3BKUA

Apo c-terminal domain of nikr
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
81
structure length
68
Chain Sequence
b'QGFAVLSYVYEHEKRHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nickel-responsive regulator
publication title Structural Basis of the Metal Specificity for Nickel Regulatory Protein NikR.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 15
structure length 68
sequence length 81
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 3bkuA00
3BKFA 2WVDA 2PC6A 1Q5VA 2BJ8A 3BKTA 2WVBA 2NZCA 2FGCA 2HZVA 3QSIA 2WVFA 3BKUA 3PHTA 2BJ7A 1Q5YA 2HZAA 2BJ3A 2WVCA 2F1FA 2CA9A 2WVEA 2Y3YA 3LGHA 2CADA 2BJ9A 2BJ1A 3OD2A 2CAJA
chains in the Genus database with same CATH superfamily
4I4BA 1KC8T 1VQSA 3HVAA 4I2PB 1T95A 4I6YA 2C2NA 1RU2A 4AUKA 3LO3A 5B0EA 3ILOA 4DZDA 1UWBB 1YX2A 3KJNB 3M30A 2R7TA 1IWGA 2KM8B 3DDNA 5KFXA 4ED4A 4NZ0A 2FHKA 2Z2YB 4X4RA 2CPIA 2V50A 4DBQA 4JI4J 4PG5A 3AJ2A 1SJFA 3RUBL 4DPOA 4X62F 2UU9J 1LK7A 3GG1A 4DV2J 3H2VE 3BN4A 2IHR1 4QW8A 3BSNA 1RAAB 5EX3A 3QFHA 1O51A 3ILLA 2AYGA 3J81Y 3TJ8A 1N8RT 1FRLA 4XDDA 4UQTA 5F3ZA 1YVFA 1K44A 4RBUA 2GIFA 3BF4A 2FJEB 4P72A 3GIJA 2ZNYA 4JB8B 2L08A 2V34A 3BSOA 4ZVRB 3GWCA 1C1BA 2KT5A 2MQLA 2F40A 4P73A 4LFAJ 1AUDA 3MDFA 1UVNA 3NS7B 4JYAF 3ENAA 3I5AA 4K0KJ 4IDKB 1VGYA 5JJBA 5AXMA 1A0OB 4WFZA 3VV2B 3LANA 3FZBA 1BWEA 1NJYA 3N0VA 3CJ4A 4UT4A 1K1SA 3BQ1A 1VBYA 2DNYA 1AZSB 2HG4A 3CCJS 4HYKA 3DLHA 3FFIA 4MK7A 1K8AT 4N7TA 3RRKA 3SV4A 5D3GA 4L75A 3A8IA 4JI4F 4MFBB 5DO2A 2HZCA 4ECVA 5KOWA 1OPZA 4I7FA 2UU9F 4DV2F 4OZ1A 4DF8A 1NK6A 3VHQA 1VK3A 4ES2A 1KRPA 2RJZA 4FF4A 2ACYA 1I3OB 2BV3A 2CQIA 3VVUA 2X3DA 2W01A 3TUPA 2JEJA 5CABA 3KDNA 3D7SB 4FDFA 1FKAF 1UJ6A 3DGPB 1NNDA 2F8MA 4HH0A 5C25B 1N5QA 1FNOA 3ZZTA 4LFAF 3DNCA 1DQ9A 2M0GB 2V68A 5F41A 3HI9A 3OTBA 4K0KF 3N5BA 1JJHA 2EFGA 1TL1B 5ETNA 1NK4A 1E6YA 3H5SA 2QFIA 3BPDA 1RCXB 4IQMA 4CM0A 4WZMA 4FNHA 2YQ3A 3NGUA 4W92B 1CLFA 2MHEA 1ZH5A 3GFZA 4K50A 5F0UA 1FVSA 3LP2B 4K4VA 2HS4A 1Z2LA 3VGVA 4DS5A 2XHWA 2ZH3A 4X4OA 5K8OA 1JKHA 1FRMA 1GEHA 3MM7A 2E9TA 1QJHA 1ROFA 1M5OC 2B9WA 4OI3A 4J9LA 1TKXA 4DSLA 3KLFB 3DXSX 1RAFB 3RAMA 3U27A 1RYSA 2UVRA 1UFLA 3L09A 1JLFA 4WE1B 2B7BB 2ZZMA 2GCFA 3PRBA 2X1FA 1MW7A 3M8QB 1S48A 4UOFA 4LR8A 1RTZA 1CS4B 2DO4A 2K3KA 3K5LA 3KG0A 3KLEB 2KFNA 2QA1A 3DOKA 1S1VA 1GTEA 2N3OA 3A3PB 3MUMP 4CO0A 4XAKA 3OTDA 3VCDA 3PIOQ 2GMJA 3M8WA 2H54B 1VQMS 1GMWA 3SDEB 2PN6A 2HHUA 2HWTA 2YWFA 3IBFB 3WIUA 1FXLA 1TV6B 1BUXA 2DO0A 3SCJE 4YS2A 1RADB 1FA0A 4WFXA 4AL6A 2KTQA 4G65A 2HMIB 2C2RA 3HD2A 4Z7YA 2IAJA 4ZOSA 3PX6A 4F4ZA 4DCPB 2Y8WA 4ED3A 4L72B 2HHSA 2DHSA 2VPWB 3QRPA 3B78A 1LK5A 1KOOA 1VJQA 1CJUB 5KFTA 1FFSB 2ZNZA 3M9MB 2W7OA 3ZTQA 2X1BA 2G9OA 3DOLA 3DOMB 5KFEA 4HDHA 2VA2A 3I0RB 2ZKTA 1F3VA 2XULA 2M2BA 3D28A 2NPIA 4UOHA 2DTJA 4FVMA 4LREA 1EX8A 2MXYA 2LA4A 3QT8A 1WHXA 6FDRA 1NK5A 4Z2XA 4Y65A 3V81A 4IFYB 5HLFA 3M8PB 1S77D 2DH8A 4KQZA 4QIFA 1Y00A 3MEEB 2XZWA 2ALZA 3VGTA 2GIQA 3KJFB 3EDQB 2H65B 1W2IA 1X4HA 2AX0A 5E3RA 2PDAA 3C6UA 3I4PA 2XHCA 3T6JA 3KOAA 2POKA 4ZVOB 4UUXA 2RILA 1QE1A 4DN0A 2DD8S 3F0NA 2WVBA 4DV0J 2VH7A 2F4FA 2BABA 3M32B 4UY85 2PFFB 3P49B 5F8NA 2ZJQQ 2HK2A 1LQ9A 3OW2R 2J8AA 3L3CA 1A6LA 1NHKL 3PYEA 2WAQD 2CVIA 2NUHA 4FKYA 2R4FA 2WW8A 3V6DB 3M2VA 2Y8YA 3PHTA 4J9VA 1Q81T 1RA6A 3MM5A 2DNHA 1YQHA 1QTMA 1FKOA 1BQNA 2FVCA 1UVKA 2YNGB 1NU4A 2G2YA 3Q8QB 2FY1A 4RW6A 4QWDA 5KG6A 1VLOA 3THVA 4NMLA 4ER8A 1WSRA 2BJDA 4CT8A 1HMVB 3MCMA 5GAEI 1RXOB 3OLBA 3A8KA 2COLA 2JC1A 1WHWA 2EW9A 3FBCA 4KGXB 1DY3A 4KH0B 3U1MA 4DV0F 1HL6A 4JV5J 3DHWC 2WRMA 1JMTA 1Q0NA 1HW9A 2XM3A 3MMAA 4FYDA 3BBFA 1JLAA 4QU6A 4WKYA 4X84A 4TQRA 3MAAB 4FBUA 2J5AA 1RT1A 3TOQA 2MY8A 5A8RB 5C5JA 1TAQA 3DLKA 2K1RB 3G9CA 2MZJA 3K17A 2DBBA 4WTOB 4IR1A 3UNYA 4DEZA 2X51A 2CWXA 1WG1A 1HYSA 3CNQP 2KYXA 3FRYA 4CH0S 3IG1B 5CZXA 2F65A 5BYRA 5IZHA 1HNVA 3QIDA 5HJXA 2VONA 1JJCB 4L73A 1LW0A 2DY9A 3BO4A 4LSLA 2FGCA 4LMZA 3QJLA 2AT1B 1FFGB 3CJ5A 4GVLA 3M30B 3CT9A 3DRSA 4PUOA 1FTCA 3R6LB 3U1LA 1IR1A 4JV5F 2CNOB 3CJ0A 2QIFA 5ETOA 4EO8A 3PJXA 4KJIA 4CYUA 3I9V9 1MU2B 1ZA2B 5D4LA 4BC9A 1TKTA 3GYXB 2VUGA 1Q4RA 2B4OA 4QR0A 4MTPA 3TVYA 4DFKA 2XO7A 4R5PB 2G4BA 1HNZJ 1QAXA 3A1YG 3KUGA 1S0NA 1C1BB 1NSPA 1UZDA 2HNDA 5SUHA 2LEAA 2CAJA 3K8VA 2E7XA 1FK9A 3NP5A 2JNJA 1FESA 4WPAA 1XR7A 1WELA 5HQLA 1MWYA 4X64J 5IQ6A 2W7PA 1SH0A 1S1UB 1TQLA 3R5GA 3FFIB 1FXDA 3S8SA 4AL7A 3PRVA 4QIGA 1K9MT 3OL6A 1AT1B 2F1FA 3W9HA 4V19J 1HIYA 5D3GB 1XIQA 4USHA 1RT5B 1IKXA 4F02A 3IM8A 5D0GA 1VQ9S 1F9HA 1VBKA 3FGVA 3MHYA 4CO1A 2V9KA 3TA1A 3V6KA 4IOAQ 3QMQA 2ADCA 9RUBA 3W5ZA 3G2XA 1TKDA 2OPQB 4A8XA 1HNZF 2CQ0A 2ZHBA 4C8LA 4AL5A 3EZOA 3ZZ0A 2GMLA 4LF9J 1RDRA 1WHYA 1OO0B 4WF9Q 1XQIA 1TKZA 2O66A 1K0TA 5IM0A 1XERA 1RBLA 1HARA 2MY7A 1SV5A 4NLTA 3NS5A 2A6OA 2WVFA 1E6YB 1H74A 4X64F 5KFWA 3HSZA 4O0NA 3UD3P 2NXEA 5RUBA 4FYXB 2G1DA 1NJWA 5KFAA 1X4AA 4NMXA 4UY8T 2KI2A 5AE2A 3D2WA 2VICA 3QATA 5KFCA 2VBZA 4TVAB 1JKHB 2MLYA 2NS1B 4F4XA 2YWKA 3TA2A 3MFHA 3MM7B 5DZ6A 4KT0C 1YG0A 1TK5A 1XMOF 2DRBA 1VQYA 2RF2A 1TKXB 3K5OA 4DSIA 4NLYA 3FCWA 2H48B 2YPZA 2B3TB 2XEXA 1YKWA 3HZGA 4QPXA 2UXBJ 4FYWB 5A8KA 2JOQA 5KOXA 4ECUA 1XEZA 1C0TA 2E5JA 3VAGA 3HM9A 4F8RA 2FVRA 4M5NA 2BW7A 2V63A 4LF9F 3GJTB 1S1VB 2QV6A 4R25A 1N5SA 2EG2A 4C2MA 1ZTTA 1SXLA 4RBTA 3PW2A 1FDBA 2R2SA 2YNIA 3W5XA 5CD4A 2HHPA 5GAHU 4O3QA 1UEKA 5H1SV 2H3EB 3HVWA 4K4YA 2ADBA 5G0RB 1DTTA 2FZKB 3KDOA 1KQFB 3AD7C 5L9NA 1OPIA 3OSNA 1R0AA 1LWCA 4DL3A 1NDPA 4F4WA 3JB9k 1R0CB 3H20A 2J9DE 4EBCA 2HYIB 2YKMA 1XNRJ 2JZ5A 4YDDB 5CZVA 2WBRA 2UXBF 5ETPA 5KFJA 2VBXA 1PJ5A 1KLMA 1KHVA 1TFWA 4LF6J 1NKCA 3SIPB 4BS2A 4WCEQ 1VYAA 4O3PA 2OIHA 4F4KA 1VR6A 7FDRA 2ZH7A 4DHVA 1U4BA 1S5ZA 3R9LA 4KKOA 1VRTB 1F1BB 3RGIA 3Q2TC 3IXQA 4ZVEA 2FZGB 3GU0A 4DS4A 2G0CA 4X65J 3V81B 5HLFB 5DQGA 4OJ1A 2MKCA 2M7SA 3PW7A 3MOJB 2I2YA 4RW8A 2RQ4A 4CLFA 4R0EA 2I5JA 1G7CB 1H7XA 2K8GA 4NEYA 4YUDA 2HNZB 3OR2B 2HLUA 3H4DA 2VASA 4DL0C 3CD0A 3HT3A 1UKUA 2ZVSA 5L46A 2ZBPA 2R8KA 3C6UB 1FWKA 2OEJA 1HNWJ 3G71S 1VQKS 1M5SA 1QE1B 2KM8C 3EUNA 1F5AA 2AU0A 1XNRF 2XBPA 4TKTA 2CDRB 2CPYA 2IA0A 3HK2A 1HI8A 1M1HA 3DRXA 5CAAA 3C16A 4LF6F 1VS3A 4ED2A 5KT3A 1S4FA 4S0MA 2MZQA 3NOGA 4WXOA 4ZMMA 3KNAA 3RBXA 2JLEA 2DR5A 4DLGA 3M2VB 1TP7A 3GJSB 2XS2A 1RAOA 4ZPAA 5KG4A 5ETMA 3PRDA 4D3GA 1F60B 3HLUA 3GV8B 3I87A 4QCLA 3ILIA 1VC6A 3CCZA 2LA6A 4RW6B 3L7PA 4F36A 2EC0A 2NQPA 3I0SB 1T94A 4UTGA 1V5VA 3M6UA 3EVMA 4Q2MA 3D68A 2AIRB 2OMLA 3K89A 1DJ0A 2UV8A 4WFBQ 2DIVA 4NA1A 3FVYA 1VQ5S 3FK4A 1S79A 2QG9B 1HNWF 2BMBA 1WC5A 4C3MA 3PR4A 2HAFA 3OHAA 2PC6A 2FVQA 3NBPA 2YPYA 4ITSA 4PXCA 5D0HA 4NLXA 1VQNS 1R89A 4DZ6A 2DNZA 2JFKA 1VQOS 2V2QA 3EZ5A 4ED0A 1BQMA 5HK4A 2C3PA 1MN9A 2I6WA 4NCGA 4DSFA 4A8QA 3UQSA 3RB6A 1KONA 3NWGA 2N7CA 2DKOB 1S4EA 1FJGJ 4AE5A 4KPYA 2DHHA 3N6NA 2HLTA 4LFBJ 1SH3A 3R7NB 4RW7B 4D3HA 2DNOA 3H59A 2VHGA 4LIWA 4OYAA 1LW0B 2J9CA 2R2RA 2ZE2A 2KN4A 1KTQA 1RTHA 1HBMA 1VK8A 3M8RA 1RJJA 3NCQA 3DRSB 4PUOB 4RNOA 1U24A 2X7IA 1EQMA 2BKOA 4DCOB 4CYUB 4AD6A 1PKUA 1EARA 3LF0A 4USMA 4P74A 2SXLA 4K2JA 2V94A 4Y2KA 3VQTA 1UMJA 1TMMA 4C0OC 1RU1A 3SQGA 3TNVA 1NZAA 4CTAB 1HBUA 2BDPA 3V4MA 1FJGF 3PR5B 2V4RA 1VQPS 1SQFA 1YJRA 4QU7A 2MKJA 5KFYA 4LFBF 3ZZRA 2A6MA 3T5LA 4YR3A 3C3LA 2VG7B 2J7UA 4RW9A 2E66A 4OYWA 2M52A 2XMKA 3HVTB 4PWDA 2BE7D 5ETRA 4DV5J 1N32J 1S1TA 2NXCA 1JK9B 1WNEA 4HHJA 3CD5A 1IWAA 3RW7A 2AV5A 2X3GA 1PG5B 2WB4A 5IT4A 3SSQA 5J2QA 2M4MA 4KB7A 1U2CA 2Y1RI 3MFIA 1IKXB 2LXUA 3MM8A 3OUYA 1H6KX 4XIUA 2HQGA 2QT7A 3CSKA 2BUNA 4CH1A 1FEHA 3H98A 1KVKA 3MWBA 4N8OA 1P1LA 5CQGA 1V3SA 1RHQB 4I68A 2YBVA 3P96A 2UV8G 3KK2B 3Q8SB 3KHRA 4H4MA 3M1VA 3NMAA 2CNNB 2UUBJ 1CC8A 1GFWB 3WX4A 4WYLA 1R0BG 3UNGC 2HGLA 5C42B 1ZM3A 3O3LA 2B43A 2XMJA 5J2NA 1TKZB 2PE8A 1LXNA 2C42A 4CLUA 2ZOFA 2YWEA 5KFHA 5ADZA 4MMOA 4IOBA 4DV5F 3MCOA 3QNWB 2HS0A 2XY5A 4EYIB 4X2BA 3HSJA 1IBKJ 3UI3A 3P4UB 1X0PA 1U2FA 1FDNA 3UR0A 1IUJA 4ED8A 4ZJQA 4OJGA 3KNGA 4HI2A 4TU8A 2YWHA 3AB2B 4HACA 2FB0A 3SI8A 2XLIA 4WFYA 4LF8J 3WDOA 4LBPA 2IY5B 2CFXA 4PKDB 3JAMY 4J9UE 4KPCA 4ZVGA 3D1OA 4TLQA 2RDJA 1NUEA 3JAMU 1RTJA 3QIPB 5F8IA 4KRWA 1Y11A 2DPJA 1Z1ZA 2L9DA 2HK3A 2UUBF 2JRSA 2WCXA 4HDGA 3LPYA 3LAMA 2ZVIA 4OQJA 2U1AA 4KV8A 4ES3A 2CDQA 4ZKAA 2QFJA 3RRHA 2V8VA 4B9NA 1S49A 4FXVA 4C0BA 2OPPA 3CJKA 4RUAA 1TL5A 3GILA 4HT5A 2K06A 3I56S 2ZWOA 4X4PA 1IBKF 2W9AA 3C15B 4ZCMA 1LWCB 3G8SA 4CNZA 2IDLA 3B54A 4C3LA 3W2VA 3W5YA 2HVZA 1NH7A 1SH2A 2R7QA 2YNFA 4QW9A 4ZVPB 1CQNA 4LF8F 1S76D 3HP6A 4WYWA 4AXJA 4FPRA 2DIUA 2VG5B 3M6XA 4AXIA 3F73A 4EWTA 5CYMA 3TAPA 3CPWR 1TL4A 4H54A 1H72C 3QWPA 3MM9B 1S10A 1JXLA 1NMEB 1F3FA 4O4RA 2W25A 1B99A 4QWCA 4RJVA 3TWZA 2B8QA 2GQCA 2V8HA 3TVKA 2G0IA 5HL7Q 2MQNA 5KFMA 4ID5A 5CH7B 2NPFA 3GCXP 1BY9A 1IR2A 1UW9A 2MB0B 3OR1A 2QLFB 2DXDA 1U1NA 1M5KC 1KD1T 4NLSA 2F3JA 4IO9Q 2Q3PA 3HHLB 4RW8B 3AB4B 1SKWA 3W60A 5KFQA 2AJQA 2AJFE 2UUTA 4DR7J 2YH1A 4FN5A 1Q8BA 1RTIB 5EWFA 2DGUA 1VBXA 4TYBA 1Y5IB 1JLEB 1S0VA 4TY8B 1S9EA 2DVIA 1RAJA 3T3FA 2DR8A 1T3NA 4DQQA 3ZXWA 2OGUA 4B9SA 1N54B 4QQBA 1VMBA 1SL1A 3Q89A 2HFUA 2HRUA 4OJ3A 1U6BA 4BLGA 3CIMA 3MURP 2P2CB 3FKBA 1ZA1B 4URGA 2CZVC 5BR8J 3M7VA 4ATNA 1RAEB 5EWGA 2V4JA 2OP5A 3GV7B 1NM2A 4C8OA 1FNMA 3R7BB 3QT6A 2KFYA 2ZZTA 3LGNA 4NA3A 1UA0A 2RE1A 4DR3J 2CQHA 1RT2B 1HHTP 4ECRA 4USKA 3V4IA 4DR7F 3FQKA 2ZUAA 3V5RA 4MKAA 5AXLA 2E1PA 4K4SA 1PGZA 1T05A 5E7OB 3NAHA 4Q2LA 4YMEA 3V6HA 4F25A 2OMOA 1YJ7A 1YWXA 3IMQJ 2RU3A 3BM7A 2XZDB 3CCMS 1FXRA 3NBPB 2CQCA 4CO4A 1WC4A 3IN5A 1SUQA 1D8ZA 4B17A 3SSRA 1TUWA 4CLSA 2GGPA 1BQMB 2XY7A 3CO0P 5BR8F 1ZZFA 2O5DA 3LQVA 4GVBA 1HQ2A 1S1WA 5IV4A 2XSJA 4K4WA 1X4CA 3BYPA 1NK9A 2LECA 5KT5A 3OT9A 4O44A 5D4PA 2BM1A 5J2MA 1RISA 4M63A 1HBOA 4AFFA 2L48A 2R8GA 3D5MA 3RAXA 4PYAA 4DR3F 1WI6A 5DS7A 5ETQA 4CNYA 4LRAA 1CJTA 5GAHI 2ZE2B 1T9WA 3BYRA 3CULA 1UVMA 1HBMB 3MMJA 2HGMA 2YNHA 4KGKA 4KY3A 2DGXA 1U6ZA 3LP1A 4L76A 2NYIA 3QPIA 4C6AA 1V3RA 1E6VA 4ETZA 1UAWA 2MJNA 2UZAA 3W7BA 1MMLA 1MROA 2LQ5A 5EHHA 3CCVS 3NMRA 1VRUA 2DISA 3HZEA 3TZWA 3UCZP 2CKWA 1CJKA 