3BKYH

Crystal structure of chimeric antibody c2h7 fab in complex with a cd20 peptide
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
226
structure length
226
Chain Sequence
b'QAYLQQSGAELVRPGASVKMSCKASGYTFTSYNMHWVKQTPRQGLEWIGAIYPGNGDTSYNQKFKGKATLTVDKSSSTAYMQLSSLTSEDSAVYFCARVVYYSNSYWYFDVWGTGTTVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords the Fab fragment of chimeric 2H7, heavy chain
molecule tags Immune system
source organism Homo sapiens, mus musculus
publication title Crystal structure of chimeric antibody C2H7 Fab in complex with a CD20 peptide
pubmed doi rcsb
total genus 39
structure length 226
sequence length 226
ec nomenclature
pdb deposition date 2007-12-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bkyH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3bkyH02
1K4CA 1D5IL 1Q0XH 3RVVC 4X5XA 1A1NA 5KSUA 2EDBA 3V8OA 3THMH 5CZVL 5TDPB 4ZFGH 5KN5B 5BS0E 3C60C 4AG4L 1T03L 1CL7I 3QEHB 5KOVC 5FHBH 4LPWA 4H0HB 3CCHB 1TZIB 3HUJB 4XX1G 2G60L 1WZLA 5F7NC 1WK0A 1QBAA 4CJ1A 3GSVB 2HVJB 5J8OA 3KJ6L 4X5XB 5FYKL 4Y2DD 1PYWB 4WFGE 4EQ3A 1E28A 4KVCL 4P9ML 1VEMA 2MKWA 3E2HB 3UPRA 4X80H 3VGAB 3KPSE 1EPFA 3F65A 4YO0A 1CFBA 2JCCA 1CICB 5BVPL 3P0YH 4ZPVB 2X5PA 2BZDA 4UIKH 2P1YA 1DP0A 1KJVA 4FG6D 4HZLB 2YUZA 3MRFA 1CLCA 3MRKA 1WFOA 1M05B 4S1RL 1JUFA 3M8OH 4XCNA 2NY1C 5IK3B 2NXZC 3TO4A 5LXGL 2NTSP 2VLKA 1SJEB 3BWUC 4WWKC 3W81A 4ZDHB 3HA0A 2BOCA 2GCYA 3QQ3B 4XHJC 1JGVH 1LWRA 4J8RB 2X4OB 3LV3A 2I9LB 1HINH 3JV4B 3W9EA 1HDMA 1BVKA 2BVOB 4NCDA 4ERSH 4NQUA 1A7OL 2IAND 3ILPA 4GRWF 1CFNA 4HUNB 5D1XA 3RY6C 2GJZB 4G9DA 3PGFL 1EGJA 2ICWJ 1KTLA 1ZT4A 3RWEA 1DBBL 2R1XA 4BFEA 1CT8A 2BVOA 1CQYA 4PJ5D 3IETB 4MD0A 3LRHA 4JFDB 3LKRA 5F7FA 5JHLH 5ICXB 5KOMC 3SQBA 4XCCL 4GSDH 5CEZE 1ZGLP 3UZEA 3QI9B 2YZ8A 2B39A 3SGDI 1AI1H 1MI5D 3H3BC 1A3LH 1AR2A 1HXYA 3L9RA 3U4EA 4RZCA 1I7RA 1NCUA 3L3GA 1SYVB 5B38B 1UM4L 3PWUB 4P59L 4RGNE 1HHIB 2BNRD 4XBPA 4X6DA 3LRSA 4H88L 4I9WD 2ICWI 3KAAA 3D9AL 1JYXA 1NLDH 2XQYG 3WLWD 1V3KA 4LVOC 3WN5A 2ICWB 3L6FA 4YHYB 1A6UL 3QIUD 5GRXG 3S36H 1KLGB 4I1NB 3MRQB 4X8JB 1KENH 1OAYL 4OZ4B 3C5SB 4GAFB 5E4IA 5DF0A 1DCLA 4QTIL 4KI5D 4LKCB 3GNML 4ZAKC 3VE0B 3X3FH 3STLA 1T1WA 2AEPH 4QHUA 4P4RA 2EDDA 4JVUA 3VGFA 2ZSWB 3UYOD 1IQWL 3DUUB 3QNXA 3DMMC 5F6HI 4HKJA 5CSBA 1XR9A 1LEGB 1Q0YL 5IJVA 4PV9B 4WVRA 5HYJD 1ES0B 5GGTH 3B9KD 3VXUE 5AEAA 3EOTH 4K2UH 5IMMA 4Q58C 1RIHH 4MNQA 5JORB 1MCKA 2C3GA 2L0DA 3KJ4C 4M48L 3SOBH 4LPUA 3MLWH 4JB9L 4L4TD 5LBSH 2OL3H 3EKCA 4JKWA 1JN6A 3JV6A 1KIPB 4AH2B 4PGEB 4L3ED 3SEPA 5FUZH 3CC5B 3V6ZB 3GIZH 3FCTB 5MI0C 1P4IL 1P6AB 5SWZB 3OKEB 1KN2L 3B3IB 3CXDH 5FYLD 3RAJL 4TPRH 3RHWK 2OZ4H 2EXWC 2I60L 2C1OA 4XI5C 1T7WA 2ARJA 2Q76A 2BNQD 4UT9L 3CLFL 5HHOD 5J11C 3O4LD 3B2VH 4JQXA 3MLUH 4QRPA 2VXSL 2PXYD 1V7ML 3KHOA 4C83B 1GGCH 1A4JB 5CMAA 4YHPB 2JB5L 1SMAA 2HJLB 4GS7C 1FL6A 4ERSL 3RL1A 2IBBA 3TF7C 1PD6A 3JTSB 1EZVX 5KSVB 1W2KT 2WSKA 5T3ZH 1FG2B 4N1CA 2JJUA 4U1NA 1ZLSH 4MSWA 4CDHA 5LWYL 3FN3A 2R0KL 3HAEH 2P48B 4M8VA 4M6OH 2X1QA 4WTWA 1F6LL 5DJ0B 3VRLE 4AENA 1T1ZB 3QEGH 1CTOA 3VWJD 2XPGA 4C56B 3T08A 3TZVC 1ONQA 3L1OH 4GRLB 3GBML 4IMLA 1I1RA 2QADD 4HCRL 1PLGL 2MJWA 1J0ZA 2XKSA 1BEYL 2VDQL 5E99H 2GITA 4NKOA 4UAOB 1LEGA 3UBXB 4X7TB 1RUKH 4QRTA 1ZMYA 2VLJE 3V7AG 1XF2B 5DYOB 4XWGL 5B3NA 4OI7A 3BUYA 5E6IC 2R69H 2RFXB 4KVCH 4P9MH 5D7SL 1F6FB 1AE6L 3ULUD 3BT2H 3KPQA 5TJWK 4TNVK 2ZUTA 3HN3A 4HUWB 1FH5H 1MCNA 3OGOE 4FZ8H 4JDVA 2EDRA 4JAMA 4PJ9C 2V9RA 4PLOB 2ZKHH 5LQBH 5IWLC 3CFEA 2R0WL 5AWNL 2ZOKB 2CLZB 4LQFL 4HUMB 3HR5A 1H8SA 1T1ZA 4GUPA 4RAVA 2NY6D 5K9QI 3RBSA 3DGGA 3WE6A 5KBNC 3QG7H 3DUSB 3PWNA 7FABL 1JZ3A 3BP4A 3T1FA 2K9UA 4HUWA 4G3YH 5B4MD 3S34H 1MCLA 3NZHH 2NPLX 2R8SH 2CMRH 3RU8L 1UJ3B 1KC5L 5FYKE 2ZWLT 1ACYL 4RAVB 1PZ5A 3BP7B 1LEKB 5JPNB 3U83A 3VFGL 4R97C 2NMSA 1CDYA 4K94L 3STBA 3FOLB 1SM3L 4JHWL 4WHCA 4RFOL 5B8CC 2M8XA 4WI8A 3WS3B 2J5LB 4QF1A 1MCWW 5I1LA 1R5WA 2FATH 3OQ3B 4UDTB 3VFWB 1SY6L 2Y5TA 5FYJE 4OCWH 2YD4A 5IFHL 4NWUL 3ZDXF 4PB9H 4YDVB 3GUTB 3FQXA 2X89D 1YEIH 4U1MB 3RTQB 4X4YB 2XWJB 4JRWA 1I8IA 2UY7A 5CP7B 5DR5L 4LHUB 2K1MA 4F2MB 1XH3A 4PLKC 1NBZA 3VGBA 4LRIC 4C58B 4L8BA 5BV7H 1CR9H 1QPPA 4XPBH 1V7NL 1IT9L 3GBNL 1LEIB 3T77B 5IVXE 4PRIE 2AI0L 4FQXD 1TZGH 3CXHK 3N1PC 2J7LA 5I18H 2ARWA 4L1HA 1O7VA 1UXWB 1UA6L 3OF6A 2KDGA 2OR8A 3DVGA 5C2BL 1L0YA 2XZCL 1QSEB 2UYLA 2YRLA 3PL6D 4Z7UE 3NABL 4WWKA 5FKPA 3WE6B 3B8SA 1X5GA 3HTLX 3MZGB 3SKMA 1IGTB 5F97E 3T0AA 3GUTA 2HKFH 4UV7L 3LN4A 4NRZB 4N0RA 2IBZX 4OI8A 1YY8A 2IPUG 1MNUL 2AV7B 3KPSA 2DYPB 4JN2A 4W6XB 4WU7B 3JZ7A 3K81A 2HT3C 4FFWC 4S2SB 4P0DA 3C6SB 2A0LC 4PBVC 4A2MA 3G9VA 2Y7QB 2VDML 5ISZE 1ZA3B 5DJ6B 1T7YA 3IAPA 3PQYA 3GZKA 5A43C 5E9DE 3LKOB 2NYYD 2IH3A 2IF7A 2W60A 4N90D 3UPCA 2PW2B 2Y5TB 4JPIB 4APQD 5LGKA 3M8OL 1N7MH 4MJIE 5I8OH 3O0RL 4WCYH 3RWIA 1JWMB 4KJWC 5JOEA 1QSEA 4Q9RH 3BKCL 4KJPD 3RVXD 4HC1L 1UA6H 1CQKA 2MKLC 1WTGT 3ULVH 3AU1B 3EYQD 2R56H 1AO7B 3TM6A 4XP9L 4M1CC 5IW1B 5TDOA 1RZGA 3QXTA 4J3XA 2MHAA 3SJVE 4OZIA 4HS3B 4JQIH 1G7IB 5IOPA 3M07A 4HKXB 2NY4C 3HR6A 2VTFA 2WBJB 3QO1B 4JZJA 2HLFD 4J4PD 