3BMBA

Crystal structure of a new rna polymerase interacting protein
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
135
Chain Sequence
SRPTIIINDLDAERIDILLEQPAYAGLPIADALNAELDRAQMCSPEEMPHDVVTMNSRVKFRNLSDGEVRVRTLVYPAKMTDSNTQLSVMAPVGAALLGLRVGDSIHWELPGGVATHLEVLELEYQPEAAGDYLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Escherichia coli Rnk, a new RNA polymerase-interacting protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Rna binding protein
molecule keywords Regulator of nucleoside diphosphate kinase
total genus 36
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01272 GreA_GreB Transcription elongation factor, GreA/GreB, C-term
A PF14760 Rnk_N Rnk N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.286.20 Mainly Alpha Orthogonal Bundle GTP Cyclohydrolase I; Chain A, domain 1 GTP Cyclohydrolase I; Chain A, domain 1 3bmbA01
3.10.50.30 Alpha Beta Roll Chitinase A; domain 3 Transcription elongation factor, GreA/GreB, C-terminal domain 3bmbA02
3GU0A 4Q7JA 1TFEA 1AIPC 2F23A 2PN0A 1GRJA 3GTYX 2ETNA 3BMBA 2P4VA 2EULA 1EFUB
chains in the Genus database with same CATH superfamily
3WD1A 4P8VA 2XP4A 2PPOA 1W9VA 3KZ7A 1ITXA 3KAHA 3RM9A 3CHCA 3FAPA 4MTVA 2LJ4A 1N3SA 4DRBJ 5HT1A 1A8RA 3G6LA 2LGOA 4DRPA 4JYSA 1NWUA 4ZPTR 3GPKA 3O5FA 1ZK6A 4ODNA 1NSGA 1IS7A 2F4EA 4UDMA 4MNLA 1HKMA 2VCDA 1E6NA 1JNEA 1NH6A 4WKFA 3KADA 3WD0A 1FD9A 1Q6IA 2EULA 1NWRA 4MAVA 5B8IC 5I98A 1FKBA 4Q7NA 3ARYA 1N3RA 3AS2A 3PA7A 2A3EA 3OOBA 3TCZA 1E6PA 2MLXA 1LL6A 3NRKA 3LW5K 4W5UA 2KE0A 3AS1A 1YATA 1JVWA 1W9UA 1FKRA 1W1TA 1NMVA 4DRIA 4ZS6A 2FDMA 4DIPA 5J6EA 1HJWA 1W1VA 1OGGA 4TX0A 2MF9A 1KT0A 2G8ZA 3O5OA 1W26A 4XAKA 5HBFA 2DPEA 1EYMA 1SYTA 2B31A 1LQ0A 3WQWA 2ESCA 3BMBA 2LPVA 3KAIA 3CHDA 5DITA 4QPMA 2ZQUA 1HKKA 2KR1A 3LUOA 4LGXA 4DRHA 3FY1A 4R5EA 2O01G 4WK9A 2KO7A 1SR0A 1HJXA 1AIPC 2F23A 2PN0A 3ARUA 1E9LA 3IKGA 4TW6A 3FXYA 5DMZA 1RD6A 2O9OA 2DT1A 2ZR6A 1C9HA 3WIJA 2P11A 4JFIA 5D75A 4DWSA 2RUDA 1U79A 3PRAA 2WK2A 5JH8A 1FFRA 4MNMA 5HKGA 1P5QA 4TW7A 1D7JA 4DRQA 3B8SA 1E6ZA 1KFWA 3AROA 1KT1A 4ODRA 2DSUA 4WKAA 1UR8A 1N3TA 3CGMA 1EHNA 2JZVA 4KQZA 1LL7A 1GRJA 4IPXA 3WL1A 1LG2A 3CGNA 2LNZA 4MNKA 1H0GA 1X6LA 1TFVA 2ETNA 