC 5HYJE 4ELKA 3QUYD 3V6OA 4LKCB 1QSEB 2AJVL 1SEQL 3BMWA 3KPQA 4KH2A 5T3ZL 3PNWB 4PGBA 5EOCH 1KEGH 2LV4A 3H6JA 4AL8L 2UUDH 4YGVA 3ARDB 3VXSD 2BHYA 3EYOB 2O61B 1S7SA 4R3SA 1YMME 5JPNB 2CLVA 2AQ2A 4YXHH 2LU7A 4NQDE 3WMSA 4PTUB 2IAMB 1Q72H 2PO6D 2DTSA 1YNTB 3CH8A 1A9EA 1KTLB 5FUCE 3OKEB 1I8LA 2PN5A 2XQBH 2NZIA 5FV2A 4B7IA 3F65A 2FX9L 2VC2L 4PJ7B 2ORBL 4NFCA 2HAZA 3RL1A 1BPVA 4BFGA 1NBVL 4Y1AE 1QACA 7FABH 4JZJA 3LKRB 4Y4HB 3JV0A 2SEBB 1KPUA 2WLZA 5TDOB 5BVPL 4U6XA 2IH1B 1PFCA 3E8UH 3F12A 2GUOB 1T1YA 4XB8A 3MRIA 3IKKA 4PJAB 2HJFA 3T08A 3GHEL 3M8OL 1KJ3L 5IKCA 2PUQT 3MNVB 2ILLA 1RZ7L 3SE8L 5KSVB 3GKWH 5FF6B 5J12C 3W0WE 1WEJH 2EDJA 3RU8H 1YEDA 4X6CA 3V4PL 3ZL4L 1JHTB 3WIHA 2WBJB 3VFMB 3OKNA 4WCYH 5J13C 3BAEL 1NEZG 2IAMC 2X2YA 1ULVA 3ZE1E 1RPQA 3UDWA 4LFHD 1C16A 1QVOA 2IADA 1F58H 3PHOB 3OKEA 2A9NH 4K7PL 4BFIB 3T4AA 4ODSH 2F19L 4LLYA 3ULSA 1RJZB 4WWKB 5IHUH 5J1TC 2IMNA 2VQ1A 2P5WB 1I9JL 3LKRA 3QIBA 1EEQA 4ODWB 4E41D 1L7TH 1S7SB 2FRGP 4LMQE 4IDJH 3W9EA 4DJMA 4NO2B 5HI5C 4D9QE 1KNOA 5ACZA 2GK2A 1WTGT 1Z5LB 3BGFC 4KZDL 1IFHH 1KT2A 2DLEA 2X4NA 4N68A 5C0DA 3TIDA 3RPIB 5BCAA 1U8HA 3BUYA 3IDMA 1QPPA 2N4IA 2YBRB 1DFBL 2PW1A 1G9NL 1D5MB 2DQTL 4PB0L 1RU9L 2RBLA 4KXZH 4UV4L 4WFGE 5E6ID 1K6QL 4KHXH 5JDJA 3S96B 1IT9L 4C59B 1PQZA 2VL5B 3MCG1 4LAQL 1JWMA 1RUPH 4MJID 3VXMD 4O51B 4L4TD 1KACB 4YNYA 4LU5L 1KG0B 1CVRA 4WHCA 4PJ8B 4R7DA 5HD8C 1KFAL 4ELKB 1DQLH 1CWVA 1JWUA 3MLZL 5JOPE 3ARFA 1MI5A 1DQJA 2BERA 4NNPL 4MQXD 3IDYC 2JIXA 3PIQA 1B6UA 2ARWA 3FFCE 2BVQB 1HKLH 5A2JH 3EDEA 3DUUA 5C3TA 2E27L 4YH6A 4MSWB 1EEYB 3LH2L 3EO9H 1OARL 4ALAH 4MQXC 3CDYA 5KOMC 1LP9F 1K2DB 5A40E 2YUXA 5I1IH 4CNIA 3IF1A 3C87A 5I18L 4JFDA 4OSUL 2CJUL 5BRZB 1S9YA 3MV9B 4I48A 4X4ZA 5CBAA 1YEKH 1T03H 4I2XE 4NP4H 4IRSB 1OARH 1CLYL 5KSAC 4AQOA 2DQCH 2X70A 4LEXL 1JI1A 5LGKA 5T5FL 5CJXA 3EKCA 3K3QA 3T1FB 4NQXB 2J5LC 1TZIB 1N4XH 1CK0L 1PVHA 2IFGA 3X11B 4C58B 4U1NA 1P5UA 4HJJH 4L29B 3NGBC 3TT1L 1QHOA 1HKFA 1GGCL 3GMNA 3BGFB 1JGEB 4ZUUA 1EO8H 5DD3L 1YUHA 3PHSA 5KSBF 4MD4A 4XNUL 4KRPB 4X4YA 3P9MB 4NQCE 2MOVA 1MIML 1IT9H 1UFUA 4KDTA 1KJ2B 3P4NA 1Q9KB 5B22A 3PHQB 5D2LF 4DVBA 5HSFA 4PV9B 3U6RB 3ARGD 1IGIH 3WXVL 3FB6B 4YO0B 1F3RB 2X1XR 1C7TA 3T65A 4KZDH 3C5ZB 4A6YA 5IVZB 4M03A 4KROC 4OZ4B 5I76B 4ZPTB 4FQ2L 4K71C 1AR1D 3MRQA 4IIQC 5DVNA 5FUZH 5GRJH 3B8SA 1Z3GL 2YSSB 3U0PA 1E0OB 5IHUL 1ZLUK 5A16A 3FT4B 4YNYB 1T5XB 1T5WB 4ZDHB 2ZSWB 4YC2B 4ZODA 5EBMB 5JUEH 4MS8D 2FJHB 4LBEA 4XAKE 5BRZD 3NCCB 3KWWB 3A0OA 1V3MA 4HUVA 1YZZA 4PJ5A 3RGVC 3BYYA 4JHAL 1IGIL 3WXVH 4OZFH 4QXWA 2BSTB 3U46A 2R0WH 3U0WL 5ID0B 1DDHB 2Z31A 3WN5B 5D1ZD 4ZUVA 5TPWL 3MACL 4BQBA 1KT2B 3K1DA 3UJJH 4WCYL 3CDGA 5DLML 5KSUB 2MSPA 2Y7QA 4X7TB 3I6LE 4EDWL 2Y23A 2AQ3A 5CJXC 3MOAH 5JXED 5HDBE 5SWQB 5JOPD 1RMFL 4OFIA 3F8UB 3AM8A 5F7WC 4Z7UF 2VMFA 5CINH 1L9NA 4YQXH 2AJUL 2D7TH 1A1MA 1NPUA 1Z2KA 4GFTB 1RZ7H 2VOTA 3GBML 2NXZC 3NCYP 5F7UA 4IHOB 3OZ9L 5J3HC 5KN5B 3C6LB 1J0HA 3M8OH 5E2VL 1EVUA 3K7UA 4JPIB 1S7RB 3T2OA 5BJTA 5GS1B 4GBXD 4JQXA 4DOHB 2DLGA 1B4JL 1T03L 3HLAB 4I3RL 2VXSH 1AKJB 4NGHH 5IESL 2GYSA 2G9HA 2ORBH 3EBAA 5DRNA 