3BL6A

Crystal structure of staphylococcus aureus 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase in complex with formycin a
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
230
structure length
230
Chain Sequence
b'AMMIGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAFLEKAAVSSSQTVEALVSQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-methylthioadenosine nucleosidase/S-adenosylhomocysteine n
publication title Structure of Staphylococcus aureus 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 78
structure length 230
sequence length 230
ec nomenclature ec 3.2.2.9: Adenosylhomocysteine nucleosidase.
pdb deposition date 2007-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3bl6A00
1PR2A 4KN5A 3OZEA 3KVVA 4TTAA 1YBFA 1RXUA 1CG6A 4OJTA 3KUKA 1ODIA 2ON6A 1OU4A 4P54A 1ZL2A 3MMSA 1PF7E 1ULAA 4M3NA 2OXFA 3OZDA 4WKCA 1RFGE 2A8YA 3EUEA 1FXUA 4DA0A 3E9ZA 4JOSA 5F7ZA 3DDOA 1ODJA 1JDSA 1V2HE 1Z5OA 3INYA 3OOHA 4JWTA 1ODKA 1U1FA 3GB9A 1ECPA 4GMHA 2QTTA 4MCIA 1JYSA 1LX7A 1RXYA 1A9RA 1T0UA 4GLFA 2IQ5A 3IEXA 1I80A 4G89A 1PW7A 4OY3A 1A9TA 4E1VA 2QDKA 4DA6A 3MB8A 4R2XA 1RYZA 1JE1A 4QFBA 1JDVA 1JE0A 1T8SA 1SD1A 1VMKA 2OC9A 3BL6A 3K8QA 4LKRA 5CYFA 4K6OA 4NSNA 3KHSA 4U2KA 1A9OA 4LNAA 1PR0A 1SQ6A 3UAXA 1V4NA 4EB8A 1Y1QA 4QARA 1OTYA 1TCVA 4F2PA 3E0QA 4UC0A 2AI3A 5DK6A 1ODLA 1C3XA 2PGAA 4WKBA 1U1GA 1JDZA 3SCZA 5EFOA 1Y1RA 3ENZA 1K27A 1OVGA 1Y6RA 5FAKA 1RSZA 4MCHA 1SJ9A 2A0WA 4NS1A 1U1CA 3LA8A 2QTGA 1Y6QA 5B7GA 4YNBA 3PNPA 1Z5PA 5EUBA 2HRDA 4OGLA 4BN0A 1QE5A 2HN9A 5F7OA 4DAEA 4BMYA 1OTXA 3K8OE 1A9SA 4QAQA 4WKNA 5CYGA 2ISCA 3LBAA 4D8YA 4TXHA 5K1ZA 2HSWA 4OF4A 4TS9A 3T94A 4PR3A 3FAZA 4R31A 3OZCA 3E9RA 5CXQA 3OZBA 5ETJA 2QSUA 2I8AA 1WTAA 4YO8A 1U1EA 1PKEA 4IP0A 4TXJA 3OPVA 1LV8A 3ODGA 1Z5NA 1B8OA 5B7NA 1Z39A 1PR1A 4M1EA 3D1VA 3UAVA 5F7XA 1VFNA 4MARA 3FB1A 3PHCA 1JP7A 4YJKA 3FWPA 5I3CA 5IFKA 4LNHA 4R2WA 4DABA 3F8WA 4BMXA 3BGSA 2RJ3A 4D8VA 1PBNA 4OGKA 1CB0A 4GLJA 3DPSA 4TTIA 1TGYA 1SD2A 3KVYA 1N3IA 3NM4A 3TL6A 3UAYA 5IU6A 4QEZA 1A9QA 1B8NA 4H1TA 5KB3A 4BMZA 4TYMA 2AC7A 4F1WA 3BJEA 1PWYE 2P4SA 4OEHA 4TXNA 1U1DA 1RT9A 3DP9A 1T8YA 3PHBE 4NY1A 4LZWA 3KU4A 1ULBA 5C80A 3NBQA 4RJ2A 1ZOSA 3KVRA 2QPLA 2AI2A 1T8WA 1A69A 3IOMA 4DAOA 4L5CA 4DARA 1PR4A 3OCCA 1VHWA 3FUCA 1Z35A 1JPVA 1NW4A 3NM5A 1PR6A 5B7QA 3EMVA 4F2WA 1Y1TA 3DF9A 4JP5A 4G8JA 1V41E 1Y1SA 3O6VA 4GKAA 3DJFA 1YQUA 1K9SA 4TXMA 5CCDA 5F78A 4TS3A 1TD1A 2GUWA 5B7PA 4DA8A 4DANA 4PNPA 4WKPA 1RCTE 4L5AA 4QATA 1YRYE 3O4VA 1Z33A 3OF3A 3UT6A 1V3QE 1Z34A 3FOWA 2OECA 3OOEA 2A0XA 4EARA 4F3KA 1PK9A 5JPCA 1Z36A 1LVUA 1OV6A 1XE3A 1PK7A 5F76A 1V45E 2I4TA 1TGVA 5EPUA 2Q7OE 1NC1A 3EEIA 3EUFA 1Q1GA 1Z37A 2OC4A 1PR5A 2XRFA 4D98A 2H8GA 1YR3A 3BSFA 4G41A 2AI1A 1JDUA 4FFSA 2B94A 3ONVA 1TCUA 3LGSA 1M73E 3QPBA 4TXLA 3UAWA 1JDTA 2BSXA 1A9PA 1RXCA 4LDNA 3GGSA 3P0EA 4YMLA 2HWUA 4L6IA 1T8RA 3NM6B 5F73A 5CCEA 3UAZA 1G2OA 3C74A 5CXSA 1YQQA 5F7JA 4X24A 4I2VA 4D8XA 1VHJA 3U40A 4ECEA 4WKOA 1K3FA 4TTJA 4L5YA 4M7WA 4QASA 1RR6A 1RXSA 3FNQA 1Z38A 1NC3A 1V48A 3P0FA 4D9HA 4F3CA 3PNSA 4L0MA 4DA7A 2A0YA 5F77A 1OUMA
chains in the Genus database with same CATH superfamily
5JSKA 3N0VA 4ENQA 1W4ZA 4R71A 2JJMA 3QEBZ 4O4IB 5F21A 5CA1F 4A91A 4DNXA 2V7BA 3LY5A 1OGYA 1PFVA 2OGUA 2UVDA 4MOWA 4ZVLA 1WB9A 1AZSC 1C9KA 1CUEA 1LBHA 1W4AA 4BNXA 4ER5A 1M7BA 5AK0A 2F43B 1YASA 3EQ6A 2LVBA 3Q5DA 5IWAB 2RBEA 5C5CA 4M9XA 3DHWC 3B60A 4IKPA 4XD2A 1V5GA 3HEAA 3E15A 4TWZA 4Z9XA 1ULAA 1O7JA 1TYAE 2W71A 4DG5A 4GOJA 4LOKA 2RHHA 3LTNC 3GIDA 5BSUA 3RM3A 2XMGA 2ECPA 2EW2A 4EHKA 1H2XA 5EKSA 3ZTYA 1P7YA 5DB4A 4IDNA 1WXHA 3LX8A 3QU4A 5ILOA 4KR2A 5AW8A 3LX6A 1T2VA 3FOBA 2H29A 2IHVA 4RS4A 1FXUA 2YICA 3PNKA 4B3IA 3TJZA 1ANKA 4JOSA 1O3YA 3OQNA 4U5QA 2XUDA 3AZPA 1I4WA 2IP2A 5G4LA 4P4UA 1IHPA 1T2UA 5DSZA 3VPFA 3CA8A 4JWTA 3OLXA 1ZHHA 3MTJA 4K0RA 5JYDA 2G5GX 3EPJA 1VMIA 3HABA 4CEJA 3B48A 3QFHA 4ZMRA 4N8SA 1EJBA 2PNJA 3QVKA 3KU1A 2YWEA 3VDQA 2XXAB 1ZD4A 1NMQA 2X40A 4C5BA 2BF7A 1SK9A 1O6FA 1OLUB 3LBFA 4Y6RA 1Y1LA 1XKTA 3KPUA 4QLAA 5GVSA 2J5KA 2JZOA 4RPIA 1KJ8A 1KEZA 2WAMA 3K7EA 3KB6A 3DNFA 2O5EA 1OWPA 2IK8A 3ZR4B 1N92A 3PEYA 3FDZB 5COQA 4TLEA 1FYDA 1HYEA 3I30X 2BFDB 1IBSA 4UU1A 4Q93A 3IIJA 4O2RA 3EARA 4MVCA 1OLOA 1QZUA 5HZKA 2XRZA 3JCZA 2FPRA 1L5HA 2QKYA 4HZUB 4QRDA 2WJIA 1JAZA 5E6RA 2IYFA 3TTVA 2IODA 4KXLA 4XQCA 5D51S 3N2NA 3HXKA 3N28A 5EXTA 1ADJA 2V6GA 2G7ZA 1JE1A 4HDSA 4L0QA 3GLTA 3WGJA 4KE8A 5TQ2A 5TPWB 2PTGA 4B2LA 1ZLXA 1ND5A 1GL3A 1SRQA 3I0ZA 3AVVA 1AMOA 1CUGA 5CHEA 1B00A 3CX3A 3QGMA 3B12A 3IULA 4M49A 2UVPA 1FU4A 1TJPB 3KT8A 3L0OA 3CUUA 4TQAA 3LXRA 2QAGA 3QUBA 4U7GA 4YGYA 3V8PA 1Y3BE 2ZQZA 3N2IA 1H3FA 5ALJA 3RLFA 3E61A 1VLZA 3D3KA 5EHNA 1Q7CA 4TMTA 4NR0A 4OMUA 4LSGA 3TZBA 3B7WA 4TLMB 2HQOA 2FMHA 2WUWE 4HYYA 3AEUB 1KJYA 5EZ5A 3VU9B 3REGA 4AFNA 1IEWA 1NXOA 4FC6A 4YASA 3G6WA 5DE3A 1P7VA 2Z2KA 3CISA 1IN4A 1YIAA 4BWYA 4Q1EA 3L1KA 3SXPA 1MOPA 4R9RA 1Y1RA 1ZMRA 3BXXA 1FJXA 1EGQA 1OF1A 2C1XA 4P84A 1E32A 1ISRA 4A8HA 3FUXA 1Q0PA 5IKMA 1T24A 2YHUA 3OD5A 2OY0A 4GX0A 3I5UA 2A0WA 3Q88A 4NZZA 