3BMBA

Crystal structure of a new rna polymerase interacting protein
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
135
Chain Sequence
SRPTIIINDLDAERIDILLEQPAYAGLPIADALNAELDRAQMCSPEEMPHDVVTMNSRVKFRNLSDGEVRVRTLVYPAKMTDSNTQLSVMAPVGAALLGLRVGDSIHWELPGGVATHLEVLELEYQPEAAGDYLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulator of nucleoside diphosphate kinase
publication title Crystal structure of Escherichia coli Rnk, a new RNA polymerase-interacting protein.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Rna binding protein
total genus 36
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01272 GreA_GreB Transcription elongation factor, GreA/GreB, C-term
A PF14760 Rnk_N Rnk N-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.286.20 Mainly Alpha Orthogonal Bundle GTP Cyclohydrolase I; Chain A, domain 1 GTP Cyclohydrolase I; Chain A, domain 1 3bmbA01
3.10.50.30 Alpha Beta Roll Chitinase A; domain 3 Transcription elongation factor, GreA/GreB, C-terminal domain 3bmbA02
1AIPC 3BMBA 2ETNA 2P4VA 1TFEA 2EULA 1GRJA 1EFUB 2F23A 2PN0A 3GU0A 3GTYX 4Q7JA
chains in the Genus database with same CATH superfamily
4GIVA 2K8IA 2PI6A 1C9HA 3O5RA 4TW8A 5GPGA 4TW7A 2ZQUA 4IT4A 4ODRA 4ZPTR 2MLZA 2WSFK 1KFWA 3O5JA 1D7IA 2O92A 3AS0A 1EHNA 3VEJA 3ARRA 2N87A 2KI3A 3PRAA 3ARZA 4P8UA 1EYMA 1SYTA 3JYMA 3NTPA 1HJVA 4W9QA 2PN0A 1ZBKA 3CGNA 1FKBA 3RMEA 4P8XA 2Y78A 3W4RA 2DT0A 3B7XA 3H9RB 1E44A 1HJXA 2LGOA 4MPKA 3RM4A 4ODLA 1HXVA 4BF8A 1IX5A 2XP6A 5HW8A 2DSUA 5BXJA 1LJYA 1ZBCA 2F21A 3UQAA 3O5EA 1P5QA 3CHCA 4DWSB 3LW5K 1D7HA 2KE0A 1TFEA 3ARQA 1JNTA 4WK9A 3UI5A 4DU6A 3PRBA 3RGCA 4HARA 3AROA 1FFRA 3KAGA 1FFQA 2LO0A 3B9DA 1Q6IA 1ZB5A 1T11A 2A3AA 2IF4A 2AOSA 2ZR4A 3B8SA 3NRKA 1N1AA 1NMWA 1KT1A 3KAIA 2MPHA 5I98A 4TNSA 3ARUA 3GTYX 1EDQA 3WIJA 4JYSA 4U86A 4FN2A 2PPOA 1F40A 3KAFA 3O5PA 3CZ8A 3UQIA 1O6IA 4Q7NA 1JVWA 5DIVA 4Z2LA 1GUVA 4DROA 1W1PA 2DT3A 4S3KA 1UR9A 2PPPA 4Q22A 1ZK6A 4W9PA 2FAPA 1ROTA 4DRBJ 1E6RA 2OFNA 1NWRA 3NI6A 3O5OA 5DEZA 4LAXA 2IUZA 4C02B 4TYOA 1EFUB 3CGMA 3BMBA 4ODQA 1D2KA 1NSGA 2ETNA 2XP9A 1TCOC 1Y0OA 1K9TA 1E6PA 3WQVA 2G41A 5HT1A 1FKGA 4ODNA 2DG4A 3CHDA 4S3JA 1E15A 5GPRA 3ARYA 4UDMA 4QIBA 3I6CA 