3BL6A

Crystal structure of staphylococcus aureus 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase in complex with formycin a
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
230
structure length
230
Chain Sequence
AMMIGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAFLEKAAVSSSQTVEALVSQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Staphylococcus aureus 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords 5'-methylthioadenosine nucleosidase/S-adenosylhomocysteine n
total genus 78
structure length 230
sequence length 230
ec nomenclature ec 3.2.2.9: Adenosylhomocysteine nucleosidase.
pdb deposition date 2007-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3bl6A00
5F7OA 4YNBA 3EMVA 1JDVA 1V48A 5FAKA 3OOHA 4G41A 4DAEA 1YQUA 1XE3A 2A8YA 4TTJA 1M73E 5F77A 1V41E 4DA7A 1VFNA 1RXCA 4D8VA 1PR0A 1RSZA 2AI3A 3UAYA 1OUMA 1T8YA 4R2XA 1SD1A 4QASA 3LA8A 1SD2A 4D9HA 1PF7E 4TXLA 3DJFA 1RT9A 3E9RA 4F2PA 1U1EA 1Y1RA 4OEHA 3BL6A 3LGSA 3FB1A 1Z38A 1PR4A 1PK9A 4LZWA 4M7WA 3DF9A 4D98A 3UAVA 1LV8A 1RXYA 3NM5A 1Z39A 4GMHA 3MB8A 1A9PA 5F7JA 1CG6A 3OZCA 1JP7A 2BSXA 3GGSA 3O6VA 1TGVA 1V45E 3ENZA 3TL6A 1I80A 1Z5NA 3KUKA 3NM4A 4UC0A 3D1VA 4WKBA 3K8QA 3DP9A 4L5CA 2QSUA 5I3CA 1LX7A 1OV6A 1NC3A 1T8WA 4EARA 1PKEA 2QTGA 1VMKA 3DDOA 1Z34A 1Z37A 4JOSA 4QEZA 5B7GA 2GUWA 2AC7A 1PBNA 3OCCA 3FUCA 5F78A 4IP0A 1A9SA 1PR5A 4OF4A 4X24A 1U1FA 5F76A 1TCUA 2QPLA 4WKNA 1U1DA 1Z36A 3E9ZA 3U40A 4H1TA 1ULBA 1JDTA 3BSFA 4BMZA 1B8NA 1Q1GA 4TXMA 4PNPA 3EEIA 2AI2A 4D8YA 1JDSA 1V3QE 4TXNA 1ULAA 4LNHA 1Y1TA 4RJ2A 3UT6A 1Z33A 1K3FA 4DA8A 3PHCA 4TXJA 5CXSA 5CCEA 2XRFA 2HWUA 2OECA 1Z5OA 2AI1A 4L6IA 4WKPA 3PNPA 3UAWA 5CXQA 1K27A 1TD1A 4DA0A 1YR3A 1WTAA 1ZOSA 3OF3A 3P0FA 5EPUA 1Y1SA 1ZL2A 4QARA 5F7ZA 4QFBA 4TS3A 3DPSA 4L5YA 3OZBA 1A9OA 4PR3A 5JPCA 4NS1A 1Z35A 3INYA 3KVRA 5K1ZA 4BMYA 4DA6A 3OPVA 4LNAA 3FNQA 3BJEA 1YBFA 2H8GA 2I8AA 1SJ9A 1RCTE 4TXHA 5EFOA 1A9RA 4F1WA 1Y6RA 4F3CA 1ECPA 1PWYE 2OC9A 5EUBA 3NBQA 4G8JA 1N3IA 1U1CA 4YO8A 4OGLA 3MMSA 4MCHA 3C74A 1U1GA 3OZEA 4TTIA 1JE1A 5IU6A 4LDNA 1ODIA 4F2WA 1Z5PA 1PW7A 4D8XA 1C3XA 1CB0A 1YQQA 1JE0A 2ISCA 5IFKA 4M1EA 1T0UA 1OVGA 3KVYA 3UAZA 1A9QA 4M3NA 3IOMA 3LBAA 2QTTA 2HN9A 2P4SA 2OXFA 1A69A 3IEXA 5C80A 5DK6A 3FWPA 1JPVA 1PR1A 2I4TA 5F73A 3FOWA 5KB3A 1Y6QA 5B7QA 4EB8A 4P54A 4OGKA 4DABA 2HRDA 3ODGA 4E1VA 4JWTA 2RJ3A 1ODKA 3EUFA 4TTAA 2QDKA 4WKOA 4YMLA 5CCDA 3F8WA 4QATA 2ON6A 4TS9A 3EUEA 1FXUA 3GB9A 4DANA 4LKRA 4OY3A 3O4VA 1RXSA 1SQ6A 4U2KA 4K6OA 4BMXA 1Y1QA 4MARA 1T8RA 1V4NA 4L0MA 1NC1A 4WKCA 2Q7OE 3FAZA 5CYGA 4MCIA 1YRYE 1TGYA 1RR6A 4R2WA 1VHWA 5B7PA 3UAXA 3OOEA 1JDUA 5CYFA 1PR2A 2HSWA 4GLFA 4BN0A 4JP5A 5F7XA 4I2VA 3KU4A 3P0EA 2A0YA 4NY1A 1TCVA 3KVVA 4TYMA 2A0XA 5ETJA 1ODJA 1PK7A 4GKAA 4YJKA 1K9SA 4G89A 1RYZA 3ONVA 1VHJA 4L5AA 2PGAA 1OTXA 4QAQA 1JDZA 4OJTA 4R31A 4GLJA 2A0WA 1V2HE 1NW4A 4NSNA 4FFSA 1OTYA 3BGSA 2B94A 4KN5A 3QPBA 4DARA 1PR6A 1RFGE 1LVUA 4DAOA 4ECEA 1OU4A 3PNSA 1B8OA 2OC4A 4F3KA 1A9TA 3T94A 1G2OA 1T8SA 3OZDA 3SCZA 1QE5A 3KHSA 3PHBE 2IQ5A 1ODLA 1RXUA 5B7NA 1JYSA 3NM6B 3E0QA 3K8OE
chains in the Genus database with same CATH superfamily
2X76A 2FN4A 2O23A 4FYHA 3JQ7A 4BNVA 1X2EA 3ZC3A 3NW9A 3ENVA 2AD5A 1JEAA 3NGLA 2DGDA 4QQKA 2GKSA 2JIMA 1ACMA 3EIHA 3DOEA 3OJ0A 4P7BA 1X80A 2DBVO 5EZSA 4LC1A 4QHTA 2PV7A 1MABB 4ARBA 2YZMA 3L7NA 4IFBA 2QW1A 1FUUA 3CTPA 4CLDA 4DNQA 2ZXEA 4R2KA 5JS7A 1A9YA 3T15A 2G5GX 2PMCA 2QVCA 3ADKA 3QMVA 4IX9A 4IOLA 4AZ0B 2P67A 4DCCA 4KOEC 2A8YA 3HWWA 10MHA 3GVCA 3L92A 2PJZA 1YU6A 2PUTA 2XB8A 1E5TA 3QBVA 3GOHA 1NLFA 2BEVB 2WIGA 3TZCA 2PL5A 3I9FA 5JBIA 3LWBA 4FB4A 1BDHA 4Y9RA 3OLXA 2VZLA 2FFHA 1ZOLA 1LSJA 1ULSA 3A0RB 1A1VA 3VFDA 4XWAA 5HE8A 4M83A 1XVTA 4QASA 4O3MA 1BDMA 4N7BA 3ZS8A 3RVMA 1GGNA 4PBRA 4CEHB 1M6NA 4HNAA 4H2DA 4G86A 5IT5A 3P7MA 5H9WA 3KUDA 1POWA 2D4AA 3EPHA 3RTGA 5ELLA 3KSBC 3OKCA 3E35A 3JQBA 3E9CA 4C5CA 5BWOA 4DNOA 1M7HA 4PHCA 2VJDA 3LGSA 4R2IA 1CS0A 4EQ6A 1GKKA 4FONA 2FUKA 3NIDB 3ZWMA 3B3AA 2A0FA 2GT1A 4Y6LA 4KHPB 2X2EA 3NASA 4H6PA 5FFNA 5FEUA 1OYOA 3MYYA 4TT3A 4UBJA 2JLUA 1T36B 1B41A 5DV9A 2QNIA 4ZREA 2EP5A 3WJ7A 2PZMA 3HY4A 1ZK3A 1OX6A 2V6JA 1QDLB 1P9NA 3NM5A 4UCFA 4MI3A 3WIEA 1SUIA 3OWXA 4ALKA 1BXGB 2UXCB 1P2GA 2OKCA 1IN1A 2P9QA 2IOFK 1VJRA 4HPJB 1Q83A 4UPDA 1O5TA 4BMDA 1JWLA 3NS7A 1ELOA 4RK6A 1I6LA 3JASB 1VCHA 3KNZA 1TPZA 4II3A 3W79A 3PZRA 3DWEX 2JBAB 2JLXA 4MAFA 5HE9A 3BXXA 4DLSA 3JD4A 4EPWA 5A0FA 1JQ5A 2OGTA 3EDCA 4RH3A 2GETA 2BGKA 3RC9A 2CFOA 1DJNA 1U2RA 3VYRB 4DCTA 5HUQA 1YOVB 3CZ9A 2ST1A 1JECA 1MEOA 2NT4A 2ZG6A 1JHMA 3ENZA 1F8XA 4YRTA 4F0JA 3N0WA 3EQZA 1GR0A 1HRKA 1YOVA 3G59A 3HR8A 2C1XA 4Q9IA 3T7KA 3ZV6A 4V2IA 4Z4FA 3A11A 1O6GA 8AT1A 4RQBA 3TR5A 1Q5PA 2HU2A 2NO0A 4XLTA 2JFZA 1KAEA 1Y82A 2XADA 1P60A 1AV7A 1JDBC 3E84A 1L5GB 1E94E 2GZ2A 1G55A 2IHUA 1WV1A 1PZEA 1E1DA 1JVSA 3C3EA 3M4JA 3K8QA 3MA0A 2P62A 3QKWA 2O3QA 2BBOA 4URVR 5T4BA 5DF1A 2Z57A 3RLIA 2HQSA 1CE8A 3GJSA 3MAAC 1CBUA 2IU6A 1CQIA 3IH5A 4RZUA 4TKMA 1TL7C 3GGPA 5IJAA 1Z4MA 2YVQA 5CA0A 1XPOA 1KZ9A 1PWXA 2BP7A 1CY2A 1I13A 2O2HA 