1ZFNA 1U5BA 2DBZA 3U13A 4ZDIA 5EIBC 1Y8ZA 4ZYZA 1D4OA 2R1VB 3T8YA 3CVJA 1UKAA 2O07A 3ZD9A 4ARUA 4CG0A 5I9NA 1QF6A 5HILA 1PG5A 5MN6A 3C70A 5K5EA 3SC2A 1NW7A 4ZYTA 3ISJA 3RYCA 2BZ0A 3QNUA 2RAVA 1G64A 1Y8QA 2W6JA 4BLOA 4DIFA 2HPHA 4ON9A 4CIAA 1G60A 3PGLA 3PYLA 4J0DA 3RTEA 2HH9A 4IIHA 4PR0A 1TUBB 4JUBA 4WACA 4YMSA 1A7UA 3X0DA 3D4NA 1P4AA 3A2KA 2GZRA 2M6RA 3NP7A 4QHTA 1FFEA 4NK4A 2XJ9A 4LGCA 5IARA 3A9VA 2VG8A 2OUIA 3KJZA 4BVHA 3VYTB 2X42A 4U5XA 3LLSA 5FNVF 5EERA 5JO9A 3ZOKA 2B98A 5CJJA 4A8JB 2GPYA 2ZJYA 2L2QA 2AA3A 3BM5A 3M6FA 2HSWA 1NATA 1OD6A 4X20B 3MRTA 2JLYA 4WIAA 2D00A 2O1SA 5IDVA 1MMFB 1CQPA 1GZHB 3D2AA 2V7QA 1T9ZA 4LMPA 3ADCA 6REQB 1WS6A 2VYVD 3VH3A 3RTDA 1ZJYA 2WV7A 4LISA 2NYVA 5FWXA 4AB1A 5GIOE 5ECGC 2P1ZA 1ZXXA 4JUAA 5FA6A 4M83A 3WDLA 3FUWA 3IE2A 1PKEA 2FSPA 1A7JA 3ITNA 2IWHA 1PJ3A 3RS7A 4JODA 4XJVA 3V1YA 2VUSA 1EX1A 1GA6A 2DGDA 2J3JA 3C7DB 1YB5A 1H9BA 1XI2A 2NO0A 2X77A 3GJ8A 1HA3A 1V5EA 2HCFA 1VGQA 3OH8A 4JAVC 4QYSA 5AVWA 4DRXB 2BMFA 1FK8A 1PR1A 1ZJ6A 2Q6LA 2V7XA 3DFZA 1QAQA 2VPTA 3FKSA 3HCNA 4QPPA 4B6PA 1Z0FA 2VJOA 5IKPA 3P9KA 2O2CA 3M70A 5JD6A 5EESA 2AMJA 5JXWA 1I0IA 3EGWA 4W99A 5DLDA 2OCXA 2Q3CA 2HNBA 1DBIA 5DHTA 3S2ZA 2O2EA 5AQEA 1I6LA 2QVXX 3OU2A 3WBKA 2Q4OA 1J70A 2GBGA 1PLJA 2ZJ7A 2P5YA 4RZUA 2QRMA 1F6WA 1Z4QA 3EIUA 4UM7A 5KVSA 1P5ZB 2GEFA 2ZS8A 5LDHA 3D5EA 1ZONA 4OA8A 1XPRA 2R7KA 1OFUX 3MG9A 2DPHA 2C2MA 2P0EA 3EOBI 3P8ZA 4J29A 3VUFA 2NZ8A 4YV0A 3WGGA 5KBYA 1WUTA 4B9EA 4IDPA 3B3QA 1X7XB 2DHEA 1M3SA 4IIJB 3SQNA 2P2YA 4JMLA 2BGGA 4G0YA 5KWEA 4X84A 2HA3A 1U4SA 1W8IA 3FCCA 1E2EA 2BRUC 3QPVA 2W4IA 3BRWA 3PHLA 2VYQA 5SZJA 4I5IA 1KFKB 2ACKA 2JFUA 1NA5A 2P79A 3PP8A 3U81A 2PZEA 4F3NA 4V1CA 5JECA 3NV7A 4LC9A 4DCNA 3AL2A 4ZK6A 1KPGA 2ZU6A 2QQ5A 3A3NA 3U80A 1KFEB 3PWTA 2FRDA 2VRCD 3NTUA 4PQFA 3VPAA 1KKLA 2GDJA 2NSYA 2BE9A 3HWSA 4ANFA 1R27A 1WU8A 4TTIA 1XRMA 1SQ5A 2YCLA 1M5UA 2YMLA 4P7GA 1RPNA 5HIJA 1LB1B 2YWGA 5FYQA 5BT9A 3RVPA 1NU6A 2DR2A 2IHNA 1VZ3A 3CF2A 2QVYX 2PCLA 2CK3D 2H85A 3IR5A 1EXNA 5B6PA 5JSZA 3AG5A 3NHLA 4Y2SA 2Q5IA 4KWIA 4BUZA 1NJ2A 1Q21A 3FD8A 4H1TA 4CMHA 2PU5A 2A9OA 2W2LD 5ALTA 3OT1B 3QKUA 1KSJA 4X54A 4F8EA 1EB8A 4MV0A 4YJ2F 4TYMA 2XVAA 2RC6A 4H6PA 2F3PA 1I7LA 3I09A 4IJ6A 4DLTA 1KJWA 2D8MA 3UN1A 3BJEA 2Y68A 3IP9A 4YT8A 1N6KA 4JSRA 5TRTA 2DY1A 3P2YA 3L4EA 1G5HA 4NG5A 3OUZA 4S1VA 1MDFA 3TL2A 4B3RB 1YBVA 2QRKA 1FFXA 4G1MB 4XB2A 2VYCA 4UDNA 3RVSA 3IAXA 1JIIA 3FYTA 1OV4A 4Y1GA 4P4SA 3WDSA 5LDGA 1E5VA 1W85B 3KU4A 4DRZA 5KJ1A 2YNMA 4K2HA 1PR3A 2GK3A 4O6VA 3MGGA 4XPZA 5FV7A 1R6BX 3LZ6A 4JASB 1KQ3A 5GJCA 1E3WB 4GI3A 1BU8A 1DT5A 1YSCA 4DV0B 3TLMA 4L57A 7ABPA 4TM7A 1U1IA 5E1MA 5HIAA 2AK3A 4KQ9A 1X9GA 5F5NA 4HUQB 2EWMA 1H2RS 1V96A 5E9QA 3F96A 3NQ41 3NVDA 3RASA 3TB6A 3HG7A 1QZXA 3PDIA 1U0HC 1V6SA 2QT1A 4E4TA 1AMUA 4WN3A 4UTNA 1G18A 5EHGA 1RLMA 3EASA 3U9TA 3PCXA 1JNYA 1TK2A 5ITZB 5LA6F 2GM4A 1FW8A 2V7VA 4AJIA 3PRJA 3S3TA 1VE9A 1CY8A 2HDHA 4H15A 4C78A 4D44A 2ZYSA 2WR8A 5JSYA 3TZ6A 5KNBD 1T1IA 2G1KA 3WVNA 1JHXA 2C0QA 1Y1TA 1MB2A 1U6KA 3DUWA 3O8NA 3VR3A 2ATCA 5IK2D 4KDFA 4PYIA 1BQEA 1GGKA 4BX0A 4LN1A 2GN2A 4FSXA 1V11A 4MAAA 1SHLA 2O2ZA 3DEIA 2D74A 421PA 3ENNA 5B30A 4FCWA 3U4HA 3LV8A 4H31A 2X1VA 5IC5A 1PUJA 2G5PA 1E58A 1UFKA 2B1JA 4WNCA 3UGTA 3MD0A 3ZIDA 3GEEA 4DA8A 1CP3A 3FGZA 3EXFB 4JLAA 5DBOA 3W34A 4K0KB 2UYQA 4YR9A 3PC8C 4BECA 4UFOA 4JYMA 2H7VA 2VYND 3G9XA 3SIWA 3T52A 4EMUA 4JR2A 3ZHQA 1OREA 4BX8A 2Y71A 1SAYA 4HH0A 3OZSA 3SYKA 1CZOA 2Y1XA 1N0IA 1TYBE 2RGNA 5JTUA 5A9TA 4XSVA 4KFUA 3OF2A 2BR4A 1TVEA 2IZ6A 4AY4A 2AC2A 4YRGA 2VR1A 4J4TA 3EFEA 2OFFA 1NQTA 4KQJA 1S7CA 1NKVA 1B8VA 1GYQA 3EPPA 3GELA 5AKEA 3RK1A 4ARSA 4EABA 4MV4A 4LYAA 1JXAA 4LJKA 4P3XA 2W6IA 3ZCVA 1LNSA 1WB6A 3N3BC 3U39A 1ILEA 2H0QA 1SHJA 4I1RA 4LYYA 4RV5A 5TS3A 3ZE2B 3UQZA 5AVVA 1EUQA 2Z5VA 4ZANA 1P75A 4ZT6A 4WBNF 3R2JA 1E3EA 1JLRA 3TOXA 4B7CA 2Z9DA 4QUAA 5LB2A 1OA0A 1P17A 4OK3A 2JH3A 2PQ2A 4IR7A 1CUDA 2A4MA 2ZDQA 2Z8ZA 3GROA 4EH1A 1V16A 1KK2A 1Y7LA 3JQ8B 4QXOA 4QWWA 5JDCC 2HBZA 1B76A 1QHIA 2I1VB 1ZOLA 2I8CA 1VSBA 2ZRCA 3OMWA 4PTYA 1AQUA 5ALVA 1VRCA 3SM9A 4FXOA 2VHTA 4ZCMA 1FSZA 1HQKA 4I9NA 3ZW8A 5KTTA 4OHKA 1O6ZA 1TJ5A 2R6R1 3D54D 4NQRA 2XIJA 1W9MA 1WXDA 3E53A 3L04A 1BSVA 2B5OA 3R5JA 3TIIA 4YMVA 1GAXA 1IN1A 1G3MA 1SCBA 5IDQA 3UW3A 4OYLA 1T1GA 3ACBA 1XLWA 3RWOA 4G8CA 4H60A 2O50A 3UJ6A 4JYZA 4Q1AA 4O1IA 4WWHA 5ER6A 2ZYTX 5B3KA 2AN9A 5J47A 4OXRA 1BX1A 4P4TA 5GADl 4L2IB 5UKDA 3BJMA 5FADA 5MGNA 1CUZA 4KREA 5JS8A 1OZHA 5HWSA 4ER7A 3HXQA 2XYQA 1T8RA 1NWHA 4RPJA 3UPTA 1YOBA 5LUBA 3GLVA 4F4JA 2OB1A 4NJEB 1X8KA 2GZ1A 6GPBA 4KQHA 5M04A 1LXCA 3ZDCA 3PX7A 3MWYW 5K3SA 5KQGA 5JNRA 3LT2A 3WKCA 4J0QA 2BFFB 3UJ3X 5EXDA 4CLRA 4HFMA 3D3EA 1FZTA 2ODEA 4NE9A 5ANRB 3TZKA 3G8DA 1RHMA 2AXQA 2UUBB 2Y9PB 4PXSA 4YT5A 1G9XA 2SBTA 2VJQA 4ZOLB 2PUHA 4UTVA 3D6UA 4RTQA 3F6PA 1IY2A 1V37A 4MUGA 4FM9A 2ZEJA 1FMFA 2LRHA 5ALUA 4AMGA 2Q8PA 3GFSA 4ZDWA 2ETXA 1CV2A 2H2IA 3UOGA 2BMJA 3S55A 3L7JA 1DFHA 1ISSA 4NV0A 1ZW1A 2A57A 1P2BA 4X8LA 5HCIA 1POWA 4RNCA 5DGTA 1E61A 3EAFA 1RXSA 3UQYS 4EENA 2YWJA 1F2UA 2CZQA 3T1OA 1UDWA 2QTFA 4HWTA 