3BL6A

Crystal structure of staphylococcus aureus 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase in complex with formycin a
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
230
structure length
230
Chain Sequence
AMMIGIIGAMEEEVTILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIPQMPVAFQSSKPLIEKVSQVVQQQQLTAKVGLIVSGDSFIGSVEQRQKIKKAFPNAMAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAFLEKAAVSSSQTVEALVSQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Staphylococcus aureus 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords 5'-methylthioadenosine nucleosidase/S-adenosylhomocysteine n
total genus 78
structure length 230
sequence length 230
ec nomenclature ec 3.2.2.9: Adenosylhomocysteine nucleosidase.
pdb deposition date 2007-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3bl6A00
3KU4A 5B7QA 4LDNA 1V41E 1A69A 4TXHA 1T8WA 1JE1A 1Z5OA 5F76A 3IEXA 3MMSA 5IU6A 1I80A 3FUCA 2A0YA 3U40A 3OZCA 3OF3A 4EB8A 1ODIA 1JDUA 4MARA 1V2HE 1Y1RA 3P0EA 1TCUA 4OF4A 4JP5A 4TS3A 5C80A 1PR1A 3LA8A 1YR3A 1A9OA 5ETJA 1VHJA 4G41A 4D8YA 3OCCA 5KB3A 4TXNA 3KHSA 1TGVA 3NBQA 1ODLA 2A0WA 3DJFA 1V48A 1Q1GA 2OXFA 3PNPA 1YQUA 1ZL2A 2HSWA 3EEIA 3LGSA 4TS9A 4GKAA 1OV6A 1ECPA 1JDSA 1NC1A 3FWPA 4NSNA 2AI3A 1RXSA 1T0UA 1RXUA 1PKEA 4L6IA 2ON6A 1Z34A 1U1CA 1VFNA 4QASA 4D9HA 4DANA 1B8OA 3EMVA 3TL6A 4R2XA 5B7NA 4F2PA 1RXCA 5EFOA 3GB9A 5F7JA 3DF9A 3FOWA 1Y6QA 4RJ2A 4GLFA 3OPVA 1C3XA 3OOEA 3OOHA 5F73A 1ODJA 4BMZA 3LBAA 2PGAA 1PR5A 3OZDA 4MCHA 4WKPA 3ENZA 5I3CA 4M1EA 4TXMA 3KVYA 4DAEA 3MB8A 2OECA 3INYA 5CXSA 3IOMA 2Q7OE 1CG6A 1U1FA 1RYZA 1SD2A 3NM4A 4IP0A 2IQ5A 4PR3A 5CXQA 2RJ3A 3E9RA 3UAVA 1A9PA 2AC7A 5B7GA 1Z5NA 1JPVA 2I4TA 4ECEA 4OGKA 1LX7A 4MCIA 1U1DA 1SQ6A 5F78A 3O6VA 4L0MA 4X24A 4YJKA 4WKNA 1JDVA 4H1TA 1ULBA 4G8JA 3KVVA 1YQQA 4UC0A 4DA7A 3T94A 1RR6A 2A0XA 4GLJA 3EUEA 1K9SA 4DA6A 4P54A 2HRDA 1OVGA 4F2WA 1JDTA 1NW4A 1Y1TA 1WTAA 4BN0A 1N3IA 3ONVA 1XE3A 1TD1A 5JPCA 2P4SA 1PK7A 1NC3A 1PK9A 2A8YA 4YMLA 3FB1A 4LKRA 4YNBA 4DA0A 1Z35A 4TTJA 4LNAA 1FXUA 2ISCA 1Y1QA 1V4NA 1VMKA 1PW7A 1Z5PA 4TTAA 2B94A 3UAWA 1ODKA 1PBNA 4QARA 3F8WA 2HN9A 5CCDA 4NS1A 1YRYE 3FAZA 4WKCA 5F7OA 2GUWA 1Z39A 3KVRA 4OY3A 4QATA 4D8VA 4D8XA 1OUMA 3FNQA 3UAZA 2QTTA 3NM5A 1Z36A 3NM6B 1PF7E 4TXLA 4TTIA 5F7ZA 4JWTA 4DABA 4F3CA 1SJ9A 1JE0A 1M73E 1TCVA 1RT9A 1VHWA 2OC4A 2AI1A 3K8QA 4LZWA 4M7WA 2XRFA 4WKOA 1K27A 3BL6A 1PR2A 4QEZA 3BGSA 5B7PA 1Y1SA 4DA8A 1TGYA 3KUKA 3PHCA 4F1WA 1PWYE 4PNPA 1RCTE 2OC9A 3UAYA 4JOSA 1V45E 2AI2A 4NY1A 5CYFA 3DPSA 5CCEA 4KN5A 3E9ZA 4WKBA 1Z37A 1Z33A 4TYMA 3C74A 5FAKA 4TXJA 1QE5A 3EUFA 4BMXA 1A9QA 2BSXA 3E0QA 4R2WA 4OEHA 1Y6RA 5EPUA 3BJEA 1YBFA 3DP9A 5EUBA 4G89A 2I8AA 4GMHA 3PHBE 4EARA 3PNSA 1LVUA 1OU4A 5IFKA 3BSFA 3QPBA 1A9SA 1ZOSA 4I2VA 3UT6A 3P0FA 1G2OA 3DDOA 3D1VA 1OTYA 1ULAA 3ODGA 1A9TA 4DARA 4OGLA 4L5CA 1JDZA 1U1GA 1RXYA 1U1EA 1K3FA 4E1VA 1T8SA 2QDKA 4F3KA 4YO8A 3GGSA 3SCZA 2HWUA 1B8NA 5F77A 2QTGA 4D98A 2QSUA 1T8RA 1PR4A 3OZEA 4L5YA 3K8OE 4M3NA 4R31A 4QFBA 1A9RA 2H8GA 1JYSA 1RFGE 5F7XA 3O4VA 4K6OA 5CYGA 5DK6A 4QAQA 1PR6A 3UAXA 4U2KA 4LNHA 5K1ZA 4BMYA 4DAOA 1LV8A 2QPLA 1Z38A 1CB0A 4OJTA 1T8YA 3OZBA 1RSZA 1V3QE 4L5AA 1SD1A 1OTXA 1JP7A 4FFSA 1PR0A
chains in the Genus database with same CATH superfamily
2N1BA 2VPQA 1AB5A 3L8EA 1SXGA 4FR5A 1AA6A 2J3EA 2ZG6A 2HH9A 5IBRA 1T35A 2BFBA 1ZWLA 2O9JA 4KQ1A 4HNTA 3RYIB 3JS5A 3LC7O 1YO6A 2JI9A 3JQQA 4RWZA 3IJ5A 3JALB 4X7BA 2Q1SA 4TTVA 1WY5A 5JTUA 1VMDA 2BMWA 3FCOA 1WD5A 1U8FO 3WS7A 1PWEA 1ZW1A 5JYCA 1GPKA 1F8UA 2FH5B 3IYLW 2WJIA 3HDVA 4B6SA 3VO1A 1R6UA 1RRKA 2YWCA 4UTOA 1DIHA 3D6AA 2QBYB 1JHDA 2ADMA 5HF6A 3FY4A 2HWYA 3OZCA 3RQIA 2BLLA 2GZAA 2O1WA 4B3BA 3RRNA 4HB4A 4KDRA 3SFZA 3ENQA 1ST2A 5H4HA 1GN8A 1O8BA 4CU5A 2CUTA 5ALDA 5AI4A 5DXAA 4ZZ1A 4MARA 4AIIA 2ZXFA 3V34A 4BWVA 2NO7A 1R15A 1KORA 1XJQA 5CHEA 4ZYZA 4GNRA 2V5UA 4ZO4A 2D59A 1HE3A 2V8OA 5JSKA 2ESRA 3CFYA 5ICEA 1HLPA 3GZNA 2RGCA 4LC9A 1IATA 2JAOA 3P9YA 2C2WA 1HFEL 4LMPA 1J97A 1G21E 3LH5A 3WWDA 1FP4A 2ZSAA 2AZTA 4ZTZB 1KFJB 1KKMA 4BFZA 1GRVA 1N34B 3LBHA 1RWQA 1HYBA 2VTEA 1JQJC 3SMVA 2NAPA 1IRXA 5FWYB 2IY8A 1HLGA 3ZLBA 4JVMA 3OFJA 1VRCA 4U2EA 2QZ9A 2FPOA 5FBLB 4RFVA 3LLCA 4GI5A 2RAFA 1UDRA 1MTOA 2VUIB 5A1TA 5LPNA 2D2EA 2CJFA 5JALA 4R2IA 2ZI4A 4Y2PA 3U9TA 1RBYA 4B40A 1YC5A 2FW1A 3H97A 2AVDA 4W1PA 1LBQA 4LHEA 3GLIA 1WCIA 1P2DA 1Q3HA 4MVJD 5BYAA 1U6KA 3V8PA 3UCEA 3HXQA 1TFUA 3EEFA 2DWCA 1FVFA 1Z2PX 4M22A 3Q3IA 2NUPB 2O2JA 3JWJA 4WZ6A 3TE7A 2IP2A 3TKAA 1NW7A 3VHRA 3PNQA 4WADA 4ZCQA 4DLSA 5SZJA 5BSTA 5B2EA 4IXNA 1V8PA 4ZREA 1X0VA 5ESDA 3TF5A 2A1IA 1W5SA 1Q1QA 3FYUC 4IAOA 2EXXA 2Z1MA 4Z4GA 1PD0A 2XUQA 1DELA 2JJ1A 2UUPA 3DZ8A 3RTBA 2FSHA 2A5DA 2XDQA 4O4JF 3R5JA 2PY6A 5ES3A 1IBMB 4QLAA 3H1EA 5IDVA 2GJKA 4HMPA 2FCRA 3DLAA 1P5HA 2FSFA 2ORED 3FHJA 2OWDA 4HVTA 4KO1S 4L6IA 4ND8A 5B58T 3D8NA 4CMEC 4F4DA 1R7RA 2HPZA 3NDIA 4IDEA 4WESB 1YGYA 4S24A 3ZJTA 3E35A 1Z88A 2GCEA 1KYZA 3E23A 3CWCA 2IZ5A 4D6PA 2VS1A 2DGDA 5JS1A 1P80A 2C4VA 5JNUA 3VX4A 5LQUA 1XVVA 5HCUA 5TQ2A 3P0JA 3STHA 4CQMB 2G8NA 3W2TA 4GOXA 5CFLA 