2ITKA 2VN1A 2WSEG 1ZL1A 1HKJA 1QPFA 2Q5AA 4NZCA 2A3CA 3EY6A 4WJXA 3H9RB 3GU0A 4HBOA 3IKDA 3O5KA 4KR0B 4G2PA 1HJVA 3VAWA 1A9CA 3JYJA 1W1PA 1EIBA 5GQBA 2WSFG 2M2AA 3NI6A 4DRJA 1LG1A 4DT4A 2IUZA 5HWBA 4Z2HA 3EIPA 4S3KA 2F2DA 4P8WA 2PBCA 2XP8A 2WM0A 3O5EA 1VF8A 3PRDA 4DWSB 1NMWA 4DWSD 2XPBA 1ROUA 4W9QA 1D7IA 4NSBA 1ZCNA 2DT2A 1J6YA 4Z2JA 1WURA 5DIUA 5DO2A 1YW5A 3WD3A 4ODPA 3B0BC 1O6IA 3B7XA 1FKGA 3AQUA 3ARTA 1GPFA 4NNRA 3UI4A 2MPHA 4FAPA 4MGVA 2DSZA 4L3NA 2FAPA 3UQBA 1J4IA 2RUQA 3VEJA 4U85A 5HUAA 3B9DA 2KFWA 5BXJA 1F8AB 1FFQA 4DROA 1BL4A 2DT0A 4TYOA 2PPPA 2G41A 2PI6A 3JYMA 1FKKA 4PTMA 3RFWA 1NWTA 3LW5G 3ARSA 4LAXA 4S3JA 1JNDA 1T11A 3O5MA 2PV1A 3AS3A 1W9PA 3UQIA 1HXVA 4Q22A 2XP3A 2WLZA 1WB0A 4ODLA 1FKJA 4L72B 4IQCA 3WH0A 3B9EA 2XP6A 1D7HA 4JFMA 1JNSA 2WSCK 2M08A 2OFNA 4GIVA 5HW6A 1GUVA 2QF8A 1FKLA 4U86A 1A7XA 4JFLA 1FBXA 4DU6A 1ZBWA 5HTGA 2DG9A 4G50A 4DH0A 1E6RA 2ZQSA 4C02B 3UI5A 5GPGA 1QZ2A 4HARA 4ODQA 3ARXA 4QT3A 3UI6A 4U84A 4W9PA 3O5DA 3B9AA 3ARPA 2DSVA 2D9FA 1R9HA 1QPLA 2ZQVA 3ARZA 1D6OA 1FJDA 1FAPA 5GPRA 4ODOA 2O92A 3NTPA 1FKIA 2MLZA 2WSFK 3W4RA 4QZVB 3CZ8A 1EFUB 4Z2LA 4LAYA 4ODMA 2RUCA 3CH9A 4NE3B 2UZ5A 4TW8A 1WPLA 3CHEA 1LL4A 3TC5A 2KI3A 1ZB5A 4E44B 2XPAA 5HW7A 2PPNA 3IK8A 1XRVA 1TFEA 1CTNA 2WLYA 2K8IA 4GGQA 3ARRA 1J4HA 1N1AA 2DSWA 1IX5A 3O5RA 2ZR5A 1UR9A 2AWGA 2YBTA 1FKFA 3I6CA 3O5QA 4JA3A 4ITZA 3WD4A 3GTYX 2P4VA 2Y78A 1L1PA 2F21A 1E15A 2A3BA 2YBUA 2N87A 4N19A 2MNTA 4Z2GA 4JFJA 2XP9A 4ML4A 3BXWA 3WD2A 3RM8A 3WL0A 5HWCA 4FN2A 3KCEA 3O5IA 5DF0A 1EDQA 1LJYA 3IHZA 3ARQA 1OGBA 3CHFA 1F40A 3RGCA 4P8UA 4DRNA 4IT6A 1WNOA 1JCHB 2M1IA 4ZPWR 1EQ3A 3KAFA 2RQSA 5DIVA 1FB1A 3RM4A 1K9TA 4HBEA 3UQAA 1PINA 2LKNA 2L2SA 1WUQA 4W9OA 1PBKA 1FKTA 2KR7A 2DG3A 2KGJA 2WSCG 2AOSA 2B5UB 2XP7A 3KACA 1WM9A 1W1YA 3WKZA 4NE5B 2FKEA 3UF8A 2DT3A 4DWSC 1E44A 1GTPA 2PV3A 3MDYB 3TDBA 4R8QA 4DRAE 4BF8A 1FKHA 1NWSA 3ARWA 3O5LA 4JFKA 3ALFA 1ROTA 3G6MA 3RMEA 1HKIA 4O2TA 4WIWA 3JXVA 1EL6A 1Q6UA 1X6NA 4LAWA 4QIBA 2IF4A 1Q1CA 4AY1A 2ZR4A 4LAVA 1H0IA 3OA5A 5DEZA 1IS8A 4E45B 4IT4A 4NE6B 4MPKA 4P8XA 1Q6HA 1ZU8A 3ALGA 4J4NA 1B6CA 3PRBA 3O5GA 4DZ2A 1ZBVA 2OLHA 2MLYA 4MSPA 3ARVA 2LO0A 3O5PA 1D2KA 1Y0OA 5HW8A 4DRMA 3KAGA 2A3AA 1M5YA 4ODKA 4MNJA 1GOIA 3O5JA 1ZBCA 2XP5A 1BKFA 1ZBKA 2DG4A 1JNTA 1WAWA 4Z2IA 4QT2A 1FKSA 4ZPVR 4Q7JA 2PV2A 4IQ2A 3AS0A 1XHGA 4Z2KA 3KABA 4DRKA 1FKDA 4URIA 4TNSA 3WQVA 2ZQTA 3PR9A 1OWQA 3ODKA 1TCOC 2WSEK 3QOKA 4DZ3A 2RSEA 4R0XA 2RURA 1J4RA 4WKHA 4J4OA
