3BKYH

Crystal structure of chimeric antibody c2h7 fab in complex with a cd20 peptide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
226
structure length
226
Chain Sequence
QAYLQQSGAELVRPGASVKMSCKASGYTFTSYNMHWVKQTPRQGLEWIGAIYPGNGDTSYNQKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYFCARVVYYSNSYWYFDVWGTGTTVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords the Fab fragment of chimeric 2H7, heavy chain
publication title Crystal structure of chimeric antibody C2H7 Fab in complex with a CD20 peptide
pubmed doi rcsb
source organism Homo sapiens, mus musculus
molecule tags Immune system
total genus 39
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2007-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bkyH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bkyH02
1BZ9A 2X41A 4OCXH 5KS9F 4HZAA 4YEEA 1DQQB 5HHOA 2LVCA 2ICEB 1YMHB 1H15A 3C2AH 3MLZH 4F2MB 5A16B 2AK4A 3RI5F 1IEBB 3HNVL 2VITB 4U2YA 2DLHA 3ZKND 3G5VA 3GMMA 3T2QA 3QH3B 1JYVA 3QXDB 1JZ8A 1UACH 4XCNB 4DFIA 3KDMA 1K3IA 1T03L 4E41E 3B9AA 4K55A 5E8NA 4KK5C 5DJCA 5SWZD 3IETB 5I19L 4FFVD 1KTDA 1ZGLM 1HHKB 3GMLA 1E28A 1NL0H 4FQLL 4DN4L 4UNVA 3D0LA 2ZCLH 4H0IA 3QEQE 2FX8H 3NCYS 4GW1A 5EULV 5J0BA 4U31A 3RHWK 2FEDC 3RU8H 1MH5B 4G80A 1NEZA 1PLGH 3NN8A 4OZHF 5DRWA 5FF6B 3GSNH 4OLXL 2NW3B 4HKXB 4F33A 2BVPB 3O4LD 3REVB 5JIPA 1MFDH 3N9GH 4Y88A 4PJCF 1FH5H 1J8KA 1U58A 3B4NA 1ZHNB 2HLAA 1DCLA 1BIIA 1ORQA 5DVMA 3F65A 5KOMC 5IOPA 4BSJA 3L3IA 5IHZA 2IQ9L 4HC1L 3HAEH 3JBG7 4I13B 1QBLL 3LZFL 4X80L 1JPGB 1PYWA 4LDLB 3PWUB 3H3BC 1ES0B 1FFNA 1K4DA 5L88L 2JK5A 2PTTA 3PIQA 4RSVA 4NC1C 4WO4C 4YC2B 4NBXB 5JW4R 2OL3A 3A6CH 4JY4B 1RZJL 3MUJA 5C0CA 2QHRL 3QP3A 1B0RB 1EMTL 3MRJA 4LF3B 5JHLL 3RDTA 3EFFA 1PJ9A 5DUBA 3L1OH 1AD9B 3MJ8A 3WLBB 1EGJL 3VH8G 1FGVH 2D03H 4PJEE 2O61B 5GRJH 2IBGA 2ZUXA 5EZIH 3MROA 4BKLA 1BD2B 4FP8L 1BQLL 2YR3A 3GM8A 2ZOKA 1I9IH 1T2QH 2MQCA 4OD1H 4X8JB 4MDIA 5D2LB 4X8XA 5IFAH 3V6OA 5LWYH 2VOTA 4PGEA 1ACZA 1GL4B 3VJ6A 1OM3L 5GRYA 4NPYA 4OSUH 2IPKA 5K9KA 1WK0A 2YK1H 3ZKNC 2V7NB 1VGEH 1U92B 1IBGH 3Q5OA 1QPPA 4RAVB 3RWJA 1Q94B 2E6PA 2R29L 1JWUB 3O6FA 4XNYH 4IOFC 3S4SG 3DSFH 3PABA 4G5ZL 5C0BD 4WI8A 4FFVC 4WGWB 1UB6A 1WISA 3BMVA 5ISZD 4D9QD 1UM4L 5GGQL 2VMFA 2WBJA 4DGVL 2D7NA 3RWDB 4P23D 1UFUA 2VZVA 1JPSL 4GSDH 1P7QD 3TLRA 4AEFA 5GZOD 1NAKH 3K4ZA 3TM6A 4DUWA 5ANME 3O6MH 4I3SH 1DSFH 3MR9A 3TP4A 2Y06L 3U9UA 1K85A 2IFFL 4PJHB 5EUOF 3RPIB 2GSIB 5AZ2L 3FO0L 3KYKL 3QHZH 3MOQA 4X6DA 2X1XR 5D2NC 4GMTH 2MOVA 3VCLB 5C09E 2H26A 2FX7H 3U0PA 5IWLA 1LEKA 2R39A 1U8IB 1ADQL 3SDXE 3ROLB 1MCWW 4Z7WF 1MOEA 4LSQL 1QVOB 1XGUA 3MLTB 3VW3L 4JZJC 5CGYD 1JUFB 3IAQA 4QHKJ 4A6YA 3M17B 2VUYA 1HINL 2RGSA 1I7ZB 2B20A 2FNBA 5H2BB 2CDGA 2RBLA 3V5KB 4RISL 5CSBA 4XVTL 3MRQB 1NEZG 4XRCB 1U8PB 4MHHG 2EYSA 3KJ4B 4NM8H 2GK0A 3G6JA 4LKCA 5EOQH 3DYPA 2CJUL 4WDIA 2W0PA 4LSUL 4YDVA 5IFJB 3NFNA 1Q9OA 4RIRB 1I1FA 3QHFH 4PGDB 3TIDB 1NSNH 4PV8B 2DQGH 2OP4H 5IP4A 5AYUH 3FQTB 1WIOA 4KXZH 5HHOE 1CZ8L 3DVFA 3DX8B 2WLZA 1S5IL 4KY1L 2X4PA 3AU1A 1MCWM 5CZVL 3MNZB 1W0YT 2APVA 2AK4E 3QFJB 5JORB 3QNYA 4HIHA 3GI9H 3SKMB 4LU5H 4AM0B 1T83A 4NJAH 5IQ9A 3SGEI 5I1GL 3ARDB 2CMRH 1GPOH 2AERT 4MHHI 5GS0D 2B1HL 1HN1A 4ONGL 3MRRB 2V2XA 4M8QA 3JV5A 1KLUB 1U3HA 1A3QA 2IALB 3TO4C 2YD3A 1DEDA 2ZUQB 1MSPA 4OQTA 5E56A 5DMKB 1MFEH 1HEZB 3TJEL 3BUYA 4PLJC 5E8DH 3O9WD 3DVGA 2GSGB 4JFOB 2ZWLT 1CGTA 3ULSB 2VISB 1MHPH 4GRMB 3F58L 3HMXH 4NQCA 1FZKB 4GKZB 4QF1A 3ZDXE 3RUGA 4QHMA 5DJAA 3BP4A 3VFRA 4P23C 5CEYA 3PL6A 5B39B 4UUJA 5DK0A 1MCEA 5GZOC 5FOJA 1E0OB 5F8RC 43CAA 3ZDYF 2FYYA 2NY6B 2HTKD 5DI8B 1UWXK 1IGIH 5HXMA 3CVHB 4YPJA 1VFBB 4OCWL 3ZT5A 2DM2A 3ISWA 4OGYL 3V4PL 4LP4A 2QLVB 3IS1X 1DBAH 2EDHA 4TSCH 3VFSA 4J8RB 4NO0A 4JFFA 4JZNB 4FABL 5JR1L 4DQOH 2NXZB 5KVDL 4ORZC 2HT4D 1DUZB 2JB6B 3GMOB 4LLQA 3DVNA 5MI0B 4Q7DA 5CGYC 4NFDA 5CZXD 3VRJB 4JY6A 3KXFD 1HSAB 4U7MA 2C1PA 4EZMA 1T20A 1KELL 4PTUA 5D7LB 1LE5B 4HIXH 2AXHA 4WHYG 4XP4L 3FO1A 2YUVA 2DB8A 5C0RL 3GZKA 1U3YA 4LCWA 1KTLA 5I1AB 2VLRB 4L4VE 1BD2D 1EEZA 3WNMA 4KAQH 5IB2B 1U93B 3MXWH 3RY6C 4W68A 3V6OE 3PHQB 4UTAL 1LK3L 1WAAA 1NMBL 3TBSA 1XF2B 3MBEB 3IJYA 1RK1A 2EDDA 1LP9F 4ZO9A 2BNRB 1FVEB 2CH8A 4BQ6A 5F7KC 4JO4H 3LHPL 1HH9B 2BY0A 4E42A 3LEXA 2GFBB 4X7SL 3AB0B 2DRUA 1PG7H 2DQFA 2YD2A 1JHKH 4HX1B 4QOKB 5I1IL 3IDYB 3OWEA 5TE7H 3BIAX 3CDGB 4M3KB 4OLUH 3UC0H 1LD9A 4ELMB 5E2TL 3O9WC 5FYJD 3WFCL 2R8SH 3V52L 1ORSA 1ZEAH 3GIZH 4M7JL 4R90H 4RMUA 5JLZA 3T04D 2DQHH 5KAQG 5DT1H 3BT2L 4XX1E 3VI4E 1FNGA 2Q87A 1I7UA 4HK0A 3GRWH 2EDRA 4POYA 1Q9WB 1OLLA 3MX0A 1OF2B 1FZOA 1I8LC 2AJUL 2EE3A 3FQNB 4TUKL 3J8F7 2VLLB 1G7LB 5MEQA 4KZDL 1YEHH 4WU7B 4X6DE 2QQLL 2HTKC 1T2XA 2UWEF 3VG0L 5EO9A 2CLZB 4YDIL 5ITBL 1L0XA 4HUUB 5KSVB 2DLFL 3DURB 1NBQA 5ESVA 4HH9B 4CADB 3ZLQC 3RWFA 1INEH 1JF5A 3BIKB 5DEGB 3DIFA 3RWGB 2P8PB 2XG5A 4LHUB 5GSRB 1A1OB 4LLVB 2XKNA 4CUCA 1R24B 2VDQL 4LLYB 3OG6B 2HT4C 3K8KA 3QWOA 5CJ8A 2DTML 3G6JE 3ILPA 4N0UA 1AGFA 4YC2C 3FT3A 1QG3A 5HI3D 4N8PA 5CZXC 2D7OA 1CLOL 5IT2H 3ARRA 5J9PB 3NACH 4WTZA 1A6WH 1EGJA 4YE4L 3DUHA 4N68A 4RCAA 1GSMA 