2QE7A 2ATVA 3BIFA 2C61A 5C5CA 3F71A 1FX0B 1PGQA 1ZBQA 2WABA 4HPWA 4MRVA 1CJMA 4JDUA 4V24A 3MLBA 5DIFA 3CR7A 3AVOA 4H7PA 5KKAA 2FOLA 5JH7A 2VYNA 4OQLA 5IJ9A 3U5ZB 2XZDA 4XDGA 4Y2HA 5FR1A 4L2IA 1ADJA 3S2GA 3D3NA 3B6EA 1IXSB 3H87A 1QGOA 3HBJA 3CZAA 5GOTA 3TRJA 3NWBA 3QPWA 2M1XA 1U0JA 4WY8A 5JXGA 4KO2S 1AO0A 1CJSA 3K1TA 3L5KA 5IXJA 5TJ9A 3X43A 2AS0A 1XCPA 2WF5A 3D7LA 2BFFA 3GCZA 2WU4A 4RL4A 2ZJOA 4HFNA 4JLKA 5AW5A 4JS0A 2R1VB 4D0GA 3U62A 1SBIA 3M6WA 3B3FA 5I3ZA 1KMCA 1HO3A 2G4LA 5J47A 3B6MA 1HURA 1WOMA 4K28A 1VA5A 4RVFA 4BO9A 3LOUA 3E3MA 4DLKA 2AF3C 5ABPA 3VDMA 1F06A 1JQDA 3BD7A 2HJRA 3MB8A 5C35A 1J8FA 4R83A 1N2BA 2PSFA 5A5VA 3JD1A 4I5GA 2G1PA 3R7WB 4IY1A 4NCBA 3C8MA 4ZQHA 1EDOA 4C1NA 3DL2A 1F2UB 2NYRA 2BGNA 2P2GA 2Q7OE 3DZBA 1FBTA 4U6SA 1A2KC 2OO5A 2FE1A 4EEZA 1NPYA 2VCEA 3GJQA 4BVAA 4RSHA 3RSSA 3N28A 1XP8A 1VSTA 2RJ3A 3RRZA 1NVVQ 4C30A 4IDFA 5JMOA 2Y6VA 1P5FA 1V5EA 4L0CA 1M2JA 5CRIA 4F5EA 1AHIA 2B3DA 3OWOA 4YT4A 1DX9A 2BP7A 1HUQA 3CCCA 3Q72A 2V9CA 4MO2A 3Q7SA 3RTDA 3LIIA 1J5XA 1PR3A 4M37A 4C4PA 5EKUA 4G8BA 4M0EA 2IK8A 4DWVA 4TSRA 3BZBA 4LXQA 3S5JA 2P9FA 4NHEA 4BNWA 3RS5A 5HR5A 4GXNA 5JXWA 4YXWD 4MUJA 4YRSA 5F1YA 3RWBA 2ZAMA 2XRMA 3KE9A 4BVHA 1NG9A 1YA4A 4YUYA 1DBVO 1JDVA 3V3KA 2FXIA 4YYEA 5K09A 5AOAA 1E0KA 2C8KA 3I23A 3ORHA 3HHPA 4YI5A 4XR4A 4A1FA 5ED0A 1NSFA 4YMHA 1XWFA 1Q74A 4DM3A 3OQIA 2BFWA 2JHAA 3PFGA 3UMYA 3IURA 4RKQA 3DKKA 2P75A 2PKYX 3LC0A 4KN8A 1OVGA 2PKCA 2GN6A 3H8JA 2AL7A 3NVMB 4M9UA 1S9DA 1QH0A 1NUTA 3GUVA 5CD9A 5K8JB 3CG4A 3D8HA 2FCAA 3BQ9A 3ONNA 3FUTA 4G4GA 1P72A 2LXNA 2ZWPA 4UMFA 2ZRHA 1FMTA 2A33A 2IXBA 2WP0A 2DQ4A 2KI5A 3FCUB 2EQBA 3BMXA 3IQWA 4FNMA 3B60A 4G26A 4X54A 5HKOA 3OJ0A 2XZPA 3JAWA 4B73A 4UOEA 4S0ZA 4HAZA 2E4WA 3OFNA 1QTQA 3SVTA 3O9VA 1AA9A 2O4CA 4M87A 1O3YA 3G2OA 2V4ZA 2ONJA 4EEXA 1XHFA 1YFZA 3FRIA 3NWOA 2QUZA 3G2QA 1BVHA 3JZAA 5JQGB 3C5WP 3ANSA 5I7SA 2FPXA 2K4MA 4KVZA 3M6LA 3WB0A 2XUKA 4AUEA 2FFAA 5G3ZA 5B6JA 3LGXA 4I7EA 3GDHA 4KWTA 3OEEA 3UGQA 3LE8A 1NR7A 5EHZA 3IJRA 1C14A 3L7DA 2IS2A 3P2EA 3KEGA 1G1MA 1GG2A 1AKEA 2FLWA 3KJIA 1X9GA 4P9NA 2HMTA 4WESA 3VU3A 3DT6A 1BJTA 3ISTA 3KNZA 5HIJA 4GWKA 3SWWA 3O8RA 2F3UA 1USVA 4MGZR 4CCYA 4ARIA 3ZLJA 4MYCA 2ES4A 2HV8A 2G67A 2TYSB 1I2BA 1SBQA 1TYAE 2AW3A 2RGNA 3VU9B 3ZVLA 1J21A 3LIPA 3D4IA 3NLLA 1ZD4A 4JI2B 4UVHA 3JZIA 5L4LA 1NGSA 2BC9A 2EJCA 2XDQB 4P3KA 4XARA 5DKFA 4C0BA 1E77A 3ESQA 1QGUA 3G79A 1SQ5A 2AV6A 5KAPA 2J7PA 1JYFA 5FO1A 3K4QA 3SYLA 1U3WA 4IJ6A 1WG8A 3IMCA 1FCJA 2JFVA 3LP8A 5T4FA 4UQPA 2OPBA 4RK6A 4PYIA 3K1AA 4NEQA 2QRVA 5FRDA 3R0IA 1PTJC 4RF5A 1N2EA 2OSBA 5G0WA 4ERNA 4L6AA 2ACKA 621PA 3JQAD 1R0CA 1EVQA 5F52A 4Q4CA 2TMYA 4I6EA 3K96A 4PX2A 5FI0B 5K3CA 2Q5QA 1OZ0A 3KBBA 3ABZA 5AVJA 4FX5A 5DE3A 1X7WB 2ECKA 4TVOA 3KQKA 3TOSA 3Q5EA 3RC8A 3QFSA 1BKYA 2G5TA 4M0LA 4ZYWA 3VXKA 5I7RA 2W42A 4DSOA 4Z9AA 1O0SA 3CNHA 1Y7PA 1FXWA 1JSZA 1SHZA 3TLGB 1GTSA 4YRQA 5G41A 1SK9A 1UPXA 3C6YA 1EWTA 1NI4A 3E48A 3NFRA 4C01A 1GTG1 1PTJA 2R8OA 1N2CB 5K4AA 3BGSA 3PA8A 5B7PA 2VLBA 1DCKA 4JODA 1CB7A 1GQ2A 1RACA 4J0IA 3HBLA 4EHNA 1U4SA 2FZKA 2H4ZA 5B1HA 3JRWA 1CTQA 4NCXA 3KSMA 1U02A 4GX0A 3T3EA 2GEJA 4F1WA 3AEKB 3M0EA 1J56A 1BVYF 5U4QA 4NABA 5B4VA 4FHGA 2VSQA 2BGRA 3LZ6A 4OFXA 4CKBA 1PT6A 2AC4A 1C4WA 1OA0A 4JX9A 4L0QA 4LSGA 1W47A 3DZJA 4NCKA 4O4LA 3NR2A 5AJTA 2YQZA 1FFWA 4IWYA 3K1JA 5JH7F 3MF4A 2PXHA 1BMDA 1LRLA 3CX7A 1BWSA 3D4BA 4JC5A 5E1DA 4CW7A 1YL6A 2EW8A 1GU0A 2Y76A 1DKLA 2YOFA 2ZWVA 2ODBA 2NACA 3DAOA 4HQ6A 2AXPA 3THXA 3QPDA 2QSZA 1PIWA 2CLOB 5DYTA 2XWSA 2WC1A 1W73A 1G291 3B6IA 4TXJA 3IKTA 1J2EA 3LX5A 1IB6A 2JA1A 1A9QA 4REQA 5FNVB 3AL3A 1A5TA 1IQUA 1EWVA 3NAGA 5FBHA 4AJ1A 2R25B 3LQ2A 4R2WA 3OZWA 1B0AA 3W2IA 1NV8A 1R9GA 3BRWA 2GO1A 3S99A 2HWKA 2R00C 3EXHA 2F48A 2PXXA 4MHSA 5JBNA 1V5GA 3AUJB 3CRQA 3MG9A 3I1JA 3MWKA 5I9SA 1II0A 2R1TA 4E3WA 2QL6A 4GMHA 2JK1A 2D13A 2OCIA 3DW3X 1CW2B 4EQZA 2QNBA 4DV1B 2CCGA 4PGAA 4GS5A 1LPAB 2J30A 1OFUA 5L3ZA 3ABSB 3R3UA 4Y6OA 4ZVLA 4MMXB 6CHYA 5JC1A 3ESCA 3SS9X 4R9VA 2W6IA 1A9SA 2CW5A 5KSOA 4Y9RA 1W93A 2N9UA 3ZR4B 1SY7A 4AN4A 3OE1A 1FU4A 1NN1A 1PSDA 3TDMA 5MF6A 2G9VA 2IJGX 4KDCA 3L8HA 4RF3A 2A9QA 2O19A 2D7CA 4S04A 1P5ZB 1XU7A 4ZMSA 3EVAA 1WPGA 2MJLA 5DWDA 2PG3A 2KS6A 4K6FA 4PWYA 1KAOA 1CY8A 3T9EA 4DLZA 2QUBA 3A05A 5KYGA 1MOSA 4TZKA 3MUEA 1L8OA 2BHNA 2H5LA 2OHJA 1XKQA 1PJRA 1QIJA 5TPWB 4D0RA 3I3OA 5DBEX 3GRAA 4JUDX 1QSGA 4FLEA 4N9QA 2H4FA 3S2YA 4AKEA 3CXRA 4E1VA 4EO4A 5KOHB 2QDKA 3D7NA 3LT5A 2QR2A 4D79A 2DPGA 4Q1EA 2JDIA 1X7DA 2WHPB 2RB4A 4HFJA 1JAZA 3A1TA 1UAYA 3VPHA 3A8TA 4ZU3A 4XOUA 3WE7A 2NUTA 5BN3B 1GKLA 4OLAA 3PD7A 1V43A 2L42A 4PQFA 4UZFA 1L7XA 5TQ0A 3QX8A 3QFTA 1V16B 1PR4A 1GCGA 1YS2X 1WXGA 4DQDA 3I5MA 2GZDA 1MF7A 1ZAKA 3A1NA 4GLBA 4PSKA 5FWNA 5ALNA 1RJGA 2KSQA 3M3HA 1G4UR 3T99A 1WDKA 3K9HA 3KAJA 4YJ2F 5IUKC 1Q7CA 2BELA 3LO5A 3EH1A 4PANA 4R5HA 3RHZA 1Q0PA 4XYGA 2P2DA 4MV7A 5HIMA 3U17A 1R0WA 1ZXLA 1DEXA 2WYWA 1YK0A 3RG8A 1ZXBA 3SD7A 1N5OX 4A5SA 5AVUA 4K6OA 1MT0A 4U2BA 2AQIA 2G77B 1LF5A 1NQWA 4QXQA 5KNBH 3U61B 5AHOA 4KAAA 3H0KA 3WXBA 3OE7A 3LUGA 3ID6C 1L7QA 3HJGA 4R7ZA 1B16A 4H9GA 5E8JA 