1QY7A 1UJ4A 2ZHAA 4LRCA 2XMVA 4QYRA 2AKWB 5K14A 3PFEA 4USWA 1REVA 2WSEC 3EICA 4JV1A 2AEJA 3GG0A 1AUSL 2VZ9A 3FZ2A 1RAHB 4B9VA 1QUPA 4ECYA 1HBUB 2PSZA 1RZMA 2E1MC 4MYTA 1D09B 2ZH9A 3EGVA 2HEKA 1R8CA 4YP3A 4FS1A 2DEJA 1YBAA 3LP0B 3RTVA 1FX4A 1HNXJ 3TX8A 1SIWB 4B08A 4LRFA 4OYZA 1T9VA 2BJEA 1KNZA 4O0IA 4QOTA 2GAGC 5J2QB 3CJTA 5IT9Y 2N3LA 3FCVA 3MM8B 4WIQA 2VC0A 3BSCA 3HKZD 1C1CA 1B7FA 5L1IA 5IT9U 2W2MP 3H5YA 2IBOA 1LW2A 4PQAA 1S6QA 4ZLNA 4NOHA 4Y6IA 1KVIA 2ZD1A 3DU6A 3GIMA 1ZAVA 1NK0A 1N5TA 2V9WA 4H4MB 1NDCA 4LRDA 2IJNA 1U48A 1Q8LA 3TAMB 1T7PA 3H8YA 4IH7A 2VIHA 5J1EA 2RRNA 4OLPA 4ICLB 3AXMA 1RWWB 4F3OA 3OL7A 2VFSA 2QX0A 5K8NA 5IQQA 2GIRA 5JMNA 3NCPA 5HBMA 1HNXF 5HANA 1PCAA 4DJBA 4DV1J 3Q24A 1WSVA 4EYHB 4M5HA 2ZEJA 1FJCA 1X5TA 4E8UA 3GJRB 2Q6CA 2V2KA 5THWA 1Y10A 1Y0HA 4HACB 3JS9A 5F0WA 4DL7A 3PX0A 2EK1A 4JI5J 3R5DA 4L3NA 1GAOA 4RUBA 5JVHQ 4WBFA 2LMIA 3PCOB 4K8RA 1HLWA 3SYZA 1S12A 1HBNA 3G82B 3JQMA 5HROA 2VFVA 4G1PA 5DGBA 1C0UA 4KV8B 1VHIA 3H7HB 2IVMA 5F9NA 3C14B 1RB0A 4CT9A 2JHEA 2XS5A 2MKYA 2FYXA 3PY8A 3A12A 1SB6A 5DQHA 2OPPB 3CJKB 3MD1A 2DHGA 4DV1F 3E2EA 1H2TZ 2O01C 1JXVA 4MIAA 1WKJA 3EVWA 2MLZA 2EG1A 1LOUA 1RACB 4K5SA 1NJXA 3IP0A 2ZC4A 4KH1B 1YIJS 1SC1B 2YNFB 4JI5F 1UWBA 5GADI 3N4WA 2QA4G 4MKYA 2OTLS 3PO5A 3TJAA 3MEKA 1S57A 2EFOA 1ZBTA 2BJ1A 4E0DA 2UUAJ 3MAQA 3OTEA 3EJMA 1Q16B 1FD8A 2XLKA 1T03B 1H2UX 3I4HX 2EVZA 2A18A 3NL0A 4M5MA 3MMBA 1NJIT 1SKUB 4ID5B 2MDAA 2CG8A 2YX4A 4RZRA 1U26A 4U6PA 2CPEA 2NR0A 2LEPA 2Y0BB 3EPGA 3KXDA 3OR1B 1X5PA 2M3DA 2XMWA 4RO0A 5B09A 4DL6A 3VAIA 3AHPA 1OY6A 1LFWA 3FQLA 1ZPVA 5B7WA 1FKPB 4YEAA 4DQSA 4FF3A 2DY1A 4CH7A 3HHLD 1DRZA 4LSZB 1FE0A 2KYZA 2QMXA 1NZ8A 4BDPA 1S9EB 4JI2J 3J81j 4Y34A 2PA3A 4RBVA 2XO6A 4CLYA 3PX4A 4A8OA 2IRXA 4JBCA 3KHLA 4MFBA 1RWPB 2UUAF 4C8YA 2DH9A 5AE3A 1LNQA 2WB1D 1SJRA 3CDEA 4RNHA 4IFVA 2Z57B 1URNA 3MECA 3Q8RB 2V4QA 2ASDA 2IBKA 3DGPA 4L3KA 3BKFA 2V4JB 1OMSA 5C25A 5K8MA 1S7HA 3KG1A 2CG4A 5HMZA 4CWBA 3I55S 4O3SA 2JEGA 2KRRA 3CF5Q 5EGYA 2E9RX 3LGMA 4YOEA 1RHRB 3FEZA 2EKNA 1UW4A 4IG3A 3LP2A 1JLGB 3LGHA 1MN7A 1T05B 4LJMA 2XGPA 4JI2F 5L39A 1NEEA 1TAUA 4HT7A 3KUEA 4L74A 5EDWA 3MTJA 2HFSA 1IJFB 1UL3A 3W62A 2XY6A 3SFUA 5B0FA 1SUQB 4OHXA 5DG8A 3RJMB 4NYZA 4RNNA 4KE5A 4WE1A 2EC2A 2IFXA 4NRUA 3M8QA 1SJ3P 1YJ9S 1S1WB 5JUMA 2XWXA 3Q8YA 4O44B 3KLEA 3IR5B 3E01B 3P3DA 4B3MJ 4ZIWA 3LA0A 4OHVA 3H42A 1HBOB 2B4UA 1JNZB 2WZ1A 1CJTB 4PXEA 2RQCA 3HSGA 2YX7A 2JLGA 2AJ1A 2H4WB 4LQ3A 1IBLJ 2YNHB 3OBIA 3VVTA 2BRKA 3LP1B 3SDEA 4KO0B 1E6VB 1TV6A 1QSLA 4I6WA 2WVCA 1MROB 1UFKA 4P7VA 1VRUB 3B82A 3CE8A 1XMBA 3KKFA 1CJKB 2KZZA 4P10A 3EE3A 1U0SA 4KHMA 2HBZB 4EZ6A 2R7RA 4ERDA 2QC3A 2OD4A 4F0HA 4W90B 4Q8FA 5B0AA 1X4DA 5K14B 4Z37A 1REVB 2ZBCA 1CJUA 2K2PA 2UUWA 3LALA 3I5CA 1R31A 3K57A 3GPAA 2MZSA 1RT6A 1F5CA 4B3MF 3R5AA 3UD4P 1P27B 1OYDA 4DR2J 2ATLA 5FIIA 3K5PA 2LEBA 4LQ9A 2BQRA 2BJ3A 2GHWA 1P6TA 3TQ1A 1IBLF 2B9XA 3VZIA 3MR7A 3OVBA 2JVOA 4IFYA 4K59A 3W66A 1U8SA 2M8DB 3M6VA 4URSA 3TYTA 3G87A 3CCWA 4XO0A 1RLDA 2GAHC 1RWKB 1W2BR 1FRXA 3NGSA 2UUCF 2LU1A 4FVCA 5KG7A 1RQ0A 3QZ8A 4TYAA 2ABYA 1UA1A 3IS9B 5A2QY 1MSWD 3O8WA 3BH7B 2LVWA 3SSSA 4LRBA 2ZD1B 3M32A 3R2DJ 5A2QU 4O4GB 4ZS6A 1RGVA 1RBAA 2FGOA 2VFRA 4A4JA 4J9SA 4DL2A 2OTJS 1HD1A 1ACMB 4NLVA 1N48A 2OSRA 5KTQA 4KAIA 1SIZA 1SL0A 2Y3YA 4LF5J 3OFGA 3NNAA 2R7OA 3K2YA 4DR2F 1Y5NB 3QBCA 4FKXA 5HQ8A 2YKAA 5HBMB 4ED1A 3MZIA 1F9FA 1JLQB 3E8OA 7AT1B 2PT0A 4IR9A 2ASLA 1KS2A 4TNOA 5L8RC 3MMCB 2FY8A 1S6PA 1VI7A 1WKLA 3GR0A 3HHLC 2XNRA 5SZTA 1D0EA 1HMVA 1KSPA 3BPSP 4DPTA 3UE2A 1M1GA 1APSA 4ECXA 4OZ5A 4OYPA 3WBZA 3QFWA 4ELUA 3VAHA 2ASJA 3A8EA 3HKWA 1YJWS 4P52A 3MPDA 4G3IA 3FEXB 4QZVB 1Y5LB 4K4UA 2BVZA 1CJVB 5KT4A 3FC9A 3GIRA 3CIZA 5IOLA 1HBNB 2LCWA 1PSDA 4EZ9A 1U1LA 2XCPA 3KLHB 4C3KA 1C0UB 1FRJA 3QSIA 3W61A 3M4XA 3TJ9A 3D66A 2I9SA 4EEYA 1S0MA 4CP5A 4Y3CA 4A47A 1ZOTA 3BBBA 3PJWA 3O2IA 3ICLA 5I3PA 5T41A 4BWMA 3EMTA 1EKSA 3CDBA 4RX6A 1UTAA 2J6TA 1HWLA 2LYVA 2IJRA 3IRWP 4OHWA 1XR5A 2C2MB 1TVRA 2J0SD 2RAQA 1U6FA 4RU9A 3MM6B 4PWWA 3R27A 5AE1A 1YLXA 1SL2A 4TY9A 5HJYA 3FUYA 4ZHRB 2G2OA 3ITHB 4DMZA 3FJ2A 2FJAB 3K58A 2OPRB 2DNLA 2F8HA 4Y0FA 3MD3A 1MU2A 2FTRA 2MQQA 4NLRA 5E2QA 1L3VA 3FCHA 2P9CA 3D3BJ 5CD4H 2EWHA 2MTLA 3OFFA 5M2RA 2O3DA 2W9BB 3MMBB 2HGNA 4R5PA 1RHMB 5FDLB 3UN2A 1JX4A 2XCAA 2B51A 2MKHA 2A2DA 1BQXA 4ZDNA 1QM9A 5T7LA 5MAOA 4ZVHA 2D7SA 2FLLA 4PYDA 4WIIA 4YB6A 3GCWP 5HQMA 3IBCB 5C24A 5H9FK 5LJ5Y 3D3CJ 1MMDA 2RUSA 4Q0BA 1RT4B 2H51B 1TUVA 4PG8A 2FJVA 1S1UA 2W2NP 1CULA 4PPDA 3BV8A 5GMEA 1AA1B 3H5UA 2B8PA 3VF0B 3UFCX 5F8LA 3M6WA 1CG2A 1RT5A 2CZ9A 1NCLA 2H9ZA 4F67A 2YQ0A 2IM0A 1SC4B 1REGX 3AOCA 2YH0A 4IFVB 3EYZA 1AYEA 1EP4A 1HI0P 3MECB 1XN9A 3PJ9A 1I1GA 3RRGA 3W63A 2FHMA 3D9BA 1R8BA 2OPQA 4KC5A 2N4CA 3UDLA 2CQPA 1TELA 1I6JA 2PO4A 4J9QA 1WD6A 1LFPA 5DZ7A 1GMUA 4JV2A 3DRRA 2W1BA 2APOA 3SFGA 2GZOA 4P75A 3LAKA 1HNIB 5IWAJ 4F2SA 3AD8C 3OLAA 3RYLA 1WACA 5B0BA 4LVNP 4OLOA 4B02A 4CDIA 2AYBA 1NDKA 3IBWA 1PYOB 2HVDA 3H5XA 4IG3B 4FF2A 2MKKA 2IMWP 1IQZA 1WTFA 3HHEA 3PEJA 2DNGA 1FT8A 4ANCA 3U1NA 4JI8J 1WHVA 4J9RA 1UEUA 1Q5VA 3MAHA 2AGOA 1RWXB 1XJWB 1S0OA 5I42B 5JXSA 3NY0A 4ED5A 4ZJOA 2EPIA 2L9NA 2RB7A 1FRHA 1FF2A 2RU9A 4UZCA 4NLOA 3LW5C 1ZAWA 1D9FA 3DHXA 1Q86T 1HHQA 4KR0B 2QL5B 1VDHA 2M70A 2HIYA 3F44A 4C7QA 5E3QA 2KKHA 4NWBA 2KH9A 2Y0SD 2IRUA 4QWBA 1TR0A 1TMJA 1FE4A 5IC4B 3H90A 4E98A 4M5KA 1AROP 3F56A 4YHHJ 5IWAF 3CXCR 3UDVA 2ZH1A 1WKKA 1YGYA 4DX6A 4ECWA 2M9KA 3NKYA 5T14A 4DWIA 2OFHX 3GTYX 5G0RA 3QAUA 4A48A 2BXJA 1D9AA 3G96A 4YR2A 1RHJB 3TR5A 2Q66A 3J7AN 1SJQA 2Y1IA 3AH6A 5EUHA 1PIEA 5LSRA 1U47A 4E2FB 3EDRB 2NYHA 3H40A 1HKAA 2NLWA 1GK8A 5J2PA 4ZITA 1WC3A 4JI8F 5GVQA 4DF4A 2R7XA 5KG1A 4FYVB 2HVEA 3P45B 4U7UK 2B0GA 3BKTA 3GFYA 3QGIA 2JVRA 3EGWB 5B08A 3KTQA 3MGJA 2HHXA 4NCAA 1DBDA 2UXDF 2Y1LB 5DJBA 1KLNA 2N82B 2AF6A 4W4MA 3HFKA 5M2UA 3Q8UA 4N41A 1RWOB 1M5PC 2ZBQA 4UOCA 3MTKA 4Z7CA 1RT6B 2EBGA 2W2OP 3S6EA 3NEKA 4YHHF 4ZP6A 1C4AA 1GMVA 1SQGA 2AEMA 4KSEB 1T9YA 1VRTA 4R8UB 4V1Ak 1RK8A 3KYLA 4DR4J 4QR2A 4CLWA 1PAUB 3ZTPA 4X4UA 1NRKA 4DDFA 3X3UA 4LF2A 3VAJA 2CQBA 2BJ9A 3CGIA 4I6AA 1G3OA 1DZ5A 1N4LA 1H3DA 2ZDOA 2HNZA 1FEEA 3OR2A 4ZP8A 5ETKA 2NSBA 4P2FA 2VDHA 3G6XA 2DJWA 4C8NA 4QIVA 3GMGA 4C98A 3BREA 2R7WA 2EXUA 2CPFA 4DPUA 3IC1A 4AYBD 3DLJA 5CYQB 4K4XA 1HD0A 1HPZA 1EB0A 1FDDA 4CLZA 1XMQF 3US5A 1NJZA 1N34F 4ZN3A 2GX8A 1PAEX 5B0CA 2MGZA 4DR4F 4F2RA 4HTIA 2GQ2A 2VBWA 1T11A 3T1YF 3G6VA 3R7SB 1PBAA 1S6PB 2GNKA 4QIWD 3I0SA 3FSYA 4YR0A 2LLZA 4QYZK 5D4NA 2RUGA 1IN0A 1R7IA 3CEDA 3R1LA 4CIOA 3TARA 1B4SA 1BHNA 5ETLA 4UF4A 2E1CA 2J7WA 4DSKA 2R7UA 3CMQA 3CJQA 3BJYA 3KK3B 2WK4A 3JSMB 5D8HB 2CJKA 2L9WA 1OQ6A 3CMES 5BXIA 3N6LA 2Z2MA 2CJYB 2GHPA 3OQ2A 4USTA 4DXLA 3QJPA 3UN5A 3DLBA 5KFSA 2OELA 1ITPA 2DEIA 2ILYA 2BE2B 3N6MA 1ZS6A 3LH2S 2L41A 3OTOJ 2HNYB 1C4CA 3VWSA 3IWNC 4F3QA 3RG6A 2HWIA 5HSPA 3TP2A 3FBFA 1SPBP 1WF2A 2R42A 4G6VB 3JTPA 3IAS9 3OFHA 4RW7A 3EGZA 4V19X 1JIHA 2DHXA 4OX8A 3VALA 1GXLA 3PYDA 1TVRB 3FRZA 2IPOB 3LWLA 4QIEA 2FJDB 4J90A 2VOOA 4DV7J 2PGCA 1MG7A 2PMHA 4RLEA 3FDSA 1F2GA 1IBMJ 5CHCB 2JX2A 3UCUP 4ZK7M 2B4VA 6FD1A 4N76A 4A8WA 1H2VZ 1MLAA 2OPSB 1TFYA 3UDCA 2CNLB 4PG4A 3OTOF 1VBZA 1VISA 3OXLA 2D3UA 3S7RA 4NEZA 4ECSA 2DB1A 4CTAA 2R3VA 3ET6B 2P9GA 5T7LB 3NXZA 5KFLA 3NAIA 2VG7A 5C24B 3TANA 2J0XA 3BGUA 4Q0BB 4X4SA 4IH6A 5KFVA 3HVTA 2DR7A 2RHQB 4KHPJ 1WOOA 1NK8A 1CULB 3T1HJ 3RR7A 3CUNA 1Y7PA 2W4CA 3A3OB 3TZXA 4ZN1A 4DV7F 1WTBA 1EKRA 2IC3A 4ELVA 2C22A 4A8MP 3QT7A 3CCQS 1IBMF 1KBRA 3PIPQ 2DCUB 1U2RA 3HHDA 4XTTA 1XMOJ 1BWVA 1B0TA 2AD9A 2RT3A 4F4AA 1OS5A 8ATCB 2JLFA 1SC6A 5HMWA 1D9DA 4R0JA 2HWHA 1EP4B 4B9UA 3ZZUA 5KFBA 4KFBA 1MMNA 1A9NB 3KK2A 2KHCA 1RKJA 5F8HA 3Q2SC 5KFRA 3DRRB 2K7JA 4C11A 4ECTA 1R27B 5C42A 4I67A 1N52B 2GS8A 1I5OB 2NCKL 1VHFA 3KWMA 4DV6J 4OI4A 1HQEB 2KFZA 1QD1A 4KHPF 1M1KT 1B7YB 4Y00A 2K3IA 3OVAA 2H1YA 4NX9A 3PW0A 5HVGA 3CWJA 3T1HF 2BEFA 4CM2A 5ETVA 3HD1A 2BX6A 2W4DA 2CNKB 2A2CA 3OVSA 1GX6A 4K5RA 1IM6A 1KTVA 3G6ES 1ZPWX 4A8SA 2R2TA 4OIXA 1RWVB 1GXTA 1RE1B 3DRYA 1J5OB 4RL1A 5M2PA 3N79A 4OYBA 2NXUA 1LWFB 3KMSA 1WWHA 4U9RA 4C4WA 1VC0A 1ZM9A 3QIPA 2DRDA 3QZ7A 8RUCA 2HS3A 1IKVA 5ITHA 1OSCA 4JI6J 4NRTA 2PMZD 4IQXA 4GMKA 4M5GA 3I6PA 4NLUA 3JSYA 1DARA 2BACA 1T3OA 2RHSB 2FLNA 2UVUA 1XNQJ 1Q79A 3ZZOA 3PG9A 4JV0A 5DG9A 3CD7A 4WU3A 2DNPA 4DV6F 4OJHA 4QYZJ 5CA5A 2ZUGA 2RS2A 1IQTA 4N8NA 2ZBRA 3C15A 2BZ2A 4OHYA 2MKIA 2E9ZA 2XNQA 3JTNA 5J2PB 5DG7A 1G1XA 2B5JB 4NLQA 3D1HA 2FC9A 4EBDA 2VG5A 2IM2A 2BRLA 2BE9B 2W24A 5LSOA 1I94J 1S1XB 3RBZA 2HBQB 3ADAC 3T5JA 3MM9A 1ELOA 1YSJA 1M90T 4JI6F 2DH7A 2Z2ZA 4I2QB 1RT7A 4ELTA 3NNCA 1X4GA 1XNQF 5HVHA 3U02A 2XI2A 2JWNA 1QDUB 1KQSR 1DFDA 1S7IA 3N9UC 4YB5A 4B3OA 1V6HA 3EXCX 3NGKA 4AT1B 2DCLA 3HHLA 5KFIA 2V6AA 3AFGA 4LSNA 1S97A 3W1YC 3IGNA 3OL9A 1RTIA 2E44A 1JLEA 2EI5A 4CQ1A 3TUJC 4TY8A 1NHVA 3OD2A 2UXCJ 5IS2A 1I94F 2J9EA 5A76A 3GV5B 2BJ8A 3PYFA 2KDOA 1F0XA 3GONA 3EXYA 1HPZB 1NPKA 4BC7A 2WBMA 4MAKA 4HTJA 1U49A 3M8YA 3FSIA 2WTFA 4OX9J 1HHSA 2YX1A 3OFEA 2ZBIA 2E5IA 3ZFVA 1NSKL 2MGZB 2A1BA 1TL7A 4M5DA 2VOPA 4RW4B 3A3NB 2DNMA 2JSXA 1CSJA 2D3O1 3J80Y 2QSWA 2LDIA 1OIAA 2AQ4A 4Y2IA 5CCLA 2AZ3A 2DNQA 1UPPA 2ALYB 3FMBA 2H4YB 3DCAA 3J80U 1HWKA 3DDIA 3BR8A 2B4PA 1RT2A 2E5GA 1ZETA 4ALZA 3QRQA 1UWAA 3BR9A 3GR1A 3BSAA 4C8KA 2LQ8A 3AOBA 2AGPA 3CCRS 1YTYA 6AT1B 5KAKA 4EMDA 2QA4S 5I3UB 3BDEA 2UXCF 3UN3A 1P9QC 4CZCA 3J81U 3OHBA 5IFMA 2YKQA 1BE4A 4WP9A 4OZNA 2KO1A 5FD1A 1Q78A 3WC0A 1UPMB 1U7LA 2YTCA 2RQKA 3JXOA 4OX9F 5KT6A 4DFPA 1X60A 2KJVA 2Z30B 1KQGB 5ETTA 3QYYA 4PXBA 4YY3J 3V2UC 1AXQA 4GC6A 2YWWA 2KJWA 3BS9A 1YBUA 1H98A 1LWXA 2O1PA 4J5OA 2QYGA 3R5JB 2W4PA 3JSRA 1R43A 4LBIA 3CCES 1PJ6A 2GW8A 5A6PA 3NCRA 3ZZPA 1KR4A 5GADU 2QLBB 3ILJA 2PEBA 4DL4A 3GFHA 2CQ2A 1N36J 5L1LA 5EN1A 2AX1A 1RTDA 1U1KA 1K1QA 3Q23A 3CB4A 1KHWA 3SZ2A 1WEXA 1NB7A 2YWGA 2MLXA 2YKNB 3HX9A 3M2UB 1B70B 5D78A 4EI2A 1IJEB 5IT0A 1T8EA 1O6XA 2FUG9 4YY3F 3M8ZA 4C97A 1BLUA 2VG6A 4KTQA 4X4TA 1FX2A 3VAFA 2OD6A 3KFWX 4ZPCA 1S72S 3L9ZA 5DM6Q 