3FO2B 3EFDL 2JTDA 3CLEH 3QFJD 1WBZA 4G42B 2HFFB 3AY4A 3QWQB 5GHWL 1YDPB 1D5BA 4ZFZA 1MRDL 2X89D 3SPVB 2Y23A 2UZIL 1JPTL 4QRQA 1C7SA 4MLSA 3ARDD 4L29B 5MENA 3DTXB 3VRLE 3EDFA 4MXWH 3BE1H 2D9QB 5GS0H 1T0MA 1FNEB 4PJ5D 4PRNA 4U0RB 2APTA 1RAMA 1EJOL 1L0YA 1VGKB 1EHAA 4ONFL 1FVCB 3NPZB 2OSLA 3NCCB 3T0WA 3LKRA 3K2MC 1T2JA 1GGUA 3PGCA 4BSWA 2H3NB 5CEZD 1ZLSH 4CVUA 3QO0B 5DMIH 3OAUH 4U6HA 1KIRA 4J3VA 2ID5A 3RUGE 5ICYA 4WEUD 2ORBH 1C08B 5C92A 2FO4A 3BD5A 2XIDA 4XBEL 1CTOA 2EDLA 4QHUA 4Q6IA 2ILLA 2NY6D 5ACZB 5HYJA 3BYTA 4NQDA 2AKRB 2EIDA 2VSDA 1KN4L 1W8OA 2X9XA 4KVNL 1XF3B 5JMOC 3CVHL 1GAFH 2Q6WB 2EZ0D 4TRPH 4YXKH 4JFFE 3BH8A 3I75A 3X14B 3L7FB 3VXMB 1ADQA 1GYAA 1RUAH 1GGBH 2VLMD 1LDPH 3CAFA 2NXZD 1J1PH 2NW2B 5ADPH 1OGAB 2X4QA 3TN0B 4GH7B 4NZRH 1SY6A 3ZE1F 3U46A 4TULH 4PJDE 4B50A 1JPST 2IADA 5L7XL 2ZOLA 4FXGA 2KQNA 2OR8A 4HUXB 5CJQH 3X3FH 3VWKB 3NA9H 3T4YA 2G60H 1ZK9A 4KTEL 4OAWA 3HN3A 1KLGB 3E3QE 4L8DA 1UM6L 1WTGT 3WD5L 1PD6A 1NGXA 5D7LD 2G5RA 3KJ4C 3S35X 3GB7A 4IRZH 2VDLL 3Q6GL 4PJIF 2OJZL 4M6OH 1HQRB 3JVGC 5I8OH 4ZMAT 1X6NA 2AW2A 5HI3C 4LNRB 2F5AH 5TQ2L 4LCWE 1OAUH 2VLRD 4F37K 4QY8B 4HUVB 4HCRL 3P77A 4GUPA 2HWZH 3MRMB 4IMLB 2D0GA 4PY8I 1FNSL 4R7NB 5FGBA 2WBWB 1R3LB 4MJ2A 4ZFGH 2G9HB 2V9TA 4UQ2B 5T1KB 5CP3H 1I8MB 2IGFL 2GHWB 5FB8B 3MBED 3K80A 4HWUA 3QUKB 2BNRD 2K7PA 4HBCL 4YGVA 5DJ0A 3ARDC 4RDQG 5GS3A 3HE6A 3O11B 5ICZA 4D3CL 4ONHB 1ZHKA 5HY9A 3V8CA 2Q8AL 1MCIA 5I18L 3PV6A 3CPLA 2DQTL 1PG7W 1F6AB 5TE6H 1Z3GH 1AE6H 3HR6A 1KB5B 1QYGH 4HFWA 4I48B 4DOHB 1HDMA 2ZUQC 1CCZA 2UUDK 3IDGA 4PBWD 1BQHG 3W0WA 3LKSA 2XWTB 4G9DB 3U1SH 5CD3B 3SY0A 4LSDA 4F7TA 2HT3D 1ROWA 4JRYA 5FYJH 5D6DA 2Y7QA 5IBTL 4P2QB 2IAMD 1PBYA 3WO4B 3ELAT 1NMAL 4X4ZA 1DBKH 1CDIA 4QTIH 5DEFA 2VDOH 2VLJB 3R1GH 1CGSL 2KDGA 4DUVA 1QOKA 2NY6C 5DUPL 1P4BL 1S7VB 2HVKA 1LO3L 4Z7QF 3IKCA 3MQIA 1MJJA 1T7ZA 3GDBA 1TIUA 4NP4L 2A38A 1X6LA 1PEZA 2EZ0C 3HZYB 2BCKA 2Q1EA 5MEOB 1J7VR 4MJIA 3T0XA 1ZHLA 4LHUD 3PJSB 3LEVH 5F1NA 4OD2A 2NXZC 3WUWG 2CUIA 3G5YB 3QIUA 3C5JA 2P1YA 4G8FB 5JOPE 3D69A 4EI5B 5HVWA 1BFOA 2F8XC 5JDSA 1FE8L 3TVMA 4JRXA 3DHMA 5MI0C 3QJFB 3RWEA 3EO0B 3IXTB 5E6YA 2EXWD 2R1YB 3LEYH 1U8NA 4XVSH 4YDLB 1MCFA 4HPOL 3HPLA 1DN0B 3EYVB 5T3ZD 5DHXB 3T0BA 3SDYL 4O2EB 3GBNH 2YBRA 5FUOH 4PGBB 5DQJA 1G7IB 3RJDA 1L7IL 3WHE0 1M7DA 2XT1B 4WI6A 4CKVX 2DQIH 2MMXA 3MJ9H 5B4MD 3V7AG 1GGIL 1G0DA 1CDJA 5MENE 3PWNB 4K23H 3L3HA 3OX8A 1R5IB 1MRFL 3THMH 4JHBA 1D5MA 1RULL 4EOWL 2BNUA 2LE9A 2DOCA 3MBEC 1KIQA 1G7JB 2C7UA 4JFPA 4TVSa 1J18A 5EZJA 3W9EB 2X4NB 3BGMB 4S1SH 5DHYA 4CVXA 1FLRH 1HHGA 4HHAB 5B8CA 3C08L 1SEBB 1KEMH 3AB0C 2X5PA 5DFWH 5TGBB 1XF1A 2YA0A 1DBBH 3IDYC 1CFBA 5CEZH 5GGVL 4LMQE 2FB4L 3UJIH 4PFEA 3MMEA 5FM5O 3BHBA 4MJ4A 4PJAA 3GI8H 2DLGA 4I4WB 2HT3C 4YHML 1DQDH 5BVPL 2F74A 4QCIB 3QBTB 5GRUL 5HYJE 5ACMA 4NQDE 3FQXA 2Q7YB 1ZA3A 3VGEA 3IU3A 3MV01 5D1ZA 3K4DA 2IAMC 1NCNA 2J6EH 2ZJSL 1I7RA 3OJVC 4M3JA 3ZHKA 4MNQA 3NAAH 4HWEL 1NDMA 4PG9A 5I8KH 4PRHB 3D85B 2O5XL 3VXMD 4RX4A 1F6LL 3DO7B 5I15H 3CMGA 1RZFH 4NNXB 1OGAD 3TN0D 4QHLB 3BH9B 5CS7A 4AH2A 1A7PL 1QA9A 1RU9H 1BFVH 2ESVD 2W60B 5BV7L 1NCCH 4ZPTA 3VWKD 1FN4B 4XZUB 2H8PA 1SM3H 4HIJA 1BF8A 2A83B 3U9PH 3FMGH 5I30L 3WL9A 4AENA 3C87A 1MHHA 3KAAA 2VR5A 5JQ6L 3U4BL 4YX2L 1KJVA 2EXWC 5I71B 2YZ8A 1JTPA 2HG5B 1U8KB 5HYIA 1IC5L 4KHXH 1AH1A 2BNQB 4CVZB 1FL6B 3A6OA 3ARFD 3ARXA 3H3PL 4PJ7B 3T0AA 4OCXL 3CX2A 4UIMA 5C0FB 2VAAA 3TWCL 4XMLH 5F3HA 1DL7L 2F53B 5I2IB 3CFEA 5BRZA 2FGWH 5T33L 1UXSA 3VXNA 3QUMA 3MCKB 1M05A 3OR6B 2JCCE 2ICWB 2DYPA 4L8BB 1F58H 4XPAH 4X6BA 2JJTC 2BOBB 4RNRA 1UACL 4L3CA 2MKLC 3SDAA 3PWVB 5EOCJ 3CNKA 5FCUL 1G0XA 1KIPB 5LGJA 1R3IH 4U0RC 3FTGB 2VLKB 3W0WE 4OQ1A 2XTLA 3VXRB 2ZCLL 1BPVA 4WU5B 4MAYA 2FX8L 1ZTXH 3UTPD 3QYCA 1GIGL 2LABA 2N7BA 4JRYE 4JN2B 3X13A 1I8IB 2BSSB 3CFJA 5I0ZA 4F7EB 2DWEB 3ARWA 3W39A 4U1LB 3NMEA 1D5ZA 2HVJB 2VLJD 3VXSB 1OB1B 3VA6A 4WNQA 5E95B 4OLZH 5DJ2B 1WBYA 3UO1L 4ZOEA 4EIGB 1J1XH 3JV4B 4G7YH 3C60B 3QWRD 5M7QA 5F7HA 5EIQA 4MCYB 3EYFB 5E94A 1T0NA 4GBXA 2B4CC 2PCPB 4HKJB 4K2UL 4MJIE 2AGJH 2RFXB 3O6LH 4PJHF 3GSQB 5ITFB 3MSPA 1C5BH 1HCFX 3TN0C 5E4IA 3TZVA 4EI5D 3ARPA 3OKMA 4PJFA 4PJBB 4ODHH 5AZEH 1HH6A 5TE4H 1OWRM 3MRGA 3QUYB 3U7WH 1CFVH 4I0CC 3HI1B 4F7MB 3VWKC 4ODTH 5KS9A 3MLXL 5HHMB 2A6KB 5B38B 2XQYG 3UP1A 3VGHA 2BXYA 3FZUD 3SCMD 3RNKB 1U95B 2GUOB 2BP3A 3CFCH 3WFDH 4IRJA 5T3ZH 2DTSA 1VEOA 3L1OL 3FT2A 3SQOH 1CE1H 1ZGLA 3PWJA 3LH2L 5CHNA 2DD8L 5E6IA 2D03L 3D1MC 1RJYA 5IB5B 3Q0HA 4K3HA 4MXQD 5F96H 3RTQB 3MRBA 3KNBA 1AGEA 3WSQL 2PXYA 2CLRA 3O3EA 1IT9H 4Z7NF 4KI5D 5D7JA 1QRNB 1Q1JL 2EH8L 4UV7L 1AP2B 3PNWB 4PLKD 5GQBA 4X83A 4Y2DB 4YHKH 5DYOA 4H26B 1F11B 2G75A 1IBGL 3MV9B 2R0KH 4NNPH 4NHCL 4OZHA 4RFEA 1G7HA 1P1ZB 3O3BB 3TBTA 5MP6L 2NLJA 3DSFL 7FABL 4K8RD 5JUEH 1BREA 4I0KA 3CFDA 5EUKA 5DR5H 1U0QA 2AJZA 3GMPB 4PJCA 2FR4B 2P7TB 1PY9A 4UB0H 5EG6C 1Z9LA 3OKNA 1NCBH 3OXRB 4M00A 4PJAE 3TIEB 3U2SB 3IDJB 3MGAA 2FHCA 5E7FA 3FQUB 4GSDL 3KYNB 3OXSB 4U4BA 3O6ML 4I3SL 4OGAC 1DSFL 4MNQE 1TNMA 4XCFL 4PRHD 1P4LB 4DVRH 2P49B 3FT4A 4XP6L 3RPKA 4JPIB 5EC2A 2B4CH 4JN1L 5JZ7D 5A40E 3QHZL 