chains in the Genus database with same CATH topology
1FB1A 4Q7JA 1EL6A 4E44B 3VEJA 2EULA 2LO0A 1WUQA 3GU0A 1TFEA 1AIPC 2F23A 1N3SA 2PN0A 4DRBJ 1N3RA 1A8RA 1N3TA 1A9CA 1IS8A 5DMZA 1FBXA 1WURA 4DU6A 1WM9A 4NE6B 4E45B 4NE5B 1GRJA 3B0BC 3BMBA 2P11A 1GTPA 1EFUB 2LNZA 1IS7A 4R8QA 4JA3A 4DRAE 4QPMA 3GTYX 4NE3B 2ETNA 2P4VA 2KR1A 1WPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GU0 A;  4Q7J A;  1TFE A;  1AIP C;  2F23 A;  2PN0 A;  1GRJ A;  3GTY X;  2ETN A;  3BMB A;  2P4V A;  2EUL A;  1EFU B; 
#chains in the Genus database with same CATH topology
 3WD1 A;  4P8V A;  2XP4 A;  2PPO A;  1W9V A;  3KZ7 A;  1ITX A;  3KAH A;  3RM9 A;  3CHC A;  3FAP A;  4MTV A;  2LJ4 A;  1N3S A;  4DRB J;  5HT1 A;  1A8R A;  3G6L A;  2LGO A;  4DRP A;  4JYS A;  1NWU A;  4ZPT R;  3GPK A;  3O5F A;  1ZK6 A;  4ODN A;  1NSG A;  1IS7 A;  2F4E A;  4UDM A;  4MNL A;  1HKM A;  2VCD A;  1E6N A;  1JNE A;  1NH6 A;  4WKF A;  3KAD A;  3WD0 A;  1FD9 A;  1Q6I A;  2EUL A;  1NWR A;  4MAV A;  5B8I C;  5I98 A;  1FKB A;  4Q7N A;  3ARY A;  1N3R A;  3AS2 A;  3PA7 A;  2A3E A;  3OOB A;  3TCZ A;  1E6P A;  2MLX A;  1LL6 A;  3NRK A;  3LW5 K;  4W5U A;  2KE0 A;  3AS1 A;  1YAT A;  1JVW A;  1W9U A;  1FKR A;  1W1T A;  1NMV A;  4DRI A;  4ZS6 A;  2FDM A;  4DIP A;  5J6E A;  1HJW A;  1W1V A;  1OGG A;  4TX0 A;  2MF9 A;  1KT0 A;  2G8Z A;  3O5O A;  1W26 A;  4XAK A;  5HBF A;  2DPE A;  1EYM A;  1SYT A;  2B31 A;  1LQ0 A;  3WQW A;  2ESC A;  3BMB A;  2LPV A;  3KAI A;  3CHD A;  5DIT A;  4QPM A;  2ZQU A;  1HKK A;  2KR1 A;  3LUO A;  4LGX A;  4DRH A;  3FY1 A;  4R5E A;  2O01 G;  4WK9 A;  2KO7 A;  1SR0 A;  1HJX A;  1AIP C;  2F23 A;  2PN0 A;  3ARU A;  1E9L A;  3IKG A;  4TW6 A;  3FXY A;  5DMZ A;  1RD6 A;  2O9O A;  2DT1 A;  2ZR6 A;  1C9H A;  3WIJ A;  2P11 A;  4JFI A;  5D75 A;  4DWS A;  2RUD A;  1U79 A;  3PRA A;  2WK2 A;  5JH8 A;  1FFR A;  4MNM A;  5HKG A;  1P5Q A;  4TW7 A;  1D7J A;  4DRQ A;  3B8S A;  1E6Z A;  1KFW A;  3ARO A;  1KT1 A;  4ODR