3BDPA 1SVDA 4Q44A 4Y28C 3LP0A 5HMXA 2DPIA 2F8EX 3CDUA 4DLEA 3Q8VA 4ZP7A 1QUVA 2C2DA 2QN6B 2CJ9A 2EBEA 3UPFA 3K5NA 2DITA 4ILRA 4PABA 1VLYA 2E5HA 3F41A 3SEOA 1JXEA 1U1OA 3E3XA 2PMWA 5K9FA 1FRIA 1QAYA 1WC1A 2ILZA 1N36F 1DLOA 3W8PA 2IC3B 2BANA 2C3OA 1Q5YA 2WOMB 4C9DA 2GVDA 3AAWB 2CIMA 1X5OA 4DR6J 1RUSA 4USJC 1KFSA 3IR7B 3JQJA 4CO5A 3EVOA 4B9TA 3POTA 4KFBB 3P5BP 4OL8A 4FP9A 5LT5A 3TAMA 3HFVA 4C11B 4P6QA 5DDPC 4ICLA 2RH3A 3DLGA 3MI7X 2KHDA 3R2CJ 3TO8A 3A4TA 2HSEB 1SC3B 3JQKA 2RSQA 5L38A 3IO1A 5DM7Q 1O0PA 1V9OA 1HI1A 5L1JA 2AHOB 5HVFA 4XDCA 4H4OA 5D15A 1LKZA 3PTWA 2F9JA 4PAAA 4DUZJ 2IRYA 3PFOA 2I38A 4OI0A 2CJBA 3BQ0A 3RBEA 4ZLJA 2JJ4D 2HHTA 5HAOA 5B0DA 4ZPTR 1R8AA 4DR6F 4I69A 2HBYB 3VAKA 2KL8A 1B0PA 3TUIC 2IDEA 1W7WA 2HQFA 1WOPA 1TL3B 2WONB 4DV4J 2ROPA 2DYAA 5KG2A 1JLBA 3IWLA 3G82A 2J6SA 2GJ2A 2NSCA 1IKVB 2FLPA 4CCHA 2VL1A 4FXDA 4OZLA 3HULA 3C14A 4U7CA 2KXFA 5DRKA 2RVJA 3HJVA 5LJ3Y 4ENOA 3HJFA 1W25A 5E41A 4WK3A 1R8PA 3CO9A 2D3ZA 3P5TL 2CPJA 4WFAQ 4DUZF 3OPKA 4F4YA 5KFUA 5DETA 3DC2A 5IXUA 2BOAA 3GFXA 3O1LA 2DGQA 2ZH6A 3GSIA 2O67A 2E29A 3CC2S 2VB6A 1D8YA 2WHOA 5F9LA 1YJTA 3ISND 2QMUB 1JLCA 3CDWA 1B0VA 2FDNA 2IM1A 2C2OB 1QAIA 3K59A 4IKAA 4DV4F 5KG0A 2LXFA 1ZM2A 4LF7J 3AOAA 2R8JA 3MEGA 1T03A 3KHHA 4C48A 4NCBA 1RT7B 1VIOA 4N77A 4ZPVR 3KG4A 1RABB 3RB0A 1IKWB 3PYGA 4YDXA 3R97A 3SXLA 4B3OB 3OJSA 1F6TA 4PQUB 4OX6A 2XS7A 3LPEA 1N5YA 1FKPA 1H38A 4ZVQB 1X9SA 2MQPA 4LSNB 2OEKA 3PO4A 2LFVA 1N6QA 1G4CA 2RD5C 1RYRA 1IBCB 5HMYA 3OJUA 2PD1A 5KG5A 3D6TB 4Y2MA 1EAYC 2KXNB 4A8FA 3DYAB 2LXIA 2QYCA 3DRPA 2IYGA 3PM9A 2YXLA 2XI3A 4LF7F 5K8PA 1NLKL 1QVFR 3MOZA 2HZVA 2BKNA 3PHEA 2B56A 2CQ1A 2Z58B 3I82A 1WF0A 3ENVA 1Z2ZA 2XMMA 3D6HB 3H0PA 4JP8A 3HDSA 2FZCB 4B9LA 1TL7B 2R8IA 4M5DB 2JC0A 3JTOA 1M5VC 4OFZA 1N88A 1RA7A 2CADA 1RWMB 1PILA 1HW8A 1EJ7L 2ZWPA 1CVJA 1FWPA 1IVZA 1NH8A 3PW5A 2MZ1A 1NDLA 3DKDA 4NYOA 4OYOA 1NBEB 4NASA 2FPHX 1PYTA 2VJUA 5KFKA 1JLGA 3PEHA 5F8GA 4ZVSB 5D77A 3P6YC 1M0SA 2J6UA 3DU5A 5H9EK 4IRKA 2MPUA 5EX0A 1S9GA 3Q8PB 2G1HA 2VKZG 5KFGA 3DXBA 4DPYA 5F8MA 3I31A 3IWXA 2BR0A 5LSLA 1Q82T 2JH3A 2DRAA 3RZAA 3THPA 2WVEA 3R5CA 2BKPA 3G8TA 3MPUB 1VC5A 2HHQA 1YDLA 2CJXB 4P2MA 2D9PA 2VPZB 3E01A 2AW0A 2HQCA 5L9XA 4DX5A 4RNFA 1UEVA 2U2FA 2HHWA 1VJWA 1Q95G 4DR5J 1EQ0A 1T02A 3TEGA 4USVA 4I7FB 2CWKA 3ZNJ1 2CJQA 2GJFA 4TXSA 4LVOP 4QPTA 4LIRA 4XK8C 1R6YA 3N28A 4QWAA 2QL7B 2AEFA 4KO0A 3V6JA 4DX8H 3O44A 4U7UD 2CZ4A 2XLJA 2ZM6J 4DR1J 2MEWA 1JQGA 1RTDB 4JI7J 3CW2C 3ZNUA 2EFQA 1UJ5A 2ZH8A 2GO8A 3ZTSA 4EGLA 2BOPA 1SKSA 4HI1A 3M9NB 1YJVA 4ZCIA 1J5EJ 3TAQA 2LP4A 3BGLA 3Q83A 4TQSA 4M8LA 4HLBA 3AY0A 4ECQA 2HZAA 1I51B 1VQ4S 1U0HA 1N33J 2VG6B 4ZIVA 2PIIA 4DV3J 4ZVFA 4RWXA 1WF1A 4DR5F 5KFFA 2HQDA 2D9OA 1IKYA 4NZ6A 2QGFB 3BGRA 2P9EA 2FHJD 5U47A 2GO9A 1DTQA 1X0FA 1FD2A 1O5JA 3QGHA 3UVJA 2VFUA 4M94A 3K5MA 1JLFB 4B3SJ 2E1AA 3BO2A 1DLOB 2V8PA 4LR7A 1GTHA 3ISNC 3H25A 1FHTA 1WUUA 1S99A 2ZM6F 4DR1F 2BANB 3TI0A 4JI7F 2OFGX 2GVDB 3MCSA 3DOKB 1U02A 1GNKA 3IS9A 1HR0J 3OV7A 4IG0A 2P8IA 1DHMA 1RWNB 1J5EF 1SJ4P 3POTB 1RSCA 5D0EA 3BN7A 3W2WA 4O4GA 3QWUA 3VGUA 1S6UA 2KU7A 3SCLE 5C2GA 4WU2A 1XBWA 3I9ZA 2HFNA 2Q79A 1N33F 4URQU 1PC4A 3DLGB 2HQ3A 1IM4A 2M88A 4DV3F 2BBEA 3QGGA 2M5YA 5LM7E 1FFWB 2B9YA 2YVSA 1EIYB 1LWEA 2IAJB 2OI2A 2GFFA 2N7YA 3T41A 1JLQA 3JYTA 4I64A 1WG5A 4H4OB 2VBYA 5ETSA 4UUWA 3S1TA 3MMCA 4WXWA 2ZJRQ 2W8KA 4B3SF 3LTOA 4C8ZA 2XG8A 2BYCA 2QJ3A 4NPOA 3ZZYA 2P6TA 3DOLB 4Q43A 3PACA 5A6WA 1ZZNA 1FO1A 4F26A 5DDQC 3CJ3A 2C2KB 3BKUA 2VF3A 3KLVA 4PWUA 4FNIA 1HR0F 3L7UA 4XPEA 2CA9A 5HI7A 3OXGA 3VQSA 1CJVA 7FD1A 1FRKA 3SCIE 1JLBB 3H2LA 3KK1A 1H0HB 1SI9A 2AMCB 3SBMA 4QWEA 2V8DA 3KLHA 2Z8QA 3MXHP 4N5SA 3NGRA 5KFOA 2G13A 4MIBA 3W64A 4PG7A 4OZ3A 2XMAA 4OHZA 3T9ZA 2Y1JA 5E33A 2VU5A 3WHIA 2QEXS 4EK2A 5LL6d 2FJWA 5CYJA 1OQ3A 3H2UB 2X1AA 5IC6B 3A8JA 4ZLLA 2R7SA 1UCNA 2Y9HA 2FIUA 1AB8A 4DN9A 1X9MA 1OY8A 2ACMA 3BGFA 3L95X 2KRBA 3OL8A 4F0KA 1T9TA 3QLHA 4ES1A 5H9EJ 1JLCB 3MM6A 4IH5A 2PI4A 2ZKUA 2EKYA 2Q43A 3L4BC 3MM5B 4ZHRA 3ITHA 1K47A 4DUTA 4KGZB 3T5HA 1FKOB 1URRA 4U96A 1BQNB 2OPRA 3SCKE 3FEYB 3TEHB 2KZMA 3J7A1 4X65F 1CQMA 2J9DA 3CJSA 1AFJA 3UWTA 4GO7X 3MEGB 4ZPBA 2HW3A 4MKBA 3IM9A 2VD3A 2GQQA 5F3TA 3LWMA 1VQ8S 4LBHA 4WKRA 2W9BA 1MNEA 2HVIA 5FDLA 5JVGQ 3PW4A 4IRCA 4YB1P 3NOCA 1FJEB 2DNKA 5KFZA 2JL9A 2DNRA 3EWGA 1YRXA 4PZVA 1N5YB 1VQ6S 1FERA 3EM1A 3T19A 4HH1A 2OUGA 3AQOA 3MMAB 3DLEA 1JLAB 4DI6A 1RT4A 2DGOA 2I8EA 1WI8A 3AODA 5BYQA 1N6QB 2VFTA 1RT1B 2V67A 3C8YA 3VZHA 1D3WA 3DLKB 1L3KA 4JI3J 1QVGR 2BA9A 2VV5A 1RHUB 2H5IB 3DRPB 3OSPA 1HYSB 2OHDA 2V5HG 2CXEA 1BC6A 1O8BA 4M1KA 4IOCQ 4NLDA 4K4ZA 3G8QA 3IRXA 4UZBA 4NI2A 1HNVB 2XZTB 4ZA1A 3WIVA 3MUVP 5HP1A 3CCUS 1NK7A 2V2ZA 1QAJA 3QAEA 4LSLB 1HQUA 3IA0A 5KFPA 4Q45A 4ILLA 2G2ZA 3GYGA 3J7YU 3GLJA 4DUYJ 1HNIA 4G1QA 1Q8KA 2GVZA 4I1TA 1JNRB 4M95A 5DDRC 2UVWA 2HBRB 1MWQA 2VKRA 5CCMA 3B4MA 3FBBA 1ZAXA 1AFIA 1RP5A 1TKTB 2B9EA 2DXEA 4N56A 1EHWA 2LDYA 1NSQA 3ZTRA 3BZQA 3QQCD 4JI3F 2MMYA 2XWYA 2VODA 4WJBA 2QRRA 2A0FB 3C6TA 5K5MA 1S9GB 3ONQA 5C7PA 2D69A 3Q22A 2LKZA 4DCJB 3DMJA 2D1CA 2HNDB 4MYUA 4DG1A 5I42A 2VQFJ 1UETA 5DGAA 3HO1A 1KEKA 1FK9B 1HWIA 3D6MB 1YI2S 3W9IA 4I0WA 3QGPA 2B6AA 1VRQC 3DI6A 2QE5A 2CPXA 2RIJA 4U67Q 5KT7A 1N56A 2ASYA 4GC7A 2YKPA 3CJ8A 1JB0C 2E7WA 2CJAA 8AT1B 4DUYF 2MQ8A 1BD6A 1X7VA 5LOQA 2YQ1A 4J9KA 1YHQS 4U95A 3KLGA 1S9FA 1GT8A 3ETMA 1U09A 1Q7LB 4J91A 2YY3A 1AW0A 4NYPA 2F4VJ 4HEA9 4CLPA 2C1EB 3N5FA 4O23A 2MYFA 3CCLS 5EWEA 1WC6A 1F2HA 2MJUA 1WC0A 2MSTA 1VIXA 2BM0A 2CQ4A 4ECZA 4OYMA 4DPWA 1VQLS 2UUCJ 5J1PA 4Q8EA 3HHNB 4MH8A 4BWJA 3M8SA 1KP6A 4DQPA 2VQFF 4P71A 2IYIA 1RKIA 2WSCC 3ETOA 2CPDA 3D1QA 3S01A 4B9MA 5IM0B 1BMQB 4DL5A 2DHAA 1SV5B 2F5GA 1KWMA 2EFPA 4L6V3 3EZUA 3MEDA 3U7JA 1FWLA 5D4OA 2NZ4A 1G6BA 2E5LJ 1N32F 1U0HB 3SQOP 1KKHA 1KOHA 4DFMA 1ULRA 4HR2A 3VAMA 1QLNA 3ULHA 2IJFA 4EBEA 1M5HA 5BYSA 3HPOA 3KUHA 2MZRA 3QSYB 4R8UA 1IKYB 4HVZA 3BGRB 3DM2A 3D54A 1T9UA 2RF2B 5AXNA 1UP1A 3I96A 1DTQB 4A8KA 4O3RA 2F4VF 3UVJB 4WP3A 4B3RJ 4P9SA 3HMJG 2DR9A 1C2PA 4FPIA 1U45A 3RU0A 5A8KB 3M2RA 5LXRA 1C0TB 1FCAA 2OO4A 3H4BA 1ZM4A 4FF1A 2J7KA 3IFEA 1IXKA 3SMZA 3W3SA 4IG0B 4DQIA 3NRBA 2YNIB 5KT2A 3B6BA 4PXDA 3GQCA 3W2WB 4RNMA 4MKVA 5CYQA 3PXGa 2XMTA 4CO2A 4JOUA 2E5LF 1JWWA 4H4KC 1ZYQA 1DTTB 4WP8A 3MF5A 2CVEA 1BXNA 3PKYA 2HFVA 1R0AB 1GMWD 2C3YA 3T6BA 1Y4ZB 4JUZA 3D6FB 4KIAA 2C3MA 1LWEB 2CPHA 4OI2A 2FLOA 4J7CA 3JYTB 2QZ8A 2FQQB 2IIHA 3C19A 4NXNJ 3WC2A 2Z0GA 2YKMB 4B3RF 2FD2A 4NA2A 1WOSA 4RUHA 1PC5A 2DNNA 2C3UA 4CLKA 5GAGU 5MLCV 1RI7A 4KHRA 1U1MA 1KLMB 1DAXA 2J0QD 5BJRA 2HFOA 1K0VA 1ZTWA 2XGQA 2QLWA 2F7VA 2ROEA 4KKOB 3EX7B 3FBEA 3W9JA 3KK3A 1Y3KA 3JSMA 2RQMA 5DQIA 1RBOB 2UVVA 2V2VA 1NB2A 1NAQA 3KK1B 2IM3A 1PO6A 4GKKJ 4WWSA 4NE9C 2MSSA 1ICEB 3P8BB 2BE2A 2X1GA 1VQ7S 2W2PP 1OY9A 3J7Z5 2I5JB 4U8VA 3ZC4A 2HNYA 1KDNA 3TW0A 2AJ2A 4NLPA 2QTWA 1QSSA 3TRGA 3PKMA 3DN9A 4X4QA 3C2PA 5E3CA 1X4BA 5GMKa 4NXNF 3AJ1A 1WG4A 1TU0B 3NLCA 3G86A 3LOUA 1WDDA 1WEYA 4DU7A 2MHNA 3K7RA 1VCTA 4GKJJ 3QO9A 2WSFC 5KFDA 1U1QA 1FI4A 2GJIA 1V3ZA 1VOMA 2HURA 3C16B 4LFCJ 4N47A 3BBCA 1UFWA 1LXJA 4OYXA 2BJ7A 3QLHB 2OEMA 3MCNA 4F0MA 1GXUA 2GHVC 1Q8IA 1TUGB 4BHQA 3FMWA 2HQIA 3RW6A 2XSFA 4OZ0A 2F63A 2VDIA 2OLWA 3ENWA 5AJ3J 3R6GB 1LEOA 5IV3A 4GKKF 4MK8A 1R3NA 2WVDA 1T9XA 2OPSA 3MPVA 4HL9A 4JI0J 4CLTA 3AT1B 4BCAA 3OTCA 4OV6A 4OMFG 4I56A 4NXMJ 3CJ2A 3L7OA 5KFNA 3D0GE 4HHHA 3RR8A 4KGMA 2RKIA 4O3NA 2CPZA 3ET6A 4EFAC 2UP1A 1JJ2R 1WDTA 3UCGA 3DLLQ 1G2EA 2BW2A 4GKJF 1RHKB 1H7WA 2ROGA 2OJ3A 2MQMA 1KQKA 3DLEB 2AP6A 4BBYA 2KB2A 1GH8A 3CC7S 4LFCF 3M9OB 2AJ4A 1D1UA 2JDJA 1HFEL 3R1HA 1XK8A 2G0JA 4TU7A 1OYEA 4NCGB 4MT1A 3HHKA 1YITS 5I3QA 3KJVA 2P6SA 5AJ3F 4FS2A 2I1RA 2R7VA 3G4SS 2ZOMA 3IRXB 2E7VA 2E1RA 3BGOP 4NI2B 2K7KA 5HP1B 4M5IA 2ZH5A 4JI0F 1X5SA 3TZZA 3G6YA 3BB5A 1T0TV 4IUFA 3ELHA 3R8YA 4NXMF 2D74B 2ATCB 1RTHB 2EEYA 4G1IA 4Y2AA 1PYSB 1HQUB 3I5BA 2DR6A 2JEFA 4JI1J 4G1QB 2GVZB 2NZCA 2W9CA 3KJQB 3EPIA 2QSFA 3DDKA 1U8WA 1X4EA 2J8SA 1W26A 1RCOB 2Z4PA 2EFNA 1OSDA 4UW2A 2CYYA 1UVLA 1HQEA 2CQGA 1YZ6A 2D3OR 2FJBB 4ANEA 5DLGA 2OSQA 1X9WA 2XMUA 4Y2CA 3SQGB 2RRAA 3WQPA 1A7GE 2MQOA 1HWJA 2EK6A 3C6TB 2FVSA 2ZFHA 4CRJA 2XYGB 3DMJB 4DG1B 1J5OA 2QA2A 4FZVA 4OI1A 3HFZB 5A0YA 2VJVA 2Z56B 2KVQE 2UXDJ 4ZPWR 1LWFA 2IVYA 2PI5A 4A46A 2MKSA 4X4NA 3OXFA 2B6AB 3DI6B 4RW9B 4TN2A 4PWDB 1S1TB 2OH2A 2OKQA 4PR6A 4USIA 3RB3A 1RAGB 1SCJB 1RT3A 4JI1F 1NHUA 1IR0A 3CJRA 3KLGB 2R8HA 2FHOB 3MPWA 2CQDA 4B3TJ 1NO8A 3CC4S 3OUYB 2KG0A 4ZCLA 2V0NA 3NS6A 3GZ7A 4K4TA 3NGDA 1WEZA 4ED6A 1CC7A 3HSDA 4FXWA 2ZH2A 1N0UA 4DPXA 1CBKA 5KG3A 4LT6A 2J76E 2BQUA 3TUZC 1EZZB 2GC8A 1L5UA 2ZZNA 1YBTA 2XC9A 4MK9A 3M1VB 2B5JA 2DK2A 2QLXA 5CXTA 2IVFB 1HA1A 2A10A 2ZHOA 3J7ZT 5J2NB 1NSAA 4IRDA 3W8GA 3DGVA 5D6GA 1BGXT 2IMOA 1GQEA 1S1XA 3TVZA 5E3PA 3E51A 1WORA 2HAIA 2KXHA 3BQ2A 1NPPA 1GX5A 3MEDB 3T5KA 3ZTOA 2ZDPA 5D0RA 4LF1A 5A8WA 4ZPDA 1XMQJ 4U8YA 3KLIA 1DQAA 1YRTA 4I2QA 1N34J 2VA3A 1YJUA 4B3TF 3GJQB 3B8HA 3DM2B 2JEIA 1OJ4A 3T1YJ 2AYMA 2LQ9A 3AQPA 2AJ0A 1XWLA 2RDIA 1DQ8A 4J9MA 3X1LB 3KMQA 3M2RB 1RTJB 1N0VC 3UDEA 4YB7A 1TTHB 4LUBA 3AA8A 4PCQA 2FVPA 2HPUA 2W8LA 1S59A 2BQ3A 1EETA 3W65A 1U25A 4EO6A 2H5EA 4RU2A 3GP9A 4F3MA 3NGTA 3D67A 2C2EA 4RPFA 1XC9A 3AA9A 2DGVA 3IGVA 2C28A 2D41A 2H5JB 1XR6A 3T9NA 2LQBA 4ZLPA 4UQGA 2JFDA 3W2VB 1L3UA 1QSYA 5HN0A 4I2PA 3Q0AA 2ERRA 2RMLA 4RW4A 5E0OA 4ETXA 1SBRA 4X66J 5H9FJ 2L3MA 3J7YI 5CYMB 4J9OA 3KHGA 3NG8A 1KVJA 3C66A 3PZPA 3QT5A 4OV1A 2AGQA 1NXIA 3BH6B 2FJXA 3D4JA 3AD9C 3ENQA 2KT3A 1XTZA 3FNNA 4NL5A 9ATCB 1FNXH 1CEZA 3VGSA 2LU2A 5I3UA 2RS8A 2NXNA 4USUA 2ZJPQ 4MJKA 3R5BA 5L1KA 1R6VA 1FJ7A 2PEHA 2V69A 3MPYA 2LQJA 2QMWA 3K0JA 4LF4J 3D0IE 1NKEA 3HXMA 3TX0A 1U1RA 3PNIA 4OYIA 3GIKA 1P8GA 5K20B 3CVKA 5E3AA 5C2CA 1B64A 3IR6B 4IDKA 4CO3A 3R3TA 4J9NA 1X4FA 2XQCA 5DDOC 5HATA 4CI0B 2RDDA 1V5IB 3TQEA 1PBUA 1AZSA 4X66F 1SQEA 4FYYB 5LXYA 1RAIB 3LUYA 3VTIA 1CPZA 3C46A 2NUUG 5HO4A 4P7TA 3QO9B 2GA7A 1FDAA 4DU8A 4ANDA 2QL9B 4AQYJ 1P1TA 4ILMA 2AYEA 2QO3A 1DURA 4MIWA 