3BKJH

Crystal structure of fab wo2 bound to the n terminal domain of amyloid beta peptide (1-16)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
224
structure length
224
Chain Sequence
VTLKESGPGLLKPSQTLSLTCSFSGFSIRTSKVGVSWIRQPSGKGLEWLAHIYWDDDKRYNPSLESRLTISKDTSRDMVFMKITSVDTADTATYYCARRGFYGRKYEVNHFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSESITCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WO2 IgG2a Fab fragment Light Chain Kappa
publication title Amyloid-beta-anti-amyloid-beta complex structure reveals an extended conformation in the immunodominant B-cell epitope.
pubmed doi rcsb
molecule tags Immune system
total genus 46
structure length 224
sequence length 224
ec nomenclature
pdb deposition date 2007-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bkjH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bkjH01
2PO6A 1ZE3C 4ZFZA 4NRXB 1X5FA 2PYFA 1NBZB 4U7KA 4QXTA 5F1IA 3VFRA 1YEKH 4JPIB 3WS3B 1BD2D 3E6HB 2XY1A 3U4BH 3O4OB 4I2XA 1EEYB 3CLEL 1XAUA 4P46D 2BOBB 5L88H 2FBJL 2LU3A 1F4XL 4YHLL 2F74B 1IKFH 4YHML 1CGVA 5E9DB 4ZFFB 1RIHH 2WLYA 4HCRA 5F9JA 4ODVH 2ESVD 1M71A 3KPMB 3T2NH 3QI9B 1K5NA 4HXBH 2Z31C 4H0GA 1UXWB 1TETL 5T1LA 3VU2A 1CZ8H 4PJGA 4NWTH 5CILH 4R7NA 5I8OH 1X7QB 1IC4H 4MA8H 4NQVA 1H9VA 4L8DA 5DJYA 3SOBH 2PR4L 5KG9A 3OKNA 3VXRB 1KYOJ 2XZQL 3BPLB 4JB9L 4HBCH 4K55A 1TVBA 2BY2A 5DJXA 5LBSL 4U6YA 2RCSH 1X5GA 5DDHB 1FO0A 3OG6B 3O0RH 3QULB 3TBVA 3UAJD 1CXFA 3P4NA 5T1KD 5ICYA 5L6YH 1TCRB 1V3JA 4KAQL 3U4EB 2W0KA 5KZCD 3BP4B 2Y9RT 4JO1L 4W81A 1BF2A 3OPZH 3RJDA 5L0QC 5I1GL 4U6HA 2HVKA 4H5SA 3ARYA 1N5AA 4U1JB 4CJ0A 43C9A 2EC9U 4OZGE 3W82A 3QDMA 1G7HA 3S98A 3WO4B 3ZTNL 2DQUH 1G7QA 2BVTA 4MD4B 3TVMA 1I85A 4ELME 4QGTA 3ULUC 5IFJB 1RUKH 4OD3H 1TZHA 3RIAF 2WBJB 4F15C 5CGYD 1CIUA 3C5JB 5T3XD 3D3VE 5IQ9B 2B1HL 4D9RD 3GIZL 3ARFC 3QDJE 1OAKH 1NLDH 3BKJL 1HI6A 4LCCB 2OR8A 4P59L 1ZGLM 2APWA 4K23H 1MJJB 1T2JA 2G5RA 2JJUA 4PD4J 5IB3B 5CINH 4HAGA 1J86A 2XN9E 1RURL 4M02A 4J8RB 1DLFH 1AGDB 5D8JL 1U8MA 3MLSH 3A6CH 4XHJD 1RJYB 4M00A 1BFTA 1AR1D 1QACA 2C4FT 4CW1B 1CTNA 1CXIA 3FFDB 4POUB 1MSPA 2ICWB 1EGJA 5E95B 4JDVB 3BISA 4KK6C 4NJ9L 3SO5A 1B88A 1GIGL 1UCBL 4KVCL 1JHTA 2AV7B 5EU3A 3WFBL 5MEPA 3TBWA 2PXYA 3T0EC 2WW8A 4N0CC 1PFCA 4XAWH 1WCQA 2Q3ZA 3UDWA 3GSNH 2DLFL 2FJHA 3H9SE 2YPLA 4FQ1L 4IJ3B 4X5WA 2R9HD 1MNUH 3BWAA 3MUZ1 2Z91A 3HUJB 3GUTA 3RVXC 5EN2B 3ULUH 1WFUA 3LQAL 1Y6NR 3U0WH 1BX2B 3W5MA 1I8MA 5JO5A 4Z7WF 3BD4A 4TUOB 5HY9A 2WUBH 3FHQA 4ZPTB 1XCTA 2BSRB 4LVNB 4M48H 3CXDL 4TYUA 1KFAH 5GRXG 3BESR 4TVPL 1NMCC 3GBML 1I3GL 3K1DA 3W11C 3RGVD 1SY6L 3O2WH 1ORSA 1QR1B 5CZVL 1ZV5A 3W0WA 1XF3B 4HEME 5EOQL 5EU5B 1CVSC 1NQBA 2AEQL 4I0PD 2CLRA 5I1LB 5F96H 5DHVA 1AO7E 2H2SD 4GG8A 3QIWC 3QUZC 5D1QA 2UWEE 2AXHA 5JORA 2E27H 1Z5LB 1KTLA 3ULVD 1AD0B 5IB5A 4YDIH 5C0DA 1G7JA 4Y89A 2ADFL 4M7LL 1OAUH 4RAVB 4MQXD 2VLKB 2ENSA 4XZUB 1NJ9A 1UCTA 2V2WB 5DYOB 3ZYJA 5DRNB 1B4JH 1A7PH 3BKML 4XWOD 1AGCA 4P5TD 1Z3GH 1S7VB 2F19H 1G9ML 2XQBH 4Q2ZB 1JMZA 4OCRL 1WTLA 2D7MA 3UTSB 2UVEA 4FZEL 1JZ4A 5CLTA 5J06A 4XCCH 4OCNC 1FZJA 1PLGL 3SPVA 1MHCA 4J4PD 2EE3A 3C5ZA 3HNVH 3RRQA 2B2XH 2X4SA 3SKJH 3DXAE 5I1DA 3G5VB 2J3SA 4XVJL 4ZXBB 4JN1H 2HMIC 3O6MH 5FOBB 4N8CH 5MENB 5FCSH 1FVDA 1BD2E 3S36L 2A9MH 4HUUA 1A7NL 3EHBD 4YUEH 2XWBB 3MYJA 2VLLB 4NQCA 3ARDB 2AVGA 3B6SA 5DC9B 1FVEB 5CGMA 1KCRL 4PLKD 5F6IC 1OM3H 4NRZB 4ODXB 5ICXA 4UT6L 1NUGA 2ESVE 1FG2B 3CFBA 3MNVB 5FHAL 3IDIA 4U1KB 3SO3B 2FDBP 4LCUA 2AJXL 4IOSD 3QNYA 5IMLB 5IFAL 1T1YB 3QUXB 3TCXA 2RFXB 2OX5A 1PAMA 4GRWH 4OKDA 3WDJA 3OJMB 3BZEB 5E8EB 4I18B 1WVZA 5DHYA 1YMMD 1F6AA 5LCVL 4BK5A 4L3ED 1FGNL 4WW2F 5KVFL 3M8OH 4AIOA 1CD9B 1S9YA 3IJYA 2YUXA 3FT2A 4D0DA 2ZUWA 3DYOA 1IEAB 4JGUA 5DVKA 4P3CH 4Z7UA 3UMTA 5FM4A 2ZSWB 2FCBA 3T8XA 4WO4D 3PHSA 3MPCA 1R0AH 1JV5A 1U58A 1SJHB 3B3IB 3I50L 3WNKA 4YXHH 4OQTA 3I9GL 3S5LG 4JDTH 5TE7H 4IRJB 4UILL 4G6JL 1F11A 2G9HA 1MCOL 1VADB 3K8KA 4JHAH 3Q6FB 1KPUA 2OJEB 4XCEA 3WSQH 5SWZB 4GAJH 3SGJC 4KJPD 2DMCA 4PJ9D 2YK1H 5I76A 3IGAA 3V0WL 2MPAH 3WJLA 4P49A 5T3XE 2NX5B 1BM3L 4OLXH 5EO1B 5A16B 1C12A 1NGWB 3MOAH 3QHFH 2IADA 4R2GD 2C3HA 4Z7VA 4Y16B 2H26B 4L8SC 4HT1L 3VH8B 1KLFA 4WW1B 3IJSB 3QPXL 3CPLA 2AP2A 4IRSD 4NO2A 5HI4C 1JNNL 3CFDA 5DJCA 3QQ4A 1KPVB 4NKOB 3HB3C 4NUGH 3O2DL 1T83C 4KMQA 2VDKL 4B0MM 1CR9H 3VI4E 1FZOB 3TA3D 5C0AB 5I30H 1A02N 5HYEA 1EJOH 3ZT6A 4NN6C 5JHDB 4NBZB 3RFZC 2OL3L 5D1XA 4N1CA 2I07B 3OKEA 2Q87A 3X3FL 4AT6B 2OR9H 1CICC 4MJ5B 3QXVA 4PTTB 5DEFB 1KTKE 2FYYA 1INEH 1RJCA 4LLQB 5EBGA 1F42A 3C2SA 4PJGF 3PXHA 1MFAH 3MA7A 2DJUA 3GHBL 3QEQD 4PGEB 1EO5A 4YHYC 3OB0K 4JVUA 5DTFB 1QRKA 5F93C 4NM4H 4OZ4A 1MCWM 1OAYH 5I1CL 1U6AH 2XKNA 5D96C 4HIXH 4JFHD 4KDVA 4Y0GA 4U1GC 1KCLA 1HDMB 3OB0H 4XI5C 1G6RB 2IANB 4ZTPL 5FXCH 2Q76A 1DDHB 1B0GA 1C08B 1KCSL 1VSCA 3PWJA 5E70A 5FUZL 2R0ZH 4KQ4L 4LVEA 3WIFA 2A83B 2CDEB 3K74B 5C07D 4LLYA 3CD4A 4QHLB 3HMXL 1NANI 1OTSC 2P46B 1OAQL 4GH7B 1CQKA 4GBXA 2VDNH 4JO4L 3VJ6B 3HNSH 2ATKB 2AV1B 2R2HA 3OAZK 4G6MH 5I2IA 3TPUA 4R0LA 5T5NF 4NRYB 2DI9A 2HTKC 4WHTB 2ZJSL 2N56A 5KTEH 1ZHNA 1KV3A 3OAZH 