1YMMB 3LN5A 4WHYH 4PR5B 1DBMH 4QYOB 3BN3B 1K85A 3D3VA 1XGRA 3VDBA 4DKFL 3CIQA 3SE3A 4Z7UB 5JNYA 3U0WH 3O4LB 3U1SH 1QSEE 3M1BB 4NJAH 1S9YA 4MJIA 4QRRB 1WCQA 1ZA6A 1N7ML 2G5RA 3BESR 3VMPA 3GMRB 1MCIA 4DK3A 4ZPVA 2DI8A 5E9DA 4PJ8B 5EIQA 4GAYB 4U2YA 3LOWA 1J11A 4DN4H 4CU8A 1WCBA 1I8MB 2D7PA 4PJHE 4XNXL 1DQQA 1KC5H 3C09C 5ISZA 3UTSD 3VFOB 3HC0B 1F4HA 3RP1A 3LB6C 5DA0B 2DLIA 3T65A 3U7YH 4B53A 3NIFE 5IKCB 3O9WC 4FNLL 3CFKB 1P6FA 3HB3C 4XPFH 2BHZA 4HV8B 3B4NA 5LVEA 4LVEA 1H3TA 2NY2C 2C7UB 2A74B 2NY5L 4ZDHA 1B4JH 1FDLH 2CLRB 2P43B 1J86A 1JFQL 1NL0L 2K7QA 2Z8RA 3DLQR 3HC0A 4Y16B 4JO1H 3RUGA 2CRYA 4MAYB 3SDAD 1UWXK 4G80A 1T0NB 5IFAL 4FXGB 4ENED 2W9EL 3IVKA 5CIPB 4QXUH 1MVUA 1A14L 3EOAA 1TZHB 1HCVA 4DGYH 3CVHL 4MS8D 1E6JH 1UXSB 5F8QC 5KVGL 5B38A 2PO6C 3MJ9H 4O9HL 2DQGL 12E8H 4D3CL 2A77L 1B2WH 4U0RC 5CP3H 1CDCA 2JK5B 5CGYC 3E8UH 4XGZA 4V1DA 1U58B 4WENB 4QYOA 2Y1VA 4WTXA 5DJAB 5CBEB 5K9OB 5E2UL 3BSZH 4KRPD 1INQA 3L7EB 4DOHB 4MQXC 5HHOB 3P0GB 3TT1L 1JL8A 3BJLA 1DQMH 5I75C 3RNKB 1MH5B 1WISA 1ZT1B 3P9MB 4LLQB 1ADQH 4YBQD 2HFFA 3P30H 4IDLA 4MAYC 1XF5B 5ESVB 5CD5D 2LU4A 2FBJL 1OP3K 5IV2B 3CVIL 4HAFA 5ELIA 5DQ9B 1YEEL 1N8ZA 2BOCB 2GCYB 2VAAA 3QQ3A 1VGEL 5KSAC 4M93B 4WY7L 5FYJD 3DTXB 5JUEL 2E7MA 2CIIA 4HS8H 4P46D 5BVJA 1ES0A 5IM7B 1HDMB 2XN9D 3SDDC 4YWGH 3CFKA 4XMKH 1ACYH 3AREA 3GM8A 3TFKD 1NAML 1DZBA 3RTQD 1CXKA 3C5SA 4JRYD 4Y19D 3MV01 3HE6A 3IDMB 4NQEB 5K9KA 3NZHL 3STLB 5I66B 5DMIL 3RVUD 5IWLA 5F8RC 1P4IH 1T5WB 3LAFA 2VLRB 3FB5B 4P4RB 1IAIL 5E4EB 4P23D 3BKCH 2AABL 2QR0A 5C07D 3WLWC 3EIFA 3O0RH 1QLRB 5DD6B 2R2BB 4PJCF 3HHRB 3HE7D 4NGHL 5IT2H 4GQ9H 1CK0L 3ARFA 3MJ8B 4XP1L 1SEQH 4KKAD 3WIIH 4F58H 4AEHH 2RBLA 4JEGB 4OI9A 1A2YB 1ZLWK 1FPTL 1GGIL 3G6JA 1BQHB 3Q2CA 4LEXL 3ZE2E 2R0LH 1CI5A 1HHHB 4QOKE 3MRKB 3ABZA 1UQSB 3MLSH 3CX5J 3U2SA 4E0RB 1SYVA 5K9OA 4Z7WA 5F1OB 5TQ0L 3HNTH 4NKIH 5FKAB 3U6RA 1T7ZA 2HTLC 1BD2E 2VDPL 2VZTA 2VZUA 4RGOH 2I9LA 5DJXB 4RFNC 4NN7C 5CJOH 2ZZUT 5FFLA 5HYJB 3C5ZC 4D9RE 4FFVC 3KR3L 4Z7WB 1CFNB 2AGJL 1D7FA 1OAQH 3QUML 3T0EC 3C87A 2R0KH 4G8GA 1CD8A 2F5BH 4RISH 3WL9A 4LSTL 1JMZA 2OJZL 4GW5A 1IGFH 4JM4L 2ADJA 1UVQB 3DVNA 4KY1H 5TFSH 2YMXL 3QI9A 1FAIL 1FQ9C 5IF0B 4Y4FA 3FT2A 3PDOA 5FM8A 3QCTL 2NXYB 3VXOB 3CFEB 4UV4H 2Z93B 3DX7A 2NY4B 2VR9A 1IKFH 3Q6FA 5EUOA 5T1DH 1VFOA 4PJCB 5EPMA 3DX6B 3MV9E 4RFOH 4NDMB 1BD2A 1H5BB 4EOWH 5GSVB 3SGDH 1IM3A 3IKKA 2LTQC 1TTFA 1WWAX 4MNQE 1FZOA 4HHAA 5JW5B 1C8PA 4POZC 3D39A 3VXUA 1R3IH 5I1AA 1BIIA 3DX7B 4NKDA 5KVDL 4DGIH 1OOAA 2OJZH 1XR8A 3HPJA 2NY7H 3GSUB 3MCKA 1DVFA 3DYPA 5BOPA 4BSWB 5IFJA 4NT6B 5DHYB 2NY0D 4FHBD 3MNZB 4PJ8C 1OP5H 6FABH 2AEPL 4CGTA 4OCSH 2N7AA 4PB0L 3SPVA 3O6FA 3SKJH 4HPOL 1OSPL 5D96C 3RUGF 2JJTA 1G7HA 1BBDL 4I2XA 2BMKB 1CICC 3MZTA 3NFPB 3QJHA 3QCVL 4O4YL 4EDWL 1RK0A 5JORA 2NY6C 4Z0BL 2VN7A 1N6QL 5E6YA 5EZJA 5C0IB 2C4XA 3DWTA 4LSRH 4WEBL 3VMOA 3A6CH 4NKQB 1U9KA 2W65A 1JI2A 1CFVL 1UG9A 4I0KA 3FQXB 4HJJH 4X4YA 5D6DA 5KJRL 2GFBB 1Q94B 3WIIL 3VI4F 3PABA 4BH8B 2VISA 3HS0A 4NT6A 4O2FA 1W0VA 1MFBH 3KXFE 1JPFA 1T22A 5TQ2H 2MTPA 1T5XB 2QQLH 5F7LB 5DO2C 5CZVH 3THML 5I73C 1D3CA 2BNRB 2Z31D 2BDNL 1YC8A 5IMLA 2FECI 1P2CB 4OV5B 4LLVB 5HHNB 2VO5A 4PP1C 5E2UH 5HYQA 5DMGC 4R96A 1UFUA 4WU7A 1F2QA 4DGIL 3KPPA 5T3ZE 4FFYH 1HZHL 2P7TA 1MCHA 4GH7B 2A77H 3MLUL 4W4OA 1CE6A 4PJGE 3LEVH 3MRRB 1I3GL 1IC1A 2W0FB 4GKZB 1CLOH 4HKZA 3BN9D 4TYUA 5DRXA 2GJ6B 4XNUL 5HGDB 4KJQD 3WEXA 5DD3L 4JFYB 3QIBC 3MLZL 1PSKL 1OW0C 1T6VN 4ZUUA 3RWHB 3RL2A 3CSBA 1A3RH 1UM5H 1KCRH 5MEQA 4XMPL 5IQ7H 3HR5B 5EH1A 4C4KO 5C1MB 1U91B 2FJGB 2OR9L 2XN9B 3IF1A 3TT1H 3HI6H 2OL3L 3HG1D 3MA7B 2FBOJ 1I8LA 4JN1L 2X4RA 2NY5H 3BSZL 1CL7H 1K8IB 4GW4B 3F7RA 3WFZA 1YMHA 3BZ4B 2EDOA 2X41A 4RMTA 4YDIH 1A9BA 4J3UA 3L3KA 3C8DA 4H26A 4R4FH 5I15L 1C5CH 1OY3B 5GGTL 1Q9WA 2FJFA 5F7UA 1KTRL 3K4ZA 3OMZA 4HUXB 1FNGA 4ZS6D 4PGCA 3QZWA 4M5YL 2V5TA 4PJHA 1MI5A 3EDFA 4WW1A 4X8XA 4ZXBB 5JXED 1RURL 3QZWG 4GUPB 4GT7A 3H7LA 3U36B 3QB7C 1U8PA 2V9QA 2VKXA 4Y4HC 3QUYC 3U7WL 4K8RL 3QUXA 5I8KH 3CSYB 1YY9D 1U8IB 3L95B 4TULL 2WBWB 4JY4A 3VFMB 3IDIA 2X09A 4HMCA 1VADA 2I9TB 1DBML 3RVVD 4H25A 2UZIL 4KUCD 1OTUD 4EUPA 5TGBB 1ZHKB 3MRDA 3PG2A 3ZYOA 1IAOB 4NNXB 4I4WB 2FB4L 3TA3B 2DQUL 3MNVA 1CGSH 1XAUA 4F7EB 2DLFH 4KFZC 5TF0A 1RZJH 4NPYB 4QHNA 5EZOH 5DFVC 4DJMA 4I77L 1SEQL 2R0ZH 3QDMA 3GJEB 2W92A 1BECA 1ND0B 3O3UN 4I3SH 3K2UH 3V5DA 4LKXB 5BRZD 3VRIA 4BQ8A 1TVBB 1JTTA 5CKAA 3ARBC 1FGNL 4FQ2L 3P4NB 4K23L 1YEFL 2WUCH 5JLZB 4PJ9A 1JYNA 4MNQD 2IGFL 3ZHLA 5HYSG 4K9EL 3EYVA 2DQCL 1IBGL 1DLHB 1NLBL 4LKXA 4OF3A 5GGRY 4NC1E 4YHZL 3CU7A 3C08L 4PLNC 2FNBA 4YO0B 3BRDA 4L4TA 1EH9A 2AJ3A 3JWNC 1OCWH 2BJMH 1FV1A 2FJFB 2PR4H 4I0PC 1PKQE 5K9JH 3BZFA 3C6SA 5TGBA 1JBJA 1AGDB 1OAUL 3QDJD 4O51A 2Y72A 4ODSL 1IAKA 3WFDL 5ICYA 3OX8B 3V4UL 4N0UB 4Y1AA 5IJKC 3VFTA 2EDKA 4PRHE 2QQNH 3QEUA 1VACA 2EKSB 1WGOA 1ZS8B 4JFFD 5HHOA 2O5ZL 1MCRA 1PAMA 4F7MB 3CSYA 3QUKB 4NZDA 4WIQA 1TFHA 3RWFB 4A6YB 4DK6A 2FR4A 3WIHA 3QUMB 3FMGL 1UB5A 1QSZA 4ELMA 1L6ZA 1R5IB 2E8YA 3EFDH 3HC3L 1NGQL 3VGEA 3O4LE 3KLDA 4CL7A 1P1ZA 4Z7UA 4YGAB 2EO9A 3MMEA 4OZHA 1OAXL 4R9HA 