2KVIA 1U1PA 3MR6A 3MUTP 1YK9A 4ZVTB 4FBTA 2PFDA 4UOGA 3O5TB 3D0HE 4QR1A 4RKUC 3A13A 4DFJA 3M05A 3TA0A 4TLRA 4GRSA 4LF4F 4PPZA 2YKNA 3ZZZA 1UZHA 5GAEU 4XPCA 2XYHB 1NKBA 3M2UA 3SV3A 1TL1A 1KN6A 3V4IB 5LMNJ 1QTNB 4F04B 4GO5X 2RKIB 1YJNS 5AT1B 1VFJA 2W2QP 2CUYA 5B0GA 3Q86A 3BO3A 2FHJA 4CLLA 3N01A 5AXKA 2DGWA 1KFDA 2DXFA 4WZQA 4AQYF 4IYQA 4X4VA 3DFEA 5E5NA 4WK1A 3KLFA 4LR9A 2CRLA 2R9LA 2MZTA 3RB4A 2GGPB 4DSEA 4GVBB 5DLFA 4HKQA 4YQWA 3QRRA 3KJVB 1CS4A 2XSJB 4P2SA 1FTRA 4ZVUB 2WOMA 3GB0A 5J2MB 1UVJA 2FC8A 4C0HA 3HVRA 2GMHA 3IAM9 3ISZA 1N5VA 2B7CB 2HRYA 4K2XA 1JJ4A 3O6QA 1HWUA 2P5VA 2DGSA 2RRBA 1RWUA 5FJ4A 1R8HA 5LMNF 2HRTA 3CCSS 4PEOA 4DQRA 1UVIA 1Q53A 4TU9A 2XTJP 2VQEJ 2XYPB 3UW1A 4A8YA 3RBDA 3BEGB 2I0XA 2W9CB 1LV5A 3K8WA 4QBUA 2HHHJ 4ZCKA 1X31C 2HMIA 1OWXA 2C2ZB 2HFZA 3UO0A 1B3TA 4NLWA 3WX8A 4DSJA 3WZ0A 1YRUA 2YKOA 4IO1A 4P2XA 3GIIA 4M5LA 5GAGI 2DGTA 5G4DA 3QJJA 3DOMA 4KYZA 2NXJA 4F7VA 4O3OA 3I0RA 3CDAA 5A0YB 2ZITA 2W7AA 4J37A 2RNEA 3HF5A 1P9YA 1L3SA 1TL3A 2WONA 3NNHA 1TK0A 3CTRA 4F50A 3NWRA 3EGNA 2KG1A 3PV8A 3THTA 3M8PA 3AJDA 1RT3B 5FLXY 2VQEF 2HVHA 1L3TA 4J9PA 3MEEA 4QJVA 1RLCL 4ZP9A 2A3JA 5FLXU 1SJ1A 2HHHF 2CQ3A 1F5BA 3AXKA 4K7QA 1C1CB 2Q1LA 1H73A 2HIQA 1Y9OA 4Q5VA 1NPRA 4C8MA 1LW2B 1MWZA 1S6QB 2J0WA 4HHUA 1K73T 1YZ7A 4EUVA 3HCXA 5LMUJ 1TK8A 3PDNA 1Z4UA 4YN3B 3GSDA 4WTYA 1J2VA 3FSXA 4EU0A 1J27A 4NLGA 5J1EB 3CD6S 2Q6BA 2HKEA 2QLJB 4NZ7A 3V6DA 4OX7A 2ZC3A 3CCTA 4ID8A 4OI6A 4YFUA 3GYNA 2ZH4A 1Q7YT 3MR3A 5GMDA 1F9EB 4OZJA 2YNGA 4H4KA 1WJ9A 4PRFA 5A8WB 3GE9A 3PVXA 3KLIB 3UD5A 4KGVB 2N4DA 2NREA 2R2UA 3CMAS 1FVQA 4RUCA 4RWWA 2Z2LA 1IKWA 3ZO7A 2VPXB 3UR3C 3MR5A 3JSBA 4PQUA 2AWZA 2F9DA 2OAUA 1Q1KA 2VC1A 2PA8D 3HT0A 4RR5A 2XB2D 2M8HA 5LMUF 2GV1A 2IA6A 4X62J 2EFVA 4ZJLA 4DX7A 5HROB 4WFNQ 4KBIA 1TZ0A 2VPYB 5I4MA 3VR1A 3MAAA 2V8GA 3B4DA 3RAQA 3MR2A 4PG6A 5A8RA 2WW4A 2AZ1A 4LF5F 4ED7A 2K1RA 1EETB 3I32A 2ZOGA 4OZ2A 2HHVA 3DYAA 4M5JA 5J1NA 2DT9A 2KT2A 1PJ7A 5F8JA 3T1AA 1Y3JA 3TZYA 3IG1A 1SKRA 4DOZA 1X8DA 1S6OA 4Q7AA 4JYAJ 4W98A
chains in the Genus database with same CATH topology
3BKFA 2WVDA 2PC6A 1Q5VA 2BJ8A 3BKTA 2WVBA 2NZCA 2FGCA 2HZVA 3QSIA 2WVFA 3BKUA 3PHTA 2BJ7A 1Q5YA 2HZAA 2BJ3A 2WVCA 2F1FA 2CA9A 2WVEA 2Y3YA 3LGHA 2CADA 2BJ9A 2BJ1A 3OD2A 2CAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BKF A;  2WVD A;  2PC6 A;  1Q5V A;  2BJ8 A;  3BKT A;  2WVB A;  2NZC A;  2FGC A;  2HZV A;  3QSI A;  2WVF A;  3BKU A;  3PHT A;  2BJ7 A;  1Q5Y A;  2HZA A;  2BJ3 A;  2WVC A;  2F1F A;  2CA9 A;  2WVE A;  2Y3Y A;  3LGH A;  2CAD A;  2BJ9 A;  2BJ1 A;  3OD2 A;  2CAJ A; 
#chains in the Genus database with same CATH topology
 4I4B A;  1KC8 T;  1VQS A;  3HVA A;  4I2P B;  1T95 A;  4I6Y A;  2C2N A;  1RU2 A;  4AUK A;  3LO3 A;  5B0E A;  3ILO A;  4DZD A;  1UWB B;  1YX2 A;  3KJN B;  3M30 A;  2R7T A;  1IWG A;  2KM8 B;  3DDN A;  5KFX A;  4ED4 A;  4NZ0 A;  2FHK A;  2Z2Y B;  4X4R A;  2CPI A;  2V50 A;  4DBQ A;  4JI4 J;  4PG5 A;  3AJ2 A;  1SJF A;  3RUB L;  4DPO A;  4X62 F;  2UU9 J;  1LK7 A;  3GG1 A;  4DV2 J;  3H2V E;  3BN4 A;  2IHR 1;  4QW8 A;  3BSN A;  1RAA B;  5EX3 A;  3QFH A;  1O51 A;  3ILL A;  2AYG A;  3J81 Y;  3TJ8 A;  1N8R T;  1FRL A;  4XDD A;  4UQT A;  5F3Z A;  1YVF A;  1K44 A;  4RBU A;  2GIF A;  3BF4 A;  2FJE B;  4P72 A;  3GIJ A;  2ZNY A;  4JB8 B;  2L08 A;  2V34 A;  3BSO A;  4ZVR B;  3GWC A;  1C1B A;  2KT5 A;  2MQL A;  2F40 A;  4P73 A;  4LFA J;  1AUD A;  3MDF A;  1UVN A;  3NS7 B;  4JYA F;  3ENA A;  3I5A A;  4K0K J;  4IDK B;  1VGY A;  5JJB A;  5AXM A;  1A0O B;  4WFZ A;  3VV2 B;  3LAN A;  3FZB A;  1BWE A;  1NJY A;  3N0V A;  3CJ4 A;  4UT4 A;  1K1S A;  3BQ1 A;  1VBY A;  2DNY A;  1AZS B;  2HG4 A;  3CCJ S;  4HYK A;  3DLH A;  3FFI A;  4MK7 A;  1K8A T;  4N7T A;  3RRK A;  3SV4 A;  5D3G A;  4L75 A;  3A8I A;  4JI4 F;  4MFB B;  5DO2 A;  2HZC A;  4ECV A;  5KOW A;  1OPZ A;  4I7F A;  2UU9 F;  4DV2 F;  4OZ1 A;  4DF8 A;  1NK6 A;  3VHQ A;  1VK3 A;  4ES2 A;  1KRP A;  2RJZ A;  4FF4 A;  2ACY A;  1I3O B;  2BV3 A;  2CQI A;  3VVU A;  2X3D A;  2W01 A;  3TUP A;  2JEJ A;  5CAB A;  3KDN A;  3D7S B;  4FDF A;  1FKA F;  1UJ6 A;  3DGP B;  1NND A;  2F8M A;  4HH0 A;  5C25 B;  1N5Q A;  1FNO A;  3ZZT A;  4LFA F;  3DNC A;  1DQ9 A;  2M0G B;  2V68 A;  5F41 A;  3HI9 A;  3OTB A;  4K0K F;  3N5B A;  1JJH A;  2EFG A;  1TL1 B;  5ETN A;  1NK4 A;  1E6Y A;  3H5S A;  2QFI A;  3BPD A;  1RCX B;  4IQM A;  4CM0 A;  4WZM A;  4FNH A;  2YQ3 A;  3NGU A;  4W92 B;  1CLF A;  2MHE A;  1ZH5 A;  3GFZ A;  4K50 A;  5F0U A;  1FVS A;  3LP2 B;  4K4V A;  2HS4 A;  1Z2L A;  3VGV A;  4DS5 A;  2XHW A;  2ZH3 A;  4X4O A;  5K8O A;  1JKH A;  1FRM A;  1GEH A;  3MM7 A;  2E9T A;  1QJH A;  1ROF A;  1M5O C;  2B9W A;  4OI3 A;  4J9L A;  1TKX A;  4DSL A;  3KLF B;  3DXS X;  1RAF B;  3RAM A;  3U27 A;  1RYS A;  2UVR A;  1UFL A;  3L09 A;  1JLF A;  4WE1 B;  2B7B B;  2ZZM A;  2GCF A;  3PRB A;  2X1F A;  1MW7 A;  3M8Q B;  1S48 A;  4UOF A;  4LR8 A;  1RTZ A;  1CS4 B;  2DO4 A;  2K3K A;  3K5L A;  3KG0 A;  3KLE B;  2KFN A;  2QA1 A;  3DOK A;  1S1V A;  1GTE A;  2N3O A;  3A3P B;  3MUM P;  4CO0 A;  4XAK A;  3OTD A;  3VCD A;  3PIO Q;  2GMJ A;  3M8W A;  2H54 B;  1VQM S;  1GMW A;  3SDE B;  2PN6 A;  2HHU A;  2HWT A;  2YWF A;  3IBF B;  3WIU A;  1FXL A;  1TV6 B;  1BUX A;  2DO0 A;  3SCJ E;  4YS2 A;  1RAD B;  1FA0 A;  4WFX A;  4AL6 A;  2KTQ A;  4G65 A;  2HMI B;  2C2R A;  3HD2 A;  4Z7Y A;  2IAJ A;  4ZOS A;  3PX6 A;  4F4Z A;  4DCP B;  2Y8W A;  4ED3 A;  4L72 B;  2HHS A;  2DHS A;  2VPW B;  3QRP A;  3B78 A;  1LK5 A;  1KOO A;  1VJQ A;  1CJU B;  5KFT A;  1FFS B;  2ZNZ A;  3M9M B;  2W7O A;  3ZTQ A;  2X1B A;  2G9O A;  3DOL A;  3DOM B;  5KFE A;  4HDH A;  2VA2 A;  3I0R B;  2ZKT A;  1F3V A;  2XUL A;  2M2B A;  3D28 A;  2NPI A;  4UOH A;  2DTJ A;  4FVM A;  4LRE A;  1EX8 A;  2MXY A;  2LA4 A;  3QT8 A;  1WHX A;  6FDR A;  1NK5 A;  4Z2X A;  4Y65 A;  3V81 A;  4IFY B;  5HLF A;  3M8P B;  1S77 D;  2DH8 A;  4KQZ A;  4QIF A;  1Y00 A;  3MEE B;  2XZW A;  2ALZ A;  3VGT A;  2GIQ A;  3KJF B;  3EDQ B;  2H65 B;  1W2I A;  1X4H A;  2AX0 A;  5E3R A;  2PDA A;  3C6U A;  3I4P A;  2XHC A;  3T6J A;  3KOA A;  2POK A;  4ZVO B;  4UUX A;  2RIL A;  1QE1 A;  4DN0 A;  2DD8 S;  3F0N A;  2WVB A;  4DV0 J;  2VH7 A;  2F4F A;  2BAB A;  3M32 B;  4UY8 5;  2PFF B;  3P49 B;  5F8N A;  2ZJQ Q;  2HK2 A;  1LQ9 A;  3OW2 R;  2J8A A;  3L3C A;  1A6L A;  1NHK L;  3PYE A;  2WAQ D;  2CVI A;  2NUH A;  4FKY A;  2R4F A;  2WW8 A;  3V6D B;  3M2V A;  2Y8Y A;  3PHT A;  4J9V A;  1Q81 T;  1RA6 A;  3MM5 A;  2DNH A;  1YQH A;  1QTM A;  1FKO A;  1BQN A;  2FVC A;  1UVK A;  2YNG B;  1NU4 A;  2G2Y A;  3Q8Q B;  2FY1 A;  4RW6 A;  4QWD A;  5KG6 A;  1VLO A;  3THV A;  4NML A;  4ER8 A;  1WSR A;  2BJD A;  4CT8 A;  1HMV B;  3MCM A;  5GAE I;  1RXO B;  3OLB A;  3A8K A;  2COL A;  2JC1 A;  1WHW A;  2EW9 A;  3FBC A;  4KGX B;  1DY3 A;  4KH0 B;  3U1M A;  4DV0 F;  1HL6 A;  4JV5 J;  3DHW C;  2WRM A;  1JMT A;  1Q0N A;  1HW9 A;  2XM3 A;  3MMA A;  4FYD A;  3BBF A;  1JLA A;  4QU6 A;  4WKY A;  4X84 A;  4TQR A;  3MAA B;  4FBU A;  2J5A A;  1RT1 A;  3TOQ A;  2MY8 A;  5A8R B;  5C5J A;  1TAQ A;  3DLK A;  2K1R B;  3G9C A;  2MZJ A;  3K17 A;  2DBB A;  4WTO B;  4IR1 A;  3UNY A;  4DEZ A;  2X51 A;  2CWX A;  1WG1 A;  1HYS A;  3CNQ P;  2KYX A;  3FRY A;  4CH0 S;  3IG1 B;  5CZX A;  2F65 A;  5BYR A;  5IZH A;  1HNV A;  3QID A;  5HJX A;  2VON A;  1JJC B;  4L73 A;  1LW0 A;  2DY9 A;  3BO4 A;  4LSL A;  2FGC A;  4LMZ A;  3QJL A;  2AT1 B;  1FFG B;  3CJ5 A;  4GVL A;  3M30 B;  3CT9 A;  3DRS A;  4PUO A;  1FTC A;  3R6L B;  3U1L A;  1IR1 A;  4JV5 F;  2CNO B;  3CJ0 A;  2QIF A;  5ETO A;  4EO8 A;  3PJX A;  4KJI A;  4CYU A;  3I9V 9;  1MU2 B;  1ZA2 B;  5D4L A;  4BC9 A;  1TKT A;  3GYX B;  2VUG A;  1Q4R A;  2B4O A;  4QR0 A;  4MTP A;  3TVY A;  4DFK A;  2XO7 A;  4R5P B;  2G4B A;  1HNZ J;  1QAX A;  3A1Y G;  3KUG A;  1S0N A;  1C1B B;  1NSP A;  1UZD A;  2HND A;  5SUH A;  2LEA A;  2CAJ A;  3K8V A;  2E7X A;  1FK9 A;  3NP5 A;  2JNJ A;  1FES A;  4WPA A;  1XR7 A;  1WEL A;  5HQL A;  1MWY A;  4X64 J;  5IQ6 A;  2W7P A;  1SH0 A;  1S1U B;  1TQL A;  3R5G A;  3FFI B;  1FXD A;  3S8S A;  4AL7 A;  3PRV A;  4QIG A;  1K9M T;  3OL6 A;  1AT1 B;  2F1F A;  3W9H A;  4V19 J;  1HIY A;  5D3G B;  1XIQ A;  4USH A;  1RT5 B;  1IKX A;  4F02 A;  3IM8 A;  5D0G A;  1VQ9 S;  1F9H A;  1VBK A;  3FGV A;  3MHY A;  4CO1 A;  2V9K A;  3TA1 A;  3V6K A;  4IOA Q;  3QMQ A;  2ADC A;  9RUB A;  3W5Z A;  3G2X A;  1TKD A;  2OPQ B;  4A8X A;  1HNZ F;  2CQ0 A;  2ZHB A;  4C8L A;  4AL5 A;  3EZO A;  3ZZ0 A;  2GML A;  4LF9 J;  1RDR A;  1WHY A;  1OO0 B;  4WF9 Q;  1XQI A;  1TKZ A;  2O66 A;  1K0T A;  5IM0 A;  1XER A;  1RBL A;  1HAR A;  2MY7 A;  1SV5 A;  4NLT A;  3NS5 A;  2A6O A;  2WVF A;  1E6Y B;  1H74 A;  4X64 F;  5KFW A;  3HSZ A;  4O0N A;  3UD3 P;  2NXE A;  5RUB A;  4FYX B;  2G1D A;  1NJW A;  5KFA A;  1X4A A;  4NMX A;  4UY8 T;  2KI2 A;  5AE2 A;  3D2W A;  2VIC A;  3QAT A;  5KFC A;  2VBZ A;  4TVA B;  1JKH B;  2MLY A;  2NS1 B;  4F4X A;  2YWK A;  3TA2 A;  3MFH A;  3MM7 B;  5DZ6 A;  4KT0 C;  1YG0 A;  1TK5 A;  1XMO F;  2DRB A;  1VQY A;  2RF2 A;  1TKX B;  3K5O A;  4DSI A;  4NLY A;  3FCW A;  2H48 B;  2YPZ A;  2B3T B;  2XEX A;  1YKW A;  3HZG A;  4QPX A;  2UXB J;  4FYW B;  5A8K A;  2JOQ A;  5KOX A;  4ECU A;  1XEZ A;  1C0T A;  2E5J A;  3VAG A;  3HM9 A;  4F8R A;  2FVR A;  4M5N A;  2BW7 A;  2V63 A;  4LF9 F;  3GJT B;  1S1V B;  2QV6 A;  4R25 A;  1N5S A;  2EG2 A;  4C2M A;  1ZTT A;  1SXL A;  4RBT A;  3PW2 A;  1FDB A;  2R2S A;  2YNI A;  3W5X A;  5CD4 A;  2HHP A;  5GAH U;  4O3Q A;  1UEK A;  5H1S V;  2H3E B;  3HVW A;  4K4Y A;  2ADB A;  5G0R B;  1DTT A;  2FZK B;  3KDO A;  1KQF B;  3AD7 C;  5L9N A;  1OPI A;  3OSN A;  1R0A A;  1LWC A;  4DL3 A;  1NDP A;  4F4W A;  3JB9 k;  1R0C B;  3H20 A;  2J9D E;  4EBC A;  2HYI B;  2YKM A;  1XNR J;  2JZ5 A;  4YDD B;  5CZV A;  2WBR A;  2UXB F;  5ETP A;  5KFJ A;  2VBX A;  1PJ5 A;  1KLM A;  1KHV A;  1TFW A;  4LF6 J;  1NKC A;  3SIP B;  4BS2 A;  4WCE Q;  