3O45A 2W91A 4OKVB 1S7TB 5DC9B 3MUGA 5SWSA 4N90E 1Q0YH 5GS2H 4LCUB 1NGQH 5T1KA 3BD4A 5JIPA 2VJXA 3WFDL 4KK9C 1K8DA 4X6CF 3HUJE 1AO7E 1JK8B 4ALAL 5GJSH 4HZLB 1QA9B 4U0RB 3D1MC 1MHEB 1AGFA 4L3EA 4YHYB 1P4BL 2JKXA 3LKPA 2AI0H 3UTPE 3LEVL 3KYNA 2AJVH 3GMPB 1AXIB 4UOJA 5F7FA 1BQLL 2DTML 1DQLL 1H3TA 4J4PD 3GHBL 1T0PB 4DTGH 3MRGB 1IAIM 1JV5A 4O4YH 1YMMD 5F1IB 1UZ6E 2A6DA 3GSRB 1JRHL 4HH9A 5DD0L 2HRLA 4YXLL 1AH1A 1I3VA 3WV0A 3VFVA 1PAMA 3SKMB 3N1PC 1PKQA 3C5JB 1ND0B 4TULL 5F88B 3IRPX 4FS0A 4DZ8A 4HQQH 5DA0B 1BZ9A 5H2BB 1QBBA 1OTUC 4QO1A 5KN5A 4H26A 1T7WA 2ZOKB 1ZANH 3O9WD 5D7LD 1F2QA 1HXMA 4JQXC 4ZTPL 1YQVL 3VFNB 3HE6B 4NDMB 5F9WC 5I30L 1WBXB 4RGNB 1KCSL 4WEUD 2A9NL 3EOBA 2GT9B 4GMSH 5F6HJ 4OIAA 1FNSL 3MNZA 4X6BB 3PWPD 4G8GD 5DGRA 3WN5A 4EVNB 2AJZA 4LCCC 2MHAB 3ULVE 2JJUA 4QXUL 1WFTA 2C9AA 4FNLH 5I75B 1R3IH 5FGBA 3MA7B 1NANH 4I0KA 4L4VE 2UWEF 4LEOA 4YDLC 1ZLWK 2FJHA 4LBEB 1UQSB 1AE6L 2O5ZL 3CFDA 1ZXQA 3FO9A 4OI9A 4UTBL 1WWCA 1JGVH 3HHRB 3IFLL 1A0QH 1JPTH 4LVEA 1KPVB 5HDOA 5F71A 2E7CA 3BGMA 3VWKA 1AD0A 4Y5XB 5DRWA 2FBJH 1XF4A 3BWUC 4OI7A 4JRXE 3KHOA 1W72L 2QHRH 2VN7A 4PBXA 1S5HA 2X1PA 3LN5A 1F4AA 3FQUB 3VCLA 4DQOH 1R5VA 5ANME 5L7XL 4D0BB 1A3LL 3CXDH 2NY5C 3JXAA 4BQ9A 1GGIH 1OSZB 4I8DA 5D2LA 2AW2A 1N6QL 1AO7B 3DX6A 3BKML 3C08H 5CIPA 4FQPA 5IMKB 4OGXH 1HK6A 2VNCA 3QYCA 4NHUB 2UZIL 5FA4B 4P2OC 2ITDA 3TF7C 3R06A 1JN6A 2EZ0D 2R39A 3P40A 3WUWB 5L9DH 3QUXD 1QRNA 4P23B 2BK8A 3GRWH 1E4KC 3L5WA 1HDMA 3QIBD 1F8TL 3D25A 4MXWH 4MXWL 3K8LA 2DQJH 4KVCH 3QEHA 3RHWK 1INDL 1DEEB 8CGTA 5I16A 4MDJB 3VD3A 2YOCA 1JI2A 2GSGA 3TNMA 3SKJH 1S9YB 3U2SB 1T21A 5HHOE 3O2DL 4H5SA 3MRJB 4GG8A 2C3VA 3QNZA 1JWSB 4A6YH 4OGXL 1DLHB 2V5RA 2OTWB 3FFDA 3GSWB 4M00A 1CGYA 4Y4FA 5LCVH 5JPMA 4I0CC 1IQWH 1VGKB 3VA2C 1JNNH 1GZPB 4HS6A 4LLDA 4RX4A 3S35L 1I85A 1MRDL 3AREC 4HK3J 3VGBA 3PWNB 3TO2A 2VZOA 5DJ2B 1NMBL 4LSQL 1G0DA 4A2LA 4WWKC 3PE9A 1Q9OA 4Y88A 4PPTA 3VGGA 4CKVX 3RIAF 4XNZB 1UWXK 4OF7A 2VDPL 3LAFA 4S2SA 5GSRB 2FBOJ 4NPYB 1ETZA 5GRZA 5ITFA 2Z35A 1QLFA 4UUJA 4PV8A 1JYWA 1D6VH 1GZQA 4IRJD 2BNQE 3DSFL 1KV3A 3MV7E 1WBYB 4JY6B 3DX7A 1HN1A 1FIGL 5D8JH 4F7EA 2AKRB 3P11L 3FJTA 3LMJL 4GRLD 2EYRB 4JDTL 4P5TA 1KIRA 1AXTH 3KHQA 3MRHA 4U3XA 5GISH 4P48A 1VFUA 4XX1G 4E9LA 2H1PL 5ILTH 2YD5A 1OWRM 1ZK9A 5I73C 4H20L 1E4WH 4FP8L 4GRWF 5EO9A 3MV7A 4NUGH 1FL3B 5JTWA 1FNSH 2IQAA 1YEJL 3ULUF 1WF5A 1EHLH 3FN3A 2J8HA 4U1MA 1H3PH 1RJLB 2OMNA 4H1LB 5K9KA 3KPTA 4J3OC 1G7PA 3MMEB 1MF2L 5D6DA 5FYLE 4BQ8A 4WFFD 4H25B 4OM1H 4L4TE 3RWDB 2ATKB 1H3WM 1T66C 1JWSA 5F7YC 1JPST 4PY8I 4DKDC 4WO4D 3IU4L 2VQUA 3T0WA 1NGXA 1L7IL 4DFHA 5HGDB 1OAYH 4NBYB 5D1XC 4P2QA 2DI8A 3IS1X 2DKMA 3D39E 4TTDC 2W0PA 1N5AB 1M1SA 5BO1H 4OGAD 5BJTB 4NZTL 1CG9B 3PUCA 4LF3A 3VRLF 4M93B 1RK1A 4MA8H 3V0AC 1JN6B 1FE8L 1KB5B 4UDTB 1DN0B 3U4AA 1A14H 2IANE 5A2IH 4AEHL 4U6XB 1FAIH 3AY4C 2PTTB 4NHUA 3SGEH 5HHOB 3EDFA 1UJTA 3DO7B 2YN5A 5I15L 1SJEA 4K3JL 3DYOA 3CFJB 3KPMB 4GOSA 4U1SA 3QZWA 1EUUA 2GKIA 4PTUA 3IDJB 3GGWA 4NFDA 2W9DH 1KGCD 5SX5H 2CLVB 5FM4A 1VFAA 3HZKA 3OF6D 5GZOD 3FMGH 1BVZA 3TM6A 2FLBT 1J8HB 3LPFA 3UYRH 2AP2A 3G6JA 