4TMKA 5AH0A 1NX9A 4QG3A 1UKZA 1QHYA 4N7RA 4NCKA 4EHAA 3MT0A 5LD2C 2G09A 5C2JB 2OBMA 4LFCB 2P9BA 3HYNA 2GZMA 3AFHA 4M89A 4JGBA 2MYPA 4C9BA 3WMWA 1TKBA 2ZSFA 2AOWA 4GC9A 2ZJBA 3RVDA 2O8FA 4P7JA 3CF4A 4ZYYA 1KYZA 3WGVA 3U4GA 1Z7YA 2WD7B 1MBZA 1R10A 2VUIB 4AS1A 3AHEA 3M6WA 2R85A 4JYCA 3IT0A 1GQYA 4P08A 1UZAA 1E2IA 2RHBA 4K9SA 4F3TA 2FSGA 3OQIB 1FSGA 2XRYA 5G3YA 2K7FA 4BAUA 3LBIA 5BVHA 1JQJC 4YCBA 2IITA 1ONNA 1KFCB 2ZWMA 3V7FA 1VL0A 4DCTA 4WCVA 2PAAA 2O7QA 3FOCA 3TUIC 4GEKA 4MJLA 2W00A 3P9IA 4F5ZA 4DIUA 1NJ5A 1E9CA 4UNIA 3IKVA 3GGCA 3WBBA 5SYMA 2HHCA 2JCBA 3NG1A 5JO0A 1LV7A 2D2FA 2JBWA 3EA4A 1Z0IA 2YUIA 3JQDA 2AOUB 3GRPA 2ZRAA 1ZC4A 3N8KA 4R3NA 1LPMA 2ZAIA 3FAKA 5HIKA 1C3OA 1AKVA 2X13A 4M3NA 3GIWA 2OXFA 5KYTA 3LYLA 3ZJUA 2W2QA 4W5HA 3Q5GA 4J2TA 5HJ2A 1APBA 3S2YA 5EJ5A 1H0RA 2D5AA 5D7BA 1N5JA 3JWGA 3W5JA 3PYXA 3TS1A 4XOUA 4W1PA 1U02A 5BQPA 3EX7C 3AMVA 1V2HE 2QI9F 3K9LA 2HPZA 2C3OA 1S8OA 1CY0A 3C45A 3INYA 3S2UA 2NU7B 5JXGA 2AEJA 2GWHA 3HN6A 5KPDA 2ZRPA 1Z22A 3R6LA 4MLPA 2CJYA 1IL0A 1NVBA 2V0CA 4G8DA 4UTRA 3OPXA 4YI5A 1T1RA 4EEXA 4GOKA 4KRXA 4R41A 3LO8A 1D2HA 1H94A 2DUUA 3OPYB 4PNEA 2AW5A 2CDNA 1JYEA 4BS9A 2FPIA 3N5CA 4O33A 2FPPA 5KUTA 3E8SA 1M76A 4FYPA 1A95A 1G4AE 1P2UA 3OIYA 3RK4A 2B8WA 2F3TA 4D9EA 5JI2E 5LMNB 1FNBA 1TVMA 4X6LA 2ATIA 1MB3A 3THOA 1UFVA 4UQPA 1RXYA 1OYYA 1V4VA 2HJHA 1MC5A 1U0NA 2PRYA 3IFSA 3T4XA 3TQQA 4EQ6B 4U9IS 5A1JA 4CFZA 3URMA 5GVRA 1WE2A 1JH8A 3BFXA 3S29A 4M6WB 3C6YA 2XBMA 3MSCA 4QECA 3BMCA 2EBUA 4GXNA 4DQLA 4E1VA 1FSFA 1SC3A 3MHTA 3C5EA 1NV8A 4PBTA 4KNYA 1UDXA 4MAMA 3B3JA 5B1EA 1U0BB 3KO8A 1IK6A 2WHXA 4B3BA 1T8SA 1PJCA 2PYIA 3GP8A 4ZTZB 1BD3A 3K8QA 2H31A 3EGCA 3SF0A 4M4SA 3CJQA 4KQWA 3I4FA 2Y4OA 5AHKA 5JCJD 1UWVA 4I3GA 5DGXA 1KEWA 2RGAA 4LNAA 1RADA 3SN6A 5KYYA 3U5ZB 4JI0B 4ROTA 1JG3A 1KJJA 1Y1QA 1OTYA 2WAOA 1LS1A 1OBOA 3WWEA 1CT9A 1U2GA 2IZ7A 1Y0BA 5JZMA 2A5FA 1BH2A 2QN8A 1FMTA 1L4NA 1PDOA 3C3XA 3DEHA 3EF0A 4ZU1X 1XPUA 4O0LA 2VXCA 1XZLA 4ESHA 2WPDD 4K9OA 4M8IA 5FTNA 1YZQA 4ER3A 2NG1A 5C5EA 1MW8X 4QRIA 2I66A 4IOKA 5EMJA 2DECA 3R76A 4F91B 5JQGA 1DCKA 1W36C 2R79A 2NTYC 4P3KA 1GCAA 4C7BA 2XTZA 2R8OA 1E9RA 2Y76A 4I8XA 1EFPA 5HOEA 1COWA 4LGMA 4RDHA 1GGJA 2R65A 3LC7O 1LPAB 4IGEA 4YJGB 3C85A 1TF7A 1WWKA 2XTJA 1TMOA 4LK3A 4NNJA 1R88A 4E1BA 1I1NA 2QLNA 4BNIA 1V2GA 2C3YA 3WHKA 3DEZA 2ZBPA 4BMDA 5JZSA 2XCTB 2EYQA 1Y7HA 1Q7BA 1HRKA 1PYGA 1ZI8A 3W4JA 3Q7SA 2ANBA 2CVPA 5KNCD 3DMFA 3LYUA 3MLAA 4FSHA 2K7ZA 2JRCA 4H3KB 5F33A 4ATNA 2YOHA 4BOYA 5F7OA 3CN9A 4NZ9A 3HB4X 1BEZA 1N1DA 2RAPA 4HLCA 4G36A 2JGFA 1DTWB 3LPNA 1AKYA 3B3GA 4MA4A 2AD1A 4WE3A 3REQA 4EKGA 4HN2A 5LZ7A 4RK1A 1EZ4A 3QOFA 4FILA 2O2SA 4AQYB 4XYLA 4TS1A 1LBIA 3CLRC 2Q3JA 1JI3A 1GTMA 1W96A 1XTKA 3DYVA 4A16A 2V5UA 1KI2A 4WLEA 4Y6GB 2OAP1 3L7IA 5ALWA 3FAZA 3DOUA 3P96A 4Y0VA 3DTTA 3IO3A 4X8OA 4W9RA 3NEJA 3IUEA 2QXTA 3OIGA 1YT5A 1Z4KA 2ZTLA 3IP3A 3UFBA 2V3WA 5EL0A 2AWNA 2OGSA 4RF2A 5CLLA 3TSZA 3QKRB 3UUGA 1IHUA 4IF4A 1HE4A 1OFTA 1WHTA 4LZJA 3ROPA 5IMSA 2VYVA 4JI3B 1L7BA 4Q9JA 2OPBA 3VR4A 4L5BA 3AESB 2F62A 3HYCA 1O94D 2OHGA 4IFEA 1YB7A 5DEOA 3VKGA 1VKHA 1NP6A 1RJ9B 2UUPA 1B4DA 4PS0A 1LI7A 1T4BA 1Z4LA 3U3RA 3ULKA 1NR5A 2AKAB 1I0ZA 1WJGA 3K1TA 2HJWA 3SGLA 2GN1A 3LP8A 3MVEA 3E1KA 4RS3A 4C14A 1X7ZA 2GZSA 1Q11A 3IIKA 1LLUA 2IE0A 4MV6A 4EPVA 1XR3A 1UMBB 1QFMA 3B7GA 3NNSA 1Z2PX 1VSVA 1X6VA 5KYKA 3COWA 1FFYA 3SIPA 1JAHA 1JSZA 1ZZEA 4ZO7A 5KTYA 1F8XA 1WU7A 4Y6QA 5L95A 5I51A 4G9EA 1JP7A 2O6LA 4HOYA 5HOQA 4B3TB 3G2NA 2JBAB 3A9WA 3KHTA 3VAYA 1RWNA 1QLWA 2VPZA 3AZQA 3DFMA 2DBVO 2VTBB 3FWPA 3GCDA 2ZWIA 5IFKA 2VAWA 2D3TA 2YHAA 3W9BA 1DBQA 1VL5A 1R4NB 3TVDA 2WZCA 2PJRA 4FYVA 4GQIA 3RCBA 3U7FB 1AC5A 4XVHA 1E9FA 3OTQA 5KOJB 2UZ1B 2PY6A 1NUHA 2F1JA 2Q45A 2ZOSA 3K1ZA 2XT9A 2WG2A 3PUWA 4UTXA 3MBIA 3PKIA 2W7TA 2VP4A 3C2QA 3CZMA 4I9UA 2C0CA 1YU6A 2FUCA 1NRXA 4AXXA 4A15A 1P39A 1P0IA 4YC7A 4ENSA 1A3CA 1E1QD 2QTHA 2YDXA 3JYQA 4JJ8A 1J07A 2WYHA 1E6MA 3TJMA 5KEIA 3ELDA 3QVJA 4YAGA 3AFGA 1E1RD 3D2CA 3GA5A 1YB2A 1SXGA 2Q3LA 1Q19A 4FE4A 4NULA 4IQGA 4QXAA 1TJ4A 2V98A 3SQOA 3T1NA 4BWFB 2GEUA 4C0JA 1SN7A 1WXFA 4HP8A 3ESQA 1L5MA 1FTSA 3MJSA 3QV1A 4Q3DA 1AKTA 5JADA 3HC7A 1PGNA 4Q5IA 4HXYA 4ED9A 4QTTB 3SNHA 3S70A 5HM8A 4P33A 3O4GA 4FKMA 3AYXB 1ES9A 2FPUA 4CMJA 1DWPA 5KIAA 4B8WA 1Q0HA 1QGDA 2KYRA 4YRQA 1QTRA 2ZVDA 2AB0A 4WSOA 3PNOA 1CQZA 2WWFA 2D5BA 4DWVA 3CPJB 3DMGA 1CDZA 1YKSA 1P1KA 2EOAA 4C08A 5DHQA 1OHHD 3ETGA 1KERA 5I45A 4QVIA 1TM2A 3O1LA 1SHTX 2CHUA 3DQZA 1K06A 3RSZA 3USCS 4KXMA 1KAOA 5FBHA 3R3WA 4LCBA 3ICWA 3IALA 2ONYA 4C07A 2QAGC 4G5YA 3VJRA 3RV3A 2V6MA 1B41A 4EKNB 1TXGA 3T1HB 1D2EA 3F71A 1N6LA 4WY5A 1NRIA 3BICA 3NV9A 3RAPR 4UFPA 1FP2A 1Q1QA 1Z17A 4RKYA 4E12A 2FWNA 2GM5A 1F8YA 1R0SA 1HLFA 2N47A 4GFDA 3TMAA 1ORIA 4AUKA 1ST2A 4DV1B 5CB6A 3ZHTA 3K32A 3Q7PA 3M89A 3HL4A 4PCUA 4EPRA 4YV2A 5JFTA 2QRGA 1DDGA 1D5CA 2CVHA 5E9WA 3TUZC 2ZIWB 3CV3A 3O75A 4P8RA 4QTXA 1G8SA 2O5CA 1TU4A 3QTTA 5AMXA 5IT4A 1RLJA 3IB3A 1VKRA 1KH3A 1AXEA 1FTQA 4CF4A 4EZEA 2Q21A 3ZLJA 3C48A 2PZFA 1LSJA 4EYEA 1ZD9A 1X80A 1G8FA 4TUYB 1HL7A 4DR2B 2A92A 4MV9A 2RGUA 2D59A 