1VYA A;  4O3P A;  2OIH A;  4F4K A;  1VR6 A;  7FDR A;  2ZH7 A;  4DHV A;  1U4B A;  1S5Z A;  3R9L A;  4KKO A;  1VRT B;  1F1B B;  3RGI A;  3Q2T C;  3IXQ A;  4ZVE A;  2FZG B;  3GU0 A;  4DS4 A;  2G0C A;  4X65 J;  3V81 B;  5HLF B;  5DQG A;  4OJ1 A;  2MKC A;  2M7S A;  3PW7 A;  3MOJ B;  2I2Y A;  4RW8 A;  2RQ4 A;  4CLF A;  4R0E A;  2I5J A;  1G7C B;  1H7X A;  2K8G A;  4NEY A;  4YUD A;  2HNZ B;  3OR2 B;  2HLU A;  3H4D A;  2VAS A;  4DL0 C;  3CD0 A;  3HT3 A;  1UKU A;  2ZVS A;  5L46 A;  2ZBP A;  2R8K A;  3C6U B;  1FWK A;  2OEJ A;  1HNW J;  3G71 S;  1VQK S;  1M5S A;  1QE1 B;  2KM8 C;  3EUN A;  1F5A A;  2AU0 A;  1XNR F;  2XBP A;  4TKT A;  2CDR B;  2CPY A;  2IA0 A;  3HK2 A;  1HI8 A;  1M1H A;  3DRX A;  5CAA A;  3C16 A;  4LF6 F;  1VS3 A;  4ED2 A;  5KT3 A;  1S4F A;  4S0M A;  2MZQ A;  3NOG A;  4WXO A;  4ZMM A;  3KNA A;  3RBX A;  2JLE A;  2DR5 A;  4DLG A;  3M2V B;  1TP7 A;  3GJS B;  2XS2 A;  1RAO A;  4ZPA A;  5KG4 A;  5ETM A;  3PRD A;  4D3G A;  1F60 B;  3HLU A;  3GV8 B;  3I87 A;  4QCL A;  3ILI A;  1VC6 A;  3CCZ A;  2LA6 A;  4RW6 B;  3L7P A;  4F36 A;  2EC0 A;  2NQP A;  3I0S B;  1T94 A;  4UTG A;  1V5V A;  3M6U A;  3EVM A;  4Q2M A;  3D68 A;  2AIR B;  2OML A;  3K89 A;  1DJ0 A;  2UV8 A;  4WFB Q;  2DIV A;  4NA1 A;  3FVY A;  1VQ5 S;  3FK4 A;  1S79 A;  2QG9 B;  1HNW F;  2BMB A;  1WC5 A;  4C3M A;  3PR4 A;  2HAF A;  3OHA A;  2PC6 A;  2FVQ A;  3NBP A;  2YPY A;  4ITS A;  4PXC A;  5D0H A;  4NLX A;  1VQN S;  1R89 A;  4DZ6 A;  2DNZ A;  2JFK A;  1VQO S;  2V2Q A;  3EZ5 A;  4ED0 A;  1BQM A;  5HK4 A;  2C3P A;  1MN9 A;  2I6W A;  4NCG A;  4DSF A;  4A8Q A;  3UQS A;  3RB6 A;  1KON A;  3NWG A;  2N7C A;  2DKO B;  1S4E A;  1FJG J;  4AE5 A;  4KPY A;  2DHH A;  3N6N A;  2HLT A;  4LFB J;  1SH3 A;  3R7N B;  4RW7 B;  4D3H A;  2DNO A;  3H59 A;  2VHG A;  4LIW A;  4OYA A;  1LW0 B;  2J9C A;  2R2R A;  2ZE2 A;  2KN4 A;  1KTQ A;  1RTH A;  1HBM A;  1VK8 A;  3M8R A;  1RJJ A;  3NCQ A;  3DRS B;  4PUO B;  4RNO A;  1U24 A;  2X7I A;  1EQM A;  2BKO A;  4DCO B;  4CYU B;  4AD6 A;  1PKU A;  1EAR A;  3LF0 A;  4USM A;  4P74 A;  2SXL A;  4K2J A;  2V94 A;  4Y2K A;  3VQT A;  1UMJ A;  1TMM A;  4C0O C;  1RU1 A;  3SQG A;  3TNV A;  1NZA A;  4CTA B;  1HBU A;  2BDP A;  3V4M A;  1FJG F;  3PR5 B;  2V4R A;  1VQP S;  1SQF A;  1YJR A;  4QU7 A;  2MKJ A;  5KFY A;  4LFB F;  3ZZR A;  2A6M A;  3T5L A;  4YR3 A;  3C3L A;  2VG7 B;  2J7U A;  4RW9 A;  2E66 A;  4OYW A;  2M52 A;  2XMK A;  3HVT B;  4PWD A;  2BE7 D;  5ETR A;  4DV5 J;  1N32 J;  1S1T A;  2NXC A;  1JK9 B;  1WNE A;  4HHJ A;  3CD5 A;  1IWA A;  3RW7 A;  2AV5 A;  2X3G A;  1PG5 B;  2WB4 A;  5IT4 A;  3SSQ A;  5J2Q A;  2M4M A;  4KB7 A;  1U2C A;  2Y1R I;  3MFI A;  1IKX B;  2LXU A;  3MM8 A;  3OUY A;  1H6K X;  4XIU A;  2HQG A;  2QT7 A;  3CSK A;  2BUN A;  4CH1 A;  1FEH A;  3H98 A;  1KVK A;  3MWB A;  4N8O A;  1P1L A;  5CQG A;  1V3S A;  1RHQ B;  4I68 A;  2YBV A;  3P96 A;  2UV8 G;  3KK2 B;  3Q8S B;  3KHR A;  4H4M A;  3M1V A;  3NMA A;  2CNN B;  2UUB J;  1CC8 A;  1GFW B;  3WX4 A;  4WYL A;  1R0B G;  3UNG C;  2HGL A;  5C42 B;  1ZM3 A;  3O3L A;  2B43 A;  2XMJ A;  5J2N A;  1TKZ B;  2PE8 A;  1LXN A;  2C42 A;  4CLU A;  2ZOF A;  2YWE A;  5KFH A;  5ADZ A;  4MMO A;  4IOB A;  4DV5 F;  3MCO A;  3QNW B;  2HS0 A;  2XY5 A;  4EYI B;  4X2B A;  3HSJ A;  1IBK J;  3UI3 A;  3P4U B;  1X0P A;  1U2F A;  1FDN A;  3UR0 A;  1IUJ A;  4ED8 A;  4ZJQ A;  4OJG A;  3KNG A;  4HI2 A;  4TU8 A;  2YWH A;  3AB2 B;  4HAC A;  2FB0 A;  3SI8 A;  2XLI A;  4WFY A;  4LF8 J;  3WDO A;  4LBP A;  2IY5 B;  2CFX A;  4PKD B;  3JAM Y;  4J9U E;  4KPC A;  4ZVG A;  3D1O A;  4TLQ A;  2RDJ A;  1NUE A;  3JAM U;  1RTJ A;  3QIP B;  5F8I A;  4KRW A;  1Y11 A;  2DPJ A;  1Z1Z A;  2L9D A;  2HK3 A;  2UUB F;  2JRS A;  2WCX A;  4HDG A;  3LPY A;  3LAM A;  2ZVI A;  4OQJ A;  2U1A A;  4KV8 A;  4ES3 A;  2CDQ A;  4ZKA A;  2QFJ A;  3RRH A;  2V8V A;  4B9N A;  1S49 A;  4FXV A;  4C0B A;  2OPP A;  3CJK A;  4RUA A;  1TL5 A;  3GIL A;  4HT5 A;  2K06 A;  3I56 S;  2ZWO A;  4X4P A;  1IBK F;  2W9A A;  3C15 B;  4ZCM A;  1LWC B;  3G8S A;  4CNZ A;  2IDL A;  3B54 A;  4C3L A;  3W2V A;  3W5Y A;  2HVZ A;  1NH7 A;  1SH2 A;  2R7Q A;  2YNF A;  4QW9 A;  4ZVP B;  1CQN A;  4LF8 F;  1S76 D;  3HP6 A;  4WYW A;  4AXJ A;  4FPR A;  2DIU A;  2VG5 B;  3M6X A;  4AXI A;  3F73 A;  4EWT A;  5CYM A;  3TAP A;  3CPW R;  1TL4 A;  4H54 A;  1H72 C;  3QWP A;  3MM9 B;  1S10 A;  1JXL A;  1NME B;  1F3F A;  4O4R A;  2W25 A;  1B99 A;  4QWC A;  4RJV A;  3TWZ A;  2B8Q A;  2GQC A;  2V8H A;  3TVK A;  2G0I A;  5HL7 Q;  2MQN A;  5KFM A;  4ID5 A;  5CH7 B;  2NPF A;  3GCX P;  1BY9 A;  1IR2 A;  1UW9 A;  2MB0 B;  3OR1 A;  2QLF B;  2DXD A;  1U1N A;  1M5K C;  1KD1 T;  4NLS A;  2F3J A;  4IO9 Q;  2Q3P A;  3HHL B;  4RW8 B;  3AB4 B;  1SKW A;  3W60 A;  5KFQ A;  2AJQ A;  2AJF E;  2UUT A;  4DR7 J;  2YH1 A;  4FN5 A;  1Q8B A;  1RTI B;  5EWF A;  2DGU A;  1VBX A;  4TYB A;  1Y5I B;  1JLE B;  1S0V A;  4TY8 B;  1S9E A;  2DVI A;  1RAJ A;  3T3F A;  2DR8 A;  1T3N A;  4DQQ A;  3ZXW A;  2OGU A;  4B9S A;  1N54 B;  4QQB A;  1VMB A;  1SL1 A;  3Q89 A;  2HFU A;  2HRU A;  4OJ3 A;  1U6B A;  4BLG A;  3CIM A;  3MUR P;  2P2C B;  3FKB A;  1ZA1 B;  4URG A;  2CZV C;  5BR8 J;  3M7V A;  4ATN A;  1RAE B;  5EWG A;  2V4J A;  2OP5 A;  3GV7 B;  1NM2 A;  4C8O A;  1FNM A;  3R7B B;  3QT6 A;  2KFY A;  2ZZT A;  3LGN A;  4NA3 A;  1UA0 A;  2RE1 A;  4DR3 J;  2CQH A;  1RT2 B;  1HHT P;  4ECR A;  4USK A;  3V4I A;  4DR7 F;  3FQK A;  2ZUA A;  3V5R A;  4MKA A;  5AXL A;  2E1P A;  4K4S A;  1PGZ A;  1T05 A;  5E7O B;  3NAH A;  4Q2L A;  4YME A;  3V6H A;  4F25 A;  2OMO A;  1YJ7 A;  1YWX A;  3IMQ J;  2RU3 A;  3BM7 A;  2XZD B;  3CCM S;  1FXR A;  3NBP B;  2CQC A;  4CO4 A;  1WC4 A;  3IN5 A;  1SUQ A;  1D8Z A;  4B17 A;  3SSR A;  1TUW A;  4CLS A;  2GGP A;  1BQM B;  2XY7 A;  3CO0 P;  5BR8 F;  1ZZF A;  2O5D A;  3LQV A;  4GVB A;  1HQ2 A;  1S1W A;  5IV4 A;  2XSJ A;  4K4W A;  1X4C A;  3BYP A;  1NK9 A;  2LEC A;  5KT5 A;  3OT9 A;  4O44 A;  5D4P A;  2BM1 A;  5J2M A;  1RIS A;  4M63 A;  1HBO A;  4AFF A;  2L48 A;  2R8G A;  3D5M A;  3RAX A;  4PYA A;  4DR3 F;  1WI6 A;  5DS7 A;  5ETQ A;  4CNY A;  4LRA A;  1CJT A;  5GAH I;  2ZE2 B;  1T9W A;  3BYR A;  3CUL A;  1UVM A;  1HBM B;  3MMJ A;  2HGM A;  2YNH A;  4KGK A;  4KY3 A;  2DGX A;  1U6Z A;  3LP1 A;  4L76 A;  2NYI A;  3QPI A;  4C6A A;  1V3R A;  1E6V A;  4ETZ A;  1UAW A;  2MJN A;  2UZA A;  3W7B A;  1MML A;  1MRO A;  2LQ5 A;  5EHH A;  3CCV S;  3NMR A;  1VRU A;  2DIS A;  3HZE A;  3TZW A;  3UCZ P;  2CKW A;  1CJK A;  1QY7 A;  1UJ4 A;  2ZHA A;  4LRC A;  2XMV A;  4QYR A;  2AKW B;  5K14 A;  3PFE A;  4USW A;  1REV A;  2WSE C;  3EIC A;  4JV1 A;  2AEJ A;  3GG0 A;  1AUS L;  2VZ9 A;  3FZ2 A;  1RAH B;  4B9V A;  1QUP A;  4ECY A;  1HBU B;  2PSZ A;  1RZM A;  2E1M C;  4MYT A;  1D09 B;  2ZH9 A;  3EGV A;  2HEK A;  1R8C A;  4YP3 A;  4FS1 A;  2DEJ A;  1YBA A;  3LP0 B;  3RTV A;  1FX4 A;  1HNX J;  3TX8 A;  1SIW B;  4B08 A;  4LRF A;  4OYZ A;  1T9V A;  2BJE A;  1KNZ A;  4O0I A;  4QOT A;  2GAG C;  5J2Q B;  3CJT A;  5IT9 Y;  2N3L A;  3FCV A;  3MM8 B;  4WIQ A;  2VC0 A;  3BSC A;  3HKZ D;  1C1C A;  1B7F A;  5L1I A;  5IT9 U;  2W2M P;  3H5Y A;  2IBO A;  1LW2 A;  4PQA A;  1S6Q A;  4ZLN A;  4NOH A;  4Y6I A;  1KVI A;  2ZD1 A;  3DU6 A;  3GIM A;  1ZAV A;  1NK0 A;  1N5T A;  2V9W A;  4H4M B;  1NDC A;  4LRD A;  2IJN A;  1U48 A;  1Q8L A;  3TAM B;  1T7P A;  3H8Y A;  4IH7 A;  2VIH A;  5J1E A;  2RRN A;  4OLP A;  4ICL B;  3AXM A;  1RWW B;  4F3O A;  3OL7 A;  2VFS A;  2QX0 A;  5K8N A;  5IQQ A;  2GIR A;  5JMN A;  3NCP A;  5HBM A;  1HNX F;  5HAN A;  1PCA A;  4DJB A;  4DV1 J;  3Q24 A;  1WSV A;  4EYH B;  4M5H A;  2ZEJ A;  1FJC A;  1X5T A;  4E8U A;  3GJR B;  2Q6C A;  2V2K A;  5THW A;  1Y10 A;  1Y0H A;  4HAC B;  3JS9 A;  5F0W A;  4DL7 A;  3PX0 A;  2EK1 A;  4JI5 J;  3R5D A;  4L3N A;  1GAO A;  4RUB A;  5JVH Q;  4WBF A;  2LMI A;  3PCO B;  4K8R A;  1HLW A;  3SYZ A;  1S12 A;  1HBN A;  3G82 B;  3JQM A;  5HRO A;  2VFV A;  4G1P A;  5DGB A;  1C0U A;  4KV8 B;  1VHI A;  3H7H B;  2IVM A;  5F9N A;  3C14 B;  1RB0 A;  4CT9 A;  2JHE A;  2XS5 A;  2MKY A;  2FYX A;  3PY8 A;  3A12 A;  1SB6 A;  5DQH A;  2OPP B;  3CJK B;  3MD1 A;  2DHG A;  4DV1 F;  3E2E A;  1H2T Z;  2O01 C;  1JXV A;  4MIA A;  1WKJ A;  3EVW A;  2MLZ A;  2EG1 A;  1LOU A;  1RAC B;  4K5S A;  1NJX A;  3IP0 A;  2ZC4 A;  4KH1 B;  1YIJ S;  1SC1 B;  2YNF B;  4JI5 F;  1UWB A;  5GAD I;  3N4W A;  2QA4 G;  4MKY A;  2OTL S;  3PO5 A;  3TJA A;  3MEK A;  1S57 A;  2EFO A;  1ZBT A;  2BJ1 A;  4E0D A;  2UUA J;  3MAQ A;  3OTE A;  3EJM A;  1Q16 B;  1FD8 A;  2XLK A;  1T03 B;  1H2U X;  3I4H X;  2EVZ A;  2A18 A;  3NL0 A;  4M5M A;  3MMB A;  1NJI T;  1SKU B;  4ID5 B;  2MDA A;  2CG8 A;  2YX4 A;  4RZR A;  1U26 A;  4U6P A;  2CPE A;  2NR0 A;  2LEP A;  2Y0B B;  3EPG A;  3KXD A;  3OR1 B;  1X5P A;  2M3D A;  2XMW A;  4RO0 A;  5B09 A;  4DL6 A;  3VAI A;  3AHP A;  1OY6 A;  1LFW A;  3FQL A;  1ZPV A;  5B7W A;  1FKP B;  4YEA A;  4DQS A;  4FF3 A;  2DY1 A;  4CH7 A;  3HHL D;  1DRZ A;  4LSZ B;  1FE0 A;  2KYZ A;  2QMX A;  1NZ8 A;  4BDP A;  1S9E B;  4JI2 J;  3J81 j;  4Y34 A;  2PA3 A;  4RBV A;  2XO6 A;  4CLY A;  3PX4 A;  4A8O A;  2IRX A;  4JBC A;  3KHL A;  4MFB A;  1RWP B;  2UUA F;  4C8Y A;  2DH9 A;  5AE3 A;  1LNQ A;  2WB1 D;  1SJR A;  3CDE A;  4RNH A;  4IFV A;  2Z57 B;  1URN A;  3MEC A;  3Q8R B;  2V4Q A;  2ASD A;  2IBK A;  3DGP A;  4L3K A;  3BKF A;  2V4J B;  1OMS A;  5C25 A;  5K8M A;  1S7H A;  3KG1 A;  2CG4 A;  5HMZ A;  4CWB A;  3I55 S;  4O3S A;  2JEG A;  2KRR A;  3CF5 Q;  5EGY A;  2E9R X;  3LGM A;  4YOE A;  1RHR B;  3FEZ A;  2EKN A;  1UW4 A;  4IG3 A;  3LP2 A;  1JLG B;  3LGH A;  1MN7 A;  1T05 B;  4LJM A;  2XGP A;  4JI2 F;  5L39 A;  1NEE A;  1TAU A;  4HT7 A;  3KUE A;  4L74 A;  5EDW A;  3MTJ A;  2HFS A;  1IJF B;  1UL3 A;  3W62 A;  2XY6 A;  3SFU A;  5B0F A;  1SUQ B;  4OHX A;  5DG8 A;  3RJM B;  4NYZ A;  4RNN A;  4KE5 A;  4WE1 A;  2EC2 A;  2IFX A;  4NRU A;  3M8Q A;  1SJ3 P;  1YJ9 S;  1S1W