2DT1A 4JFIA 1D7JA 4U85A 2A3EA 3UI4A 3ALFA 1LG1A 1HKMA 5HW6A 2KR7A 1NWSA 2KGJA 4NE5B 2B31A 1QZ2A 1GTPA 3AS2A 4DRHA 1YATA 3ARXA 1ZL1A 1W9VA 1VF8A 4DRQA 3KZ7A 2MLXA 2D9FA 2RUQA 4R5EA 1H0GA 3WD2A 4E45B 2KFWA 4N19A 2WM0A 2M08A 3TDBA 1WNOA 3FY1A 1FJDA 1CTNA 3G6LA 4IQ2A 3BXWA 4LGXA 1J4RA 4IPXA 2F4EA 3WD0A 3ODKA 1E6NA 1B6CA 3O5LA 4MNLA 4DIPA 3CHFA 1FKHA 1A8RA 1FKTA 4MNMA 3WL1A 4ODOA 2WSEG 2M1IA 2ZQVA 4ZS6A 1W1VA 1FKLA 1D6OA 2WSCG 2LPVA 2P4VA 3AS1A 3AS3A 3OOBA 4DWSC 4DWSD 1Q1CA 4DRKA 2MLYA 4JFKA 3FXYA 4MGVA 2LJ4A 1WB0A 2PPNA 1L1PA 4MAVA 3WL0A 1FB1A 1A7XA 2XP4A 2FKEA 4QT3A 1FKKA 3ARVA 2MNTA 3WH0A 1ZCNA 2ZR5A 1WAWA 1FKDA 4DRJA 4NSBA 2ZR6A 5HBFA 5HUAA 1HKKA 1F8AB 2ZQSA 1NWUA 5HW7A 3VAWA 1OGBA 4GGQA 4WKAA 4ZPVR 4ODMA 1X6NA 2F23A 3GU0A 2RUDA 1ROUA 1M5YA 1RD6A 4MTVA 2ESCA 2FDMA 4WKFA 1FKIA 2JZVA 3ALGA 3IHZA 1W1YA 2RSEA 4MNJA 2VCDA 4MSPA 1SR0A 3B0BC 1YW5A 3KABA 3MDYB 3IKGA 4ZPWR 1LL7A 2WLZA 4DT4A 1FKRA 3UI6A 2LNZA 4O2TA 3ARPA 1A9CA 1QPFA 4ML4A 1ZBWA 4R0XA 4DH0A 2WSCK 4DZ2A 4JFLA 1LG2A 4XAKA 3RM8A 5DITA 1BKFA 1XHGA 5B8IC 4Z2GA 2DPEA 5HWBA 4W9OA 1GRJA 2AWGA 3PR9A 1GOIA 1E6ZA 1W26A 1JNDA 4IQCA 3O5DA 3WQWA 1H0IA 2RUCA 2PV1A 5JH8A 2KR1A 2OLHA 3WD3A 2O01G 4KQZA 2F2DA 4MNKA 2G8ZA 3O5QA 3WKZA 1EQ3A 3PA7A 5HWCA 1LL4A 3TCZA 1WURA 3AQUA 4WKHA 1XRVA 3WD1A 5DMZA 2M2AA 3TC5A 1NMVA 1ZBVA 2XPBA 1ITXA 4DRIA 1Q6UA 3IK8A 4TW6A 2RQSA 3JYJA 5HKGA 1W9UA 1FKJA 2DSZA 2DT2A 2L2SA 4ODKA 3PRDA 5DIUA 2XP8A 2WLYA 4DRNA 1OGGA 2VN1A 4NE6B 4DRAE 3O5GA 4NE3B 1U79A 3EY6A 4URIA 4ITZA 1HKJA 4J4NA 4JFMA 4P8WA 4IT6A 4Q7JA 3O5FA 4PTMA 3WD4A 1W1TA 1R9HA 4L72B 2XPAA 3LUOA 4Z2IA 1AIPC 2YBUA 5J6EA 1OWQA 1ZU8A 1BL4A 3IKDA 4R8QA 4TX0A 2PBCA 1HKIA 2P11A 1WUQA 1IS7A 3ARTA 1FD9A 1GPFA 1NH6A 2DSVA 2Q5AA 4LAYA 1QPLA 4QT2A 2ITKA 4DZ3A 4LAWA 3O5KA 4WIWA 3ARWA 3QOKA 5DO2A 1J4HA 1N3SA 4WJXA 2A3CA 4Z2JA 3OA5A 3FAPA 2DG3A 2KO7A 2LKNA 3ARSA 3CH9A 4DRMA 1N3TA 4DWSA 2WSFG 3KAHA 2WK2A 1J6YA 1IS8A 3O5IA 2UZ5A 3GPKA 2O9OA 1EIBA 3B9AA 5HTGA 4QPMA 4ODPA 1J4IA 1N3RA 2MF9A 2XP5A 4J4OA 4JFJA 2XP7A 1E9LA 2PV3A 4KR0B 2DSWA 3UQBA 4NZCA 3RFWA 4L3NA 1FKFA 4U84A 1LL6A 4AY1A 3O5MA 1JCHB 1FKSA 2WSEK 3UF8A 3B9EA 1UR8A 5DF0A 1JNSA 2B5UB 2DG9A 3KCEA 3KADA 1KT0A 3JXVA 1LQ0A 1X6LA 1WM9A 3LW5G 4LAVA 1JNEA 5GQBA 4DRPA 4HBEA 4E44B 1NWTA 1EL6A 2XP3A 2RURA 2EULA 1HJWA 5D75A 4G50A 4Z2KA 4Z2HA 4FAPA 1FAPA 2A3BA 4HBOA 4NNRA 1FBXA 2QF8A 1PINA 1W9PA 3G6MA 3KACA 2YBTA 3EIPA 4P8VA 4JA3A 2PV2A 4W5UA 1Q6HA 3RM9A 4G2PA 3CHEA 2ZQTA 1PBKA 1WPLA 4QZVB 1TFVA