3BMQA 5B37A 4BQFA 5EN4A 5KNLA 4LF9B 4KR0A 4UAGA 4CTMA 3MT7A 4RWEA 3N0WA 1E3QA 1QC5B 4XWTA 4CCSA 3AL0C 5D1HA 4AL4A 3DDSA 5KTMA 2HMAA 1WMSA 2MWMA 2R8XA 3MK31 3QV2A 2ZRJA 3V8MA 3B8HA 1ZM3A 1M66A 4LMAA 4H7DA 5H80A 3VA7A 2BGWA 5A06A 3NHAA 2FMUA 2I0FA 3UK0A 4Z4CA 3QG5A 3PPIA 3P45A 4DTIA 1NW5A 1VJ1A 2JD0A 1TADA 3MCWA 2REQA 1T2NA 3JALA 2LE0A 3Q3EA 5H81A 1QH9A 2DHCA 2V96A 3BREA 4GX2A 1KEVA 3GA7A 3EZ9A 3CZPA 2DFKB 3EJWA 4WKPA 1YRYE 4ZI5A 3SMVA 1A9ZA 2H0AA 2ZM6B 3TNYA 4X66B 2JHFA 3EW7A 4XRGA 1GCUA 3WMFA 2ID8A 2XNCA 3FPJA 4IJVA 4QVKA 4B3XA 3LWDA 3O3CA 4KWHA 5CVVA 2P4UA 2ZIAA 4V0ME 1GPDG 4RQUA 5D86A 3V4LA 4MV7A 2AJLI 2P9CA 1Z34A 2RK6A 2OECA 3Q7QA 1SXJD 2DZDA 3LT0A 3A6ZA 2YWXA 5AM5A 5HDQA 3OD1A 4EARA 3CZ4A 3OQJA 4RZXA 1TQ6A 2PXHA 5ALHA 3FR7A 4J0FA 4PYJA 2HWKA 4WERA 4RTJA 3PUHA 1VHQA 3TO5A 3NALA 3EBOA 1TJNA 4S0XA 1DFIA 2I22A 5KI6A 1HDIA 2AR0A 4A5SA 2NSDA 3BIOA 3P9RA 3OOSA 1LWNA 1SUAA 4DPLA 1DIHA 1NR7A 1UJ2A 5ITVA 5JAPA 2ZM5A 1KDOA 2P0AA 4MGKR 2FN4A 3DZGA 3F4KA 2FRVA 3W3ZB 4ND3A 3ZWKA 3D81A 2W6MA 1EVJA 1K7SN 1L5FA 1QVRA 1TIPA 2CXXA 4AKTA 2OM2A 3HKBB 4DUYB 2JGDA 2PGOA 3QFTA 2D6FA 3CG0A 4WZBA 1Q95A 4FLFA 1LNQA 3IVAA 3R3UA 4HYEA 5KYGA 4CPDA 4AS2A 1QG4A 2EJTA 2QZ4A 3BN3A 1OLXB 1O0SA 1KO5A 4BP1A 2FAXA 3S8YA 1UFRA 3MOSA 4YGXB 1SB9A 5ILGA 4QGSA 4IJQA 4WFIA 4WNYA 2GZAA 2VIIA 3MPOA 2QM0A 3GLHB 2A5JA 3M5WA 5EVCA 3JRWA 4XVRA 3A0RB 2CCKA 3GLSA 2B94A 3HU1A 2FQ1A 3C7KA 3O8QA 4KWTA 3LGSA 4DY6A 4ALNA 1L4LA 3IP8A 4IDHA 4OQNA 1W34A 3GJ3A 2Q7DA 2FSUA 4UZSA 5IH3A 4AWBA 3NGXA 2XUHA 2OCDA 4J1NA 2ZRMA 3DE3X 4GSYA 3R4VA 4R68A 5EMLA 4OI2A 3M4ZA 4QBIA 5K03A 2EP7A 2FFHA 2YJTD 3RT7A 4A26A 2YZMA 2Q9AA 5DDIP 2ZTHA 4CN9A 2E1RA 3ELWA 4XOIA 3OWHA 4B82A 1L0BA 1QHXA 3LCJA 2FRDC 4DADA 2Y6VA 3DDHA 4BMSA 2HWUA 4D9MA 1EK6A 3E1GA 2C9YA 1RC8A 2Y2VA 1IATA 2F8LA 2C2KA 1U3DA 2XWJI 1QHNA 1U7OA 1C1YA 3TRFA 3OSUA 2I7TA 3A9SA 4MWDA 1OH6A 2E3JA 2IIPA 5DNEA 2OYCA 1YXMA 3IPAA 3P9PA 2RHRA 2J3LA 2NNWB 4KE9A 4L08A 1ZAKA 3HCWA 4P34A 1L4MA 1UJ4A 5L3ZA 1VQ1A 4F4IA 5A4JA 3HXLA 5I9SA 1NJ6A 4Q7MB 2BFWA 1CW2B 4ZU3A 4ZCIA 1A5TA 1OX5A 5JROA 1V7ZA 4D4LA 2VDWB 1KI8A 2IUTA 3GP5A 1CY2A 1ZYUA 2VK4A 1UP7A 3PRYA 2KBEA 4KYVA 1NPYA 2WMOB 1ENPA 4M0LA 2XF2A 1EJ6A 2BKEA 4O02B 2OE2A 2GAOA 4IH1A 1PX2A 1PFGA 3TLCA 4IY1A 4W6QA 3I8SA 1QZTA 3NGMA 1C2YA 3OP1A 2HT1A 5DPMA 3FBWA 3RYTC 4BP9A 5HKKA 2AN5A 4M7WA 5EP1A 1T3HA 2CEAA 5DBEX 3Q4GA 1N6IA 2Y6UA 3I6ZA 3AFMA 1T5DX 3VC2A 4D3FA 1BMTA 1CUCA 2Z3VA 2RE8A 1N7IA 3JYOA 4CL3A 1FU7A 4G09A 2BEWA 2F3QA 4W1QA 2YNMC 5GZ6A 1DFGA 4BO1A 4CHGA 2IYPA 1JKJB 2JA1A 4NFHA 3QVVA 4XA8A 1D2AA 4DT1B 3MJCA 3JQCA 3P0FA 4JB8A 4W1SA 1ADGA 4ZVVA 4IMRA 3OY7A 4S1WA 4D3ZA 2IBTA 1DZIA 4LEIA 2PR2A 4MRMA 1DLJA 3K0CA 5ADHA 5JXJA 2Q5QA 3SQWA 4PLVA 2GFQA 3W2FA 2XPCA 3DV9A 4B7AA 3NYQA 4GR5A 1F20A 4PX9A 1AXGA 3T7KA 1EK2A 2CSXA 1QORA 2NZUG 3BFPA 1WCYA 4HDOB 4IWYA 3L6UA 5DMXA 4LW8A 4FYHA 4TTAA 5SV2A 2Y27A 1QGUB 2R44A 4D8TA 2W6QA 1LSUA 4JLUA 1CE8B 4YYEA 1B23P 4JLBA 3LK7A 2PA0A 3S40A 4LJ5A 1W44A 2G17A 2V1UA 3ILXA 2B0CA 4KK3A 1HBJA 1ODIA 2C2BA 1UJ6A 2E5WA 2HRCA 4CV1A 5LR6A 2QB5A 3DMTC 3DTVB 5HZMA 1PD1A 4L75A 1E63A 4PZYA 3KD3A 2DX7A 5KSPA 1FBTA 1KE1A 4BNMA 4JFRA 1ADCA 2O8VA 1L5RA 3BTOA 3O93A 4PIPA 5E7MA 1AKNA 2F6RA 3K4HA 2CZGA 1KS9A 5IS2A 4NBUA 2VS1A 4HRYA 2Q0SA 2YVKA 4G3XA 1Z26A 4F6CA 5BMVF 5IXYA 4QDUA 4GDFA 5JVDB 4CCYB 1YRQA 3A9CA 3EUEA 3HYRA 1GDHA 4LJ6A 4ZJUA 3WLRA 1LF0A 2WIFA 3DD5A 4HX9A 4I7EA 5T6MA 4DMMA 2ZCJA 3VGJA 1DOZA 5HKLA 1EG7A 1XLVA 3ZLBA 1JX6A 1NI3A 3PHIA 5DTQA 2VTKA 1MEOA 2DQKA 2RGNC 1QU3A 1N1EA 1AKQA 4OHPA 1NTRA 4DGQA 3VISA 2OHHA 3GB9A 2C61A 1XA4A 2QRPA 4J2HA 4KYTA 4GM1A 5I8WA 1SXIA 5A6SA 2XLCA 3PHJA 4GLLA 4LPSA 1E2LA 1ZBQA 4HYQA 1UJCA 5KHLB 1URPA 1UMCB 2X8JA 2QTTA 3KJXA 3IMGA 4IMJB 1VKNA 3T1YB 3ZQKA 4BN4A 3LVQE 5IKOA 1X0XA 5AJHA 1N7JA 1C1HA 1VL1A 3MS2A 4NE2A 1E94E 3D7KA 1KDVA 4UNRA 3EF1A 5DGDA 2HGSA 5KVQA 4AIRA 4C30A 4FKZA 2INGX 2C42A 3AY0A 1QO7A 4AX8A 2J3HA 3R40A 3TNFA 1Y8RA 1WSAA 5K3CA 1DELA 3PXXA 821PA 5LJLA 4MWBA 2R2GA 2P2SA 3EB9A 3WLQA 2R7NA 4A36A 4OHWA 1P4SA 3LU1A 3VTFA 1U11A 1I3OA 4FFBB 1MH9A 3VNQA 4G63A 5BP7A 5FR1A 1RYZA 2C9MA 2QG4A 3A1UA 1JILA 4ZQCB 1WF6A 1VL2A 2BEUA 3LUGA 2RGEA 2X5XA 1I2CA 3X1DA 1YIOA 4D0RA 2EX4A 4H16A 4ZAYA 1EWTA 3UTCA 4NSNA 4DCSA 3CY6A 2JAXA 3H2SA 2WHYA 3BDVA 1PEYA 5FAXA 1G8HA 4FBLA 5HKBA 1SIBE 5C53B 4FFLA 4ERNA 4F9GA 5K99A 5CRIA 1WXXA 3ZU2A 3HXTA 2V7GA 1TCVA 2HLPA 4PEVA 4I1PA 4H2DA 4CQMB 3L6DA 3MQFA 1C8VB 2OHFA 5C32A 1OIWA 1DIGA 2CXPA 4FCCA 4C29A 3KK0A 3NVMB 1OAAA 2J4FA 1VKOA 3UJBA 2JKZA 1VXRA 4TL7A 3U7QB 4YRNA 2CV2A 1N2JA 5IW8A 1U1GA 2E4YA 1ZUNB 2DTXA 4AXBA 3SD7A 3F7OA 2PYDA 3M6AA 4NDNE 4L0CA 2YJ5A 1PRYA 2B8TA 3A1TA 4HRXA 4MV3A 3QVMA 1GLNA 1OI4A 4B2PA 5CFMA 2YVAA 2H5EA 3RC8A 4H7PA 3QW4B 1QLHA 2R1TA 1Z68A 5KOJA 4HXEB 2O5VA 4LYEA 4L22A 3L9WA 4N8DA 3D31A 3JQ9A 4BNKA 4A2PA 2R8RA 2W6NA 3KEOA 4CKXA 1N5DA 4DLZA 4L8FA 3AHJA 1YZLA 1F48A 4R1LA 4BVFA 3LVRE 2AUTA 1E9AA 3EGXA 4DMHA 2LR0A 3GUZA 1Z4MA 2VHEA 5GJWC 4QOJA 3W9UA 3GLGA 2G0AA 2REXB 2XTAA 3BA6A 2GJKA 4BN0A 1W5EA 3AM3A 3FDJA 3NBYC 1CJUC 3AWIA 3NOQA 