2VYND 2RB5A 3QEOA 4PONA 4FFDA 1PKEA 4H7DA 3IGFA 5FOTA 1B26A 1XX6A 1FEZA 1DFIA 5AYVA 4XB1A 1DX9A 4G1UC 5MFPA 3NBYC 2BCGY 2C99A 4EJ0A 4JB0A 1S96A 4DYHA 3QEMB 1DWQA 2AC4A 1M7GA 2GUWA 4B6GA 5B36A 3G2MA 3OCCA 4WNIA 3S55A 1A9SA 1ZICA 3CISA 1Z62A 3KPWA 1GYRA 1U7XA 4HMQA 5H68A 3HKEA 1XZHA 1ZESA 3MBIA 4FGZA 4P86A 4AT1A 5FFMA 4A9AA 4WE3A 2LIPA 4XQ0A 4AM8A 2UYYA 1URPA 2BZ1A 3BA6A 3OZVA 3O8DA 1TO1E 1N2BA 1VJGA 2ZW9A 2BH2A 2VP5A 2QD1A 1HE2A 2BZ0A 2DHQA 5E2BA 3ZBPA 1P33A 1N9ZA 2NUBA 3A28A 1YB6A 3NCTA 3NP9A 4HLCA 4R1LA 1OB2A 3BMQB 3HKBA 1V1RB 1CUFA 1P4RA 5B1IA 4B6RA 4NYJQ 3LH5A 3W06A 3KQKA 1RYHA 1S8NA 1PS9A 4U9UA 2JS7A 4GU5A 1GQYA 1UPUA 2HBZA 2QUIA 1GCAA 3FGPA 3IQDB 1U8CB 3JQFC 4TSRA 5AHWA 5E9WA 1IRIA 3V1MA 4DJJA 3RQIA 4M9ZA 4BXOA 5EEHA 4JI4B 4B3RB 2XCQA 3FPSA 3NTVA 3KYCA 4WCFC 1T9KA 4BNFA 4N5LA 3L7IA 2CNLA 1TF7A 2K5UA 2GPBA 1QTRA 3UFXB 4AULA 3DG9A 3CLTC 4URZR 4FOOA 4HH0A 1KK2A 3CBQA 3B1YA 3K9LA 4B1FA 1ECJA 3GJXC 5T4FA 3C41J 1T10A 2BYTA 2IEDA 3ADDA 4FC6A 2JGLA 3LQ4A 1LRKA 3T9BA 3X43A 2HSDA 3MILA 2WDZA 1P0QA 1G66A 1OAKA 3Q6MA 2NLOA 3R8XA 3TRIA 5BVHA 1XRRA 3UJAA 5AVRA 3JAMA 2GPAA 1EDOA 2NVWA 1JI3A 1Y4ZA 4FDTA 2R7MA 4PFKA 2IVFA 4I1OA 4N03A 3TRHA 3P9ZA 3R7WA 2II6A 2QMZA 2JBHA 1Z75A 2ZK7A 2V0NA 2HGSA 3CLTD 1G7RA 1XZDA 2O3SA 4KITB 2AFHA 1H0KA 2VPYA 4ZCPA 1NNI1 4GPTA 1ZN2A 1MB0A 1W0JD 3PQ4A 1EE9A 3PI6A 4H1WA 2I1VB 4IJVA 2FWNA 4HDQB 1HT2E 2R9VA 4Q02A 2UAGA 2H2AA 4UVIA 3O8CA 4GR4A 1E6LA 4EB6A 1EFHA 3F4KA 4LCJA 4EX6A 3U16A 3VA7A 2PWAA 3D4NA 2H57A 1JTVA 3KTDA 4RWEA 3H5IA 4DQVA 1BJTA 5DMHA 5EHNA 2V7WA 5B1DA 1Y1SA 2BFMA 3P5BA 4FKBA 4W9NA 5M29A 2BLLA 2DQYA 3AHCA 2FGJA 2H1VA 3UMJA 5EP1A 4DNPA 5IRCD 1FFSA 1AKRA 4JDPA 1ZXXA 1GPNA 2BM8A 5I5GA 3CZ5A 1E4OA 3W4JA 3IHKA 5ES4B 3L79A 4H4CA 3UB3A 3GPBA 4D80A 1NXOA 4BE9A 1NBIA 1Z0AA 1W5EA 2EL9A 1KE2A 1E79A 5LZ4A 3DAGA 1XAGA 3K32A 4NS1A 3X44A 5CHYA 4YCAA 1Y7IA 2ASVA 1P8AA 5JAPA 4RSRA 5DNDA 3BFKA 4IXTA 2LRHA 5KYTA 3BKXA 5FHQA 4TVKA 3V6MA 3E5NA 2ZYRA 3UK2A 4BFCA 1Q1ZA 2C92A 2VATA 1Y7TA 4KGVA 2Z3WA 4GLBA 1B23P 4N3NA 4IUCS 4YJFB 1EG7A 1HY3A 2JFPA 4WFKA 1FDVA 5K8LA 1XROA 4N47A 3WRWA 1RCTE 2GI4A 1U7PA 2GBCA 1ZZEA 2VRBA 5CBKA 1A9RA 1AM4D 5JJCA 3L8HA 1DL5A 3BTUA 4MYDA 2ODAA 1AXGA 2PANA 3JPYA 3KWFA 3BS4A 4JLDA 4CKEB 4ZJZA 5LYJB 1T1EA 2AZ4A 4JLKA 2OC9A 3U49A 3FFBA 4C87A 4Z6KA 1U0RA 1HEIA 3SX2A 4E7OA 1X38A 2JW5A 4Y7CA 2B78A 3SVZA 2NMVA 4OJMX 1M2OB 2V7EA 5CPFA 4DQKA 2QLFA 2ZIUB 2DFDA 2Q7XA 4PW0A 4BVEA 5KS2A 3I45A 3NJ8A 1Z47A 3TZBA 3RYIB 1V37A 1YAJA 3BXEA 3NAQA 4HQNA 1KDOA 1TCAA 4TLEA 4BLSA 3RTBA 4B6SA 1II8B 1Q0HA 4UUNA 4RDXA 2XGSA 3MMSA 3WMGA 4DW8A 1I0IA 2PRSA 2FWPA 4CMKA 2UYHA 2VNKA 4NARA 2GTPA 3MS7A 5L3SA 2PBLA 1JLLB 4QREA 4WADA 5G4KB 5LB2A 2VCEA 3VU0A 4EB0A 5A62A 5M04A 1VIVA 4QD3A 4I4TB 4XB6B 4J0EA 4DIDA 3W5VA 2Q2WA 3IKVA 2XQIA 3TG8A 5IU6A 3CR3C 4CQMA 1VGRA 2VDNB 2ZI4A 2XDAA 3ZE0B 3ZKAA 2GAAA 2ZCJA 2JVJA 2LBPA 1M2OA 4FHCA 2FX2A 4JJGA 5FWYB 3S29A 4DVJA 1TFUA 3VH4A 1OT3A 2VDQB 5AW1A 4B0PA 4LJ4A 5CLLA 3B1JA 1I7DA 2FW1A 4KBYA 4LRXA 4JENA 4HCJA 4X20A 3CA8A 4K9OA 2CNOA 2V0GA 4MJ3A 3EWIA 3KVYA 3MWKA 3V4ZA 1E4EA 4DR6B 4YDSA 4HRXA 5AW2A 2VDUE 4G6ZA 1J9GA 4QPDA 4YP5A 4MCJA 1WY7A 4MV4A 4DQ0A 1GL7A 4CEJB 3BK7A 1MIOB 2OZVA 1MJGA 3KZXA 4CVNA 5C80A 1AK1A 1CK4A 1PJQA 1V5IA 3QKUA 1GAWA 1IHXA 4AMBA 3TLGB 5C4MA 2P1DA 4ZK6A 2ZSKA 5JANA 1TVMA 1ESZA 3DE3X 1MFZA 3A6ZA 1DIHA 3L9XA 3EOBI 4K6HA 2W0SA 4FFLA 3RBVA 4BFUA 1EZ4A 3VYSB 5T8KA 4H35A 4OFWA 1KI4A 1DAMA 1FUEA 3SJUA 3EY9A 3FVQA 3VR5D 2PWZA 2V59A 1Q16A 2HT6A 2OFOA 5KDDA 2C0CA 1WMAA 1RBYA 2YHAA 4UTPA 2NV2B 1Q50A 3SC6A 5GJCA 3SYRA 2IV3A 4G67A 3W2TA 1E1MA 1Z5GA 3F4BA 3W9SA 3PE3A 1GHTA 3EAQA 3NT4A 1TDJA 5JAMA 4LX0A 2J8ZA 4HXEB 1QUEA 2P6UA 4MJLA 3PNVA 2I54A 4PGFA 1RLUA 5CCDA 5HWSA 5LKAA 4GBJA 3S1SA 2KM1A 2QTZA 3RF7A 4C4XA 5FR1A 3AVTA 2HJWA 4PLTA 1AGPA 3KKLA 3C6XA 4CQLB 4MMYB 4YAEA 4EA7A 1LK7A 5A4DA 1GRQA 1HDEA 1M9NA 1T8TA 2PZJA 3I05A 4J75A 4A5OA 3GRPA 4MYSA 4O4IF 4JP1A 2EFJA 1KY3A 4E5KA 1UWVA 4DBVO 3NHLA 1BWRA 4UMFA 1XRJA 4XWTA 3ZNNA 2PR7A 5GAJA 1UFKA 2A1IA 4MARA 4LCBA 4KN6A 2W6QA 3OCZA 5EUQB 1I5OA 4E5SA 2VXBA 3IQIX 3NWPA 2PX3A 1JR3E 4QPZA 1OX4B 1K6XA 3LYAA 4UHEA 5BRJA 1EK0A 1RQGA 3NLLA 1GGMA 3G68A 3RVSA 2DF8A 3IQEA 3D8NA 1HG0A 4HN9A 5K20A 4B9EA 2DUMA 2PTGA 1Y6FA 1AN9A 1TADA 2ES4A 2P9FA 3MCAA 4N7JA 4P36A 2PT7A 4JJKA 5AK5A 1RR6A 4ZEXA 1O0CA 4D45A 1F0KA 3AESB 3RTEA 3TEMA 1U28C 4YIHA 5AXBA 1N0WA 2YC4C 3U26A 4J7AA 3A7EA 5CFNA 1DQNA 1H6DA 1ODSA 3HH8A 1M1YE 5JWHA 1AKYA 4YP6A 3SC2A 4BXOB 3OC0A 4LJ9A 1IM5A 2CEKA 4ZT2A 2GKOA 1V16B 4AJHA 4BASA 1KQ3A 9MHTA 3DOJA 4JP5A 4NX2A 2X9NA 3M3HA 3N0XA 2QHXA 2WABA 1HM5A 2C1EA 1L7NA 3MLEA 3FNBA 3M1YA 4ZVSA 2AOUB 2BUBA 1XD9A 1K6JA 3HKDA 2YW2A 4IXNA 3CGWA 2PSSA 1XZAA 1TCVA 3AK4A 4POAA 4CFYA 1L4HA 2P77A 2VK8A 1S2NA 2Q21A 2VQDA 1T9AA 3CUVA 3QPCA 3HWX1 3B5EA 4N12A 1G20B 3B3GA 2PSFA 4ZU1X 3TJMA 1DTEA 1CEQA 2F4NA 2UXBB 1W35A 2AG6A 3HFJA 3HUFA 2OCLA 1J99A 4P7GA 1E99A 3U39A 2C2XA 3DVSX 4I1VA 2BIFA 2RGCA 3DDNA 2XYHA 3TLCA 4PHFA 4RD4A 2DR0A 4D6PA 1Q7RA 1JJAA 5IHXA 4D3DA 1RNLA 1VKHA 2IUEA 3TRDA 5A4FS 3MUNA 3RJ5A 