A;  2DSU A;  4WKA A;  1UR8 A;  1N3T A;  3CGM A;  1EHN A;  2JZV A;  4KQZ A;  1LL7 A;  1GRJ A;  4IPX A;  3WL1 A;  1LG2 A;  3CGN A;  2LNZ A;  4MNK A;  1H0G A;  1X6L A;  1TFV A;  2ETN A;  2ITK A;  2VN1 A;  2WSE G;  1ZL1 A;  1HKJ A;  1QPF A;  2Q5A A;  4NZC A;  2A3C A;  3EY6 A;  4WJX A;  3H9R B;  3GU0 A;  4HBO A;  3IKD A;  3O5K A;  4KR0 B;  4G2P A;  1HJV A;  3VAW A;  1A9C A;  3JYJ A;  1W1P A;  1EIB A;  5GQB A;  2WSF G;  2M2A A;  3NI6 A;  4DRJ A;  1LG1 A;  4DT4 A;  2IUZ A;  5HWB A;  4Z2H A;  3EIP A;  4S3K A;  2F2D A;  4P8W A;  2PBC A;  2XP8 A;  2WM0 A;  3O5E A;  1VF8 A;  3PRD A;  4DWS B;  1NMW A;  4DWS D;  2XPB A;  1ROU A;  4W9Q A;  1D7I A;  4NSB A;  1ZCN A;  2DT2 A;  1J6Y A;  4Z2J A;  1WUR A;  5DIU A;  5DO2 A;  1YW5 A;  3WD3 A;  4ODP A;  3B0B C;  1O6I A;  3B7X A;  1FKG A;  3AQU A;  3ART A;  1GPF A;  4NNR A;  3UI4 A;  2MPH A;  4FAP A;  4MGV A;  2DSZ A;  4L3N A;  2FAP A;  3UQB A;  1J4I A;  2RUQ A;  3VEJ A;  4U85 A;  5HUA A;  3B9D A;  2KFW A;  5BXJ A;  1F8A B;  1FFQ A;  4DRO A;  1BL4 A;  2DT0 A;  4TYO A;  2PPP A;  2G41 A;  2PI6 A;  3JYM A;  1FKK A;  4PTM A;  3RFW A;  1NWT A;  3LW5 G;  3ARS A;  4LAX A;  4S3J A;  1JND A;  1T11 A;  3O5M A;  2PV1 A;  3AS3 A;  1W9P A;  3UQI A;  1HXV A;  4Q22 A;  2XP3 A;  2WLZ A;  1WB0 A;  4ODL A;  1FKJ A;  4L72 B;  4IQC A;  3WH0 A;  3B9E A;  2XP6 A;  1D7H A;  4JFM A;  1JNS A;  2WSC K;  2M08 A;  2OFN A;  4GIV A;  5HW6 A;  1GUV A;  2QF8 A;  1FKL A;  4U86 A;  1A7X A;  4JFL A;  1FBX A;  4DU6 A;  1ZBW A;  5HTG A;  2DG9 A;  4G50 A;  4DH0 A;  1E6R A;  2ZQS A;  4C02 B;  3UI5 A;  5GPG A;  1QZ2 A;  4HAR A;  4ODQ A;  3ARX A;  4QT3 A;  3UI6 A;  4U84 A;  4W9P A;  3O5D A;  3B9A A;  3ARP A;  2DSV A;  2D9F A;  1R9H A;  1QPL A;  2ZQV A;  3ARZ A;  1D6O A;  1FJD A;  1FAP A;  5GPR A;  4ODO A;  2O92 A;  3NTP A;  1FKI A;  2MLZ A;  2WSF K;  3W4R A;  4QZV B;  3CZ8 A;  1EFU B;  4Z2L A;  4LAY A;  4ODM A;  2RUC A;  3CH9 A;  4NE3 B;  2UZ5 A;  4TW8 A;  1WPL A;  3CHE A;  1LL4 A;  3TC5 A;  2KI3 A;  1ZB5 A;  4E44 B;  2XPA A;  5HW7 A;  2PPN A;  3IK8 A;  1XRV A;  1TFE A;  1CTN A;  2WLY A;  2K8I A;  4GGQ A;  3ARR A;  1J4H A;  1N1A A;  2DSW A;  1IX5 A;  3O5R A;  2ZR5 A;  1UR9 A;  2AWG A;  2YBT A;  1FKF A;  