1V7ML 2IQ9L 2CQVA 3C5ZC 3MV8A 3K80A 3K2UL 4F58L 3W9DB 1QLFB 2GJJA 2Q7NA 4DCQA 5BW7C 4HKBA 4RQQB 1BFVL 3TJHD 3K8MA 4U4BA 3QIUA 3QDJB 4Q0XH 4XPGL 1VACA 2YPKA 4FQXD 5JOEA 5F1NB 3C5ZD 1Z9OA 4AIOA 5ANMB 1FLRH 1WGOA 2Z4QA 4FG6D 3NFNA 4GLRI 3MCLL 1U58B 5BZWB 3PWNA 3TO2B 2AGJH 5T1LA 3PL6D 1WT5C 3FB6A 4YO0A 3LKNA 3V5DB 4JFQA 4C54A 1T1XB 2H41A 4MA7H 1BAFL 2FD6H 2W59A 1MAMH 5J7CC 3X14B 2AABL 3WCYA 5E8NB 3QB7C 4Y2OA 5I1DB 2MQ3A 4OZFB 1K3IA 2VDLL 4BA8A 3U0WH 4J7RA 2FHFA 3QNZB 4J3TA 3EIFA 4JB9H 3QEQA 5GGSA 4HCRA 3QT2A 4I3GA 3DUSB 4LP5A 4N8VA 1AJ7L 2A6KB 1T83C 2C3HA 1RZJC 2HLAB 5HGAA 5MHSE 4F2MA 2B8OT 1FP5A 3E2HC 1UM4H 3MRKB 2PYFA 2XKUA 1GGBH 1KXTB 3EW3B 5IB4A 4LLQB 5DFVD 4P46C 3BP7A 4XCYB 4WHTA 3STBA 5IFJA 5FA4A 4LVOB 5DEFB 1HE7A 1F2XK 1I8KA 3OKKB 3M1BA 3HE7C 5C0RL 2UWEB 3EFFA 3UC0L 4OM0H 5IBTL 4RAHA 3QRGL 4IRZH 3RA7L 3BIKB 1N7ML 1A3RH 3TBWA 1DANU 4RWYL 2A74A 2AV7A 1EEZA 4KK6D 1QRNE 2N7AA 3WFBH 2JCCB 2A1WL 4HK3N 1MLCB 1I1AA 4YUEL 4GG6F 2N56A 1QRKA 3GSQB 3X3FL 2M26A 4HJJL 43CAB 4HK0A 1MJUL 2HJKA 3VXNB 4H8WL 5JDSB 1XF5B 1ZHBB 1J8KA 1IL1A 2DD8L 2D0HA 5FM5M 3HMXL 1LO4L 1JWUB 1JHLH 4U1KB 3OAZK 4KKNA 4NCC1 2AK4D 4JVPA 2X10A 3CDFA 3DVGB 5SWZD 1JGLH 4LHUD 3BZDA 5ANMA 4MJ2A 4KJYA 2QSQA 1NFKA 1U8QA 3LB6C 3HLAA 3O4OB 4PJGB 1T83A 2QEJA 4U6TA 5EORH 4N5EC 3QNXB 2D0GA 4JRXD 4LOUC 4QHUB 2XQYG 4RGND 1EZVX 5I19L 3V2AR 1J9CT 1WC7A 4PJDA 4Y16C 3CFBA 1KB5H 3C5SB 2XFXB 2IPTH 4MNQB 2DI7A 4ODWA 2C4FT 5BXFB 4HMCA 3IDJA 3MV7D 1KC5L 4DEPC 4GQPH 2VLKE 5DMGD 5TF1L 4J23A 3P9LB 4KC3B 4JHWH 4FTVD 2C5DC 5HVWA 2LTQB 4RGOH 4I18C 4MA1C 2CDFA 3O41B 3U46B 2QQKL 2OK0H 1DBJL 3VFVB 3O4LD 3PQYD 5MEOA 1RJYB 2OLDA 2ESVE 4OCSH 4HWBH 1EMTH 3JUYA 4LLMB 3VGAB 1R3KA 1DVFA 1CG9A 4M62L 3KYMA 2O93L 5A16B 4NN5B 1F3JA 1NBZA 3ILPA 2V2XA 1H8NA 3MLRL 3V95A 3P73A 1S9WA 1FORH 3U7WH 2HJKB 3VXNA 2OXHA 3SDDA 5IBLC 4G5ZL 1AGCB 1L7TL 4JFOB 3CXHJ 2EH8L 4JM2F 4Q97A 4KQ3H 3H9HA 3QDGD 4JZJB 5FO9A 1OM3H 1IZJA 4OQ1A 1F4XH 4HIIB 1F58L 1A4JB 2HT2D 4G80A 3BWAB 4ONOA 1INDH 2I26N 4MD4B 4P5MB 1WIOA 1NCAH 2CKNA 2AVGA 1BECA 3U83A 3WIIH 3SOBL 1LK3L 4QRRB 3HZVB 4LRIA 4O58H 5DEFA 5EUOF 3VFUA 1YDPB 3OJMB 4GSDH 3HUJA 1A7QL 1CFQA 2WZPD 2F53B 3I6GA 4PLOB 1KIRB 1H3GA 1YECH 5JXAL 4X83A 1R5IA 5I71C 4PRPE 5C0CB 4Q6YA 1IEBB 4K8RH 5ESAA 4ZOBA 4ZYKA 5SWSE 5DYOB 5LAXB 1OB1B 1AIFA 4JY6A 3MV9A 3IDNA 4I48B 4X0KB 3V5HA 1J1OL 1IAOA 3F6IA 4I2XA 2DLFH 3RUGF 4J12A 2JELH 2VXUH 4ODBD 3MFFB 4Z9KB 1H3UA 4OZHB 3TBYA 5KJRL 1RK0A 1MCOL 3ZTNL 1MJ8H 5D5MF 1QYGH 5DJ0A 5EZJA 4CADB 4DK3A 5D5ME 3MGAA 2OP4H 4HULB 1F4WH 2A0LC 4F8TA 1NGZA 2A73B 5F1OB 2DQIH 4OF6A 4P5TC 2O5ZH 2ZUWA 3I2CH 3SDXE 1BMGA 2W9EL 3VGDA 3L6FA 4AL8H 4F33A 2BSSB 1SY6L 4GAJH 4X5XA 4FNLL 2YPLA 2VIRB 4YE4L 3BEVB 1NCAL 4KTDH 1HZHL 5T33H 4Y4KC 5MENB 4MXVE 4FQHB 1WCQA 1G7LA 3GBLA 5CHNA 1D5BB 2R0LH 2GSGB 3TNMB 5HHQA 1XAUA 5CJOH 5FGBC 3S37L 4WFED 2ADIB 1RIUL 4LRIC 4YK4C 4OQTL 3PGFL 4R96B 5KTEL 4IOFD 1CT8B 3O3AB 3EJZC 3FO1B 4ZS7L 1FORL 4HHAB 1DP0A 3UBXB 5HY9B 3ES6A 1X5FA 5AYUL 3P30L 3GJEA 3OB0K 3WYRA 1T04A 1QVOB 2IADB 1UWEL 4FQLL 5FYKL 2FH8A 1JPFA 4NCDA 4MB5A 4BH7A 4XH2B 4NQCA 