1SVCP 3DSNA 3S4SB 5ICXA 3WHXB 3LKNB 4WI3A 2FX7L 1YEFH 5CMAB 4BZYA 1II4E 2GW5A 4P59H 3BP6A 2A2QT 1LNUB 3NCMA 1NFDE 1TZGH 3QJHA 1YA5A 1S3KL 4YAQA 4P46B 3C8KA 4WFEE 4UTBH 4JDZA 3S3PA 4NQVA 4EI5C 3ULVL 4GAJH 4GXVH 4TUOB 4XNZB 3TYFB 5D7SL 4YK4B 5GS1A 1VPOL 4UI2A 4TSBH 4F80A 4OM1H 4KTYA 4AZ8A 1CVSC 4M48L 2FX9H 4YDLC 2DKSA 2BNQD 1MHEA 4R26L 1JRHI 1NLDH 1NSNL 1S8DA 3KPMB 5IHBA 3VMOA 3NIFE 5AYUL 5F6IB 1LO5B 5F9AC 5JHDE 3M8OH 5D93B 1XR8A 3C9NA 1NBVH 1N0XH 4LLWB 1QSZA 3LDBB 1XF4A 4NT6A 4MXQC 1V7MH 4UU9A 5IK3B 3AREB 4XNUL 4MNHA 2CMRL 1GPOL 1T1YB 3AS0A 3V6FB 4KI5C 2R2HB 1EEUA 4PLKC 5CUSH 1K8IA 4RMTA 1T3FA 3MFFB 2VLKD 3VXRD 1BZQK 3RA7L 1EAJA 4CVWA 4DZ8A 3B6SB 4H0GA 2Q3ZA 4BZ1H 5JPNA 5HGDA 3INUL 3BD3A 5MHSE 4NUJA 1P4IH 4FQ1H 4K8RC 5EUOA 3NIGE 1X5AA 3K46A 2I9TB 4DVBA 1H3GA 3VXSD 2JIXD 3FB7B 4YHLH 2LTQB 5CBAA 1MFCH 3OG4B 2VB5A 3O6KH 4HQQH 4ELMF 3S34H 5C7XH 4UIKH 3W2DH 4Z7WA 5I0DA 4Y5XB 3HLAA 3PWLA 4NWTH 1S9XB 1IGIL 4M7KH 3D2UA 3CK0L 3OJDA 5FCSH 1FO0B 3N1PC 2XZQH 3MNWA 3OR7A 3MRNA 3RWHA 1DBAL 4PY7B 5JZ7C 4MQ7A 3RX7A 1JL8A 1KYOK 3C6SB 4RGNE 3NH7H 4P4KB 1PQZB 5GS2D 4HS6A 3U30B 1IAOA 3QUYD 2V5SA 5DK2B 3S36H 4X99B 3WS6A 1A1NB 2YD9A 5HHMD 1NAMB 5IFHH 3IRPX 5K33A 4FTVA 3FKUS 3U7YL 3VFUB 3R4DA 4EUPG 4UV4L 3RL1B 2OK0L 2N56A 2XY2A 4HIXL 1EVUA 1MF2H 1YEGL 2VR4A 4CW1B 3DUSA 4PB9L 1G9MH 2EICA 2AQ2A 4L4TE 4LSRH 4DKFL 5I71C 2RB8A 3ECBB 4ZUSA 1A3RH 5E03A 1YN7A 4IOIA 1XGTA 3RTQD 2GTZA 4K3JH 1X5IA 4KAQL 3G6DL 1AFVH 4Q2ZB 1J0ZA 1FZMB 5C07D 1OAYH 1QRND 3WJJC 3TCLA 3QAZB 2F9BT 5FK9B 5C9JB 3ZE2F 4ZUVA 1I4FB 4TUJA 2BSRB 2YPVL 2AV7A 1KT2A 3MV9D 4BFIB 4NRXA 5HHPB 1KENH 3ZYZA 1M71A 4DK3A 2O5ZH 4NO5A 2LVEA 1J8HA 4OZHE 2A77H 3V4UH 4YWGL 2A73A 2XA3A 2Z4QB 3V0VA 3QQ4B 1KJ2B 3W9DB 3T09A 3O3DB 4OT1L 2C3HA 4PJCE 3VXQB 2FCBA 4Z78B 1Y18B 5DJXB 2QL1A 1R3KA 4QNPF 4G7VL 5ABDE 3GIZL 4F15B 1MJUL 4NWUL 2GY7B 3GSNA 1NDGB 4R90L 4HLJA 2A9ML 4LAQH 3GJEB 4N0FA 5LXGL 3JTTA 4IMKA 2AQ3A 2C26A 1RQ5A 2XRAH 3EHBD 3UEZA 1UA6H 5JQHC 1XEDA 1BEYL 1HSBB 4LEOA 1T5XA 2OS7A 2R1WA 3RRQA 4NO2B 1W0WB 3HNTH 3E6FB 5GXBB 4ZAKA 3C60C 2Y6SD 2PW2B 2D7PA 4R4FH 15C8L 1AY1L 3IJHB 1SJEB 5IESL 3B9KB 2NTSP 4YHOL 3V6ZB 3HAEA 4H1LH 4U1MA 3FFDA 3EGSA 3LIZH 4NKDA 2Y9RT 1C5DA 4TQEH 2HRPH 4PJ8A 1CFSA 5DDHA 1CR9H 3JWOC 1DLHB 4JEGB 3PWPB 3DMMB 1RZGB 2FD6H 4ACPA 5C0AB 3QUYC 4DKEH 1XZ0B 4JZOB 4JFDA 1UM5H 5C8JB 2V7HA 1EUUA 4Z7UF 3KPRE 3GO1L 1Q8MA 5IT2L 4UT7H 4PJXB 1FHGA 3I6KB 4NQTA 5D7KD 4OLVL 4HJJL 3MBXH 1AO7E 3QZWG 1HHJB 4D0CB 1YEKH 4GW5B 1MI5E 1DJSA 4Z8FH 5FXCH 1LP9A 3CLEL 4FZ8H 2EH7H 3P3YA 4HIIA 5D70H 3OGCB 4U6XB 3BUTA 4RWYL 3G5XB 5FA3B 4DCQB 3WE6B 3RTQC 3ARED 1VADA 3GHEH 1J0YA 2FATH 2FH8A 4MXWL 2HFEA 2XOTA 3BKYL 1TZHA 5E70A 1C16A 1RJLA 4Y2DC 5GS0L 1NJ9B 4O2CB 1KPVB 3BW9A 1DE4B 5ELIA 1WC7B 2FSEB 5T5FH 4Y4HA 4ALAH 4QRRB 1FNLA 2JB5L 5EFIB 2VDMH 3EDKA 5I1CH 2GITB 2W9DH 3IU4H 1FGNH 1LEIB 2Z91A 3FQWB 4P9MH 5A2LH 3D25B 4YFDB 3VFVB 2Y36H 3H9HB 1QSVA 3LV3B 4J3WA 1M7IB 5EUOE 1BWMA 3QDMB 1VDGA 4GQ9H 1HE7A 3TA3A 4JFEA 3OAUL 2DQUL 4ODSL 2QQKH 3DRQB 2WWMD 2UWEA 1U8HA 2YRLA 4U1HB 4XVJH 5DD6B 3WO3B 3AMKA 1ULVA 3RIFF 1X4XA 4Z7WE 1EEQA 3GHBH 5F7FA 5EOTB 1W2KT 4OTXL 1QSEB 1VKXA 3EHBC 2FH6A 3R0NA 1T4KA 1U8MA 1IM3B 2XWJA 1NUFA 1GGCL 1MCPL 1B0GB 1EXUB 1JFQH 4OLWL 1I9EA 2PO6A 1GGBL 4P4KD 3WNNA 1EO7A 3JWOH 4NZRL 2VDPH 1J1OL 4TULL 1K6QH 1LE9A 2HH0H 1FFOA 4WO4A 4K94H 1MREH 5KVEL 2SEBA 3S88H 1KCRH 4P46C 2D7TH 2G60L 1I1YB 4FTVE 4XI5D 3P4OB 1JNNH 1GRWA 4XNZC 3IFLH 4JG1H 4H25A 3PF2A 4Z76B 3LKQA 4HV8B 3EYOA 1D7FA 3G9AB 3PQYB 4IRZL 4PBXA 5AYQA 4NKIL 1VEPA 5KJRL 4QGYA 5I8OL 2RJMA 3STLB 1A5FH 1CE6A 1G6RB 4H8WH 3BXNA 4HWBH 5C0GA 4GRLB 3T77B 2R0LL 3VFWB 4JFQB 5ENWA 1T21A 3UTQA 5F6IC 2D2OA 3CLFH 4KRLB 5D93C 5BVJB 1R3JA 4ZFGL 1RIUH 2Q8BH 3HAEG 4AEEA 3MC0A 3BX7C 3LDBC 4MJ6A 1UJ3B 2EDKA 3MCG1 3TFKD 3AREC 4K7PH 3BSZH 4Y8AA 4Y4FB 3D9AL 4NHUA 2NTFB 1J8HE 1QLEH 5FHBH 1QR1A 1TFHA 3TPUA 5SWZA 2VZ3A 4K9EH 1QYGL 3W11C 4KI5F 2R0WL 2HT2D 5AD0A 1FDLL 5FKPB 3U4EB 3HMXA 4EBQH 2JELL 4HWNA 4MAUH 2QSCL 3TV3H 4UDTB 5KG9B 1QRKA 4CL7A 3GM0A 4PGZA 4OV5B 2LTQC 3O4LA 4DGIH 4KK8D 1A14H 3EO9H 3U0WL 4OV6F 2WWMC 2W59A 1HYSD 2VDOL 4BFGA 1P84K 1QKZH 1IC7H 3PDOB 4RMSA 1RUMH 2EKJA 2ZSWB 5FHAH 1EVTC 5D2NA 4Y5XC 3EOBB 3F7YB 1TTUA 3B9KD 4MD4A 1MWAB 4XCEB 3MLVL 3PXJA 2DICA 1CT8A 3DX9B 2OZ4H 5DS8B 2PYFA 2AJSH 3I3EA 4JZJA 3N50A 1P7KA 1YY9D 2QR0B 3MJ7B 4OCLC 1QLRA 4WW1A 3PWPD 4PJIA 3DMMD 2A6IB 2E5EA 2KPNA 4P4KC 3T3PF 5C0AD 2P24A 4QYOB 1XFPA 1K2DB 4OF5A 5IKCA 1U8OA 3U30C 4P5KB 3HZKB 1MUJA 3GMQB 4JFDE 1BF2A 4AK1A 3V95A 3P73A 2E9WA 3LPGA 4KROB 3U36B 5TFSH 3LEYL 5IR1B 2OLDA 3FCTA 1PEWA 4XVSL 5CIPB 2V2TB 4FQ2L 1E27B 2V9RA 3U4AA 1VSCA 2W0FB 3HZMA 1CTNA 5F88B 1W72L 1LP9E 3T0EB 5E99L 1IGCH 2MQ0A 1UQSB 5IMKA 1R3HA 1ZS8B 1SVZA 3MJ9L 4MLIA 1F2XK 5C08A 2CGRL 3UAJD 4JFZH 2A1WL 4PJ7F 3QAZC 1TCRB 4QHNA 1D5IL 3GMRB 4NN6B 3MV8B 3QG6A 4XPFH 3SGEH 1OY3B 3TFKC 1HWGB 2FJHB 5IMLA 1EFQA 4QRRD 4S1SL 1FLRL 1UADC 1J87A 3HUJE 1MVUB 2HJKB 4YXHH 1IM9B 4MA1B 2NY7H 1BJ8A 5C0BA 4XH2A 3AROA 2MHAA 4X5WA 3X12A 1S7UB 1I8KA 3QDMD 1BQUA 4JFEE 5CEZL 4ZD3H 1BAFH 1AGDA 