4JN2B 3F62A 3MLWL 1D5XB 3QO1A 5DJAB 2ADJB 4Z5RA 1UJTA 4CVZA 1JUFA 3DYMA 4PUBL 3ULVE 4XPTL 2ZCLH 1YC8A 3ARGA 3D87B 1YEIL 4GAYB 4ONFH 2QQKL 1PGRB 5SWSA 2D03H 3HI1A 2BJML 3OXSA 3SKMB 1I9IL 3HZMB 4JRXD 4LRNL 3HG1B 1RMFL 2MKLC 2HKFH 2GCYA 3SBWA 2I60H 4GSDH 5HI5C 5B39G 1WBZA 3UJIL 1UM4L 3VFOA 1QNZH 3T65A 3GSOB 1P7KB 3MGTA 4I8DA 3SJVB 4EQ3A 3N9GL 4YGAB 3S9DB 4GXVL 1FNSL 4YFLF 2A6JA 2VAJA 4DK6A 5JXED 1MHHA 1W8NA 4KHXH 4BFEA 4BFBD 3U6RB 5IJKC 3U7WH 1PKQA 3L1OL 3E6HA 3GJEA 4GW5B 1EEYA 3HFMH 3UTQA 4M6MH 2X4OB 2BOBA 4XTRC 3MV9B 1BZ7A 4Q9CA 4M4RA 5HYJD 2F74A 4M5ZH 2NY0C 1RK0B 1LGVA 1UWEH 5E9DA 3O45A 2D4FA 5DJ6A 1MREH 3BGFC 1WEJL 3BJ91 3KPMA 2MCG1 3QI9A 5F1SA 1UXWA 4P2RD 3L3DA 5E2TH 2A6KB 5FYLD 4X6CB 4XCFH 4ODWA 1MJUL 3WDHA 4E41D 4OI8A 3JUZA 3VXRA 3MCLL 5IG7A 1FL6A 4Y2DD 2XQYG 2C1PB 2ZUTA 1YMME 5TDNB 1OGTB 3PWPA 4X98B 2PTTB 1EXUB 4L3EE 1A21A 1HSAB 4XMKL 3FQWB 2D0HA 1KEGL 5EO0B 4ALAH 3GSVA 2CKBL 2HJLB 3GMLB 4MCYA 1JCKA 5DD6A 3RHWF 5BVPH 4Y1AB 4HFWB 4JFFB 2GI7A 3BP4A 5CZXD 4O2EB 4I3SL 4D8PB 1LK3L 2MCPH 1WZKA 4Y5XA 3P73B 1KUMA 2DTMH 5DO2C 4HJJL 2XQYK 1KULA 4M5YH 3V4PH 4Y5VB 1S9XB 3C60B 5IFJA 1BGXH 2AEPL 1NMBH 1XIWB 2X10A 5L9DL 4UU9B 2WBJA 5B8CB 4MNGB 1DVFB 2G60H 3IFLH 3OR6B 4PJFB 2QTEA 4OLUH 3K2UH 5T3ZH 4C56B 2DQCH 3BP7B 5E8NA 1FNGB 5BZDA 1DQJA 4OM0L 3T09A 1AHWC 4BSVB 3BI9X 3RY5A 3O4LB 4KMTH 1MRFH 2A0LC 4XPHH 4EI5D 2V5MA 3HA0A 2OTPA 3JVGC 4J8RA 1AGDA 4LSVL 4HKJA 1N4XH 3TN0C 4OFDA 1RJYA 1A7RL 6CGTA 3SGKA 2HKHL 1F3DJ 3X13A 1HKLL 4BK4A 3BKCL 4JDVA 5GZOD 3O6FD 2FB4H 2P49B 3LKOB 4JM2A 5KVDH 4CU7A 3ALXA 2I25N 2AV7A 2HJFA 4R4BB 3QUMA 5JIHA 2WINB 3O11A 4ZQKA 1M1SA 1X4XA 2X42A 5E08H 2BOCA 4JM4L 1ZLVK 3QEQE 5EZJA 5HVWA 4X9BA 2MJWA 3MRHA 5DEZA 3QFDB 1OTTD 2AJUL 4OLZL 3DGGA 3OV6A 1YYMH 3J8F7 4LHJB 1MVUB 4JFHE 2A1WH 4UT9H 5EN2A 1UGNA 5HDOA 5HHXL 1ZLVH 5C7XL 1Q9OB 3BPNB 1LEGB 1XGUB 4PLJC 4M7ZC 5CMAB 4BQBA 1KJ3L 1Y6KR 4DGIH 1NGXA 4TUOA 4XPFH 4Z7UF 1VFOA 2OTWB 2BSRA 1A4JB 5C07E 2OZ4H 3IS0X 4K71C 1BBDH 1WITA 2WZPD 4JFDA 4NCDA 4X7CC 1BECA 4PJGE 1MCJA 2BNQD 3IF1B 2UVFA 1RD6A 5ID1B 4KTYA 1MQ8A 5F44A 5FF6B 3D5OF 1LK2A 1RHFA 1I7RA 4L29B 4ZOCA 2E9IA 3ARZA 4OV5A 4RGOL 3BX7C 3MX0A 4LRIA 3SCMB 3RWEB 1N0XH 4HHAB 5DQ9A 5ESQB 5E8DH 4K94L 4PRID 2UYLA 5C0CD 4XZUA 5D7JC 3NFSL 3VW3L 1PW3A 4WGVB 1CFNB 1AE6H 3VWJD 2V2WA 5DYOA 2V17H 1HNFA 3C6LB 4Z7VF 1S7VA 5LAXA 2AGJL 5TQ2H 3GIVB 3C9NA 4HK3N 4Z0XB 4UZGA 5D7LA 3HC0B 4BUHA 2HG5B 2IAMA 1Y0LA 3QDME 4UT7H 1LHZA 2FRGP 5TE4L 2YRZA 4YH6A 3G5VA 5IM7B 4Z7OE 3OQ3B 4PJ8B 5FOBA 5TF1L 3RDTC 1FFOB 3S4SA 5MENA 2JJSC 1OCWL 4AMKL 1KBGL 1Z2KA 1FN4B 2LVEA 2VQTA 1WC7B 4GQ9L 4NO3B 3IDJB 4FQ2L 5JW5B 2VLMD 4OFYD 2WV3A 3UPRB 5HYJE 4DGYL 3FO0L 4J3OC 3FHAA 2W38A 3I6KB 4JJ5A 4P4RB 5KS9A 3NPSB 4UNTA 1R5VB 3S8WA 4ODXA 4NUJB 5L88L 5LGHH 2YRPA 3EYFA 4X80H 2VZ1A 1DSFL 3FB5A 3GM0A 4PJDE 4P2RE 1MOEA 3DSFH 2VTFA 5BRZD 4MA1C 3ZKXC 3QUXA 5I15H 5FYLE 5E00B 5EBMB 2RFXA 3RWHB 3VFUB 2VDPH 5E8EA 4I18A 4HXBL 3T2OA 3WUWB 4QTIH 1SVCP 3R8QA 1ODAA 5CJQH 5ITBH 4PR5B 1HHGA 5FA4B 5CILL 1GGUA 5I8OL 3U0TA 1MCLA 3IKKA 4PJHB 4FNLH 2LFGA 2IFFH 4W4OC 5E94A 1PQZB 5DA4A 5GGSA 4HBCL 5E1AB 4G6FB 3MBED 5CSZA 2EYSB 3QRFM 1HE7A 3O0RL 4YHOH 1JRHI 3LB6C 4RMSA 1L9NA 5HGDA 4DAGH 2MHAB 4O9HL 1SJHA 2E3VA 3X12B 2FJGA 2HT3D 3RX8A 1CXEA 2DAVA 3JXAA 4IRJA 3RL2A 3CU7A 1VADA 3VRLE 5SWZA 1NCUA 3MRDB 3QNZA 1ONQB 3RBSA 3S35H 1QFWH 3I85A 5I17B 4QY8B 5HDQH 2NY4B 3TZVB 3ZKNC 5J1AB 5D6CB 3KLHD 5A16A 5CJXA 1NGWA 3RA7L 3NIGF 4Y16A 2H26A 4MDJB 4FABH 5FK9B 2NW3B 4FMKA 4WW1A 1WQVT 3IJSA 4HC1A 2NY3D 5EZIH 4NKOA 1KPVA 4LGPB 1NLDL 4EN3B 1MHEA 4BFIB 1X9QA 3LDBC 1FZOA 3JSSA 1R3LA 4ODHH 4GKOA 4FFWC 1XGYL 5EC1B 5CINL 2VIRA 1MEXL 2V9RA 1ZT4B 2I24N 4PJ7A 4I48A 4MJ5A 4PTTA 4PGBA 1IGTB 3LKQB 4R3SB 1MH5A 4LNRB 4FQLL 4J3VA 3GO1L 4NN5C 4YE4L 3FRUB 3G6AB 4PGEA 1MCPH 1WFOA 2FECL 4M62L 4PJIE 5DWUH 2DI7A 2H32B 2YXFA 3QDGD 5CEYA 5ICZB 1QBLL 1RU9H 4KHTH 2PO6C 5CP3H 1HDMA 1A1NB 3D25A 3LKPB 2IANA 4NPYB 3GSNL 3Q6GH 1C08A 5BQ7A 5HVHC 1J5OH 4MB4A 3MV11 5GZNC 2A83A 5LWYL 1DANU 1H3VA 4U7MA 4QHLA 3NBNA 1V3MA 2R29H 3MUGA 1JGVL 3L6FA 4XWGH 3U0WL 3KPRD 5FO9A 3VFPB 5JIIA 5JOEA 1OT1A 2P5ED 1I1AA 2QBWA 4WHTA 4GT7A 1S3KH 4S1RH 3QUYD 4NQXB 4M48L 2J2ZA 4JN2A 1O7VA 5DJAA 2ADJA 1YY9C 5IROA 3O2WL 1I8LA 4BQ8A 1Q1JL 3VD4A 2VXUL 3KXFB 4UINL 4K7PH 5CD3B 2GT9B 4PRIE 4XNYH 5C0CE 4ZAKB 5F96L 4Y4HA 5E03A 2V7HA 4GXUM 1YECH 2XA3A 3SKMA 1SMAA 4IHOA 4YDIL 2FEEL 1HQRA 1OAUL 1XGPB 2XACC 5KVEH 4GKZB 4WI6A 1FV1A 1I9JH 3BD3A 3UTZB 3EUUA 4QRTA 4EQ2A 1P7KA 1A7PL 5I9QB 3HKFA 1A9BA 1PG7W 1Z3GL 2VNCA 4MAYA 4P2OD 2DQGH 3FQXB 3TCLB 3KYKH 3WFHB 4FQXB 3U6RA 1CFQB 1GOGA 4P9MH 4G9FD 1M7XA 2BRRH 4U0RC 4JM2F 4M4PA 3OZ9H 3VFGL 2FWOA 4GRLB 3MRFB 2B2XL 3SKJL 1RIVH 2AXFB 5GS1B 3TVMC 1I85C 1HXYB 3B83A 4XVTH 2CUIA 1RK0A 2VLME 3LRGA 1B6UA 4LQ1A 4OZIE 1D5ZA 4HCRH 5F72S 5C09B 3SDCA 2A9ML 2CIKB 1TTUA 3BYYA 3JV5A 4X83A 1QRNA 3SKOB 3WNLA 1RZFL 3QEUB 1EUTA 5T5NG 5BZWA 2A6KA 4X6CA 5GRJH 5BRZE 2P24B 1CICD 5JUEH 1R3KB 4BKLA 2FX7H 1CDYA 3CC5B 4B50A 5F89B 5C6TL 3QO0B 5FDWB 3CX5J 1ZLUH 4BUGA 1IM9A 1FO0H 5FAAA 3K4ZA 2Z35B 3BPOC 4JZJB 1Z9SA 