5ADHA 1HMPA 5EIHA 1W5FA 3WNVA 1UXJA 1AXRA 1QO7A 2UZ1A 2GEKA 1JQBA 1JG6A 3FB4A 2ETXA 3DF7A 3I6QA 1RXIA 1TRKA 4EHJA 3VX3A 4Z4GA 1JDZA 3Q9UA 2QW8A 3LT1A 1B15A 4WN3A 3LSTA 1FB5A 5EMHA 3H65A 4BWYA 2CDRA 4EJSC 1DCFA 1FUKA 3DGEC 4LI0A 4AY4A 5EZ5A 3WWOA 4QG7A 2REOA 2Z2XA 3AR4A 3FZYA 4NIMA 4DQUA 3HP4A 4Q1DA 1C3OB 2HFKA 5LLTA 4RHEA 5JWRA 3KE9A 3KQPA 3WAGA 4JNKA 3WIUA 2M9MA 3KO8A 2GXSA 5EXTA 1IXZA 3ZJ5A 1DKMA 1PE0A 1PRYA 1E6WA 3QPBA 3CBGA 2HXYA 3PEUA 4HUQB 2KE5A 4LA4A 1F48A 1FPQA 4XLZA 4MQ5A 1PR6A 2P6MA 3PFHA 3SSOA 5U9CA 3HHPA 4KGXA 2O54A 1Q74A 1T9CA 2BMWA 4CM6A 2GPJA 2NW6A 4TUYB 3T94A 2FR8C 2OV4A 3EK2A 3CEHA 5A0TA 1W9MA 2EFDB 2IHTA 3OZDA 3S2EA 3OVMA 1YB5A 3GBSA 5HKLA 3U7JA 1G291 4MYCA 1VL6A 2YDXA 5K8VA 1FSSA 4O4JF 3PQ8A 4EOGA 1TK3A 1SQFA 4WASA 3WLTA 1KMMA 1DUSA 1F1JA 1GQQA 4CCAA 1NZDA 1HO3A 1E6UA 2QVXX 2VK2A 2PH7A 4FE3A 1BXGA 3BBPA 5ICGA 1DRJA 2JGDB 2WIBA 1JG3A 1NURA 3CUKA 3FHLA 5KSZA 3DBIA 5I9IA 5LQMA 5A06A 3WGYA 4DE5A 3MFYA 1TI7A 4QEDA 4QLBA 2WD7A 2VYFA 3E0QA 4E12A 5JJKA 3KHTA 2KW5A 3OT5A 1X1CA 3O21A 3TUJC 4FN4A 3OZXA 1JQDA 2PEYA 1L7BA 1AGRA 1ZW6A 3IDFA 2I22A 2YN0A 4UOZA 2EBHX 2BM0A 3PWZA 2JIRA 1T5OA 5AI5A 4E4RA 4HB4A 3GFGA 4HUTA 3SS9X 3M49A 3THWB 3AJAA 2HO5A 2QM0A 1AH2A 4L2IB 2P90A 2W2QA 1ZQ9A 4I4LA 4BJ3A 2VIIA 4C88A 3QJ5A 2NUPA 1DPGA 4XVHA 1VFPA 3UICA 4YJHB 3KTFA 4HNAB 2JA1A 3WIBA 1T8UA 1XQ1A 3L49A 5ALXA 1ISFA 1FYDA 4W7HA 1BZYA 1QIHA 2O9JA 1QXSA 3OFJA 4YTEA 3HYLA 4HTFA 1VLMA 2WSIA 4JUAA 4NECA 4ENPA 4WLOA 1DC6A 1D2CA 4OX9Y 4OQPA 1KRWA 1C0IA 3U2QA 1NI5A 1XK6A 1PQYA 1Y9AA 1NBAA 1UJCA 3LA8A 2GHQA 3WGJA 2HPAA 1QFZA 2BEUB 2IZ6A 2MSLA 3GJ4A 4UCQA 1QO0D 2PMFA 1L4YA 3CSDA 2EX0A 4RJKA 1QP0A 3GQBA 3W3ZB 1YJCA 3D1LA 4G81A 2QRKA 5ER9A 3KZVA 1TKBA 1L1QA 1TEXA 1N2HA 1W44A 3U9SA 1A96A 4AD8A 1IBKB 3TNYA 4M22A 4Z4EA 4A16A 1U1EA 4JQYA 4LZLA 4FHZA 4CL8A 4ZJUA 4HNVA 1CY7A 3JALA 4F2DA 4ZXFA 1DQRA 4LXIA 1XMQB 3O8OA 1L4NA 1XF9A 3KQLA 3SXJA 3RJTA 1RHMA 4XUEA 1FU7A 3UA3A 4RS3A 1LB1B 3S6JA 1OTHA 4HN2A 4IDOA 1G8YA 5TMEA 2Z5LA 4B80A 1C0KA 4X62B 1ZMXA 2FP3A 1Z5UA 2XXAA 3NVMB 1K97A 1ZUWA 3TCKA 1CXZA 5E4FA 1LPNA 3DF9A 5HF8A 4TKVB 1EFAA 2NP7A 4RF3A 1XC7A 2RARA 4RF4A 4C7BA 2RH8A 4HEHA 4TYYA 4BZPA 4E2YA 3M2PA 3O4GA 2GCIA 4AG3A 1ZQ1A 4AP9A 4MGEA 1IB0A 5JDCC 3WLNA 1ZH6A 3GV0A 1JAIA 3I5MA 1SXIA 4FVTA 3MB8A 2CHGA 2WD8A 3ZWDA 3NUZA 1E2GA 1YI0A 1MH9A 1Z2NX 1RJWA 2FPXA 1H65A 1UDXA 1N2OA 3HS3A 3TSWA 4MV9A 4PAMA 4BQEA 4V3BA 4EM6A 3PYLA 3BIJA 2IJGX 5K8IA 4FDAA 1KJ9A 3HNPA 3PNLA 3VM6A 2H4FA 2DZDA 2GA9A 3FUUA 2AVNA 4AWXA 3JWEA 4HLUC 2X6QA 1KY4A 3NWBA 4D9NA 3CF0A 2BGRA 1G64A 1SBYA 3F7TA 4WA7A 1X1DA 5DGXA 2G88A 1I80A 2Z30A 3ZJ4A 5C51B 2VHJA 4UW9A 4ZD6A 4CETA 3ROZA 4UC0A 1PHPA 3D4OA 2RG1A 1A4XA 1QYRA 4R81A 4CDGA 2PKWA 1N32B 3UMBA 4S12A 4UM9B 5E3JA 1JZTA 3EFOB 4FFBB 1ILWA 4RAOA 2B8NA 1KAGA 4BZQA 4FD3A 2Z6QA 1BHSA 1BN7A 5ED4A 1G9XA 1Z8DA 3BEDA 4COKA 3PXBA 2QS9A 1Q3HA 5AJWA 1HI9A 1W52X 2X15A 4DQLA 4MWGA 1LX7A 1XRSB 2CFCA 2HA4A 4OB8A 4P0TA 5I51A 4I6JA 1NC3A 1W87A 4G2TA 2QLLA 3O8BA 5GIOE 4OXQA 2MSKA 1SUFA 4P3KA 4ZCQA 4PVDA 4X85A 3K1JA 1Y3HA 2DKFA 4QQRA 3EIEA 4HBZA 1C4OA 1DUVG 1NM5A 4J1QA 1DUIA 2QG4A 1Z37A 3E1GA 3S7TA 3BF8A 4HJXA 1S2GA 2YC2C 2E4XA 3UV7A 1QP7A 1R00A 4JC8A 2AC7A 4OLAA 5TEVA 1X9GA 1A2QA 3VUEA 4HYQA 4XIIA 2E6UX 4CBVA 2NXNA 1Y1LA 3GJ5A 3B85A 1RLMA 1YIAA 2IOQA 3COYA 2B21A 1K7EB 4KXVA 4WNAA 1E0DA 2FG5A 1P8JA 2L82A 4HVLA 1IVNA 1EA5A 3WMRA 4PIPA 2F67A 2GEFA 4Q4DA 3O8RA 2QPLA 4RY9A 3WHIA 2BGIA 4GVPA 2CEAA 3V7FA 4HV4A 3PNKA 4LXTA 4QOJA 2I4MA 3NRJA 4CN9A 2CJWB 2CZQA 2QVLA 3IPRA 3MJDA 2H0RA 2OMEA 4P5PA 4ESVA 3IJEB 4YYEA 2ZJ7A 4OHFA 2F9LA 4LVNA 3KEFA 5E2IA 3U40A 1EFVA 1H85A 3JZFA 3EZFA 1L7VC 4XDHA 3H2GA 5M2QA 1OZAA 1TJNA 1E2QA 3BSFA 2XEDA 3LQRA 4P4UA 4JBGA 4D43A 1JSRA 2RAVA 1H2ZA 1X8JA 2ZUUA 3OIFA 4LOKA 4MW2A 3PS9A 4QBTA 3VC1A 2I6SA 1DXYA 3NTXA 5C8VA 1PWZA 821PA 3GLFE 1L5QA 3SEFA 2I99A 1PDOA 3AI3A 1J09A 4UXHA 3PNQA 4OP3A 4QE3A 4XDYA 4IDDA 3IV6A 4KMMA 1FXWA 2F3TA 3OQIA 1Y81A 3OT1B 3CU5A 3WL3A 1USIA 2RBGA 1U90A 4EA6A 4DTIA 3V7YA 1EWRA 4W5NA 2C4KA 3PICA 6PFKA 4DV6B 4EGSA 2AXEA 4IKEA 5DGCA 4CDNA 5CCEA 3BTSA 3OX4A 4LYGA 4PTYA 1NNSA 1JHYA 2VCYA 3GD5A 3ROEA 1NN0A 2WR8A 1UANA 1Z5OA 4C30A 4CKWB 2UVQA 3K30A 2ZTSA 2EG5A 3NTRA 4E07A 1J25A 1M1UA 5A5VA 1A76A 3V34A 3AG6A 3HC7A 4QBIA 4F45A 2PGOA 3FPGA 4L28A 3KEQA 5BQPA 2V1UA 3DZHA 1OX5A 3VR0A 4R2JA 2JVIA 2BM1A 1YR3A 2FSGA 3TX2A 3TLYA 1NJSA 4GX1A 4QYWA 3OH8A 3OX2A 4XIYA 3IIJA 4ABTA 3EPRA 4HMPA 1V9SA 2IODA 3IAHA 2E1RA 1S7CA 4JASB 1CT9A 2XCUA 3MD9A 2A86A 5L4LA 4I1PA 1U5CA 4AIIA 4EYGA 2R6AA 3ZUGA 1WDMA 2EW1A 4DLYA 4KMSA 2P9CA 4H77A 3ZIDA 3KJZA 5HTKA 4IG4A 2A1TS 2Q3EA 1HEUA 3KX2A 3EWSA 4BQNA 3LT0A 1OLSB 3ZEAA 1Q1NA 5I4CA 2AN1A 1ZAYA 2EDCA 4PZLA 1M34A 1H4SA 5BXQC 4A8JC 2GSDA 2VUUA 2ZT8A 3I9NA 5I7WA 4X8OA 1YE3A 3QKTA 5EPOA 4RY2A 3AF5A 2HI0A 3H3FA 1RPJA 5ITWA 1JLSA 1H22A 1CY1A 1WSAA 4P7KA 1G5FA 3JZAA 4M88A 1O1YA 2ZRFA 3R20A 4FFNA 3NHZA 5I7AA 2ZS7A 3O1JC 4RD0A 4BQPA 1SKYB 4TL7A 1E0AA 1GAJA 4J1TC 3I6ZA 3ED1A 5E6RB 1MIHA 3A9TA 1FOEB 1QH1A 4U9IS 4Q66C 3H2JA 4HDMA 3DEKA 1ECPA 4HSGA 