4B7LA 2HT2C 1JV5B 4RQQB 4NKMB 4EI6A 2UWEE 3BGFB 3RVTC 2X4OA 3RAJH 1P7QA 3GI8L 3O2DH 5L8JB 3B5HA 3U0TB 3ILQD 3ZTJH 1KPUB 3GRWA 4V1DD 1ZT4B 3O2VH 3DUUB 1YUHB 2J6EL 1CICB 3FJTA 5HI5C 1F3JA 4KK8C 1K5NA 1RZ8A 3L5HA 3NAAL 4XHQA 1HYSC 2QKIA 3JTSB 1D6EA 3L5WB 1AI1L 2V9QA 2X2YA 2FO1A 3P30L 3MTRA 1BJMA 4M62L 3UJJH 1CFQA 1HIMH 3HC4H 2Y5EA 5I15L 2Z92B 3LCYA 3B9KC 3BJ91 3KR3L 3PP3K 7CGTA 1JN6B 1VFAA 3O3UN 1A6ZA 1NGPH 4Z5RB 5F70A 4X6FA 3U48A 1LDSA 4M7LL 4NC1E 5IEKB 5BQ7A 4MSWA 3ULVE 4KJWD 1YY9C 3FFCA 4Y7MA 1XF5B 4OM0L 5F3BB 2CK0L 1XCTA 2X09A 1CF8H 3DMMC 5DA0B 2AXGB 3BZEA 1SJHB 3SO3B 4U49A 4YR6A 4ZOBA 3PQYD 1GZPB 2FIKA 4PJBF 3U6RB 3IFOB 5DGRA 3F5WA 3KPNA 1SYVA 4MJ5B 4U1IB 4X7CC 4PB0L 1T66D 4GRLD 1DQQA 5ESAA 5DJ6B 2K7QA 1LEGB 4BSVB 1YMHA 4FG6D 1ZLWK 4PG2C 4XMLL 1CGUA 2BSED 2VITA 2VXTH 1S9VA 4HXBL 1V05A 1SQ2N 3OHXB 1HZHH 4R8WH 4LCYB 4OD3L 3IT8D 3OB8A 4XCNA 4Y4FD 3I6GB 4PGCB 1N6QL 5TPWH 4O51A 2V5TA 2EDJA 3QHTC 1GXEA 1L9MA 1WT5C 1X5ZA 3UAJC 3IETA 5HHNB 4Q6YA 1HHKA 1DBJH 3WCYA 3S6CA 2R56L 2ZCKH 3OTTA 2DI9A 1BQSA 4U6TA 1R3IL 4WHYH 1A3LL 1C12B 1KFAH 3CU1A 5FIEA 1KJ2H 4Y16B 3GUTA 3O9WA 5J1TC 3T65B 2VL5B 2YD8A 3CZFB 1MH5A 3CSYA 4APQB 2BY2A 3HC3L 2AXFA 2A74A 2R4RH 3GSRB 1AR2A 4AEHH 2EO1A 4X9BA 1BLNB 1TETH 4IDLA 4HT1H 2WMPA 2ZKHL 4HKXA 3VI3F 1E4XI 1QNZH 2BVPA 4HWZB 1I8LA 5FYKL 3O4LE 1JNLH 3UTTB 4WFGD 5HVGB 2EYTA 4NDMA 1JGEB 4ZUUB 3ZE1E 3ILQC 1Z0NA 5FYLD 2ADIB 1T89C 1A47A 3QEGH 1WSST 5GRVL 3FB8A 3H9SE 3CX5K 4FXLA 2FGZA 2OCFD 4LPUA 4O58H 5INDB 4EVNA 3WFHB 2HAZA 4LDEB 2ARJB 3WFEH 4MA3A 4LCUB 2ADFH 1EHLL 3O6LL 4PJIE 1J5OL 1Q0YH 3PWUA 4CMMA 2ED7A 4BFBD 1ES0A 1N2RB 3N85L 3K8LA 4MQXC 3U7WL 4KJWC 1CFVL 5EO0B 4KROD 4ODTL 1MLBA 5EOCH 5T3XD 3KXFA 1J11A 1UVQB 2AJ3B 1VFOA 4LF3A 5GRZA 2RHEA 1MQKH 1AD9A 2J8UB 3K1DA 4X6CF 3WLBA 5C0EB 3CFCL 3T0ED 3BEVB 4I0PB 3OKOA 4QRUB 3LD8B 2O61A 1CE1L 2XPGA 3B3IA 3LMJH 1G1YA 1RJCA 3BO8A 2OR9L 3L5XL 3WXVH 3CGTA 5I17A 4X8JA 1T66C 4GRLC 1FL3B 2XFXA 3CDYA 5F96L 3DWTA 4DEPB 3WNPA 5CP3A 5C08E 5EBLB 5TF1L 5ID0B 1HK6A 4FG6C 1QSFE 1G9NL 4QXGH 4I3RH 1IT9L 1IAKB 2YA1A 2DAVA 4X0KB 1NCAH 2Z8WC 4K3EH 3MV8D 3ES6B 4WUKH 4P3CH 32C2B 1UEYA 2P45B 4RAVA 1WZ1H 1Q94A 4AQOA 4G8EA 1JWUA 3NTCH 4Y4FC 2GT9B 2IQAB 2CO7B 1T22A 3RZCB 1MAML 5EU5B 2E6JA 1MJ8L 4C4KO 2YMXH 1IM9D 4RFOH 4BQ9A 4ERSH 2ENSA 1ODAA 1KYOJ 3LAFA 3ORJA 1F2QA 3STZA 3BN9D 2R15A 4LFHD 1N4XH 4D9QE 1DQLL 3AXLB 3OPZH 1E6JL 5DHVB 1DZBA 5DRXA 3RWDA 3DGGA 5F7UA 2ED9A 4G6MH 3TESA 3H9YA 3MODH 3HNSH 3IS0X 5T1DH 1J0HA 1MNUH 3T0DA 4PJHA 1IC4L 5LKNA 1NFIA 2GSIA 5HJ3A 4HF5H 3KPSB 4G8IB 4MA8H 1DEEB 4U6VH 1MFNA 3VCLA 5AEAA 5EH1A 3BZFB 5DQDH 2KH2B 1P9MC 3EOTH 1FG2A 4X9IA 1A7OH 3QFDA 3ROLA 1MIML 2YRZA 5FEBA 4I18C 1OCWH 4LARL 1QVOA 1HNGA 4U1NB 4CDHA 1NQBA 1WEJH 3RGHA 2P5ED 1JUFA 2AP2A 1AHWA 2V17L 2EE6A 3FFCE 3RHWF 4MNGE 3VFGH 1I7ZA 1UWXH 1TZGL 5H2BA 2E7MA 3V5KA 2LV4A 4N0RA 1V3MA 4XRCA 2P44B 1XT5A 3CXDH 3T4AB 3GMNB 4GAJL 4GXVL 1I85C 1KEGL 3SE9L 5IQ7L 4S1RH 4TSBL 1E4WH 3VXUE 2DKMA 4KROC 4KKNA 3MOAH 3VE0B 4PV8A 4GAYB 3D39D 3DX6B 4DGYH 2ZUUA 3DX8A 4GKSA 4U3CA 1G6RH 1NLDL 3I9GH 5FUZL 1EK3A 4NKQB 3MNZA 3T0EC 5I1LB 4J6RH 5JORA 2PR4L 3LQAC 3SKMA 2Z8RA 3MJ9A 1NBVL 3HMWL 2NYYD 2X89A 4P2OD 4C4KT 4AM0A 2PW1A 1ED3B 1HYRC 4N90D 5D71H 4DAGL 3QEQB 4AG4L 2DM4A 5LVEA 4W70A 5EORL 5IVOA 1UZ8A 4X5XB 3UCRA 5HYFA 4LOUD 5E8OA 1FLTX 2DBLH 5CBEB 3MRRA 4JVPA 4N8VB 4KZEH 3JV6B 1S7RA 2X40A 3O4OB 2Z35A 1JZ2A 4NN6C 1Q9KB 2W92A 4L9LB 1G7MB 2CSPA 4PJ5A 5FDWB 2F8OA 2XZCL 3LY6A 1UGNA 3AAZB 4XNQB 5DMKA 1HEZA 3B2VL 1JTOA 1I9RH 4LSPH 5DJZA 5EIIA 2GSGA 4MA1C 2F19H 4APQD 3ULSA 5C86A 3NBNA 4WFHD 3ZL4H 5GRXG 2I5YH 1P4IL 3BN9C 4ZYKA 2W0LA 1MEXH 4GG8B 4JO3H 4XPHH 5D1QB 3UTTD 3VD9A 5B39A 4W6XB 3BGFC 3RBGA 1IGYA 2BSTB 1YJDC 4HAGA 3NFSL 1MFCL 2DM7A 4NYLB 5DI8A 2J6EA 3O6KL 3LVEA 1NKRA 4HQQL 5BS0D 2WINA 4WW2A 5SX4H 5HGBB 1J05B 2LAGB 3W2DL 5C7XL 1EFXB 3ZT6A 5FYLH 4MGXA 1CICC 1QZ1A 1VACB 2B5IB 4J8RA 2XZQL 3DLQR 4FQQB 5JXAH 4JZNA 2IH1A 3H6JA 3C2SA 4OFDA 2BY3A 4PRBA 5L2KD 3MNVB 3FHAA 1DUZA 3QQ3B 1BVLB 3GMOA 5IB4B 4X9GA 5CILH 3WIHH 1QO3B 4LQ1A 4JQVC 3VRJA 1B0WA 5L0QB 3F6IA 4PRPB 2X42A 2LU3A 1HSAA 3KXFE 1S7WB 5HPMB 5IFHL 2COQA 4PLNC 4Z95H 2NY5H 5D7LA 4K7FA 5T3XH 35C8H 3SO3C 4TVPD 1V3LA 2E9JA 4I0PD 3S35L 4X4YA 1MF2L 4NN5B 5HHVH 1G9ML 2GJZA 5I1AA 1N8ZA 1XGYH 2VLRA 2R23B 4OZGF 5ETUB 2NX5B 4JCLA 5DGQA 3SE3C 3KPTA 2E8ZA 4MWFB 1A3RL 3QIBB 1CD9B 5IB2A 5E6ZA 2VDRH 4XBPA 4JVWA 1AFVL 4M7LT 2H45A 3PHQA 1MCRA 2QJDA 5F1SA 1BZ7B 1XF2A 1JVKA 3MBEA 2NYYC 3ZYIA 2W65A 2CLVB 4P2OC 3HB3D 5J3HD 3ZTNL 3VRIB 2BNRA 1EO5A 1FVEA 3RWIB 1MY5A 3RZCD 1HH9A 2UZYB 3RNQB 2GFBA 1KENL 4S1QH 1ZVYA 2O5ZL 2QADB 1B4RA 3F7VB 4EUPB 1DP0A 5ANMB 4HX1A 2A77L 3VGAB 5I74B 4UNTA 3MLWH 3CDGA 2APWA 2MWCA 4ELMA 4Y16C 1A0QH 5FYJE 2E6QA 3OMZA 4APQC 3KS0J 4ETQB 5DVKA 3FB6B 4KVCH 1YJDH 25C8L 2FZ3B 2IAMA 3UBXA 1QEWB 4YBQD 1MCHA 3MRHA 3VFMA 4F7CA 1S7TB 4PJHE 2VLLA 1G7LA 1UCTA 4O02L 2X4RA 2XRAL 1A7RL 1PZ5B 4ZXBD 1HXMB 4G43B 2XZAH 3N1GC 3IDIA 4XCCH 3EOAA 5C0IA 4IM8A 5IHLB 2H32H 4YDJB 2ADGA 3OJMB 4R4FL 5KSVA 1D3CA 3D3VA 1T7VA 4N0YL 4OZFB 3Q2CA 1FZJA 