2J88H 3O3BA 1ZMYA 1N59A 3H3PH 3F58L 2R4SL 1NC4B 3GMLA 4KJWC 2X4TB 4HMEA 4HFWA 3TO4D 1OPGL 1KN4L 5CZKA 4JFFA 4WI4A 4P2QD 3ILPB 3MLYL 2PXYC 1KCUH 1YDPA 1XFPA 3DX9B 1LEIA 4D8PA 3M8OL 3L5XL 4KJYA 3L3GA 2I5YL 2Z92B 1BWMA 4P2CG 3RX7A 1AGEB 4G9DB 5C1MB 3UDWC 3F65A 3FZUC 4P3CL 4LSPL 1TZIA 4JFYB 2OL3B 2GJ6A 4Y5VA 1LP9B 2F53B 3GI8H 5B22A 3GSQB 1XIWA 2HTKD 3HZYB 4MAUH 1IAOA 4YXHL 5TGBB 5B8CA 3H2WA 5KSUB 2RGSA 1DVFA 4JDTL 3OR6A 4KUCD 4PJFA 2D7OA 1M05B 3HN3A 1YQ2A 4F9LA 1FNGA 1DUYA 1P7QD 4Q9BA 2P44B 4BSVA 1CDUA 5B38G 4YO0B 3CZFB 4QO1A 5J12B 3RVWD 3O4LA 3FCTA 2NY2C 3GSRB 2R0KH 4N0UA 2JJWA 3TBYB 2EKSA 4JLRA 3T3ME 5B3NA 5E0QA 4OLXL 5I1HL 1IAKA 1GAFL 5JW3H 3MOAL 3SGDH 1KYOK 4WWKA 5D1QC 5INDA 5LGKA 3QQ9C 1HH6B 1EGJH 5KS9F 1FYHB 2X6MA 1T3FB 2P5WA 1MFBH 3MRMA 4KK8C 5GRZA 2HFGL 1J1PH 3IRZA 4A2LA 3BKYL 4HLZH 5EU6D 4JJHA 5GGRB 2BHZA 5BJTA 3LV3B 4LQFL 2XZZA 2W07A 3DX6B 1FLTX 1OAXH 2W59A 3FQNB 1IAIM 1PKQE 4XTRD 2VDMH 5AAMA 2OR9L 1GZQA 1G7LB 1JK8B 2ZPKH 1EHLL 3C5ZC 5FKAB 3QXAB 4PJXB 3L5WA 3QDGE 1AP2A 4BSJA 5K9KB 3ECBB 2JTDA 1TXKA 5DEGB 1MVUA 3NZ8A 5F70A 2EEDA 2CK0L 2AJSL 1QYGH 2NY6B 1OW0A 3ZDXE 1OAYL 4RAUA 1U6AL 3HZVB 2NTFB 3RHWK 4A2MA 4YWGH 4Z18A 5IUSA 3QB7C 4DFIA 2ZOKB 1RUQL 4XT1C 5C2BH 3VFTA 1VACB 1ZKAA 2J8UA 3KPRE 2R0ZL 2P5EE 3DETC 4PD4K 1U8HB 3X17A 2Q7NA 1NBVH 2FHCA 3MBXL 5EA0H 3SCMA 1N5YH 4PRBA 2AXGB 4G80B 4NKMA 3F12B 2B20A 3V6OA 4O58H 4YQXL 1U3YA 4LHQB 3C6LA 3OAYH 3ZHDA 2JK5B 2OCFD 2ZCLL 4X4ZA 2DKMA 3GIVA 4QEGA 1V3KA 5SX5H 3HC0A 3MJ6A 5HGBA 5C0IB 2F5AH 2HG5A 5ISZB 1GGBL 5C9JA 4QKXB 3B9KD 4GSDL 3CH8A 1F2XK 1CE6A 2FJFB 1UH2A 4MSWB 1FFOA 4G9FE 1JGEB 4YFEA 2CKBB 1FN4A 3ARBB 3D39D 2R56H 4PY7B 4PJ7F 1WC7A 4YDVB 5D7IA 3CDYA 4NO3A 5IFHH 3IDJA 3CVIH 4KHXL 1BVLB 2JLLA 2XXCB 3GMOB 3U7WL 4P4RA 4E5XB 4FTVB 3WIIH 3WJLC 3GRWH 3HRPA 4UIMA 2ED7A 3HFML 1J0HA 4NUJA 1U3HB 1I7TB 1U91A 3UJTL 3ELAT 3BH8B 1JWMB 2FLBT 5E00A 5EBMA 1CFSA 4JZNA 1CI5A 1H8SA 2A6IA 3VFUA 1BFVH 4YR6B 4F8TA 2L7JA 3SKUD 1Q94B 2H9GB 4P4KA 3KHQA 4DTGH 2FBOJ 4XBGA 3C08H 4OLVH 2GW5A 3ZYZA 1INDL 1P4IL 1INQB 2BVPA 4PJHA 2AK4A 4MA3A 4N9OB 5FFLA 3UTTD 5D1XC 1PQZA 1BOYA 2OK0L 4CUCA 1QVOA 1MI5A 4Q6YA 3CMGA 4P57B 3HE7D 4FMFA 2QJDA 5DLML 5C0NC 1LD9A 4QF1B 3U30B 4M9OA 3DVIA 1XZ0B 1O5DT 5CP7B 4OQTH 5BVPL 3SDXB 4NO0A 3IFOA 2Y23A 4RA0C 4CADB 3REVB 25C8H 4MVBD 4S1DC 2A6DB 2IH1A 4Q9QH 3GFUA 2EICA 1A7QL 3MRDA 1ONQA 3TFKC 1C7TA 3T2QA 4KI5F 4OZFB 5JQ6L 5J1AA 5ILTH 1XF1A 3VXMA 1QBBA 4WI9A 4XNQB 1BGXL 1KXVC 4LPXA 5FK9A 2YKLH 3TP4A 2X70A 1CD1A 4RNRA 3O6LH 1H3WM 4R0LC 1I1YB 3IFLL 1ETZA 5TDPA 4OLUL 1RUPL 3WKMH 2X4UB 4H26B 3QPQC 3RKPA 4OQ1A 2P1YA 4EN3A 5DMYA 1F4YL 2K7QA 4HKZA 1P69B 2KDGA 4HPYH 3QQ3B 3RWDA 5MI0C 4KMTL 4D0BB 1AXSB 4ORZC 4XPHL 3ARGC 2C3GA 4CGTA 2OBGA 2Y7QA 2AI0H 1ZS8B 1VKXB 4DCQA 1N4XL 1ZHLB 2D9QB 3MJ7B 4HIIB 4EUPG 1AY1L 1NBQA 1IGTA 3LAFA 5IT2L 5E5MA 2BNUB 5EU6E 3EO0A 4OCLC 4KTDH 3SBWC 4X6CF 5D2NB 1YEDB 3Q0HA 2FB4L 3FRUA 1N6VA 4J1UB 3LKNA 3H9HA 2F5BH 1I1FA 2BHUA 2NY1C 5HGAB 4YIQA 1GVIA 5IWLA 1NC2B 5HHMB 4AH2B 5E08L 4J3UA 2R8SL 1UEMA 1A1NA 3LKPA 3O9WB 3V52L 5BOPA 5CEZD 4ZFGH 4APQD 2DM3A 2OI9C 1P1ZB 1P53A 4LVOB 3SDAB 3AVEA 3PV7A 2FLRT 4F2MB 1IL1A 3BEWB 1YYML 3KPQA 2A1WL 2BFVL 4WY7H 3MREA 4OLYH 1S7UB 4EIGB 3JWOC 1GHFL 5EOCL 4TTDC 1A3QA 2DM7A 1QUNA 3DJ9A 3MNWB 2CDFA 5HVGB 1BFSA 2GAZB 1QLEH 3QI9C 4NQXA 2FO4B 3V5KB 3DMMB 5D1ZD 5H8DA 2L0DA 3EOYG 5IBLD 3R8BB 5H94B 4QRPB 3KXFA 3F7QA 4PYGA 5T3XL 5JHLH 3I2CH 3ES6A 5E2UL 3KPSA 4K9EC 2AK1L 3O6KH 3BPLC 2GT9A 4PJFF 5CIPB 4ZD3L 1CLOL 4EBQH 2W9LA 5GJTL 1W72A 4Y4FB 2VLRB 3AXLA 4I9WD 4X5XB 4WCYL 5E8DL 1TJGH 5IHZB 3UTZA 4YBHA 1DBAH 2EXWD 5IGXH 4Z76A 1CT8B 5EFIB 5J3HD 1E4WH 1BBJB 2NXZD 3MLRL 3MRBA 5I18L 4YHNB 3FQXA 5DUBB 3TCLA 4YX2H 4OD2B 3LKRB 3O8XD 2X9YA 4Z6AT 4WNQA 4OJFH 2HLAA 3D39E 3N0PB 4NYLB 3FT4B 5GS1A 3BQUB 4U3HA 2VYRE 1BJ1H 3Q2CA 2WBJC 2HFFB 3JWOH 3D85B 2FO1A 4GAGH 3WE6B 1QP1A 5ANME 2M2DA 4LBEA 4F7CB 3SQOH 1A4KA 4I0KA 4GG6B 3V5DB 4MNHA 1RJZB 3QEUA 3U2SA 1D9KB 1E28B 4PJBB 3QCVH 4UBDC 1T4KA 4ZODA 1LEKB 3U7YH 1FC1A 5C0FB 4K9EH 4X80L 4ODTH 5F89A 2KZWA 3IXAB 3QO0A 4M6OL 4PJ7E 1EMTL 3A67H 1LVEA 5HJ3A 3X14B 3GEWB 3SGKC 3DSFL 5K59F 4P5KB 3FT3B 5DMGC 5CFHA 1Q9LB 2Z35A 3M07A 2YBRB 4JO2L 2VDPL 1PX3A 5C9KA 2J8UF 4JM2C 5L8JB 4BH7B 3BVNB 1W2KT 3UTTE 1F13A 2MWCA 4NHCH 2YSSA 1A5FH 3O2DA 3EYVB 2PYEB 3DX9A 1RFDH 1XF4B 4D3CL 3HI6H 4FNLL 2Z92A 2IFFL 1JWUB 3EZ8A 1J8KA 3H42H 5F7MC 4N9GB 4JFYA 4IJ3C 4YHOL 4X4ME 1ZK9A 3UO1H 5BS0A 4M03A 1XCQB 3H3BC 3AU1A 3RZCB 2EH8L 2FEDC 1YNKH 3OXRB 4EI6B 5E8PA 1M05A 2BRQA 1WWWX 5L2JB 3O2VH 3AS1A 4LVNC 4GQPH 1XT5A 3IAGC 1PYWB 4ORGA 3CZFA 1FFNA 4LVHB 1QFWL 2UV3A 4XNZC 1HHHA 3LIZH 4MCZA 3ROLA 3SY0A 3TBYA 3FFCB 4UDUB 4WEUD 3GSNB 4M7LT 4OTXH 5LG1A 1YEHH 2NYYD 1SBBA 2BVQB 5F7WC 5D7IF 4FABL 4LRIC 5DD3L 5CBEB 5HHOB 1A6AB 3C8KA 5CHNA 4ZDHA 4F15B 2VABB 1P4BH 2NR6C 3H0TB 4RSVA 5I19L 4KI5E 1TVDA 3ARFB 3QUMH 1UZ6F 5BMFL 3E3QE 2X4NB 3MRKB 3EW3B 2UZIH 4P5MB 3DX6A 5I8CB 4QRSB 1OLZA 3LHPL 2IAMC 1IBGH 2WIMA 1JK8A 3VGGA 3B8YA 1OD9A 4KH2A 5FKAA 4P9HC 3TYFB 3S37H 3EJYD 2M26A 1ORQA 5DEGA 4ZXBC 5ACLA 4BYHA 1UH3A 