4FC6A 5K6AC 4C4ZA 4PAGA 1VP3A 1EBUA 4U2KA 4A7PA 3HY6A 4Z9YA 3O3NB 1SRQA 4RGYA 4KRYA 4YV0A 1JB1A 1PR9A 1X80B 4ALMA 2RHLA 3VR4H 1A96A 2IU4A 4DAOA 5KTYA 3VR5H 3K1YA 1WNFA 2DJIA 3GFBA 3OQNA 4YXWA 2WIDA 3I76A 4REMA 3WYNA 5DLYA 3BE4A 1DARA 2NUAA 4PZUA 4KAJA 2W7TA 5AHKA 2A4KA 3ISVA 2HO5A 1NNLA 3FIUA 3TLXA 421PA 1U2QA 2H2HA 2VN8A 2Y2UA 4MKHA 4JBXA 2CHGA 3GMIA 1GNLA 3DXFA 4ITRC 3ZVNA 3FGZA 3VR6H 3CVWA 1E62A 1FNCA 3WQHA 4B7ZA 1JP7A 1ZC4A 5A6SA 3PXCX 1GGEA 2CFSA 2EDAA 3ORQA 1BMFD 4DMHA 1ENYA 1HE4A 5DN6D 5B7QA 4H27A 4LDNA 2YJ4A 3EXIA 3JWPA 5BSEA 4COKA 1YR1A 3TECE 3W7AA 3WLAA 3IB3A 4G0YA 3SEFA 2FX2A 1XDZA 2XUFA 1H2WA 4TTQA 4A3SA 4L50A 3U2QA 2V74B 5B4UA 3MPUA 3AQ4A 5K5EA 3FCYA 1ZJ6A 1WUYA 1TM4E 3N6XA 4K5QA 1ZRMA 3UQZA 1BYUA 3E22A 1X1EA 3FUCA 4L4YA 3R5HA 3ZD8A 3FI9A 1V7ZA 5LZ2A 1NJGA 4X6LA 4C7OB 2PFKA 3RBXA 2FK7A 1ONSA 3O1JC 3GJ5A 1G2QA 4GDFA 2PWZA 2ZRFA 1JU4A 1RQ7A 3KQPA 2CB0A 5F4BA 1JDUA 1WZNA 2KMLA 3HZZA 4XGKA 4N01A 1DCMA 3IALA 3SDSA 4NOLA 5AVTA 3SBEA 4Z4IA 3A3PA 4OF4A 2CXOA 1RM0A 3ADKA 4H7HA 3V4ZA 1NF9A 3S2SA 4DLBA 1H5QA 4BUJA 1QFMA 3ZVRA 2AH5A 4XLZA 4QOHA 3EZXA 2XCLA 4H1HA 3OZRA 5ALUA 3IIIA 3VZCA 4A2WA 1KQGA 4KXWA 3CVVA 1F6DA 1ZA2A 1YR3A 1D1QA 1HYQA 1MIOA 2GNPA 4MVCA 2ZYRA 4CGZA 1TUBA 2EQAA 1KEEB 3HB5X 3GT0A 3P19A 2EP7A 4PV7A 1G6HA 4IOKA 3A6PC 1XEWY 2AQKA 2ORIA 3GI1A 3HKEA 3HABA 4GYYA 3GRZA 4F11A 1NHGA 3TZCA 1WWKA 3AT1A 4P3OA 3AERB 4YP6A 4GW3A 4TWJA 4UEQA 4M1OA 5GIPE 1LV7A 1ZISA 4GM1A 3SY8A 3W7VA 4OQQA 1NBHA 1P7YA 1YI8A 2M1ZA 3SQOA 1PV2A 3USCS 4DRXA 1EVLA 2BKUA 4K2HA 3QXJA 4Q3KA 3UJAA 1MHPA 2BI7A 3N0TA 4PZLA 1IOVA 2V1UA 3A10A 4N9WA 1Y37A 1RW4A 3B6ZA 3D6MA 3P97A 3DQZA 2QLNA 1AGNA 3ZOZA 5CXXA 1P60A 4GBED 2X4LA 1DT5A 5EXTA 4RLHA 5K01A 5LQDA 1U8YA 2QORA 4RVNA 3KSDO 1NYRA 2HK6A 3AESB 3NGXA 3QE3A 4KTVE 4MRNA 5BN5A 3OU7A 5AVOA 3TTSA 3DLHA 1ZW6A 3QJGA 4D9EA 1JR4A 4RPLA 1AQUA 1A5AB 1TYCA 1Z4IA 4DRYA 1NJ1A 2XMGA 3LY9A 3ZKAA 1MRSA 1YB6A 3ROKA 4BO7A 3PGVA 3SP1A 2ZETA 2PKEA 3KQSA 4D4MA 4Z8XA 3RI3A 3RSFA 2OB1A 3ZWMA 2YZGA 1PS0A 4FDMA 4ACAA 2XE4A 4IXMA 4QDXA 1G9SA 1NOIA 1PBTA 2C1ZA 1EPUA 3MWGA 4L2IB 1ICEA 2VYND 3CVUA 2G5GX 1FP2A 1GGNA 1CBUA 4YCSA 1KY4A 3MMZA 4DC9A 9ATCA 3AFIA 1UEIA 4URWR 4EB6B 5EWJB 1MN6A 2OA0A 2PKWA 3TM4A 4D9HA 4BE4A 3HYRA 4U8HA 1C3OA 1JQAA 2LVBA 4KN9S 5DW0A 4D9CA 2D2FA 5LXTF 2DULA 3E1KA 4NU8X 4EP1A 3A32A 1VKRA 4D26A 1QB7A 1KFKB 3UTDA 2BE9A 4I50A 4B6GA 5EY5B 3QPAA 1QVWA 1E92A 3FE2A 1IPHA 1XTZA 1TKRA 3BB3A 4K9OA 2EFCB 4C06A 3GXOA 1QQAA 2GBPA 1O5OA 1QYWA 3FPGA 1Q0SA 4H2DA 2NUBA 3BXOA 3L6CA 4E11A 4IDCA 4JXJA 1BMTA 2W2TA 3V97A 2QMYA 1HRDA 2WVAA 1G8AA 1SVOA 2WHEA 2GASA 4JI8B 2AE1A 4L4XA 4N7RA 3FD8A 3M2PA 2HJVA 1C3XA 1T9CA 4UBKA 4Y6PA 3CXUA 2H7CA 4BLWA 4URZR 4HLUA 2VSFA 2IIBA 1JAYA 3MWYW 3ME5A 1LJ8A 1JF8A 2P0EA 3GD5A 4BX3A 4DR6B 1UBEA 1U28C 1WXQA 3K31A 3QVMA 4IGKA 1KPHA 4GZ6A 3JAMA 1YZKA 1ZITA 5HWSA 2B37A 3WB2A 1QFYA 4EY3A 3IB6A 2XKBA 3DBRB 4OH1A 4BRWA 2Z8YM 2NT4A 3O4FA 4MVJP 1E4YA 1VLMA 5LKAA 3SGLA 3LY8A 3K0CC 4FQ8A 5E1MA 5FOWA 2HT1A 1M1NB 4YLEA 6REQA 2BFDA 3ESBA 1YRAA 4EIWA 4NICA 3WIOA 2QT1A 4YGXB 3MOSA 2JNWA 3NDJA 3H1PA 3MWFA 5F64A 3ENVA 5D5PA 1DDGA 4PFSA 2Z2ZA 1MPTA 4PZCA 3WOHA 4MAMA 5TDHA 2B4TO 2P11A 3I9OA 1H6AA 4JCOA 3KLBA 4KFUA 4NNJA 4Q6BA 5DBHX 3R7FA 1L5MA 3ORRA 5J1SB 5IT0A 2AD1A 3GAMA 3DZCA 5AD1A 1WZ2A 5ICSA 3CNQS 1JZSA 2XPCA 1Z4MA 1XTQA 1ZK4A 1TPYA 4TUYB 1RM3A 4YVFA 3K6JA 2VJOA 4OGKA 3FWYA 4JY7A 1VPEA 3ZXUB 3EAGA 2CC2A 2AQ8A 2OGUA 4JIMA 5JLJA 1GVHA 1X19A 1BE6A 1VHQA 3GGCA 3ZIDA 3GGPA 4PC6A 3Q15C 4TV8A 4IVQA 4AZVA 3E9EA 3FJOA 3HACA 4ARZB 2RCNA 4DB4A 2C7PA 4EGCB 2B3TA 1X94A 3TW4A 2P9HA 1XAJA 3ZV3A 1ONPA 4BEBA 2BTEA 5SY6A 1T0HB 1P7VA 3H99A 2HX1A 5HRUA 1Q22A 4ICIA 3OESA 3EF1A 4S1OA 4WN9A 1XMQB 2OLJA 1U0GA 2F3TA 3NP9A 2TS1A 4ZQIA 5EXPA 2E9SA 2Z5LA 3IVCA 4L8WB 4YP7A 4JB3A 4OSPA 1MB9A 4PGFA 3BH7A 4O4IA 3U31A 1OV4A 4R84A 2OPHA 2XE6A 1QCZA 2QKYA 1MA3A 1XD8A 2QN8A 1GNQA 1GAJA 2A3NA 2AVNA 2CJXA 3LBNA 4QNNA 2AJLI 2UZ1B 5E1BA 1GU7A 1TNDA 4DLUA 1LBSA 3IX7A 3GLGE 1PFUA 3C48A 4ZI2A 4CIAA 1Q7BA 2HNKA 2BMVA 3E5HA 1QIFA 2E21A 5EZYA 4DCOA 2GZRA 2A8YA 2P2CA 5J59A 1NVKA 4UREA 4BFUA 5F51A 4YLYA 1Y3DE 4H4CA 1LSOA 5A3QA 4DS3A 1RDFA 4KKVA 4KOEC 1CUIA 5LLTA 4D56A 4IINA 4PLZA 1JEYA 2JI6A 4MR9A 3PYXA 2O3SA 2RJOA 3BRWD 3T0FA 2L2QA 3FDFA 4L6CA 5EIBC 2ASVA 1AS2A 1Y98A 2PO7A 3ED1A 2VUUA 5KO2A 3GX1A 4Q4DA 3AJEA 3IKMB 1V8BA 1QPBA 3H2BA 3LVFO 4ZCMA 3GEDA 4LUCA 2X14A 1EINA 3FKQA 2HSGA 4IFTA 1J07A 1PBNA 2QL7A 4UPDA 4BS9A 2XKJE 1RC8A 1QP7A 3L4BC 5CK4A 4XJSA 1JR6A 5F7OA 2GUWA 2H11A 3BGWA 4ZCIA 4XW2A 2ZANA 1V8DA 3L41A 1TEXA 4BO2A 4BLUA 3AW8A 1J2JA 3UJ7A 2W43A 1KP2A 1XDBA 4AO8A 4F46A 3TG2A 2ID7A 1C4XA 4W5TA 4XCXA 4J1TA 5AH0A 4QYTA 2RGDA 3G9QA 1X1BA 1ZIYA 3KTAB 1YZTA 3G0HA 2VF4X 1H2EA 3IQIX 1CUXA 4HGQA 4FNGA 1KMNA 1JU3A 2HF7A 2HV9A 3KR2A 3ST7A 1NG1A 3UWDA 4BO1A 2SKDA 3B82A 3VNAA 1JEYB 4QFCA 3TLZA 1DOZA 3ZV5A 5KIAA 2VDJA 1UPFA 3V8BA 5F2KA 3BGOS 1P7ZA 2Q45A 2HRRA 1RT9A 3AWDA 3GELA 3HZRA 2E4VA 1P1KA 2JATA 3QYFA 3RRXA 3ADDA 1VFPA 4CG0A 2B1QA 4AWBA 1R5OA 4Y7DA 2AFIB 3PNOA 3VO8A 1OX4B 5KNBD 3P9IA 2HXSA 1GUDA 2H0AA 