1IGJB 1A22B 4HH9A 4CADA 1QTYT 1J0IA 4JM4L 3RWGA 4TQEL 1GH7A 4Q9RL 2HRPL 4LHUA 5GSRA 3BYYA 1A1OA 4OCSL 4W81A 4LLYA 4AY0A 4WI5A 4ODUB 4QTHA 3LSOA 4EXKA 1Z6JT 3OAZK 1CDYA 1R5WB 4PIRF 3VGBA 2FJFB 1QBAA 3QNZB 2AK4B 4DKEL 2YUZA 5E5MA 4ZUTB 5J9PA 1KCUL 5B39G 3JUZA 4YQXH 2VIRB 1BBJA 5ALBH 4Z7NE 1NCDL 4UT7L 3FO2A 4BJLA 1YPZB 3EAKA 2BOCB 1KG0B 5L8KB 4I0PC 5B3JE 5E8NB 5DJYB 5DJCB 4G42A 3LD8C 1RY7B 1YDPA 4FZ8L 1Z2KA 4NNYA 3V5DA 3VMPA 2WW8A 5D70L 5GIRB 5BMFH 4HG4K 43C9B 2AJYH 4L29A 5EU3B 4DEPC 5I8CA 4TNWK 3QXTA 3ZKSD 1P84J 4JFHE 5E1AB 4DW2H 4UT6L 1YQVL 4PRIB 4G80B 5DJDA 3QXVA 3P2TA 4XXDA 1FNEA 3G6AA 3HB3C 4PJ5E 5J3HC 3MOBH 3BDXA 5IVXE 1VGKA 1FVCA 3CCHB 5D96B 5KVMC 4UBDD 3RZCC 4CMHB 3L3JB 2VDML 4TTDD 5CEZE 1MRCL 5K93A 2R0ZH 3WXWH 3VDBA 3QO0A 4P9ML 1RZ7L 5EU6E 1JGLH 2Y36L 5I1HH 1U58B 1YNTB 3Q6FA 3ZKXB 2VDKL 3UZQA 1BIIB 3P4MA 5D1QD 4GQ9L 4OF3A 2Y4SA 1WFOA 5EZOH 4XB7A 1D6VH 1EO8H 3BRDA 4UT9H 1T7WA 5ACZA 3QNXB 1JP5A 1PYWB 3F8UB 1EFXD 1ZT1A 2UUDH 4C59B 3GHBL 4YBQC 4M1GL 1K4DB 1FFNB 4JG0H 2PTTB 3PIQB 2OJEB 1Z9OA 2C1OB 5AWNH 2OL3B 4F8QA 3L7FA 3VXMA 4ZS6D 2VLME 4OIAA 5D72H 4P9HH 5SWQA 1OGAA 1I9JL 3MRJB 3TN0A 2BX5A 3RDTB 5DUBB 5DXWA 4Z7UA 2M8XA 1UT9A 2ESVA 2W9EH 4HUXA 3H9ZA 2CKBL 2HH0L 5D5ME 3VWKA 2UVEA 3BQUD 3IGAB 1UKTA 4PRPD 4Y19A 4K94L 1MREL 1HNFA 2DLEA 3ESVF 4IJ3B 4L4VB 1IGMH 1U8QA 3GIVB 4BKLB 4XWOD 2ZOKB 2L7UA 1MHCA 1OSZB 5D7LE 1U91B 4RWHA 1AQDB 1JNNL 4HJGA 1EX0A 4OIBA 5HVHB 4LLUA 5FOBA 5DZOA 1YNLL 1GHFL 1HQRA 4FNLH 4XWGH 5FA4B 4TVPH 4LNRA 1I1CA 4RRPA 5DMJB 4NPYB 2IPKB 5J6HA 5K9KB 1FSKB 4G8GB 4Z7OF 2NX5D 3SKOA 4PGJA 4LPVA 4F58L 3ARFA 4H8WL 4HWBL 5BW7C 4LSSH 4GW4B 1R3LA 4X9FA 3PABB 1I8MA 2NPLX 4PJGB 1T1ZB 1RIUL 2Q8BL 1UB6B 3GNMH 1MCLA 3QUKA 2BNRE 5CLWA 2WBJB 3O11A 3FN0L 1CIUA 1U9KA 2WUBH 4P5TB 1ND0A 2QADD 3O4OC 5I1KL 4L9LC 1CG9A 5KSBF 2NNAB 4K9EL 3WIFB 4OFVA 3U9UB 2FJGB 1AQKH 2Q3AA 4ELME 4ZFOL 4G9DA 5CD3A 4UBDC 5INCA 3MACH 3TC9A 4R9HA 4TTDC 5AAWA 1IGFH 4QXUH 4WHTA 1YYML 4EBQL 5FYKE 5F89A 4MAUL 2X9WA 2H26B 3U0PB 1H0DA 3UROR 4QXTA 5D1QC 3BKML 1OARH 2VLJA 4M6NH 2Z31D 4TSAH 4WV1A 5A43C 1XGUB 1KGCE 1FBIH 3EO9L 4NKOA 3IF1B 1IC7L 3NOIA 3QWRA 4X7EC 1PY4A 2CDEB 1AC6A 3OKDA 4YFLF 4BH7A 3D3VE 5J8OA 4O2FB 3GJFB 2M26A 2B5IC 1FNAA 2GK0B 3G6JB 4LKCB 5BOZG 2XI9A 2UVFA 4XVUD 1QFUH 1MJ7H 2OXHA 4YDVB 4ZS6C 3MLPA 4YPGB 3NFNB 1XAUA 1WIPA 3SKUD 3G5YA 4G8FA 4EI5A 3IDNA 2HKFH 2YPKB 3TT3H 4IIQA 3GSXB 2Z93B 1INDL 3AU1B 5L2JA 1FP5A 1W0VA 2H9GA 3QJFA 4OIIH 3T3ME 3EO0A 5LQBH 3QNYB 5DD1L 12E8H 2R1YA 3BQUC 5L0QC 2ZSVB 3SBWC 4XWOC 2VQTA 5GSVA 8FABA 3QUMH 2GQHA 3SCMA 4ZS7H 2PTVA 4TYUA 4O2EA 4LSTL 4FFZH 3ZE2E 3UTSA 5I1EH 4PGBA 4HW6A 1G7IA 4NN5C 2C4XA 1G0YR 2ITDB 1N6UA 1YEIH 2F58L 1KXTB 4YHNB 3KLAB 4Y5YC 4PS4H 1Q72L 3O3AB 4XAKE 1N5AB 3O45A 4N5UA 5HHQB 1Z5LA 1UWGH 1R5IA 1BOGB 1TJHH 4WCYH 5D7IB 4PRID 1K3ZA 2VSCA 1QLFA 2F54B 4PR5B 1RJZA 2C3GA 2NY0B 1G7JA 5E2VH 3CX5J 2AEPH 4QF1B 3W9EA 2X4NA 1RUKL 3BGMA 4QNPE 2GJ6E 2IPUK 4JHAH 4P2CG 4P4RB 4JKLA 5DTFB 3PL6B 1SEBA 4UUJB 5DK0B 5CKAA 2QADC 3UTZB 3O8XB 43CAB 4AL8L 2NY7L 1JGUH 3VGAC 1A7NH 5I74C 5FUCC 3OKKB 1FORH 4FA8A 4F37F 3NGBB 1CXKA 2X4TB 1Q9LB 4I4WA 3ABZA 2ZNWA 3BPNB 4U1SA 4NO0B 4JFFB 3HI5H 4ISVB 4DN3H 5FO9B 3O2DL 3NFPA 2J5LB 4U3XA 1INQB 5GGTH 4FZEL 4G3YH 4PJDB 1K9TA 4LLQB 3PG2A 2B2XL 3DVNB 2PYEB 1EPFA 2X7LB 4PRHA 3VXME 3VFTB 3G9VA 3DO7A 4C57C 4L5FH 4JY6B 4NNXA 4HKZB 4H1LA 3UJJL 2C1PB 5IHUL 4QHLA 5C0DA 5ADOL 1QR4A 1N5YH 4Z7UE 1OTTD 3CMOL 5DFTA 2ESVE 1MELA 1NGPL 2W60A 2EXYD 4XVUC 1FN4A 4XZUA 1NLBH 1DQJA 4LCWB 3A67H 4KPHH 4Y19E 1ZOXA 4F9LC 4L4VD 1KTLB 2A83A 1EEZB 1LHZA 5F71A 3UDWA 1CF8L 5A2KH 1URLA 4XP9L 2DWDB 5F72S 2J88H 4OGZA 1J88A 1WV7T 4AEIH 2G2RB 3MLRH 1NC4B 2RCSL 3SHSA 4EDWH 3JWDL 4G8GD 4GAFB 4X4XA 2HG5A 1GC1C 1U8KA 3UZVB 5BZDB 2BNQA 2EKSB 1FL6A 1QPXA 2KBGA 4PJ7A 3WFBH 4CVZA 1B6DA 2UY6A 1HQ4B 1IVLA 3B9DA 5C0FA 4E42B 1ZWIA 4BZ2H 5ESQA 3WJJA 1PG7X 4JB9H 4ZPVB 5I2IA 3AS1A 5DK3A 1OAXH 2DQFB 3BPLB 2XZZA 2VXTL 5DVOA 1MFBH 3OR6A 5TDNB 3TBVB 4L8BA 1HZHL 4L8SB 1H5BB 1Y0LB 2X1WL 4HMDA 4P5TD 2UY7A 5TPWL 3B83A 5DD0H 5JLZB 4D9RD 2IBZX 5GGVY 3FTGA 4V2CB 4EUPH 2VLKA 1I7UB 1FVDB 3IJSB 4HK0B 3VXRA 4BK4A 5D96C 4P2RE 2WLYA 4WU5A 3CC5A 1AC0A 4JY5H 4TOYH 3VXOB 4CMHC 4CU6A 5MEQB 5T1LA 4FQCH 3UTPE 4KK6D 5IIEB 3KLSA 1KXQE 1OP9A 2BSSA 4G6KL 4F7EA 2Z0BA 3QQ9D 1RMFH 1CN4A 2DWEA 2QTEA 3ZKXC 4BM7A 2XKSA 3BKJL 1TETL 4ZTPL 1OGTA 4FQJH 1V7NH 1OB1A 2JIXA 1QNZL 3MUZ1 1FPTH 2R69L 2E3VA 4KK9D 2BRRL 4F57L 2I60L 3DIFB 5BXFA 5EN2A 3JV4A 1LGVA 3B2UD 2XKNB 5DD5H 4MCYA 4A6YL 4Q0XL 5I1JH 2XN9B 1YEDA 3QWOB 3TGXA 4HKJA 4MQSB 2ZNXA 2RFXA 1CDGA 4JFYA 3H7LA 3GSQA 5ITFA 2BFVH 1A6TA 1C7TA 5GGRY 1IAIL 2YOCA 1OAZH 2AEIT 1Q0YL 4PJBA 5F8QC 1OTTC 1CDBA 1S9YA 5ACLA 3QUYA 3BDBA 5EBWB 3QO1B 1VFMA 2HRLA 4F7MA 2GAZB 1KBGH 4EN3B 1D5BB 4IJ3C 3DV4B 4LEXL 3UTOA 2A6KA 1OAQH 5IEHA 3O2WL 1V8HA 5EO1A 1AXSA 1V5JA 3HR5A 4Y1AA 5EOCL 4QRQB 4J2XA 1U95A 4MZ2A 2GUOA 1GC1H 5T1MA 5HVHC 4H5SB 3EJJX 3UTSE 3V6OC 4GFTB 3ET9F 3FRPA 2OQJB 2AK1H 4LIQH 1FSKC 4HWBA 4IEFB 4I2XB 1NFKA 5D4QA 3LMJL 3RTQA 4LGRB 1MVFA 3IRZA 2FDBP 3LKRB 5F6HJ 4OGXH 3S98A 