3BMCA

Structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and substrate (folate)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
267
structure length
248
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 88
structure length 248
sequence length 267
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bmcA00
4UVHA 5BNIA 1OZAA 1O6ZA 2FY8A 1VJ0A 1JLLA 3P2YA 1PL8A 4W7HA 4XA8A 3VC7A 3VTZA 4ZU3A 4HFJA 3RAJA 2EHDA 1DDOA 4KWHA 1PIWA 3GC6A 3DZBA 3MTJA 2NADA 3L9WA 1ZH8A 5A3VA 1O8CA 1U1IA 4AJ1A 1PJSA 3OSUA 5EPOA 3ITDA 2Y68A 4I9NA 5DT9A 4QO7A 2EXXA 2Q49A 3AUAA 1HL3A 4E2ZA 3QWBA 2HJSA 3SX2A 3JQ8A 3LC2O 3JYOA 1JAXA 3GGOA 2QZZA 1I5RA 3PDJA 4R3NA 3KSZO 3OP4A 1LUAA 1KVSA 3C3XA 4QUKA 5LC1A 3W8FA 1EZ4A 1X13A 4K6FA 3ZNOA 5FI5A 7ADHA 1ZK4A 3WIDA 4XDZA 3Q2KA 2FPGA 3WB9A 3ORFA 3GVXA 1MC4A 4KDFA 4WKGA 1ZW1A 2UAGA 1PJ2A 4NU5A 1WW8A 4GAEA 1R0KA 1BTOA 1UR5A 4TRMA 2ILTA 3D64A 1M6HA 5KKAA 1N9GA 4RPKA 4NZ9A 2UYYA 1V8BA 2HK9A 4J4TA 1WAMA 4MPDA 3UGKA 1I3LA 4CL8A 5H82A 4LVCA 4PRLA 1U2GA 1X0VA 5DCUA 5A5FA 1E6UA 4OH1A 4AJJA 1LEHA 3F3SA 1NM5A 1HDXA 3M6IA 1HDOA 5CG1A 4B8ZA 2D4AA 4PG8A 1I10A 3NV9A 4GMGA 3UF0A 1U7TA 1AN9A 4MVJD 3L4SO 4YBZA 2V6MA 3ZNPA 2BD0A 4FFPA 3ENKA 1FDVA 2VUSA 5L53A 1M6WA 2JFGA 3VTFA 3HDHA 4CM9D 4PLYA 3EZYA 2YYYA 3OEWA 1W73A 4AFNA 1V3UA 2JCXA 3DB2A 4H7PA 4FB5A 3OECA 2CDCA 2GUGA 3D0OA 4MVJF 3AY3A 2ZJ0A 4M55A 1ENZA 1YVEI 2ZTLA 4B7XA 1Z45A 1E3WA 3FHLA 3GRKA 3AUTA 4HV4A 2DTXA 3FRJA 5CAEA 3A1NA 4OQZA 2VOJA 2GZ2A 4BKUA 2B36A 1TT5A 4Z9XA 1U8XX 2AW5A 4E30A 4E2WA 1I2CA 1E7QA 1T4DA 1HE2A 3WXBA 3FN4A 1UZNA 1LI4A 4NDNE 2D5AA 5COQA 1WZIA 3EY4A 3EMKA 3U4IA 2B69A 3ZHBA 3GVPA 3OA0A 4FCCA 2GSDA 1ZK2A 3VHRA 2VTDA 4FSHA 2Q99A 2X0RA 3UOGA 1VL0A 1UDBA 4I5FA 4AJNA 1YB4A 3OQBA 3QRWA 1DHRA 2IZZA 1OBFO 4W9NC 1ADGA 4ZN6A 1NFFA 3WOHA 1A7AA 1ENYA 2R00A 