4IIJF 4UMEA 5D6NA 5HMLA 1O0CA 1TA0A 2NVUA 3UJ3X 1GZ7A 4RIEA 4FN5A 1SVLA 2AMFA 2F1IA 3NIDB 1V0JA 1J0CA 3MCZA 3SQLA 4BV9A 1N9GB 2BY4A 3A36A 5IP5A 4XWKA 5BW6B 2JCGA 4HDCA 1ZUNA 3JQAA 1Y1SA 4D97A 3OHSX 1MQAA 1RHUA 1ATZA 5HF5A 1CZLA 2CXHA 3C1TA 3FYUB 4FP9A 5DYIA 2H1VA 1SRRA 2MCFA 1Q3TA 3PUHA 3QY9A 4M89A 1ESZA 3CSDA 1DFHA 1SUAA 4TMVA 3RRBA 4O2LA 3T06B 3BWXA 1ESCA 1MO5A 3BXZA 3PHGA 5J9FA 3SR4A 2VPXA 2Z6AA 3IP6A 4MO9A 3VR5A 4RD0A 1C30A 4IIXA 1GDHA 1WEKA 1XDWA 7YASA 2YVAA 2WZDA 4OI2A 1RMTA 3REGA 3UFBA 3VDRA 3BMOB 4PAMA 5T57A 4D46A 1U3DA 1Q91A 2I33A 2PCLA 4LXHA 5DWVA 1E9AA 3QWAA 4DG9A 1SB8A 2FA9A 5I9TA 3OT1A 1NE2A 3OBIA 2R11A 3ANNA 3N86A 4LOAA 2CNDA 3VMMA 2SBTA 3I0NA 4Y6SA 2CFRA 1C3LA 4DHEA 1XDDA 1GL6A 2DR3A 5HGXA 3JSXA 4IIJB 2VDRB 2ZSKA 4IR7A 3PPYA 3AKZA 3A2MA 3S1AB 2FUNB 2NG1A 1NN3A 5HF8A 2PVSA 3CKLA 4M53A 3V3TA 4ZEXA 2J9RA 2X58A 3I34X 2CL5A 3M1LA 1GPWB 1FUUA 4P4LA 2XVAA 2NIPA 3R6GA 2CB9A 3O75A 2ZYWX 4EKEA 2OEPA 1L7MA 4YH1A 3PNSA 4K9LA 4ZJPA 9LDTA 3L8CA 3ZJYA 3WGZA 4HNSA 1SC6A 5EXDA 4LQLA 4BQIA 5IJ0A 3I6ZA 1KMHB 3PXAA 2FPRA 2OT3B 1U8XX 4G9EA 2YL2A 2VNKA 3QPBA 5EZYF 4YFYA 3OF2A 1JIVA 5BN1A 2QXTA 3AOGA 3ZUPA 5JS8A 1BO6A 4S3MA 4UHCA 4I8IA 3GCDA 4ROSA 4KAXA 4JB8A 4KXMA 4BO8A 1JT9A 2QM8A 2BFNA 5FL3A 3CEHA 4IJVA 3NKFA 2FWIA 2OBLA 4JI3B 3ZLTA 5CB4F 3KYIB 3L6DA 4C0KA 5ALYA 2JHGA 4JC4A 4KITB 3VTFA 1PNOA 3ND8A 3RG2A 2IZ0A 5K8UA 1QRRA 3FRHA 3QHAA 4JUIA 2PQ6A 2X2EA 4GRIA 4S1WA 5K51A 5HX7A 2V7UA 1TCBA 5JW6A 1T2NA 3T4UA 1R4NB 3B20A 1IIRA 7GPBA 4L08A 2Q50A 2G5PA 3OWHA 4ALJA 1JQKA 3A04A 4RJKA 1GFZA 4CEHB 4MUYA 2PANA 1OLSB 1K3UB 3ZJUA 1F17A 1THGA 3JQ8A 2JBAB 3FCAA 5LA6B 1G9TA 5AI9A 3FNBA 1QIKA 4B82A 3H6KA 1TK2A 3EDYA 1KOLA 5GONF 1A50B 2WQZA 3M4NA 4B2PA 3RYFB 4E4RA 1Y7LA 2VHVA 4WOPA 1G17A 3GMSA 2VRBA 1Y4UA 1XA4A 3IIEA 1G7SA 3GWZA 3HH8A 1N1EA 2O5RA 2R65A 3RIYA 3V8EA 1KZGB 4KYIB 5I7HA 3ZCSA 3U9SA 4AXXA 1R8YA 2J6HA 2UVQA 3F7OA 3FB4A 3GJ7A 3E05A 4J6EA 4EUEA 3A4NA 2XYGA 3FTCA 1MG5A 3GW8A 2F9LA 4B45A 2NPFA 1FLAA 4EELA 2IW1A 1SBNE 1G2PA 1U9IA 3PNVA 5JD6A 4Q0MA 3REQA 4FYJA 4JELA 4L3WA 1MXFA 4BFWA 1H1TA 1U0HC 2RGWA 4C0SA 821PA 2JAQA 5A6VA 5B1IA 5DRTA 1TRKA 2JCSA 2PFSA 2UVPA 3BZUA 2AX3A 3NKLA 1K86A 2JIMA 2NU9A 1FZQA 1KOJA 1RPTA 1ISMA 2NQ8A 3LF1A 4K6CA 4NMLA 1B42A 3WL6A 2GBLA 3I0ZA 2G04A 3CLHA 5A5FA 2OAEA 1W59A 5TMPA 1CIJA 1I24A 1XD2A 3KJGA 4B3DA 5DCYA 3LXXA 2JKZA 1LPNA 4G09A 3NKVA 4CODB 4DG8A 1DXQA 4JJZA 4HNQA 3IERA 3ZZTA 1UP4A 2I22A 2QEQA 4TUYA 4Y7CA 1L5GB 4C5AA 1BXGB 2PLFA 3OZBA 1AKNA 3MC1A 4HDRB 4KN6A 3FVVA 5ICMA 3TLBA 1NUSA 2NGRA 2I8LA 3QM1A 1H2XA 4WJKB 2AN9A 2YKGA 3NTQA 1UPCA 3D9QX 1O4WA 1RJ9B 5D3QA 1SXJC 4PLFA 1ZIDA 4AO7A 4J94A 5LVAA 1H0SA 3HFRA 4Q7LA 4JMPA 4RPGA 1X9HA 3BD6A 5F1OA 4GI1A 1G0OA 2AA3A 4GOMD 5ALGA 3RADC 1EUYA 1M1NA 3WO0A 6REQB 2A9PA 3AMVA 5JAQA 1RRGA 1JL3A 1PZFA 5J4LA 5LMUB 4J49A 1S2OA 1Z3CA 1DXOA 4FDUA 1ZJZA 4BQNA 4RTNA 1ND5A 1MEJA 3OX3A 3NORA 3ADBA 4LJAA 4QXOA 4ED9A 1C8VB 1Y3CE 1L5HB 3OF3A 4XJTA 2G83A 1NM5A 3CT4A 1B43A 4LXTA 4DGSA 1NNSA 2ZBRA 3QELA 4OJYA 3U56A 2WAXA 2Q5OA 3AKEA 1F8GA 4I9HA 4EPTA 1IMOA 3PJGA 5HA5A 2OHFA 2OHXA 3FKSA 3NIFB 4BB6A 2ZSIA 3EEYA 4LE1A 4E5KA 5GTDA 1XWIA 1ADCA 3GJSA 1DPFA 4W7IA 5KJFA 1TIBA 1R0ZA 1W94A 2C99A 2VF8A 5KTNA 4UFNA 5H8WA 1XI2A 1WDMA 1CK4A 1W0KD 2CVFA 3IXQA 4OGFA 3O2JA 1G3UA 1T5OA 2HCBA 3KOOA 3EGXB 4TN5A 4TS1A 1DMRA 4RQUA 4ZVRA 3GMDA 4A6XA 3Q12A 4MR7A 3TCKA 2PYZA 1P6UA 1Q1EA 2EJTA 3HCRA 2GEBA 4KBYA 4LWPA 1L4BA 3C1UA 4MJ7A 4W7SA 4LZPA 2E6UX 4XDHA 3ZDAA 2E4UA 1U7HA 2HJHA 2GUGA 4BZQA 4NENB 1J1ZA 5EEHA 3EMDA 2XBLA 3DMPA 4H1WA 2QB5A 4J0QA 7REQA 1S1MA 1EFLA 2VJMA 4AP9A 5E0OA 4NYMQ 4ZCRA 2CMKA 2FUG1 4OXRA 3RE1A 1Q1GA 3HK2A 2FWAA 2MYPA 2ZKLA 4B3HA 1LF0A 2CDRA 1KVQA 1G2IA 1LK7A 1P0FA 2JGDA 2IKQA 4Q3DA 1U5AA 1X0XA 4LZOA 1YQUA 2QTMA 1A7KA 3MJ4A 2Q0XA 2AF4C 2PQMA 4HN4B 3VAAA 4BVEA 3AZQA 4A6DA 5L4SA 5I9LA 5G0SA 2FW9A 3RF6A 3ZWNA 3O8OB 2JKVA 1JXOA 3P5SA 5DHTA 4RZHA 1E2GA 3H9BA 3WNCA 1FS5A 3RYTC 2HIHA 4GKAA 3K0KA 1FDIA 5GONA 2R7AA 1JHMA 1T3SA 5AK3A 4CMGA 3DA8A 1TEZA 3DEHA 3KKOA 2BM1A 2FZ5A 1NUQA 4K9KA 5CLQA 5AT1A 5AVWA 2P67A 5K0SA 5CR9A 1P2BA 1RXEA 3STXA 4DYHA 3ETCA 1KEZA 4QUBA 1A72A 3DDUA 4DPLA 2QM3A 4EB3A 3ZWPA 2OG2A 1SHJA 2VXYA 3UB2A 5J2TA 5FUWA 1PZGA 4A2QA 4CLDA 1T2DA 2XIJA 1UJNA 3VKVA 4I1OA 3RVNA 1EHYA 2GEUA 2EATA 3GWGA 4Z0HO 4A03A 3BORA 1RRMA 3ZCQA 5JR3A 1RWNA 1UK8A 5EWLB 1UPTA 3BERA 3HNPA 3JYNA 3W3AH 4KQEA 2IS1A 2Q6OA 1C29B 5JYDA 4Z9XA 1LJLA 1OREA 2XQJA 1YRBA 4LYHA 4KQMA 1G55A 3BAZA 2L0XA 5BNZA 3ZCRA 4JI4B 5TIIA 3GJ8A 2PU7A 1OI2A 5DM4A 3THYA 3SKYA 3W34A 3HGTA 1SEPA 2A5YB 3IE0A 2V3CC 2G88A 2JH8A 1ZYUA 1KK1A 3KIPA 2V3WA 5ALEA 4WXHA 4DXHA 1XQVA 3GLHA 2GJ4A 4FPXA 2HU7A 3Q0IA 4FD3A 4YAJA 3TD6A 2HFKA 4IV0A 2MINA 5DH9A 4EVSA 1ORIA 1IY1A 1S4QA 3HN6A 1W2GA 4RK7A 4C4YA 4RYDA 4A1OA 4GLFA 2RHCA 4WQMA 1QV7A 4MW6A 2XCOA 1JSCA 3WYGA 3ABRB 3MZ0A 1CC1S 1TIPA 4EKDA 2B7CA 3LRTA 1YZLA 4Z9FA 1ITZA 2ZTHA 4RV9A 2JJMA 4KUEA 1CHDA 1H2HA 2G9UA 3DTYA 5FTKA 2ZUVA 3F96A 4I55F 4TVKA 1KK0A 1DEHA 1DUSA 1NUPA 2R8EA 4X20A 5DYYA 1SOMA 1ODJA 3PR3A 3NDBB 2WUGA 2C31A 3TOCA 3RU9A 4Z4EA 3KSUA 