chains in the Genus database with same CATH topology
3BMBA 1N3RA 2ETNA 4E44B 1EL6A 1N3SA 2EULA 2F23A 2LNZA 1FB1A 3GU0A 4NE5B 1AIPC 1GTPA 1A9CA 2KR1A 3VEJA 1FBXA 4R8QA 2P11A 1WUQA 1N3TA 1IS7A 1A8RA 1TFEA 1IS8A 4NE6B 4DRAE 1WURA 4JA3A 4DRBJ 2PN0A 4NE3B 3GTYX 1EFUB 4DU6A 5DMZA 2P4VA 1WM9A 1GRJA 3B0BC 1WPLA 4E45B 4QPMA 2LO0A 4Q7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AIP C;  3BMB A;  2ETN A;  2P4V A;  1TFE A;  2EUL A;  1GRJ A;  1EFU B;  2F23 A;  2PN0 A;  3GU0 A;  3GTY X;  4Q7J A; 
#chains in the Genus database with same CATH topology
 4GIV A;  2K8I A;  2PI6 A;  1C9H A;  3O5R A;  4TW8 A;  5GPG A;  4TW7 A;  2ZQU A;  4IT4 A;  4ODR A;  4ZPT R;  2MLZ A;  2WSF K;  1KFW A;  3O5J A;  1D7I A;  2O92 A;  3AS0 A;  1EHN A;  3VEJ A;  3ARR A;  2N87 A;  2KI3 A;  3PRA A;  3ARZ A;  4P8U A;  1EYM A;  1SYT A;  3JYM A;  3NTP A;  1HJV A;  4W9Q A;  2PN0 A;  1ZBK A;  3CGN A;  1FKB A;  3RME A;  4P8X A;  2Y78 A;  3W4R A;  2DT0 A;  3B7X A;  3H9R B;  1E44 A;  1HJX A;  2LGO A;  4MPK A;  3RM4 A;  4ODL A;  1HXV A;  4BF8 A;  1IX5 A;  2XP6 A;  5HW8 A;  2DSU A;  5BXJ A;  1LJY A;  1ZBC A;  2F21 A;  3UQA A;  3O5E A;  1P5Q A;  3CHC A;  4DWS B;  3LW5 K;  1D7H A;  2KE0 A;  1TFE A;  3ARQ A;  1JNT A;  4WK9 A;  3UI5 A;  4DU6 A;  3PRB A;  3RGC A;  4HAR A;  3ARO A;  1FFR A;  3KAG A;  1FFQ A;  2LO0 A;  3B9D A;  1Q6I A;  1ZB5 A;  1T11 A;  2A3A A;  2IF4 A;  2AOS A;  2ZR4 A;  3B8S A;  3NRK A;  1N1A A;  1NMW A;  1KT1 A;  3KAI A;  2MPH A;  5I98 A;  4TNS A;  3ARU A;  3GTY X;  1EDQ A;  3WIJ A;  4JYS A;  4U86 A;  4FN2 A;  2PPO A;  1F40 A;  3KAF A;  3O5P A;  3CZ8 A;  3UQI A;  1O6I A;  4Q7N A;  1JVW A;  5DIV A;  4Z2L A;  1GUV A;  4DRO A;  1W1P A;  2DT3 A;  4S3K A;  1UR9 A;  2PPP A;  4Q22 A;  1ZK6 A;  4W9P A;  2FAP A;  1ROT A;  4DRB J;  1E6R A;  2OFN A;  1NWR A;  3NI6 A;  3O5O A;  5DEZ A;  4LAX A;  2IUZ A;  4C02 B;  4TYO A;  1EFU B;  3CGM A;  3BMB A;  4ODQ A;  1D2K A;  1NSG A;  2ETN A;  2XP9 