1MPAL 1DDHB 2CJUL 5D7JD 4GLRH 5D1XB 2C3HA 2NLJA 1MFNA 4OM0H 2APXA 3HPLB 1ZK9A 4KHXL 4X4ME 4IDJH 2WZPD 1ZT4B 3MBXL 1PKOA 4PJBA 5AAWA 1G84A 4JM2C 2QQQA 1HHIA 1J1PL 1F58H 4ZFOB 2X1XR 4D2NA 3FQNB 5HDOA 2W0KA 5I8CA 3T8XB 4JO4H 4WTZA 4MA8L 4Y1AB 3NA9H 4KROD 1NUDA 5EU6E 5ESVA 1T3FB 4X0KB 3VFNA 4Q74A 2VERN 1ZT7B 5C0FB 5DD6A 2R2BA 3SDXE 4KRPC 3C6LD 3GDBA 5ILTH 1CXIA 2FR4B 1X4YA 4J7RA 3CPLB 2ZOLA 5D1ZD 3L5HA 2FATL 3MOAL 1W72L 3W9DB 3K2MC 5J56B 3O45B 4O58H 3DBXB 5KZCB 2GEEA 2EC8A 1JWSB 5I18L 5ITBH 4JO2H 5E9DB 4ZFFB 2G9HB 2NY3D 5TF1H 3DUUA 5DUMH 4R7NB 4NO2B 3UBXG 3GSXA 4UUJB 3OKMA 1FGVH 3ULVD 4N5ED 4N8CH 4G43A 5LKNA 3BGFB 3TBVA 1J1XL 1S9YB 4YEFA 1QHOA 2DQUH 2ATKA 3NTCH 2OS7A 5INCA 3QFJE 1BZQK 2CLRA 1EHAA 2UZIH 1XGYL 2XWTB 4ACPA 1WEJH 1XF3A 4PJFE 4JFZH 3V8CA 4XVSH 1G1YA 4XRCB 1OGAD 4NWTH 4TSBH 3RUGB 1A22B 3ALWA 5KVEH 2IADA 2DIAA 4UNUA 3I6LE 5C0GA 1EUTA 1FIEA 1A0QL 4LCCC 3FTGA 1S7WB 2WWKO 2R2EA 3SE8H 1AGEB 1JI1A 4XTRC 1ZGLA 3P40A 2Q3ZA 3HE7C 1V05A 2BHYA 4JQIL 1UZ6F 4DKAA 2VC2L 4CVXA 3H3PL 3VXQB 5DQ9A 2X89A 1KIQA 2F19L 4MDIB 2JIXB 3SBWA 1RUKL 5C0GB 5DUML 3V7AE 3KNBA 3V6ZA 5DK2B 2PETA 4OCLC 3FONA 3IJSB 5MENE 1RU9L 2V17L 1J5OH 4G3YL 4L4VE 3SO5A 4I3RL 4N8VB 3CVHB 4D0DB 2EZ0C 5DJ0A 4WHTB 2QBWA 3MLRH 2R0WH 3QEGL 4HQQL 4MQSB 2HTLD 4ZSOE 4PLJD 5GS1B 3BDYH 1UM5L 4XP4L 1S9VA 4DZBB 4HK3J 1JNNL 5DLML 1FO0L 3EO0A 1NC2B 2IJ0C 5BRZB 3G6AA 1EEQA 4FFVD 5E08L 1MJUL 1RZ8A 3LKSA 4MHHI 4EZMA 4WWKD 4GAJL 2DJ4A 1JZ8A 4PJIE 4CDGC 4HLZG 3CX5K 4QRPE 2Z31B 5AYQA 4UT9H 5EPMB 5GRVL 2A9NH 3GMLB 3VD9A 1KBGH 1BEYH 5HHMD 5TPWL 1QFUH 5BQ7B 3LMJL 3L5JA 3H42L 4MVBD 1TCRB 1DBKH 1OQXA 2XTLA 1WIUA 2ADFL 3PQYD 3UBXA 4YHOH 5GJSL 3WNNA 1MQ8A 2AEWA 4LU5L 4QRUA 2XACC 3KPRD 4X6DB 5FM4A 2AI0H 4PGBB 2XTJB 4LPXA 1BQSA 4JPWL 1NCWL 3P11H 4APQA 1DEEA 5FYLH 3FB5A 1QSED 3E6FA 4U33A 3FO0H 2EYTA 2ORBL 3FONB 4LCUA 4LEOB 5ADOL 1PW3A 4U6VH 1HH9B 2CDEB 1YMME 5A40E 5D7LA 4FQCL 3D85B 1ORSA 4NM8L 3V5HA 1OTSD 3EJYC 1A1MB 5IR1A 4ZPTA 4HXAH 4TRPL 2Y06L 1KEML 1SEBB 5EN2B 4QEGA 4WUUE 3ZTJH 4FQ2H 3VXSB 3WNKA 2H6PA 3AM8A 2P8PA 2OX5A 4DZBA 1IFHH 4YAQB 4YPGB 4PJAB 1AP2A 4K3JH 3MCLH 3CMOL 2YK1L 3VFGH 1MVFA 5E1HB 3ZKNC 4I3SL 3SOBL 5JR1H 2ZNWA 1MY7A 4N8VG 4XNYH 3S4SB 4XX1E 1Q9OA 2FX7H 5IHBA 1LE9B 1RZJL 3MRGA 5ACLA 2ZUYA 3G5XA 1R3HB 3T77A 4OLUL 2Q8AH 4MJID 2FB4H 2XV6B 3GHBL 1KIPA 3O2DH 5GGSA 2H26A 1RQ5A 3MGTB 5HYFA 1QFWI 1WFNA 1CIUA 4QHLB 2DI7A 5D6DC 4LLYA 2EDXA 3B9KC 5DHXB 1NPUA 1OGTB 1LD9A 3DHJA 3OKOA 1FJ1B 3FOMA 2I24N 2AK1L 2B20A 1G7PB 3UC0H 4OB5H 2AEQH 1FVEA 2NW2A 4Z5RA 3MGTA 3G04A 3TO2A 4JRYB 4AT6B 3L7FB 1AH1A 2X4NA 2KQMA 1FL3A 2GSGB 3VG9C 1QZ1A 1INEL 1JNHA 3MRMB 2G2RB 2NR6C 5D6CB 3PHOA 1WBZB 1BIIB 3FO0L 1RAMA 4KK6D 3MX0A 3QHZH 1YUHA 2ATPA 4PGCB 4JVPA 3O8XB 5EUKA 2VDQH 2B0SH 1RUMH 4MYWB 2P5EB 43C9A 2EDWA 1L6XA 1D9KB 1LO3L 1CGYA 1FL5A 3DX6A 1BMGA 3DX9A 3NA4A 2AK4A 1M05A 3F8UB 3FN0L 2A0LD 4WW2A 1YJDL 5JW4M 2P8PB 1FVDA 1X7QB 4WEMB 4GG6B 5KAQG 3X11A 1J18A 2NW3B 3V6BR 2DKUA 3BIAX 4XNQB 4G6AD 4V1DD 1S9XA 3VW3H 4HUXA 2MMXA 5C3LD 4LHJB 1V3LA 2VDPH 2HN7B 4RMUA 4F3FB 2JB5H 2HMIC 3HNTL 1H3UA 2IQAA 4D94A 2B7DT 1LE5A 3VGAC 1G0XA 2Y4SA 3PV6A 5DHVH 4AIXA 4Y5VA 35C8L 4B0MM 4NKMB 4JPIA 2FEDC 2W38A 3K8MA 4IJ3C 1I3VA 1Z9MA 1NMCB 1PBYA 1XGUB 4LLMB 4X5WB 9CGTA 1MFEH 2GUOA 4BELD 2VLRE 3RWGA 4CNIB 5F44A 4DN3H 5E6ID 1LE5B 5DZOA 4F33B 4Z95L 5EOCJ 4P23B 1JRHH 1VFBA 4XC3L 4P46A 1R5WB 1SBBA 5GGVY 4F7PA 5FUOH 4Z7NE 5TDOB 4JRXD 4OCXH 5C92A 4WHYG 3CDYA 4QLRA 4Z78A 4NUGH 3QPXL 1PJ9A 2AQ3A 2LAAA 5MEPA 4JRYA 4AT6A 3HLAA 4X5WA 1RIHL 2DD8L 3R06B 1YEHL 4NN5C 4U6XA 4PBXA 5L88H 5DJDA 5EB9A 3K2UL 4Y5YB 5CCKL 4D9RD 5C07A 3D69A 1K8IA 2DMBA 3VRIB 1IEHA 4OZFB 4R0LA 1ZV5A 2HFEB 4YXHL 3VFOA 5EZOL 2AKRA 2P5EA 4CBPA 1MCPL 3HE7A 2R29H 5A1AA 3ARFD 2IBZY 5CD3A 5ID0A 5L8LB 2DIJA 5EU5A 1NBVL 2OTWB 3P4MB 4NM4L 1H3GA 3LS5L 4IRZL 5HDQH 3ULUH 2J6EA 1AY1L 3S36L 4F2MA 3FFCE 3EZJB 4D9QE 1E4WH 4NWTL 4OGYH 1YA5A 4P46B 3GJFH 1E28B 3BHBB 2VKWA 3IVKB 2Q7NA 3WD5L 4JZOA 3HMXA 4MA1C 3V0WH 4OZGB 1AD0A 3M17A 3VRLF 3QNYB 1YEKH 5D1QB 4WV1C 1BPVA 4AIZA 3B5HA 4ELMB 3A67H 4G6MH 1QA9A 2EH8L 2YN5A 1C5DB 4M62H 2F54D 4V1DB 2VL4A 3MRNB 2P4AB 5INDB 4P2OC 3MMEB 4Y8DC 5GZOC 4B7LA 2XTJE 5JDJA 3QFJD 5AZ2H 4LRIA 3T0EB 3BOVA 3F12B 1D5MB 2HG5A 2XTJD 1S5IL 1IKFL 3FO2B 4ODWB 4HAGA 2AXGB 5HGBA 1A9EA 5IESL 3TVMB 1IAII 4PYGA 1BVKB 4KAQL 2WLZA 4WU5B 1EEYB 5EOQL 3QJFA 5HJ3B 3QI9D 4GJTB 1ZA3A 1B3JA 2OQJA 1AXSA 2FWOA 5ALBL 1B4JL 1FDLL 4YHIB 4MQXD 3MYZA 3K4AA 4KY1L 5AAMA 1XMWA 4NO2A 2G75A 4ZNEE 1J0IA 2A6IB 5F1NB 2WIIB 5JQHC 4U1HB 4PJEA 4J3VA 1N3NB 5DJZB 5JHDB 4OT1H 2AJ3B 2VDKL 3S96B 2ITDA 1HKFA 3MV7B 4NUJB 1AHWB 4QXTB 4IDJL 4AMKH 1EHLH 4MAYD 3SDAB 4P9HH 3JUZA 1BD2D 1QSFB 4EUPH 3W82A 4QHMB 3QUMH 3FL7A 3HE6B 3IDIB 5LXGH 5GS2D 3KR3H 3EOYG 1DL7H 4NO3B 2V2XA 4XHJD 3LPGA 1BWWA 1LO4L 2WIIA 1YNKH 1NCCH 4GW1B 1FE8L 5L2KD 1KJMB 1AC6A 4I3GA 5ALCH 1TXKA 4MJ6A 1QRNE 3MNVB 4S1QL 5I16B 3MO1B 2E5EA 4M1DH 4BZYA 1I4FA 1DVFD 2R9HC 1YYLH 2EKJA 1IEBA 1CDGA 2R2EB 2YA2A 2LVCA 3QJFB 5HJ3A 4RQQB 2EC9U 5C70A 1KELH 4P4KB 1TNMA 1NMBL 1DANT 1FFPB 1WZ1L 5DRNB 2R4SH 