4B9AA 1PR5A 4BLSA 1JKFA 4V02A 5A4IS 1HDRA 1QH8B 5KS2A 1OYWA 3EUAA 4J07A 1SBCA 4ACBA 1AS0A 1NLYA 1UT8A 3AB7A 3W3AD 4ZTUB 4TZ0A 1YT5A 2FSVC 4DAEA 3IGFA 1K5GA 3ZV7A 2JGDB 3F67A 3HSYA 3U4AA 5HW0A 4IJ5A 3FYHA 3J81A 3PTLA 1YIOA 3MMPA 2F3QA 1RYMA 4WBNF 4N8SA 4OBBA 5DNDA 1IZ8A 1SD2A 3U4CA 1X70A 3AY7A 3GNSA 3O1HB 4QREA 3IHKA 3RC3A 3RROA 5I9NA 4PR3A 5LBTA 2JLCA 2XT9A 2GPTA 3CA8A 3WRYA 1R4AA 5LU9A 1TEHA 3ITEA 2AC7A 1PG0A 2ODNA 2YXDA 2GRUA 3Q9LA 3I4CA 1KRHA 1YHYA 5JSHA 2OBMA 4U7PB 4IO0A 4F2DA 2R84A 2PUGA 1CUBA 2A67A 5CBPA 2JGJA 3HP7A 2IGTA 2IYRA 3ZY4A 1CUSA 3TLJA 3T38A 3EB9A 2YHIA 3W4JA 5D1NA 4HN2A 3HI4A 4F06A 4TS4A 1NW3A 3ROEA 3UWSA 4D42A 5CA0B 5MDHA 1XLWA 1NXXA 4FFDA 3S4YA 3RRFA 3PT5A 1YJ8A 3PXXA 3GC6A 3M2TA 3QJYA 4RD3A 3ZCXA 4ADSG 2EX0A 5C1DA 3WJ1A 1FVXA 1FP7A 4XB1A 4RZXA 4JBLA 2XNHA 4B4DA 3CN9A 3OIVA 3CLTD 3IS3A 5EIFA 1PJ4A 3H04A 3LWBA 3HCEA 3SQDA 3V42A 2LD4A 1DJPA 1RR6A 3NP7A 1XF9A 3P9SA 2OXIA 5TS2A 4IIFA 1YVRA 3T3DA 5JU6A 2CSXA 3A7EA 2AC2A 5DLPA 1EBBA 5AKJA 2WFAA 4RIFA 1JMKC 1RVDA 2EBFX 2MSEB 5EE9A 2G1JA 1MABB 2G0AA 2OY0A 1W1UA 1X1CA 1ZIXA 2WLTA 2YZNA 3RC1A 5DTJA 2REQA 2C2GA 3OY2A 4JUCA 5JCPA 1GNRA 5IRCD 1VL1A 4AJOA 5K2OA 4LJ7A 1WP4A 1NF2A 2ZJ5A 3G2NA 3LYAA 2YJ6A 3R0JA 4RH0A 3I61A 1N3IA 1Z4PX 1YVPA 1CJCA 3Q3GE 2P35A 4HH4A 3VH4A 1CEQA 1R0KA 1BXKA 1VDMA 1ZVQA 2ZJ0A 3L8YA 4FNAA 3KKNA 2NUTB 2PZAA 3D4NA 1NC3A 2DKFA 3T5DA 1OBOA 2FRDA 5AHXA 2B8TA 1EB9A 3WA7A 1E7YA 2QZJA 4ZK2A 1DRJA 1CR2A 4YNBA 4DA0A 3EFHA 5BY2A 3F4BA 5K0TA 1ESEA 1EFVA 2J9FB 4L8YA 4LNAA 4MR8A 3O8QB 4C43A 5KQRA 1NF3A 4PG8A 3DE6X 5C31A 1QGDA 2NZ2A 3L02A 3NT4A 4S35A 3WGUA 1YHNA 1DAGA 2O20A 4L85A 1N2JA 3IO3A 2X7XA 1AHPA 3M6AA 2VXOA 2WOJA 2BOVA 4HSGA 1ZXXA 2WJYA 3AR5A 1PW7A 2FEAA 1Z0JA 2I6XA 3EDQA 3LQFA 1WZEA 1Z07A 1O6BA 2LPMA 3IR5A 1FIUA 1N8KA 2DJ5A 5K6TA 1XZCA 3WAGA 1FOEB 2UXCB 3ZBTA 2RK4A 4H7EA 1ODKA 5E8RA 2PYIA 3CSUA 2VTBA 2D7DA 5BUCA 2W6ZA 2IYZA 3O4GA 1GQOA 1TVKA 4YAEA 3REQB 1JWBB 4IS2A 2C3MA 4FZJA 3KVRA 4DCSA 5KHOC 1AQNA 3HB0A 3INGA 3V8MA 4ALIA 2WTNA 3I64A 3F5FA 2HCFA 4UUPA 4EUNA 4X45A 2ZBDA 2W0MA 2ZAYA 3N6VA 1WUHS 3CINA 4QFDA 3UUGA 3MWLA 3U1BA 2EP5A 2OZPA 5I8WA 3N87A 1E5DA 1XAIA 2IE8A 2FF7A 1O5TA 3GBPA 4B79A 4CN8A 4Q82A 3F8SA 2AG0A 4KEAA 2B6HA 5DHPA 3ETEA 2FVYA 2M9MA 3CO5A 4JLDA 5CVEA 1OVMA 5ALPA 3T6KA 4DRZA 5C8YB 2F8SA 2N47A 1M2HA 1JKIA 3BUSA 2A5FA 1BDHA 4GR4A 4MQBA 5K3BA 2Z8XA 2X41A 4UXIA 4LJRA 3JQDA 3PHHA 5LBUA 4G63A 3QLJA 1LXCA 1KTVA 3PQ6A 5HK8A 1X2EA 3LTEA 3KJXA 2LIVA 4JLNA 5EPOA 4QRHA 1GCAA 1H8ED 1BDMA 3CKKA 1DAOA 4G24A 1D6MA 4IUBS 5LZ8A 2V7WA 1UJCA 1G1AA 1WCWA 2CE7A 3G7UA 3PQ5A 4AJKA 1OXTA 1G8GA 1L7DA 4RANA 5FBZA 3WDKA 2O6HA 1E63A 3OZXA 4AL4A 2E3JA 2FZCA 2GLXA 1OZAA 2Z0MA 4L8FA 1F0YA 3I9MA 4QRDA 2YUIA 2CEKA 1DTWA 4H1UA 4XJVA 3TB4A 1XPRA 1IBKB 1QR2A 3PQ7A 4OVKA 5BN4A 1E1RA 1MB2A 3E4CA 4QUAA 2PXAA 3GLTA 1K7XB 4BMPB 4EJSB 3H65A 3QU2A 2YHBA 5CA0A 1EWYA 1FFXA 1T3GA 2Y05A 3WFIA 4E32A 5CK5A 1QPZA 3E70C 4WA7A 4EPWA 4JK3A 3BX1A 3W8FA 3CWQA 3S6JA 2XRZA 1NQXA 1YQDA 2FV8A 4J0KA 3K2IA 1VBKA 3TGLA 4RZ2A 1KI4A 3L3BA 5KYTA 4X85A 5BW8A 2L69A 5TMDA 5JCJD 3B6JA 1QX4A 1JMVA 8LDHA 4BGUA 5CLFA 4TT3A 3EQ2A 1NPDA 2Q27A 5CYFA 3UBMA 3H3XA 1E2DA 5AR1A 3DPSA 1P4RA 4GPTA 5KVQA 3ZK9A 4EG6A 1U8ZA 5BORA 2ORYA 1ZUHA 1Z5UA 4QOJA 3M6VA 1VG8A 4FTWA 5H80A 4YAUA 3LRXA 1XOIA 2BMFA 4BMOB 2RKWA 3TZBA 1FY2A 2PL3A 1A27A 2FZGA 2KYRA 2O8BB 2J3QA 3ETNA 1VJ0A 3I4LA 3Q2KA 4GO1A 1A77A 2HBZA 4R7TA 3NDPA 3RFUA 4F6RB 1FQKA 1M5RA 4LHWA 3PHIA 1ECCA 1Z4OA 1T6BY 1W46A 2B21A 1MRZA 3G7NA 3ZDZB 4BFTA 4OEHA 3LT1A 4BFCA 1MORA 5EPUA 1REQA 4DLPA 1TOAA 5BT8A 1SCIA 2WT4A 2OBNA 3P9CA 1L8XA 5KYWB 3QOWA 5CDFE 2CHVA 5DOVA 2LCFA 2YHAA 1SUIA 3AONB 4ZOEA 3RS0A 2W9XA 2JGKA 3L6BA 1V8OA 1XLTC 1LLFA 4R16A 2PUJA 5CB8A 1XDSA 1DSSG 1TMKA 4WLFA 3S1SA 3VBCA 3UW1A 2ECOA 1KJ9A 1TAHA 2HSJA 2YJ3A 3P45A 4B7AA 4BNVA 1WUKS 1EXDA 1G2OA 4M1WA 2DOKA 3SX4A 1WM1A 4FFPA 4OM8A 3PDWA 4CKCB 3DTVA 1VKZA 1OWLA 5JANA 1STOA 1A2BA 4ZAWA 1KAQA 2DECA 4MYUA 2PIAA 8ABPA 3HJRA 3K72B 2ZJ6A 4BNGA 2JHFA 3OC0A 4OHWA 4CTKA 4AY3A 4C2UA 1F51E 2C5HA 3ZY3A 1E0AA 5KJ6A 4DV3B 4G5XA 1NSTA 1WCIB 1L5NA 1EHCA 1FTSA 1OE0A 3DTTA 3JVUA 1GAQA 3OG9A 4M0FA 4BASA 4EGQA 4WW0A 1F7UA 1OGYA 4HTAA 2Z2IA 1T3LA 1UKEA 4L7VA 4TZ6A 2QW8A 1QAQA 3RT7A 2ZB3A 3VYUB 3DBLB 4BO3A 1RYDA 2BGLA 4IRUB 2H4XA 1E3SA 3PR1A 4RNCA 4XIJA 1JR3A 1DMSA 2RBKA 5J43A 4LXXA 4DSUA 3L6RA 4ER7A 1R27A 4QULA 4V3CA 4BJHB 1ZD9A 2IYNA 2BDUA 5ED4A 1YK1A 3K8OE 4Q3EA 2AHRA 1IVYA 4PLGA 4EDFA 1CJBA 3CZ5A 3N2NA 1B6TA 1CZRA 1N1GA 1XUOA 2A84A 2HPAA 3FXAA 4Q00A 4QFBA 4F92B 1KEWA 3LI2A 4IYJA 4F85A 1F8XA 5I8ZA 3N70A 1T9BA 3C24A 1JYSA 2VJAA 2ZDQA 3EMKA 3OMWA 4I1RA 4P4SB 3IOBA 1V1MB 2IHUA 3AR2A 4KWEA 2ONYA 3P2KA 1Z6QA 2R6CA 4KU4A 1GUYA 4MV4A 4BNJA 2IEYA 2H92A 2O8CB 1QJCA 1CR6A 3K0CA 1N2CA 4FZVA 3LD9A 4KPUB 2AXNA 3FR7A 3ROPA 3HR8A 3EJWA 1XFDA 4J0EA 4M38A 1ZOOA 1PR6A 1E3IA 2HJGA 4JJAA 1WPRA 1YQGA 1XTRA 4N0PA 5KQMA 3WTCA 5CVCA 2HA6A 1QFZA 1P7CA 1QU2A 1I14A 3JV7A 2BPOA 2VK1A 4YPOA 4JFRA 4FDTA 3C3PA 3F7NA 4LQCA 2C3UA 1AUQA 3IA7A 3Q2IA 4UBMA 2JEYA 3JPWA 1SKQA 2W93A 4AJNA 1UBUS 4F12A 1J0BA 