3I6C A;  3O5Q A;  4JA3 A;  4ITZ A;  3WD4 A;  3GTY X;  2P4V A;  2Y78 A;  1L1P A;  2F21 A;  1E15 A;  2A3B A;  2YBU A;  2N87 A;  4N19 A;  2MNT A;  4Z2G A;  4JFJ A;  2XP9 A;  4ML4 A;  3BXW A;  3WD2 A;  3RM8 A;  3WL0 A;  5HWC A;  4FN2 A;  3KCE A;  3O5I A;  5DF0 A;  1EDQ A;  1LJY A;  3IHZ A;  3ARQ A;  1OGB A;  3CHF A;  1F40 A;  3RGC A;  4P8U A;  4DRN A;  4IT6 A;  1WNO A;  1JCH B;  2M1I A;  4ZPW R;  1EQ3 A;  3KAF A;  2RQS A;  5DIV A;  1FB1 A;  3RM4 A;  1K9T A;  4HBE A;  3UQA A;  1PIN A;  2LKN A;  2L2S A;  1WUQ A;  4W9O A;  1PBK A;  1FKT A;  2KR7 A;  2DG3 A;  2KGJ A;  2WSC G;  2AOS A;  2B5U B;  2XP7 A;  3KAC A;  1WM9 A;  1W1Y A;  3WKZ A;  4NE5 B;  2FKE A;  3UF8 A;  2DT3 A;  4DWS C;  1E44 A;  1GTP A;  2PV3 A;  3MDY B;  3TDB A;  4R8Q A;  4DRA E;  4BF8 A;  1FKH A;  1NWS A;  3ARW A;  3O5L A;  4JFK A;  3ALF A;  1ROT A;  3G6M A;  3RME A;  1HKI A;  4O2T A;  4WIW A;  3JXV A;  1EL6 A;  1Q6U A;  1X6N A;  4LAW A;  4QIB A;  2IF4 A;  1Q1C A;  4AY1 A;  2ZR4 A;  4LAV A;  1H0I A;  3OA5 A;  5DEZ A;  1IS8 A;  4E45 B;  4IT4 A;  4NE6 B;  4MPK A;  4P8X A;  1Q6H A;  1ZU8 A;  3ALG A;  4J4N A;  1B6C A;  3PRB A;  3O5G A;  4DZ2 A;  1ZBV A;  2OLH A;  2MLY A;  4MSP A;  3ARV A;  2LO0 A;  3O5P A;  1D2K A;  1Y0O A;  5HW8 A;  4DRM A;  3KAG A;  2A3A A;  1M5Y A;  4ODK A;  4MNJ A;  1GOI A;  3O5J A;  1ZBC A;  2XP5 A;  1BKF A;  1ZBK A;  2DG4 A;  1JNT A;  1WAW A;  4Z2I A;  4QT2 A;  1FKS A;  4ZPV R;  4Q7J A;  2PV2 A;  4IQ2 A;  3AS0 A;  1XHG A;  4Z2K A;  3KAB A;  4DRK A;  1FKD A;  4URI A;  4TNS A;  3WQV A;  2ZQT A;  3PR9 A;  1OWQ A;  3ODK A;  1TCO C;  2WSE K;  3QOK A;  4DZ3 A;  2RSE A;  4R0X A;  2RUR A;  1J4R A;  4WKH A;  4J4O A; 
#chains in the Genus database with same CATH homology
 1FB1 A;  4Q7J A;  1EL6 A;  4E44 B;  3VEJ A;  2EUL A;  2LO0 A;  1WUQ A;  3GU0 A;  1TFE A;  1AIP C;  2F23 A;  1N3S A;  2PN0 A;  4DRB J;  1N3R A;  1A8R A;  1N3T A;  1A9C A;  1IS8 A;  5DMZ A;  1FBX A;  1WUR A;  4DU6 A;  1WM9 A;  4NE6 B;  4E45 B;  4NE5 B;  1GRJ A;  3B0B C;  3BMB A;  2P11 A;  1GTP A;  1EFU B;  2LNZ A;  1IS7 A;  4R8Q A;  4JA3 A;  4DRA E;  4QPM A;  3GTY X;  4NE3 B;  2ETN A;  2P4V A;  2KR1 A;  1WPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...