A;  1TCO C;  1Y0O A;  1K9T A;  1E6P A;  3WQV A;  2G41 A;  5HT1 A;  1FKG A;  4ODN A;  2DG4 A;  3CHD A;  4S3J A;  1E15 A;  5GPR A;  3ARY A;  4UDM A;  4QIB A;  3I6C A;  2DT1 A;  4JFI A;  1D7J A;  4U85 A;  2A3E A;  3UI4 A;  3ALF A;  1LG1 A;  1HKM A;  5HW6 A;  2KR7 A;  1NWS A;  2KGJ A;  4NE5 B;  2B31 A;  1QZ2 A;  1GTP A;  3AS2 A;  4DRH A;  1YAT A;  3ARX A;  1ZL1 A;  1W9V A;  1VF8 A;  4DRQ A;  3KZ7 A;  2MLX A;  2D9F A;  2RUQ A;  4R5E A;  1H0G A;  3WD2 A;  4E45 B;  2KFW A;  4N19 A;  2WM0 A;  2M08 A;  3TDB A;  1WNO A;  3FY1 A;  1FJD A;  1CTN A;  3G6L A;  4IQ2 A;  3BXW A;  4LGX A;  1J4R A;  4IPX A;  2F4E A;  3WD0 A;  3ODK A;  1E6N A;  1B6C A;  3O5L A;  4MNL A;  4DIP A;  3CHF A;  1FKH A;  1A8R A;  1FKT A;  4MNM A;  3WL1 A;  4ODO A;  2WSE G;  2M1I A;  2ZQV A;  4ZS6 A;  1W1V A;  1FKL A;  1D6O A;  2WSC G;  2LPV A;  2P4V A;  3AS1 A;  3AS3 A;  3OOB A;  4DWS C;  4DWS D;  1Q1C A;  4DRK A;  2MLY A;  4JFK A;  3FXY A;  4MGV A;  2LJ4 A;  1WB0 A;  2PPN A;  1L1P A;  4MAV A;  3WL0 A;  1FB1 A;  1A7X A;  2XP4 A;  2FKE A;  4QT3 A;  1FKK A;  3ARV A;  2MNT A;  3WH0 A;  1ZCN A;  2ZR5 A;  1WAW A;  1FKD A;  4DRJ A;  4NSB A;  2ZR6 A;  5HBF A;  5HUA A;  1HKK A;  1F8A B;  2ZQS A;  1NWU A;  5HW7 A;  3VAW A;  1OGB A;  4GGQ A;  4WKA A;  4ZPV R;  4ODM A;  1X6N A;  2F23 A;  3GU0 A;  2RUD A;  1ROU A;  1M5Y A;  1RD6 A;  4MTV A;  2ESC A;  2FDM A;  4WKF A;  1FKI A;  2JZV A;  3ALG A;  3IHZ A;  1W1Y A;  2RSE A;  4MNJ A;  2VCD A;  4MSP A;  1SR0 A;  3B0B C;  1YW5 A;  3KAB A;  3MDY B;  3IKG A;  4ZPW R;  1LL7 A;  2WLZ A;  4DT4 A;  1FKR A;  3UI6 A;  2LNZ A;  4O2T A;  3ARP A;  1A9C A;  1QPF A;  4ML4 A;  1ZBW A;  4R0X A;  4DH0 A;  2WSC K;  4DZ2 A;  4JFL A;  1LG2 A;  4XAK A;  3RM8 A;  5DIT A;  1BKF A;  1XHG A;  5B8I C;  4Z2G A;  2DPE A;  5HWB A;  4W9O A;  1GRJ A;  2AWG A;  3PR9 A;  1GOI A;  1E6Z A;  1W26 A;  1JND A;  4IQC A;  3O5D A;  3WQW A;  1H0I A;  2RUC A;  2PV1 A;  5JH8 A;  2KR1 A;  2OLH A;  3WD3 A;  2O01 G;  4KQZ A;  2F2D A;  4MNK A;  2G8Z A;  3O5Q A;  3WKZ A;  1EQ3 A;  3PA7 A;  5HWC A;  1LL4 A;  3TCZ A;  1WUR A;  3AQU A;  4WKH A;  1XRV A;  3WD1 A;  5DMZ A;  2M2A A;  3TC5 A;  1NMV A;  1ZBV A;  2XPB A;  1ITX A;  4DRI A;  1Q6U A;  3IK8 A;  4TW6 