1TJ3A 4EF5A 1G7TA 4BP9A 3OVMA 1TDJA 1B41A 3IV9A 1Z38A 5GGYA 4OJTA 1BS9A 1XZPA 3UC9A 2FY8A 2YV3A 4DUGD 3JQ8B 2Y4OA 2GZMA 5FT9A 2W6MA 1RWBA 3HA7A 4B46A 3MGBA 1CZOA 1QO7A 4LY0A 4H18A 3VVLA 1IXKA 3E9CA 5KOJB 4CEHA 3C5EA 1TZJA 2HA0A 1ZY2A 2DFNA 3BJMA 1KZ7B 3IUYA 3DOCA 1ZD2P 3NB0A 1G64A 3O91A 4QQNA 5DYGA 1ZL0A 1QGUB 2L82A 2TRSB 4IDGA 4QQKA 2WUDA 1QORA 3V48A 3WZLA 4URVR 1CKEA 2OBFA 4YRNA 4FKBA 4P58A 3HZHA 4GOND 3QX9A 1CEXA 4AG6A 2PYDA 4E5SA 1JIJA 5C46F 4XGQA 5HRAA 2QAGC 4CM1A 4JGIA 1AUVA 3DMRA 1H85A 2QD3A 4YMSA 4EW1A 2GPJA 3FG9A 3PKJA 2JLWA 1WW8A 4DDMA 3HU1A 4YN3A 1NWHA 4LF6B 3C41J 2DX7A 4LJ9A 1NDUA 3GUCA 3MELA 3KYDA 1Z0KA 4D6YA 2ZRMA 1H0KA 2CJPA 2VYCA 3E3AA 5DI3B 4KVGA 3SZRA 3DOUA 1NVMB 3G8BA 2A14A 1EK6A 1LEHA 4L76A 4XD7D 4GSKA 4DSNA 3QVUA 1Y3FE 3H1AA 3P0EA 2BLNA 2QAJA 4WZBB 5JNVA 2XLBA 3VR3A 1KBOA 2WSLA 4QAJA 4A6PA 1PI3A 2CHUA 3TJRA 2C83A 4DPMA 4EHDA 4ZOLA 3T3HA 4HLDA 1CQIB 5IF9A 1SUPA 2OOKA 1TMGE 3MXTA 1KO7A 3QOXA 4KJXA 2QW1A 1PNTA 4I66A 4LPKA 2R5NA 1YTLA 2BSQA 3TRIA 2Q7DA 4O2BA 1TGVA 1ODLA 2Z43A 3Q8MA 2A0WA 4FINA 4IWNA 5B57C 4DG5A 2VDLB 3BRQA 3IP8A 4AS3A 1GQFA 1LVHA 5ILQA 4ENSA 4O2AB 5IFLA 4UJ3A 4B8YA 1KJ8A 4HWTA 1G6Q1 4V1CA 2W11A 4C08A 1GOTA 1QZ3A 4C0LA 1XSEA 2HEIA 5FLXA 1CWUA 1YJCA 4RTOA 3H11A 3X1KA 3FZGA 3AYZB 5CGQB 4V38A 1PGNA 4AF8A 1EKXA 1DRWA 1M0TA 1NL3A 3GPBA 3QVJA 1TYEB 3KR9A 4NV1A 1Y3AA 4QSHA 1U65A 3EZ9A 3KQTA 1PJ8A 4URFA 5SICE 5C4IA 4P0QB 3MQ4A 5MHTA 1T4CA 4R1OA 3U19A 5EGSA 3U3RA 3SHVA 2R7LA 3OX1A 3AILA 3FVRA 3DDNA 4KXVA 5F4ZA 3EPJA 5IVKA 2P4QA 4CKXA 4IEFB 1JDJA 2G17A 4PZPA 1JG1A 2QX8A 4ZDIA 1E3DA 1RLUA 3FWPA 3CNLA 4MQFA 5KOIA 4QGGA 1GQYA 1XMJA 4MTCA 1WB5A 1VKHA 1KERA 2ENUA 4RCYA 4K2AA 5GAJA 4HQKA 4JKOA 1EYZA 1OJ7A 2IP1A 4Q9NA 4PRLA 2D2IA 2P7IA 2GRAA 4ZDJA 4NULA 5BR4A 2BAGA 3RU2A 1LLQA 2PV7A 3FSJX 3SSAA 3MWJA 2HLHA 4Q15A 5IVPA 2DBVO 2ZRCA 2QQEA 3Q0TA 3IQDB 2JLVA 3W6UA 2BJWA 1EWQA 3AZPA 4ZT7A 1E1NA 2VNSA 1ETHA 1JX6A 4WAUA 2FB9A 3CVXA 1UJ2A 5B7NA 1Z17A 3BS4A 1KSHA 5B64A 2VTDA 4KNWA 4QXPA 1HH4A 3SIPA 4HWRA 5FWXB 2FG6C 3NBXX 4J3NA 3SX2A 1OIWA 3H4IA 2O8FB 2Z2YA 1QC5A 4RESA 4KC0A 2A9VA 4WNCA 2VXCA 3OM1A 2WU8A 2GTPA 4P1ZA 2I6FA 3V4VB 3RF7A 5L3QB 1CUFA 3AI7A 3RYCB 4OK5A 1N9KA 2G4CA 2XMCA 3S8YA 4N0QA 1C8KA 4JBYA 5AKZA 4MQ4A 2OFPA 4XWGA 2Q07A 3JQGA 4RAOA 1RM5A 2XGSA 1JN0A 1CV2A 2R4TA 4CIDA 2YYYA 1W4ZA 4YGYA 5F3DA 1DHTA 2DVMA 4XVUA 4AP5A 2FMUA 2RH9B 3EDRA 4XJXA 4TKVA 1XYVA 1P2GA 1TLTA 4OGWA 3LSYA 3TW0A 2QTZA 4CKEB 3FTEA 3GFQA 3HN2A 3MGAA 4ESEA 1R9NA 3F9IA 4A91A 2CKDA 3OZDA 4MXDA 4MCHA 4BNHA 2WIAA 3L01A 1NRJB 2OCBA 3HFSA 5K6AA 4S2UA 1Z0UA 5CM8B 1XPOA 3FA2A 3K4HA 4RLQA 3RWMB 3M9WA 3TS1A 3ETJA 4NJOA 1IHYA 3PEEA 1XVTA 2DKOA 3GBSA 3PVSA 1FL9A 4R8LA 1CETA 5TQ2B 3QLEA 1QH1B 4GR5A 3S29A 3T7RA 2R2GA 3U4QB 2JI8A 1S8NA 1W0KA 1Z5WA 4G23A 1ULSA 4OXIA 5CXSA 3PIDA 3AHFA 3X1DA 4AZWA 3AVWA 1U1FA 1G4AE 4C6SA 1NUAA 2EJVA 2BONA 2O2SA 4E2ZA 4QRIA 5A5GA 2IU6A 2PWYA 3M7IA 1L5KA 1VE6A 1AMNA 2ZUDA 2FQ1A 1VIAA 1OLUA 5H81A 1X13A 4IS3A 4TWBA 4A36A 3Q3JB 1DAKA 3X2FA 1OBCA 4PAWA 2FRDC 2QENA 3EA5A 5F23A 4N5MA 4RPCA 4HK4A 1ZSVA 2C4NA 1VMEA 3LBIA 4TRNA 5TQJA 1K6XA 3RS4A 1XYYA 4IIEA 3ZIUA 1LX7A 3I04A 3KX2A 3M6XA 4HUQA 1SGWA 4OATA 1Q2UA 3AHCA 5JXIA 4R1SA 1NBOA 4RSMA 5IAGA 4D9FA 1PZMA 3UGKA 1EX1A 5HCIA 3EGIA 1GDDA 1U2RA 3KZCA 1Y9DA 5JSUA 3DH0A 4I6JA 1XZLA 3M1IA 1T29A 1VM6A 1AKUA 1ZPDA 1A76A 2LBPA 4IMJB 2RFLA 4CV2A 1ULZA 3AJ8A 5L3RA 4ZARA 3X1JA 1CCWA 1P0PA 2X42A 4TT8A 5KTKA 1R10A 4BOYA 4WFQA 1N92A 4DA6A 3EVGA 5LYJB 3ACBA 1ISSA 3D2AA 1WO8A 2XVMA 1A7AA 2HCJB 4E21A 4LWZA 3ELYA 1OH8A 1I8TA 3ECAA 4HX2A 4EVRA 3LCMA 2O52A 4KWCA 1XJ0A 2KHZA 2QVBA 2WG0A 1BSVA 3L7AA 1QRUA 3ICCA 1H6DA 3I4FA 3NXKA 3WSTA 1ML3A 4RH3A 4J03A 5AK0A 3VBEA 4BMNA 3AETB 1Z7EA 4ASUA 4KSBA 5FUYA 1F0KA 1OWNA 2R8RA 3PT9A 3WIBA 5I6DA 1PJCA 3O8QA 4HPJB 5AHWA 1DC4A 2VJKA 1LPSA 3H16A 3PITA 3QKSB 4J0DA 3QVSA 4CLRB 4D0LB 1NMYA 4ZXFA 1Y6JA 5A4DA 4JT4A 3I8SA 1SIWA 5LOVF 3BFJA 4G97A 5HNKA 1HM5A 2WTUA 3FB1A 4ONEA 4TKUB 4YV1A 3HCNA 2YWRA 2XVYA 2YCLA 3JAKA 1V9CA 3I9KA 3L2OB 1BE8A 1LQTA 1FXUA 2CMFA 2IODA 4PSAA 4JSTA 2V5VA 1N3YA 3LS2A 1PLLA 2FSGA 2AKAB 2DWUA 2HPHA 4J76A 4DV2B 3WBJA 3N76A 3OPXA 2I6GA 4B2LA 5LP1A 1GZ3A 4KIJA 1E4EB 1N2CE 3OE5A 1ADGA 3CY6A 4B71A 2ZJAA 4XVRA 3WRVA 3FLAA 2YVKA 4DIUA 1TA4A 4BLPA 4KR7A 1UMCB 3WDLA 1PSZA 1Z62A 2X5XA 3AEZA 2ONKA 4LX0A 5DSXA 1D0SA 1Z74A 1T1EA 4UVIA 5K0ZA 2F1OA 4QBKA 2IV2X 5B55A 1Y8CA 4R4JA 3WDSA 4FEEA 5ALZA 3MJFA 2B5OA 4M1KA 5BQ3A 5EXSA 5KTSA 2YWXA 3SZMA 2X5OA 3V7YA 5IM4F 1ZJWA 2F3PA 4J91A 1YB2A 3AOEC 3LLMA 4PU0A 1RWKA 1V1JA 2PMCA 4IILA 2NP7A 4CIBA 1NDQA 4B6JA 2A1UA 2ZE6A 4J4TA 1ZH2A 1UBLS 3BMQA 3MCAA 3ZWAA 3L1HA 2QVYX 4E2FA 1QO0D 4XCVA 3R76A 1KSGA 4ENTA 1PT7A 3P4YA 3V33A 1RHMA 2P9YA 2Y1OA 3GA7A 4R3NA 5FXMA 4ZVUA 3VU0A 3HJFA 3QVOA 1A4IA 2H2WA 2EBUA 4I99A 1PDOA 1F9EA 4UDNA 2IUUA 2CBGA 2VDUE 4DMFA 3Q6NA 1M8KA 4K9SA 1Z9BA 2XYPA 1XZ8A 2AOTB 2RHJA 3AUKA 4WVFA 2CV1A 3QE2A 4NONA 1P18A 2IEGA 3R8FA 4BNZA 2NM0A 2Q3JA 2REXB 3K8QA 4LZWA 1L4FA 4GOOD 3W2EA 5T7BA 4EI9A 5A7FA 4YP1A 1ZM2A 2XRFA 4XZ3A 3E2PA 4MULA 1CLEA 4E7OA 3HCWA 1QH1A 