4WY7H 2F54D 2GY7B 3O6MH 5DQ9A 3OJ2C 4DKFL 1NMAH 5F3HA 3QDHA 4OZIA 1B0GB 5F70A 2I9TB 5GHWL 2VLMD 3RNQB 4KJWC 2AXHA 3MRDA 4P5KB 5ELIA 4RRPG 3MROA 4JN2A 1CDYA 3U9PH 4F33B 1FIEA 2IPTL 3QDAA 5BS0D 5DMJB 1YEGH 1LEGA 4LLUB 1RHFA 3QCTL 2DLIA 5TE4H 2VISA 1M6OA 4TNWK 4Y19A 1IC5L 4NOFA 2OP4L 5C2BH 3F12B 5ALCL 2AJ3A 4YDVA 4YGAB 5DO2C 3QUXB 1GOGA 4PJEA 3FFCD 2JIXB 1U8LB 3TA3C 1J0YA 4FTVE 4JFDE 3RL1B 4JREC 4KMQA 1WAAA 4CW1A 3T2PA 1UXWA 4G9FD 2HFGL 3CC5A 5EU6D 3S36L 4JM4H 2VXSL 5IR1B 2DQHL 1L0YA 4I3RH 1KTLA 2VXUL 5J11C 3KPPA 3MGOA 4O51A 5CEZL 3AB0C 2ZCKL 1BVKA 2ICWA 5LQBL 1OGTB 5JQHC 1NAML 2DD8H 3QIWC 4P2OD 1Z0NA 5FYJH 2FGZA 1BIIA 2QQNL 3L7FB 5H2BA 1GGUA 3GSNB 5E1AB 3IDMB 4ODHL 1B2WL 1MI5E 2RIKA 4NFBA 4WENB 3HNVH 4NUJA 4PGDA 2G5BA 1CFNA 4HIXH 4NZRH 4LKCA 2JTDA 2ZUQC 1KNOB 4YLQT 5IMOA 4YDJA 3RAJH 3VXRD 2JCCF 4IDLA 1KCLA 5LGJB 3QDGA 3OGOE 5EU5A 4KVNL 1U36A 4JKMA 3JTSA 5IGXL 3QRGH 3ECBB 5BZDA 5TDNB 3CH1B 1MLBB 2FX8H 4QNPF 3O3EB 4V2BA 1INEH 5FEBA 2VDRH 1OSPL 1XR9A 3FRUA 1FNAA 3DTXA 2IGFH 2JK5A 5D1ZB 1PX3A 2CIIB 2DJUA 1YC7A 4RNRB 4Z7UB 3LOWA 3JZ7A 1Z3GH 4URTB 1T7YA 3ARXA 4CMMB 3VRJB 1RUAH 1TJIH 1VHPA 4ZD3H 2P44B 4H5SB 1LDSA 5CEYB 4WW2A 4XWOD 5BQ7B 1N64H 1AJ7H 4WU7A 3VMPA 3D3VB 3MLRH 1E28A 2D4DA 3L7EA 5C0CE 5BVJB 4MX7B 5IHZA 2PKDA 3MNVA 4Z7OF 4XCNA 5D6DC 4BM7A 1MAJA 1S7TA 2A2QT 2PTUA 3UTSA 1OLZA 5EUKB 1BIHA 5BMFH 2NNAB 3VFSB 4XNUH 4AMKL 3IXTA 4F3FB 4BKLA 5GZND 2EC9T 4KTYA 4PBVC 3WJJC 4ZFFA 4HC1H 1CFTB 3AS1A 5GGVY 2CRYA 3TO4A 2P46B 3PDDA 1C5BH 4NKDB 2DBLH 1EFXD 3S9DB 5TF1H 2WAHA 1N4XL 3ARQA 4OB5L 2IAMA 5F44A 3T0DA 2J8UF 3OR6B 3O2VL 2QSTA 4XPGH 4J1UB 4UAOC 1JTOA 5DC4B 4R96A 2GI7A 3FQUA 1EO7A 1A5FH 1BM3H 1FVEB 3BIBX 5IB5A 3EJYD 1RZJH 3CUPB 5L8LB 5K9OB 2V5SA 4TSAH 2WLYA 3OKOB 4Z95L 3LEXB 4M7JH 4FFWD 1AGEB 2FO1A 3KPQB 5DI8B 1KCUL 2BSTA 2XYCA 3SGJA 6FABH 4QT5A 3GMLA 1QLEH 4Y16A 5I1IL 3BUTA 3C6LC 5B39A 1BP3B 3STLB 1YMMA 4W6YB 3DMMB 2BNRB 2NY3C 5T5NF 1JL8A 5GS0L 5I0DA 3L9RA 1MCRA 1BFSA 3O4LA 4X7DC 4LDLB 3LIZH 2FEDC 3RI5F 3NCBB 1U8KA 1CXIA 5L8KB 4YX2H 2EE2A 1FO0B 5DVMA 2NW3B 2X40A 4V1DE 2A9ML 3LZFH 3MLZH 1S7XB 4YUEH 5C0JB 1BD2E 1KFAH 1IKFL 1X3DA 2OJEB 4X4XB 4XCCL 4DVRL 1A7NH 2JCCA 5E7BA 1CDHA 2JJTA 3KR3L 4K71B 2ZSVB 3B9AA 1T89A 4QRPD 1MCSA 2EE6A 5AD0A 2VABB 4RDQF 4PB0H 3QDME 4YFDB 2O5YL 5F7DA 4U31A 1RVFL 2DM4A 5C07D 1PDKA 1MHCA 2B0SH 4I18B 4P46B 1X7QB 4OQTA 1CFVH 4EDXB 1FPTL 2P7TA 3L3OA 2V2TB 4M7LH 2P48B 2ATPB 3BEWB 1YYMH 1N59A 4F15B 1KCUH 5D2NB 4R8WL 4LSUL 3F7YA 2KL6A 4K7PH 4KPHL 1JFQL 3EO0B 1CF8H 3FB5B 5FOJA 4YZFF 3QP3A 4LNRA 4Z0XA 4L8CB 4FG6C 5KVFH 4LAJH 4LQFL 2H1PH 5GXBB 1V3LA 2OTUB 1F3DH 3G6AA 3VRJA 3RY6C 1EPFA 2FECL 2R1YA 3JWOC 3MO1A 4YHML 2HLFC 4NKMB 1OTSC 4ODUA 4JZJC 4UQ3A 1R3JA 3NFPB 3H42L 3LDBC 4JFQB 1M71A 3TJEL 1IGMH 4MD5B 5T1KB 3ILPB 1EEUA 3EYFA 3CFIC 4XWGL 4RAUA 3T0ED 1NDGA 4AMKH 3KJ4C 3MPCA 1MHHA 4PRHB 4E5XA 4NYLA 15C8L 1CGUA 3ZKMD 1OTTC 1DQJB 4MDIB 5TFSL 3D0LA 2R15A 3I3EA 4NWUL 3E8UL 4LLVA 4ORZC 5FAAA 4LSQH 4AIXA 2E7LA 4WI8A 3K2UH 1JWMB 1NBVH 1JVKA 1CS6A 4JPKL 5DURB 2XQBL 3PWVA 1D3CA 4QRPA 1U92A 2ERJB 2ENSA 1N8ZB 2W60A 