5JZ7C 2YD4A 1S9VB 5CEZE 4OKVB 3TT3H 1F90L 4F9PA 5F7FA 3EOAB 2F8XC 3QCUH 2NTFA 1J0YA 4KHTL 3P11H 2DF3A 4LLWA 2Y07H 1MY7A 4K2UH 4LEOA 1KLGB 1RZKL 2VWEC 3LSOA 1CGWA 1GGCH 5FA3B 1FZMA 1J5OL 5MP6L 4Y5YA 4MJIA 3EDDA 2YXMA 2IH3A 3OKYA 3DBXB 4HF5H 1PDKA 2EDFA 2R29L 1YYLH 3S4SG 4EDWH 2JKXA 3QUXC 4KJWD 2GYSA 4LPCA 3I02B 3VGEA 4G80A 2Y36H 4RIRB 4JHWH 3I75B 3NTCH 2VLJB 3MV8D 1A6PA 2XTJE 2QADD 1SM3L 1JJUA 1S3KL 4I18C 4S1RL 4F58H 3UTOA 3ESVF 1FHGA 2EDBA 1D5IL 5H2BA 4QOKB 3INUH 1JHLH 1XH3A 3FZUD 4I9WE 1GXEA 4I4WA 3IAQA 2A74A 4GMSL 5CD5C 4OUOA 4C59B 3DX8B 1S7QA 1JVKA 1U36A 1T0MB 1YECL 4PRPD 5ISZA 4JVWA 3N50A 4P9HH 5GHWH 5GISH 3QIWB 1MLCA 4XP4L 4DJMA 1CFTB 1I9JL 2XI9A 2W0PA 4PGCB 4LMQE 4LMQI 4GRWB 2V5RA 1JGEA 3PHOB 3RP1A 4IRJC 2CKBA 4G8FA 4JRYB 1ED3A 4Y2OA 5DI8B 2PCPB 2Q8AH 2DQGL 5ENWB 4EEEA 3QIBD 3KYKL 1BVLA 4PJAA 2VSCA 3GMOA 3HRZB 1RV6X 3RTQB 4FTVA 1FORL 3IU3A 2V9TA 2ZWLT 3OZ9L 3EFFA 4MZ2A 2LU4A 5CJXC 1U3HA 4NQSB 2H2PC 1BVZA 5ADPL 3BP5A 2CDGA 4Y16C 4XVTL 4EZMA 2PW1B 3BH8A 2DQDL 1JWMA 1FAKT 1WZMA 4LLMB 3CNKA 4KK8D 1ACZA 3NCJH 4ZPVA 4FN0A 1Z0NA 2X1OA 5FGRA 3FN3A 2P5WE 4U05A 4LCWA 5CJBA 5IQ7H 5DD0L 4FS0A 4KROD 4DZ8A 2BK8A 1FFPB 5IHUH 3WL9A 3QG7H 1INQA 2LAGB 4QT5B 1FRGH 5EBLB 4JGMA 2FX7L 5DT1H 3IFPB 5F6IB 4XCYB 4N68A 1OQOA 3V4UL 5IW1B 1H3GA 4EDXB 3GI9L 5CP7A 3VRJB 3U1SL 3PHQB 3VDAA 4X4YB 2IEPA 1N8ZB 2DWEB 3REVA 4NKDB 3S5LB 1I4FB 1JTTA 1LE5A 2VH5L 1JFQH 3L5IA 2JIXA 2ZKHH 4S0TD 2WBWB 3A6BL 1DFBL 5GIRB 2J8UE 3VXTB 4OZFA 4ERSH 3WCYA 1KC5L 4RFEB 3ZTJG 3T0XA 2BXYA 2NXYB 3QBTB 1KB5L 5TE6H 4Q7DA 3WLBA 5TPWH 3LMJH 3MZTA 1QSFB 1SJEB 5F9OH 2XZAH 5GSVA 2X89A 4HC1H 1I1AC 2GKIA 3KWWA 5F7YC 4O5LL 2CK2A 4JFED 1F8TL 4IIQB 3PIQA 1M7IB 1PJ9A 3MA9H 4ZNEA 2EDRA 1DR9A 2CLZB 1CU4L 5IROC 3QQ3A 1KJMB 4X6EA 2I9TB 5L2KD 2R0KL 4NZTH 5I1KH 4XGZA 1LMKA 1VKXA 4OZGB 4Y4HC 3MJ7A 4POZD 3KS0H 4JG1L 4HIIA 3G04A 3MXVH 3G6DL 2QKIA 5FYLL 2VZSA 4L8SB 4Y19D 3ZTJH 1JZ8A 5DQJA 2BNUA 1PSKH 5EU7C 4NN7C 3SDDD 3VXSB 1FNLA 1K4DB 1EJ6A 5CJOL 3S6CA 8FABB 4KI5C 1MFBL 3NH7L 2BDNH 1J1OH 4M6AA 3VXOA 1WSST 4TPRH 3RAJH 4MAYC 3SE8H 4KRMB 2J8OA 4AH2A 4WJ5A 5C0RH 4NN6B 2ITDB 3O9WA 4V1DD 3G5XB 2XN9B 3MMEA 1LO5A 3SDAA 4NGHL 1JRHL 1OWWA 4PB9L 1HHJB 1N64H 5E1HB 4F2MA 3MLXH 3D0LA 2VXVH 1LDSA 5JIPA 1S7UA 1DN0B 2X7LB 3RPIA 3R06A 2C7UB 3MNWA 3KPPB 1QYGL 1IZKA 2VDOL 1A2YA 3SGDI 3SDCC 4R6UA 3LD8C 2W9EL 5IK3B 2FO4A 4YWGL 3V5KA 3VWKB 1WZ1H 3DMMA 1UKTA 4U1GB 5C2BL 1FLRH 5EUKB 2G2RB 3EOTL 4FXKA 2Y06L 2AK4E 2KPNA 2YD3A 5DVMA 3MV8E 4HK0B 5CIPA 4KZDL 2ITCB 3H9SB 1MI5E 2PETA 2N7BA 3GMMB 3ZSSA 4KK9D 2FIKB 3AAZB 2P45B 3VE0B 4JY6A 2VL4A 1KCVL 2XTJC 3MNZA 4HPOL 4OCSL 1V7ML 5A2JH 1NSNH 5EFIA 1OP3H 5B39B 4LHUA 5DK2B 1BBJA 1RZ8B 1E4XH 1FNEB 4F7TB 4PRPE 1NMAH 5C08B 1QSZA 4M7JH 4B7IA 4DOHE 1W0YT 4Y4KA 1XGTB 4OD2A 2XRAL 3U9UA 4X6BA 2R0WL 4HS8L 1NEUA 1REIA 1MJ7L 5FYKD 4Y5VC 5DF0A 5EOTA 5INCB 3FT4A 2UWEB 1J7VR 1NUDA 1E6OH 1RJLA 5DR5H 1XIWC 4UB0L 4N90D 4PYHA 2HFFA 1EEZB 3PGFH 5B8CC 3D85A 1BJ8A 1DVFC 3WE6A 4KJQC 5JIKA 5J6GB 4NQED 1V7NL 2JE8A 2R56L 1TTGA 2WQ8A 4HUNB 4J23A 4F9LC 4GG6A 3CVIL 3O3EB 2BCKA 4U4BA 1Z9MA 3EFDL 3V5DA 3G6JA 4PJBA 1CXKA 3TLRA 1T22A 2OJZH 4UTBH 1Q72L 1VFMA 1PZ5B 4RBPK 1LEKA 5CKAA 4DVBB 3BIKB 4QNPE 5C0FA 4S1SL 1FL3A 3ZHLA 4LASH 3OKMA 4XPBL 5E8OB 3LQZB 4BM7A 1KLUB 2FATL 1Q9LA 3TYGH 5IB4B 3CK0L 2NW2B 5CKGA 4ODUB 2C4FU 3CH1A 4BH7A 5L8LB 3MSPA 3MACH 2GHWB 1BD2B 3BGFB 3GK8H 4KTEH 3K80A 3V5HA 2QR0B 4RMRA 3H8NA 5E2VH 3EYVA 2EKJA 1XF4A 4DVRH 2OYPA 3GM8A 3MRCB 4F57H 1IC7L 2Q86A 4XP1H 3W5NA 2E7HA 1FC2D 2ZCKH 4AL8L 2ESVB 4D9LH 2BY1A 1U92B 1N3NB 3DARA 1JIBA 4CMHB 4F7PB 1XF2A 1MIML 4GMTL 5ACZA 1XCQA 1JPTH 3D2UA 3BPNC 4GKSB 2DOCA 1OP5K 1JI1A 1KENL 5A2KH 4LSQH 1OW0C 3C8DA 3O81A 5E56A 5L2JA 3KPNB 1H0DB 2Z0BA 5DUML 3MRQA 4K8RC 3V0VB 3GZKA 2AKRB 3MZGB 1MFDL 1RK1A 5C3TA 4E42B 4CVXA 4G8GD 3ARPA 1AJ7H 5F8RC 1FYTD 3IDXH 5FUCE 4Q0XL 4TUJB 1Y18B 3QWQB 3SCMC 2ZOLA 4ZUWB 5EUOE 4PJAF 4L4TA 1ZA6B 5DS8A 3O6LL 3CX5K 2IMNA 5JLZA 1KEML 5L2KE 2R69H 3V6OC 3WKML 4OBRA 3H0TA 1ZANL 2DYPA 3VXQB 4O2CA 5F1KC 3JUYA 4L8CA 2R1XB 3C6LC 4ZG1A 5TQ0H 3EYQD 2Z8RA 3L3KA 2X4NA 1AHWB 3MRKA 3QH3B 5H37G 3LKSA 1N7MH 1E27B 4H20H 4Y19E 1QTYT 4P5MA 4IBLT 5LVEA 2H1PH 4A6YA 4HQQL 3QP3A 5KSVB 4LOUD 4QRSA 1CS6A 3PDOA 3DX7B 3W39B 3GMQB 1C1EH 1E6JL 5FO7A 2XV6B 5GGUB 3KPTA 4KY1H 4KTDL 3L7FB 5FECB 1FPTH 3VCLB 5J7CC 2F5BL 1P84J 4K3DH 1G7IB 3T0VA 4NBXB 3GKZA 3IU4H 3ZE1E 4UAOB 2R4RH 5ESAB 2VKWA 1XGRB 3DIFA 5D4QA 3HNTH 4K8RH 5I1EH 3G08A 2DQHH 2DLGA 3NPSC 2MFNA 3G5ZB 5FA3A 1K8DA 3S34L 5H37H 1JBJA 4HS6A 5LKNA 4D9QD 3QWRD 1OARH 4K3EL 3ESUF 3DBXA 3GJFA 4WI7A 3CLEH 4WUUA 4OLYL 3SKNB 2FBJH 3KHOA 2Z8VC 3OJDB 4YHLH 4YHMH 1JWSA 4X0KB 4RIRA 2EXYC 3I75A 1HH9B 4M7ZB 5FOJA 4P4KC 5IEHA 1S7RA 3Q5OA 1EFXB 1IGYA 5EZOL 2D7QA 3N1PC 4K71B 1TETH 1EZVX 2X4QB 1K8IB 5JHLL 1CK0L 2GK0B 3QXTA 3PABB 4P99A 3E8UH 5CSBA 3L3JA 2PR4H 3DX8A 4PY8I 2DJ4A 1HZHH 2EIZA 3T3PF 3NN8B 1ZA3B 4PS4H 1TJGL 1KJVB 1WT5C 3PWVB 4LKXA 1YN7A 4HWUA 5IGXL 1M6OA 3BO8B 5D7JB 4CDHA 1E4WL 5FYKE 1NCWL 4L4VD 5ENWA 3IJHB 4HJGB 1J8HB 1VEPA 5K9OB 4QHKI 4PRHD 3IDNB 2Q8BL 3QFJB 