1CQJA 1U1IA 4C4SA 3K6SB 1ABEA 2DFLA 2I4RA 2ZPAA 3HRKA 1DO8A 4KQKA 4E6EA 3C5HA 1RWVA 1YJXA 3I2JA 3W4IA 3M5PA 4DBLE 1L8LA 1EU1A 4HB2A 4TV8B 5D01A 2OCAA 2YQ4A 2JAHA 1CE8B 3QV2A 1L3CA 1JU9A 3W3ZB 5LQCA 3DAPA 3EWNA 3MWDB 3B78A 3BPSA 3NH6A 4U5XA 1H93A 1XX6A 3A25A 2Q21A 1TCCA 2R79A 1E3WA 1F0PA 3L1JA 2CVPA 1GVNB 4INAA 1V45E 2AI2A 3PHLA 1MT3A 4MA5A 4PRZA 1LDEA 3EDMA 1QX3A 3CRNA 3GQVA 4WCFC 3SAJA 3ZBPA 5EWMA 5K8IA 2AE2A 1H0RA 1HWYA 2CFTA 1QKJA 3F4LA 3FX2A 4P0PB 1SOUA 3Q87B 3D02A 2X22A 4YUZA 2Q1UA 1NJ8A 4X7MA 2KPOA 5DM2A 3WLOA 4BCDA 2GM9A 1K8YB 2KWIA 4N54A 3EISA 4AJ9A 2CFIA 3DGFC 1KO1A 2PT5A 3EIQA 3G5UA 4QTYA 4QLOA 5KX5F 2C59A 1V6AA 4BO6A 4AUNA 3EX7C 3SDBA 1H3FA 2R8YA 3URMA 4NIMA 1SA0B 2QZ4A 4FWBA 2C4HA 5E3JA 5SZKB 1C1DB 1J25A 4BB9A 4MVJI 3WGKA 3WRWA 4EY4A 4JH0A 1K6MA 1K92A 1RKUA 5WRFA 4AIRA 3KPWA 5LBIA 2FWNA 2CEAA 2GXQA 1YBFA 2QMQA 3OT1B 1H1LB 2Y1CA 4HAOA 3MERA 3NHLA 3TCXB 3L49A 1XK7A 4A0HA 1CUCA 4O1MA 3SN6A 1BD4A 4DR7B 4XUDA 4EATA 1PDWA 3TIIA 2OCDA 3FNHA 4BGEA 4EARA 3ICEA 3U1TA 5DFAA 1EUCB 3VSAA 4DCPA 3COSA 4N6NA 4TQ9A 1UP6A 1E2EA 4PN3A 4YRAA 4QYWA 1ECGA 2Q8QA 3HKBB 4DXAA 2IUEA 3RSCA 2Z04A 2IDZA 3UT6A 3D7SA 4V0ME 1VCHA 2XQVA 3G2MA 4BLTA 4BWYA 3J81k 1X1TA 1Z5ZA 3IEIA 3K2QA 3K20A 4JP1A 4CV3A 3UHAA 4G85A 3IAAA 1NM5C 2PGDA 1C3JA 4FOPA 4J0FA 1N0WA 2IITA 3KUCA 4J4BA 3RVBA 1NYTA 1KFCB 1E4EA 1OFGA 2FUG6 5CW2A 3SXUB 2V59A 4NMWA 3DEYX 4P83A 2BMJA 4X41A 1XZAA 3HWWA 1S8FA 3ICPA 2R96A 2ZT6A 2GX6A 3M6FA 2LP4Y 1QCDA 4PBRA 3T4XA 1MJGM 1XRLA 4GFDA 2OHOA 3HZOA 4MLDA 3FTPA 2A5LA 3STYA 4MGYR 5JJLA 3UXMA 1CY4A 2GCOB 2QP3A 3C5CA 4MH0R 1BW9B 2IW3A 4UM7A 2O7NA 1SG6A 2PSSA 5FAXA 1W76A 2VP5A 3VPCA 4UBIA 5JRDS 2YMLA 4JNKA 1H6BA 3DO6A 4P3NA 4YJ3F 3TTTA 5CA1F 4Y2RA 4LJSA 1UAAA 3JQFC 1GQSA 3AFGA 4AMGA 4CF6A 4L16A 1PQUA 4PGMA 4JOQA 4LFAB 3GIDA 1KS2A 3NHWA 3W4KA 1N1MA 3KPYA 3DOEA 3NRBA 5MGNA 1X1SA 3EY4A 5B2FA 4AXBA 5CFRA 4D0SA 2NMVA 3QBEA 2FZEA 1EDEA 4JB0A 2P8SA 3KETA 3VTZA 2IU3A 2OZLA 1HV8A 2YRFA 4IWXA 3A7DA 1U98A 1YIAA 2HRZA 4FCTA 4PS0A 5ADUS 1XGKA 2XB6A 3PC8C 5DWQA 5BN5B 4PZYA 4HWOA 4PZZA 4PY2A 2V8BA 4QUHA 2OMKA 2YNMA 4UCQA 3DKRA 1CT9A 1XV5A 3BGIA 3SSMA 1I2ZA 4KE7A 3DVAA 5EIXA 4GZ5A 4CT5A 5IWCA 5DM1A 3ZVMA 1XZGA 4CQLB 2IOYA 5EPEA 4XGRA 3ZQKA 3NT5A 1TTQB 3Q1LA 3UAXA 1HT3A 3A3NA 1UWKA 2ZRGA 2I2BA 3PHJA 1KZHA 2B61A 3CUYA 5L3SA 1HNXB 2RHWA 4HNRA 2JVJA 3PDHA 4DIBA 3DVLA 1RNLA 3DMGA 2R6DA 3O3CA 3G02A 1WEHA 4YRPA 5DHSA 1NU8A 3WNZA 3TZ6A 3ZXYA 1SKYE 1XO1A 3LFTA 3OCZA 4QHYA 4EG7A 3O9ZA 2MU1A 3L1UA 1UFKA 3GVCA 4NCHA 4AM8A 4WNAA 3A27A 1OLUB 4TGLA 4BDSA 3H8VA 3Q6MA 5GJVC 2QN1A 1EXVA 1FW6A 4Q03A 4XAQA 4OGGA 4AI6A 2R44A 1W9HA 3M1YA 4YJFB 4BP8A 5GADl 4QX6A 2G1UA 4HVLA 5B3KA 1RHRA 1XEXA 4K1LA 3G0GA 2XYRA 4PSVA 4BU0A 2B30A 4KR3A 4RWEA 1JIQA 2JEZA 4UU8A 1CY0A 5EA2A 2C9YA 4LPSA 3OKFA 3BEOA 4LXYA 4YV7A 2PVPA 2MSDB 4IL5A 2GD0A 1KK3A 1KSFX 2CXPA 3LPDA 3OUUA 4Q01A 1JQBA 1Z6YA 2MWMA 4C7OA 1SVIA 1SXJD 5E7QA 5EFZA 5G0UA 2XGMA 2NU9B 1RWMA 3LHFA 1E1DA 4W1QA 5IJWA 1FPQA 2P3QA 1VZ3A 2A0UA 1XXHA 2O0MA 3CLRD 1B7GO 4FGJA 1RAEA 2V03A 4HNAB 5EMHA 1PK8A 4DLYA 5K7SA 1AXEA 1J8VA 2VUHB 2BJVA 3M4JA 4QO8A 3N8HA 4I4LA 4QWWA 4B3CA 5FWAA 1KMMA 1ODIA 3WSWA 5AJVB 5TGZA 3UHFA 1H1DA 4KACA 2BW0A 1FQJA 3RRMA 1HNWB 4KQHA 4CLHA 4UTVA 4M21A 2MINB 5C80A 1LY1A 4IQ0A 2G5CA 5BP7A 3IDOA 4BVLA 3JYOA 1EUDB 4NECA 4MI6A 3HV2A 2Q1TA 1C0PA 1G20E 3LA8A 4AJPA 2JIBA 1YS9A 4MK4A 2I7XA 2I1WA 2W6PA 2R9VA 5HZMA 1LNQA 2BISA 3ORYA 4R1QA 9LDBA 4N48A 5EC8A 2ZFUA 2ALJA 5C7YA 3UJNA 2XA2A 5B3JC 5EESA 1TTHA 4IIDA 4F3NA 2A4MA 2I8CA 1QHEA 1JLKA 3KWLA 3OPYA 3JD4A 4JEIA 2NSJA 2QP9X 4HNVA 1K8ZB 1QV9A 1KDZA 2X6QA 3R5FA 3O82A 4NBUA 3OY7A 4YCDA 4A23A 1TO2E 3DJFA 3T3PB 3D0OA 2LDBA 3MJRA 5J58A 1H4QA 3VZQA 2JLBA 4M0DA 2WF8A 4KQFA 1Z15A 3I6MA 4H6PA 4U0JA 4YK7A 3BDIA 1E2NA 2OXFA 4YP9A 4DTIA 3WYEA 4WUVA 3K5PA 1V1RB 2BDTA 2WHQA 4I8DA 2O3JA 1RKQA 1HQKA 4KV9A 4FI3C 3B9PA 3Q88A 5ALXA 4B4OA 1SH7A 4KVAA 4TWRA 4P8RA 3WMXA 1U7ZA 4RKYA 5FBRB 3BB4A 3CF4A 1UZNA 2NQTA 2VBFA 4K6GA 4NCAA 5AW8A 3A31A 5D5QA 3U7GA 3EODA 3FYSA 1E1LA 1VGQA 1YZFA 2H0RA 2FP4B 1C7FA 2CVZA 1E9EA 1T2AA 4LISA 5BSMA 1XZFA 1SUEA 3PUZA 2OVBA 5KVSA 3K4PA 4P4NA 2ZJ7A 3GU3A 3TQCA 3B2QA 1OXSC 3GEEA 1CF9A 1L7NA 1ZD3A 2NLOA 2YFQA 4M49A 4XH9B 3I73A 1PJAA 2HMWA 3T7TA 2WJZB 3HDYA 4KRGA 1E9DA 3BXFA 1GV0A 3D6NB 3EGDA 3KJEA 3MD0A 5CIWA 1QKKA 3TIGA 4Z4FA 4UVDA 4PTLA 4F72A 3A1WA 4QU0A 1J8YF 4TSKA 2FPIA 4QASA 3WHPA 2VA9A 1X7WA 4WFJA 2UUCB 5JO9A 5PGMA 3UK6A 5I47A 4GMGA 1HKHA 3VKUA 3LV8A 1JILA 4BRSA 2DLCX 1J0EA 2J3IA 3QE4A 4CUZA 1BMFA 5BVHA 1TO1E 1V71A 4MUEA 2AEMA 3SHQA 4LF4B 2ZBEA 1LZLA 3KYJB 4UUOA 4BMSA 4MPTA 4Z0TA 1IJFA 3VI3B 1XCOA 1IUOA 3KT6A 4ME6A 4OQMA 4Y1GA 1T1RA 4PYNA 4L8VA 3NOVA 3VSEA 4ETNA 5KU7A 4KAFA 4RJ2A 3SMQA 5FUVA 4MNTA 2VPTA 3PPXA 4YRIA 1N6PA 1U0FA 1V47A 1RYYA 2I5PO 3JD2A 4C6TA 1EP1B 2H9IA 2M6SA 3WGQA 2JLQA 3GGJA 4JT2A 3NIWA 4WEQA 4IBOA 3P2JA 1E6MA 2GHTA 3NHUA 3PFWO 3CF4G 3PIRA 5EHNA 1KKUA 3ZGNA 4BNYA 5BXQC 3MTAA 3PLRA 4XGNA 5BVGB 1W4RA 2CGEA 4O2AF 4B0PA 3UZUA 1R66A 3VPFA 2FN3A 1JLHA 4UHEA 2J1LA 1AX9A 4IIHA 1KYIA 2CNNA 2SICE 1ZM7A 3F74A 