1NPTO 4OXKA 4OXYA 2JAHA 3ZDFA 1IULA 1KEVA 4Q3AA 1ZJZA 4LGVA 3AFNA 2GDZA 4CUKA 5JCJD 1KVRA 3WGTA 1EMDA 4GVLA 3HFSA 2YZ7A 1UDAA 2OZPA 2XXJA 3V1TC 2NSDA 5CDGA 5BNFA 2EERA 3LLVA 3MJCA 3D5TA 4PZCA 4AJIA 3K5PA 3OETA 1I0ZA 1LLQA 1W8DA 1ZK1A 1I30A 3KSUA 3I4FA 3OA2A 4DBVO 2HCTA 1JWAB 1D1TA 1KVTA 1R6DA 2FOIA 4J7UA 1QG6A 3E5RA 3O38A 3U49A 4WJZA 3A14A 3WMXA 4GMFA 4FIZA 2Y0EA 3PDUA 4F6LA 5JC1A 4DBZA 3ICPA 4XCVA 3ANLA 4Q3BA 3GZ4A 3V5NA 3AI2A 4DVJA 3WTCA 4B3IA 4BNZA 3U4HA 2X22A 5G2OA 2V65A 1HDGO 4B79A 3BTOA 2ZB7A 4BNFA 2ET6A 4YJHA 3ASUA 4BNNA 2SCUA 1DXYA 5ITVA 1ISFA 3OH8A 5I8WA 2GLXA 3TZCA 3E9MA 1UUFA 3QJ5A 1B14A 1B3BA 3FCOA 4BNWA 5U1PA 3AUUA 3DHEA 3GA0A 1ZK3A 4L73A 2NTNA 3ZWWA 3BHJA 3JQBC 2YW9A 3GOHA 1EQ2A 3O8QB 4PZDA 4HNGA 1FF9A 4BO0A 2J3KA 1LQUA 4BGUA 3B20A 4TROA 1L1FA 4BNKA 3KYDA 2B5VA 4DMLA 7MDHA 4OOEA 3RUDA 4IXWA 2VUUA 3ZWXA 1ONNA 4RL6A 5A9SB 1DC4A 3HB5X 3QY9A 3WGGA 4J4HA 3AWDA 3BMQB 3ON5A 4YRAA 1WLYA 3H4VA 2DPGA 3AUSA 4CMCA 2H9IA 3RIHA 3MWEB 2IZ0A 1ZNQO 4GQAA 4GX1A 4D46A 3QIVA 4J7CA 4BQPA 4KWIA 3JTMA 3GPIA 3NT5A 3QW2A 4PG7A 1KS9A 3JQ7A 1V0JA 3IJPA 1LBEA 3WYBA 3M1LA 4M86A 3VZRA 4CV1A 3F4BA 3ZWBA 1B8VA 5EIOA 4DWVA 1VM6A 4CPDA 2LDXA 3A9WA 3H5RA 5DP1A 1UXJA 2J3HA 3ZGYA 1XWFA 4TQGA 5KNLA 2ZB4A 1T2DA 3D3WB 3AY7A 1YL6A 1J49A 3JQAD 1PU2A 3IUSA 4L74A 4F46A 2EWMA 5CPBA 2PFGA 3JQGA 1E7YA 3I6IA 4GVXA 4OSOA 3KOUA 3T7CA 1UP4A 4QTZA 1D3AA 2HMVA 5BT9A 3RUHA 4L76A 2OO5A 3EW7A 4A03A 4BV9A 1TEHA 3K9QO 1IB6A 1U4OA 3VZPA 4BGVA 2ZCUA 4Q3DA 5CDUA 4C7JA 2JFHA 2VNSA 4NI5A 4R1NA 4R69A 4CUZA 2LDBA 4IDFA 5DBFA 1E1NA 1GQQA 3R3JA 4IGFA 4K1LA 3I9MA 1GQYA 1MC5A 3V8BA 3PXXA 4D0SA 3G17A 2AA3A 4M54A 3LQFA 3OF2A 1EK6A 3BMNA 1NP3A 3FR7A 4DGSA 2Q1UA 4ALNA 3EVNA 2Z95A 1MGOA 4IDAA 2VOEA 1ARZA 1YDEA 4CQMD 1Y5MA 2Y1GA 5EESA 4RLSA 3EVTA 1I2BA 4CUJA 2DTEA 2WD7B 3TJRA 3ZU3A 5TGDA 