1MRCH 4N90E 4G8IB 2BNRB 1A6WL 3BW9B 3LRHA 3TZVC 4Z7WB 2NY4C 1SEQL 5GGSY 5IKCB 4NQEE 2AJZB 3BN9C 1C8PA 4YEEA 3VG9C 1XEDA 3N85L 2HN7B 3ZTNH 2VLKD 4PJ5D 5FYJH 1QPXA 2BY3A 4IDLA 4LLMA 2YA1A 3LQAC 3EO9H 4EN3C 2F8OA 1J10A 2QHRL 2CRMA 3GIZH 3NZHH 3AMLA 3UTSD 5F3HA 4X5LA 3PP4L 1NGQL 4BQCA 1BOGB 3BKJH 1OF2B 1U8JB 4YBQC 3CSGA 3DV6B 1LNUB 4Z9KB 3Q1SH 5EBLA 4HK3J 1SJVA 4DKEH 4JFOB 1H3UA 3IFPA 4K9EL 1RZIB 4QWWC 5D8JH 1MF2H 3A67L 4ZXBD 5C92A 1OWRM 4ZUVA 2CLVB 4MS8C 1VFBA 2WWMC 3IETB 4J3TA 4I0CC 3VMOA 4MA1B 3ZKXB 4PFEA 4CN1A 4OSUL 3HR5B 4NJ9H 1I8KB 1HILA 4NHCL 1GIGH 4NWUL 4X4YA 4KVCH 4CN4A 2VUYA 3ARDD 5IWLC 4NKDA 4U1SA 3IDGA 5D72L 3WFBH 1I4FA 1RFDL 1DE4B 2CRZA 4KPHL 4MQSB 5KSAA 5EBWB 5DXWA 5DMKB 4MJIE 2Z93B 4P2YA 4XXCA 4FQ1H 4Q9RL 1HYSC 1L0YA 5BW7A 4L3EB 5EIIB 3MRLB 2WANA 3OR7A 1V5JA 2DLHA 3LQAH 3H7BB 2IG2H 5F1NB 4CDGC 1H15B 3O2VL 2YD6A 4G8GE 4MHHI 1FYTE 1M7IA 1N6QL 3CZJA 4MXQC 2CLZA 3AREA 3O3UN 1NFIA 3CXDH 4NQDD 2I9TA 2P7TA 4TVPH 4HJ0D 3GBMH 1I3GH 1S5HA 1NBYB 4G7VL 3JWDC 3N1FC 1A0QH 2AEQH 2IBBA 4HUWB 1J12A 4ELMA 4WW2B 3G6JF 3UBXI 3QJHB 3GSXB 3TNNB 5HHNB 5IVXA 2VL5B 2GQHA 2GTZA 4PRNB 8FABA 3D3VA 2ADFH 4M7LH 4EXKA 2F54D 2B4CC 3QDJA 3QUML 4BSWA 2NTSP 1IARB 1X44A 2OQJA 1UWGH 3GBNL 2UZXB 2NX5D 4IS6B 1IGCH 3SN6N 3VXUA 5GS0D 4WWID 1T21B 2XN9A 5HDBF 2YA0A 1PLGH 4UV7H 1IBGL 1XGQB 1T04B 2XNAB 4L9LB 3ALWA 3S37L 5GS1C 3C5SB 3DTXB 2GK2A 1LQSR 3FKUS 1DN0A 2X7LA 3FQUB 3ZKMD 2C7UA 5T33L 3EIFA 2DI8A 1T2QH 2D2OA 1HOCA 5C0AD 4LCWE 4X8XA 4D9QE 1K3IA 4U3CA 3UROR 5IK3A 5JHDD 2GJJA 3VWKA 2ICWI 2AABL 1A7NH 2Y07L 3HZKB 4QRQB 1D5BA 3P77B 4P3DA 1GGCL 2G2RA 2PO6B 4X7SL 4ZFZB 3RKDD 1U8OB 2PYFB 5SX4H 2YWZA 5F1IB 5HVHB 1KCRH 4HK0A 3B43A 3JWDH 5F97E 3H9SA 4I2XB 4DEPB 4LKCB 3IXTB 3OSKA 2C3VB 1QLRA 4UT6H 4XVUD 2WUCH 1YYLL 3QIUA 5FHAH 3GMMA 4G5ZL 5D5ME 2F15A 3BRFA 1QBMH 3AAZA 1IQWH 3NTCL 1QQDA 5DZOA 4ENEC 4HULB 3GNML 1M71B 2B4CH 4UNVA 4HGWA 4HD9A 3HUJE 1NGYA 5DK2A 5C07B 3P0VL 2EEAA 3HLAB 3INUL 1WGOA 5T1LB 3VA6A 1FNEA 4F7TA 1JHLL 5HSFA 1OTUD 4PJGB 1FGNH 3KYMA 1T66D 4U7SA 1F3RB 3PL6A 5DJYB 3OKNB 1EBPA 4X6DA 5AG8A 2P48B 1ZXQA 1AO7A 4P9HL 5GISL 5INCA 3ABZA 4HBQA 2UWEA 2J1KA 4L4VE 1AGFB 4M43H 4PRHE 3TBVB 1TPXB 3P4NB 1U2HA 1Q9WA 3I50H 1G9EA 5J6GA 5ICYB 3N06B 2QSCH 4G6JH 4KXZI 4ZNEE 5F9DC 3T3PE 4U6HB 4XP6H 5SWQB 1OGAD 1ZGLB 4PJ5E 4H5SB 2HWZH 2WWKO 1N5AB 43C9B 2LVCA 4U0RB 3BIKA 3V0WH 2NNAB 5M94B 3HG1D 3K3QA 3QDMB 1G7HB 4JVPA 2OSLA 3F6IA 1G7QB 5E8OA 5DK3A 3LQZA 3DXAA 1NDGB 4C83A 1ADQA 3HE6D 5IB4A 5JPNA 3N1MC 3NCJL 1KB5B 2H6PA 2QV2A 3P30L 3SJVD 4NHUA 5CS7A 5IQ7L 5JOPD 1BD2A 3HCVA 3EBAA 1HI6B 3O2DH 4P46A 4V2BA 1CQYA 5A3IC 4XC1H 5IHUL 1M7DA 1X6NA 1WLHA 4M1CD 3MRCA 2HYMA 2H3NA 3U4AA 4B41A 3MV9D 4OLWL 2ESVA 1U8MB 4P3WA 5FYKU 4JPKH 2VE6B 3RVUC 5ITFA 3X3FH 3T04D 4F7PA 4PJDB 2A77H 4M6NL 4P2RB 2B7DT 4YZFE 1G9NC 5F7LB 2CKNA 1F45A 3BEVB 2HT4C 1OLLA 2I26N 2NY6C 2HLFC 1EX0A 1EO7A 4H1LA 4F9PC 5GS3A 1JHTB 3TBWB 1F6FB 2PXYB 2AQ3A 3NFPA 1FNAA 4NFBA 2RQ8A 4L3AA 3P4LA 4TSBL 2JCCE 1HHIB 3MR9A 1WWAX 3WNOA 4Y5YC 4AIXA 4E0RA 5FGCB 5B38B 1AC6A 4E42A 4ZTPH 1KCSH 3IDYB 5T1KA 5FB8A 5FUZH 4KQ4H 2YPLB 4YK4B 4X5WB 4UI2A 4YFDB 3BWAB 2Z91B 4JEGB 5TE6L 3GUTB 4ZUWA 5K9JH 4JO4H 1JF1A 5TPWL 4Y1AD 4ZOAA 4NQDE 3TJEH 1MCHA 1I8MB 2V6HA 5JO5B 1RZJC 5MEOA 2LAAA 3PP3K 2DQEH 5HY9B 3PXJA 2NQCA 5MEQA 5J1TC 2ZJSH 3MA9L 4MX7A 2BHYA 3WFEH 3GMPB 1ZLSL 1E27A 4PUBH 1P4LA 1ORSB 3PE9A 1A7BA 4ELKA 4XPTH 2NY2B 5K9QG 3W0WB 5KSVA 1T0NB 3C60D 2F54E 3NCEB 3W39A 1MFCL 3GMQA 3HPJB 1W0WA 3PV6A 1DQLL 2FX9L 2QQKH 5DHVB 4GG8B 3QXDA 4KKLD 4HV8A 5D1QB 5JORB 2BJMH 4KKAC 1PSKL 2Q3AA 5IB5B 4YDJA 1G9NH 1J88A 3VD5A 1G7JB 1RMFH 4JFXA 3L7FA 4NJAH 1J0IA 5FECA 4C56D 3VCLA 4EI5B 1J1OL 4LSRL 4PV9A 1UM4H 1NJ9B 1T20B 3SE8L 3SGEH 5KOVC 1AGCB 4QHUB 3ZE0E 3JTSA 1FNSH 3G6JE 1AI1L 5DGRA 2VDLL 3DRTA 3G5ZA 4KKCD 2HRLA 1ITBB 3SPVB 1MHCB 3O6FB 1F6LL 4PLNC 2EZ0C 1ZHBB 1U3HC 3UBXG 1IGMH 4FXGA 2O26U 1N64L 3OKOB 5C0AE 2VXVL 3GSWB 3C5ZB 1XR8A 3SKNA 1U95A 2X4SB 3OJDA 4UNUA 3ARVA 4X0KA 1X5XA 1RZJH 2LTQB 1NGPL 4EIZC 4XBEL 1WEJH 1UT9A 1WZ1L 1FNFA 4XNMA 3BRDA 2X4QA 1K8IA 2GK0A 3AUVA 1MJUH 3V8OA 4LLAA 4OIAA 1DQTA 5E4EB 3MCLH 3CFBB 3WLWD 4QHMB 3IDIB 1YQVH 4LCUB 3U30C 3NN8A 3QNYB 4R4ND 4MJ6B 4XMKH 3RGVA 1KJVA 1KEGH 3KGRA 1NSNL 1JZ6A 1L6ZA 2CKBH 3BO8A 1JE6A 3BWUC 3IKCA 4I0PA 1E4XL 4HWZA 1GZPA 3IJHA 4HJGA 2X1QA 4ELMF 3V4VH 3MYZA 3TH3T 3IDNA 1UVQA 1ZHKA 2ZUXA 1S9YB 5IVXF 2C9AA 3FT2B 4D0DB 2EE6A 5JQHC 3FO2A 5C0CB 3ZYIA 2DQTH 2AJZA 3EDKA 2DIAA 1J11A 4HWNA 4ACPA 1E6OL 4DN4L 4P5TA 1J87A 2WSKA 3JBG7 5KOMC 5B4MC 1JV5B 4L4TE 1U58B 5CJ5A 4OM1L 2AEPH 1ITCA 1OGAE 5ETUA 3VI3E 4RMUA 4O4YH 3HG1E 3FO9A 2HVJA 1YA5A 4J4PA 1KPUB 1BOGA 1CL7I 3FB8A 2DQIH 1U8JA 4BZ2L 3DV6A 5DMIH 4FOMA 4ODBD 3IGAB 3SJVE 4J6RL 4EKXA 1NLBL 4NOBA 4LASL 4LSVH 1FBIH 2IADB 3KJ4C 2LABA 4Z7VB 4PJ8D 2CLVA 3TYGL 4HDIA 4X8JA 1JNLL 4HGMA 3IETA 1A6UL 1HKLH 1JZ5A 3BKCH 1X5IA 5IEKB 4FFVD 4K94C 2Y72A 3GK8L 4HGKC 4NO2B 4DUVA 3CFDB 3DECA 3MV9E 3DWTA 5DJCB 35C8H 3TPKA 3Q5TA 4Y7MA 4O51A 5E2VL 2X2YA 4LSTL 2QQNH 4GS7C 4U2ZA 1D6EA 5F1OB 4DVRL 4KK5C 3ZMRA 2EDTA 4WUKL 5BRZB 3O9WC 1KG0A 