A;  2RQS A;  3JYJ A;  5HKG A;  1W9U A;  1FKJ A;  2DSZ A;  2DT2 A;  2L2S A;  4ODK A;  3PRD A;  5DIU A;  2XP8 A;  2WLY A;  4DRN A;  1OGG A;  2VN1 A;  4NE6 B;  4DRA E;  3O5G A;  4NE3 B;  1U79 A;  3EY6 A;  4URI A;  4ITZ A;  1HKJ A;  4J4N A;  4JFM A;  4P8W A;  4IT6 A;  4Q7J A;  3O5F A;  4PTM A;  3WD4 A;  1W1T A;  1R9H A;  4L72 B;  2XPA A;  3LUO A;  4Z2I A;  1AIP C;  2YBU A;  5J6E A;  1OWQ A;  1ZU8 A;  1BL4 A;  3IKD A;  4R8Q A;  4TX0 A;  2PBC A;  1HKI A;  2P11 A;  1WUQ A;  1IS7 A;  3ART A;  1FD9 A;  1GPF A;  1NH6 A;  2DSV A;  2Q5A A;  4LAY A;  1QPL A;  4QT2 A;  2ITK A;  4DZ3 A;  4LAW A;  3O5K A;  4WIW A;  3ARW A;  3QOK A;  5DO2 A;  1J4H A;  1N3S A;  4WJX A;  2A3C A;  4Z2J A;  3OA5 A;  3FAP A;  2DG3 A;  2KO7 A;  2LKN A;  3ARS A;  3CH9 A;  4DRM A;  1N3T A;  4DWS A;  2WSF G;  3KAH A;  2WK2 A;  1J6Y A;  1IS8 A;  3O5I A;  2UZ5 A;  3GPK A;  2O9O A;  1EIB A;  3B9A A;  5HTG A;  4QPM A;  4ODP A;  1J4I A;  1N3R A;  2MF9 A;  2XP5 A;  4J4O A;  4JFJ A;  2XP7 A;  1E9L A;  2PV3 A;  4KR0 B;  2DSW A;  3UQB A;  4NZC A;  3RFW A;  4L3N A;  1FKF A;  4U84 A;  1LL6 A;  4AY1 A;  3O5M A;  1JCH B;  1FKS A;  2WSE K;  3UF8 A;  3B9E A;  1UR8 A;  5DF0 A;  1JNS A;  2B5U B;  2DG9 A;  3KCE A;  3KAD A;  1KT0 A;  3JXV A;  1LQ0 A;  1X6L A;  1WM9 A;  3LW5 G;  4LAV A;  1JNE A;  5GQB A;  4DRP A;  4HBE A;  4E44 B;  1NWT A;  1EL6 A;  2XP3 A;  2RUR A;  2EUL A;  1HJW A;  5D75 A;  4G50 A;  4Z2K A;  4Z2H A;  4FAP A;  1FAP A;  2A3B A;  4HBO A;  4NNR A;  1FBX A;  2QF8 A;  1PIN A;  1W9P A;  3G6M A;  3KAC A;  2YBT A;  3EIP A;  4P8V A;  4JA3 A;  2PV2 A;  4W5U A;  1Q6H A;  3RM9 A;  4G2P A;  3CHE A;  2ZQT A;  1PBK A;  1WPL A;  4QZV B;  1TFV A; 
#chains in the Genus database with same CATH homology
 3BMB A;  1N3R A;  2ETN A;  4E44 B;  1EL6 A;  1N3S A;  2EUL A;  2F23 A;  2LNZ A;  1FB1 A;  3GU0 A;  4NE5 B;  1AIP C;  1GTP A;  1A9C A;  2KR1 A;  3VEJ A;  1FBX A;  4R8Q A;  2P11 A;  1WUQ A;  1N3T A;  1IS7 A;  1A8R A;  1TFE A;  1IS8 A;  4NE6 B;  4DRA E;  1WUR A;  4JA3 A;  4DRB J;  2PN0 A;  4NE3 B;  3GTY X;  1EFU B;  4DU6 A;  5DMZ A;  2P4V A;  1WM9 A;  1GRJ A;  3B0B C;  1WPL A;  4E45 B;  4QPM A;  2LO0 A;  4Q7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...