1F02I 1DFBL 3VXMB 1WCBB 4ODSH 5M95B 1I8MA 3D3VB 2H8PB 2YBRA 3C60D 4PTUB 5CINH 2DQFA 4R97B 4U1KB 3BISA 5DK2A 4B50A 4ELKB 1YEJH 4NUJA 2UY6A 5E1AB 5DZLA 1PX3A 4RDQF 3ARXA 3VFSA 1C7TA 3O3EB 3NMEA 3N9GH 2BXYA 2AQ1A 4E41A 4ALAL 4UU9B 2BVYA 1M71A 3MACH 1AFVL 5B39A 1WC7B 1OWRM 2PYED 2QHRL 4CVZB 3K46A 2XT1B 3FQWB 4O2CB 4NUGL 5DMIH 5T5FL 4M7LL 2NX5D 4IBLT 1IC7L 4LCCA 3PWLB 5E2TL 1X44A 3EO1B 4M8QA 1TZHA 4NFDA 1B0RB 1GGBH 4MHHG 3WUWB 4ODHH 3TCXA 3BD3A 1A7RL 1FSKB 2JELL 1YJDC 3BAEL 1MAKA 4LRNH 2DLFL 1K4DA 3UCRA 2ICEA 5F9WB 1FFPA 5DRNA 1BOGB 3QHTC 4OFDA 3GM0A 5KSAB 1GC1C 4PTUA 3NPZB 1YNLL 1WZ1H 3D2UD 1YPZF 4WO4A 1V5JA 1BVLA 4X7SH 1VGKA 4LSVH 1MNUH 4XPAH 5F93C 3TBVB 2X4UB 4DGVH 2GY7B 1J05A 2VN4A 3IFNH 1N0XH 3PDOB 1S7RA 4LF3A 5GGRA 2P44B 2EICA 2FECL 5H8DA 5E56A 1XCTB 1X5JA 3RVTD 1BOGA 3NFSL 5C2UB 3OKDB 5H37G 1VA9A 3NABH 5B38G 3MV7D 3HC4L 5F7WC 3CNKA 5C3TA 2X6MA 5HY9A 1DE4B 2P47B 4EN3D 1OSZA 3PWLA 4FQHB 3RWDB 4LCYA 3CLEL 1ZLVH 5DRWA 4A6YL 4XNMB 3V9FA 1FLRH 4WFED 2ADGB 4O9HH 1VKXA 1RMFH 1OB1A 2BK8A 2CDEA 1HH9A 4MS8C 4L3EB 3GMNB 5D70H 4RFEA 3IDGA 2AV1B 4M7ZC 2DTML 2GTZB 4LLUA 4G7VL 4N90E 2HWZH 1OSZB 4MNGE 2CSPA 4HWBA 3IAQA 2LV4A 4FABL 1WWWX 1JHTB 3V6OE 4OQTL 3SPVB 4ODVH 3UBXI 3FQWA 3KS0J 4YPGA 4L3AA 4YAQA 3DARA 1XFPA 3L9RB 3KPTA 4NRYA 2F54B 4X8JA 5JXEA 1RK1B 2YC1A 3QDHA 4V2CB 4X6CA 3QEQB 3HAEB 3O3BA 1ZGLB 4L8SA 3UZVB 4KGLA 2HT4D 5EC2B 3ZT6A 1NQBA 3HG1E 5TE4H 4WI9A 3BDBA 3G6AB 4TSCH 4LSVL 1X5HA 1EGJH 2VXVL 3BE1L 1MWAH 5CSGA 1GC1H 4OLUH 1GXEA 3ZTJG 3QXWA 1BHGA 1HHGB 4LRNL 3LEYL 3TBSA 4RGMB 2EE2A 2F58H 3UTTD 1NANH 1MFBL 3T3ME 5T33L 4K3JL 4PJIF 5DS8B 1U3YA 3QDMD 4HEPG 4XWOD 3MOQA 4KZDH 4OFYA 5E8PB 2ESVE 2P5WD 4NM4H 3ULVF 4FQJH 5D6CA 1FZKB 2QL1A 3PWVA 5C08D 5IEKA 1LD9B 5T3XL 4PJ9D 4MCZB 4WI2A 3SJVB 4HH8A 43C9B 5ADPH 2YUXA 4LHQB 2PCPA 3HAEG 3KYNA 4ORGA 5IF0A 4HJ0C 1AGCA 5MERA 4EN3B 4OD2A 4XI5D 3RI5K 1RIVH 2WUBH 3EO9L 2J88L 2E9BA 3KWWA 1OTTD 3QDJA 1F8TL 3SKJL 2R23A 3GJFA 2VZSA 1KCSL 4N0YL 3REWA 2O61B 3E6HB 3MLYL 2ZCHL 1KTDA 4KXZH 4PJXB 3SDYH 5JO5B 4NZUL 2WIMA 4S1QH 4Z95H 4JFFA 2X4RB 2ZJSH 4ZTOL 1G9NH 2HVJA 3H42H 5DRXB 5KSBA 1FL6B 5I1HL 3JV5A 1UCBH 1U8NA 2KPNA 1N6VA 5CEYB 4LIQH 4O5LL 3RRQA 2VXVH 4TVPD 1G1CA 3S3JA 3UPRB 1PG7W 5KN5A 1NSNL 4RMRA 1EBPA 2NX5B 3JSSA 3RWCB 4JHAH 4EOWL 4HULB 4KMLB 3WFHB 2D9CA 1N5AA 4PG9B 1BOYA 2OK0H 3FT3B 3MQIA 4M6NL 4NO5B 3VWKC 4TSAH 3MRFB 3AXLA 2OP4L 5CEYA 1TJIL 5F96L 5LCVL 3O2VH 3P0VL 1FJ1A 2X4TA 3FOMB 1CVSC 3T4AB 4JY4B 4MWFB 1MQKL 4FXGA 3VD3A 1MUJA 4OQTH 3FN0H 4L8DB 4KAQH 4ZYKB 2Y7QA 3MRJA 3ULUC 2FYYB 4EIZC 1J0YA 1NL0H 4X6BB 5JO5A 2ED9A 3T1FB 4JE4B 4DUWA 3B6SB 4I3RH 4HSQA 1ZTXH 2I25N 2HRPH 3G5XB 2J8UE 3GMOB 5IB4A 1CDIA 3WFBL 5CJ5A 5BV7L 3U7YL 2CPCA 3BYTA 3F62A 4JAMB 2ENYA 3RJQB 4URTB 1FLRL 5DJ8B 5HGAA 1G7MA 5HI4C 4HKBB 4GG6E 1R6VA 3NACL 3WN5C 2BMKA 1IKNA 2PYFB 4OFPA 1CGWA 2I07B 4O00A 1YDPB 2BNRE 4NZRH 2DWDA 4QTIH 3RX7A 4WNQA 3FT3A 4LSUH 4G9FA 4PJ7F 4YDKH 1OAYH 4OZFA 2APFA 1KCKA 2WQ8A 3SKOB 5IB2A 1TTUA 5DJ8A 1P7HL 3ULVE 2CRZA 1WBYB 1ZVSA 4QHKI 3L7FA 1H3VA 4HWNA 1AQDB 1E4WL 1ZXQA 3BH9A 3TWCL 1J8HE 3JWDL 4BK4A 1AY1H 3B9AA 4M93C 2CK0H 4WFHE 2FD6L 1NGYA 1GVIA 3RDTA 3MYJA 4HMDA 3N85L 3B6SA 1OGAA 1MEXL 3QCUL 1CT8B 2VISB 1LO2H 1VPOL 4MXVF 3OKYA 4N0UA 5J7CC 4KZEH 3MXWH 1QRND 5FHAL 1WBXB 4N8CL 4U1JB 2QSQA 5LGHH 4F58L 1KF9B 1GGBL 4E5XB 5IW6A 1NEZB 3AXLB 1NC2D 2ZUQB 3C2AH 2YPVH 5DQDL 2R56L 1ZWIA 5AWNH 5E00B 1Z9LA 4JFQB 5BW7A 3L5XH 4Y16D 4OIBA 2IANE 4B41A 3KPMA 3W39B 4Z7WF 1AD9B 4WCYL 2Y06H 3MLTA 3P77B 2D0FA 4TQEH 3N9GL 3WJLA 3BQUA 4P5TC 4OIAA 4DN3L 4XMKL 2CLVB 5I1EL 1FYTD 1NGPL 1Y0LB 2ORBH 1HQ4B 1TQBC 4PPTA 3PL6C 4LARL 5F70A 1N5YL 1JWUA 1LP9A 1R5VA 4LASH 2IC2A 2PYEE 4HKBA 4ODTH 3PQYB 1CFQA 3T2NL 4FTVB 1B0GA 1NCWH 3P11L 5GS1C 5HHMB 1I7ZB 2XA8L 4JREC 1U3JA 1GJIA 5A2FA 4UMGA 1O0VA 5GGQH 4D0BB 3KYOB 4NBYB 5L9DL 5EORH 1KJMA 3EYFA 1HQRB 2YR3A 1QFOA 2YPLA 1NFDE 1BZ7A 1ZANH 1TENA 4XNZB 4KKNA 3VI3F 1A5FH 1WBYA 4P2RA 3QUZB 1XR9B 5CGTA 4F9PC 2OJEB 8CGTA 5LWYH 1YNKL 3S37H 2Q7YB 5C2BH 3O3DB 4U3CA 5D8JH 4JGMA 4FZEH 1INDH 25C8H 1G0DA 4PBWD 3KDMB 3P77A 1ADQA 5H35B 4YXKH 3RZWA 5FYLE 3REVA 1E4XL 4LCWA 1SBSH 1F97A 5TDNB 3QQNA 1KT2B 1T66D 4UTBH 1VCAA 5ID1B 1A4JA 4NPYA 4QHNB 1EVTC 2BY1A 5CMAB 4YHPA 3GBNH 2O5YH 4Z78B 3F5WB 4S1DC 3CPLA 1S3KH 3LQAC 2X1PA 1MJUH 3QDMB 4BFIA 1PEZA 3KPRA 3WO4B 4OLVL 1A14H 4P2QD 2APVA 5J13B 5FYKH 4OKVB 3T2QA 1B0GB 3PP3K 1EFXB 2UWEE 1PEWA 4QNPF 1S5HB 4JM2B 2PF6A 4JPKL 4H20L 1BBJB 3WV0A 3MRDB 1I9EA 5I0DA 5D7IE 3ZE0E 2VXTH 5JDSA 4LK4A 3MLRL 1CE1H 3R1GH 4ZOAA 4EVNA 2IAMD 4M48H 4M8QB 5FK9A 1S8DA 1X5YA 3T2OA 4KMTH 5CGYD 1EFXA 2VQTA 4NKOB 4KI5E 4CKVX 3O3EA 1FV1B 4K94H 5IEHA 3WLBB 3M17B 4OGAC 3CSGA 5JOFB 4CMHB 1F5WA 1T5WA 2DQJH 1FBIL 1HSBB 4EKXA 2YXMA 3AB0B 1GHFH 1NKOA 4JKPH 3IDUA 1KT2A 4HFWA 4WO4B 3QFDB 5J1TC 3HI1A 1WICA 1A6ZB 4N1HB 4PRNB 2JJTC 2R8SL 3WSQH 1KB5L 3H9SE 5ESQB 3QUKA 4JDVB 2X40A 1K3IA 3FRPG 5DFVD 1BFVH 5FAAA 4G7YL 4NQSA 2V2XB 3OWEA 4XPTL 3GSRB 3MODH 3QHFH 2RQ8A 1C5BH 1CTNA 3DGGB 2ZKHL 4H20H 1GZPB 3TFKC 1JGLH 1HK6A 4LCYB 3RTQC 5CSZA 1VGKB 2WLYA 4LNRA 4U1HA 