3B6IA 3DLPX 3LMKA 1EUYA 4R7GA 4DMLA 5TC4A 4EY3A 4D9MA 3LC0A 1MA0A 1NULA 3NTUA 2Q7DA 1E2MA 4Q1CA 4M89A 2AUMA 5ERGB 1N9GB 4FI3C 4GOJA 4ZEOA 1XELA 3ZBUA 1ACLA 1K4YA 2P3OA 2PX6A 2P2ZA 1BS1A 3NKLA 4GXRA 4H1HA 1MW8X 3OIVA 5F98A 1E2NA 1E2LA 1LNZA 1Z6XA 1GGJA 2NQ2C 3L01A 4MB6A 1U99A 1GSIA 1H6AA 1UZUA 3ESCA 1QU2A 5F51A 2PKRA 1BKYA 1IHOA 4KPYA 5SICE 3KYJB 3IB6A 4QOFA 3RTDA 4DCNA 2FXVA 1XWFA 3RUIA 3T1VA 2ZKIA 3KFVA 5CVCA 2W90A 3HCCA 4YAJA 4YA6A 2HLDD 4Z1MA 4CKCB 3CX3A 1U6IA 4RF2A 3GCXA 1SOAA 5D1HA 3DL7A 4EDHA 1QYXA 2ZBRA 1LUAA 3FMOB 4P6VF 5GJWC 1APBA 3GMIA 1CFZA 5F12A 4NU0A 2XA9A 1ECBA 4GFDA 5DBGA 4J2TA 4NYIQ 3DTNA 1Q92A 5LQSA 5JMOA 3R3JA 2D5AA 4QUJA 1WR8A 2ZAIA 3UT0A 4A8HA 1CB0A 2IRWA 2PBFA 3BCSA 3CJRA 1I10A 3N74A 4OBBA 1PNVA 4GOMD 1BMDA 3ODPA 2VJAA 2UV8A 4LXXA 5IT0A 2D6FA 5DNYB 3C1OA 4M60A 3RUCA 4DY4A 4I3GA 3T1TA 2OV3A 1F2TA 2QRLA 3KQMA 1EJ2A 1ETUA 3AX6A 1JQ3A 2QKYA 4L4ZA 1Y7HA 2Q9UA 4OKNA 3AR6A 5FUVA 2JANA 4MB0A 4LTNA 1XTZA 2FP4B 1SVMA 3LL4A 4WINA 5EE0A 3TMKA 4DXDA 4UTNA 1LBSA 4JCCA 2QX8A 3B60A 5CT8A 2V8OA 1NQVA 2W2VA 1NFQA 2YJ3A 4E1BA 2WQ7A 3MW8A 2YXLA 4HGRA 2GZAA 4ZVQA 2QPTA 5KOHB 3H6KA 3REGA 3WMEA 5AFSA 5E7QA 3DOIA 1XZIA 3WYEA 4E4TA 5KAPA 2F1KA 2HNKA 4IFIA 2WJ4A 3T0GA 2A7QA 7MDHA 1MGPA 3VHRA 2ID4A 2XITA 4HVAA 4RIHA 4P82A 2OCXA 1X19A 3D2LA 4Q7EA 4H3KB 4B46A 5JOQA 5DX1A 1FTQA 2IHBA 2P9JA 3QVVA 5I47A 1HDYA 3DHEA 5AK6A 1RTKA 4YMHA 3TBFA 5BQOA 4ER6A 2GFHA 1KVTA 3KOXA 4CMGA 1L5WA 1B3BA 3WZ2A 4OLHA 4QDKA 4ZFNA 2J4CA 2XUDA 2A3RA 5CURA 1ZRNA 4DIBA 2PUAA 1VIAA 1JHUA 1FP6A 1QYDA 4I8DA 2IYAA 2H1LA 3QH4A 3GB9A 4JJ6A 5FUBA 4BBJA 5EJ4A 1RKUA 4QTTB 5AJUA 4KPGA 1XL1A 5TVGA 3R7FA 3A1TA 2O0LA 4MQMA 5EE1A 1V5FA 1Y98A 1JG7A 4WCFA 3KWJA 3UKDA 2VRCD 3C6QA 2GBLC 2DTEA 3IAS6 1JXMA 2CXXA 3VTKA 3O82A 5DNAA 5ITSA 1G42A 1K2WA 3G17A 5J2TA 1YWGO 1RHKA 3NTOA 1BVYF 1TF2A 2H31A 3H0CA 4DA4A 5IBCA 1NX9A 4F71A 5CYGA 4XCQA 3AL0C 1C9NA 1YA4A 1E5XA 2ZRDA 4EUFA 4KK4A 3HB1A 2YV5A 3TQFA 1G9SA 1PYGA 4MYRA 4H4EA 3GLFB 4HRVA 2QN3A 2XNDD 1WQ4A 4NJMA 4YV0A 5IDQA 5I9NA 2XRZA 2PTHA 1P6QA 2XKJE 4FTWA 4YXWA 4E46A 3ADCA 1H0SA 3RO7A 4CDRA 1P6UA 3TW0A 1N77A 3TXYA 1AHPA 3IP7A 1G20E 3S2ZA 1M2WA 1XVVA 1XALA 5F1OA 3T3PB 3LP8A 3W6PA 3P71T 2DUUA 1L8LA 1OVMA 1R8QA 4LF9B 2QTCA 2FHSA 1JR4A 4BN0A 5LLDA 1JKMA 1K75A 1J7KA 4IGAA 2GF2A 2IPAB 3ZDRA 4RTOA 5G0SA 4AZ3A 1D0VA 1ACJA 3T06B 4E33A 1E58A 1JEOA 1TVCA 4NAUA 1J8FA 2IYUA 3ENQA 2HA0A 3EY4A 3ZGXA 2EIXA 3CVUA 2C20A 1E63A 2B2NA 4GKJB 4DILA 4GR5A 1UDAA 1VCNA 4L6AA 2QY6A 3RC1A 1U3GA 3BD7A 1QX4A 4OQYA 5BV1A 1BS9A 3JQ9C 2CK3D 2CFRA 4MVWA 3I1IA 1ZIYA 4G5HA 4OUKX 5AH0A 3ZZNA 3PPIA 3MS2A 4AJEA 1IAVA 1KNXA 1W1UA 2A14A 1XQ9A 3LPDA 3PX3A 3LV8A 4LC9A 1NTOA 4UZEA 1EE1A 5LBTA 1KSGA 4X6LA 1DHRA 2CUTA 2OT3B 5ANRB 3DEHA 5A7GA 1NAIA 1WPRA 2IUSA 1SCUB 3NP7A 4M0LA 1ZJZA 1OTXA 1PG2A 1WMEA 1X7YB 1ISJA 4OHPA 5B4VA 4NCBA 3LZCA 1LDEA 4G2NA 3VYTB 3QVXA 2C9DA 3MIIA 2JEYA 4W8OA 3ESAA 1FMLA 2BI7A 4JELA 3ASZA 4E2WA 5K3OA 2JASA 3QSYA 1V2HE 4HNQA 4HWTA 5AJYA 4CU2A 3OX3A 4EW6A 5DIFA 1OCEA 3G9TA 1SVLA 2IYLD 3PENA 3EVNA 2B4QA 3PGVA 5ES3A 1HH4A 4BJ6A 3K20A 2JFVA 4LF8B 1GUYA 2QD5A 4MX8A 3AM3A 4WAUA 4YAWA 4NXMB 1K3UB 4XYEA 5IXJA 1ISIA 3HCPA 1DV2A 4UTZA 1UBEA 1W0KD 5D7BA 2QAGB 4UU8A 1RFGE 2VNSA 1SURA 4GLLA 2DC1A 4L5BA 4Q9AA 4AAYA 5FTWA 4BNJA 3LX8A 3VH1A 1GGFA 3K5WA 5JJBA 3L8CA 5ISMA 1B0AA 5FQOA 1OC2A 2BH9A 3OLQA 5CYPA 4DMMA 2OESA 2PRZA 5JDIC 5IM5A 4IWXA 1CJUC 4MKHA 3RRYA 4LISA 1QOZA 4YV7A 1V5EA 3OPNA 2FRDC 3DKRA 3IDOA 2J7PD 2N42A 4KLAA 2A5YB 4D4KA 5J47A 5GONA 3CMMA 1OWOA 3R7DA 4QBGB 2ZCUA 3BDVA 1XDZA 4KAXA 3O9MA 5ESDA 1CYDA 3OOSA 3QTTA 2DUJA 5CB6A 5AM0A 3OZTA 4ASUA 3P0IA 4ILEA 1JIKA 3HU1A 4XIFA 5HVNA 2Q6VA 4UU0A 4EMUA 3RRNA 1PL7A 3LY7A 2G6TA 4J4BA 3WADA 2EDAA 2O7SA 3NHJA 3K8OE 1EM8A 5JY1A 2IYTA 3Q7TA 3V1NA 2Q5CA 1TM5E 3JD3A 3NT2A 5KI6A 3IHWA 3VGJA 1IJKA 3GCDA 1Y4SA 3MTDA 1A2BA 2FLVA 2GRJA 4FUTA 4CR7A 2QT9A 3DW3X 4KV7A 4EHBA 1U8FO 2YXBA 1V48A 3FYHA 5BUSA 1YQGA 3SZRA 1OYVA 1Z0SA 5LDHA 3TGPA 2VJMA 1CZRA 2W9XA 4YCSA 3IUQA 2KQUA 2JKVA 4UM8B 5EQJB 1QTNA 1TXGA 3S1AB 3TNLA 3FSEA 3SX4A 3AHFA 2AB0A 1PSDA 4JSYA 5JSQA 1TRHA 2R4UA 4BUJA 2WWYA 1NNUA 1SCIA 1IK6A 4DC0A 3FLMA 1WD7A 1ZWKA 2NPFA 4HGOA 1JBKA 1IOWA 3BF7A 1NNEA 4FYJA 4JLSA 2HBRA 4HYTA 3VV2A 1EIWA 3A3OA 3OTWA 3PCRB 3DFIA 2H2GA 4N0QA 1MC4A 5T8KC 4LQCA 5JEDA 1R18A 4NOKA 4ALNA 1CZNA 2FUCA 2H59A 3A4NA 2HUNA 3G8DA 4HDKB 1Y33E 1Z88A 4QUDA 4WVFA 4PQFA 4WOPA 2C57A 3B38A 4BO4A 5AD1A 2BL4A 2JI8A 1GY8A 2C8VA 2GD2A 3DEFA 3NIGB 3KYBA 4DKXA 1JT9A 4DDTA 1TNDA 3T9DA 3GCWA 4ZPJA 3KPUA 2Q6OA 5L7WA 1SIWA 1FIUA 3E3OA 4WXEA 1X39A 2WILA 3BERA 2Z6UA 1UK9A 2CNKA 4LAFA 3DZCA 4C05A 1HOXA 4L3WA 4GC5A 3RVJA 1IQRA 1MPTA 3DXZA 4C5AA 1CZOA 1KO5A 3RK0A 3SYKA 2FMKA 3DDWA 4KNWA 1BA2A 2WUVA 3B52X 3A6GA 3Q0IA 1EPUA 1WUJS 2VP4A 4XOIA 1U0NA 5CFOA 1I4LD 3HDVA 1FX1A 4QQ8A 1CKEA 4XFDA 4FDUA 1QQ5A 1D2MA 1CZKA 2C4HA 3GWZA 1UDBA 2O2ZA 1C3VA 4D4IA 1J0BA 1NUPA 3OSZA 3VDNB 1G18A 5ALQA 1KFEB 1KPHA 3ZHTA 2XSZA 2J9FA 3NBAA 2OQIA 4DN6A 1DG3A 1XHFA 3ENKA 4H7PA 1CJBA 1QLJA 2OO7A 5EJGA 1O08A 4ZAFA 3CZMA 2QN8A 4QT0A 