2W9DL 3QRFM 2NZ9D 3V4UL 3QZWB 4JN1H 1BBJB 5B38B 4EXPX 1U3HB 4D0DA 4CN4A 1ZTXH 1KXQE 3QZWG 3UTSE 3DO7A 4GRLA 5IW1B 3BPCA 4NQTA 4WI6A 2ZG1A 2VERN 4K2UL 4LHUG 3BKCL 3PHOA 1JNLH 1NC2D 3TYFB 5ISZA 3RAJL 4DZBB 3B9KB 4NZTH 5E2TH 1P84K 4PB9L 1YQ2A 4HIXL 1HILA 4JCMA 1MCIA 3DV4B 3TV3H 1UH2A 4K9EH 1MQ8A 3RNQA 3ZKXB 4PY7A 1Z6JT 1UACH 4DAGH 3P9WB 4XNMA 4FMKA 2BDNL 4PJIA 3L5XH 4P9MH 3GI9H 3PHQA 1GVIA 4NQCB 4QXGL 4DVBB 4OD1L 2BRRL 4Q9RL 1T4KA 4QYOA 4BSWB 3U4EB 5JHDB 4ZNEE 1EVTC 1NGWA 1IC7L 5F9JA 2D31B 2Q7YA 3V7AG 3P9MA 3T2NH 3BIKA 4Y19D 5EZIH 1FG2B 3QULA 3GMQA 4L9LA 5CS7A 2BNRD 1YEJH 3MLWL 2YD2A 4S1DC 5J6HB 1UXSA 1JPTL 1JGVL 3EOTH 3A6OA 3VXSA 4PJAE 1E4WL 5HI3C 4XXCC 3PWUB 2I24N 3CSPA 2WSKA 1AXTL 4S1DD 4JDTH 5EN2A 1B9ZA 3IDGA 1NCBL 1UB6B 4DWHA 4XNZC 3DBXB 1FIGH 2QSCH 5D8JL 1KLGA 1MQKL 2H8PB 4PRHE 4XC3L 4JVWA 1N2RB 4I18A 3REWB 1KXVC 2HT4D 4M02A 1QR1B 1GHFH 1X4ZA 4JFFE 4NQUA 4Z7QE 4PJEE 2YUWA 3ARED 5F6IB 4S2SB 1ERNA 3LN4A 2AK4E 2UWEE 2EXWD 4JO3H 3NH7H 2VDNH 3MLSH 4PBWD 1U2HA 4Y19E 2YA2A 1Z0MA 4HMDA 2J7LA 3I75A 2LU3A 1NGZB 5JQ6L 5HYSB 2IPKB 1KCKA 5ERWA 3Q5TA 1AY1L 2P5WE 4O9HH 3RZCA 1KBGH 3L3IB 2ITCA 2W65A 4Y5XC 1KENL 1IM9B 2MCG1 3VFTA 2GJZA 2XG4A 4S0SD 2I5YH 1BEYL 2HH0H 2FZ3B 5F7MC 4HIJA 5FB8A 3CGTA 3TBYB 1KN4H 3LD8C 4U1LB 1ZSDA 2C7UA 1QFWH 4OKDA 3X13A 4MAYA 1YEIL 5KS9F 4MLSA 4R0LB 3J8F7 4JPVH 1MELA 2BCKB 3BQUC 1N2RA 5EO0B 5E56A 2CIKB 4PP2A 3WS6C 4KMTH 1IC4L 3GK8H 5FCUL 3GMLB 3UPRA 4XCEB 1X5IA 1XZ0B 3GI8H 3WNOA 3DO3A 4EI6A 3BT2H 3WL9B 1HNGA 3RPIA 3SDAB 1NKOA 3D9AL 4UQ2A 1H8OA 1WQVT 4EIZC 1OCWL 3MC0A 3QI9B 3UTOA 2DB8A 1I3UA 3CFJA 1AO7D 4P3CL 2JF1A 5GRVL 3CFKB 3HZVA 1RZGA 4Z7VB 1GJIA 2P5EA 5IROC 1C5DB 4ZFZB 4MNGE 3QUZC 2VDQH 2K7PA 1FZMB 3LDBB 5IHBA 1DN0A 4TYUA 1YJDL 3AFLA 1AKJD 3Q6GL 5B3NA 4NWTL 4HEPG 1YNKL 2EDBA 1GGYA 1EFXA 3WJLC 4QHKI 1ZE3C 1AQKL 2JB5L 4K7FB 1T7XA 5SX5K 4OLWH 1UB5A 4R26L 1J1OH 3RWJB 1NCUA 3IB4A 3U7AA 4KRPD 3VJ6A 5BOPA 1LP9A 4KZEH 1OAXL 3LS4L 2YEZB 2WBJA 2XPGA 5FM8A 4PJHB 2XTLA 2B1AH 4XCNB 2FBJL 1MCPH 4L3CB 5H35A 1W0YT 2R4SL 4G8EA 4X6CB 2D7TL 4OCYL 1JF1B 4YHZL 1MREL 2Q86A 4KRMB 3E2HB 1JNJA 4GSDL 5GGQH 5FOBB 3R4DA 3DECA 1CICB 1CU4L 1RY7B 2GCYB 3ZKSD 2FX7L 4XBGA 5DK2A 5BOZG 1CE6A 1ZGLB 1TITA 3HPLA 1T1YB 5HJ3A 3GSOA 4QHNA 2VXQH 5HPMA 3K4DA 5T3XH 2R0WL 5TDOA 5E6ZA 2H26A 3FZUC 4EVNA 3JV5A 3OKYA 4JY4A 3BZEA 4NCC2 5I8KL 2XA3A 4L8DB 4HBCH 4WEBL 5SWZA 4PRIA 4HJ0C 1CD0A 5HDBF 4N0CD 3RWIA 1U93B 2VLRB 4I9WE 2HTLD 1IGYA 5GRJL 2AKRA 1ZANL 1K5NA 3G5YA 5CBEA 4DN4H 2BY0A 4HIHA 4GMTL 4HUXA 1I75A 1KGCE 1SJHB 5GGQL 5EPMB 3LN9A 2FDBP 2R9HC 4NC1C 3VD9A 3S37X 5EPMA 3ZDYE 5IT2H 2ZUXA 4NPYA 4HT1L 2CLRB 2QTEA 2EEAA 2BNUA 4OJFH 1FGVL 4HWBL 1OAXH 2QHLA 4XRCB 1K4DA 5CCKL 2VUOA 1FG9C 2PYEE 2FO4A 4Y4FD 4WTZG 3HAEG 4DTGL 1ZHLA 5AZ2H 2MCPL 1J1PL 2H32H 4F7TB 3D5OF 4ODXB 4JO1L 5IB3B 4UQ3B 4M5ZH 1KIQB 2NXYC 5IK3B 4NKMA 4H0IA 4KKBD 3E6FA 3GSQA 4XZUA 4XP1H 5J1AB 3UTZB 3WHE1 3NBNA 5JO5A 5JLZA 1R3LA 5EUOB 2VISB 3U0TA 3QWQB 3SPVB 3MRNA 1NSNL 4MNGB 1G7HB 2NXYD 1LEGB 3A6BL 4LLUA 1OCWH 4EUPH 2YD7A 3D9AH 4LSTL 1FVCA 2NY4D 1BX2B 5H37H 2ESVA 1WAAF 2R2HB 2YN3A 