1RFDL 3CMGA 5C0BD 5C86A 3CFCH 1VKXB 1CZ8L 3AFLA 4AL8H 1XZ0A 1T20B 2YPKA 4FXKB 3RVWC 5BS0D 3UJIH 4U6VL 3I3DA 4HZLA 3TO4D 2EIZB 4QHMA 4UIMB 3OXSA 1JTOA 4LNRB 3G5YA 4HCRH 3I6KA 2VIRA 4WDIA 3QXDB 3U82B 5SV3A 3QPXH 2YPKB 2A6IA 4FS0A 4IEFB 5IROA 5D7KD 1N2RB 5J6HA 1D5ZA 1RZKH 5FK9B 1A6VL 4OV5A 4PS4L 4QCIB 4Z7QE 4UDUA 4N1EA 2UWEA 3FQNA 4PRPD 5LCVH 2AK4D 1QO3A 3Q1SH 4MA8H 2Z4QA 3LMJH 3ROOA 4MVBC 4TSAL 3ULSA 4GBXD 4X7DC 5HGGS 2VDMH 1NMCC 4PJ5A 2NY5C 2AJXH 5D5MA 4ZNCD 3HZKB 3HZVB 2APBA 4L9LC 4UDTA 2DWEB 2EEAA 3QEQE 3HI1B 4X9HA 5C0RL 3NOIA 4Q6IB 3MBXH 4YDLB 4Z0XA 4NOFA 1DN0B 3EOBA 2VQUA 4JFDA 5FGCE 1JF1B 5E6IB 1ITBB 2NY0B 3KYMA 3OAYH 3MOBL 4UB0L 4ZPTB 3RWHA 2N1KA 4NNYB 4KGJA 3OB8A 3C5ZA 4Q7DA 3ZDZF 2VLLA 2PNDA 4YIQB 2BVEA 3G5YB 2BDNH 4L8BB 2CR6A 2FCBA 4LPYA 1FO0B 2YPLE 4Z0XB 4R26L 3IGAB 2D4DA 1WV7T 3C6LC 5GIRB 3L3KB 5GGQL 3RY5A 1HHGA 1T20A 1CS6A 1M7XA 1IAMA 2XFXA 5C6TH 5IB1A 1BM3H 1KIQB 3QIUA 1U6AH 3IXTA 2B1AL 1NAKH 5GRYA 1V8HA 3OXSB 4W81A 3UTPE 1L9MA 4MAUH 1QEWA 5T3XH 3GSNH 3MGOA 3TESA 2ITCB 3PHSA 2QADB 4WDIB 4BZ2H 1DQDL 4LFHG 3QCVH 1U8IA 4QRRE 4PRID 2DOCA 1S78C 2DQEL 4TNWK 2JJSC 5BS0B 2L4OA 1HE7A 4F8TA 3U0TB 5HYJA 3B9KA 5T3ZD 4GRWB 4P2OB 3AU1A 2AP2A 4HGKC 3QXAA 4HXBL 3MUHL 4ZO8A 1PKQB 4D8PB 2X4UA 5MEOA 5C0CB 1G7QA 3O6KL 4WJ5A 2AW2A 3AAZA 4PY7B 2R1WB 2IEPA 2NX5E 4L3EA 2MPAH 2BXZA 4XTRD 2NZIA 3FQUA 1GH7A 1M7IB 2CH8A 7CGTA 3WHXB 1EGJL 2R2HA 2NW2B 1ZTXL 4OZFH 1KEGH 3VRJA 5SWZA 5JR1L 4KH2A 3V4PH 1MRFH 3WXVL 3JWDC 1LGVA 5I1LB 2HFTA 1VDGA 1SVZA 1WIOA 3IFOB 1BIHA 4Z7VB 2KZ1B 3V4VL 2FL5A 5C8JA 5A3ID 4QRPD 2PXYA 4K94C 4MJIB 5F6IC 5I8KL 1OTTC 1I7UA 4PY8J 4XCYA 3WIFA 1TJIH 2BNQE 4L8SB 3PIQB 3OTTA 3SCMB 4L9DA 4JFXA 2W0FA 5JIKA 4GKSA 4PJAE 3QXAB 3QSKB 1J1OL 3WHE1 1X6NA 1NJ9A 5GGUA 4JHAL 1FCGA 2R4RH 5A2IH 1R0AL 1IM9D 1FNLA 5D72H 2MSPA 4YE4H 5HI5D 3VWJA 3MRBB 5GRVK 1XGUA 4NRYB 1EO8H 2HT2D 1ZS8A 4HFUL 4XCFH 4QTHB 1MRCL 5GGVH 3IU3B 3OGCA 5IGXL 1YNTB 4I18C 3T0BA 2EIBA 1K3ZA 3QUZC 1AGCB 5DMGD 5MERB 3DVFA 1MELA 4XXCC 4QNPE 4RAHA 4P4KD 4BKLB 1IM3B 1FIGL 3R4DA 1AJ7L 5JPMB 1MHEB 3EDKA 4HD9A 4N0YH 1T1YB 3PHQB 4M7JL 5IMKB 3LSOA 3LN9A 3VXRE 4Z8FH 1T0PB 3BN9C 2V5SA 5L2KA 3JV0A 1HIMH 4Y0GA 3VG0L 1UZ8A 2DAVA 2VXSH 3ELAT 1IGML 5IVZA 1M7IA 3DJ9A 4R7DB 2OTUA 3I6LD 3GMMA 3JXAA 4H1LB 4IS6B 5GGSB 5T1LB 3T0WA 1F3DJ 3FHQA 1OP3H 3IRPX 1KCUH 3GSOB 5EOCL 4PJAA 4X0KA 3ARYA 1FSKC 3H9HA 4K3EL 1RVFL 1X6LA 4QT5A 2BRQA 5C0BB 1L7TH 1DUYB 1EDQA 3CFJB 4Z7NF 2YEZA 2BERA 2I26N 4KPHH 4NNXA 3U4AA 3ARFC 5F89B 2WQRA 4FN0A 3FQTB 4OF5A 3MC0A 4PGJA 4ZFGL 1WAAE 2AJVH 4YUEL 1ZLUK 2X4TB 3DROA 1WBXA 3CFBA 2QHRH 4HS6B 1CFSA 1IAIH 5JXEC 2O5XL 3KPLA 4E41D 1T83C 4ZYKA 1UM6L 4NC1C 4ONOA 1GPOH 1AQKH 4J12A 4PJXE 3QNYA 4DVBB 1ZLVK 4OZIB 1L9NA 4NCC1 5EOCH 1MWAL 4HIHB 2F19H 3HS0B 3P3YA 2NX5A 1Z6JT 4OTXL 3ZTNL 3OV6A 1KG0B 3D0VB 1XF4A 1AD9A 4PJDF 4HS6A 5HGDA 3DV6B 3KYAA 3TO2B 1D6VH 1NMBH 3OZ9L 1S7TA 2WWMC 5JMRA 1KLUB 1QYGH 5D2LA 2EDFA 4KHTL 2M2DA 1MHEA 5FCSH 3V0AC 3U4EB 1DQDH 2ZUWA 3VXRB 2IFFL 4YFLI 4PRDB 5LJYH 2NZ9D 5I6XB 2GJ6A 5DZNA 3QNXB 1QNZH 3GMOA 5F1IB 5IB4B 3OF6D 5IVZB 5F3HA 1IJ9A 3PP3H 2YXFA 1BLNA 3PL6A 4ZXBC 5IJVB 1HOCB 15C8L 3T65B 3F6IA 3GSOA 5JW4R 3X3GL 4D3CH 3LS4H 4HV8A 3IDXH 4IRSC 4L8DA 1HXMB 4JREB 5ITBL 2P5WB 1U0QA 2UUDK 4O58L 2DWDB 1BFOB 2ZCKH 1MCOL 3FB7B 1OT1A 2FX9L 4XAKE 1K8DA 1KPUB 3WNPA 1VFUA 4C56E 4QWWC 1JNJA 3RKDC 2LU3A 5MEPB 2BC4B 4EIGB 4EBQH 3NFSH 3EO0B 1U36A 4J3TA 3TLRA 3QUYB 3CAFA 5K9QG 4DZ8A 5IMMB 4XVTH 3JTTB 1DSFL 4P5MA 5SWQB 5I0ZA 5EBWB 1BFSA 4XNUH 2FRGP 2O5YL 2ADJB 2CLVA 2W91A 3PDDA 3BP6B 2ZPKL 4AEFA 3DV6A 4DN4L 3P4MA 4OM0L 4HLZH 3G5VB 4U1NB 3CH1A 4R2GD 3HC4H 5SWSE 1OGAB 5F7MC 4N68A 3LKRB 2Q8BH 1KCLA 4PJ9B 5I1CL 1CD1B 2DQEH 2NTFB 3SGEH 4J4PA 3P0YL 3UJJL 4HBCL 4PYHA 4HEME 4U1JA 1NCBL 1NUFA 2IPTL 4XPAL 1U95A 5FYJL 1MCBA 1BLNB 3BZFB 1QBBA 2NYYC 1RIUL 2C26A 3H0TA 3JTTA 5IBLD 4KRNA 5DYOA 4KRMB 3CFCL 1H3PL 5CINL 1YYML 2VYRE 3A6CL 5C09A 2YD8A 3FFDB 3CGTA 1KIRB 3K3QA 1S9KC 5DVOA 3M1BA 4KJPC 4PRHB 1N64H 3A0OA 3SCMD 3I6KB 4XBEL 4NDMA 5JZ7C 1J88A 1C5BL 5E9DD 1IGIH 5IBTH 3SO3C 2QR0B 1AKJA 4RX4A 1YEHH 1AR1C 1DBJH 2WUCL 1FZOB 3TA3D 1HXYB 3UTSA 5ISZD 4NZTL 4X7TA 3TNMA 4NO0B 4OZ4A 1U2CA 5HHQA 2CRIA 4DFHA 4ALAH 1J7VR 4R4NC 3OX8A 3RA7H 1F2XK 1CG9B 2WBJD 3LQMA 3IJSA 1RUAL 3RWJA 4LSDA 2X4QB 5LGJA 2HAZA 3MXWL 5FHAH 4KUZL 4Q6IA 2H26B 3H0TB 1MAML 4FP8H 5EA0L 3BWAB 1A21A 1UH4A 2J12B 4EN3C 1S7VB 4U1SB 1CGUA 2FBJH 3TH4T 5HGHB 3PABB 3HNVH 4BH8A 5KAQF 3JWDH 1FNHA 2CIKB 3IFPB 1T1WB 2Q87A 3DGCR 1HWHB 3UJJH 3QRGH 4P2QE 4PGEA 2Z35A 4JG0L 3QIWC 1RZ8B 2P24B 3VW3L 4K8RH 5IESH 3OL2A 3HAEA 3IDGB 1FFRA 1UKTA 4KROC 4CVUA 4OLVH 3LQAH 3HZMA 3OB0K 5KVMC 2FO1A 3SQOL 4R6UA 4TTDD 3KPRE 1BQLL 2V7NB 1IC4L 1FFNB 3QPQC 4AMKL 3WS3A 1QBLL 1MJJA 2G5BA 2W9DH 3BRFA 1U2HA 2A9MH 1RZ7L 2VL5B 2YA1A 5D93B 3VFPB 3Q48A 1CL7L 4QXUL 2AK4B 3W9DA 1KB9K 1WQVT 3BKJL 3OHXA 4GMTH 1KJ3H 5I8EB 2CIKA 2X7LB 3TNNA 4JO1L 1TNNA 4PG2A 2P8MA 3STZB 4MD5A 5CJOL 1LEIA 2BVQB 2XA8H 4LDOB 4DKEL 3HE6D 1ORQB 1YY8B 4G9FD 3CFDB 4XPFL 5DDHB 3OG6B 3UX9B 4OF0A 3OJMB 4LL9A 4X9GA 4LARH 2IH1B 3GO1H 3ARWA 