1FSFA 1YJBA 2GFIA 3L7LA 3LKDA 2C2WA 4B35A 1N0IA 3LUFA 1U7TA 1WB6A 2QNRA 3GGSA 1ZRSA 3NVAA 3B89A 1P0MA 3DPUA 3O7WA 3SFVA 1E77A 2RJOA 2WHRA 2EAUA 3WL8A 1CUZA 1X7XA 3ZZTA 7REQB 4ALLA 2AJ8A 5EMKA 1Z8HA 4ERNA 5K0EA 4H27A 2XJ9A 4WZBB 5C1OA 3LDUA 2GZHA 2LCQA 4QYXA 2EKPA 4KRXA 3WS7A 5GV8A 6CHYA 4S2EA 3OMWA 1U0HC 1V1MA 4YBZA 1NBWB 4TLMB 3T4UA 3ACBA 1GOTA 3HYTA 4PM4A 3FYUA 4I19A 1D0IA 3SR3A 1YS1X 3F6CA 1JHXA 4KWIA 4P98A 5CU7A 4AECA 3DFKA 4H7HA 3R6GA 1GIAA 1A5BB 3U3RA 3FWKA 5D3QA 1Z4LA 1KZHA 3W6ZA 1WZCA 3OF2A 4MTCA 4WK4B 3ETGA 2CNWA 1GZ6A 1SXJE 1X8LA 4I4TF 3VRHA 4CQJA 4O3FA 4UBKA 2DBRA 3KL2A 4GVLA 4DNXA 1B8UA 3EHDA 1VMKA 3OJWA 1P5ZB 1R4MA 3GJ3A 2RFLA 4D3FA 5LR6A 2RBKA 2B83A 3A8TA 3KLNA 4TL8A 4JUFA 5FWAA 1NBOA 1MT0A 1JL3A 2VOJA 3OA0A 3PUZA 3AYZB 4K9QA 4NJEA 4P2GA 4QEZA 3TLAA 3HRIA 2J3JA 3P9IA 4IIJA 1BHJA 1P29A 3SD7A 5LOVB 2RMKA 5TGDA 1UT8A 4OHKA 1G19A 4DMUB 2VJOA 4RV5A 2HMVA 4DIKA 3DFZA 1YQEA 4Q16A 1KDZA 2ZUEA 2E2WA 1QV6A 1WEHA 2EZTA 2NTYC 2OE2A 2ZWPA 1DC4A 2XCTB 3OFNA 4N5HX 5FDFA 2EIHA 3DTTA 1JF8A 1PQUA 1Y7PA 3JQCA 3LUPA 1OQAA 2JCSA 4X1KA 1O4WA 4D8WA 4HDOB 3CY6A 1UOOA 4I5EA 1U81A 4KAJA 3K70B 1IEVA 3WLRA 4L08A 2N1MA 3V2IA 4UDNA 4HVCA 2UUOA 2R86A 2LKDA 4AMGA 3U7HB 3MF4A 1IUNA 1E1RD 1ZNYA 1FNNA 2HREA 2XHZA 1AK2A 3MTGA 2P6NA 4IKPA 4N01A 4O02B 4ZQHA 4F3YA 1SUAA 4IDNA 4EGQA 1RMYA 2PS0A 2QUJA 3FFAA 5FPKA 3DBRB 3UK1A 3H8JA 4RTPA 4DNFA 4QUIA 3WNBA 1OA0A 1B0UA 4ZEMA 1NHGA 4PNPA 3TZKA 3EC1A 1X7YA 4ZK2A 3DO5A 4TMZA 1F8UA 1I7LA 4R9VA 3GK3A 2GA8A 3TB4A 3UXYA 1BWPA 3L0BA 2H4XA 2AOXA 2W37A 4HF7A 2XDQB 5L4NA 2UVPB 1P1BA 1PGPA 2X2OA 3D4LA 3G3EA 4YHHB 2GF0A 1QZZA 3A26A 3HJFA 2CYBA 5JU6A 5K6AC 3KJFA 3FRHA 4L9AA 3I8OA 1LDNA 2E4VA 1K88A 3E9NA 3FPAA 1YQDA 3A2LA 1HG1A 2IW3A 3MRVA 4PLZA 1ZSYA 1TAHA 3FCYA 4TT3D 5A4IS 3D3QA 1HURA 1ODCA 1E1QD 2R79A 2BFBB 2VJKA 3GFTA 3R0XA 3LPNA 4UAGA 2QLBA 1JXAA 3OZ7A 1XMVA 1BC5A 3KBOA 4PWZA 1UM9B 1WW8A 3EG5A 4O4IB 4X97A 4B2LA 2QEQA 3K8ZA 2P27A 4KQ6A 5DN9A 4W9RA 3HZHA 3FZGA 1X6VA 4FD2A 5KTMA 3O47A 3A3PA 2D7DA 1WJGA 3VC2A 3W5UA 1N75A 3SS7X 2DHRA 4RK5A 4AJ4A 1L7PA 1WDLA 3A25A 4Y2GA 3VI3B 1E6EA 4IQGA 5ELXA 5BQXA 4EF4A 1TM1E 1W19A 2EQBA 4CIYA 3WICA 3EGVA 3IXQA 3WNQA 2G1UA 2X14A 3K1AB 4UEQA 4YRCA 2V74B 3BSWA 3G0OA 1GG5A 4QARA 3RKRA 4EYOA 1R6UA 1AA9A 2QRVB 3KT3A 3G1UA 4GBMA 1I7NA 4TM7A 1VSQA 5IBPA 4PNHA 4RPKA 5KWVA 1G0OA 1SOUA 4RBNA 4DIOA 4S1OA 4RACA 2LPMA 1P4JA 4YUXA 2QX9A 2RH4A 4ON9A 4CODB 2ZR9A 2J7KA 3H9EO 4PR3A 5JH7A 2GTHA 3O8QA 3LNTA 5B6JA 2D0PB 1KR2A 4LV5B 2FPGA 1H2FA 3GW8A 2AFIB 4CMBA 1J1UA 1EWQA 3ZYZA 2C96A 1WDWB 1ZGZA 4YI5A 3TF5A 4UAJA 2FZ5A 5EJ8A 4KIWA 2VTDA 4DR7B 4ZALA 2WTEA 4UHFA 1NVKA 1C14A 1UP7A 2VOEA 4QUEA 4BV8A 4X44A 3EGCA 2BC9A 4DZRA 2XZPA 3A6LA 3BMNA 2VJLA 1K5PA 4ZOAA 4N3GA 4WMLA 3GRYA 4RJTA 1EWVA 1CRQA 3U7QB 3GEMA 3I1FA 5BWNA 1A27A 4XWKA 1XB2A 4ZC1A 1J00A 3PC2A 4F1WA 3V55A 4Q3BA 5LFAA 2R11A 1U7HA 3HCOA 5JH7B 3PRKE 4RHCA 8ADHA 2Q0HA 1NMSA 4DLAA 2C4UA 2H4HA 2G36A 4KGDA 3Q1LA 3G2QA 5D1NA 2ZROA 1UQTA 1IZ9A 2GN1A 4KBGA 5BVGA 3GMTA 2IK8A 3CURA 3LPAA 4FWTA 4FJ1A 2DKOA 1FNCA 1U1CA 3SS8A 4AUKA 4PIMA 4H0FA 2QXTA 4B73A 3WGMA 1KIMA 4NU5A 4YRPA 1TUBA 4UUMA 4R1TA 3VPFA 4QNRA 4E30A 1O0SA 1M34E 1TTPB 4U9HS 3I83A 4HAUA 4EYSA 5EZYF 2HL6A 1E96A 2WA2A 4CLEA 2MR6A 5BP7A 2AN3A 2XT6A 3WSTA 1DFGA 2AJLI 4N5DA 4CI9A 3GLTA 4B3JA 4HGQA 3GD7A 1PQWA 2FSUA 2WSSA 3H1EA 1OWPA 2WVGA 1AF7A 3BULA 4ND8A 5ALYA 5FPSA 4ZO4A 4J7CA 5FNVA 1P7YA 2PD4A 2ADMA 2ZVDA 4HDNB 1ZINA 4ZJPA 2OXCA 4FIDA 2V6IA 4GS5A 3DBLB 4DDUA 3AGPA 2P0AA 4NMLA 5A05A 3WGIA 1F2TB 4DR2B 1BCSB 1PVOA 2W2LD 5T4EA 4MGIR 5B12A 4R0NA 4Q3AA 2ZR8A 3FGZA 3TSCA 5KSYA 5JDIA 2QTVA 3ZDEA 3CVYA 4CWAA 4LCEA 4N7MA 1V11B 3E2PA 1AS3A 4UCXA 4P4SA 3D0KA 4GI2A 3IL2A 1R4AA 2RGYA 3HCWA 4P34A 1T13A 1RQXA 1UMBA 4MEBA 4K9PA 4YB8A 2CHEA 5H81A 3DEJA 1O9BA 1SHKA 1YONA 3L77A 4IWYA 3RIEA 3TZ6A 4AXXA 1Q3TA 3P5SA 4PG8A 2WF7A 3SQDA 4OYYA 2JDIA 3B2NA 3IOMA 1G2PA 4MI9A 5B2FA 4NMMA 3ZJUA 3NU1A 2G1PA 2J9XB 2PGIA 1NW8A 1O9HA 2C5SA 3H1FA 3OOYA 4Y3UA 2IA5A 3N59A 2YQZA 2FG6C 2GZRA 3FDFA 3BMOB 4C89A 5IS2A 3AOEC 3G85A 4M37A 4BNNA 3MWFA 2BGNA 4MPDA 1WXFA 3NHKA 4C0KA 5JAQA 4AY2A 4YDRA 1DQSA 4DV7B 3ZVMA 1VHLA 1XCJA 2FZWA 4Z5XA 2MYNA 4Z3DA 5C35A 1IN7A 2DT5A 1A9XB 1V6SA 1U0LA 2AS0A 2Q3JA 2PRIA 1VJ1A 2G67A 2I7DA 3GF4A 4ID9A 2GVNA 4L9SA 2IXDA 3IEUA 4MVJP 1PD1A 3Q3GE 5KTNA 2Z8YM 2UZ3A 1I14A 2Z5FA 4TVBA 1EXNA 1HQYE 3DOCA 4FLEA 3VR6A 3WDKA 3ZEIA 4AN4A 1PLJA 2ON6A 3TSAA 3VU3A 3HN2A 4ZV9A 1G3UA 3UUFA 2QQGA 2D54A 1SQGA 1N5DA 2CLDX 2ZUVA 4MUHA 1LDMA 2YZGA 1JJFA 4B4DA 4CG1A 2L2QA 4F1JA 2OHHA 3M81A 4GWGA 3CWQA 1O87A 4V0KA 3WOHA 3IAFA 4I55B 1EJ6A 2H06A 2RI1A 2YASA 4K6OA 1Y1QA 3NBMA 2MR5A 4WZBE 1R0ZA 4NC9A 4R1UA 5EY5B 3L0SA 1DQZA 9LDTA 3JWIA 3HA5A 1ND5A 2WU8A 2TMGA 4ZMSA 1BYUA 1NC1A 4BOYA 1IZZA 5BORA 2WLTA 1OLSA 1XYGA 3H7AA 2A57A 2XMDA 3BAFA 3HVIA 3OPMA 4LXYA 1Z4NA 4P4SB 3T9AA 3HV2A 3R7SA 3I9LA 4WZBA 1LK5A 2ZGVA 3QWFA 3WK7A 2JRCA 3T5CA 5A7FA 3HNRA 3RADC 1ICIA 2HA5A 1GADO 1T9GR 2PYIA 2VBIA 4LE0A 5G1OA 1BMFD 2D06A 2PRKA 2X8JB 5IC5A 1NYQA 5C3UA 1Z82A 4BFLA 1E61A 4G36A 2VYQA 3I8SA 