4OGAC 3KR3L 1X3DA 4YPJA 4OZFH 5D1XB 2FD6L 4HEPG 3SDAC 3OKEB 4JM4H 2VDQH 5J89A 1YMMA 1DBBL 4Z95L 2FYYB 1JPTL 4F33A 4L3EA 3U82B 3MJ8B 1MCFA 5EIIA 1KNOA 3BSZL 3MA7B 3MRLA 4R96A 4C4KO 1ERNA 2YD7A 2DDQL 5C7XH 2Y6SD 4LSQL 1T7XA 5F1NA 1KJ3H 4X6DF 4IMKA 1NFDA 2FSEA 4OZ4B 4X9IA 3MBEB 3DMMC 2XKNB 4ZUUB 1WWBX 1I7UA 2IFGA 2UWEF 4NCC1 4TSCL 4YHZL 5DJZB 5JTWA 5AYUL 4WO4A 3T4YA 1VPOL 5ERWA 1QO3A 2BVUA 1RZGA 2LE9A 3FMGL 2XWJA 1B0GB 1IAIL 1NBYA 1NH6A 1S8DA 2P47B 2VUOA 3ILQD 3OB8A 3PWJB 4CKVX 3WIFB 1QLFB 4HX1B 4KZEL 4LLYB 4RGNC 3KLSA 2ZSVA 4GBXB 4RGOH 1K9TA 1YN6B 4WW2A 5F3BA 1KTDB 2R2HB 3BH9A 3PQYD 4TNWK 5I2IB 4WHYG 4EUPB 3TPUB 4PJ9A 3MLZH 2GTWA 4R0LB 5K93A 4KI1A 4K94H 2VB5A 2E9WA 3Q5YA 1A6VL 1UEYA 4JREC 3NFSH 3VW3H 5TQ0L 4Y8DC 3CIQA 4OUUB 2NZ9D 3WDIA 3O3DA 4CVZB 4Z5RB 1N7ML 4Y4KC 1NDMB 4H20L 2NY4D 4MNGE 3TZVD 1DLHB 1GGYA 5MI0B 5HYFA 4XH2A 2H1PL 2CRYA 5FDWA 4GRMA 1HEZA 4IRSA 1XGQA 4JKWA 2XNAA 3HI1B 1L7IL 3C5SA 3OXSB 1BLNB 5T1DH 3TA3A 1NAKL 1WBZB 2VC2L 4LHUG 4PG2A 3VFOB 1S78C 5E6YA 4UDTB 3W9DB 1OCWH 4AMKH 2HJKA 3DROB 4OIIH 4X4XB 4GQ9H 5C6PB 4K8RL 2R39A 1J18A 2AEIT 2LU7A 2A6JB 2DQHL 1CCZA 3G9VA 3HZKA 4FQ2H 1MHHB 4Z7QE 2Z9TA 4DGYH 3FO0H 1U8OA 2VR9A 4LDOB 1FG9C 1PKQB 1OARL 3GKWH 1M4KA 3QEQA 5CIPH 3GJEB 2OI9B 4LKCA 3IXTA 3UTQB 2C3VA 1BZ7B 5TFSH 1DSFH 1YEGL 4JFQA 2RAMA 3O45B 3WFCH 1YUHA 4RX4D 1IILE 2E7MA 5DJ6B 1KIRB 4WI2A 2BC4A 5A2FA 1Z6JT 5M95B 5C07A 3HLAA 4YHPA 3L3DB 3H6JA 4QHNA 2UUDK 3E8UL 4R4FH 1KIQB 1QSED 3KPRB 4Y8AA 4ODWB 2P5EB 1GOFA 2WNGA 1VFUA 1HZHL 2J6EL 2YPVL 1TDQA 5IG7B 1FL6B 1JF5A 3QUYB 4N5ED 5BV7C 3PWPB 4U1NA 4PS4L 5E2JA 3RU8L 3RZCC 1AGFA 4WDIA 4X9GA 4ISVB 1QA9B 2PF6A 2G5BA 4O9HH 1AGBB 3GSVB 1TJIH 4MCYB 4KV5E 5DD6B 4DQOL 4KUZL 1ND0B 4LAJH 5LGJA 1Q0YL 2YHGA 5I73B 1JPFB 4PP1C 1WBYA 2OMBA 3OKDA 4KRLB 1SYVA 1MRCL 4JRXA 5SWQA 1ZGLA 4LVHC 4Y5XB 2JB6B 4I5BA 2V7NB 4ZAKD 2GFBA 4CMMA 1U2CA 1K4CB 3FQTB 1S9WA 2NNAA 4AENA 1U8QB 4ONOA 1RAMA 4DN3L 3FTGA 1PZUB 2FHBA 3RA7H 3VI4F 3QCTL 4AEIH 5FYJL 1NDGA 4P2OB 3B9EA 1KB5A 3FB7A 5JXEA 1YZZA 3EO9L 2A9NL 5IVXE 4G9FB 3NACH 5GRUH 3GGWB 5HI3D 1B0RB 3NZHL 1OSPL 3NCYS 4FQXD 4G6AC 4KFZC 5E8NB 5EORH 5BZDB 1DQJB 1MIEL 5HYJA 4EOWL 3Q1SL 4PJEE 3EGSA 1XGYH 4DKEL 3VXUE 4GRLD 3CFEA 4JANA 1MEXH 4QLRA 4MXVE 1MF2L 2XKSA 3IDMA 3K1KC 4HKJB 2YN3A 4KKBC 2VE6A 1JPGB 3T4AB 5E6ID 1UYWL 4PJDA 5FM8A 4P2RA 5BV7H 3X13B 5KAQF 1DUZB 1F4WL 2BERA 5C09D 5KANI 3BEVA 4FQLH 3GO1H 1CWVA 4YE4H 4JM2B 1JN6B 4E41A 4NDMA 2BVOA 2HJFB 3VGHA 4M62H 3QUMB 1QR4A 4Y2DA 3H7LA 1QBLH 1IVLA 3O11B 4PBWD 4ZQKB 5HDLA 1HHIA 5LXGL 2BOCB 5B38A 5EZJB 1KOAA 3TO4B 2NLJB 1YNTA 3MRHB 5LWYH 3RJQB 9CGTA 4XBPA 5E5RB 3DGGB 5DZLA 1NC4D 3ULVF 4WEMB 4UUJB 1A9EB 1JGVH 4WHCA 2IG2L 1UJ3A 1NGXB 2ARWA 1VCAA 5FUOL 2R0LL 1AD9B 4FG6C 1S9KC 3JTTA 1UA6L 5C6WH 5EZLA 3GMPA 2YMXL 4JFDB 3V7AE 2B0SL 1ACYH 3VD7A 3PQYE 3D18B 4A6YH 1Q1JH 4XNZB 2VXUH 2QQQA 4UINH 2F53D 4MMXC 2W91A 1LK2B 1T0NA 1I7RB 1A0QL 1B6DA 1UG9A 4X6DE 2HT2C 3PWNB 5F7HA 3HPJA 4OV5B 4RCAA 1P7QB 3RNKB 4WENB 2VISA 5DQ9B 1CN4A 2MOVA 4EI5A 2UYLB 5DK0A 3VMPA 1T20A 4S11A 1KIUA 5JR1H 12E8H 3HI5L 1TLKA 1UWGL 4JG0L 1FFQA 1UZ8A 4OZHA 1IKNA 3TNMA 4QHUA 5LAXB 3GJFK 1P6FA 1IGCL 3RTQC 3C9NB 5D7LB 1R6VA 5DSCA 4UV7L 3EYOB 2IF7A 3O6FA 1BPVA 4YXKH 2DL2A 1ZHBA 1WUNT 5AG9A 1CXHA 2IAMB 3OKOA 1Y0LB 3VFGH 1YMHB 3JV0A 1EFQA 5JMRA 1VGEL 1R24B 3GSWA 4DKDC 1SMOA 2APTA 1SYSA 1NCAL 5EU6B 1HCFX 1T2QL 5J11B 3S4SB 3VFSB 4PJIA 3BUYA 4ZUSA 3S3PA 1FE8L 3LZFL 1PBYA 1C16B 1RZFH 2OM5A 3DV4B 5J0BA 4JJ5B 5KS9B 5DFVC 1T1XB 3FL7A 2GY7B 2CIIA 3JWDL 1W72L 3OTTA 1NFDF 2WUCL 3EYFB 4QHMA 3BJLA 5C6TH 5HD8C 3FB5B 1RSFA 3CCHA 1QBML 1IQWL 2NY6D 4MJ6A 4W6XB 2BNQA 3FRPA 2AS5M 1ZT7A 4S1QL 2B4CL 1QSEE 2EYRA 1FGVH 3F58H 2R4SH 3BXNB 4OD1H 5DQDL 5C0GB 1OPGH 1P84K 2ZUVA 1KN4H 3SE9L 1HHGB 4M1GH 3MLYH 5F6HI 2RBLA 1JYNA 3Q3GA 3U0TB 4YAQA 4KRPC 1VERA 3L5XH 2YC1A 1S7WB 4ZSOE 2I5YH 3VA2C 5E94B 5GGSB 4PRIA 5GGTL 5C0CA 3VRIA 4LSPH 3AS3A 4XXCC 5CSZB 3VWJA 4O2FA 2NXYC 4MWFA 1B9ZA 5DJ0B 2AAVA 1ZLWK 4AQ1B 1MLBA 4M43L 3WNPA 5HGDB 1BFOA 4F7EB 2E6QA 2W0LA 2FJGB 3LPGA 5JMOC 4LNVA 2QSCL 4IIQC 2GSIA 3RL2B 4NP4H 4TOYH 4HH9B 3RBGA 3RI5F 3AREC 4P23D 3GB7B 5FM5M 4XP6L 5GGVY 2HWZL 3QNZB 4TVSa 5CAYB 1K85A 5FCUL 2XWTA 5I1HH 4B5EA 1GAFH 4D9RE 4M3KB 3D39B 5D71L 3R1GL 4OFYA 3E1F1 3ARBD 4OZIA 2IJ0C 1VFAA 2AXJA 1A14L 3HC4H 5IEKA 5ANMB 3ZYOA 1N0LA 1MHEB 2HFGH 4XC1L 5IMKA 3BIAX 1R3LB 1G84A 3BKYH 4JQIH 5BRZA 2VIRB 4LQFH 5F7NC 1TNNA 1MQKH 2K1MA 4JPKL 4PJ7B 2A77L 4I48B 4PGBB 1EHLH 2XIDA 3FJTA 4OGZA 1MH5B 3MJ8A 2FGWL 2EDJA 2CK0H 2AJSH 4TQEL 5FYKL 2FHFA 2YUZA 4WEBL 3MBEA 5CEYB 3VWKC 4U49A 4ZUUA 1PVHA 3PF2A 4KGLA 4GO6B 3E6FA 5DJZA 5EB9A 3CX2A 4TUKL 4R90L 4ZYKA 3D25B 4CVUA 3HTLX 1RUQH 5BQ7B 1TZGH 2XPGB 5FKPB 4JO3L 1QLFA 1KPRA 4HX1A 1MVFA 5CBAB 3QIUC 5K9JL 2BSSA 1YN6A 3MBXH 3MUGB 1TJHL 4HFUL 1KTDA 3TJEL 3L6FB 1DQDH 4LFHD 1I3VA 4PP2B 4EUPA 5FO9B 2O5XH 2DQEL 4LLUA 1I1AB 1T1WA 3I3BA 5DJ8A 2EDWA 1LP9E 1T03L 4YQXH 1S7TB 5EIVA 3QAZC 3ROOA 2L7UA 4OUUA 3WFEL 2P8LA 3BN3B 1NDMA 5EWIL 1DLHA 1TCMA 2MSPA 2Q6WB 4Z7OF 4XC3H 3NOIA 5C0BD 3PL6C 3S36X 5AD0A 4NZDA 3I3DA 1FCGA 