3BUYB 4G6ML 5FM5O 3MRIB 1X5LA 4YNYA 1MIEL 2AXFA 4OLEA 2W1NA 2AJZA 3N0PB 2GJ6E 1U92B 1P4BH 3SE9H 1DBAH 4OD3H 1AGBB 4KKBC 4KVNH 4U6YB 2M1KA 4NN5B 4CU6A 3I84A 5EC1A 4LOUD 1K2DA 3H9YA 5K59E 2X4SB 3RGVA 5JHDE 4P46C 4X9IA 4KPHL 5KSBF 2SEBA 4HW6A 5CJXC 5C0NC 3WHXA 1JRHL 5EOTA 1IARB 2XWBA 3V52H 3TH2T 3F7YA 2JJSA 3GK8L 3ARBA 1H3PH 3KXFB 4X98B 4L9LA 5C0AA 2DN7A 5GS3A 5GGRB 5DA4A 1NDMA 2V5YA 3MBEC 2PYEB 3K4DA 2W65B 4PLJC 3PNWA 5CD3B 5E8NB 2X9WA 5DVMA 3G6DH 1I7UB 4OGZA 3DV4A 1U93A 2AXFB 3T0EE 1FYTA 3KYKH 3MA9L 3S37X 5KSBB 4JRYE 3MRLB 5GPRA 2Y6SD 2RHEA 2Z4QB 3ARBB 4JPWH 4OF7A 1AGBA 1ZHKA 4OIIH 3R0NA 4Z8FL 4NFBA 4ONHA 1I9IH 4HPOH 4PJ5B 5DK0A 4YDKL 2V9TA 4RWYH 3HRPA 2XWJA 2WINB 2FIKB 1YJDH 4XC3H 2X4SA 4Y88A 1EJOH 5DSCA 5F9OH 3G08A 4P2QB 3PWPE 4PY8I 5T3ZL 4HIIB 1LQSR 3QNZB 3TIDB 4P2RD 3TV3H 4KKLD 5C0JA 1U8LA 1HKLH 5EBLB 3ZYZA 1EJ6A 2GSIA 4LASL 4ZMAT 5TH2A 1WF5A 3V2AR 4HT1L 1F00I 4FFZH 2Z8VC 3WUZA 3K80A 3BH8A 4QRQB 1WSST 4Y4KC 2LTQB 3BJ91 1HIML 2C1PA 3O11A 1YQ2A 5HYSB 2BY0A 5EU6D 2I07A 1E6JL 3ZKMD 4UOJA 1KJVB 1OLZA 3LDBC 2IQAB 2NR6D 3VXUD 4R90L 2H6PB 1IM9B 3S88L 1EX0A 2YHGA 5HPMB 2QADC 4DEPB 5HI4D 4P4KC 5FUCE 3ZYIA 1AXSB 1XCQB 4GLRI 2AVGA 4U7KA 1R24B 3MV9B 1PG7H 1N26A 1MLCB 1U8OA 4FFZL 3PWPD 5FV1L 2JB6B 4B5EA 3RWFA 1JYWA 1LHZA 3DSFL 4JM4H 4HIIA 4BFGA 5L8KB 2BOBB 2IAMA 5HDBF 4JGUA 1X9QA 4X99A 2FGWL 4IRJA 2F53E 3DXAB 3BH8B 5SV4A 2FD6H 3L7EA 5E94B 3V6FB 3KLAA 2NLJB 5D2LB 5EZLA 3CX2A 3AC0A 4P9HC 4N9OB 5EO1B 4PJDB 2ZOLB 1JWMA 3B9DA 5ICXA 3DRTA 4POZD 4XCYB 1RIVL 3QWQB 3OZ9H 4RQQA 2YWYA 5KW9H 4DKFH 4HUVA 4FQIH 1XCQA 4KK8D 1GOGA 1N59B 2VITA 2EE3A 1KN4L 4ODUA 3LZFH 3BZEB 1LP9F 2D2OA 4PJ8D 1YNLH 1WFUA 5ENWA 2H1PL 2VR5A 1IAIM 1CD9B 4MXVE 3GK8H 4X4ZA 3P4OB 1KTDB 3RI5F 2C1PB 3QQ4B 4P5TD 3UTTE 3LV3B 4AEHL 3UTZA 1CICD 4XXCA 1KSRA 2P45B 2DQTL 2YK1H 3LIZL 4AEIH 3TH3T 2GSGA 4JLRB 4FTVE 3NAAL 5JA8B 3BVNB 5T5FH 5HPMA 4QHKJ 3UTOA 3C8KA 4FZ8L 2HRLA 5GISH 1G6RA 4KJYA 2ZG1A 2FZ3B 1RJYA 3PWJA 5I19L 4XCEB 2UZXB 2YUVA 4Q6IC 3KLHD 1N5AB 5EBWA 4WFFD 1UZ8B 3G6JB 3IDMA 1CF8L 5MENB 1YEDA 4UT6L 1PZUB 3ZKXC 1X5IA 4ODWA 4JO4L 4G6AC 5TE4L 1J10A 5KANG 5HGAB 4PRPA 3HG1A 5FYLL 1BM3L 5I1GH 5D2LF 4ZOCA 3AMLA 1S9XB 1EK3A 1FRGL 1TITA 4DKEH 5EZLB 4GBXA 3L1OL 4I9WE 3HZYA 2ESVB 3CD4A 3CUPB 4I48A 1RSFA 3BZ4A 1PG7X 1QR1A 4S1DD 2ADFH 1W8OA 4JFDD 4MDIA 1T0NA 5DUPH 3BKML 2B2XL 1EAJA 4S1RH 1WWBX 4QWWD 5FDWA 3U2SB 2D7TL 2ID5A 5IHUH 3FMGH 4MX7B 5GZOD 2C4FU 2FIRT 2J4WL 3HZYB 4F15B 4YC2B 3CH1B 3DSNA 2C7UA 2I27N 3QIBD 4WFFE 1OM3L 1B2WL 5EULV 1ED3A 5ADPL 4M43H 1RJZB 3BEVA 3AS0A 5HBBA 3QI9C 2CGRH 4E5XA 1FN4B 2BSSB 3RWEB 3I85A 2X4OA 3BXNA 3OAZH 5C07B 5EOQH 1SJHA 4C59B 2GT9A 3EYQC 1T04A 5DJYB 4ZUSB 4X7FC 4AG4H 3GSWA 1T03H 5ESAA 3WXVH 1SY6H 2BC4A 4XPHL 3FRUB 3EYSH 1RZJC 2YWZA 5C0BE 5F1IA 1YEDB 3VFSB 1RU9H 2V17H 1J5OL 2DYPD 1Y0LA 3TJHD 2BY3A 1S7TB 2A6DB 3NIGE 1TVDA 3AGVA 1QTYT 2EIZA 4N0FB 3BEWB 3IFLL 5HGHA 2EDYA 4LLQA 4KDVA 4XC1H 4ZUWA 1SEBA 1IGYA 3FRPA 2UZYB 1Y18A 4Q9CA 1CBVH 3MOAH 4X6FB 4QRPB 1QLFA 4YLQT 4LSQL 2EDJA 2P24A 5B22A 4M7LT 1CGXA 1IZKA 3PL6B 3MRQA 1EEYA 2UWEF 4XPTH 1F6AA 2FO4A 5F6IB 5LQBL 5SWZD 2Z8WC 4G7YH 2OI9C 1EEUA 1NLDL 2ZUXA 2XRAH 3L3OA 5FIEA 5D7IF 4MAUL 3ZE0F 5FCUL 3NA9L 4PJEF 2GJJA 5EZJB 1G9NC 2WBJC 2ESVD 4GXVH 5I66A 5IG7B 4G6FB 1A9EB 2C3XA 3KNBB 3VU2A 1MFAH 3I2CL 1FN4A 1R5IA 5E0QA 1NCDH 5D7JA 4MNHA 3UMTA 5CCKH 3ALPA 1JV5A 3FFDA 5BCAA 1BQLH 1W72B 2DI9A 1IE5A 4JKKA 3DUSA 2VLLB 1JGEB 3REWB 1W72H 1HHKA 5DJXA 4R3SA 1ZKAA 1KJ2A 4X6FA 3BPLB 1EHNA 5DEZA 1UJ3A 3SJVD 1BZ9A 2CD0A 3TYFA 2VUYA 4OV6F 4HWEH 5FXCH 3S5LG 3TPUA 3DXAD 1G7JA 2BNUA 4UQ2A 3K1DA 1MFEL 4P4KA 1KNOA 3SGKC 3AUVA 4JFOB 2VDKH 5DD3H 1JPST 1FNEA 3C6LA 3V4UH 1S3KL 3WHE0 2R9HD 3CZJA 4IOIB 1R3KB 5F71A 4PG9A 1XIWC 3MO1A 3PDGA 4ZNEA 5GS0C 2E27H 1MCJA 4CW1B 2YC1B 4ZUWB 3OR6B 5L7XH 3PXHA 1JIBA 2FH8A 2HLAA 3CK0H 4ORZC 3WIHH 3CDGA 3H2WA 4MCYB 3C08H 4K9EH 3UPAA 3T0VA 1OAXH 5D8JL 5EO0A 1HSAA 2D7NA 4P2RE 5I1KH 4FQ1L 4NJ9L 3Q6FB 5EUOB 1WITA 2FX9H 1R3LB 3R8BB 5ACZA 2X70A 3EGSB 2J8OA 5I71B 1UVQA 3DVNB 1G7LA 3GRWH 4PRHA 2GK0B 4WJ5B 2QQNL 2EXYD 3SDDD 4OLXH 1K4DB 1KXVC 3HE6C 3IS0X 3X14A 4JJHA 4PRBB 1LP9E 4ODTL 1CCZA 5GRUH 2BSRA 3Q5TA 3AREC 4AENB 3AM8C 3EDJA 4L4TE 2GUOB 1JPTH 5FB8B 3MGAA 3BO8B 3LH2H 2KBGA 4MJ5B 4Z76B 1KN4H 2O26U 5FUCC 3KPNA 2WNGA 3OKKB 3QDAA 4W6YB 4ZS7L 4CN6A 4YH6A 4N0CD 2Z92A 3QULB 4TULH 5HTSA 1KENL 3MRHA 5MHSE 4BFBD 4QOKD 1I85C 1RZKC 3ULVC 2H32A 4RMQA 3BH9B 3TGXA 4LOUC 1X5AA 5H94B 4P5KB 4QY8B 4GKSB 1NCCL 4NHCL 4YBLB 3MFFA 4TUJA 3EGSA 5FA4B 5E2WH 4Y19B 4I77H 3S4SG 4F7TA 1CVRA 4M5YH 5DQJB 5FGCB 5C8JB 2X2YA 2CMRL 2PTVA 2GYSA 1LO0H 3QO1A 5C07E 3DI2B 4FOMA 3E0GA 4FQLL 4PJXA 1UC6A 3QG6B 2CLZA 2GJ6D 1J8HA 4MMZC 4XB7A 2UVFA 1DQLH 1S7SB 4WGVB 1YEGL 1P7QB 3MCLL 1HYRC 3RIFK 4MDJA 1IFHL 5E95B 4U1IA 5F9JB 3WDJA 2F53D 2HT2C 1H15A 5JHLL 3HE7B 4YHYC 3IAGC 3GSQB 1AGFA 1Z5LA 3O2VL 1DLHA 2EYRA 3MUY1 2FJHA 1D6EB 3MLZH 4R96B 3FT4A 4XXDB 1NAMB 3QCTH 3W2DL 4NM8H 1MHPH 4CADA 5ECJE 4TUJB 4ONGL 2A6JB 1ZHLA 3GGWA 3U79A 3RZCC 2EZ0D 5CEZD 3UO1L 1H0DB 1HZHH 5J1AA 1I1CA 5C6WH 15C8H 4RGMC 1KTKE 