3AHIA 3DWIA 3GLHE 3Q7QA 4RQBA 5LXTA 3RT1A 4KLRA 1XMOB 2QVXX 2GN1A 8OHMA 2VDMB 2J45A 3IJEB 4UCWA 4EY5A 2ZTLA 2YXLA 3L18A 5B6IA 1C1HA 1C9KA 4LF9B 4U2FA 3CNEA 2W90A 3LGAA 3OZAA 3RNOA 4M1ZA 2QRPA 4RKFA 3ZZNA 4UM9B 1WLYA 3DHEA 4K3UA 2WEKA 5ADHA 1QK5A 3MINA 4MI9A 1JPUA 1RJ9A 1XVUA 2O1XA 4AB1A 5GVRA 3H5NA 5JQGA 3AY3A 3TJMA 2ZS7A 3RIHA 2B34A 2AG6A 3NM4A 1FYDA 2DCMA 4MVJE 4BRUA 3VR0A 3DFUA 2DFDA 4P3PA 3ZEIA 2VHZA 2ETVA 3A1CA 2PX8A 2EFYA 5BR7A 2C7QA 3H4TA 2FEOA 2WV9A 3K2BA 4RVGA 3I2KA 1P3JA 3C2QA 2I4LA 1Z0DA 3L7MA 1WB9A 1P44A 3IFSA 1Y7HA 2QTHA 3BOSA 2WFLB 2DE0X 3G1WA 3PXDA 3BCRA 4CM6A 5CDTA 3K09C 5LUAA 3TVTA 3HWRA 4RELA 3JQ6A 3ZNPA 1RJEA 3CU5A 3ZWOA 3BD9A 3M34A 4ENPA 2HYIC 1YBMA 3GZ4A 3MQFA 3F5MA 3G68A 1S8AA 1FNMA 1GUZA 3VFDA 4BLOA 2IHVA 3ECCA 1SVMA 3LHSA 3TLYA 1FU8A 3CLUC 5DMHA 4Y0AA 1YC2A 3RVJA 4M83A 4MP8A 4EB0A 1JXMA 4WKNA 2R86A 1ZRHA 3CEJA 2Q0QA 1A5BB 3HCAA 2GD1O 5EN4A 3WYAA 5C8DA 1MA0A 5JSQA 3B2EA 2D8AA 2WA1A 4HH0A 1KQ3A 3KVVA 4ZYVA 2AJTA 4QDZA 3MCTA 4I3HA 1J22A 2PMBA 3MAGA 2D3WA 3BB1A 3GRCA 4CQNA 1EH5A 3L0IB 4F56A 3LX8A 3ZDBA 1JW9B 2DPMA 1TUEA 5C37A 4LF5B 2VTKA 2BBSA 4J90A 4L27A 5CURA 4ZEWA 3C6MA 3CJQA 3CRRA 1HZZC 3QOFA 3EXAA 2FFJA 1O95C 3GJTA 5J2UB 4LRXA 3VPSA 4EG8A 2PH1A 2ZP1A 2W4MA 2OENG 3H84A 4AG3A 4JNCA 2Q6KA 3PX2A 4NQZA 3A6EA 4PC3A 2ZWAA 3KEQA 2GKGA 3M4ZA 2VYVD 5AKIA 5NLLA 5HHTA 2E0IA 2YV1A 1EUCA 4NMXB 4U6QA 1HTBA 3U0BA 1ZNWA 4YA6A 3ZOKA 2QK4A 5IHPA 3T9BA 2AJCA 3MHPA 3DEJA 3SJ7A 5LP6A 3QUCA 2M6KA 4AQDA 3F73A 1N78A 2ZYAA 2YWBA 4UHJA 2QV0A 5CA1A 3DKVA 4KXQA 1EVYA 1N6IA 3HNRA 3TDKA 3SVLA 4HD8A 1IU9A 5EZYB 5KNDA 3AVTA 2XUAA 4KHZA 1QXSA 4KQIA 1UK7A 1P7PA 2GYVA 1M7HA 2I4NA 4G0OA 1ZN8A 2FPMA 3P52A 1VMKA 2H3HA 2XTAA 2WKQA 1JHRA 2MT9A 4JKYA 3W5JA 5BMVF 4RD4A 4DVJA 1W6RA 7MHTA 3L77A 1XEAA 2UUOA 3KALA 3N3BC 1NR1A 4E12A 1UOOA 4KGVA 4YRCA 1R4MB 4DLNA 1RQ2A 4MWOA 2PX0A 4X90A 2YCBA 1AGPA 2J3JA 1XQYA 3FVQA 3VJRA 2GN2A 3P0RA 3A58B 3H0EA 4GEGA 1B93A 3KR1A 4JAVC 3GOHA 4OHFA 2FWPA 4CKYA 1ZVMA 3EIUA 3QU5A 1MAHA 3NVAA 1FYXA 4L51A 3K9WA 3IT0A 5HKAA 1Y7IA 1Z8HA 1DQSA 2KLBA 2ST1A 4I4IA 4W5HA 4RVSA 3T9FA 3R23A 3WBFA 5CIYA 2CXQA 1TYZA 1P4GA 3KQMA 3R0QA 5DRYA 3B70A 3NM5A 3OJEA 4RGVA 4HEJA 3C8DA 3VR2A 4GBJA 4CEJA 3PZBA 3NM6B 3QUSA 1PWXA 1LBHA 3E81A 3EEBA 3F97A 4JBGA 4N7BA 3T52A 1NN0A 1IWPB 5HVNA 1GPDG 3WLJA 3B9RA 5IVHA 3QY0A 3K6SA 1HDEA 3P4UA 4HDMB 3S2IA 3CB2A 5TQ0B 1CFZA 2XE7A 3L8DA 1J6UA 1XPUA 5BW5A 2C4KA 4YHHB 3UIEA 4Q7JB 4F3CA 2X0NA 4ZFNA 1F3OA 1U2SA 4JIGA 3QF4B 2R6JA 3O7WA 4EL5A 3PEWA 1ZOIA 5EJIA 1NMZA 3H5TA 1YKSA 4KLAA 3RJ5A 1COZA 5AW0A 4J29A 5L6MB 2J0UB 2V7QA 1CQPA 3CVJA 2Y8EA 3GRUA 3OBBA 4GEKA 4UMVA 3ZK7A 2B4RO 2EKPA 4B2IA 5A5DA 1TQ2A 3OETA 4MTLA 5DOZA 1G18A 1Y5MA 1EVZA 1WA5A 2BTOA 4I08A 3V7WA 4D8WA 2GQ0A 4L72A 5A3VA 2YX1A 1LH0A 4DY4A 5AVVA 5C53B 2GK6A 2RSLA 1WUTA 4M1TA 3FF4A 4OQEA 4CDMA 4UW9A 2HB6A 2VQ6A 3D6UA 3HRIA 3MTGA 4FB4A 3OFKA 1VMIA 3TOVA 3FJYA 5BWLA 2VG8A 2J5KA 5JBIA 1YMVA 4CF7A 1CRQA 3CQ9A 1VE5A 2AQHA 4CEIA 2CYCA 1XTJA 2OCLA 4BFLA 2KLHA 2HA5A 3C8HA 2UDPA 1OZGA 4OX9Y 3F6RA 4LECA 5KTMA 1UMBB 2D1RA 2E7ZA 1AS3A 5AI6A 2XITA 4X91A 3I12A 5CMLA 3WMGA 1EK5A 1EVEA 1V1RA 2QTRA 1Q1BA 2RIPA 4MGKR 4NY1A 4G5HA 4I1VA 1FFHA 2Q9BA 3OC6A 1H4SA 5LB4A 3K6RA 4B6OA 2H2DA 2LW7A 2PHZA 4EQ6B 2XAUA 4JYAB 1EFPA 2EX1A 1NE7A 1XZBA 1GQRA 3GVHA 2C9MA 4I19A 1ABBA 1UDAA 2R6R1 5DIZA 5FADA 3VSCA 3W2FA 4RXTA 1PQWA 8GPBA 1O1YA 2FN4A 2OHIA 2HQ1A 2I2FA 3ONFA 2H3EA 5PNTA 3BFKA 4EVQA 2PGXA 2RDMA 2ZYVX 3G23A 2W22A 3NFYA 1O89A 1YQ9A 2QRNA 4Q1FA 3BL5A 5A5EA 1Q0TA 2PAAA 2D5BA 4REQB 1LSSA 5IC6A 3ZD9A 1KQPA 4BJ5A 3C6BA 3NBUA 3JWGA 3B3QA 3UHJA 4R8MA 2C8VA 4AX8A 4AAYA 2Q0HA 2CXNA 2Q9CA 1GZHB 3B8HA 3DR5A 3EIFA 3GT4A 3OE4A 4URUR 3I42A 4G89A 3VTKA 4RTMA 4D8TA 3DEFA 2AUTA 3Q11A 5CNJA 5A04A 1CUYA 2BEJA 3IAS1 1YJAA 1BVRA 2B2CA 3IMKA 4RMIA 3V1NA 1D3AA 3V46A 4CCSA 2JZOA 3IEVA 1XD9A 3ZU2A 3UOWA 3TXAA 4U2DA 4GOKA 5IFKA 1U0BB 3GAFA 1B0PA 1QVRA 3N07A 3UA4A 3HM2A 4QBFA 2JLZA 3G5AA 4R98A 3ZWDA 3L1KA 3L6UA 3WKEA 2HBYA 5IH3A 3UGTA 3P71T 3WMFA 1IJBA 1Y42X 4WZZA 3IVRA 3PICA 1M0WA 5U4XA 2J0SA 2W6CX 2NXEA 3DBHB 1SG9A 1OTYA 3MSXA 1EDDA 1T6YA 1HDIA 3I9FA 3RAGA 4OQ4A 3ETHA 2P79A 2DP4E 2RHBA 4OHKA 5M29A 1KFEB 1VJDA 3EE6A 3FOBA 4HKTA 3EIEA 4JA0A 3M81A 3IELA 1NW5A 2VRNA 3E8SA 3U3OA 3KB6A 4HBZA 1SHUX 3QH4A 1LLCA 3WMRA 4BX2A 1AY0A 3GNLA 2X5NA 1L8QA 4JJ7A 4P38A 1PV4A 1A1VA 1KR5A 3SE0A 1N6HA 3RBZA 1CUHA 4NBRA 4BCBA 3DM5A 4XEUA 5FNZA 2JGAA 5D7NA 4P98A 4PZAA 2Q5EA 2VO1A 3S1LA 5FV4A 1GL9B 1M34A 1RP1A 1T8UA 3S70A 3TEJA 3W6OA 2HSDA 1SXQA 1H9AA 4HUJA 4AN1A 2FDCA 4A8JA 3C14C 2WLSA 4WXPA 2QTGA 1SOWA 1P1JA 1C0EA 3TKLA 2EYUA 1U63A 1TAUA 2PA0A 4E2WA 2GA9A 1NATA 3DP7A 1UDWA 3K94A 2UZ1A 1XZNA 2VF2A 1XWWA 4IXDA 4X1IB 4HGPA 1CIVA 2CNWA 2QJOA 5HFJA 3AGPA 4WGGA 3WBKA 5IPFA 3RJZA 3KOWA 3DXYA 4LVOA 5L3SB 4Z3OA 1A8HA 2VPZA 4H3SA 1MABA 1RU3A 2R7MA 3P0IA 5H16A 2JBWA 1JFFA 1FVHA 4FGZA 3WWEA 5BWCA 4ZZ3A 1KA9H 4U8GA 3WB9A 5G02A 1ICIA 1KPGA 1U7TA 3I92A 1MDBA 2W6JA 2ZRIA 3QBTA 3TLMA 4EYGA 1K4MA 1MGPA 2WYOA 2Z57A 4QAQA 1UBKS 2XMPA 1DO2A 3KLMX 1A4UA 1NTOA 2IUTA 4CCYB 3HU3A 1UMCA