4NHOA 4UDOA 4FCWA 4IRXA 2LNDA 3TMYA 3ZIAD 1PR2A 3VJRA 3S8YA 1N8KA 2FN7A 3KLPX 1KJ8A 3LUCA 3LXUX 4OHUA 4RK7A 2G04A 2XWBF 5DI3A 3KSAC 1GXSA 2GK6A 4EY7A 2ZM6B 1CY0A 3ITKA 3KU4A 4Q9LA 2PXAA 3V1TC 1U9YA 2UZIR 4QGAA 3A6PC 3IUBA 3SHOA 3QFRA 3P9NA 4R3NA 4B9AA 1TUBB 2VHVA 1XCPA 3OO1A 4XCXA 2BAGA 1NBEA 5AJHA 4HZGA 1PK7A 5F9FA 1NBMA 3P9RA 4CF5A 1Q2XA 1SUPA 1SKBA 2WAXA 3N3AC 4WZAB 3AUJB 4EI2A 4MVJM 3GUCA 1FTWA 2IYPA 4E3WA 5A5DA 2IC5A 2IIPA 4G89A 1X3LA 3C7CB 1ZJ6A 2R5FA 1N2SA 2O8VA 2QTMA 3A6FA 2EGHA 3I9V1 4OKSA 1NYRA 1P2VA 2A5DA 2XJ4A 2XWPA 4JT2A 4JYCA 5ALDA 4M6WB 1SCKA 1XL0A 2PGAA 4LWOA 1Z4IA 4D0NA 5FRDA 2VHCA 4M8LA 2A30A 2N75A 2WU4A 4GLJA 2CXPA 2N0SA 2PZFA 4LN1A 1HA3A 2IXFA 1T43A 4Y2RA 2INGX 4F4IA 1CJKC 1NW4A 1ZIXA 2JCBA 2PIAA 4GH5A 2WHEA 4NAHA 2VJNA 1F6DA 4ZXPA 4ZEVA 2DH5A 4EG7A 1SOVA 2XTZA 1E2DA 4GOOD 1AZSC 1K68A 1MV5A 2J09A 3FDIA 4FE7A 4H60A 1LKZA 4IUDS 4K6KA 4RK1A 4HAXA 4MGZR 3AETB 5H02A 3MUFA 1H4QA 1JPNA 2JCGA 2WYOA 4B4WA 1CB7A 3GNSA 5AKYA 3U3ZA 3X3HA 5CD9A 1RD4A 2CNDA 3A70A 4IDQA 4REQA 1H3NA 4JFRA 3JQ8A 5M5BA 3I58A 1O89A 1XKLA 2NO1A 3BL8A 2V1XA 2JFUA 1MR3F 3D0RA 3LDFA 3QYAA 4O59O 3BDIA 4YJGA 1J0EA 4C0AC 2HNBA 3T7TA 3CSUA 2COKA 1T0BA 4R01A 3UENA 4F8JA 1JYFA 4OATA 1N7HA 2CBXA 2XW6A 4YXWD 1WAMA 3Q12A 5F4BA 3UQYS 4MUJA 2RCYA 4HVTA 3IIIA 1W94A 3UK7A 2BFBA 1HDZA 4JXZA 2QN6A 4M8IA 4K05A 1GV0A 2WHQA 4PCAA 2O50A 1VTKA 1A4RA 1T4BA 1YR9A 4DUGA 5EJ9A 2NZ8A 3EMVA 4WXHA 1Q0TA 1SKQA 1B2LA 2JFQA 1WQ1R 1RBMA 5C31A 3LT5A 2D2IA 5EYPA 5FAKA 2CVZA 4AO7A 2A9OA 5KYYB 3PJRA 5FI0B 2WHPB 4PBSA 1ZSNA 3D3WA 2LP4Y 3DTVA 4KMOA 2Z56A 1VJ0A 3EF1A 3KJGA 1KY5A 1J6UA 4GRAA 4US2R 1OWNA 3FPEA 4MR8B 3HRKA 3PGJA 3AU9A 5H7XA 2GZMA 3I1JA 1KVQA 2FH5B 4DA7A 1VFNA 3ZBTA 1AC5A 3HXQA 1KEVA 1H2RS 1PR0A 4D8VA 3BQNB 2JFNA 3K9NA 3I2JA 3AI7A 3RKUA 2HRBA 3L07A 2FSHA 4ZT6A 4EY4A 1GTMA 3AINA 4PGAA 1LLCA 2VQ6A 4JQCA 3M5WA 2A3NA 1WUKS 2XTAA 2P9GA 4X8HA 4P3NA 5DTRA 5I9TA 1AKVA 1U7OA 4BDSA 3CINA 3E15A 4RHUA 3GDHA 1JFVA 2FR8A 2ZJ2A 4R8MA 2B1IA 1LBIA 3HCRA 4A2QA 1SPXA 2F43A 3M9LA 4CUZA 5KVSA 1W2HA 3IKJA 2D1YA 4BWVA 3Q9SA 2OZPA 4H0CA 1EX7A 2DQSA 5KWIA 1QHEA 5LQCA 1MHPA 1P62B 2R8BA 2R4QA 2CVHA 2XPCA 4OJQA 2Q4OA 4LZWA 1DXHA 4LTMA 1MOZA 4TWRA 5IJ9B 1SZCA 1IOLA 1MO5A 4IDHA 3QUQA 4IF4A 4UBIA 3ZCPA 3D6AA 1LV8A 2H9IA 2NVOA 3FBGA 3LVQE 2RGWA 3M33A 3KCNA 5DYIA 4B0OA 4CKXA 2Y1CA 2XWJI 5IVPA 2BEUA 3CUWA 4XJTA 5JNLA 4ZVOA 2IP4A 3LL7A 1GDHA 3HO6A 1RC0A 3ZXYA 2XGJA 2NSDA 4KI0A 3AUFA 1LI4A 1MG0A 3M6WA 3Q72A 4IVNA 4KYIB 1PLKA 3DL4A 2QP4A 5KMGB 1OWMA 4YRKA 1TAUA 1GNLA 3AFHA 2QF7A 3B20A 1SPBS 4GZLA 5EE3A 5EJ6A 2B5OA 4NRDA 4X0EA 1KARA 3RAGA 5JCJD 1POXA 5DB4A 1RW4A 2O2CA 3E61A 2XQGA 4L95C 5A1JA 5DU2A 5HF9A 1OZFA 5LCXA 4NLLA 4M1TA 4D6YA 4YRSA 3M2TA 1D7OA 2EJCA 5BMOA 5AW0A 1HLFA 2AR0A 3THWA 3TQRA 3ZJYA 1QH8B 1XAIA 5K03A 2FHPA 4OM7A 3U5TA 3EAFA 1VCMA 5JCOC 5EJFA 1Z8NA 2F2TA 1ONOA 1U98A 4KE8A 2O8DB 4L15A 1E69A 2YW9A 2O5EA 5IH7A 2GAOA 4BFTA 4WXYB 3UPUA 1DWUA 3D81A 1Q17A 1AZTA 2WUFA 4G5XA 3U13A 3VOSA 4RZHA 5CEEA 3VSEA 3SHFA 3T7JA 2WKQA 2XE6A 2Z08A 4HWPA 4NZPA 3T3EA 4UD2A 2DFVA 2QTGA 5HPYB 2WM9B 3Q88A 4FNGA 4G07A 3UANA 1KWKA 4XGRA 5FOXA 3L4EA 3ICEA 4X3PA 2CN1A 4QLOA 3E2MA 3DDSA 5CIQA 2H3EA 3QLUA 4OQ4A 5A6SB 3RH0A 4AJPA 4CR8A 5BR4A 1M83A 3AWDA 4M53A 3U48A 1E5DA 2DCUA 2WWHA 3G2PA 4CF6A 5A2GA 2CXNA 4BX3A 3ESYA 2D74A 1GQRA 1PL0A 1T0PA 3H04A 1ORVA 2QJRA 1SXJA 5FI3A 2QMOA 1Q14A 3AUAA 3DMYA 3L7AA 1Z0IA 5KQGA 2VP3A 2BZSA 3DMRA 2AG8A 2WI8A 4IDFA 4HY3A 4MB2A 2GEJA 1JYEA 1P1KA 1R6BX 4OQXA 3ZGVA 4D0GA 2Y76A 3BRQA 3UM9A 3CJQA 3D8TA 3M83A 2BI4A 3UC5A 3IILA 4XYBA 1XLWA 4RIEA 2JAXA 3L8EA 3CNOA 4QYIB 1RZRA 4NE7A 4O2BB 4IJKA 5ICSA 2AJDA 4G97A 5ALLA 2J46A 3AH8A 4UMEA 1CEEA 2RKBA 2GN2A 2HDWA 2ZKLA 3JD2A 3NHRA 5AI9A 2QAGC 1RAIA 2UXDB 3QF4A 1DCMA 4DLWA 5ED0A 1BGWA 1WSWA 2QUAA 3PL5A 4QRIA 1VKOA 3EIUA 4U3JA 3A04A 1R6XA 3ZCXA 1C4XA 5CFZA 1A8HA 1KIFA 2IV2X 3U0BA 3WYBA 1WMDA 4L85A 3GEGA 1NY6A 5FF9A 1KEKA 1PZHA 3HDHA 3EGWA 1EM8B 4QXRA 5AVZA 1P4AA 1ZGHA 4UBOA 1QF7A 1E89A 3C97A 4MWOA 3SLRA 1KEPA 4R1QA 1EVQA 3FCAA 3F47A 3EPJA 2AW5A 2HM7A 4JVMA 1FJGB 4LOJA 1E3IA 5DULA 3II6X 3NCHA 2PFGA 2VAXA 5C53B 1PJ3A 1UUFA 3CZCA 3GDOA 3U7EB 1WBDA 4X7PA 5FWXB 2O8EB 3LQ2A 1G5RA 3CN9A 2PD6A 2PSEA 4FXOA 1B3RA 1HOTA 2H2HA 2YINC 4NPCA 4OHCA 3SXUA 3VZSA 4DBZA 1NOJA 3PF8A 5KZMB 3BMXA 3HPQA 3DAHA 4BV2A 4DA0A 2EKQA 4D4HA 2DWQA 3R9KA 5LXTA 2Y8EA 3TTUA 1ZL2A 3L40A 3U4GA 4NH0A 1G6HA 5LUAA 5E6UB 2F7SA 2HF2A 5AUPB 2GARA 2Q8PA 1NQUA 4FX2A 1W36D 8GPBA 1M5RA 1MC8A 3COPA 1JTEA 2O0HA 3CH6A 3CG0A 4RKFA 4S1PA 4EHFA 2HRQA 1HFKA 2QL7A 5JECA 2X42A 3IVXA 2JHFA 2K2QB 2EZUA 1J06A 1IG0A 1R9GA 3K4QA 4KDFA 1UXHA 4L4RA 1IQ0A 1H2BA 4YP9A 1QH1B 3C7DB 4C22A 4ZICA 4BECA 1TPYA 3D8RA 3OA2A 4ZVMA 1P5JA 4MZXA 3KT0A 3DWGA 4ZOBA 4QXPA 5EFZA 1IBSA 3O7MA 5AI6A 3VSCA 1FL9A 1PG0A 2H8GA 2WOJA 3OTOB 5LUBA 1EP2B 2WIAA 1T5IA 4QGHA 4YAOA 5DTJA 1WMSA 1AO3A 1QK3A 4RL4A 4G5OA 3R7AA 1R6TA 3GZTB 2M6SA 3KVOA 1J21A 3I2FA 4FR5A 2XOKD 4YO7A 1YGYA 3HCFA 3P45A 1L7EA 3PWKA 5LQNA 3JYHA 3NALA 1WZ2A 1EAMA 2RKOA 1JQJC 1U8YA 3AR3A 4CKBA 2GHIA 3IUMA 