4JO3L 5FDYA 3FO9B 5D1QC 1U8QB 4MD4A 4W4NA 4Q2ZA 1BZ7B 5JXAH 4LHUA 1OP9A 1BJ1J 1F3JA 4ZTOH 5HI3C 3MRHB 1OAQL 3ZE1F 1KCRL 5EZIH 3ARSA 1IGTA 2YD9A 3LN5B 5D7LD 4CMHC 3V7MA 5B3JE 1T2QL 1EEZA 1K4CB 4QKXB 4U7SA 5D5MF 1I8KB 3WKMH 2Y23A 5TPWH 5DRZA 1N3NA 5DJZA 1ZSDB 3GRWA 3ESUF 5T5NG 3NCJH 1FNFA 3TIEB 2ICES 5IHZB 1NSNH 3DPBA 4GKNA 3S8WA 1NGPH 2V5RA 1U93B 3T8XA 5I30L 3OG4B 3GMQB 5E08H 4G80B 2VXUH 3OKNB 4ODXB 1ZVYA 5E70A 2VLKB 5CBAB 1FO0H 1MVUB 3EOAB 4JFFE 3QIUC 3O11B 5GISL 1QSFE 4DCQB 5DWUH 5D2NE 1MCEA 3K8LA 3DETC 5C09D 5IEKB 1CLZL 2VDNL 2R1WA 4C54A 4HQQH 2AJVL 1AGFB 2C5DC 4S2SA 4JB9H 5LBSL 4TUKH 3LIZH 4AEIL 3DBXA 4PRDA 5HHPB 2Y5EA 5DGQA 3SCMA 3NCYP 4HJ0D 1F3DH 1QSFA 1XF5A 3R0MA 3U30C 3W11D 4PRAA 3QNZA 1RV6X 3BKYH 1JZ7A 4I4WA 1T89C 3LHPH 4QHLA 3TA3A 1UB6A 4OD2B 4UT7L 4KK8C 4GXUM 1IKNC 1F4YL 4C55A 1JF5A 3ILQD 1NFDF 2WBJA 5D2NB 2XNAB 4Y8AA 4PJ7B 5HYSA 2NZ9C 4PGDA 1J0KA 3ZKND 2FZ3A 3L3HB 3PWJB 2JCCB 4POUB 1TIUA 1TVBA 1M71B 3RNQB 3U9UB 4KZDL 4I5BA 1BF8A 5HYJE 3D1MC 2VAAB 5C0JB 2H9GA 1NUNB 4I13B 1KPVA 3BMVA 4MX7A 3WNOA 1T4KA 3VXNB 2YKLL 3NACH 1KJ2L 5E2VL 1YMMA 5F9WC 2BRRL 3BEVB 2DTMH 4I48B 5D93C 4HFUH 5KVDH 4QOKB 3BP6A 4H0GA 4EI5C 2DL2A 3ARDA 4NQCA 4U1GC 4H8WL 4Z77B 2V7HB 3VXNA 5F3BB 3MJ9L 1GOFA 1KYOJ 2FEEI 2GTWA 1N6UA 3MJ8A 2HVKA 4P3DA 2E6PA 4X6CE 1MHPL 2P46B 4MA3B 1N2RA 5J6HB 1UENA 3LQAL 3VWJC 1F11B 3BIBX 5D71L 4JRXB 5A2KH 4I5BB 4CVXB 1CLYH 1SQ2N 5BO1H 2VDRL 1IILE 2AK1H 2OL3B 3TBTA 1FG9C 2XI9A 4PV9A 5CIPA 3GMPB 3I02A 2OK0L 5KS9A 1G6RB 1UB6B 1JFQH 1T4KB 1UXSA 2JLLA 4PJEB 3TT3L 4JFDE 4U7MA 3HNVL 2ERJB 3LEXB 5LAXA 4JRXA 1MCCA 1JK8B 2AJSH 4K8RD 4JFHE 4Y4HB 2DTSA 1TVHA 4Y4FC 1JHKL 1EVUA 1DUZA 3RDTC 2AEIT 2X42A 2MPAL 4HIEA 1FZJB 3BAEH 1JGVL 3QUYD 5DGRA 4YK4B 5I9QC 1CDBA 2B1HL 4QHUB 3TCLB 4DFIA 5I1IL 4HKJB 3K0WA 4G8GB 3GSNB 4OQTA 4ZSOA 2W59A 3CXHJ 2C1OB 3T09A 4YBLC 1ETZA 1T66C 1UJTA 3ARRA 3GKZA 5I71C 2A6DA 4PJCA 2OM5A 4OIIL 1U8KB 4LSSH 5T1KB 2FEDD 1BJ8A 1JWSA 1N0XL 3TCLA 2AS5M 1I85A 5IV2A 1IGIL 2L7JA 4YDLC 3TBTB 4PJGF 3BPNC 5I74B 2ZSVB 4Y4FB 3TA3C 3LH2L 3IXTB 4EXKA 2EYTB 3OAUL 2ERJC 4UINH 3TO4B 1CFQB 5AYUH 1OAZL 5ANME 4C57C 1NGXB 5CJQL 3ARBD 4M9OA 5C0AD 1CK0H 4CUCA 2B5IB 4APQB 1GRWA 4XVJH 5IMOA 1JN6B 1BZ9B 2IADB 1MRDH 2HFGL 2F58L 1Q1JH 4Q9RL 1OL0A 2CDFB 2YN3A 4K3HA 1CBVL 4IM8A 1KULA 2MCG1 3JTSA 3QWOB 5A16B 3VDCA 3QFJA 4OD3L 1F4AA 5T1KA 1YC7A 3D85A 3INUL 1BQUA 5EDXA 3QQ9D 3CJJA 3RIAF 3RGHA 3MRGB 4UB0H 3BX7C 3IETA 1JNLL 4NQEA 4H5SA 4WV1B 1FGVL 4HK3N 1A02N 3SDXF 3HFML 4P9HL 4U0RB 3QXDA 4P2CG 1EFXD 3NN8A 1UQSA 4EDXA 1BGXH 1A7NH 5F7DB 1ZLWH 4JKLA 2Y9RT 4PD4K 4ZXBD 3WXWL 3ARZA 3IT8D 3CVHH 4ZFOL 3OBAA 5GJTL 2UWEB 5DUBB 5EO0B 1FZKA 4WRLA 4DEPC 3PWNB 4RZCB 4YJZL 2Q1EA 2F74A 4U6HA 3JV6B 5J11B 1J12A 1JPFB 1T22B 3TN0A 2G75B 5D7IA 4HWEL 3GSWB 5ESAB 1R3HA 4RBPK 1GYAA 4HWZA 1MJ8H 4LAQH 5DMKB 3WS6A 5EU6A 4FQHA 3RWDA 4V1DE 3WDHA 4JQXC 5DD1H 5C9JB 2BSSA 2XY2A 3LKSB 3NH7H 4PV8A 4Z7OF 1NH6A 4JDZB 2HJKB 3NIDE 1KLGA 1BGXL 4M43L 3TP4A 4H8WH 3ULUF 2DLGA 2COQA 4GMSH 4M3JA 1KIRA 4HWBH 1T0MB 3BZDA 3CLEH 5DMKA 5DJYA 1JNLH 4X6DF 4POYA 4LKCA 1YN7B 3NN8B 4ZUSA 1IZJA 4NQEE 4G8IB 4YHLL 1MREL 5JIIA 2CUIA 5DJCA 1MJ8L 4LAJH 4GBXC 5EIVA 5DFTA 1A5FL 3GSRA 5F7YC 4IRJD 3FKUS 5J06A 4K3GA 2KH2B 4IOSD 1M6OB 5T5NF 4BUGA 1I3UA 4RMVA 1Q94A 4JFZL 5BMFL 2XWBB 2Z8SA 1EA9C 4X7SL 2P49B 5JW3H 1FL5B 2XG5A 3JWOL 3K8KA 4IOFD 5CWSB 4NO5A 4Y1AE 3H8NA 5HPOA 3LRGA 5ANMA 4R8WL 2PYEA 1Q38A 1J1XH 1Q72H 5I1EH 3MRPA 3DV4B 4MXQD 3TBYA 5IBLC 4XNQA 3UEZA 3DOSA 1QD0A 1ORSB 4XMLH 5GSRB 4D9QD 3ET9F 1OWWA 5EBGA 4UT7H 4ZO9A 3GI8L 4IMLB 2E6JA 3HUJF 5CLWA 5DXWA 4M5ZH 4MCYA 3F7YB 3RVWD 1C16B 4HGWB 4DQOL 5MEND 1DEEB 3L95A 1AFVH 3RPKA 4OCRH 1X5FA 1CFSB 2YPVL 4WO4D 1WT5C 4LBEA 1QUNA 4TOYH 2GI7A 5DFWH 4JPKH 1O7SA 3WDIA 1QO3B 3GSUA 3MCKB 3EZ8A 4GG6F 3QDME 2A83B 1OAZH 1QG3A 1CFVH 1GIGH 4KQ3L 2WK2A 4N0UE 1TTGA 1T0MA 2CGRL 3HB3D 3BGAA 3P9LB 3OAUH 1MEXH 4K55A 3UTTB 3F7QA 4YXHH 5C6PB 1OGAE 2B8OT 3VFPA 2FHCA 1AP2B 2AJYL 4EN3A 1H3WM 3TPUB 1K5NB 3IRZA 3VG0H 1E27A 5FECA 4NQDD 1DE4A 4UV7H 5J12C 2VLRD 5KS9E 1J8KA 5DC9B 5MP6H 4JFHD 3KPMB 3WKNA 2D7TH 3QISA 5IHUL 1OPGL 1FNEB 3C6LB 1T1XB 3F58H 3FAWA 4Y4KD 1KB5A 1X5KA 2JIXD 2Z92B 4F7EA 1D9KC 4NN6C 3SDCD 2EC9T 5BXFA 3ZLQC 4JGJA 5IW6B 3X12A 3PQYE 4YZFE 2IPKA 2B4CC 2CXKA 1JWUB 4F9PA 1LP9B 1R5VB 3GIVB 1I3RA 4GKOA 1TETH 1IAKB 4PRPE 4NQCE 5ICYB 3VFMA 4ZUTB 3DXAE 4IRJB 3BW9A 5DQJA 4J23A 1MHCA 4AQ1B 3VFWA 4YE4L 2C9AA 3OSKA 2H2PD 35C8H 3L3DB 4HH9B 3RIAK 5I2IA 1QFWM 4NHUB 1KJ2H 4E42A 1CIDA 3CLFH 3QIBA 5J9PA 4RFNB 2M26A 2OI9B 4L1DA 1P2CA 5E2JA 1NLBH 4YHZH 4MLSA 1JPGA 3O6ML 3HRZB 5EC2A 2VDRH 1BVZA 4G6FD 1FAKT 3O3AB 1CLYL 3CXDL 5D1QA 3U0TA 4R90H 5DJ2A 1FYHB 2EEBA 2FGZA 4F8QA 5GRWA 1P9MA 4X6BA 1G6RL 3CZFA 1AXTH 4HH9A 3RY4A 1I8LC 5DHVA 3IJHA 5H35A 2VWEE 3QEUB 1IC5L 1A9BB 2NNAB 4YXLH 3V4PL 3WEXB 2EYSA 5C0AB 2LQRA 4ZG1A 2BNQB 3VXMD 3P9LA 3UTTA 5IB5A 4ODBD 1QQDB 43CAA 1JZ6A 1AHWA 3FQUB 1URLA 3Q3GA 4QXTA 4XPBL 5HVFB 3QUZA 1ZE3C 3ZT5A 4XP6H 2QSVA 4OCYL 2V2TA 1J8HB 5I1HH 4RAUA 1RJLA 2F5BL 5J3HC 3BKYL 3RWGB 4CNIA 1CN4A 1S7SA 4RRPG 4YHIA 4NZUH 