2NY1B 1OP3H 1DE4A 4NIKB 2BVPB 1XGRA 4OAWB 2D4FA 3WS3B 4M5YL 1FC2D 1RUKH 3MBEA 4W81A 4OIIH 5ADPL 5FYJU 4JVUA 5FKPB 3V79C 3TBVA 3VG0H 1YEIH 1U3HD 2ZKHH 4N9GB 3SGKC 3LH2H 3PV6A 5F1KC 1JHLL 3FO0H 4P2RD 1YN7B 4XH2A 4WW2C 3K4AA 3B9DA 1KJ2H 1PYWA 4ZMAT 1M7DA 4UILH 5GGVH 3L1OH 5JR1L 3IDIA 1MJ7L 5HGAB 4BFEA 3ULUE 4APQD 4MCYB 3KLAB 3ZDZE 4KK5C 1FRGL 2F8OA 3H9YA 4XP4H 2RFXB 3ISWA 1RZFL 1VADB 3SQOH 3T3ME 4OD2A 2B39A 1B6DA 1ZT7B 3G5XA 5TPWH 2YMXH 3RUGB 4WW1A 2NCMA 5KVMC 3BPNB 3MV9D 1G9NH 3MX0A 3VRIA 1DFBH 1ES0A 1GHFL 3W11C 3O4LB 3GSVA 4P2OA 3KPSE 2FYYA 2GTZB 3DYPA 4M7LT 1SEBA 4IJ3B 1BQHA 2OR9H 3GMRA 4RMWA 1X4YA 1MPAL 3ESUF 2YPVH 3IU3B 4PRNA 1EX0A 3GIVA 2K3TA 4OLEA 1KEML 3BMVA 1HSAB 1I9IL 4FRWA 3ZDYF 4JFHD 3W2DH 5L6YH 3B5GA 4FQIH 3T1WA 5IW6A 3NIFE 1J86A 5FV1L 1KJ2A 1RUQH 4C83A 5LXGH 2A77H 1BOYA 5D7JC 4F7CB 3TN0C 3U4BH 2XKSA 3ARBA 4MA7L 1IGCH 2B2XL 5E24E 1GPOH 3KPSD 1NLBH 1WFUA 3IDNB 4QWWD 4JFPB 3WDHA 4DAGL 3GKWL 3HUJF 3DHJA 1XFPA 1JUFB 1QHPA 1HHIB 1V3KA 3T1FA 3O2WL 3TT3L 5HHNA 2DQCL 1U8NA 2EDEA 4HCRH 4PS4L 1P4LB 4XHQA 5AZEH 4GAYB 2AXFB 3NCFB 2AQ1A 2FB4H 3OX8B 1Z9MA 4Z7WA 5TJWK 3MLYH 1PY9A 1REIA 1FZJB 2V2WA 1IC1A 1MCDA 4JQIL 4MQ7B 2YKLL 4WIQA 5J4MA 2CJUH 2X1QA 4KJPC 3QULB 3I3BA 2HT2C 3MYZA 4P5MA 3RKDC 5I18H 1FNHA 4Z77A 5ALBL 1QA9A 4PJ9D 4K7PY 5I1EH 1G9EA 5FDYA 3OB8A 1A1OB 1IGJA 3D6GA 2X4OB 3U0TB 1K8DB 4O2CB 5JW3L 1IAIH 2V17H 4J4PC 3QHZL 4X80H 3CVHL 1MFDH 3NTCH 2P5WD 4P49A 5C1MB 3DIFA 2B1HL 3G04A 3HNTL 1NQBA 3PXJA 4OFKA 3MV8E 5EO9B 1EAJA 2V2XB 2FB4L 3KXFB 2NTFB 2ZUVA 3UPAA 5LWYL 3ROLA 1SBSH 2YA1A 3A6CL 4MAYD 5AAMA 1OL0A 4ENEC 3ULVF 3OAUL 2ID5A 3DPBA 4ZSOA 3T0AA 5HI4D 1BIIB 5I8EB 2R1WB 2KKQA 5C9KA 4G9FA 4OCMC 1ZLSH 4AQ1B 3TC9A 5CGYD 3IJYA 3SKNA 3INUL 2NY7L 5C0DB 5DTFB 3CK0H 1XF2A 2CKBA 5T1KD 1VPOH 4TVPE 4NO0D 5KS9E 3ULVD 5TDPA 1F4HA 4XNQA 3BZFB 4YDKL 1OAZH 4EJ1C 1SVCP 1G84A 3KPNB 1TFHA 2E8ZA 3IAQA 1WBZA 3TNNA 3TCLB 3W2DL 5L6YL 4NZJA 5IM7A 3TBSB 1IJ9A 4NUGL 2AJXH 5D93B 1I9IH 3L5HA 5C92A 5J06A 5IEKB 4MQTB 4NOBA 1DTUA 3QUYA 4FXKA 3MROB 1DLFL 3V6ZA 2HMID 4JANB 1BHGA 1ACYL 2X9WA 1G7JB 1CICA 3G9VA 3GEWB 3DVGA 4Z7QF 5ITBH 4X9FA 5D7IF 3SJVB 1EHAA 1T20B 3INUH 4XNYL 2Q86B 2DF3A 1QO3A 1QTYT 3EOAB 3H9SA 3RZWA 4X6DA 4EUPA 4PTTB 3NABH 1F6LL 4ODUB 3WNNA 1H5BB 4PRAB 5C07B 4YHNB 2FNBA 3MJ9L 1I1FA 5IKCB 5DEZA 5DUBB 4K3DH 3DURA 1LP9B 2VDKH 5J9PA 5IIEB 3DRQB 5I8OL 1RAMA 2OTUA 3HI6L 3RGHA 2NY6C 4L8BB 1IZKA 1FFOA 1R3HB 1N0LA 5IMKA 4OLYL 2EC8A 4FQJL 5LGHH 4OIBA 2A74B 2B1HH 1YY8A 1C1EL 3VFRA 3MV11 3TEUA 4JO2L 3UYOD 4FFZL 5T1LD 5JR1H 4LVHB 4B53A 1JGDB 4NRZA 1J12A 1KJ2L 3SE4C 1S9VA 2ARJQ 3BEWA 3RIFF 3BH8B 4XPTL 1F42A 4L8SC 3QWRD 1VB9A 2CUIA 4OD3L 3LPWA 4YGVB 1CD8A 3PWPB 4Q6IC 1XGRB 3VI4E 3GDBA 1IAKB 3MRKA 4Z8FL 1F8TH 3WFHB 1BBDL 1DL7H 3O6FC 3UPRB 1TJHH 4Y2DA 4IRSC 1LEKA 3SDCB 5J6GA 3FQRB 2H6PA 3FO9B 4OLUH 2P1YA 2EYSB 4UT6L 1OAKH 4Y4KA 5DJ8A 1HHKA 3H0TA 3KYKL 3G6DL 4U6YA 3TT3H 4MCZA 1H0DA 2BFVH 5IK3A 1A02N 2AXJA 5INCB 2ICWJ 4OZFG 2ZG2A 5EZOL 2DBLL 3CXDL 4F9LA 1SVZA 4PJGF 1WZ1H 3CPLA 1HYSD 5DA4A 1MCNA 3IGAA 2EKSB 4YK4B 5EB9A 5SV3A 4R0LC 5F3BA 1UCBL 5DQJB 