B;  5JUM A;  2XWX A;  3Q8Y A;  4O44 B;  3KLE A;  3IR5 B;  3E01 B;  3P3D A;  4B3M J;  4ZIW A;  3LA0 A;  4OHV A;  3H42 A;  1HBO B;  2B4U A;  1JNZ B;  2WZ1 A;  1CJT B;  4PXE A;  2RQC A;  3HSG A;  2YX7 A;  2JLG A;  2AJ1 A;  2H4W B;  4LQ3 A;  1IBL J;  2YNH B;  3OBI A;  3VVT A;  2BRK A;  3LP1 B;  3SDE A;  4KO0 B;  1E6V B;  1TV6 A;  1QSL A;  4I6W A;  2WVC A;  1MRO B;  1UFK A;  4P7V A;  1VRU B;  3B82 A;  3CE8 A;  1XMB A;  3KKF A;  1CJK B;  2KZZ A;  4P10 A;  3EE3 A;  1U0S A;  4KHM A;  2HBZ B;  4EZ6 A;  2R7R A;  4ERD A;  2QC3 A;  2OD4 A;  4F0H A;  4W90 B;  4Q8F A;  5B0A A;  1X4D A;  5K14 B;  4Z37 A;  1REV B;  2ZBC A;  1CJU A;  2K2P A;  2UUW A;  3LAL A;  3I5C A;  1R31 A;  3K57 A;  3GPA A;  2MZS A;  1RT6 A;  1F5C A;  4B3M F;  3R5A A;  3UD4 P;  1P27 B;  1OYD A;  4DR2 J;  2ATL A;  5FII A;  3K5P A;  2LEB A;  4LQ9 A;  2BQR A;  2BJ3 A;  2GHW A;  1P6T A;  3TQ1 A;  1IBL F;  2B9X A;  3VZI A;  3MR7 A;  3OVB A;  2JVO A;  4IFY A;  4K59 A;  3W66 A;  1U8S A;  2M8D B;  3M6V A;  4URS A;  3TYT A;  3G87 A;  3CCW A;  4XO0 A;  1RLD A;  2GAH C;  1RWK B;  1W2B R;  1FRX A;  3NGS A;  2UUC F;  2LU1 A;  4FVC A;  5KG7 A;  1RQ0 A;  3QZ8 A;  4TYA A;  2ABY A;  1UA1 A;  3IS9 B;  5A2Q Y;  1MSW D;  3O8W A;  3BH7 B;  2LVW A;  3SSS A;  4LRB A;  2ZD1 B;  3M32 A;  3R2D J;  5A2Q U;  4O4G B;  4ZS6 A;  1RGV A;  1RBA A;  2FGO A;  2VFR A;  4A4J A;  4J9S A;  4DL2 A;  2OTJ S;  1HD1 A;  1ACM B;  4NLV A;  1N48 A;  2OSR A;  5KTQ A;  4KAI A;  1SIZ A;  1SL0 A;  2Y3Y A;  4LF5 J;  3OFG A;  3NNA A;  2R7O A;  3K2Y A;  4DR2 F;  1Y5N B;  3QBC A;  4FKX A;  5HQ8 A;  2YKA A;  5HBM B;  4ED1 A;  3MZI A;  1F9F A;  1JLQ B;  3E8O A;  7AT1 B;  2PT0 A;  4IR9 A;  2ASL A;  1KS2 A;  4TNO A;  5L8R C;  3MMC B;  2FY8 A;  1S6P A;  1VI7 A;  1WKL A;  3GR0 A;  3HHL C;  2XNR A;  5SZT A;  1D0E A;  1HMV A;  1KSP A;  3BPS P;  4DPT A;  3UE2 A;  1M1G A;  1APS A;  4ECX A;  4OZ5 A;  4OYP A;  3WBZ A;  3QFW A;  4ELU A;  3VAH A;  2ASJ A;  3A8E A;  3HKW A;  1YJW S;  4P52 A;  3MPD A;  4G3I A;  3FEX B;  4QZV B;  1Y5L B;  4K4U A;  2BVZ A;  1CJV B;  5KT4 A;  3FC9 A;  3GIR A;  3CIZ A;  5IOL A;  1HBN B;  2LCW A;  1PSD A;  4EZ9 A;  1U1L A;  2XCP A;  3KLH B;  4C3K A;  1C0U B;  1FRJ A;  3QSI A;  3W61 A;  3M4X A;  3TJ9 A;  3D66 A;  2I9S A;  4EEY A;  1S0M A;  4CP5 A;  4Y3C A;  4A47 A;  1ZOT A;  3BBB A;  3PJW A;  3O2I A;  3ICL A;  5I3P A;  5T41 A;  4BWM A;  3EMT A;  1EKS A;  3CDB A;  4RX6 A;  1UTA A;  2J6T A;  1HWL A;  2LYV A;  2IJR A;  3IRW P;  4OHW A;  1XR5 A;  2C2M B;  1TVR A;  2J0S D;  2RAQ A;  1U6F A;  4RU9 A;  3MM6 B;  4PWW A;  3R27 A;  5AE1 A;  1YLX A;  1SL2 A;  4TY9 A;  5HJY A;  3FUY A;  4ZHR B;  2G2O A;  3ITH B;  4DMZ A;  3FJ2 A;  2FJA B;  3K58 A;  2OPR B;  2DNL A;  2F8H A;  4Y0F A;  3MD3 A;  1MU2 A;  2FTR A;  2MQQ A;  4NLR A;  5E2Q A;  1L3V A;  3FCH A;  2P9C A;  3D3B J;  5CD4 H;  2EWH A;  2MTL A;  3OFF A;  5M2R A;  2O3D A;  2W9B B;  3MMB B;  2HGN A;  4R5P A;  1RHM B;  5FDL B;  3UN2 A;  1JX4 A;  2XCA A;  2B51 A;  2MKH A;  2A2D A;  1BQX A;  4ZDN A;  1QM9 A;  5T7L A;  5MAO A;  4ZVH A;  2D7S A;  2FLL A;  4PYD A;  4WII A;  4YB6 A;  3GCW P;  5HQM A;  3IBC B;  5C24 A;  5H9F K;  5LJ5 Y;  3D3C J;  1MMD A;  2RUS A;  4Q0B A;  1RT4 B;  2H51 B;  1TUV A;  4PG8 A;  2FJV A;  1S1U A;  2W2N P;  1CUL A;  4PPD A;  3BV8 A;  5GME A;  1AA1 B;  3H5U A;  2B8P A;  3VF0 B;  3UFC X;  5F8L A;  3M6W A;  1CG2 A;  1RT5 A;  2CZ9 A;  1NCL A;  2H9Z A;  4F67 A;  2YQ0 A;  2IM0 A;  1SC4 B;  1REG X;  3AOC A;  2YH0 A;  4IFV B;  3EYZ A;  1AYE A;  1EP4 A;  1HI0 P;  3MEC B;  1XN9 A;  3PJ9 A;  1I1G A;  3RRG A;  3W63 A;  2FHM A;  3D9B A;  1R8B A;  2OPQ A;  4KC5 A;  2N4C A;  3UDL A;  2CQP A;  1TEL A;  1I6J A;  2PO4 A;  4J9Q A;  1WD6 A;  1LFP A;  5DZ7 A;  1GMU A;  4JV2 A;  3DRR A;  2W1B A;  2APO A;  3SFG A;  2GZO A;  4P75 A;  3LAK A;  1HNI B;  5IWA J;  4F2S A;  3AD8 C;  3OLA A;  3RYL A;  1WAC A;  5B0B A;  4LVN P;  4OLO A;  4B02 A;  4CDI A;  2AYB A;  1NDK A;  3IBW A;  1PYO B;  2HVD A;  3H5X A;  4IG3 B;  4FF2 A;  2MKK A;  2IMW P;  1IQZ A;  1WTF A;  3HHE A;  3PEJ A;  2DNG A;  1FT8 A;  4ANC A;  3U1N A;  4JI8 J;  1WHV A;  4J9R A;  1UEU A;  1Q5V A;  3MAH A;  2AGO A;  1RWX B;  1XJW B;  1S0O A;  5I42 B;  5JXS A;  3NY0 A;  4ED5 A;  4ZJO A;  2EPI A;  2L9N A;  2RB7 A;  1FRH A;  1FF2 A;  2RU9 A;  4UZC A;  4NLO A;  3LW5 C;  1ZAW A;  1D9F A;  3DHX A;  1Q86 T;  1HHQ A;  4KR0 B;  2QL5 B;  1VDH A;  2M70 A;  2HIY A;  3F44 A;  4C7Q A;  5E3Q A;  2KKH A;  4NWB A;  2KH9 A;  2Y0S D;  2IRU A;  4QWB A;  1TR0 A;  1TMJ A;  1FE4 A;  5IC4 B;  3H90 A;  4E98 A;  4M5K A;  1ARO P;  3F56 A;  4YHH J;  5IWA F;  3CXC R;  3UDV A;  2ZH1 A;  1WKK A;  1YGY A;  4DX6 A;  4ECW A;  2M9K A;  3NKY A;  5T14 A;  4DWI A;  2OFH X;  3GTY X;  5G0R A;  3QAU A;  4A48 A;  2BXJ A;  1D9A A;  3G96 A;  4YR2 A;  1RHJ B;  3TR5 A;  2Q66 A;  3J7A N;  1SJQ A;  2Y1I A;  3AH6 A;  5EUH A;  1PIE A;  5LSR A;  1U47 A;  4E2F B;  3EDR B;  2NYH A;  3H40 A;  1HKA A;  2NLW A;  1GK8 A;  5J2P A;  4ZIT A;  1WC3 A;  4JI8 F;  5GVQ A;  4DF4 A;  2R7X A;  5KG1 A;  4FYV B;  2HVE A;  3P45 B;  4U7U K;  2B0G A;  3BKT A;  3GFY A;  3QGI A;  2JVR A;  3EGW B;  5B08 A;  3KTQ A;  3MGJ A;  2HHX A;  4NCA A;  1DBD A;  2UXD F;  2Y1L B;  5DJB A;  1KLN A;  2N82 B;  2AF6 A;  4W4M A;  3HFK A;  5M2U A;  3Q8U A;  4N41 A;  1RWO B;  1M5P C;  2ZBQ A;  4UOC A;  3MTK A;  4Z7C A;  1RT6 B;  2EBG A;  2W2O P;  3S6E A;  3NEK A;  4YHH F;  4ZP6 A;  1C4A A;  1GMV A;  1SQG A;  2AEM A;  4KSE B;  1T9Y A;  1VRT A;  4R8U B;  4V1A k;  1RK8 A;  3KYL A;  4DR4 J;  4QR2 A;  4CLW A;  1PAU B;  3ZTP A;  4X4U A;  1NRK A;  4DDF A;  3X3U A;  4LF2 A;  3VAJ A;  2CQB A;  2BJ9 A;  3CGI A;  4I6A A;  1G3O A;  1DZ5 A;  1N4L A;  1H3D A;  2ZDO A;  2HNZ A;  1FEE A;  3OR2 A;  4ZP8 A;  5ETK A;  2NSB A;  4P2F A;  2VDH A;  3G6X A;  2DJW A;  4C8N A;  4QIV A;  3GMG A;  4C98 A;  3BRE A;  2R7W A;  2EXU A;  2CPF A;  4DPU A;  3IC1 A;  4AYB D;  3DLJ A;  5CYQ B;  4K4X A;  1HD0 A;  1HPZ A;  1EB0 A;  1FDD A;  4CLZ A;  1XMQ F;  3US5 A;  1NJZ A;  1N34 F;  4ZN3 A;  2GX8 A;  1PAE X;  5B0C A;  2MGZ A;  4DR4 F;  4F2R A;  4HTI A;  2GQ2 A;  2VBW A;  1T11 A;  3T1Y F;  3G6V A;  3R7S B;  1PBA A;  1S6P B;  2GNK A;  4QIW D;  3I0S A;  3FSY A;  4YR0 A;  2LLZ A;  4QYZ K;  5D4N A;  2RUG A;  1IN0 A;  1R7I A;  3CED A;  3R1L A;  4CIO A;  3TAR A;  1B4S A;  1BHN A;  5ETL A;  4UF4 A;  2E1C A;  2J7W A;  4DSK A;  2R7U A;  3CMQ A;  3CJQ A;  3BJY A;  3KK3 B;  2WK4 A;  3JSM B;  5D8H B;  2CJK A;  2L9W A;  1OQ6 A;  3CME S;  5BXI A;  3N6L A;  2Z2M A;  2CJY B;  2GHP A;  3OQ2 A;  4UST A;  4DXL A;  3QJP A;  3UN5 A;  3DLB A;  5KFS A;  2OEL A;  1ITP A;  2DEI A;  2ILY A;  2BE2 B;  3N6M A;  1ZS6 A;  3LH2 S;  2L41 A;  3OTO J;  2HNY B;  1C4C A;  3VWS A;  3IWN C;  4F3Q A;  3RG6 A;  2HWI A;  5HSP A;  3TP2 A;  3FBF A;  1SPB P;  1WF2 A;  2R42 A;  4G6V B;  3JTP A;  3IAS 9;  3OFH A;  4RW7 A;  3EGZ A;  4V19 X;  1JIH A;  2DHX A;  4OX8 A;  3VAL A;  1GXL A;  3PYD A;  1TVR B;  3FRZ A;  2IPO B;  3LWL A;  4QIE A;  2FJD B;  4J90 A;  2VOO A;  4DV7 J;  2PGC A;  1MG7 A;  2PMH A;  4RLE A;  3FDS A;  1F2G A;  1IBM J;  5CHC B;  2JX2 A;  3UCU P;  4ZK7 M;  2B4V A;  6FD1 A;  4N76 A;  4A8W A;  1H2V Z;  1MLA A;  2OPS B;  1TFY A;  3UDC A;  2CNL B;  4PG4 A;  3OTO F;  1VBZ A;  1VIS A;  3OXL A;  2D3U A;  3S7R A;  4NEZ A;  4ECS A;  2DB1 A;  4CTA A;  2R3V A;  3ET6 B;  2P9G A;  5T7L B;  3NXZ A;  5KFL A;  3NAI A;  2VG7 A;  5C24 B;  3TAN A;  2J0X A;  3BGU A;  4Q0B B;  4X4S A;  4IH6 A;  5KFV A;  3HVT A;  2DR7 A;  2RHQ B;  4KHP J;  1WOO A;  1NK8 A;  1CUL B;  3T1H J;  3RR7 A;  3CUN A;  1Y7P A;  2W4C A;  3A3O B;  3TZX A;  4ZN1 A;  4DV7 F;  1WTB A;  1EKR A;  2IC3 A;  4ELV A;  2C22 A;  4A8M P;  3QT7 A;  3CCQ S;  1IBM F;  1KBR A;  3PIP Q;  2DCU B;  1U2R A;  3HHD A;  4XTT A;  1XMO J;  1BWV A;  1B0T A;  2AD9 A;  2RT3 A;  4F4A A;  1OS5 A;  8ATC B;  2JLF A;  1SC6 A;  5HMW A;  1D9D A;  4R0J A;  2HWH A;  1EP4 B;  4B9U A;  3ZZU A;  5KFB A;  4KFB A;  1MMN A;  1A9N B;  3KK2 A;  2KHC A;  1RKJ A;  5F8H A;  3Q2S C;  5KFR A;  3DRR B;  2K7J A;  4C11 A;  4ECT A;  1R27 B;  5C42 A;  4I67 A;  1N52 B;  2GS8 A;  1I5O B;  2NCK L;  1VHF A;  3KWM A;  4DV6 J;  4OI4 A;  1HQE B;  2KFZ A;  1QD1 A;  4KHP F;  1M1K T;  1B7Y B;  4Y00 A;  2K3I A;  3OVA A;  2H1Y A;  4NX9 A;  3PW0 A;  5HVG A;  3CWJ A;  3T1H F;  2BEF A;  4CM2 A;  5ETV A;  3HD1 A;  2BX6 A;  2W4D A;  2CNK B;  2A2C A;  3OVS A;  1GX6 A;  4K5R A;  1IM6 A;  1KTV A;  3G6E S;  1ZPW X;  4A8S A;  2R2T A;  4OIX A;  1RWV B;  1GXT A;  1RE1 B;  3DRY A;  1J5O B;  4RL1 A;  5M2P A;  3N79 A;  4OYB A;  2NXU A;  1LWF B;  3KMS A;  1WWH A;  4U9R A;  4C4W A;  1VC0 A;  1ZM9 A;  3QIP A;  2DRD A;  3QZ7 A;  8RUC A;  2HS3 A;  1IKV A;  5ITH A;  1OSC A;  4JI6 J;  4NRT A;  2PMZ D;  4IQX A;  4GMK A;  4M5G A;  3I6P A;  4NLU A;  3JSY A;  1DAR A;  2BAC A;  1T3O A;  2RHS B;  2FLN A;  2UVU A;  1XNQ J;  1Q79 A;  3ZZO A;  3PG9 A;  4JV0 A;  5DG9 A;  3CD7 A;  4WU3 A;  2DNP A;  4DV6 F;  4OJH A;  4QYZ J;  5CA5 A;  2ZUG A;  2RS2 A;  1IQT A;  4N8N A;  2ZBR A;  3C15 A;  2BZ2 A;  4OHY A;  2MKI A;  2E9Z A;  2XNQ A;  3JTN A;  5J2P B;  5DG7 A;  1G1X A;  2B5J B;  4NLQ A;  3D1H A;  2FC9 A;  4EBD A;  2VG5 A;  2IM2 A;  2BRL A;  2BE9 B;  2W24 A;  5LSO A;  1I94 J;  1S1X B;  3RBZ A;  2HBQ B;  3ADA C;  3T5J A;  3MM9 A;  1ELO A;  1YSJ A;  1M90 T;  4JI6 F;  2DH7 A;  2Z2Z A;  4I2Q B;  1RT7 A;  4ELT A;  3NNC A;  1X4G A;  1XNQ F;  5HVH A;  3U02 A;  2XI2 A;  2JWN A;  1QDU B;  1KQS R;  1DFD A;  1S7I A;  3N9U C;  4YB5 A;  4B3O A;  1V6H A;  3EXC X;  3NGK A;  4AT1 B;  2DCL A;  3HHL A;  5KFI A;  2V6A A;  3AFG A;  4LSN A;  1S97 A;  3W1Y C;  3IGN A;  3OL9 A;  1RTI A;  2E44 A;  1JLE A;  2EI5 A;  4CQ1 A;  3TUJ C;  4TY8 A;  1NHV A;  3OD2 A;  2UXC J;  5IS2 A;  1I94 F;  2J9E A;  5A76 A;  3GV5 B;  2BJ8 A;  3PYF A;  2KDO A;  1F0X A;  3GON A;  3EXY A;  1HPZ B;  1NPK A;  4BC7 A;  2WBM A;  4MAK A;  4HTJ A;  1U49 A;  3M8Y A;  3FSI A;  