3IL2A 1KGSA 2QTVA 1L1QA 1M1UA 2ZE7A 3JPWA 4HF7A 1B0PA 1M1YA 3LD9A 3DW1X 1KIAA 3N8DA 1G17A 3C6QA 3ANNA 3LCUA 5HKOA 3EXHB 1ONOA 4Z7NB 3NJ8A 5IZ4A 1UP6A 1A1SA 4AROA 1MG5A 1UUFA 2YFYA 5FA8A 5B4TA 5KNCA 1OR8A 3TF5A 4MP8A 1LJUA 3ZX5A 3A1CA 2GTIA 3PGA1 1S1CA 5JCZA 1DC7A 4G0NA 1GWNA 4YUWA 4GVLA 1B1CA 3ZH2A 4LWQA 4FBGA 3UXYA 1ISFA 1G3IA 1P5RA 1U3CA 4Q1VA 4O4HB 4DM3A 3JYPA 1I5RA 5IT9A 3MNFA 4IQ8A 1G16A 1MFZA 3CR7A 4F7WA 2GBLA 1QCZA 5EJMA 1X1AA 4UM9D 4EGAA 3E9RA 4CIYA 2XIQA 2C2XA 3FCEA 5CXQA 5K8JB 5LWQA 1CHNA 4A1FA 1L4KA 1KRHA 3OCYA 2FFQA 4RHTA 2XD4A 3I83A 4Z1MD 1FUUA 2BGNA 2PLWA 4IZHA 3UTDA 3FCAA 3P5SA 3T9FA 1EK5A 2WC1A 5B12A 1UOQA 2H1HA 4LHEA 3N0RA 5LMUB 3ORHA 1RACA 4DDHA 1LLDA 3I2GA 3QYFA 3COPA 1T3GA 5FUQA 4UEQA 2ID9A 1O94A 2HFJA 4C03A 2Q6IA 1T5HX 5AI8A 1DAFA 2H52A 3DOOA 4M1EA 2XT0A 2Q2QA 2FW8A 3D1VA 3T35A 5AVSA 3KNZA 2WILA 2OVFA 5IFLA 4CL8A 1K6EA 1VFNA 4Y8VA 1SEPA 1R4MB 3E05A 2WA1A 5P8WA 3JQBA 1J06A 5FP0A 5KX5B 5ERYA 4C4SA 1ECLA 4UBKA 2DB3A 4MR8B 4QYTA 4NZOA 4E7OA 3RWMB 1JHZA 4JITA 1UDRA 1QO0A 2V7WA 2Z5LA 3LWNA 4E2XA 5HF5A 1ABBA 4HTFB 3ER9A 2GCOB 5CB4A 5E1OA 1IQ0A 3ASUA 1WKBA 2C4HA 2VJMA 3EK2A 1WLSA 4EVQA 1UXJA 3A10A 3FPBA 2RJ3A 3AVTA 2IE8A 1F8UA 1FRQA 2O1EA 2Y1DA 3WX0A 4E2FA 4JBYA 4Z53A 4GQAA 1NQWA 1OW3B 1PN3A 2LDXA 4YQYA 5I4IA 2M9MA 5EE3A 3LDFA 5K3BA 2KE5A 3G9TA 4EY4A 5HVNA 3ZBQA 1QM5A 1J21A 3IT2A 2WG1A 5C3UA 3PD1A 4MVYA 1UXOA 4XYEA 2EKLA 3HNPA 3QHAA 5C5IA 2ZRGA 1X15A 2CJXA 4C7VA 4Y18A 1XKLA 4C2TA 1YVPA 2HCBA 3UAYA 3BE6A 3F3YA 3H4VA 3AR5A 4B4VA 1YZKA 2OCIA 2VZEA 4ZOAA 2JI7A 2AH5A 1VIYA 2FE4A 2QU8A 4C0SA 3WNCA 2GESA 3IIIA 3K9QO 4V39A 5AK5A 2W4MA 4ZHQB 1G3RA 5BN1A 5JSFA 4GX1A 2F8MA 4Z8XA 3ZI4A 3HI6A 1E0AA 1W52X 3KZVA 3GYBA 2IOYA 2PKRA 3C41J 2PXAA 2V54A 3R23A 4UBJA 5E8JA 4QYIB 2BDTA 1F1BA 1NWCA 4ZT2A 3WBJA 5EZYA 3GBSA 1VBKA 1SKYB 3C3KA 2MJLA 4QICA 4XDGA 5GOTA 7MDHA 4LHWA 1DQSA 1Z88A 2O7SA 4REQA 3FMFA 3PC3A 1XA0A 1QYVA 2R87A 4LYGA 2ZSIA 1W48A 1U2GC 2XUQA 1ULBA 3O1IC 1YC5A 1KQPA 2WBLC 5HBGA 1AKWA 3KZNA 4OI4A 3EEQA 3PDUA 3R5HA 4N0EA 5C8YF 4C6RA 1MR3F 4K03A 5TDHA 5JD5A 3N8HA 3WL6A 3ZBTA 2O8DB 1BRTA 4QGGA 3DMRA 4Z3OA 2PWPA 5EWMA 5LU9A 1CJMA 3D6VA 4GI2A 5FIUA 3IAM6 4CR7A 3G5MA 4COKA 3SIXA 5KYYB 4D4IA 3VTAA 3COSA 2PBRA 3MWEB 4N41A 4GPTA 2ZUVA 1RDFA 5ARDA 1PQ4A 3D2LA 4F9TA 1KC1A 4GBJA 2Q3HA 3ABRB 4HQRA 2LCQA 4Z6KA 5JBIA 2FPLA 4MK4A 3ZKAA 2D4HA 2Q0XA 4XM2A 4M1YA 1A2QA 2EZ9A 4MB0A 1GUZA 3ZE0B 3ZUPA 1H9CA 2IW1A 4C4XA 4HV4A 3B1VA 4Q4HA 4PWYA 1U7ZA 2FQXA 3QG1A 1NBOA 4JI7B 4LJ7A 3TM5A 1JQ5A 2GI4A 2FFRA 2PO5A 3PFIA 4G0XA 3RYIB 4F4DA 1Z2OX 5BWCA 4A8PA 4DR6B 3K73O 1ZY2A 2QRQA 3BAZA 1SELA 5CCDA 2EDCA 3WSVA 4O4LB 2ZXFA 1V71A 5LQSA 5E9AA 2AJDA 5I7UA 1ZI9A 3E5HA 4W9NC 2IGTA 1GT6A 3GOQA 2IV2X 1TQ2A 4M7PA 5B7PA 1ZA2A 2IUUA 4LQCA 4XQ0A 2WIDA 1SBNE 4IQ4A 1M2EA 1WUKS 1I4LD 1QLJA 4YYZA 2VJCA 1FB5A 2R8YA 3OURA 4E31A 1YACA 3TXAA 2YVUA 3DTYA 2PN1A 3S2IA 1CC1S 2W83A 4M36A 3TFWA 3T4PA 4MDYA 2OCLA 2RGDA 3NNDA 1A4UA 4S0ZA 3VKFA 5FDFA 4W5QA 3FWZA 4I5EA 5J1SB 2RC5A 1BYUA 3KXDA 3KEFA 1WR8A 2NVUB 2O3SA 3OLQA 4RGBA 1E69A 3FFWA 5H5JA 4B0PA 5JS6A 2QBYB 4IKEA 1EESA 2ZANA 1AKMA 2FDRA 1QPZA 4NDAA 3FNEA 4ARCA 1ELOA 3QY0A 2NV6A 4I3HA 3A6DA 3X44A 1V6AA 3TEJA 2D4AA 2GERA 4NP6A 4TMFA 3DLBA 4UVEA 1XK6A 2ZRNA 4CXMA 5IBCA 4UNSA 1AVTA 1GUYA 1VE3A 2F64A 1E9VA 1XTVA 1L9XA 1LQUA 2G82A 2GCEA 2HHJA 4M86A 4PGFA 4Q18A 3E0XA 1J5PA 4R84A 2WAAA 2J09A 2PS9A 1E62A 4CZ2A 2FPGA 3G68A 4HMPA 1NC1A 3LECA 3HSYA 4XVCA 4YRSA 2WEKA 3V4FA 4QNNA 2P6PA 4DC9A 5KNBH 2WU1A 4JJ4A 3PQ3A 2YVLA 2MINB 3ZKWB 2YV2A 4C7XA 2QQFA 3CVOA 1J2TA 2CDAA 4DJTA 4FN5A 4KYIB 1W59A 3FVTA 1YZUA 3HRIA 4JJAA 5AM1A 5EXPA 5LOVA 4FDAA 4R1MA 10MHA 1Q17A 1PI3A 3IP5A 3LTEA 4DJEC 4RVDA 3CNOA 1BMQA 1PJSA 2GYYA 1GZUA 1R8YA 3DPUA 5DI3A 3N58A 2NU8B 2F1RA 3D64A 3HRHA 2C2ZA 1CNFA 4MSUA 4PW0A 2GVZC 1QSGA 4ZVRA 5D3MA 3WLKX 2QL9A 2HCTA 2XB4A 3AERB 1KY2A 4EUHA 1Z2EA 1ZWKA 2FK8A 4I4CA 4R1OA 3T1VA 3UV6A 4AMVA 5I9LA 5L8VA 3UGQA 1QFJA 3K9HA 2JL1A 4S1NA 4ZYWA 3OEHD 2VDQB 3PNQA 2EGHA 1PJAA 3EVAA 1YNSA 1ISIA 3PSHA 2H0RA 4I4IA 3W6PA 3PC2A 1A9PA 4YEDA 4ZO6A 5EJ4A 2E4XA 4R5HA 4CKCB 4LWZA 4OI0A 4G5OA 2VJLA 3LRTA 3PBKA 4LDNA 3THWB 3A9TA 4CG3A 1JVSA 2H4HA 1M7GA 1P2TA 2VDLB 5EVJA 1TF5A 3FOZA 2EL7A 4FJ2A 1YE5A 5EKDA 3V1LA 2CFCA 2WTUA 5TF4A 4FHFA 2CE7A 2MOKA 5CNKA 1WOMA 2XA1A 4BDTA 1EWQA 2WQZA 1IM2A 3WMRA 2CXUA 2OD9A 3ZJTA 1EQAA 2E85A 4EKDA 4P98A 3MINA 2FUG1 4CMIA 4F6RA 1NMEA 1H4QA 1X42A 2C57A 3CLVA 4AU1A 1WRBA 2ZYAA 3AC0A 4JLSA 3LK6A 1RBZA 4K6CA 4PS1A 4R16A 4WADA 1WCIA 1OROA 1J00A 1RKBA 1REQB 2ZJOA 3ITDA 1XTSA 1HPLA 3COZA 4ECEA 1JDJA 4LZZA 5K6AA 2PL1A 1OYWA 4QDTA 4L78A 2D0OB 1NOJA 1S2OA 2X3UA 3L1IA 1ULSA 1YO6A 4NCHA 5HJ7A 2J9ZB 2J3EA 3G7UA 4LQ4A 1NMXA 4IS3A 4NC9A 3IMEA 2FGKA 3O31A 4BNHA 1GYRA 3K0AA 5AXBA 2DC1A 4Y6LA 2RGYA 1ZD1A 1FLNA 2HA5A 4NBLA 5ESRA 4F4UA 1KI9A 4GZLA 1QB7A 3QZUA 1EX9A 5T5QA 5TQ0B 3HBLA 2IDKA 3HVKA 1SVSA 1XZAA 3B6IA 3L4SO 4PPFA 2H6EA 4QTUB 5AOCA 5BW6B 3EDMA 2FJPA 2C5FA 2HKIA 5EIAA 3WL3A 3WB0A 2JFPA 2NSJA 5IULC 3TSAA 3UK1A 1MTZA 4OL9A 3LXXA 1LY1A 5A03A 3STTA 2BGMA 4OH7A 1Z5WA 