1P2CB 3PGCB 4CGTA 4NGHH 5C07A 4BSWB 2F54D 1QRNA 1RI8A 3DROB 3KPOB 1MLCA 2ADJA 4QXGL 4I3RL 4MX7A 4H26A 2WBJC 4OCNC 5CGMA 5ICYB 3ALWA 3MV9A 3MUHL 1WZ1L 3PL6D 3EYSH 1RZKL 3NZHH 4P5TC 4QHUB 3TF7C 3O8XD 2E27L 3O3BA 4ERSL 5HYJB 5LAXB 2VQUA 2P5WE 3BI9X 1I3GL 3GMPA 1N4XL 2P7TA 3S5LB 5JA8B 3OPZL 3QCUL 3UJTL 4ZNCD 3CVIL 3TIEA 3LN4A 1GJIA 4XNXH 1ZT7B 4G6ML 2EIBA 4KK6C 2QSVA 3MRFB 3P9WB 3KYNA 4Q74A 3OXSA 4FFYH 3HNSL 3KPQA 2VXUH 3HRPA 5T1DL 4YZFF 3HS0A 2I25N 2IADB 1LVEA 2PYED 4PRHE 4FXGB 4KK9C 4LKXB 5D1XA 3T4YB 4NBYB 4X7TB 2Y1VA 4HF5L 2ZUWA 3S4SA 4MA8L 2OZ4A 3WHXA 1U36A 2EDXA 4OBRA 1X44A 4M5ZL 5DQDL 3QRGH 4NFCA 3EOTL 2AJVL 3GB7B 1TJGH 4OCRH 1OCWL 2VDNL 3MLUH 3Q3GB 1ZSDB 4MS8D 1J0JA 2BHYA 5JDJA 4U1KB 5CCKL 4OCMC 4L8CA 1EUTA 4X6CA 4ODBD 2A6JB 4R3SB 5KN5B 3BKCH 4XCYB 4HPYH 2ZPKH 1CL7L 3KYOB 3MLSH 3Q48A 4I9WD 4LVNB 5E08L 2ICWI 1NC4D 3HFML 2W9LA 1CXLA 6FABH 2H41A 1EAPB 4XC3H 4OJFH 3D87B 2BVOB 4XB8A 5LCVH 2JCCB 3HE6B 3KPMA 5ICZB 4IOFD 3S9DB 5HY9B 4XPBL 1LO5A 3CPLB 1F3DJ 2YSSA 3I9GL 3PE9A 5JOFA 2HFGL 1G6VK 2WM0A 1F02I 1OPGH 4XMKL 4EDXB 4Q97A 3QUXD 5K9QG 3QB7C 4KQ3H 1EH9A 3LKSB 5GGSA 3KLHC 2YKLH 1ZA6A 5D71L 4UILH 2BJMH 3V6FA 3EDJA 4KHTH 2DBLL 1NUGA 1U2HA 2R2HA 4JRYB 3QDGB 1FFPB 2Y7QB 3DI3B 4XAWH 4PD4K 2VLKE 3VWJB 1IMHC 4MMZC 3VXRE 2CIIA 5IW1A 4BQCA 5DEFB 3B6SA 3PL6C 2EDTA 5B38G 1NCUA 5F9DC 4W6WB 1PDKA 3O8XC 4UQ3B 4TNVK 2F19L 5K9QI 2EDFA 4MQTB 4YBLB 1Q0XH 2YC1B 4NQUA 2I9TA 5LBSH 2I5YL 3FRPG 3IKCB 3NGBC 1QACA 2D4DA 4RBPK 3O2DA 5JW3L 3FB7A 4KUZH 1A7BA 3BPNC 5J12B 3D18B 2YUXA 2DL2A 1ZHLB 2J5LC 5K9JH 4Y5XA 1WCBB 3GGWB 1TVHB 5MERB 3C5JB 3BP7B 2XN9D 3D69B 2VXQH 4LCIH 1BFOB 5JDSB 1I3UA 1CD1A 2CDFA 4LLDB 3ROOB 1MY7A 4AJ0A 1XCQB 1TMCB 1N26A 4O5LH 1K8DB 4JKPL 4HG4J 5JXAL 1U8NB 3RY5A 3S97C 1UCBL 2B1AH 3F12A 3E3QC 3VGFA 3HPLB 4PPTA 5D8JL 5C6TL 1C1EH 4P4KA 5GJSH 1PQZA 4PJBE 3GSVA 4OZIF 5KZCB 4JO1H 2YBRB 2I27N 3HRZB 3TEUA 1UYWH 4M4RA 4X99A 5E9DB 4GS7B 5CILL 4MS8C 1A1NA 4EN3D 5HHME 3QG7H 1M7DB 1MFAH 2BRQA 4Y1AE 5IMMB 2M2DA 1I75A 1BVZA 3OX8B 4F9PA 2VZ1A 1PSKL 2NY5L 3BGAA 35C8L 4C54A 1NKOA 1D5MB 4O4YH 1F3RB 2QSQA 3FO9A 3HI6H 1DFBH 2BNUB 3ECBA 3WKMH 2P46B 3MZGB 3TO4D 4YEFA 2C7UB 4HFUH 4QRPA 5IJKC 2VH5L 5DHYB 4CVXB 1KJMA 4Q2ZA 4Z7VE 5DJ8A 3O0RH 4NZUH 4PLJD 3TNMB 5B8CB 1UKQA 2VDRL 2QHLA 1CLYH 3PGDB 2AI0H 5C07E 1X5HA 1QRNE 3I85A 5KSUA 5FK9A 1YPZF 1IC1A 4JO2L 3DVIA 3QUXC 2QV2A 1D5XB 2BSRA 1DDHB 5HD8D 3MV9E 4L8SC 2CRZA 1H5BC 3MMEB 3ZHDA 3BHBB 4BFIA 3VI3E 5HYJD 4S1QL 3RWCB 2Z4QA 1U6AL 1IRAY 1ZA3B 1ZANH 3MRCB 3PP4L 5IVNA 4LNVA 1KJ2A 2ATPB 5DD3L 5HHXH 3O3DA 1YEEH 2H6PB 4WY7H 3VXQA 4MNQB 4Z78A 3ETBF 1NDMB 4D94A 1LO2H 4PG9B 5DJXA 5TH2B 4RGOH 2FL5B 3BIBX 4PYGA 2AJXH 1CU4H 5L6YL 2CPCA 1RZIA 1CYGA 5D6CA 3QCTL 4AH2B 1N3NB 1LO0H 3GKWL 1QA9B 1HSBA 4R0LA 2AV1A 1SY6L 3SJVB 5DMGD 4NO2A 1W0WA 3E6FA 4AT6B 1NFDB 4G9FB 3S3JA 2OTUA 4KUCD 1YN6B 1KCVL 3F7RA 1UH3A 5KW9H 4NM4H 4WI2A 1SJEA 3B9KA 5DRZB 1X5GA 1RZJC 3N06B 3WL9B 1JTTA 2Q86A 3HZVB 3TPKA 3UX9B 4OKVA 4FQHA 4GRWH 2YD5A 4XP1H 4X6CE 1A9BA 1DLHA 2YXMA 3PWPA 3DMMA 1RZGA 4I5BB 5C0AA 3A6BL 5JPMB 1S5HB 1LO4L 2H1PL 5CWSB 2VAAB 2J8HA 3B8SA 1FIGL 1XZ0A 4JZOA 5F3HB 4OZGA 5JHDB 3RGVB 4EN3C 2ICCA 3VXNB 3L95B 5F1IB 5F93C 3ZTJG 2DMBA 5KBNC 5ALBL 5D7KE 4ZSOB 1HHJA 4X6BB 4D0CA 2MFNA 4RNRB 3X3GH 5I19H 3SDAB 2IH3B 2DIBA 4QRTB 4FQLH 5LGJB 1G7QA 5HGHB 3ZT7A 4DN4H 2BY1A 3OGCA 5GISH 4U6XA 3KS0H 4DCQA 5J11B 3WE6A 1TITA 3V8OA 3L9RB 4MMXC 3IYLW 5BMFL 4RGMB 4NSKB 1A7QL 3RVXC 1WT5A 2WQRA 5LG1A 3QDGD 5HSFA 3X13B 3I50H 2JF1A 1TJIH 1XGQB 2MCPH 3CFJB 2C4FT 1NJ9A 4O2CA 4OLXH 1KPVA 3VWJD 4XP5L 2FSEA 4CAGA 3ULUL 2I26N 4PJGF 5HD8C 3MOBL 5IM7A 4QRRA 1KPRB 5EFIA 4WNQB 5KVFL 2GITA 5ILTL 2YEZB 2OX5A 3VXTA 3FQWA 1S9WB 3D25A 4RAUB 3VFVA 1KCSH 3H9HA 1HCVA 1DLFH 3BVNA 5TDPA 2MTPA 3WXWL 3QDMA 2IBZY 4B7IA 1CDHA 1JGLL 3GBML 1T0NB 4GBXB 3I6LD 1FCGA 4P0DA 3QA3B 4HC1H 1ONQA 3DRQA 1QBLH 3MV7A 3VI4F 3LQMA 3LZFH 4OZ4A 1JNHA 4X80H 1EO8L 5F9OH 3DBXA 5J4MA 4UT9L 2LU7A 2N1KA 4NC0B 4V1DA 1E4XH 5L88H 3TZVB 4Q9QL 4RGNB 3OKMB 5I8EB 4DZBA 4JG0L 3WLWD 4G6JL 3MRGB 5DMGC 3BJLA 1RZJH 4JGMA 1MAJA 3BRGC 2QHRH 1B0GA 5AWNL 5C0CE 1EMTH 4S1DD 1IZJA 3KHQA 5JHLH 2AABH 1T6VN 4W4NA 1R0AL 5IUSA 4P9HL 5KZCD 1FNHA 4FHBD 5E9DD 5CHNB 2W9EL 4L4TB 5E6IB 1BQLH 3G6JF 1RJYB 4Z0BH 1I1YA 4U05A 3P4OA 4XPTH 3MRBB 4NCC1 1IGML 1AGEB 1B88A 1JGVL 2PXYB 2CLRB 4Z76A 4LVNC 4PTTB 4HV8A 1OM3H 5B3NA 3PQYA 4WENB 5D7JB 3QEHB 2APBA 2N7AA 4XWGL 2EEAA 3STLA 2VC2L 4QRPE 5DYOB 2R29H 1G6RA 5C1MB 2DJ4A 2G75B 2XY1A 1N0LA 4QRSB 3V7MA 4PV9A 5FGSA 4UZGA 1BP3B 2BMKB 2FEEL 4G5ZH 2YA2A 4WEBL 4JQIH 1H3TA 1S7XB 4JDTL 4OZHB 1G7HB 3FB5A 4KMQA 3TBTB 1CXHA 3DXAB 5GRVK 1UM4H 4I77H 5GGQH 4D0DA 1CXFA 3GSWA 3J7HA 5EUKB 2HP4A 4DGVH 4HKBA 2AJZB 1LWRA 4PJCB 2R4SH 4Y4FA 3OKNB 3QI9B 1HHIA 1A4JA 2WUBL 4RFNB 1A6VH 4D0BA 1OT2A 1YECL 5D7IF 3VWJC 3U7AA 4KWUA 1HHHB 2ICWJ 2IFFH 2R2EB 3ARBB 1F4XH 5AZ2H 3FO0H 1DANT 3KYKH 5IVZA 3MACL 4B41A 5JTWA 5KG9A 3IDXL 4YBLC 4QXUL 4X7DC 2EDQA 3EDDA 4YUEL 4LSQH 4H88L 5IBLD 4OV5A 5BO1H 1T80A 3SJVD 1OARL 4TSAL 1IJ9A 5E0QA 3PDOA 4RA3A 1HINH 4G9FD 2ZSWA 1NMCB 2J8OA 2KZWA 