2WTF A;  4OX9 J;  1HHS A;  2YX1 A;  3OFE A;  2ZBI A;  2E5I A;  3ZFV A;  1NSK L;  2MGZ B;  2A1B A;  1TL7 A;  4M5D A;  2VOP A;  4RW4 B;  3A3N B;  2DNM A;  2JSX A;  1CSJ A;  2D3O 1;  3J80 Y;  2QSW A;  2LDI A;  1OIA A;  2AQ4 A;  4Y2I A;  5CCL A;  2AZ3 A;  2DNQ A;  1UPP A;  2ALY B;  3FMB A;  2H4Y B;  3DCA A;  3J80 U;  1HWK A;  3DDI A;  3BR8 A;  2B4P A;  1RT2 A;  2E5G A;  1ZET A;  4ALZ A;  3QRQ A;  1UWA A;  3BR9 A;  3GR1 A;  3BSA A;  4C8K A;  2LQ8 A;  3AOB A;  2AGP A;  3CCR S;  1YTY A;  6AT1 B;  5KAK A;  4EMD A;  2QA4 S;  5I3U B;  3BDE A;  2UXC F;  3UN3 A;  1P9Q C;  4CZC A;  3J81 U;  3OHB A;  5IFM A;  2YKQ A;  1BE4 A;  4WP9 A;  4OZN A;  2KO1 A;  5FD1 A;  1Q78 A;  3WC0 A;  1UPM B;  1U7L A;  2YTC A;  2RQK A;  3JXO A;  4OX9 F;  5KT6 A;  4DFP A;  1X60 A;  2KJV A;  2Z30 B;  1KQG B;  5ETT A;  3QYY A;  4PXB A;  4YY3 J;  3V2U C;  1AXQ A;  4GC6 A;  2YWW A;  2KJW A;  3BS9 A;  1YBU A;  1H98 A;  1LWX A;  2O1P A;  4J5O A;  2QYG A;  3R5J B;  2W4P A;  3JSR A;  1R43 A;  4LBI A;  3CCE S;  1PJ6 A;  2GW8 A;  5A6P A;  3NCR A;  3ZZP A;  1KR4 A;  5GAD U;  2QLB B;  3ILJ A;  2PEB A;  4DL4 A;  3GFH A;  2CQ2 A;  1N36 J;  5L1L A;  5EN1 A;  2AX1 A;  1RTD A;  1U1K A;  1K1Q A;  3Q23 A;  3CB4 A;  1KHW A;  3SZ2 A;  1WEX A;  1NB7 A;  2YWG A;  2MLX A;  2YKN B;  3HX9 A;  3M2U B;  1B70 B;  5D78 A;  4EI2 A;  1IJE B;  5IT0 A;  1T8E A;  1O6X A;  2FUG 9;  4YY3 F;  3M8Z A;  4C97 A;  1BLU A;  2VG6 A;  4KTQ A;  4X4T A;  1FX2 A;  3VAF A;  2OD6 A;  3KFW X;  4ZPC A;  1S72 S;  3L9Z A;  5DM6 Q;  3BDP A;  1SVD A;  4Q44 A;  4Y28 C;  3LP0 A;  5HMX A;  2DPI A;  2F8E X;  3CDU A;  4DLE A;  3Q8V A;  4ZP7 A;  1QUV A;  2C2D A;  2QN6 B;  2CJ9 A;  2EBE A;  3UPF A;  3K5N A;  2DIT A;  4ILR A;  4PAB A;  1VLY A;  2E5H A;  3F41 A;  3SEO A;  1JXE A;  1U1O A;  3E3X A;  2PMW A;  5K9F A;  1FRI A;  1QAY A;  1WC1 A;  2ILZ A;  1N36 F;  1DLO A;  3W8P A;  2IC3 B;  2BAN A;  2C3O A;  1Q5Y A;  2WOM B;  4C9D A;  2GVD A;  3AAW B;  2CIM A;  1X5O A;  4DR6 J;  1RUS A;  4USJ C;  1KFS A;  3IR7 B;  3JQJ A;  4CO5 A;  3EVO A;  4B9T A;  3POT A;  4KFB B;  3P5B P;  4OL8 A;  4FP9 A;  5LT5 A;  3TAM A;  3HFV A;  4C11 B;  4P6Q A;  5DDP C;  4ICL A;  2RH3 A;  3DLG A;  3MI7 X;  2KHD A;  3R2C J;  3TO8 A;  3A4T A;  2HSE B;  1SC3 B;  3JQK A;  2RSQ A;  5L38 A;  3IO1 A;  5DM7 Q;  1O0P A;  1V9O A;  1HI1 A;  5L1J A;  2AHO B;  5HVF A;  4XDC A;  4H4O A;  5D15 A;  1LKZ A;  3PTW A;  2F9J A;  4PAA A;  4DUZ J;  2IRY A;  3PFO A;  2I38 A;  4OI0 A;  2CJB A;  3BQ0 A;  3RBE A;  4ZLJ A;  2JJ4 D;  2HHT A;  5HAO A;  5B0D A;  4ZPT R;  1R8A A;  4DR6 F;  4I69 A;  2HBY B;  3VAK A;  2KL8 A;  1B0P A;  3TUI C;  2IDE A;  1W7W A;  2HQF A;  1WOP A;  1TL3 B;  2WON B;  4DV4 J;  2ROP A;  2DYA A;  5KG2 A;  1JLB A;  3IWL A;  3G82 A;  2J6S A;  2GJ2 A;  2NSC A;  1IKV B;  2FLP A;  4CCH A;  2VL1 A;  4FXD A;  4OZL A;  3HUL A;  3C14 A;  4U7C A;  2KXF A;  5DRK A;  2RVJ A;  3HJV A;  5LJ3 Y;  4ENO A;  3HJF A;  1W25 A;  5E41 A;  4WK3 A;  1R8P A;  3CO9 A;  2D3Z A;  3P5T L;  2CPJ A;  4WFA Q;  4DUZ F;  3OPK A;  4F4Y A;  5KFU A;  5DET A;  3DC2 A;  5IXU A;  2BOA A;  3GFX A;  3O1L A;  2DGQ A;  2ZH6 A;  3GSI A;  2O67 A;  2E29 A;  3CC2 S;  2VB6 A;  1D8Y A;  2WHO A;  5F9L A;  1YJT A;  3ISN D;  2QMU B;  1JLC A;  3CDW A;  1B0V A;  2FDN A;  2IM1 A;  2C2O B;  1QAI A;  3K59 A;  4IKA A;  4DV4 F;  5KG0 A;  2LXF A;  1ZM2 A;  4LF7 J;  3AOA A;  2R8J A;  3MEG A;  1T03 A;  3KHH A;  4C48 A;  4NCB A;  1RT7 B;  1VIO A;  4N77 A;  4ZPV R;  3KG4 A;  1RAB B;  3RB0 A;  1IKW B;  3PYG A;  4YDX A;  3R97 A;  3SXL A;  4B3O B;  3OJS A;  1F6T A;  4PQU B;  4OX6 A;  2XS7 A;  3LPE A;  1N5Y A;  1FKP A;  1H38 A;  4ZVQ B;  1X9S A;  2MQP A;  4LSN B;  2OEK A;  3PO4 A;  2LFV A;  1N6Q A;  1G4C A;  2RD5 C;  1RYR A;  1IBC B;  5HMY A;  3OJU A;  2PD1 A;  5KG5 A;  3D6T B;  4Y2M A;  1EAY C;  2KXN B;  4A8F A;  3DYA B;  2LXI A;  2QYC A;  3DRP A;  2IYG A;  3PM9 A;  2YXL A;  2XI3 A;  4LF7 F;  5K8P A;  1NLK L;  1QVF R;  3MOZ A;  2HZV A;  2BKN A;  3PHE A;  2B56 A;  2CQ1 A;  2Z58 B;  3I82 A;  1WF0 A;  3ENV A;  1Z2Z A;  2XMM A;  3D6H B;  3H0P A;  4JP8 A;  3HDS A;  2FZC B;  4B9L A;  1TL7 B;  2R8I A;  4M5D B;  2JC0 A;  3JTO A;  1M5V C;  4OFZ A;  1N88 A;  1RA7 A;  2CAD A;  1RWM B;  1PIL A;  1HW8 A;  1EJ7 L;  2ZWP A;  1CVJ A;  1FWP A;  1IVZ A;  1NH8 A;  3PW5 A;  2MZ1 A;  1NDL A;  3DKD A;  4NYO A;  4OYO A;  1NBE B;  4NAS A;  2FPH X;  1PYT A;  2VJU A;  5KFK A;  1JLG A;  3PEH A;  5F8G A;  4ZVS B;  5D77 A;  3P6Y C;  1M0S A;  2J6U A;  3DU5 A;  5H9E K;  4IRK A;  2MPU A;  5EX0 A;  1S9G A;  3Q8P B;  2G1H A;  2VKZ G;  5KFG A;  3DXB A;  4DPY A;  5F8M A;  3I31 A;  3IWX A;  2BR0 A;  5LSL A;  1Q82 T;  2JH3 A;  2DRA A;  3RZA A;  3THP A;  2WVE A;  3R5C A;  2BKP A;  3G8T A;  3MPU B;  1VC5 A;  2HHQ A;  1YDL A;  2CJX B;  4P2M A;  2D9P A;  2VPZ B;  3E01 A;  2AW0 A;  2HQC A;  5L9X A;  4DX5 A;  4RNF A;  1UEV A;  2U2F A;  2HHW A;  1VJW A;  1Q95 G;  4DR5 J;  1EQ0 A;  1T02 A;  3TEG A;  4USV A;  4I7F B;  2CWK A;  3ZNJ 1;  2CJQ A;  2GJF A;  4TXS A;  4LVO P;  4QPT A;  4LIR A;  4XK8 C;  1R6Y A;  3N28 A;  4QWA A;  2QL7 B;  2AEF A;  4KO0 A;  3V6J A;  4DX8 H;  3O44 A;  4U7U D;  2CZ4 A;  2XLJ A;  2ZM6 J;  4DR1 J;  2MEW A;  1JQG A;  1RTD B;  4JI7 J;  3CW2 C;  3ZNU A;  2EFQ A;  1UJ5 A;  2ZH8 A;  2GO8 A;  3ZTS A;  4EGL A;  2BOP A;  1SKS A;  4HI1 A;  3M9N B;  1YJV A;  4ZCI A;  1J5E J;  3TAQ A;  2LP4 A;  3BGL A;  3Q83 A;  4TQS A;  4M8L A;  4HLB A;  3AY0 A;  4ECQ A;  2HZA A;  1I51 B;  1VQ4 S;  1U0H A;  1N33 J;  2VG6 B;  4ZIV A;  2PII A;  4DV3 J;  4ZVF A;  4RWX A;  1WF1 A;  4DR5 F;  5KFF A;  2HQD A;  2D9O A;  1IKY A;  4NZ6 A;  2QGF B;  3BGR A;  2P9E A;  2FHJ D;  5U47 A;  2GO9 A;  1DTQ A;  1X0F A;  1FD2 A;  1O5J A;  3QGH A;  3UVJ A;  2VFU A;  4M94 A;  3K5M A;  1JLF B;  4B3S J;  2E1A A;  3BO2 A;  1DLO B;  2V8P A;  4LR7 A;  1GTH A;  3ISN C;  3H25 A;  1FHT A;  1WUU A;  1S99 A;  2ZM6 F;  4DR1 F;  2BAN B;  3TI0 A;  4JI7 F;  2OFG X;  2GVD B;  3MCS A;  3DOK B;  1U02 A;  1GNK A;  3IS9 A;  1HR0 J;  3OV7 A;  4IG0 A;  2P8I A;  1DHM A;  1RWN B;  1J5E F;  1SJ4 P;  3POT B;  1RSC A;  5D0E A;  3BN7 A;  3W2W A;  4O4G A;  3QWU A;  3VGU A;  1S6U A;  2KU7 A;  3SCL E;  5C2G A;  4WU2 A;  1XBW A;  3I9Z A;  2HFN A;  2Q79 A;  1N33 F;  4URQ U;  1PC4 A;  3DLG B;  2HQ3 A;  1IM4 A;  2M88 A;  4DV3 F;  2BBE A;  3QGG A;  2M5Y A;  5LM7 E;  1FFW B;  2B9Y A;  2YVS A;  1EIY B;  1LWE A;  2IAJ B;  2OI2 A;  2GFF A;  2N7Y A;  3T41 A;  1JLQ A;  3JYT A;  4I64 A;  1WG5 A;  4H4O B;  2VBY A;  5ETS A;  4UUW A;  3S1T A;  3MMC A;  4WXW A;  2ZJR Q;  2W8K A;  4B3S F;  3LTO A;  4C8Z A;  2XG8 A;  2BYC A;  2QJ3 A;  4NPO A;  3ZZY A;  2P6T A;  3DOL B;  4Q43 A;  3PAC A;  5A6W A;  1ZZN A;  1FO1 A;  4F26 A;  5DDQ C;  3CJ3 A;  2C2K B;  3BKU A;  2VF3 A;  3KLV A;  4PWU A;  4FNI A;  1HR0 F;  3L7U A;  4XPE A;  2CA9 A;  5HI7 A;  3OXG A;  3VQS A;  1CJV A;  7FD1 A;  1FRK A;  3SCI E;  1JLB B;  3H2L A;  3KK1 A;  1H0H B;  1SI9 A;  2AMC B;  3SBM A;  4QWE A;  2V8D A;  3KLH A;  2Z8Q A;  3MXH P;  4N5S A;  3NGR A;  5KFO A;  2G13 A;  4MIB A;  3W64 A;  4PG7 A;  4OZ3 A;  2XMA A;  4OHZ A;  3T9Z A;  2Y1J A;  5E33 A;  2VU5 A;  3WHI A;  2QEX S;  4EK2 A;  5LL6 d;  2FJW A;  5CYJ A;  1OQ3 A;  3H2U B;  2X1A A;  5IC6 B;  3A8J A;  4ZLL A;  2R7S A;  1UCN A;  2Y9H A;  2FIU A;  1AB8 A;  4DN9 A;  1X9M A;  1OY8 A;  2ACM A;  3BGF A;  3L95 X;  2KRB A;  3OL8 A;  4F0K A;  1T9T A;  3QLH A;  4ES1 A;  5H9E J;  1JLC B;  3MM6 A;  4IH5 A;  2PI4 A;  2ZKU A;  2EKY A;  2Q43 A;  3L4B C;  3MM5 B;  4ZHR A;  3ITH A;  1K47 A;  4DUT A;  4KGZ B;  3T5H A;  1FKO B;  1URR A;  4U96 A;  1BQN B;  2OPR A;  3SCK E;  3FEY B;  3TEH B;  2KZM A;  3J7A 1;  4X65 F;  1CQM A;  2J9D A;  3CJS A;  1AFJ A;  3UWT A;  4GO7 X;  3MEG B;  4ZPB A;  2HW3 A;  4MKB A;  3IM9 A;  2VD3 A;  2GQQ A;  5F3T A;  3LWM A;  1VQ8 S;  4LBH A;  4WKR A;  2W9B A;  1MNE A;  2HVI A;  5FDL A;  5JVG Q;  3PW4 A;  4IRC A;  4YB1 P;  3NOC A;  1FJE B;  2DNK A;  5KFZ A;  2JL9 A;  2DNR A;  3EWG A;  1YRX A;  4PZV A;  1N5Y B;  1VQ6 S;  1FER A;  3EM1 A;  3T19 A;  4HH1 A;  2OUG A;  3AQO A;  3MMA B;  3DLE A;  1JLA B;  4DI6 A;  1RT4 A;  2DGO A;  2I8E A;  1WI8 A;  3AOD A;  5BYQ A;  1N6Q B;  2VFT A;  1RT1 B;  2V67 A;  3C8Y A;  3VZH A;  1D3W A;  3DLK B;  1L3K A;  4JI3 J;  1QVG R;  2BA9 A;  2VV5 A;  1RHU B;  2H5I B;  3DRP B;  3OSP A;  1HYS B;  2OHD A;  2V5H G;  2CXE A;  1BC6 A;  1O8B A;  4M1K A;  4IOC Q;  4NLD A;  4K4Z A;  3G8Q A;  3IRX A;  4UZB A;  4NI2 A;  1HNV B;  2XZT B;  4ZA1 A;  3WIV A;  3MUV P;  5HP1 A;  3CCU S;  1NK7 A;  2V2Z A;  1QAJ A;  3QAE A;  4LSL B;  1HQU A;  3IA0 A;  5KFP A;  4Q45 A;  4ILL A;  2G2Z A;  3GYG A;  3J7Y U;  3GLJ A;  4DUY J;  1HNI A;  4G1Q A;  1Q8K A;  2GVZ A;  4I1T A;  1JNR B;  4M95 A;  5DDR C;  2UVW A;  2HBR B;  1MWQ A;  2VKR A;  5CCM A;  3B4M A;  3FBB A;  1ZAX A;  1AFI A;  1RP5 A;  1TKT B;  2B9E A;  2DXE A;  4N56 A;  1EHW A;  2LDY A;  1NSQ A;  3ZTR A;  3BZQ A;  3QQC D;  4JI3 F;  2MMY A;  2XWY A;  2VOD A;  4WJB A;  2QRR A;  2A0F B;  3C6T A;  5K5M A;  1S9G B;  3ONQ A;  5C7P A;  2D69 A;  3Q22 A;  2LKZ A;  4DCJ B;  3DMJ A;  2D1C A;  2HND B;  4MYU A;  4DG1 A;  5I42 A;  2VQF J;  1UET A;  5DGA A;  3HO1 A;  1KEK A;  1FK9 B;  1HWI A;  3D6M B;  1YI2 S;  3W9I A;  4I0W A;  3QGP A;  2B6A A;  1VRQ C;  3DI6 A;  2QE5 A;  2CPX A;  2RIJ A;  4U67 Q;  5KT7 A;  1N56 A;  2ASY A;  4GC7 A;  2YKP A;  3CJ8 A;  1JB0 C;  2E7W A;  2CJA A;  8AT1 B;  4DUY F;  2MQ8 A;  1BD6 A;  1X7V A;  5LOQ A;  2YQ1 A;  4J9K A;  1YHQ S;  4U95 A;  3KLG A;  1S9F A;  1GT8 A;  3ETM A;  1U09 A;  1Q7L B;  4J91 A;  2YY3 A;  1AW0 A;  4NYP A;  2F4V J;  4HEA 9;  4CLP A;  2C1E B;  3N5F A;  4O23 A;  2MYF A;  3CCL S;  5EWE A;  1WC6 A;  1F2H A;  2MJU A;  1WC0 A;  2MST A;  1VIX A;  2BM0 A;  2CQ4 A;  4ECZ A;  4OYM A;  4DPW A;  1VQL S;  2UUC J;  5J1P A;  4Q8E A;  3HHN B;  4MH8 A;  4BWJ A;  3M8S A;  1KP6 A;  4DQP A;  2VQF F;  4P71 A;  2IYI A;  1RKI A;  2WSC C;  