4LY6A 2O7VA 3MD9A 3R6DA 2WB4A 5U4QA 2XI4A 3BQ9A 2SKCA 3QBTA 4IIJF 1WQ3A 2R1UA 1PR2A 3CWQA 2OBXA 5ENZA 3ZV4A 5E95A 1QIMA 3AEKB 1N5MA 1NE2A 3AHHA 2TMGA 3E48A 3FNRA 1MT3A 2GEBA 4ZCTA 3PTAA 1WDMA 1NBIA 1RXUA 3KC2A 4PFJA 2JFFA 5F5XA 4NXNB 1JR6A 1R9NA 2ZVQX 1GSHA 1Z06A 2OQVA 2VZ0A 5HYVA 4EMTA 4CQNA 3W5HA 1EUDA 2FR8A 4JS0A 4UUOA 2JC3A 1R0YA 3SVZA 3K20A 5BR4A 2PD3A 4PG6A 1GGEA 3FKQA 4Z2YA 2UXDB 2LIVA 1KZ1A 3HMKA 4WOKA 2M1XA 4WEQA 2X41A 2NSHA 2XX3A 4P3PA 4ZQBA 4EVSA 1W47A 3NTOA 3W6UA 3QE9Y 1F17A 1MAVA 2QT9A 3WIOA 5JFGA 4AC9A 1GL9B 4EG1A 1U0SY 4OQPA 1QU2A 5T3UA 1QBKC 1U8EA 3MJHA 4O2BA 4BQOA 4BB6A 1DNPA 3LKVA 2A8YA 2I1WA 1J20A 2UZ0A 4ZCPA 3LFHA 3SSNA 2X9NA 1EVZA 2P9JA 1G38A 2EP5A 2GJ4A 2QRZA 3R3JA 4KUGA 1Y1KE 4PO8A 3WWZA 4J1TC 1R0LA 1FTWA 3BWVA 5J2UA 1AQYA 2NQ8A 4FQ8A 3TCXB 3OQMA 3MF4A 1NKTA 2JS7A 1ZD3A 3I8OA 3JAWA 3T34A 1SU6A 4BIIA 4HXFB 4KSYA 4XWYA 3ZZUA 1XWWA 2BHNA 2V5AA 4IG4A 3PA6A 3TLXA 4J16A 3E82A 1N0WA 2I29A 4MQ5A 5DXJA 3AIKA 4I55B 3K4QA 3CUKA 1I9CA 4FOTA 2FEMA 4G01B 2QG6A 2QV0A 2VQDA 4GWKA 4FMPA 4C4ZA 3PQ7A 4K1XA 1LNZA 2HLDD 1TYDE 2Q5FA 2VTEA 1TDJA 5J9FA 4E2YA 5ICMA 4HAOA 3SOPA 1ATIA 1C9MA 1JYSA 1LH0A 1XZKA 2IOQA 3E3NA 3H1PA 3LX4A 5KJEA 4D6YA 4G07A 2OM6A 3V8RA 3JYNA 3WOVA 4MW9A 3CC8A 2ORIA 2ODBA 2VT3A 2WHQA 2XNJA 2Q1YA 1NOKA 3K30A 3EQ8A 4V0LA 4J4BA 3QVOA 7REQA 4NLLA 5AESA 1OI7A 2X8BA 1F5SA 2XMSA 3IEXA 4LHSA 2IYXA 5EFZA 3UG7A 3I4CA 3X1WA 3B3FA 1E2JA 1PAUA 4EP1A 1JJ7A 2FN9A 2P78A 3BSWA 1BTOA 4O5OA 3V7NA 4A82A 3ZE6A 4BQNA 1M0SA 2ZZKA 5JZ9A 4EFNA 3T7EA 3H5RA 1SY7A 4N0PA 1DBPA 1JKMA 1ZN9A 3M9XA 5B4UA 2I7VA 2VHYA 5KWJA 1GNPA 1UPXA 4HPXB 4KOEC 3RTGA 4C76A 4ACAA 5C46F 3BJZA 2XQKA 1ZHOA 2FQYA 3D6AA 4CKWB 1YVUA 4BDSA 3BT7A 4OFZA 3OY2A 3PQCA 4AULA 4U2KA 6ADHA 1QP8A 3VNVA 2ACEA 2GSWA 3VHXB 2Z4TA 2YBEA 3TTSA 4REMA 1MC1A 2VJBA 1QTNA 4DEYA 5I4BA 3GJQA 2GILA 2R6FA 3CLSD 2BI7A 1ULUA 2RMKA 4MROA 2Q3FA 5D00A 5I5EA 4LAFA 5ISMA 4GOOD 1EGMB 1UKCA 3HKCB 1E4VA 3KIPA 1FPMA 5MGBA 3K15A 3V80A 1KAEA 1MO2A 1UMKA 4MWCA 5CNMA 3MGBA 2W70A 2QD4A 2D1RA 3OZUA 1U94A 4FNOA 1LZKA 3KOXA 4JENA 1GQ2A 8ATCA 4E94A 5KSWB 5DXFA 2X1MA 1RZVA 3SX2A 2OCAA 3UMRA 3IYLW 4KSCA 3SFTA 3AF0A 5HS6A 2CNWD 3BRCA 4NCAA 3MTDA 1J56A 1BGWA 3O2NA 3DL4A 1I30A 2P4QA 3NATA 4NS1A 4EHDA 5EJ2A 2B6HA 3R7LA 3H1FA 3PTZA 1ZESA 2HA4A 3KD2A 4ZQGA 3L79A 1WCWA 1JR2A 2V55B 3LC2O 4YAEA 4NFYA 2D13A 5IAJA 5TR9A 4A73A 1QR2A 2FHPA 2JFBA 2XA2A 2W2KA 9ABPA 4C3ZA 2Z95A 3H84A 3MM4A 3ZXXA 3JVDA 3HJCA 3KE9A 4FIZA 5LQCA 5JISA 1NG9A 4QPNA 5JAQA 4K8OA 1VPVA 1ODSA 5K0NA 4BO6A 3IO5A 4K5QA 4FQ7A 4EUEA 2QZPA 3NWJA 3VOTA 4YP0A 5F3WB 1WD7A 1IAQA 1U0GA 4F5EA 3VOAA 2JW5A 5EQFA 2EBWA 3KJNA 1EAMA 1QONA 3D3QA 3PUVA 1WDTA 3CNNA 2H5JA 3H8VA 1QGZA 3G0CA 3OEWA 4F8JA 1PFYA 1YCGA 1GAEO 4FNAA 5FOQA 1ACMA 1JA9A 1K4MA 3JXEA 3QITA 3K0CC 4WXRA 1Y8CA 2ZR9A 4XLLA 1GPMA 5DMHA 2W42A 4HNVA 1E2PA 4OJYA 5IEBA 5JI3E 5K45A 3GOHA 4HGRA 5KNDD 3LUHA 4TVOA 3WZLA 1XDBA 2CF6A 4LXUA 2EYUA 3BHIA 3STWA 1VIAA 4IIEA 3PX2A 4G5RA 3UB4A 1JLMA 3OZ7A 2I8AA 3CH6A 1Y9AA 3PKJA 3GDWA 5G53C 2ZBEA 3BEOA 2ZSHA 4P36A 3R3HA 5CCXA 4LJRA 3I52A 1MF7A 3QK7A 1G0OA 2XGMA 4P22A 2CLLB 2F9MA 1PL7A 3AM1A 4MJ7A 5JDIA 2OMKA 1XHLA 3P0IA 1XNHA 1K3UB 1KMHA 1TUGA 2H1VA 3CB2A 3DMPA 2JAUA 2JCGA 3GG2A 3AF2A 3MA0A 5CH5A 1SXQA 4ARIA 2N42A 1R0BA 1EK1A 3JQAA 3QUAA 5T6BA 4BEWA 4M60A 2W90A 1QCCA 2VHXA 1FQWA 5E2IA 2GD2A 5ESXA 3ADPA 2ONJA 2WFMA 4DNFA 3WTCA 4UEWA 2D62A 2FKNA 2ZDHA 4O2AA 2WVAA 4XX1A 4KK4A 3QBEA 4G9GA 4D02A 5JG7A 4E0BA 4GP7A 1US8A 1ZICA 2HNAA 2DERA 1B8UA 2X8LA 2ZB4A 3FZQA 3A14A 4AJEA 1G3UA 4G4GA 4D4MA 1KDRA 1ZITA 3K9GA 5LYJF 5AR1A 3H5LA 1IXRC 2N3ZA 2PXCA 2BBTA 5E6RB 4RF5A 2PBZA 4FHZA 3H8WA 4XASA 3CLTD 3W05A 5CVTA 4YRPA 5FWNA 2NXWA 2YZGA 3KDSE 2KLBA 4B09A 2WQ7A 2ECFA 3M33A 1CULC 3T3NA 5ALLA 3RG2A 2OGWA 3BGOS 1CY1A 2A78A 4LXQA 4JT4A 1SRRA 2GR9A 2HGZA 4PSAA 3WYNA 4LF5B 5AHWA 4X85A 4X64B 4X91A 4M1TA 2AF4C 4ZI7A 1WVIA 2XHZA 2CBXA 3B9PA 4KGDA 1XFAA 3BORA 3MCVA 3DAPA 3AHIA 1CR6A 3W5BA 3K2IA 3CKKA 1RWMA 1N7GA 3NKFA 2QAGB 1SU4A 1QGAA 3CR3C 7MHTA 1C5KA 1JMYA 3MT9A 3KVYA 3R5SA 3DVQX 4FZRA 2XGJA 2FW6A 4X00A 1XZFA 1CJTC 3FI0A 2EX1A 3EQZA 4GR4A 4Z9BA 4RJTA 3T95A 4MGEA 1YZNA 3TZCA 4EELA 3PR2B 5HNKA 3IVGA 2PBLA 3COJA 3GUHA 2OBNA 3WRXA 4M38A 1S89A 1WUYA 2GJ8A 2FN3A 1EGHA 4QXRA 2GPBA 4X3CA 3WY9A 1Y33E 3N0TA 4JOQA 4DJ5X 4BBJA 4BMZA 2IJGX 4TLLB 1B0ZA 2Q46A 4AP5A 2QYHA 1IJBA 1E9SA 2VDUE 3HMQA 3NU1A 1L7MA 4MS3A 4OXQA 4B6JA 1W0JA 2NPFA 3WQSB 3BL8A 4EA8A 9ATCA 1NR1A 4GRDA 4N65A 4R8VA 4YA6A 5AKZA 3V33A 4CNQA 5IVPA 1U5BB 5EEHA 4JP3A 1LPNA 2WTEA 1Q1ZA 4EB6A 3WZ2A 5DGIA 3KKEA 2ZXEA 2MMCA 2RBGA 5TB5A 1RT9A 3LKDA 4RVGA 3QPCA 1U7WA 2ISQA 3ECAA 1FNDA 3M81A 4PZLA 1RYFA 5FQOA 5JPIA 3RSLA 3RYCB 2DPYA 1ESZA 1X7WA 2WJ4A 2Q1SA 5TGDA 1KI7A 3IUNA 4PLYA 1DAGA 1Y8QB 1N2XA 1XQ1A 2J6IA 4TL9A 1R0CA 1LW7A 3E9EA 3TNDA 1JAXA 4GS5A 4E88A 3KVRA 4B84A 3A36A 1RBYA 4OMDA 1M8PA 2GN8A 2GT1A 2ESRA 3D7MA 3JD3A 1PCXA 4XIGS 2RHCA 4YCNA 1GRNA 1X1EA 1RWPA 4MKIA 1X7YA 3F3SA 3HVIA 4JEHA 1WZEA 3O8RA 5DSTA 3CCBA 1N2CE 5AVUA 4OB6A 4MDHA 4S2UA 2J5RA 1LDBA 3C6KA 3H5TA 3I58A 2O4UX 