1IBGH 1EHNA 5ESVA 5BMFL 3KPLA 1QSFE 3GSXB 1LHZA 4NN5C 4X98B 5GS0D 2IJ0C 4N0UE 4F7MA 1I9RH 2Y25A 4JFHE 3FL7A 1NCCH 3P3YA 1A6UL 4BJLA 3DWTA 3QDGE 1ND0A 2XRAL 5F88A 5TE6L 1K9TA 2MQ0A 2VLRD 3MLTB 2PETA 4QXTB 3Q6FB 3RIFK 5F8RC 1JZ2A 4HIHB 1I1AD 1QSEE 3PP3H 5D2LE 4C56D 4LHQB 4LSDA 3B2UC 5F1IA 4NZUH 3DMMD 4XPFH 1WZLA 5MP6H 5CJ5A 2Y07H 3PWUA 1XR8A 4R9HA 4U1SB 5C8JA 1X4XA 2VDRL 2XIDA 4JE4B 3ZDZF 1J0KA 4JY4B 3BZEB 3QUMA 1G7QB 4JRXA 3WFCL 32C2A 5KVEH 4GRMB 1X5ZA 2OL3B 4TQEL 5IGXH 4PYHA 2P49B 2FHCA 2J6EH 5JW4N 4M48H 5J9PB 1MSPA 5DHXB 1AGCA 4O5LH 4AEFA 5HXMA 1HHGB 4HZLA 1Y0LB 5IROA 1PW3A 2FSEA 3ARYA 1CLOL 1QFOA 2VLKB 4GS7C 4NZRL 3VXPA 4X6DB 4NO0B 1JHKH 1BOGA 3T77A 3P0VL 4UI2A 1FRGH 5FF6A 1P6FA 4XNMB 3ULUC 3CMOL 4JFEB 1GYAA 3QUXC 4Y5VA 4HV8A 4WHYH 2Q1EA 4WHDA 4HUMB 4MAUL 4ZTOH 5DRNB 4UILL 1F00I 1NAMH 2VZVA 4Q58C 1RIHL 4YFLI 4CVZB 1KCVL 1P7KA 2D03H 4EN3C 1YA5A 3QIWA 4PLKD 2CIIA 2NMSA 3N1QC 3C8HA 3QFDA 4I4WA 2E6JA 2YC1B 8FABB 3L3JA 3O41A 2X09A 1X5KA 4PJ7A 4BYHA 4H1LA 2ZPKL 1ADQA 4GXVH 3EJYC 3RTQB 3S98A 3KPNA 1ZS8A 5D5MB 2X4UA 3LEVH 1TTGA 3MV01 3TZVB 5IW1A 4GAGH 5HHMD 4UOW0 4FFWC 1Y18B 1CL7H 3S3SA 3UDWC 4D0DB 2O61A 3C8DA 2P43B 5GJSL 1PD6A 4YDJB 4CL7A 1DBMH 3JTTA 1EXUB 1OAQL 3EYSH 1S7UA 4TUOA 4ERSH 2M2DA 5DZOA 3OXSB 3SDAA 1BGXL 1ZWIA 3BP6B 1Q0YL 1CGSH 1UJ3A 3R8BB 3H9SD 2Z8RA 2OI9C 4X6FB 2XI9A 1LWRA 2AEIT 1WBYA 3DXAA 5KVGH 4NNYB 2FECI 4HEME 2O26U 2DRUA 4Z7WF 3FT4A 1U91B 3O6ML 3FT3B 3NACL 2MTPA 4GKOA 3PL6C 1KN4L 1ADQH 4P4RA 5FUCC 4P3DA 2FZ3A 4ZAKA 2X4PB 3QG6B 4MAUH 5GGRY 2UUDK 4M6ML 5JDSA 4LVNB 4LPTA 1KENH 3UJTH 1BQUA 4G6FD 2WUBL 5DJ2A 4HX1A 1FNEA 3C9NB 5ERWB 4U6HB 1FZKA 3ELAT 3RDTA 3P2TA 5HGHA 1CXEA 2EEBA 3RWFB 2AXGB 4JM2B 3KS0H 1X5GA 3ZMRA 5JMOC 2O5XH 1FVDA 2QADB 3GSWA 3CNKA 5FYLD 3E6HA 4U7KA 3WFHA 3TYGH 3LCYA 3UO1H 3HI1A 4S1SL 3WFCH 3RNKB 2GSIB 1HH6A 5DT1H 3U2SA 1WK0A 4WEBH 5KVDL 2H8PA 2E5EA 2GHWB 1T3FB 4JQVA 1KIUA 2H2SC 3D25B 4GAYA 4YE4H 5JIHA 4HC1A 4XVUC 1QRNB 3B9KD 1K4CB 1T04B 4PGCA 1FV1A 5D1QA 3NCJL 3TJHC 1MFBH 3JV6A 4WUUE 1UJ3C 2E7HA 4NO3B 1TDQA 1ZMYA 3W81A 5DMKA 4YDLB 1F4WL 5ADOL 1QP1A 1BFOA 1OT1A 5CIPB 3MLWH 1MHCB 1R0AL 4M4RA 2XTJD 4AZ8A 4GRWB 1NCCL 3QIUC 5DJXB 5F97E 4ZXBC 2D31A 2Q7YB 5J3HD 1CI5A 4FHBD 2XN9E 1K2DA 3K2MC 4JGMA 1MCOH 1UZ8A 2ZUYA 2VXVH 3IVKA 2Y6SD 3NMEA 4OD1H 4TVPL 4NQVA 1O7SA 2OL3H 2EXYC 3S35X 3DUUB 3I6KB 5L0QC 1AQKH 4FABL 4RX4D 2AJYL 1RHHB 4PLJC 3VE0A 2X4PA 3QSKB 2VIRA 3QO1A 5T5FH 4NJAL 5MERB 4AH2B 2YWYA 1QR4A 4PJ8A 4R7DB 4P3CH 4KGJA 4HKBB 4MJIE 3EDKA 1X9QA 5E2TL 5H94A 4OLUL 4P23C 3DMMA 2DWEA 4OBSA 4N8VG 3H7BA 1CDCA 4LRNH 4MJ6A 3N85L 3AGVA 5E9DD 1JNLL 1BREA 2VR5A 4KUZH 2QJDA 4JCLA 3U82B 4IIQA 2UYLA 5DI8A 2EICA 2BOBB 4NQVB 3U30C 2GITA 4DW2L 1BZQK 2UY7A 3VW3L 4UINH 1UZ8B 3OXSA 3KPRE 2GT9A 2R0ZL 1PZ5B 3QDJE 5DUPH 1FDLH 3X3GL 4JKPH 4E41E 1I3GL 3PWLB 1QFWL 3I3DA 3T8XB 3QIBB 1HKLL 1DBBL 3WLWD 4LLWA 4MCYA 2VLJD 3H7LA 5JW5A 4LASH 4ZYKB 2APFA 4JO2H 1A21A 1D9KB 3S3PA 4EI5D 5D1QB 5T1MB 4HMEA 5CZXC 3AU1B 4Z5RB 3MXVL 3LQZA 5JQ6H 1JYXA 4LU5H 2A38A 3DGCR 4XCFH 3T3PE 4CVZA 3MLSL 3NH7L 2PO6A 1K6QH 4OCSL 4YIQB 2FGWL 