1NEZG 1OB1B 4Y4HB 1VEOA 5B4MD 2V7HB 3B2UD 3RL1B 4Z78A 1GGBH 4IHOB 1BLNA 4WV1A 1G9NL 1N2RB 4NJAL 3RZWA 1HQRB 4M9PA 4NN7B 1FV1B 1NPUA 1RZ7L 1YEFH 1Q9KA 4QRTB 4UDTA 3W9DA 3PWLA 1JPSL 3DROA 1A9BB 4JAMA 1U3ZA 4X4XA 4MAYB 4UIKL 4PJDF 3VFWA 2JB5L 2ZNXA 4HUXA 2CMRL 3V6FA 4LPYA 3UJJH 5A2LH 5JW4R 5IF0A 1IGML 4FP8H 2FWOB 3LS4H 3KYOA 4R8WH 3MLTA 3QDGA 4U1IB 5I75C 3UJTH 5I71B 3RVVD 3ARUA 4POYA 1RZJL 4TN9A 1D5ZB 1NC2D 1KIRA 1YNLL 5HHMD 3SDCB 3LD8B 5IVZA 3NIDF 4BZYA 4P46C 3OF6D 1QRNB 4U6VH 1MCEA 5BZWB 3QXWA 2BVYA 1INDH 1P4IH 4I77L 3NMEA 5A40E 5D2LF 4HWBA 2XG5A 1HQ4B 1KIQA 3KPRA 5DRXA 5F9AC 4ZS7H 2P5EA 3PNWA 4BKLB 1XF5A 1CGTA 4I13B 4WFFD 2OK0H 1II4E 2QEJA 4CMHC 2X1XR 1TVHB 5GS2D 1YQVL 2HTLD 3PG2A 3QUYA 4XMLL 4ONGH 1IM9B 3VRLF 2BX5A 1H3XA 5DLMH 4QRRD 5D9SA 5JW4N 1IGJA 1NCBH 4X99A 4UOW0 3RUGA 3DOSA 4ISVA 3TWCL 3BE1H 1QA9A 3EJZC 3O3BB 4S10A 1AGBA 1N59B 2XTJB 2G75B 1ND0A 2W92A 2VN4A 1NFDE 1JPFA 4JCMA 4ZUTA 2NCMA 3V4VL 4QRPD 1YDPB 1LEIB 3PDGA 3T1FB 4KJYB 3L3GB 2KZ1B 3OX8A 2JB6A 1A7QH 3FOLA 2V7NA 3UAJC 3NCCB 2DQJH 4L1DA 4Y4FD 2VLRD 3W2DH 1K4CA 2DQTL 3FQTA 1TZIB 5KW9L 1U8QA 5JQ6H 2N1KA 3RWIB 5FEBA 2GJ6B 4OZHF 1KT2A 1F4AA 2J8HA 1ADQH 3FN9A 4P2OA 3O41B 4H1LG 5T1MA 4G8EB 1IAOB 3VXNA 4G9FA 2CGRL 1DTUA 3GGWA 1WAAF 4O4YL 1B0RA 1RUPH 3UZQA 3QWOB 1K2DA 1NCCH 4RDQF 2DQIL 1DUYB 1F4YH 3CU1A 3L95B 3MRGA 4WU5B 3TJHD 4Q6IB 4JPWL 3KPLB 5DMIL 3FAXA 4K3JH 1F02I 3FCTB 1F97A 5CGYC 1YEJH 2Y25A 4LGSB 4WVRA 2EDYA 4N0UB 2EKSB 3BQUD 4JLRB 1IAKB 4PJIF 5F9WC 1FBIL 1JPGA 4WWKB 3T4AA 5INDB 1AY1H 5IT2H 1DUZA 5CGTA 3GHEL 4RWYL 1J0KA 4ZFOA 1MFEH 1CICA 2P5WB 1JN6A 3MRMB 35C8L 4UAOC 4D94A 4H1LH 1D9KD 2QQNL 2XY2A 5I0DA 3KAAA 4LIQE 4XHJC 5GGVL 5BJTB 2EIBA 3U83A 1IGIL 3RVTC 3C2AH 2R8SH 3V52H 4XVSH 4C57C 2VDQL 2BXZA 5GGQL 1GZQB 3TO4A 4HKXA 2NLJA 4F3FA 1F2QA 1JI2A 4P2QA 3L5WB 1AP2B 2IQ9L 3DPBA 2BFVH 3NZ8B 4UUJA 5L7XL 2O61A 1A9EA 1GHFH 5EOCH 2Z31D 2PYED 4RAUB 1AD9A 1U8KA 5KVGL 1C5CL 2R9HC 4H25A 2MQ3A 4RMVA 1R3IH 1LO3H 3VGBA 2YD5A 2Q7YA 2EE9A 3VFTB 5K33A 2YPKA 2YZ8A 3D18A 2J8UB 5DVLA 1AKJD 5T3XH 5IIEB 2GSGA 2R23A 4QGYA 5E2UH 2AK1H 3HAEG 3PWNA 4ZD3H 3RZCD 2MQ0A 1CLOH 5GJTH 4OCYL 1P7QA 3RNKA 1BQLH 4PRBB 3RGVC 3MLZL 4WCYH 3ARRA 4NKMB 2K3TA 5C0BE 3DYPA 4I0PC 5KAQG 1ZTXH 2H2SC 3MLRH 5I18H 4YDKL 2Y5TA 3ULVC 3FFCD 4JRXE 1T0PB 3VGDA 4OZIF 4YPGA 1KF9B 4MQXC 3EYOA 2OTUA 4ONHB 5HHOD 3BZFA 5HGBB 3WKNA 4UQ2A 5AUMB 3ULUD 3S3JA 1YMHA 1Q0XH 1TITA 4XWOC 1R24A 4P5TC 5C9JB 5T1DL 5SV3A 4GLRI 5IJKA 5EU6A 3P9MB 5IMMB 3G5YB 2FR4B 4M61A 1CE6B 1MRDL 3ARFD 5I1JL 3K81A 1GL4B 4U6XB 3VFSA 4OIIL 3QSKB 4MGXA 3P4OB 1X5YA 5D7IB 4J4PC 5KJRH 4HIEA 1C16A 5E5UB 5D2NE 2RHEA 2VZ3A 3DV4A 3U0PA 4NT6B 1T1XA 3GKWL 3KPOB 4UIMB 4RQQB 2XA8H 5IB1B 4NSKB 2SEBA 5TFSL 1U91B 3EHBC 4JKPH 4M6OH 1D3CA 1EMTH 1YY8A 1BQSA 3LPWA 4KK6D 4AIZB 3WFCL 2EH7H 1CFSB 4JZNB 4JO2H 2A6IB 4E41E 3BUTA 5C0EB 1BEYL 3BXNA 3T0ED 3RWJB 5C0GA 1S7SB 4P4KB 4WFFE 4NKIL 1DQQA 4N0CD 2JJTA 4XBGB 1PG7X 3WD5L 3D69A 2WWKT 3ULVH 4QRRE 5DD1L 4R4FL 4D3CH 2BVPB 1S7WA 3VGAC 4R7DA 2AK4B 3ZE2F 4MA3B 3DVNA 2GITA 3ETBF 3BDBA 3LRSA 4YC2B 1QVOB 2QADB 5J4MA 1MI5B 1V8HA 3IRPX 3NIDE 3RVXD 1F4HA 4HLJA 4U3XA 4CU8A 1LD9B 5DJ0A 2VLJD 4RFNB 4AM0A 4FQQB 2XFXA 4F7EA 1E4JA 2EH8H 4JRWA 5GS0L 1TJIL 5D2LE 1A64A 3T3MF 3WIHA 3LEXA 1DBML 1UM6H 1HSBA 4NO0B 4IMKC 3IFOB 4QOKD 1P7HL 4NO5A 4L5FL 4HH9A 3TV3H 3WBDA 3W11D 4PRPB 4OF0A 2IH1B 1L7TL 4DOHB 3GB7A 4WO4C 3B9KA 1RZKC 1WCBB 4OFVA 2ARJQ 3ORJA 3KYNA 4M3JA 2OZ4A 3QIWD 2KL6A 1EVTC 3QUZD 4GAFB 3VXMB 3D39A 4AEIL 3VG9B 3U36B 3B5TA 4WW2C 1MCDA 3L3IA 5DD3H 2ZUYA 1ZAGA 1HKFA 2X70B 1CD1B 2A2QT 1BQUA 4RNRB 4KJPC 4JRYD 1BP3B 1GGIH 4PJ9C 3NACL 3BGAA 5GRUL 5DUPH 3RNQA 1UXSA 1ETZB 5TDPB 5ANMA 3UEZA 1T5WB 5HHQA 5I19H 4QXGL 2YD9A 1JYVA 1DBKL 5EORL 2IPKB 4HKZB 4R2GC 1U42A 3RTQD 4FA8A 4OZHE 5BMFH 3RWDB 3NABH 2Y7QB 4AG4H 4PGDB 4LLDB 4DZBA 4IRSC 4HIJB 1MCSA 1WAAE 4DCQB 1KGCD 4L9LC 3ZDXF 1UB5A 3LHPH 1J9CT 1XMWA 5BV7L 2HMID 2ADGB 5E99L 3BT2L 4KROB 5E5MB 3TA3C 3EO0B 2GUOB 1IT9L 1X5AA 2P8PB 3LKNB 3H9HB 3UTTA 3BRGC 1U8IB 1I1FB 3PJSB 1F90H 4YIQB 5DRZB 3HE7A 4DKFL 4X6FA 3RUGF 2W65A 4I3RL 7FABH 1RZKH 2XPGA 5FKPA 1OVZA 5MP6H 4DEPC 1MUJB 2P42B 3ME0A 2PYEE 4PJCE 3TC9A 4X4MA 5TF0A 1IL1B 5CBAA 3KPQB 2VN7A 1BIIA 3MREB 2X5PA 1A47A 1G7MB 4CRPA 4PP2A 2CDFB 2BNQE 1CGSL 3V6BR 3STLB 1SM3H 1CL7L 1MCBA 1S7TA 1IM3B 1D5IH 3DUUA 4NNYB 1MWAA 1RY7B 1ACYL 5E7FA 3RI5K 4DGVL 2Q6WA 2EYTB 4A6YL 4JDZB 1BQHG 4MNQD 3ES6B 2H45A 3KPSB 1OB1A 2E8ZA 2CO6B 4GMSH 1W72B 1QSFD 4OAWA 1WK0A 3RL1A 3AXLB 3QZWB 5D7SL 3DURB 2X4PA 1N2RA 4XP4H 1TPXC 1YPZA 5L2KB 4FFZL 5JR1L 12E8L 4Z76B 2D7PA 1EA9C 3MRBB 3ULUE 2OS7A 3AROA 5DFTA 2D7TL 5C8JA 5CCKL 4HAFA 5CJ8A 1JHKL 3OAUH 4YXKL 1WICA 1GYAA 4ZOEA 1FORH 4WNQB 1A1OA 2V9QA 1SVZA 2HLAB 3VXSD 3CXHJ 3KJ6L 1UADC 3DO3A 5ADPH 4U1IA 1PKOA 4BQ6A 1BF8A 3MXWL 5JXEC 2DQDH 1EDQA 4JFZL 4JHZA 2ZP0T 5HI4D 2L4OA 3M1BA 5I1AA 3HB3D 1O7SA 3C09B 4QTHB 4APQA 5A1AA 4LBEB 3MV7D 1W0VB 1A4KB 5DD0H 2FEEI 4MNHB 3LH2H 3U2SB 1A6ZB 1DCLA 3OGCB 1T4KB 1L9MA 1HQ4A 4Q58C 6FABH 2CXKA 1SBSL 3ZKSD 1UACH 4ETYA 1TVHA 3T0EE 5HJ3B 4KQ3L 3L3OA 5D1ZA 4GUPA 