4DLPA 4KAXA 2OSBA 2G4VA 3MJTA 4FHCA 4IUCS 5ELMA 1VE7A 3FM9A 1T4CA 2O52A 4BMNA 1GNQA 1T0PA 5D84A 3G5AA 5B7QA 5EINA 2DP4E 2VH2A 4LV6A 2NUPB 1E9BA 2B34A 2J7PD 1ECBA 1OZAA 3KYDA 5FWXB 2FPSA 4UDOA 1MC4A 4JJKA 5T64A 1QTIA 2YHSA 4JP5A 3RC1A 3SHTA 2AFIA 3N7UA 2XJ4A 3HGTA 4WLFA 5G1OA 3IQWA 5GJBA 2BGIA 1CX9B 3Q41A 1XEAA 4I6GA 4K6MA 2ROQA 6YASA 2H9YA 4JY7A 1E6LA 3L1VA 4LX8A 1C4XA 1VIDA 4CRWB 4JQCA 4CR8A 4RJIA 3B38A 4EFLA 4Z54A 4BJ6A 4D4JA 4EEZA 3W8FA 4UCFA 4TYQA 3NIGB 2WU4A 2LTAA 4LSWA 2NV2B 4A23A 1BMFD 4DGSA 1A0OA 4B6FA 4UULA 2GHQA 2FLWA 3CWZA 1HYBA 3VZPA 4TZ0A 1RMQA 1DB3A 3F4LA 2CL0X 2BYTA 3TQIA 2GBLC 2CDBA 3C1OA 4RZHA 2VCYA 4PVDA 4A0QA 4IBOA 2XYHA 3NH9A 3I2JA 3HY6A 3GEGA 1TFUA 4NV1A 3AU8A 1NXWA 2BGUA 3L4JA 4QLBA 2XCRB 2A0XA 4JX8A 4NKRA 3ROXA 3ZDRA 4R40A 1SCUA 4FLMA 1T2AA 4RZQA 5CTJA 4XUDA 1PLKA 4V0QA 1E3DA 4QDOA 1AUOA 3WK9A 4K3VA 2VA8A 1EPUA 1I51A 4B3GA 1EYZA 2H4YA 3DZ8A 3O90A 5F76A 1O6CA 3FDXA 2JKYA 2HEIA 2I4TA 4LVOA 3DR3A 4EKYA 2CWWA 3W8DA 1KJZA 5CIYA 1L1RA 2XOKD 3UK7A 1O94C 4K2AA 2YN4A 4QREA 3UG6A 1XB2A 5L3RA 4V1CB 3HU3A 3EMDA 1DPGA 3T9AA 1W8DA 3KB2A 1MH1A 2A7QA 1K8ZB 1N8NA 3RYFA 4DMUB 1Q16A 2PT5A 3G89A 1A8SA 1D0SA 4QZVA 1BXGA 4TWJA 3WQHA 3BQNB 3JQBC 2EF0A 1JU3A 2GGSA 3AP3A 3GFVA 1A8PA 2D1QA 4LF6B 4BBAA 5EQTA 1GG9A 3QKTA 5C34B 4RVSA 4D98A 2WAXA 4KIJA 2WU3A 3E3MA 3PEUA 1KDPA 4KNVA 4PZDA 4WOJA 5JSZB 4URUR 1D2CA 4G41A 4KQ6A 1T34A 1CZRA 3GD7A 1OWLA 4UHKA 4E09A 1UKYA 1HDXA 4CTOA 3JQ6A 2V58A 4GOXA 3TIFA 1R6VA 1JKFA 4JJFA 5FNVA 4BV3A 3Q7RA 2CXNA 2BVNA 2QVZX 3V5NA 4HAVA 3WLEA 3TG2A 8MHTA 4MIKA 1EUCA 5L3QA 4DCUA 1UDCA 4J76A 4K28A 2IKQA 3F98A 4MX8A 3OTIA 2CHGA 1L5LA 1W94A 1D1QA 3TLAA 1QRRA 4XYGA 1FFXB 4EOGA 1FCJA 3U4QA 2EG5A 1GZ6A 2NT3A 4ADSG 4YRKA 3R9XB 3TSOA 4JXJA 2PKXA 3PCRB 1QE3A 4FOOA 4P4SB 2AQ8A 4LBWA 1HK7A 1NPDA 2JK0A 4KQGA 1M6NA 4RY0A 2AK2A 5EQJB 5F9MA 3DFIA 5CCEA 1SWWA 1P61B 1RM0A 2B25A 1HY3A 3FPEA 3LQRA 3NS7A 5TVKA 3L0PA 4AF7A 5F9HA 1JFRA 4FWBA 2OAQ1 1P7ZA 5B3AA 4BO0A 3QY9A 4IOLA 5F7JA 3LBYA 2JHCA 2IS2A 4NH0A 2SKEA 3TRDA 4BO7A 3NC1C 2VWGA 4WXMA 2C3PA 2GLTA 4R54A 4RD6A 3A06A 1QFYA 2G5TA 1QYDA 1H65A 2PTHA 4DSZA 2ID4A 3SBEA 2VNIA 4RE6A 5HJEA 1T6YA 3OJ0A 3NVAA 5IDXA 5BV1A 4CM7A 3H75A 3KL4A 3MAJA 3O2SB 1FNNA 1GP2A 2MDTA 2ZT8A 2J0VA 4RW0A 1L7RA 1R5OA 2ERXA 5ALMA 3DWFA 4ZODA 4E51A 1D6JA 1RR6A 1MTOA 3OM0A 4DCCA 4GPZA 1U8YA 3TGWA 1P4JA 1XWFA 1PG2A 1V11B 4KGXA 3TTTA 3I04A 4O63O 1SCNE 1WLYA 4MYRA 2FOXA 4CLOA 1ZJ4A 1MX3A 3J80A 4PX3A 3SHQA 2FW7A 2PKQP 3BF7A 1XZNA 2J3QA 2AX3A 3AUKA 5T4FA 4TKLA 2IPAB 3AR8A 2WU8A 1L6IA 2GVNA 2WWHA 2C5HA 3GLRA 3KR1A 3G02A 4KJXA 2ONKA 4DIKA 4P86A 5JYEA 5DASA 3AFOA 3UMSA 3FMVA 1W87A 1J4AA 2O3UA 3A37A 2R6JA 3U0BA 3ST7A 4PN7A 5KOHB 1JBEA 1YBFA 2VNSA 2X4GA 3EIWA 4RY2A 4ALIA 3FPAA 4FYMA 2ECKA 5BOSA 2IS1A 1QVWA 5DH9A 5EKXA 3PR1A 3VKVA 4C04A 5GPBA 1TA9A 5DN6D 3PEVA 3QUCA 4H77A 2DT5A 4DY4A 3C1TA 1GIAA 1TVCA 3DKKA 1NM5A 1SOUA 1V43A 3ZXYA 3G82C 5K3FA 3KQKA 3GNQA 2VT2A 1Z45A 1Z2AA 2WTBA 2ZAOA 3I1YA 3CEAA 4GUAA 4NRDA 3R9KA 3M7IA 2GWRA 4YLEA 3W5VA 2G88A 1M8GA 1YZYA 2J3IA 2Q0QA 1JG6A 4Q4AB 4F7DA 1IJEA 1IOLA 4YCJA 1CHDA 1NFFA 3F47A 4YJ2A 1LJ8A 3JU3A 1H1LA 3TW8B 4FFVA 1W4RA 3L49A 3M5DA 1S0UA 2ZULA 4WKCA 3TD6A 4ZYVA 3RF6A 3WJ1A 4J0KA 1A76A 1EWRA 1V16B 5EJAA 2OPHA 1M0EA 4RTOA 1YL7A 2BN4A 3KAPA 3TOSA 2VSFA 3LT1A 1E2QA 1LPOA 2CHVA 1GHTA 2PKYX 2VCEA 2ZATA 2Z83A 3K05A 4K8RB 4DC1A 5C7IO 1NY6A 4GKVA 4ZVPA 2I3AA 3AUXA 1ZLYA 2EIXA 1Z6GA 3GLHE 3RAEC 2XY4A 1ZUD1 2N1MA 4RVFA 1TC1A 5KQMA 3L7YA 4GBED 4AJOA 2OK7A 4YAKA 2VK1A 1XF9A 4RVOA 3DG9A 2NXEA 2ZJ8A 3O2JA 4HVTA 4LUCA 4ZO9A 4X3PA 3DDZX 2WPNA 3PE4A 1VECA 4IF6A 3K31A 3B70A 3EEBA 4JBXA 5LA6A 3R4CA 4NMLA 5AXCA 1WPRA 2BMVA 3ZDBA 3FHLA 2W9XA 3OE7A 4DMGA 2HLDA 2XGGA 2NLOA 3CCFA 3TD2A 4KXQA 4UEOA 4KLNA 1RXWA 4Q4LA 1SKUA 1TZ2A 4BJ3A 1XEXA 5DX8A 3ZE9A 4TOIA 1R0ZA 1FLDA 1D6SA 1ONSA 3NR2A 3C3BA 1GADO 3SQMA 4OY3A 3OCXA 2X4DA 1M2HA 2E48A 4HTAA 4NX2A 1IQUA 4C0LA 1JW9B 5AOVA 1BO6A 1Y9JA 3PRKE 1DO0A 1WHSA 5BMOA 4C4PA 1FIUA 2HJSA 2XECA 4OSOA 1DINA 3HP7A 1NBMA 5EJFA 5HBRA 1N2HA 3AY6A 3VNSA 1DU4A 4EZIA 3PJDA 2AL7A 3QOXA 4PICA 2O2HA 3ILVA 2A0UA 1XD2A 4OAQA 1L3IA 3KHSA 3RFFA 3U1BA 3N2KA 2R48A 5BNZA 3ONDA 4ZU6X 4MQEA 5I7SA 2YV1A 4BYGA 2CVQA 2GHTA 3D5QA 1EVLA 3GVXA 2BEVA 3LXUX 1HNXB 4GLOA 5CT8A 2AQIA 2O7NA 4AO7A 2FF5A 1A2BA 1NL3A 1YCFA 3E0QA 1MJHA 3F8SA 4R0MA 1WA5A 4PNHA 4QHSA 2PQ0A 4XAQA 2B8NA 4WCFA 5FL7A 3H2ZA 3I6MA 2H06A 4IVRA 2C5AA 2AFHB 3G9ZA 1EHIA 3DBHA 5FKJA 1HG1A 2IYZA 4CMKA 2V1XA 3Q9NA 5GWXA 3VSCA 1F0PA 1R8SA 5EFOA 4YN3A 3A0UA 4X7BA 2PG3A 2BFOA 3PICA 1UDBA 1DQYA 4M9ZA 2RCYA 4XGIA 5HIMA 4UPDA 2HQSA 2XUJA 2X6QA 1RSZA 3S27A 3Q6IA 4YDQA 4NWIA 2WWRA 2ZDGA 2P2DA 4WBNA 3ZV3A 2HHHB 3USES 3VAZA 4DLWA 3WIBA 4ZPJA 2A58A 2RKWA 4D3YA 3CE9A 3SJBA 4AUNA 3T1QA 4R81A 2YV5A 2IHBA 4RYLA 1VIVA 1OFUA 1Y48E 3LNCA 5AKGA 2OWEA 5JU6A 4R8RA 3ML1A 4P32A 4LY0A 3U7GA 1TCAA 5BXYA 1XAJA 5THQA 3JQGA 5AKIA 4GPIB 3SKYA 4EUFA 2RK3A 4BTEA 5TF0A 4DCGA 2DWQA 4TT3A 4ZC1A 2I3GA 2LP4Y 2JARA 4PAQA 2GNAA 5HGXA 4MHTA 3DKPA 3I4LA 4I14A 4F1KA 3JQQA 1NBHA 4C7OA 3G0HA 3B1YA 