5E8PB 4RISH 4XVTH 5HPOA 1N64H 2CQVA 4NQVB 2ED8A 5FV1L 1IAMA 1P9MA 4FRWA 4XCEA 5JNYB 3DX9A 4JLRB 4I18A 4E9LA 2CJUH 3AGVA 3WLWC 1BQHA 3OAYK 4X5LA 5GS1B 4LSUH 2MKWA 1MPAL 4PJDF 2QR0A 1HI6B 3KPRB 1NPUA 4S1DC 3PWPE 2A6IA 3JUYA 2ENYA 1MHEB 1CZ8H 1BFTA 5K9OB 1S5IH 4JQXC 4QYOA 1K2DA 3WIHA 1AO7B 5AAMA 3TT3L 3HZKA 1MI5B 4P48A 5EU7C 4P5MB 4OZGE 5JHDD 4GS7C 4CRPA 1XR8B 3C9NB 3RGVD 1D9KB 4OIIL 3TYGL 2NY4B 3U36A 1J12A 5I1GH 5DRNB 1XF4B 1FAIL 4GRWF 4WFFE 5IR1A 4UINL 4EJ1C 2V2TA 3PP3H 5I1DB 4KU1A 3QUML 4ONGH 4MNHB 5L2KA 3GBLA 2W0FA 2UYLB 3SDAD 2MPAL 4P99A 5F88A 3D48R 1N7ML 1KCKA 3MRDB 4PBVC 1K8IB 3FN9A 1JRHL 3TJEH 3RVWC 4DTGL 4DZ8B 3BAEH 3WUWA 5KSBA 2ZG3A 5EBMA 1UWGL 3NZ8B 1PFCA 3F58H 5JPNB 5HGDB 1TJHL 2IFGA 2AQ1A 3GMRA 3MV8A 4NQCE 5EUOB 2WWKO 3T1FB 4X98B 1IFHL 4OFIA 1AJ7H 4QRRE 3CJJA 4JHAL 4O9HL 1MVUA 1A1MB 5I6XB 1IM9A 2Q20A 1P6AB 2W1NA 5D9SB 1ZLWH 1WFUA 4Z7WB 1QFOA 2K1MA 3PWLB 1S7UA 4FMKA 4OCWH 1JGUL 3QDME 1DUYA 3V4PH 1FORL 3MNWB 4NKMA 3MV7E 1TVDA 3H2WA 4MA7L 1XGPB 3MREA 3U0TA 2ZCHL 1JPFA 1F90L 4MQ7B 4DN3L 4GG6A 5KVDH 4V1DE 1ZT4A 4KJYA 5BV7B 4RGND 3DUUA 1OD7A 4HMCA 3KHOA 5IBLC 2CD0A 3E0GA 3S36X 4N8CL 3JTSA 3L5WA 1NEUA 2A9NH 2H32A 2J4WH 1FYTA 3K3QA 4GMSH 3OB0K 4XP4H 5TQ0H 5JXED 1JN6A 3S37H 5HDQL 4Z5RA 2FWOB 2VN4A 1N5YL 1OTUD 5C0RH 3N1QC 3CFBB 2P5EA 2Y72A 4L4TD 4J3XA 4JQVA 2XV6B 4ZUSB 4DK6A 2X10A 1NLBL 3V5HA 1F4WL 3A67L 1AXTL 2P4AB 4IOIB 3SE4A 2GTZB 1ITCA 1SJHA 4UTAH 1LK3H 4U1JB 3PQYE 5D7JD 3L3OB 1WAAE 1GZPA 1HKLH 3RGVC 3P4NA 1KC5H 1T0PB 3DETD 3X11A 3PDDA 5DUML 3UPRB 3K2UH 4MJ5A 4EDWL 3SE3A 3WUZA 2AV7B 1OAKL 1O5DT 3D39A 3AS3A 5DJ6A 5HTSA 4NRXB 1M71B 2WWKT 1Y6NR 3H7BB 3SDAC 1KXVC 4NO5B 1J8HB 5I1IH 5LGHH 4QOKD 4BZ2L 3DXAD 3OHXA 3V0VB 5J11C 4P2OA 3OV6A 1L0QA 1F8TL 2VKWA 1TTFA 5IMOB 3I6GA 4PGCA 3V52H 4E0RB 4RGMC 3L7EA 3QI9D 4M7JH 3MO1A 5HHNA 3C8HA 3SDCB 3BT2H 3FONA 5SX4I 4CBPA 2AJUH 3JTTB 1QFWI 4TUKH 1S7SA 4Q58C 3ARBD 3RP1A 4UOW1 3OBAA 3SKNA 5KTEH 3T65A 4LEOB 1T5XB 2VL5A 1JMXA 3CZFA 2D31B 4APQA 3VG0H 3GSRA 4D9LL 5ITBH 1BLNA 3ZZ1A 3P0YH 1FFRA 5CSGA 4BH8A 1RMFL 3BWUC 4HWZA 4CNIB 3UTTA 3NCJH 1E4KC 1UXWB 1V7NL 3EGSB 3DRTA 1JGEA 3EUUA 1B2WH 4KDTA 3H42L 1FPTL 2R2BA 4A2LA 4PJ8B 2ADIA 5FYLE 1CFSB 1CFTB 5BS0A 1CLZH 1DQML 3UYPA 4RGNC 2DQCL 3IAPA 5DD5L 4N0UE 5INDA 4M6AA 4JFDB 4LVOB 3SGJC 1CLOH 2ARJA 3LQZB 3KPRD 2V2WB 1I3VA 1VENA 3QEUA 4YE4H 3CXHK 4U6YA 1RIVL 4YXLH 1FRGL 1CQYA 2BFVL 4C58B 4ZO6A 2CR6A 3EFDH 2H2SC 1H8SA 5DEZA 5JXEC 1HKFA 3EKCA 3R06A 1AO7D 1N2RA 1FC1A 4KUCF 1OAZL 1MI5D 1OTUC 4ODWB 5GGUB 3RVUD 4LFHG 5GHWH 1D9KD 4PD4J 2NY4D 1DR9A 2UZIH 2NY3B 1JPTH 5CD5D 1FQ9C 5T3XE 1UVQA 2VWEE 4N5ED 2XTJE 1VADB 3HHRB 3O41B 2WZPD 3BPCA 4JVUA 1YNKH 4KJQD 2DI7A 3BEVA 5D7JC 1PKQB 3HC0B 3QSKB 1TZHB 4ZUWA 1C16B 1RJLB 3DETC 1EJOH 4WEMB 3E2HB 3BW9B 4ONFH 1FG9C 4GKNB 3G04A 4CN6A 1FL3A 4Y4HB 1RUPL 4HS3A 4D8PB 5C2BH 1NCWH 5EBLA 1QQDB 5KSBE 4N1CA 1B9ZA 3HUJB 1A2YA 3CDCA 2JCCF 4NQSA 4X0KA 3ES6A 3MV8E 4WTWA 5DWUH 3IVKB 32C2A 4YFLI 1JHTA 5ID1A 3TA3B 1BBDL 4JFEB 3W82A 1NCTA 2ATKA 4XBEH 5J1AA 2X6MA 4HUWB 3QI9C 3RZCA 5ALCL 2UWEB 3EJZD 1U8HB 4TN9A 3KYMB 1SBSL 2D0HA 4KRPB 1JK8B 4R97B 1X9QA 3B5TA 3AXLA 5CEXB 4HGMA 3CVHH 5DHVA 3ARBC 1GCFA 1VKXB 3U83A 5BJTA 1T4KB 1T5WB 1U8MB 3NVQA 4C56B 1C8PA 4LASL 3MRKA 2BVTA 3V7AE 4GLRI 2OI9B 2EDYA 4NUGL 2OM5A 4GG6E 2PO6B 4BELD 2JKXA 4QXWA 5L7XH 1ACYH 4KMLB 2PF6A 4PRDA 4M1DL 3C5ZB 4QO1A 4U33A 5E24E 1FNFA 4HS8L 4ZXBA 2A0LD 4KTEH 4YFEA 1NMCC 4G8IA 3UMTA 1FYTE 1UM6H 3D5OF 3WD5H 3BZFA 2NXYB 3I02B 5TDOA 2VERN 3G5ZB 2OJZH 2KUTA 4H25B 4U1NA 1TTGA 5GS1C 3LKQB 5TQ2H 3EYOB 3C6LB 3Q1SL 2P5EE 5I76B 1TJGL 5CINL 2VABA 3MLUL 4HCRH 1RIHL 1CE6B 5HYQA 3RL2A 2AEQH 1KJ3H 3L3DB 1T21B 2CK2A 3UTQB 3GMNA 3MLSL 4YIQB 3RBSA 3RVUC 2IGFH 5T1KD 1A4KA 3C2AL 4AIZB 1S7QB 1D9KC 1R3JB 3MLZL 4JR9H 3MZTA 2NY4C 3WN5B 4HSQA 5CD5C 4HBCH 4MJ6B 4K7PX 4KGJA 4N5EC 3BRFA 3DX6A 4XC3L 3D39E 4OJFL 2Q8AH 5I18H 3AFLA 2DQTH 4YO0A 5BW7A 4NHUB 4U3HA 1J8HD 4LCCB 4KJQC 3BEWA 2IMNA 3WJLA 2E9BA 5D2LF 1OQXA 3V4VH 2E7BA 1FAKT 1OPGL 4OFYD 1NL0L 2GY5A 4N90E 5KVGH 2KQMA 1GOHA 4EXPX 3WEXB 5AD0B 1KV3A 3HG1B 4HGKC 1BOYA 1JWSA 5CBEA 5GZNC 5ERWB 4N8VA 5IBTH 3JV6A 4KHTL 3SDCD 1ZXQA 5HI4C 3RU8L 3ULUE 2HLFD 4P2QD 2DMCA 4L9LA 1PLGL 1NMAH 4OGAD 3OZ9H 5FDWA 2WK2A 5HYSB 4OLYH 3GSNL 3AAZA 4XNQA 5I6XC 3EJZC 2BC4B 1MFDL 2XICA 1VB9A 4OF7A 5DUPH 3N9GL 4WWKB 4LDOB 2IANA 1FH5L 2X4UB 4JJ5A 4OCYH 4H0HB 1J86A 4LAJH 3K74B 3H9SB 5D1QA 1CT8B 3UTTE 2IPTH 2PYFB 4KUZL 4JZJB 2BSTA 1MCCA 4KC3B 2VE6A 3HE7B 5GGTA 4NYLA 5JW5B 4HIEA 4WW1B 5BS0E 5HGBA 4PJIB 1J05A 5EPMB 5K9JL 1X5YA 5BV7C 1EFXA 2P24B 5IKCB 1U8OB 1U8LB 4JRXE 3MUGA 1VACA 2J7LA 2A0LC 2VNCA 1IEAB 2GCYA 4R96A 1F3DH 3A6CL 4HPOH 4WJ5A 1BHGA 5FO8B 4O5LL 5L2KE 2DIJA 1NFDF 3CU7A 1C1EL 1BVLA 1QHOA 5IB4A 5GJSL 3MCLH 3HZMB 1HILB 4JO1L 1L7IH 1QO3A 1REIA 5SWSB 1EHNA 1FGVL 2NY3D 3BQUA 1ZV5A 2XNAB 4Y8DC 3BISA 4PRPA 5GRJL 4JPKH 1SJXA 2GTWA 3QG7L 3P9LA 5EZIL 1R3HB 3LKOB 3V0AC 5HPMA 2C3VA 5I9QB 3S7GA 3VD7A 4N0CD 1MRFH 1I9IL 1T2QL 4F7PA 4OD1L 4TVPE 5C08B 1RULH 4EOWH 5C0JB 4UAOB 1QSFB 5FM5M 5IFAL 5LWYL 4GXUN 4O4YL 3NIFF 3HI6L 2DI8A 