3OKNB 1IKNC 1F97A 5GIRA 3QG7H 4N0UB 2QQKH 1RSFA 1DN2A 1GH7A 3L7EB 5D7SH 5BVJA 3FCTA 1V7NH 3LVEA 5E2WH 1YEDB 3BH9B 3QCVL 4H25A 5C2UB 2X4OA 4XC3H 4B41A 1A6TB 3MFGB 5A2FA 2YA0A 3FAWA 5L2KB 1KC5H 1H15B 2V7HB 5C7XL 4P4KA 3MZTA 2J8UB 3QI9C 3NAAL 2V7HA 1G6RB 3WIFA 3E6FB 1UEYA 4PIRF 5KSBB 1N6UA 3QUMB 3C60B 3EOTL 4ZAKB 5DVKA 3ARGB 3WDIA 4PJFF 4KPHH 1VKXA 2APBA 3CU1A 4R8WH 1KELH 1UGNA 3WSQH 3VD7A 5EZIL 4ZUWA 4N0UA 4MGXA 4LSSL 3PGDB 1QSFA 2BMKA 1LILA 4YIQA 3QFJA 3JV4A 5I71B 2H32A 3N85H 4MD0B 2BNUB 3ARBC 2ZNXA 1CDIA 5IMOB 3BXNB 1GC1H 5E6IB 1NFDE 1HH9B 3PP3K 3D18B 4WFHD 2X7LB 1S7RA 4YBLC 4WGWB 5TF0A 1UACL 1KJMA 3RWHB 3FOMA 3CSYA 4F7MB 3H2WA 3IXAB 1KJ3H 3K8KA 4HIEA 3QNYA 5EDXA 3ZE2F 3A6CH 5I1CH 5E08H 4PJ7E 4WI7A 4MJ5A 2VLRA 5E8OB 4M93C 4BSJA 1K8IB 4TVPH 4H0HB 2LABA 2YUZA 4PJXB 1S7XA 2NLJA 1PZ5A 5C08D 1S7QB 3QEQE 1D5IH 4UT9H 4QF1A 1EV2E 3SDDC 5GQBA 1FFQA 1RI8A 5I1GH 3UTQA 4HH8A 3HG1D 2F8VA 1F11B 3O0RH 5GRWA 1IAIL 3L9RB 4ISVB 5GS0H 3HPLB 4IS6B 4Y4KB 4J3VA 4YPJA 3HC0B 1SEBB 3AB0B 4ZFOB 4XBGB 4NZDA 5EU6E 4M7KL 2X4QB 4XC1L 4MA3B 5FDWB 3V4UH 1AD9A 2QBWA 1MHPH 3HNSL 3UYPA 2ZNWA 3WKNA 2WUCH 4LKXB 1NCNA 3V8OA 1MRCH 2BVUA 1UM4L 4P9HL 1S9XB 4KFZC 4KI1A 3BP4B 1OF2B 2NW2A 3VJ6B 4XVSL 2Y5TB 3RGVA 2EH7L 4LL9A 3WFEL 1CICC 1S9VB 5JW4R 2DQUL 3VWKC 3I6LD 1JZ4A 3EYVA 1JGUL 3DROA 4Z0BL 3V0VB 1V8HA 4UT7H 3BX7C 3ARSA 3BQUD 3VCLB 1NUDA 1DSFL 4X7SL 3V6OE 4WV1A 4Q6IB 1S9KC 1IAII 4OAWA 2GY5A 5DVLA 1JMZA 3OB0H 1AD0B 2YUVA 4Y5XA 1DEDA 3R1GH 5EC2A 2EDYA 3QCUL 1WFNA 2VDOL 5CBAB 4UIKL 1E4XL 1JFQH 4PP2B 3SJVA 1OVZA 4WVRA 5FA3B 3UYRL 1VENA 1IRAY 2CDEA 3MBED 3CLEL 4BUHA 1G9ML 1EERB 2DQDL 3EFDL 4P0DA 5MENA 3GKZA 2VE6B 2BHUA 5DJDB 5EC1A 3RTQD 4WJ5A 3HG1A 1FL5B 5DO2D 3A67L 1MCCA 5FGCB 4WFHE 3DTXB 4ONFL 1NAMB 4ZAKD 5IW3A 4BSVA 3LKNB 4M1DL 4Y2DC 2CK2A 4KRPC 1I7RA 1RUML 2GJ6E 1F6FB 3UTSD 3GSNH 4YWGH 3QAZB 4ZS6D 3FQXB 2WBJD 4WNQB 2OYPA 2NXYB 4NO5B 3AM8C 2DDQL 4KTEH 2OCFD 2CLRA 3IXAA 3SQOL 5IJVA 3S88H 3I85A 4LCWD 5BO1L 1I85C 1RJCA 4YHPB 1IKFH 5D93C 4N5UA 1ZT4B 2XICA 2J2ZA 3IJYB 2A9MH 3LZFL 3D18A 4EI5A 1GXEA 3RIAK 5CD3B 4ZO6A 1AGDB 3BW9B 1UB6A 3BP6A 2EIZA 2R2EA 2E7LC 2ZCKH 4U1HB 4KJWD 4ZUWB 1JTTA 2NY5H 3KXFA 4R6UA 1YDPA 2I07B 4Y89A 4APQB 2BXZA 1BLNB 1XIWA 1ZEAL 4HKZA 5DEGA 1Y18A 4GW1A 2HTLC 5KBNC 4AG4L 4OGZA 4Y4HD 4X5LA 3TZVA 4L9LB 4TQEH 1E6OH 3RUGE 1N0XH 3O6FA 4NN6B 4Q7DA 5EWIL 4WDIA 5C2BL 3OJDB 4JDZA 1CFSB 2NY2D 3MREA 1CXFA 4X6DE 3H9SE 1BFTA 3AC0A 3C6SB 2EDKA 5JHDA 1QSFD 3CFEB 4LF3B 1NSNH 4OZGE 4D0CB 1GSMA 3H9HB 5CMAB 4ELMB 1N5AA 4KJQD 1U42A 2HVKA 4TPRH 5DD6A 5GISL 4PJBB 4OF0A 5DJ6B 4RFEB 4PJIB 3O2VH 5E6IC 3LMJH 1CBVL 1NGXB 2P8MA 1MJJB 1NBQA 3SE9H 4OUUB 4XPHL 3TA3A 5GHWH 2KH2B 4OKVA 4M5ZL 1HHHB 2OR7A 4DFIA 3M17A 1NUGA 4DEPB 3ARPA 1C5BL 1C08B 5DWUH 1ZA3A 2HFFB 1BVLA 2AK1L 3GMOB 3RWDA 3QUYB 4FXKB 2C1PA 4Q9QL 4OZGB 2DBJA 5TE7H 3UTTB 5CCKH 3KGRA 1U9KA 2CD0A 5J13B 1G7PB 2HJFB 5C09A 1JYNA 3D39B 5HI5D 5FUOL 2AV1B 4Q9QH 4ZFZA 1FLTX 3RKPA 2F5AH 1XGPA 4OZIF 4FFVD 1QNZL 4FXGA 2DKUA 4LHUA 3WNKA 5I1KL 3S35H 1PG7H 3DOSA 1FYTB 5EOQL 1TZGH 4H1LH 1DUZA 4M8QB 2DQUH 3ZDXE 1L6XA 2R2EB