4X65B 1HZJA 3ZI4A 2HMYB 3OOWA 2Y9MB 1U7UA 1YASA 4DG8A 4IMJB 4QUAA 2B8EA 3H0KA 4KNVA 1Y6ZA 3BWYA 1XOIA 3FROA 5C1BA 4PSDA 4BFVA 3I8XA 4KW7A 2OYCA 3V8EA 2FY8A 3ABSB 3BFXA 5CXXA 3RUPA 2O8NA 4ZOLA 5SYNA 3T5DA 3BHNA 2XNSA 4L4YA 1SBZA 1X1EA 3GLHE 3IELA 1USKA 5DW0A 5F5XA 1IOVA 2XCRB 1AGNA 2K2WA 1W1WA 4XVCA 2OV1A 2XVAA 4CZ2A 3H9BA 1DFHA 2YRWA 1CQZA 3C3YA 5EWMA 2WWIA 3WDMA 1UKYA 1N6IA 1XEWX 1AX9A 1XRPA 4I5DA 2NU9B 2C07A 5F9HA 5K9ZA 5B58T 3T34A 1L3BA 5EQDA 4CEJA 2R7AA 4OK5A 1J0CA 2I4LA 4FS8A 1Q0LA 5E4TA 1W47A 3PUIA 3EZGA 3DE2X 3FNFA 3KR9A 2P4QA 1AU9A 1Z5PA 3UT5B 1QKIA 1JSLA 2CLOB 3TJZA 4MRSA 5KVVA 1ZI9A 1C3XA 3OHPA 5EL0A 3EXEB 2O57A 1J24A 4JLAA 4QGBA 5DPMA 5HILA 2ZIZA 3D64A 3OZSA 3LWZA 4YUVA 1PNRA 4IDCA 2AW3A 3RFXA 4TZ0A 3U7QA 4UNRA 3NFRA 2BN4A 2GASA 4JLUA 2M6RA 3FTPA 3I73A 1J22A 1HZZA 3KQYA 3KK0A 3VO1A 4F4CA 5HZKA 2JDID 5KKNB 3DDHA 4P3XA 4ZIRB 4CQMB 4UQOA 3ZHSA 4QU8A 1A69A 1CUGA 1UINA 2O0KA 4LE1A 4OH7A 1J8MF 2WW8A 2K4MA 3DCYA 2P6PA 3U0VA 1PR1A 5FBHA 1IJFA 1AURA 1VE7A 2B5WA 5L3SB 3ROQA 3T9CA 5MN5A 4UOQA 3OQNA 4C7OA 3N3BC 3RGGA 3FLBA 5ALPA 1NVXQ 1PT5A 1A8IA 3V6LA 1U3FA 3RNLA 1DLJA 3UYLA 3RSLA 3QVKA 3NHMA 1RRKA 1T0HB 2BFPA 2O7RA 4RPIA 3V8PA 2B5VA 5K0BA 2FK7A 1N2EA 1HORA 5DE3A 1M2KA 3FNIA 1U0JA 2EW2A 1ZLXA 3A1SA 4OMFG 3KB8A 1XF1A 1I1OA 2V4ZA 1SA0A 3CO5A 3VPGA 3SC3A 4L4UA 4EPTA 5K2OA 5FOQA 4P0PB 1Q1EA 1FDWA 1X70A 2IYYA 1KXZA 2PUGA 4JL8A 2GDJA 3EVGA 4BHTA 1PS8A 1ZITA 1MDFA 2HJHA 2IYQA 1XZQA 3KJNA 1JB1A 4FGSA 4IVQA 3RS2A 5H16A 1WXEA 3PFFA 2AQHA 4NMWA 3ZW7A 4YT8A 5A3VA 2WMNB 3ETCA 1FDUA 3WGQA 4DMCA 4CEIB 1FXWF 3K72B 4CTNA 1SQ6A 1DRVA 4R16A 4YJ2B 3KSRA 4GBGA 2FRVA 2Q1WA 1VXOA 5BYBA 3CTMA 1R6DA 2C3PA 3PC7A 4U4AA 5BN1A 1A5TA 1BJRE 1FVOA 1RM4A 1XNQB 2FMFA 4TUYF 4S0XA 4LGVA 5DYNA 1GPUA 4MPJA 4W1PA 3E8XA 3R9XA 4R8RA 4MCIA 3AR5A 3ITNA 1H3EA 4YAFA 2F62A 4MQUA 4AU1A 2PLRA 3WIVA 2ZULA 3AKYA 1R3DA 1ADCA 1VJCA 3PQ2A 4JK3A 4MICA 1SHLA 1JFFA 3GAAA 1DAHA 2WUDA 3OOEA 4HL6A 3UAXA 5BWLA 3NOQA 3P9XA 1A7JA 2XMRA 2XVYA 5FB3A 4CKCA 4J0DA 1XTVA 1K8QA 3TW8B 1UEIA 1X1QA 5IN4A 2RGGA 4GLFA 3MSXA 1FDTA 4QVIA 2X13A 1C9YA 4K1XA 4WFJA 1JX6A 3V9PA 4Q1EA 1DRKA 3PT9A 4DLKA 1QHGA 1XU4A 3FXAA 3QXHA 3PTLA 2XTJA 2C03A 3KVVA 4TYMA 1U7WA 4UUBA 1OF1A 4UCWA 4NU6A 1TTHA 2OYSA 3R3UA 4WCVA 2YZ2A 4DCJA 5CVEA 5HKKD 3U1BA 4PXAA 3AVYA 2ILVA 1C29B 1HQCA 2GZSA 1XRNA 4KQJA 2XXAB 4V24A 3GLHB 3MUOA 1L4FA 2OTCA 4MO2A 3U1TA 1DKRA 2JJ1A 2QYSA 3ZNPA 4ENUA 2Y1XA 1THGA 2BTOA 2WAMA 2IE8A 3WO0A 3WK5A 4F4HA 4X00A 1DKLA 4LV8B 3ESXA 1MVLA 4F72A 1GG8A 4R83A 3EVFA 1GR1A 3T3MB 1LD3A 1WA5A 4NG4A 1CDZA 5IWAB 3A1WA 1I9CA 4LYAA 1B6TA 2AEMA 5HQTA 3PQCA 4QAQA 1PI3A 3HKCB 4QFMA 3L4SO 4QDXA 2ZB2A 5IVKA 1ZIOA 3KLMX 4ZOQI 3KOYA 4J9VA 4RELA 3U7IA 2WAOA 3DCNA 3JYOA 4ZI7B 1NYTA 3ZV4A 1JLHA 2QD3A 4BNKA 3EQ2A 1E3SA 1HPLA 2PL9A 4I14A 5D01A 4AVYA 3P0HA 2NQ8A 2PX4A 1QIKA 3PCTA 1US8B 3LW7A 1U5BB 3AEXA 4KE6A 3E8SA 1KORA 5CNMA 3ZD6A 1P0FA 4R84A 1V8BA 1GUAA 2JB9A 2Z9DA 4K6MA 5NULA 1BHQ1 4Z99A 1EX6A 1W88B 2HBYA 3D6NB 4GZ5A 3O5AA 1P5HA 1VQ1A 3Q85A 2GPNA 3M6IA 1Z07A 3IBSA 4Q3NA 5CVTA 3SCZA 1S02A 5FR2A 2WIFA 2VBCA 4U2EA 3EGDA 3SI7A 2OHJA 1N5OX 2PCLA 1E1RA 2ZANA 3OJLA 4LHWA 1QFMA 1YS7A 4FYPA 4U2GA 4EHNA 4HAYA 5LQKA 2VHUA 3QQ5A 1RM5A 3MMZA 3UOAB 4V0SA 1IL0A 3AEKA 4LDJA 2QR5A 1U8UA 5IG2A 3QOWA 3WYFA 1WOYA 2ISQA 1Q57A 3AUUA 3IMKA 4MSUA 1FXSA 1QLWA 1P7VA 3EVDA 4KKVA 1EXMA 1HF3A 3AEKB 1HKUA 2QQ0A 2E82A 4B6QA 1EBBA 4C0HA 1C9MA 5F23A 4QG3A 3DCJA 1ZD9A 4IOJA 1EP3B 1Y8QB 5TLSA 2WUWE 3MYRA 5F7OA 4NK4A 4BO0A 2ZUDA 3Q7EA 1NQAO 2V5UA 4PPYA 3NDJA 2VSXA 1JUDA 3E7PA 3QLEA 1G41A 5EUMA 1Z63A 3K9QO 3QFCA 4F4DA 1OV4A 3DTVD 1IWBB 3GXOA 2YIJA 3KTOA 4Q1BA 2L0XA 4B3SB 1BJKA 3LDAA 2JGIA 1SHTX 1NP7A 1RXCA 5LBIA 1Z6PA 4YY3B 2QRNA 3I4FA 1JG1A 1QVZA 2BISA 3CF4G 1D2AA 1TUIA 3LQYA 3RNOA 4M1KA 4PX3A 4TV9F 1N5JA 4F9EA 4R2XA 5DBEX 1YR8A 4LGCA 2JAWA 2ZVQX 4W63A 1MNQA 1SD2A 2XECA 3ZK9A 3TQSA 1Q0QA 2ATIA 3D8SA 4FDLA 4OSEA 2Z4SA 4GX0A 5AHKA 5DN6D 4MINA 3KEOA 3DT9A 1GUDA 4TQGA 4LOAA 3GX1A 5KAMA 3K9BA 5K0CA 3EZNA 5THQA 2FPSA 3E9RA 3E9DA 5L53A 3UUWA 3W1EA 3NVKI 3BL6A 3OPYB 1R12A 3RCBA 1B6SA 3K7EA 5AKJA 1CS0B 3IOEA 5CLHA 3WR5A 2HHJA 4KWEA 3DONA 3SR0A 4ZMRA 3U09A 2X77A 3RSZA 4W4TA 1TCCA 4CRWB 2YWJA 1UKVY 1PTJA 1TU4A 2HCJB 4EVIA 3ZR4B 2IYXA 4Q9NA 3IR5A 3TE7A 4ASUD 2Z9CA 4UNNA 1JHOA 4PXYA 4ZAVA 4BU0A 3I6BA 2B7LA 4Z54A 1ETHA 1PIWA 1I2CA 2F48A 1M7BA 3GUZA 2IU4A 1JMKC 3KJIA 3NNDA 2HT1A 5IYZB 3O31A 1YJAA 3CPHA 2HR1A 3HUTA 1A9PA 1VLJA 4N49A 4W5QA 3GA0A 4GE0A 1KJWA 1W75A 2F9FA 2AKYA 3FHJA 4IZHA 3FCEA 4XRRA 4X6UA 4G5FA 1C3EA 2Y1EA 2WNIA 4NCJA 1V45E 3WSVA 1NGSA 3ZWVA 3PDIB 1N6RA 1PEKE 2PYZA 4GIBA 3OOJA 4EKGA 3DB1A 1T2CA 2FOXA 1GZ4A 4LFBB 1RACA 2OLKA 1L5HB 1PFGA 1XDUA 2OM6A 4WFQA 1J5PA 1G8FA 3ZK8A 1W6UA 4LOIA 4HPWA 4DLLA 1T24A 5DGTA 4MA0A 2ZPUA 3L06A 3A3YA 3F6RA 4WKBA 3FVRA 2IZ1A 2HQRA 3CIFA 3DP9A 1ZUD1 3FVWA 5I3CA 3F3MA 3MWYW 1IEXA 2IHJA 4OPMA 4MLZA 4WEQA 3PB3A 5HEKA 3NUGA 1Y1PA 3IT1A 4Z0NA 1MEEA 1I1HA 2IITA 4ZO8A 3ER9A 3JQBC 5AK4A 2YH2A 2R00A 3F6YA 1AB6A 2V97A 3FZEA 2IGTA 3MNFA 1SHUX 4UXJA 2Q9CA 3PFKA 5JISA 