1DFBL 4OSUL 2R23A 5ETUA 3WNLA 2NX5A 4Y5YA 1SEQH 2YK1L 4HFUL 4MWFA 1VGEL 5ECJE 3ZE0F 1TQBB 5IMLB 3C08H 3T2OA 5C3TA 3TBWB 3DX7B 2R1XA 3L5IA 4XNYL 4NZUL 4YHZH 3OAZH 4JHWH 5SX5K 1CLYL 4ONOA 5C0ND 4XH2B 1XH3A 1PGRB 5EU4B 2FB4H 4X5WB 2CLVA 1I8KB 3TA3D 3FN3A 5F44A 1VESA 1YZZA 5BVPH 5FKAB 1G84A 4S2SB 5TF0A 3RNQA 5GRUH 4JPVH 1P7QB 2J1KA 3SDCC 3F7VA 1NAKL 4EUPA 2HLFC 2X9YA 4IS6A 5ANMA 4HLZG 4KRPD 4LVHB 3LRGA 2OXGA 3MYJA 2ZJSH 2EYRA 3WO4C 1A6AA 4HWEH 3QR2A 3IDMB 1ZLUK 1G7PB 4FFWD 1YEEL 4C56D 1F3JB 3NIGF 1RZ8B 3ZDZE 2O5XH 2FRGP 3D85D 1D6EB 1LO2L 3B5GA 4Z0XB 2BHZA 4ZTOH 5AUMA 1CFQB 1IARB 4GMTL 2E7LC 2FZ3A 1NGZB 2EDWA 1QEWA 1A7PH 4ZDHA 2PN5A 3W5MA 1VFAB 4HMEA 1S7TA 3C5ZD 2Z31A 3K7UA 4X6FB 1PZ5A 2NQCA 4MSWB 5BQ7B 3ULVD 1HXMA 4G43A 4NRYA 3FFCB 4PJ8C 1T6WA 4MNGB 4OZIA 5F21B 4NO3B 2NXYD 4N8VG 2E9IA 4PYHA 2IF7A 4MB3A 4YDJA 5I30H 3F62A 1HXYB 4PP1C 1PVHA 4UDUA 4R4NC 4LVOC 3C6LD 4NM8L 1RUQH 5EOQL 4FXKB 5HGAB 4PRAB 3VXUB 1ZGLP 1IC5H 2BERA 4F9LA 2P8LA 3H3PH 3MXVH 4XP1L 3QHFL 2EDBA 2DQGL 2OP4L 4ODUA 5ESAB 3TWCH 1RFDH 1DL7H 1R5WA 1AKJB 2F53D 2FJFA 4UNUA 4F8TA 3QNZA 5T33H 3D0VB 5IG7A 5BRZE 4HGWB 3T8XB 2NY3C 2X44D 1KUMA 3EBAA 1S9VB 4YNYA 4ZUTA 3CUPB 3G08B 4RA0C 1F6FB 5H8DA 2VIRA 3GI9L 3VD4A 1A9EB 3LN5B 4LU5L 2KL6A 4MDJA 4NJAL 3ARUA 1CLCA 4N0CC 1YPZA 2BOCA 3C5SA 2CIKB 4O51B 3LS5H 1KG0A 1CGWA 2BZDA 1WWBX 4NZTH 5FCUH 1JBJA 4WUUB 1ZLVK 5DJYA 1UWEH 2BVQA 3X3GL 5A2FA 3E2HC 5DZLA 5I66B 1KB5H 5GIRA 1NGYB 2J2ZA 5GISL 1OSPH 43C9A 4EQ2A 1G9EA 4Y4HC 5EU3A 5DQ9B 3HG1D 1MFEL 3GUTB 4RZCB 3O9WB 5E1AA 2VYRE 1GIGH 5E8DL 3CSYB 3L6FB 4PRIA 5EZLA 5C0NC 2AXFB 2A74B 5JO5B 1MHPL 1HOCA 3HMXL 3I50L 1TJIL 4NFBA 3TA3C 2MCPL 4PP2B 1IQDA 3CCHA 5J6GB 5CJOH 3UO1H 3L3JA 2EYTB 4M61B 1ZVSA 4NDMB 3AM8C 4WWKD 5J89A 3C60D 3RIAK 3QZWA 2IANE 4KRPC 4NZJA 4R97C 4YZFE 1KCSL 4ELKB 1YNTA 1DLFL 3RKDC 3FB8B 3H9SD 2K3TA 5H94B 4FFWC 4K2UH 1X5KA 4Z77B 3SGDI 4EVNB 3NABH 4TSCL 3PV7A 2OI9C 3HE7D 4L3AA 4MA3B 3QNXA 5F9OL 2PO6C 3SQBA 4DQOL 4PJFE 4CMMB 2YRPA 1E4XL 3STBA 2L7JA 3C5ZC 2OJEA 2C1OA 3MLXH 4NQXB 3LRSB 5GGRA 5KS9E 4RMQA 3ULVC 4R4BB 2C5DC 4WWID 1MLBB 4YHYB 5E00B 3GK8H 2NXYC 3KXFB 4IHOB 3CSGA 2AABL 1X7QA 2Y07H 4FS0A 3DARA 3LH2H 3C6LC 2DD8H 3OKOB 5SWSD 1QUNA 2NMSA 1GZQB 3IGAA 2XPGB 4PRPE 2CUHA 3B3IB 2IG2H 4L4VA 5IJVB 3GIVA 3BO8B 4YHIB 4Z0BL 3WSQH 5I17B 1OSZA 1U91A 2XFXB 4XPTL 1AQDA 4ZODA 4IRSB 5C08D 5DSCB 3KWWB 3MXWL 1Q1JH 2EH8H 4UV7H 1QSFD 1WQVT 5FA4A 3WN5C 1EZVX 4Y2DD 4G8GA 3ZSSA 2NX5E 3QXAB 3MGTA 2Q76A 3BZ4B 3EO1A 4G8EB 2WIIA 5JIKA 4JO4L 4NHCH 1T22B 4GW4A 3MGOB 4LCCC 5MP6H 2ITCB 4HBQA 4MCZA 7FABH 3FOLB 4JQIL 4PJGA 1T1ZA 4OZFG 5KSAA 4ZQKB 3STZB 1ZVHA 1PG7L 1JHKL 3ARSA 2CKNA 4MD5A 2XWBB 4J3UA 2RR3A 4I77L 5IBUG 4K8RH 4LLAA 5TE7L 4NIKB 5DRXB 4OLUL 1IL1B 3DGGB 3UC0L 2R4SL 4LBEB 2LAAA 1ETZA 4P5TA 3GJFK 2YD6A 2R8SL 1ZEAL 1A6VL 2NNAA 5FUCE 2DQHL 3WIFA 2G5BA 5DT1L 3LKPB 3L3GA 1IZKA 4XCFH 4EQ3A 1A6PA 1F00I 2FJGA 3GRWL 3SO5A 2VZSA 3LOWA 1YY8B 4WTXA 4XP6H 1NFIB 1F4XL 1UH4A 4JN1H 3VA2C 5HJ3B 1YEHL 4WWKC 2HJLB 5C70A 5F9JB 4M5YH 4NQEA 1NC2B 5J06A 2WSKA 3U79A 1WBXA 1FG2B 1BVKB 3QFDB 4S11A 3HA0A 5F7MC 4HXAH 5BO1L 4TNWF 1S3KH 3RFZC 3HE7C 3FFCD 3IF1A 1AHWB 1INEL 4P46D 4OZIE 3OKLB 2CDEA 3ULVH 3QULB 5D7SH 1IKNC 1N64L 4O2FA 1VPOH 3GJFA 3H0TA 4JRWA 2N4IA 4JPWH 4M48H 3SGKC 3VXUD 4YPGA 4R26H 1M6OB 4KH2A 5EC1B 3NACL 1IGTA 4LHQB 1W72B 1A6WL 3FAWA 2YPKA 4GXUM 3MJ6A 3GSXA 4GKSB 2Z93A 1AKJD 1X3DA 2FBJH 4YDKH 4ORGB 2ZSVA 3EW3B 1BIHA 1NUNB 1UENA 2PW1B 5I9QC 4XNUH 3REWB 1YPZE 1UZ8B 2EDOA 4N9GA 5E8OB 5F9WB 4LIQE 4WUUD 4UAOC 5J13B 4L3EB 1F42A 2A6DB 1S7RB 2ITDA 2Z35B 3BE1L 1H3XA 5J1SC 3D6GA 4YHNA 3W11D 3KLAA 2LFGA 3RA7H 5JIIA 3OF6D 3QXWA 4PJ5B 3O3AA 5F7DB 4P3WA 5IVXB 1TQBC 3I3DA 1N5AA 3DV6A 5HHQA 3TNNB 4K7PY 3OKEB 5DJZB 5EIIB 3INUH 1BOGA 3BAEL 5D7IA 4PRIE 4IDJH 1CK0H 2F54A 4PR5A 1ZLSL 5EU6B 3MPCA 5DMIL 4LQFH 4ZYKB 5E8EB 4P4RA 5J56B 4X4MA 5DTFA 2ORBL 3CSPA 4DKAA 1AJ7L 4QGTA 5F1KC 2ZUSA 1IGYB 3RZWA 4HK3J 3UTZA 3CXHJ 3LB6D 3O8XA 4LVHC 5DLMH 2WINB 4WW2B 4F3FB 3PDGA 1SJVA 3CK0H 1XR9A 3OKKA 4I1NB 4LRIC 3IFNH 4PJ9B 4MXVF 3IB4A 1G1CA 2X4TA 3WV0A 4CU8A 1Q9LA 4M02A 2F15A 3NA4A 1JMZA 1GAFL 1LQSR 4TRPL 4YXKL 4ISVA 5FO9A 2VQ1A 1NANH 1E6OH 2IH1B 2LQRA 1RUAL 1K4CA 1INQA 1LDPL 2P48B 1J1PL 5ADPL 4PRBB 2ZUYA 1I7TA 4Y4KB 3BP5B 4PJDA 3EYQD 3OSKA 2DS4A 5DMYA 2PYEA 2X7LA 3P0VH 5GS2H 5FYJU 5D5MB 3VFTA 5CJQL 3GSUB 3X3FL 3NA9L 2A9NL 4HKZA 2VJXA 3U7YH 2J4WL 4UV4H 2EIZB 2WUCH 3T2NH 2OK0H 4GMSL 4K7FB 1YEGH 5TQ0L 4YK4C 1RHHA 4ZO7A 4PB9H 3S37L 4XX1G 4DKFH 4M6OL 1DBMH 2FECI 4X4YB 2CRYA 4XNMA 3V9FA 5IGXH 2F5AL 3QDAA 2GJZB 1N8ZB 1OAUL 3G6DH 2ARJQ 5FGRA 4M6MH 2HWZL 3NPSB 3B43A 4IRSD 4XBPB 2DWDA 2IMMA 5IB1B 5CP7B 2G2RA 1NC4A 4CN4A 1HKLL 1NGWA 2YPVH 2NY1B 1KC5L 2W65B 3QDJB 4G8GE 5IV2B 5BZDA 3F7QA 5IJKA 2EKSA 1SMAA 3K2UL 4R7DB 1HQ4A 5GS0C 4YWGH 4NRZB 1B90A 2X4SB 1BJ1J 5GGSY 1IKFH 4ZPVA 4PJGE 5TE6L 1Z3GL 1AE6L 1EEYB 2HJFB 5KOVC 5LGHL 3QUXA 2HN7A 3DYMA 4OT1H 1CIDA 5TDNA 4ODXB 3TBVA 3ZDYE 4L8SA 1H5BA 4ZOAA 1Y0LA 5C2UB 4G7VH 5H35B 3RVTD 3U1SL 4ESKA 1MJUH 3L3KB 4NWUH 4RMWA 4LSVH 4YHPA 2A9MH 1X4ZA 4D9RE 5LXGH