3V4UH 2ARJB 5HTSA 5J9PA 2BMKB 1SEBB 5EU4B 3GI9H 1UKSA 1FGVL 3C6SB 2G75A 2J4WL 1CYGA 4OD1L 1HK6A 4KUCF 3NA9L 3U1SH 2ZCHL 5DJ2A 2YSSB 4Y2DC 4M1GL 4XI5D 4PG9A 3CFCL 3L9RA 1JYXA 3T1FA 1H8NA 1MJ8H 2VH5H 2VLJE 2YZ1A 1WZLA 1FH5H 2AW2A 4M8QB 1UH4A 3A6BH 1DFBH 3IDYC 5AWNH 1OTSD 4HZAA 4YK4C 4QOKE 3ZT5A 3RWIA 5CZXC 1KC5H 5B3JE 1WBXB 5BS0B 2OP4H 4LP4A 2X41A 2ZZUT 4KDWA 3AU1B 3F7PC 3O41A 1KB5H 4MD5A 4G8EA 3BPCA 3T0BA 4PTUB 3ZE2E 4OF3A 3O8XA 5HYQB 5E8PB 4NP4L 4TOYL 2MKWA 4O5LH 5C08D 1X5LA 3QWOA 3ZDZE 1F8TH 1AIFB 3O3AB 3L95A 4WU5A 4ORGB 4Q6IA 3KPLA 1CU4H 4GRWE 3HPLA 3MUJA 1FFNB 2QSTA 1HHHB 4JRYE 1ZVSA 4MCZB 1HXMA 3ROLB 3SY0B 5E7BA 2VSDA 2XOTA 1EHNA 4JG1H 5HI5D 4C4KT 3TBSB 3G6DH 3QUKB 4FQCL 4U6TA 5FYLH 2C26A 2E9BA 3HC4L 2IGFL 3C8KB 5CHNB 4ZTOH 4ZDHB 4EI5C 5CJOH 1C5BH 3NH7H 4MDIA 2DMBA 1KGCE 5I66A 1IKNC 2PKDA 2H41A 4JQIL 5GZOC 4CNIB 4N8PA 1MQKL 3O6FC 1X4ZA 4XP5L 3W81A 4K3GA 3BD5A 4LLVB 4OFPA 2NY0D 4NGHH 1JRHH 4PB9H 1ORQB 3CVHA 2DD8L 2EEBA 5T3ZD 3LS5H 2LTQC 4GKNA 2VDOH 2YD1A 2C3XA 2W9EH 5L8KB 5I6XB 1OTTC 3VD3A 4LLWB 4LEOB 3LSOB 1FZMB 1TZGL 3EOTH 4RDQG 4Y5YB 4MJIB 2Y06H 4IRZL 5IIEA 2IH3B 5E4EC 5I1IH 4KZDH 5DHVH 5I8KH 2DS4A 3EJZD 2X05A 3HS0B 1DQDL 3RUGE 2O5XL 43CAB 1U9KA 4PBVC 3L3HA 1KCVH 4HPOH 4MNQE 4OCSH 1V7MH 4RGMC 4G8GB 4HUMB 4H0IA 1FYTB 1A6TA 4XXDA 3JV4A 4JKMA 2O5YH 5H2BB 1QSFE 3E2HB 5DO2D 1XH3B 4XC3L 4I4WB 2A74B 4RISL 2XRAH 4MMZC 5HYSG 4ONHA 2R0WH 1S7QB 2Y1VA 4OCXL 4HS8H 5AUMA 3RGHA 5JNYB 3VWJC 3EOBA 1KB9J 3B9DA 1MJ7H 2Q1EA 3TO2B 1MCNA 2J6EA 4PBXA 2VZUA 3FRPG 1MLCB 3UBXB 3REWB 4ESKA 3H9YA 3P9MA 5IMMA 3G5YA 2FR4A 4UB0H 1AR2A 2I9LB 2H8PB 1YEFL 2FNBA 1Y6MR 4U0QB 4U6XA 4LARL 4G8FB 5D93C 1V7NH 1ED3B 3IFNL 3P4OA 5HHPB 1QFHA 4HZLA 1NAML 3VXSE 2A0LD 3EFDH 5IOPB 4PJAB 4N0YL 3UJJL 4NT6A 3FO1A 4OF7A 1DBJL 3KPOA 3IU3B 3TN0D 2RJMA 3EFFB 4RQQA 1Q72H 2C4XA 4FP8L 4LAQL 4KVNL 5IB1A 3LS4L 4JPVL 4R8WL 3MV7E 4NSKA 3BP5B 4S1SH 2CDGB 4XPBH 3OKKA 2VAAB 3MJ9A 2B8OT 4AIZA 2FATH 3CK0H 4ZPVB 4CU6A 4G43A 3QR2A 4U1MA 1Z9LA 3OBAA 4MXWL 4NC1E 5C0EA 4LCWB 3HHRB 3QA3A 3RWJA 1S7SA 3TIDA 2EE2A 3V7MA 3QEHB 4U6VL 4DZ8B 3RVTD 4HUVA 3NGBC 2Z8SA 3WL9B 5FO8A 4ZS7L 5DMJB 1IC7H 2X1WL 3MV8A 3CMOL 4HXAH 5FHBL 4UTAL 3CAFA 4AL8H 4ONGL 1AQKL 5GGRY 4P2QE 3UPAA 1NCBL 1MIMH 4PLJD 5D5MB 4FQQA 4GMTH 3BE1L 1WIUA 4MLIA 3QG6B 1P9MA 1RUML 3VG0L 1CG9A 4PGJA 3NFNA 4YHKL 1EFXD 1KENH 3L5HA 3JZ7A 4RMTA 1A3RL 3GMRA 3MBEC 3L7EA 3WS6A 1N6UA 3UYRL 3EDJA 2XZCH 1LE5B 4PRPA 1BIHA 2DBLL 5GJSL 5DUMH 2JIXB 1J05A 4ZO6A 5DURB 1YPZF 2DQJL 1OQXA 1DQML 1WCBA 1ZWIA 3W2DL 2ENYA 2HT3C 1BVKB 1MFDH 1NCTA 3BGMB 3ET9F 5C08E 5H35A 3S3SA 4GBXC 3AM8A 1BHGA 4Q0XH 3U36A 1ADQL 4L4VB 3QIBA 2W60A 3BMVA 4PRHB 3WLBB 4W70A 3VFVB 5D7JD 5GSVB 1EEQA 4HWEL 3KWWB 1KEMH 3OWEA 1J8HD 1T5WA 1JNHB 1ZANH 3KLHC 3DUSA 1NCCL 1H3PL 3QFJD 3PIQB 4J2XA 2IPKA 2BNRD 4PV8A 4PJ5B 4K3JL 4X6EB 1IC5L 3STZA 1YEJL 2VERN 4XGZB 3TBTB 2NY3C 4PGDA 3THMH 4LLDA 4JFPA 4HIJA 4HQQH 3CFKA 4RRPA 3MROB 4IOFC 1T7ZA 2F8VA 3G04B 2ADGA 1RULL 3KJ4B 4WV1C 1E6JH 2QKIB 3RDTD 1QHOA 5DQJB 3F7YA 2GUOA 1MFEL 3F8UB 4IDJL 2VQUA 2P8PA 4YBLC 3QHZL 3UCRA 3VXOB 1U8IA 3PJSA 4XPGL 5DRZA 1I3UA 4GS7B 3CGTA 4WJ5B 3C2AL 2CJUL 4XVSL 1MFNA 4FXLA 1URLA 5T3ZE 15C8H 3MMEB 3S34H 4JQVA 1JGLL 2WBKA 4H0HB 5B21A 1LE9B 1MUJA 1LO5B 4K3EH 1GC1L 2HH0L 3D0LB 3KDMA 3WEXA 4HKBA 3GRWA 1G7MA 4EUPH 3RPIB 3R06B 2GY5A 2VXTL 1A2YB 5BO1L 2ORBL 3STLA 4NFCA 4N8VG 4MJ4A 2AERT 1IM3A 1R3IL 4NNYA 1LO3L 1AC0A 5EZOH 2JCCB 2EYTA 5E2WL 4JDZA 1U0QA 4U33A 5GSRA 4FXKB 1CK0H 3ARXA 3LB6D 1FL5A 4JFEA 3QUYC 5IESL 5DRWB 2R2BB 2FH8A 2ED9A 4RGNB 5EUOA 1S7XB 3QZWA 1BQLL 3DURA 4UOW1 4NQDB 5L2KA 4JY6B 3MNZB 4OFKA 3WFDL 4DKAA 4NNXB 5I73C 4JREB 1ZTXL 4PY8J 4LHUB 1NCWH 2E6PA 5TJWK 3MFFB 4Y5XC 4Y4KB 1UQSA 4Y19A 3RX5A 4TRPH 3ZKND 2Q8BH 4PB0L 3SDDA 4N0FA 3U9UB 4X6BB 1A6WH 2F54B 1SEQH 5GGTA 1Q0XL 2IMMA 4G7YL 5IMOA 3FQRB 5EOTB 5ID0B 3N85H 4P2OC 1RJLB 4QHKJ 2D7NA 1GSMA 3LEYL 5HPMA 5KSBA 3AMKA 5JW4Q 4V1DA 4QTHA 4HMCA 3P40A 3FN0H 1W0VA 2IPUG 4FFWD 5KJRL 2QHRH 2BCKB 3PP4H 1J1XH 1NGQH 4BJLA 1A6ZA 3G6JB 5EO9B 4PLOB 4BELD 2WAHA 3MGOB 3OGCA 4HWBH 1T22B 2XA8L 1T2XA 1DP0A 2X4RA 3B5GA 3UC0L 3BHBB 2DLIA 2JJVA 1FL3B 2OXGA 3PGDA 4XP9H 1JZ3A 3H3KA 3MRIA 2E6JA 4JKPL 3OKMB 5EDXA 1LO0H 3DVGB 2EDEA 1BREA 2XICA 1KELL 2ARJA 2EH7L 3F7VA 2BMKA 1SEBA 4K7FB 3ZLQC 5EU4A 3CH1B 2IPUK 4NC1C 3C6SA 4LEXL 4OSUH 1A7OL 2O5ZH 3V5HB 4YLQT 5ESVA 1R3HA 4NWUH 2PO6D 2AJVL 1VDGA 5D72H 3ULVL 1U8PB 1G0YR 3DO7B 2NY5C 4KPHH 5GZND 2P4AB 4M8QA 2Q86B 1E4KA 4LU5L 5C3LD 1CLYL 1NUNB 3IVKA 1KJ2A 3TO4C 3SQBA 1BJ1J 1XF2B 1I8IB 1WBXA 4OB5L 2QHLA 4NCC2 5ACZB 5BV7B 4Q9RH 3D2UB 2DB8A 4JR9L 8CGTA 3KVQA 1WWCA 3ARQA 1UM6L 4PTUA 3QJFB 5T1LD 5I16A 5HYQA 2HP4A 5I0ZA 3LN5A 1NCDL 3TV3L 4ETQA 1YY9D 1AIFA 4XNXH 3MRQB 3MRNA 1N6QH 1JZ7A 2W0FB 3O3AA 3DRQB 2VKXA 4HUKB 3VFNA 5EULV 4M93B 2ILLA 1RK1B 2HFTA 1P2CA 4CVXB 1EHXA 4G7VH 2GJZA 4NQEA 1NKOA 1J8HE 2DLEA 1D5MA 1FZKA 2ED8A 4FQJH 3QFJE 3DGCR 1LO4L 2DJSA 2ZOLB 2BNRE 3WFZA 4L4TB 5DS8B 5ELIA 4Z7WE 3QUKA 1GGIL 4XPAH 3TBSA 3MLUH 1OGAB 3RVWC 5DUPL 1YPZE 5JLZB 4QCIB 3U79A 4LCYA 2DYPB 4O2CB 3GDBA 3U46B 1RHHA 4L8CB