2V5MA 4NRZA 3ZO0A 5C0FA 4YR6A 3GNMH 1U8HB 2ZUUA 5MEOB 5KW9L 3Q3GB 2AV7A 2CXGA 3KPSB 3UC0L 4ZD3H 3U7AA 2J88H 1VACB 2EKSA 2BVPA 3RIFF 2CKNA 2NCMA 4TN9A 5JOPD 3ARGD 5D2NA 4D9LL 3MA9H 2YD3A 1DEDA 1XF4B 3LKQA 4Y2OA 4CADB 5E6ZA 1A7BA 5IW1A 3W11C 4LP5A 4S11A 4F7PB 5CJXA 3ARDB 4NQCB 4Z0BH 3ZE1E 4OCYH 1NAKL 1P7KA 1KXQE 1MCQA 5E1AA 3N1GC 1GPOL 1GIGL 2PXYB 1I4FB 1DLFH 1IGCL 4L5FH 4AM0A 5HVHB 2KUTA 2E7LC 5ETUA 2VAJA 1C12A 4GG8A 7FABH 2FX8L 2ESVA 1CXEA 3MTRA 2AJUH 4NQSB 4PJFF 2JF1A 3GBMH 2MFNA 4YUEH 4I2XE 4YXLL 4BA8A 3HNSH 1C08B 1TJGL 5C0DB 3GRWL 1QR1B 2PKDA 4PB0H 3I3EA 5CBAA 3R8QA 3GHEH 4PFEA 3PE9A 4WI7A 3MLTB 2WP3O 3C2SA 1IQDB 1CLZH 5C7XH 4NBXB 4U1KA 3I02B 1U58A 3T4YA 3OKLA 5DJAA 4FQ1H 4NJ9H 4YEEA 3WUWA 4FQQA 2X4QA 4GG8B 1P4BL 2OTWA 2BSTB 5LAXB 3AS2A 4X7CC 5CZXC 1NAMH 4ZAKA 3O9WA 2FDBP 1P5UA 1E6OL 1K8DB 1P84J 1KPUA 1MSPA 4PLKD 3UO1H 4WW2C 3O45A 4GXUN 3DXAA 1UGNA 3NCJL 4FMKA 5E24E 3BIKA 5T1MA 2VWEC 4ZFFA 1PLGH 1JMXA 4ZSOB 3HUJA 2Z35B 1CDJA 3RAJH 3BPLC 1EZVY 2JJWA 5F9OL 4UV4L 4ZQKA 1OP5K 3RX8A 5DD5L 2K7PA 3FQTA 3ZKMC 4UOW1 3EYOA 1PYWA 1HNFA 1QR4A 5DI8A 4FABH 1C5DA 1KCSH 1TJGH 1QBML 4GAGH 3V6OA 3S9DB 1OPGH 5CFHA 3WNLA 1KPVB 1UCTA 1J87A 3BGFC 4ODUB 1QRKA 5TDNA 1ZLUH 4XCFL 4YQXH 2CK2A 1VERA 1NC4B 3VWKD 4KDTC 3MUGA 1RMFL 3CVHA 1UWEH 1VHPA 3D0LA 4ZFZA 4A6YA 5D72L 4GMSL 2VLMD 2XXCB 3BXNB 4XAKD 3E2HC 4LFHD 4WEBH 5IM7A 4ETQA 3T0DA 1F4WL 5KTEH 1LK3L 3DRTB 2HT3D 1MFCH 4F37F 3RZCA 4JFEB 1WUNT 1P1ZB 1T80A 3UTZB 1I1FA 5EFIB 4AL8L 5CBEA 3SDDA 4XP5L 3RDTD 1HEZB 1QP1A 5IFAH 3V79C 5J89A 2QTEA 4MD5B 4LSPH 5JHDA 5ENWB 1QKZL 3RNKA 1F11A 3T4YB 3HMWH 5D96B 1CFTA 4YGVB 4BM7A 3S7GA 3MPCA 4ZFOA 1WEJL 4UNVA 4L4VA 3EYUL 5H2BA 4FMFA 1Q0XL 1OHQA 4XC1L 1NEZA 4HX1A 2H2SC 2H8PA 4ELMF 4QOKA 4Y16A 1Q0YH 4HFWB 1QLFB 4O2EA 4M1CD 4BSJA 1ZEAL 4GOSA 4PRNA 2V7HA 1A7RH 1CWVA 2ATKB 5DMYA 1EIBA 4TSCL 5EIIB 1Z0MA 5AUMB 3BQUD 4I18B 1I9RH 1JGEA 4KTDL 4XPGL 5E2TH 2DMKA 5EC1B 1AI1L 1NEUA 4XCEA 5IVNA 2HLFC 4J4PC 2OYPA 3SDXB 3EJZC 1UADC 3SE3C 2VLME 2Y25A 2VXQH 5BMFH 4I0PB 4G6KH 5DEFA 3CC5A 4G8EB 5IBTL 3GMPA 1J8HD 1ETZB 3EO1A 4E41E 3SKNA 3FT2B 3DYOA 1A7PL 4RA3A 4F9LA 1KJ3L 3SCMC 3CK0L 4H88H 3T3MF 4KU1A 5K33A 5JIPA 3MUGB 2YPLD 5ADOH 3HCVA 4M7KH 1B88A 3UP1A 1JK8A 3H3KA 3V0VB 3EYFB 4WY7H 4GW5B 4W4OC 2FSEB 4OQ1A 2OXGA 4JG1H 1RIUH 1I1FB 1KACB 4XH2B 4L3CB 4P2OA 3B5TA 1H5BA 2GQHA 4HUUA 4NNPH 5DD0L 1NCTA 3P4LA 1KNOB 3OKDA 2IALB 5ALCL 1II4E 4K7PY 1U8KA 1L0XA 3F58L 3SDXA 2RFXA 5ILTL 1A6AB 4OJFL 3VH8B 4BSWA 4KRLB 2D3VA 2MNUA 2VLJD 2YD2A 3ZHKA 3GKWH 4P2QA 4OKDA 3UAJC 2H41A 2VR4A 4GS7B 5ERWA 5SWSB 3PGFH 3QWOA 5GQBA 4G8IA 5A16A 3PHOB 5EG6C 1U8LB 1QSVA 5EBLA 3HZKA 1G9MH 3O6LH 5C0RH 4KDTA 2FL5B 4OSUH 5KVGH 4O2FB 3OXRB 1QFHA 5C09B 4UTAH 1EBAA 4PJBE 4PJEE 5EA0H 3BO8A 5F1KC 3KJ6H 3FCTA 4JFFB 1OCWL 2BJML 2PR4L 4TVPL 4XBPB 2VLKE 5K9JL 2JELH 3JVGA 2PO6A 1MWAA 3G9AB 4ODHL 5C0IA 1VESA 4XNMA 3QPQD 4G6KL 4M7LH 2H32B 4TNWF 4UZGA 5L2JB 3LCYA 3MRIA 3MLPA 1CG9A 1MCOH 4IRJC 3MRRA 2EDTA 4JJ5B 4WUUB 3NAAH 5GSVA 2KQNA 1AHWC 5HHVL 2DQTH 5C08B 2QSCL 3IFLH 1JVKA 1FG2A 4JG1L 5FO7B 2IANB 5C09E 3WFDH 3OKEA 5IMLB 1YYMH 3S98A 4EI6B 3MGOB 1EAPA 2BCKA 2F8OA 5D9SA 2SEBB 1YEEH 3I9GL 1A4KB 3MA7A 3Q0HA 2XRAL 5FYJH 5C0BA 4DAGH 5DVNA 2A83A 3TWCH 2IFFH 3ZDXE 1NCBH 5BS0A 1PY4A 4J6RL 3UYRH 4XVSL 3IU4L 4L9LB 1YEFH 2OTUB 5T1LA 1QKZH 3V95A 2EYRB 3OJVC 1Y6NR 3I9GH 3ZMRA 1KPRA 5KSVA 4X6EA 2KL6A 1FE8H 1W0WA 1NMAH 1I9RL 1DL7L 4UIMA 4RIRA 2Z93A 1MJJB 2G5BB 2QKIA 4R4BA 4HWBL 1R3KA 4ONHB 3FB8B 2Q86B 3NPSB 2JCCF 5D7IB 3GI9H 1U8QA 3ULVL 2PO6B 5C0ND 2HJLA 4LLYB 5I1DB 1YMMD 4J3SA 3RVTC 1ZWIB 3UTPD 4KROB 1DSFH 1Q9WB 3VXTB 1PG7L 4JFQA 4M6MH 3D69B 1OD7A 3S35X 1U3HC 4UOW0 4RGND 1T2JA 2UYLB 5FGSA 1K9TA 1DVFB 2EDEA 5DD5H 5DHVB 4X9BA 2N56A 1I75A 3P0VH 3BQUB 3FO9A 3C5ZD 3WBDA 3HUJE 2XY1A 5CJBA 5CZKA 2NXZD 3NFNB 4PUBH 1F58L 3QXUA 2X1OA 1F3JB 5C71A 3HRZA 4JHBA 4QF1B 3C9NA 2QKIB 4M7ZB 1E6OH 4Q0XL 2VDOH 5DJDB 2DB8A 1INDL 25C8L 5FM5M 5AD0B 4LDEB 5CP7A 5DURD 3LKOA 3BUTA 2A73B 1RZIA 2DMCA 2Y36H 2Q6WB 2B2XH 4HG4J 1U3ZA 1YPZB 4KKLC 3VXTA 1WBZA 3LSOB 3SDYL 1ZANL 5TQ2L 1W8NA 2BOBA 2H45A 3QUYA 3QIUB 1U3HA 1DTUA 4QY8A 2AK4E 5FO8A 2WMPA 2XA3A 4FTVA 4PRAB 1ZLSL 2EO1A 4KHTH 4ZOBA 4RAUB 2WUBL 3EO9H 5DT1H 1CXLA 2GAZB 1RUML 3RGVC 4UQ3A 2H3NB 4PRIA 3DMMB 1D6VL 4KQ4H 2BP3A 4PJGA 3FO2A 5TE7L 4L8CA 3M45A 5FYJU 1G7MB 3T4AA 4WTZG 1TZIA 3ZTNH 1CF8H 3C9NB 3GMRA 3MRJB 4XP9H 4OBSA 3U36A 1NKRA 1GGUA 4UQ3B 5FA4A 2P8LB 2LU7A 4G5ZH 1IGJB 1Z0NA 4NBZB 1JJUA 3KXFA 4Y5VB 1H8OA 4PGZA 5CUSH 3FRUA 5SX4H 3VGGA 3HNSL 4KI1A 3MR9A 2YD5A 4JY5L 4LNVA 3CCHA 3WFCH 4QXWA 1L7TL 4F7MA 5F88A 5J0BA 1ZEAH 1DLFL 1IGCH 2YBRB 4L5FL 3J8F7 1DBAL 1LO0L 2H3NA 4PRIB 2VRAA 3U48A 5IVXB 1TDQA 4ELKA 1M7DB 2F9BT 4HMEA 2CUHA 5DK0B 4Y19E 2H9GB 5GXBB 1FNAA 5T1KD 5ID0B 1L7IH 2EDHA 4IIQA 2DM2A 3EYUH 3HPLA 3DX8B 2EH7L 5BXFB 5L2KE 3ALXA 1SJXA 4FQIL 4O4YH 2KZWA 5SWSD 1YPZA 1HH6B 1ZAGA 3WLBA 3QDGD 4LSPL 1XT5A 2G9HA 1BBDH 1IM9A 4JANB 4U31A 1IVLA 3BHBA 4PJHB 4ZXBA 1JZ5A 4G43B 5J6GA 2GJZA 4MLIA 1RY7B 2HA1A 2D03H 4OLYH 4K7FB 4GW1A 2OSLA 5ICZA 2PW2A 1ZT7A 4WWID 4GBXB 5IHLB