3ETO A;  2CPD A;  3D1Q A;  3S01 A;  4B9M A;  5IM0 B;  1BMQ B;  4DL5 A;  2DHA A;  1SV5 B;  2F5G A;  1KWM A;  2EFP A;  4L6V 3;  3EZU A;  3MED A;  3U7J A;  1FWL A;  5D4O A;  2NZ4 A;  1G6B A;  2E5L J;  1N32 F;  1U0H B;  3SQO P;  1KKH A;  1KOH A;  4DFM A;  1ULR A;  4HR2 A;  3VAM A;  1QLN A;  3ULH A;  2IJF A;  4EBE A;  1M5H A;  5BYS A;  3HPO A;  3KUH A;  2MZR A;  3QSY B;  4R8U A;  1IKY B;  4HVZ A;  3BGR B;  3DM2 A;  3D54 A;  1T9U A;  2RF2 B;  5AXN A;  1UP1 A;  3I96 A;  1DTQ B;  4A8K A;  4O3R A;  2F4V F;  3UVJ B;  4WP3 A;  4B3R J;  4P9S A;  3HMJ G;  2DR9 A;  1C2P A;  4FPI A;  1U45 A;  3RU0 A;  5A8K B;  3M2R A;  5LXR A;  1C0T B;  1FCA A;  2OO4 A;  3H4B A;  1ZM4 A;  4FF1 A;  2J7K A;  3IFE A;  1IXK A;  3SMZ A;  3W3S A;  4IG0 B;  4DQI A;  3NRB A;  2YNI B;  5KT2 A;  3B6B A;  4PXD A;  3GQC A;  3W2W B;  4RNM A;  4MKV A;  5CYQ A;  3PXG a;  2XMT A;  4CO2 A;  4JOU A;  2E5L F;  1JWW A;  4H4K C;  1ZYQ A;  1DTT B;  4WP8 A;  3MF5 A;  2CVE A;  1BXN A;  3PKY A;  2HFV A;  1R0A B;  1GMW D;  2C3Y A;  3T6B A;  1Y4Z B;  4JUZ A;  3D6F B;  4KIA A;  2C3M A;  1LWE B;  2CPH A;  4OI2 A;  2FLO A;  4J7C A;  3JYT B;  2QZ8 A;  2FQQ B;  2IIH A;  3C19 A;  4NXN J;  3WC2 A;  2Z0G A;  2YKM B;  4B3R F;  2FD2 A;  4NA2 A;  1WOS A;  4RUH A;  1PC5 A;  2DNN A;  2C3U A;  4CLK A;  5GAG U;  5MLC V;  1RI7 A;  4KHR A;  1U1M A;  1KLM B;  1DAX A;  2J0Q D;  5BJR A;  2HFO A;  1K0V A;  1ZTW A;  2XGQ A;  2QLW A;  2F7V A;  2ROE A;  4KKO B;  3EX7 B;  3FBE A;  3W9J A;  3KK3 A;  1Y3K A;  3JSM A;  2RQM A;  5DQI A;  1RBO B;  2UVV A;  2V2V A;  1NB2 A;  1NAQ A;  3KK1 B;  2IM3 A;  1PO6 A;  4GKK J;  4WWS A;  4NE9 C;  2MSS A;  1ICE B;  3P8B B;  2BE2 A;  2X1G A;  1VQ7 S;  2W2P P;  1OY9 A;  3J7Z 5;  2I5J B;  4U8V A;  3ZC4 A;  2HNY A;  1KDN A;  3TW0 A;  2AJ2 A;  4NLP A;  2QTW A;  1QSS A;  3TRG A;  3PKM A;  3DN9 A;  4X4Q A;  3C2P A;  5E3C A;  1X4B A;  5GMK a;  4NXN F;  3AJ1 A;  1WG4 A;  1TU0 B;  3NLC A;  3G86 A;  3LOU A;  1WDD A;  1WEY A;  4DU7 A;  2MHN A;  3K7R A;  1VCT A;  4GKJ J;  3QO9 A;  2WSF C;  5KFD A;  1U1Q A;  1FI4 A;  2GJI A;  1V3Z A;  1VOM A;  2HUR A;  3C16 B;  4LFC J;  4N47 A;  3BBC A;  1UFW A;  1LXJ A;  4OYX A;  2BJ7 A;  3QLH B;  2OEM A;  3MCN A;  4F0M A;  1GXU A;  2GHV C;  1Q8I A;  1TUG B;  4BHQ A;  3FMW A;  2HQI A;  3RW6 A;  2XSF A;  4OZ0 A;  2F63 A;  2VDI A;  2OLW A;  3ENW A;  5AJ3 J;  3R6G B;  1LEO A;  5IV3 A;  4GKK F;  4MK8 A;  1R3N A;  2WVD A;  1T9X A;  2OPS A;  3MPV A;  4HL9 A;  4JI0 J;  4CLT A;  3AT1 B;  4BCA A;  3OTC A;  4OV6 A;  4OMF G;  4I56 A;  4NXM J;  3CJ2 A;  3L7O A;  5KFN A;  3D0G E;  4HHH A;  3RR8 A;  4KGM A;  2RKI A;  4O3N A;  2CPZ A;  3ET6 A;  4EFA C;  2UP1 A;  1JJ2 R;  1WDT A;  3UCG A;  3DLL Q;  1G2E A;  2BW2 A;  4GKJ F;  1RHK B;  1H7W A;  2ROG A;  2OJ3 A;  2MQM A;  1KQK A;  3DLE B;  2AP6 A;  4BBY A;  2KB2 A;  1GH8 A;  3CC7 S;  4LFC F;  3M9O B;  2AJ4 A;  1D1U A;  2JDJ A;  1HFE L;  3R1H A;  1XK8 A;  2G0J A;  4TU7 A;  1OYE A;  4NCG B;  4MT1 A;  3HHK A;  1YIT S;  5I3Q A;  3KJV A;  2P6S A;  5AJ3 F;  4FS2 A;  2I1R A;  2R7V A;  3G4S S;  2ZOM A;  3IRX B;  2E7V A;  2E1R A;  3BGO P;  4NI2 B;  2K7K A;  5HP1 B;  4M5I A;  2ZH5 A;  4JI0 F;  1X5S A;  3TZZ A;  3G6Y A;  3BB5 A;  1T0T V;  4IUF A;  3ELH A;  3R8Y A;  4NXM F;  2D74 B;  2ATC B;  1RTH B;  2EEY A;  4G1I A;  4Y2A A;  1PYS B;  1HQU B;  3I5B A;  2DR6 A;  2JEF A;  4JI1 J;  4G1Q B;  2GVZ B;  2NZC A;  2W9C A;  3KJQ B;  3EPI A;  2QSF A;  3DDK A;  1U8W A;  1X4E A;  2J8S A;  1W26 A;  1RCO B;  2Z4P A;  2EFN A;  1OSD A;  4UW2 A;  2CYY A;  1UVL A;  1HQE A;  2CQG A;  1YZ6 A;  2D3O R;  2FJB B;  4ANE A;  5DLG A;  2OSQ A;  1X9W A;  2XMU A;  4Y2C A;  3SQG B;  2RRA A;  3WQP A;  1A7G E;  2MQO A;  1HWJ A;  2EK6 A;  3C6T B;  2FVS A;  2ZFH A;  4CRJ A;  2XYG B;  3DMJ B;  4DG1 B;  1J5O A;  2QA2 A;  4FZV A;  4OI1 A;  3HFZ B;  5A0Y A;  2VJV A;  2Z56 B;  2KVQ E;  2UXD J;  4ZPW R;  1LWF A;  2IVY A;  2PI5 A;  4A46 A;  2MKS A;  4X4N A;  3OXF A;  2B6A B;  3DI6 B;  4RW9 B;  4TN2 A;  4PWD B;  1S1T B;  2OH2 A;  2OKQ A;  4PR6 A;  4USI A;  3RB3 A;  1RAG B;  1SCJ B;  1RT3 A;  4JI1 F;  1NHU A;  1IR0 A;  3CJR A;  3KLG B;  2R8H A;  2FHO B;  3MPW A;  2CQD A;  4B3T J;  1NO8 A;  3CC4 S;  3OUY B;  2KG0 A;  4ZCL A;  2V0N A;  3NS6 A;  3GZ7 A;  4K4T A;  3NGD A;  1WEZ A;  4ED6 A;  1CC7 A;  3HSD A;  4FXW A;  2ZH2 A;  1N0U A;  4DPX A;  1CBK A;  5KG3 A;  4LT6 A;  2J76 E;  2BQU A;  3TUZ C;  1EZZ B;  2GC8 A;  1L5U A;  2ZZN A;  1YBT A;  2XC9 A;  4MK9 A;  3M1V B;  2B5J A;  2DK2 A;  2QLX A;  5CXT A;  2IVF B;  1HA1 A;  2A10 A;  2ZHO A;  3J7Z T;  5J2N B;  1NSA A;  4IRD A;  3W8G A;  3DGV A;  5D6G A;  1BGX T;  2IMO A;  1GQE A;  1S1X A;  3TVZ A;  5E3P A;  3E51 A;  1WOR A;  2HAI A;  2KXH A;  3BQ2 A;  1NPP A;  1GX5 A;  3MED B;  3T5K A;  3ZTO A;  2ZDP A;  5D0R A;  4LF1 A;  5A8W A;  4ZPD A;  1XMQ J;  4U8Y A;  3KLI A;  1DQA A;  1YRT A;  4I2Q A;  1N34 J;  2VA3 A;  1YJU A;  4B3T F;  3GJQ B;  3B8H A;  3DM2 B;  2JEI A;  1OJ4 A;  3T1Y J;  2AYM A;  2LQ9 A;  3AQP A;  2AJ0 A;  1XWL A;  2RDI A;  1DQ8 A;  4J9M A;  3X1L B;  3KMQ A;  3M2R B;  1RTJ B;  1N0V C;  3UDE A;  4YB7 A;  1TTH B;  4LUB A;  3AA8 A;  4PCQ A;  2FVP A;  2HPU A;  2W8L A;  1S59 A;  2BQ3 A;  1EET A;  3W65 A;  1U25 A;  4EO6 A;  2H5E A;  4RU2 A;  3GP9 A;  4F3M A;  3NGT A;  3D67 A;  2C2E A;  4RPF A;  1XC9 A;  3AA9 A;  2DGV A;  3IGV A;  2C28 A;  2D41 A;  2H5J B;  1XR6 A;  3T9N A;  2LQB A;  4ZLP A;  4UQG A;  2JFD A;  3W2V B;  1L3U A;  1QSY A;  5HN0 A;  4I2P A;  3Q0A A;  2ERR A;  2RML A;  4RW4 A;  5E0O A;  4ETX A;  1SBR A;  4X66 J;  5H9F J;  2L3M A;  3J7Y I;  5CYM B;  4J9O A;  3KHG A;  3NG8 A;  1KVJ A;  3C66 A;  3PZP A;  3QT5 A;  4OV1 A;  2AGQ A;  1NXI A;  3BH6 B;  2FJX A;  3D4J A;  3AD9 C;  3ENQ A;  2KT3 A;  1XTZ A;  3FNN A;  4NL5 A;  9ATC B;  1FNX H;  1CEZ A;  3VGS A;  2LU2 A;  5I3U A;  2RS8 A;  2NXN A;  4USU A;  2ZJP Q;  4MJK A;  3R5B A;  5L1K A;  1R6V A;  1FJ7 A;  2PEH A;  2V69 A;  3MPY A;  2LQJ A;  2QMW A;  3K0J A;  4LF4 J;  3D0I E;  1NKE A;  3HXM A;  3TX0 A;  1U1R A;  3PNI A;  4OYI A;  3GIK A;  1P8G A;  5K20 B;  3CVK A;  5E3A A;  5C2C A;  1B64 A;  3IR6 B;  4IDK A;  4CO3 A;  3R3T A;  4J9N A;  1X4F A;  2XQC A;  5DDO C;  5HAT A;  4CI0 B;  2RDD A;  1V5I B;  3TQE A;  1PBU A;  1AZS A;  4X66 F;  1SQE A;  4FYY B;  5LXY A;  1RAI B;  3LUY A;  3VTI A;  1CPZ A;  3C46 A;  2NUU G;  5HO4 A;  4P7T A;  3QO9 B;  2GA7 A;  1FDA A;  4DU8 A;  4AND A;  2QL9 B;  4AQY J;  1P1T A;  4ILM A;  2AYE A;  2QO3 A;  1DUR A;  4MIW A;  2KVI A;  1U1P A;  3MR6 A;  3MUT P;  1YK9 A;  4ZVT B;  4FBT A;  2PFD A;  4UOG A;  3O5T B;  3D0H E;  4QR1 A;  4RKU C;  3A13 A;  4DFJ A;  3M05 A;  3TA0 A;  4TLR A;  4GRS A;  4LF4 F;  4PPZ A;  2YKN A;  3ZZZ A;  1UZH A;  5GAE U;  4XPC A;  2XYH B;  1NKB A;  3M2U A;  3SV3 A;  1TL1 A;  1KN6 A;  3V4I B;  5LMN J;  1QTN B;  4F04 B;  4GO5 X;  2RKI B;  1YJN S;  5AT1 B;  1VFJ A;  2W2Q P;  2CUY A;  5B0G A;  3Q86 A;  3BO3 A;  2FHJ A;  4CLL A;  3N01 A;  5AXK A;  2DGW A;  1KFD A;  2DXF A;  4WZQ A;  4AQY F;  4IYQ A;  4X4V A;  3DFE A;  5E5N A;  4WK1 A;  3KLF A;  4LR9 A;  2CRL A;  2R9L A;  2MZT A;  3RB4 A;  2GGP B;  4DSE A;  4GVB B;  5DLF A;  4HKQ A;  4YQW A;  3QRR A;  3KJV B;  1CS4 A;  2XSJ B;  4P2S A;  1FTR A;  4ZVU B;  2WOM A;  3GB0 A;  5J2M B;  1UVJ A;  2FC8 A;  4C0H A;  3HVR A;  2GMH A;  3IAM 9;  3ISZ A;  1N5V A;  2B7C B;  2HRY A;  4K2X A;  1JJ4 A;  3O6Q A;  1HWU A;  2P5V A;  2DGS A;  2RRB A;  1RWU A;  5FJ4 A;  1R8H A;  5LMN F;  2HRT A;  3CCS S;  4PEO A;  4DQR A;  1UVI A;  1Q53 A;  4TU9 A;  2XTJ P;  2VQE J;  2XYP B;  3UW1 A;  4A8Y A;  3RBD A;  3BEG B;  2I0X A;  2W9C B;  1LV5 A;  3K8W A;  4QBU A;  2HHH J;  4ZCK A;  1X31 C;  2HMI A;  1OWX A;  2C2Z B;  2HFZ A;  3UO0 A;  1B3T A;  4NLW A;  3WX8 A;  4DSJ A;  3WZ0 A;  1YRU A;  2YKO A;  4IO1 A;  4P2X A;  3GII A;  4M5L A;  5GAG I;  2DGT A;  5G4D A;  3QJJ A;  3DOM A;  4KYZ A;  2NXJ A;  4F7V A;  4O3O A;  3I0R A;  3CDA A;  5A0Y B;  2ZIT A;  2W7A A;  4J37 A;  2RNE A;  3HF5 A;  1P9Y A;  1L3S A;  1TL3 A;  2WON A;  3NNH A;  1TK0 A;  3CTR A;  4F50 A;  3NWR A;  3EGN A;  2KG1 A;  3PV8 A;  3THT A;  3M8P A;  3AJD A;  1RT3 B;  5FLX Y;  2VQE F;  2HVH A;  1L3T A;  4J9P A;  3MEE A;  4QJV A;  1RLC L;  4ZP9 A;  2A3J A;  5FLX U;  1SJ1 A;  2HHH F;  2CQ3 A;  1F5B A;  3AXK A;  4K7Q A;  1C1C B;  2Q1L A;  1H73 A;  2HIQ A;  1Y9O A;  4Q5V A;  1NPR A;  4C8M A;  1LW2 B;  1MWZ A;  1S6Q B;  2J0W A;  4HHU A;  1K73 T;  1YZ7 A;  4EUV A;  3HCX A;  5LMU J;  1TK8 A;  3PDN A;  1Z4U A;  4YN3 B;  3GSD A;  4WTY A;  1J2V A;  3FSX A;  4EU0 A;  1J27 A;  4NLG A;  5J1E B;  3CD6 S;  2Q6B A;  2HKE A;  2QLJ B;  4NZ7 A;  3V6D A;  4OX7 A;  2ZC3 A;  3CCT A;  4ID8 A;  4OI6 A;  4YFU A;  3GYN A;  2ZH4 A;  1Q7Y T;  3MR3 A;  5GMD A;  1F9E B;  4OZJ A;  2YNG A;  4H4K A;  1WJ9 A;  4PRF A;  5A8W B;  3GE9 A;  3PVX A;  3KLI B;  3UD5 A;  4KGV B;  2N4D A;  2NRE A;  2R2U A;  3CMA S;  1FVQ A;  4RUC A;  4RWW A;  2Z2L A;  1IKW A;  3ZO7 A;  2VPX B;  3UR3 C;  3MR5 A;  3JSB A;  4PQU A;  2AWZ A;  2F9D A;  2OAU A;  1Q1K A;  2VC1 A;  2PA8 D;  3HT0 A;  4RR5 A;  2XB2 D;  2M8H A;  5LMU F;  2GV1 A;  2IA6 A;  4X62 J;  2EFV A;  4ZJL A;  4DX7 A;  5HRO B;  4WFN Q;  4KBI A;  1TZ0 A;  2VPY B;  5I4M A;  3VR1 A;  3MAA A;  2V8G A;  3B4D A;  3RAQ A;  3MR2 A;  4PG6 A;  5A8R A;  2WW4 A;  2AZ1 A;  4LF5 F;  4ED7 A;  2K1R A;  1EET B;  3I32 A;  2ZOG A;  4OZ2 A;  2HHV A;  3DYA A;  4M5J A;  5J1N A;  2DT9 A;  2KT2 A;  1PJ7 A;  5F8J A;  3T1A A;  1Y3J A;  3TZY A;  3IG1 A;  1SKR A;  4DOZ A;  1X8D A;  1S6O A;  4Q7A A;  4JYA J;  4W98 A; 
#chains in the Genus database with same CATH homology
 3BKF A;  2WVD A;  2PC6 A;  1Q5V A;  2BJ8 A;  3BKT A;  2WVB A;  2NZC A;  2FGC A;  2HZV A;  3QSI A;  2WVF A;  3BKU A;  3PHT A;  2BJ7 A;  1Q5Y A;  2HZA A;  2BJ3 A;  2WVC A;  2F1F A;  2CA9 A;  2WVE A;  2Y3Y A;  3LGH A;  2CAD A;  2BJ9 A;  2BJ1 A;  3OD2 A;  2CAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...