2PKEA 1J4AA 2PCJA 4LHSA 5DRYA 3RARA 1K08A 3A4MA 3D31A 4G5RA 2IPOA 2E55A 2YZKA 1SKUA 4AZVA 2ZPTX 1XYVA 2V3WA 3DO8A 3EFHA 3K0AB 1OPRA 4HH3C 2JK0A 2XI4A 3OE4A 1RIIA 3B78A 1HE4A 2I6UA 5D51S 4A8PA 3JQ8B 4AJLA 4Z1OA 4E5DA 4ZI3A 4JJFA 4LMBA 1YDWA 5TT1A 3DSRA 1LQUA 1XTJA 4L76A 3PPXA 3X2EA 5JLJA 1GUZA 4INOA 4LX8A 2CXHA 3UK0A 2WKSA 1MB4A 3KZNA 4QPNA 5D6NA 1WZEA 1Z36A 1OAOC 2QRPA 1PFYA 3OT4A 1PGNA 3HB4X 1CVRA 2M32A 3RV4A 1FS6A 2IFTA 2VDOB 2SICE 2FSPA 1TECE 2YUIA 4X9XA 5FUQA 1E5LA 4PSVA 1X1AA 3HDQA 2R65A 4II2A 2SHKA 3HBLA 3N39C 4RF5A 5HUHA 2IIVA 3HA7A 1NAHA 2NT3A 2YWCA 4RD2A 1MIOA 4KV9A 4C0LA 2ZB4A 2ECFA 5EMLA 1M0SA 3FPBA 3RRZA 1ABBA 5HCNA 1DIOB 4XJSA 3UUEA 3ETJA 3LUHA 1WUIS 3LP6A 3VX4A 3B6MA 3WB0A 2W2OA 4IHJA 2RGDA 4IIEA 7ABPA 1DBPA 1L1EA 4GOKA 1XZEA 3K15A 2A6PA 2GEBA 4K88A 1R37A 5EEGA 5NLLA 4BMVA 3Q8KA 3OM0A 1JDPA 4JUIA 1C4KA 3WK4A 3AF4A 2X0JA 1XEXA 4Q5IA 4I9GA 3G0DA 1L8XA 3LX4A 4Q01A 4V3CA 1DJMA 3IT2A 3U44B 1AOXA 1M6YA 1NXSA 2W6IA 3L6DA 1Q6YA 4WZAA 4D74A 5J2TB 4B71A 2G76A 3HBJA 4M98A 4TXJA 5F1KA 1ONBA 2NO7A 4Y6QA 3UZUA 2XMPA 3EFEA 2NYVA 4CMCA 4WCFB 4QRDA 2VWGA 2IUUA 4DWJA 4YFVA 4XLLA 2QP3A 2WM3A 1VJTA 4ZVUA 4UJ5A 5TMPA 1YB4A 4NDNE 1B1AA 5EWMB 5A9TA 1Q84A 3M1IA 1LPSA 4Q1AA 2LWIA 1DDIA 1T6NA 3P97A 1L4UA 5CLQA 4ZZ0A 1ZDMA 3OIUA 3EWNA 2QM3A 2Q5HA 3SU8A 1KYZA 1O8BA 2WLSA 3I9OA 5CVDA 1SOMA 1C1XB 3FMPB 3NC0C 4GPIB 4QFBA 2P5YA 3WBFA 1U8TA 3AIIA 5DM4A 4PV7A 2YN4A 4I1SA 5L7YA 5INTA 1JKJB 4GSKA 4IIVA 1TM2A 4KPUB 4Q3OA 3LU1A 5MGNA 1RZRD 3KFXA 1E2JA 2R8XA 3GO4A 1GPYA 5JJLA 1UOEA 2A88A 3H2HA 5AW5A 4CKEA 3AFNA 5E0OA 4RFVA 5IH3A 1KYVA 4I8XA 3LG2A 3INYA 2QZ4A 2PLNA 4PYQA 1U7DA 1C3OA 1OKKD 5CA0F 4BB0A 5TQ2B 1CR1A 3G0GA 2W00A 4JHLA 1R9MA 3D4PA 1P75A 3W1VA 1IY8A 3JYNA 1NDQA 3E1KA 1QYIA 1YBFA 2PU7A 3OEED 3QKRB 4X95A 4C78A 1K2VN 3MBKA 4HT3B 4H18A 2Q2VA 3GNTA 3V1KA 1L4GA 1YCDA 2OXTA 5IDXA 4UFPA 1TT7A 4UHKA 3TYXA 1HYHA 4QTYA 5HHTA 3TQIA 1Q7TA 4XQGA 3WK6A 4TXHA 4BCBA 2CL7X 1O6ZA 2H7XA 4FWBA 4AF6A 1J8QA 3V5NA 3O1IC 4E5MA 3HGTA 5WRFA 3NBZC 3S5UA 3ZLBA 3AQIA 4CEHA 4XSVA 4YMTA 4XVRA 5B1EA 2G7ZA 2QU8A 1O54A 4IIFA 4WGFA 3VNBA 4RX1A 4ACAA 4W1RA 1XQXA 3NBQA 5BSTA 5A5FA 1MQ9A 4S2UA 4ND4A 1GDTA 1HQKA 2QN1A 5LSAA 3PVZA 4OXIA 4DIMA 3KYDA 3B48A 3ESZA 4ZCRA 1J07A 4MUIA 4PGHA 1P72A 4OGLA 16PKA 1GGKA 2P91A 4CL3A 3F2IA 1IQUA 1U3CA 2QT0A 3H99A 5ERYA 4WK0B 4H7KA 3RK4A 3UCFA 3UIEA 5CLGA 3DKIA 3D6JA 4KDCA 1XEAA 3TNDA 4EO7A 2M1XA 3EASA 2CB0A 1G3MA 1RYMA 3UG6A 2QSZA 4M1SA 3GAZA 4LYFA 3Q3VA 3C24A 2HOQA 1U1GA 4POOA 5KNBA 2VXCA 3N8HA 3PXCX 4PZEA 3L0OA 2D7JA 4X7BA 5HS4A 1OH7A 1HDIA 1XYYA 1F8FA 1YBAA 4E08A 3SYNA 4ND2A 2SKEA 5CX1B 2DMRA 1Q7CA 1CF9A 2FF7A 4MPRA 3PD7A 1MRSA 2CXOA 3ANNA 1MO2A 2FRDA 2H9YA 3KDAA 3MRXA 2AFIE 5J63A 1WUHS 4U3JB 5JZ9A 3GFQA 2PEZA 4BZZA 4F4UA 3F0TA 4UOEA 2Q2OA 5IM4A 4L5JA 2ZYDA 3MAGA 4BRWA 4ZYTA 2DE0X 1TA9A 4H7JA 2CJYA 4IDGA 1VYTA 4YJ2A 2EX1A 4MIKA 3FUTA 3NKFA 4P5DA 4A0QA 1CHNA 2A59A 3FI9A 5FV7A 5IKXA 1UIRA 2QWXA 1Y8RA 1CY6A 2RGNA 3IEXA 1NQOA 3NX4A 3PSHA 4PSCA 2WJPA 4MRMA 3V7NA 2PZLA 1NMYA 4UKDA 3CGGA 3HKBB 3ONWA 4UTOA 4UEWA 2EHJA 3FTCA 2XDYA 3G2KA 4OJNA 3ZNQA 4ENSA 4L7VA 2M2IA 4IGKA 4WOKA 1CNMA 5BUCA 4FFVA 1C2YA 1UBRS 1JKJA 2YJTD 5AKIA 3DE4X 4MAAA 1QWOA 3IIEA 1CP3A 1RXWA 3QUTA 1X15A 2RK6A 4GQAA 5JTUA 1J20A 4YRLA 2YWBA 2ZBGA 1CQWA 1F3LA 2DU8A 2TRSB 1CSEE 2A35A 5AQEA 3WRVA 5CIYA 2QQ5A 1LQTA 4Y2XA 2QDKA 3RC2A 2VSFA 4LC0A 4NMHA 4F92B 4BGDA 4NABA 1P4GA 2NTJA 3EUEA 4TZKA 4MKRA 3ZZ0A 1JFRA 2RKWA 4H1UA 2G07A 1UC8A 3Q0TA 4EJSB 2RBEA 4XTCS 3MN1A 1MAUA 2Z6VA 3A1UA 4CKWA 3ZWNA 5HKKA 2Z2IA 4DJ5X 1R4NA 2C97A 3GN2A 3MMNA 3A1FA 1IBLB 1EHYA 3R0VA 3A05A 3AP2A 3FJ1A 3AJDA 5C46F 3SG0A 4ZKDA 4A2CA 1OI3A 1TUGA 2OFXA 2GILA 3BFJA 4YC7A 4QJ5A 1YRYE 2HCRA 4DM3A 4EBBA 2MHCA 4OL0A 5JVDB 5BV8A 4DSUA 1DJOA 3K1YA 1Z2OX 5ECWA 5FWYA 3UGJA 1V8OA 1NMXA 2BUCA 2WV7A 3A6KA 4PNZA 3O84A 4NFSA 1QSGA 5IN5A 1JDUA 4BV9A 4XRGA 3HK2A 2HB6A 2HSJA 3MTAA 3FUXA 4MLPA 5GIPE 4C6RA 2GOYA 1PNOA 2EQAA 3FDJA 5DBOA 3QW4B 2H6EA 4LZZA 1VIMA 1LTHR 3HXPA 4RVUA 2H1FA 3GEPA 4PZZA 4ACBA 4LY3A 3ES9A 5AM5A 5EWJA 4TKZA 5C1IA 1HE1C 2B35A 1G8HA 1VI2A 2ZP1A 1PUXA 2H4JA 4OXRA 1TYDE 4O2AB 2YS7A 4O4IA 4W9MC 1T3GA 3IUJA 4R0MA 1GEEA 1BS2A 1E64A 1V6CA 1WXGA 1DARA 2GVDC 3A0UA 3GI1A 2DFTA 4R8KA 1QZTA 5FNVF 2HQBA 2PPVA 5L3RA 2RHTA 2XT9A 2ZSHA 3INTA 1YNSA 4R68A 3ZCQA 4K9MA 4ZGBA 1JEQB 3A58B 3IEMA 2JHPA 1NE2A 3TCNA 2IYRA 5GP1A 4ZI5A 5LYJA 2F3QA 1TYZA 1BCRB 1FSZA 3KXLA 2Z09A 3V8NA 4ADSG 5B4TA 1MZPA 1EU1A 3B1VA 4L51A 4GKBA 2ZYWX 4UFOA 1RPNA 1TTQB 1PKXA 2OXRA 4IZOA 5BURA 1SCNE 1U8AA 1HRDA 4O0MA 2B92A 3ACDA 4JYZA 4F6LA 4XVUA 3SIXA 1N78A 2Y92A 1ZO8A 3FYCA 1OLXB 1Z3IX 3VO2A 1VRVA 4W5OA 2V54A 1W29A 1VYVA 2E4WA 3RWOA 1FW6A 1R0SA 4NTZA 2OOKA 1L4KA 1L7MA 4FZ5A 2J0EA 2VDVE 1J56A 1P44A 4IHQA 1YQWA 4AQDA 2YY7A 2G08A 3HDYA 3KV1A 3DL2A 1KOJA 2ECKA 1V8DA 4CM4A 4LHEA 1OHHA 2FZLA 2QR2A 4GPBA 3IKLA 4L07A 3ZK7A 2X0IA 3OC6A 3ICQB 1RHJA 1XZ8A 2XB6A 2KLHA 3SAJA 1IIBA 2NZVG 2QGFA 4AQ7A 1KC3A 1NRJB 3R5KA 4UNQA 2A33A 5LB4A 3PDIA 5DM60 1EM6A 3OFND 4XPZA 4DAOA 1KMHA 1G38A 1CTQA 2YXNA 1TYAE 1GPKA