3V1MA 1NDUA 2ZT6A 3W2TA 4MUAA 5JIBA 4BFCA 3EXG2 1C3OB 3I61A 3CH7A 2HD4A 4MHSA 5B2ZA 3JRXA 3F1KA 1JV2B 3HTXA 3D9QX 1JDBB 1RBMA 2GZ2A 4YQEA 1O08A 3TCKA 3PGVA 2VT7A 1M8KA 2G06A 1NVKA 3C6ZA 4LXIA 4UJ3A 3OEED 4B73A 5K8LA 1VL8A 4AWAA 4BE9A 1QP4A 3OX4A 2W6OA 3K9FC 2I4IA 2QL7A 2Y3IA 4QELA 1MZPA 4R1NA 2AR9A 4JJZA 2OHVA 3VQTA 3A6PC 3GT3A 3DOJA 4QXMA 1D3AA 1T9BA 3PEFA 2JATA 1ZXBA 3NKVA 4IP0A 2FR8C 4WXYB 5CK4A 3K6KA 3IBGA 3ODGA 2B69A 5JCXA 4EG8A 4ZARA 1VRWA 1UKEA 4HPWA 1XO1A 4CIXA 2YYZA 1SC6A 3OOYA 1JU9A 4RY8A 5TT1A 3U17A 3HUEA 2PZMA 3V48A 4XEHA 4B40A 1PGPA 1MGOA 1ZQ9A 2FPIB 2XITA 3Q3JB 2OXIA 3RAFC 5CD1A 2FPPB 1RAHA 1XRJA 2WHRA 4GVPA 3RK0A 4ITRC 4JI1B 5LQAA 1KEUA 2PKQO 3E7WA 3OKCA 4EAAA 3MGCA 1DP4A 1L5SA 2WYVA 1Z6TA 2PGXA 2COUA 4HNAA 3PHCA 1L1FA 1Q7TA 3PGKA 3ET5A 1A98A 1RLTA 3L06A 3TOZA 4EG5A 2JJYA 5T4BA 2XODA 1MXHA 4P2GA 4WN9A 3RS9A 2R8ZA 1F1JA 3QEMA 1IHOA 4TLBA 3H65A 3UBTA 5JS1A 4FDTA 3BMCB 3CF4G 3O8LA 4OJQA 4LYFA 3INNA 1UBOS 5FUBA 2FW9A 2HC9A 2GUGA 3MW8A 4DYDA 1R8XA 4RORA 2QW8A 3PZRA 2Y1FA 4ISCA 4D8VA 1K75A 1T6NA 2HYDA 4QSMA 3U6KA 3HRKA 3WHLA 1T0HB 1Q5PA 1PBNA 3A9UA 1H93A 3D3JA 5E38A 4DKXA 4ETWA 3E22A 1U0LA 2PGIA 4I1YA 2CJFA 2H1LA 3DBRA 3W04A 4DUGD 2JD2A 4TMVA 1RBQA 1TT5A 1TAQA 4L8GA 2ZYVX 2UZ3A 3PF9A 3PYMA 4OGKA 4QLOA 2E6KA 4CKWA 2AKEA 2RHOA 1W0CA 4KVAA 1MO6A 3SXUA 3ZE1B 5CG1A 2AVNA 3BH7A 4OHRA 4KDEA 4UHJA 4DBLC 4DLXA 1MNQA 2FWPA 2O1WA 3GAFA 1RCUA 3L8YA 5KU1A 2B1IA 2WWGA 1CJVC 2FSVA 1F14A 2AG0A 4G67A 4YUVA 1HE5A 4RA9A 4PN3A 2DH5A 2BT4A 1U28A 4KUHA 3L7KA 5K0EA 3GK3A 3KXKA 1P33A 4MULA 4BX2A 3ASYA 3I9KA 2OKCA 5AKKA 3ZVNA 3VNUA 2R7AA 2WOJA 5K8CA 3FMGA 5TNXA 1II9A 4Z8YA 1C1XA 1PZHA 3I6BA 2WSIA 4NFSA 3UJ7A 3ZNPA 5B2FA 3L0BA 4LKOA 4CL0A 5DJ5A 1N4AA 2JI4A 1Z6YA 1DARA 1EFPB 1RJFA 1XG5A 2RB4A 3COYA 2Q6VA 3AI2A 3HCDA 4QXPA 1BEEA 3TW0A 4PC6A 4GKBA 2HRQA 1PWYE 2EKBA 4U2FA 4UUNA 1KMMA 3QFFA 3CFYA 4X1IA 3WGZA 1N2EA 5FEUA 2R0QC 1ZK3A 4QG7A 3C3PA 4IXNA 1RIFA 5DO9A 2CHEA 4X0EA 3DP9A 2P3QA 4LQLA 5KWSA 5LNK1 1BDMA 2FVXA 5SYAA 1P29A 4AZ3B 5ERGB 3H0EA 1Y42X 1Y6JA 3F8TA 3V4VB 3LRXA 2I6GA 3UCFA 4PYOA 1ZSNA 2VKTA 5EI5A 2A9QA 1CEYA 5E6SB 1N5LA 3SE0A 4C4AA 1ZOSA 4XEUA 4EK9A 1C50A 2ICAA 1VPTA 4M7RA 4EG7A 5KREA 2PV7A 2VRBA 2DT8A 5BN4A 3REQB 4HZIA 2B1QA 4XM1A 2GO1A 1L1EA 3NORA 4HDNB 5JLAA 3UKJA 3SE7A 5FUMA 5CMLA 5L7TA 5CXUA 3CVXA 4F6LA 4DR3B 4NESA 1J25A 4A4DA 2K6GA 4YAWA 3NHPA 3UXMA 1F6DA 1WUHS 3HYTA 1CQXA 2V6IA 3E5MA 4EJSA 4ZYLA 4Q19A 4KLCA 4M1ZA 1TVKA 3CF6R 1Y3HA 4UCWA 1D2GA 1OAKA 2QK4A 1JQDA 3F46A 2JH8A 5D2CA 3EMVA 4AP6A 4AYTA 3KZCA 4QXQA 1NW8A 4F2WA 1YUMA 3NT5A 1LTQA 1T3TA 4TTQA 2PSSA 5GONF 3KWLA 3OTHA 1KEPA 1WHTB 1UBGA 2WM8A 4YRFA 4A8TA 5CVDA 1R74A 3UZUA 1GTZA 3QIVA 4BZXA 3D4IA 1PWZA 2E2WA 2J7PA 1UBLS 4PLHA 2NWQA 3IT3A 3KOMA 5CG2A 2UYCA 5FBVB 3SZRA 2H4FA 4EJ2A 1P4GA 2ACVA 3T5AA 2W2TA 3TLBA 5T7BA 3AI3A 4KQXA 5IKEA 3L6OO 4BNYA 1XMXA 5BUQA 2BHTA 2DBQA 3P2KA 3L8GA 2ZPTX 4FZ5A 5IAEA 3N7AA 4BRZA 3RT9A 1X7ZB 2W22A 2ZJFA 4EI8A 1JEQA 2VZ9A 3U26A 4CEHB 1Y82A 3PVCA 1PNVA 2A5YB 4CMBA 1XHFA 2NU6A 4LZAA 2QQEA 4M0CA 3ILSA 1WUJS 3VDRA 3D0RA 3PXEA 4V24A 5ESDA 3WYFA 1SGWA 1IB0A 3IQFA 3JYHA 3R77A 4BJ5A 3K6SA 4YMUA 2Q4BA 3CURA 4PYRA 5IPFA 3RNOA 4JH0A 5CDSA 1B8PA 2M6LA 2JDIA 2OZVA 2VQ3A 2GK7A 1JS1X 5JPCA 2CNBA 5JD4A 3RHTA 4KWEA 3PKZA 1DBSA 1XVTA 3H7AA 1Y5MA 4QRHA 5JDIC 1YVEI 1PDWA 2IZ1A 1XE3A 1GQRA 1XZEA 1Z12A 2P9TA 2WYUA 2X2FA 1PZEA 4F45A 1V45E 1EMDA 2XT6A 5GQSA 3WLAA 4ABYA 5TMDA 3GN2A 5CFRA 3VSEA 3CVVA 4KSBA 3KQTA 4RC9A 3AF6A 4BGUA 5K6RA 2HF2A 1UZNA 1ZGGA 1RHRA 3FTPA 3SC6A 2EFYA 1Z6AA 3DP7A 3R3ZA 3L6CA 1F4VA 1Z0AA 1GSAA 2MIIA 4WXHA 1HFJA 2ZREA 3A2LA 3KTAA 3Q40A 3ZOZA 3TAUA 4PYKA 2BTQA 3RU2A 1Z37A 3N6VA 1MB0A 3FOFC 2XE6A 4NCNA 4PZEA 1I7SB 4IEEA 1Y3DE 4NU8X 3CEHA 3EBLA 3K5WA 4L6CA 4PRLA 4RH3A 4U63A 1JEDA 1YQTA 3BVPA 1NVVR 1JEEA 4NXMB 4NYMR 4EX7A 1C9NA 5K6AC 3G13A 4H7FA 4WQMA 3PGJA 1G59A 4FFSA 2ZB2A 1V6CA 4ZVSA 3GEMA 3GEBA 1P81A 4OP3A 3FOEC 1XALA 5KDLA 3TVYA 1E79A 2EZUA 5JNSA 1ZUIA 4EHIA 1PZGA 4K46A 4TVSA 3OIUA 3UAWA 1XD9A 2B92A 5CA0F 5LN1A 1E92A 3G85A 2YIJA 3K70D 4IHAA 1E7QA 3VNRA 1SKYE 1W1IA 3MUNA 3KEGA 4BXOA 4N5MA 1JFVA 3AF5A 3R0ZA 1G0NA 3X1KA 3ZN2A 5FF9A 5DM70 4KI0A 1RE1A 4LHXA 3L7BA 4C4YA 1XN4A 2DBRA 2ZIXB 5A2GA 2OGTA 4ETNA 1SBHA 1K2VN 1JVBA 2WOOA 3JV7A 3ILHA 1WBDA 5ICSA 2E82A 2QE7A 3A1DA 4J94A 3SZLA 2B5VA 4PBSA 4OXXA 4IWXA 3VR5D 4NYIR 1YQQA 2C3MA 4X41A 3WRXC 5BN3B 2QP9X 4FOLA 1W93A 2X86A 3M49A 4EUKA 1Y7PA 3AX6A 4D9FA 3ZHCA 5JALA 2BFPA 2JFZA 3NONA 4FGZA 1JL3A 3T9EA 1NSTA 3IPCA 2QLJA 4YR7A 4OGWA 3EQ9A 2HYIC 1L4FA 3ZW9A 1U2DC 3IOEA 4IDOA 1TYEB 3ZVLA 1F4PA 3PGMA 2RB5A 5TGTA 4WNIA 3L05A 3RFCA 3K72B 4UCQA 2P30A 1QIKA 3DH0A 1H5NA 5TT0A 2NTNA 4C1NA 1Z07A 4BGIA 2YJZA 1WZIA 1X80B 4JCOA 4ENTA 3CUYA 5J4YA 5H9WA 3LT5A 1AU9A 2VBFA 3BMQB 3CUEF 3PI6A 3RVKA 1M7HA 2HU8A 4M1OA 2V0GA 3NVKI 4P0PB 1ZA1A 5IM5A 3TI9A 4K9RA 4DM4A 1XDZA 3DLAA 1WZ2A 2XUGA 1XDUA 1P5JA 4NNPA 1GG5A 3QLVA 3IRVA 4B48A 4LMBA 2FK7A 2L18A 4D9NA 3I5YA 2XTNA 4QO7A 3L0IB 2IXAA 3DO8A 1F3LA 3F7MA 1DAPA 1E1CA 1OT5A 5F77A 2REQB 3H42B 3JALB 4BQSA 5BRAA 3BE8A