2ZATA 1HYHA 3KBOA 1NVTA 1XKQA 3WQSB 3ZW9A 2CDBA 2ZB3A 4EJ6A 1LLDA 1DFGA 1JA9A 4NJMA 2QYSA 4NJOA 4XYBA 4WNIA 3SXPA 1LDNA 1GZ3A 1KC3A 3W6UA 3D4PA 1B8UA 1RKXA 1BXGB 1HSOA 3NEPX 4JIGA 5DOVA 4BNGA 3PYMA 5JAQA 2HO5A 3MJVA 1ENPA 1MUUA 4GI2A 3QVTA 2GR9A 1G6KA 1P0FA 1EBUA 3HZZA 4MP8A 3OJ0A 2H6EA 5CDSA 3IJRA 5I7VA 4II3A 3GG9A 1HTBA 2I67A 3JD1A 3S2GA 4PLFA 1LTHR 3E03A 1TVEA 3DMTA 2VZ0A 3C7CB 2B83A 1UZMA 3VH3A 4E6PA 4CJXA 4FDAA 1P1KA 3ZU5A 4AJKA 1XU7A 1DB3A 2YQ5A 4J0FA 1A4UA 1X0XA 3TSCA 4DYDA 3ADPA 2PTGA 1ISMA 2QHXA 5FYDA 1R4NB 3ONFA 2POQX 4MKZA 5GMOA 2HMWA 1GZ4A 1LDEA 3BHMA 2O3SA 2TMGA 1H2BA 2CF6A 4XR9A 2VN8A 4MVJH 4R41A 1AHIA 1QLJA 2D59A 2VT2A 4HKTA 1HLPA 1NR7A 3DAGA 3W4IA 3PWSA 3RJ9A 4RJTA 5L7WA 1O95A 2Y66A 4D43A 4EEXA 1DFHA 2QYTA 1E3LA 3WQQA 5DBIA 3ZWAA 4HY3A 4PLTA 1K3TA 2Q1SA 1WPQA 5BNTA 4ESOA 4IMPA 3NTQA 1UH5A 5DP2A 3V1UA 5AYVA 2HK8A 4PLHA 3TZKA 4CLXA 3T4XA 3VZQA 3H9QA 2X9VA 3FWZA 2FR0A 1TA4A 4Z9YA 4WLNA 1HWYA 4OHUA 1VL6A 4R16A 2NU6A 2EGGA 1LC0A 1ADFA 4IS2A 4DYVA 4JGBA 4PIVA 4YA6A 3VDRA 4FD3A 2DUWA 3PGJA 5LDHA 3D7LA 4GWGA 5TX7A 4PLPA 1N8KA 3RVDA 4NBRA 4BO7A 1YH3A 3GDFA 1NYTA 2DC1A 2WMDA 3QVWA 2G5CA 1R16A 3LK7A 4YAIA 5F5NA 1WNTA 1D8AA 1GUYA 2IRWA 1AXGA 2PLAA 4RF4A 3RCBA 3JD0A 3GHHA 4NK4A 1Y5RA 3AM4A 3QP9A 4I5DA 1Q0HA 4B7UA 4JROA 5G4KB 3JD3A 3TF5A 1T26A 1TI7A 1T1SA 2AG5A 2O50A 4LISA 3JQ9C 4NFSA 2EGHA 2G82A 3F4LA 5BR7A 3JQDA 1NWCA 1P77A 4LRTB 1E77A 1M2WA 1SB9A 5EQDA 1B7GO 4BNUA 3DBRB 3WIEA 4D7AA 3R3SA 4ZQBA 4C7KA 1D4FA 2E4AA 2NU8A 1RM4A 2A4KA 4IS3A 3CIFA 3CKYA 4QEDA 2Y67A 2BHLA 1A5ZA 4MIEA 2WM3A 1BDBA 3GVCA 2FP4A 3MCVA 4FR5A 4RVGA 4X54A 2AQKA 3JSAA 4DLLA 4P4GA 4TWRA 1R15A 1ZSVA 2PKQP 2IEDA 3WGQA 4YT2A 2B5WA 1PS0A 5I9LA 1F14A 1UJMA 1DIAA 3MJEA 1H9BA 2FZEA 1XR3A 4OIMA 4WECA 3Q11A 2HKIA 4CMHA 2NVUB 4XIYA 1T2EA 1BMDA 1P74A 2G76A 1OC4A 2ZTUA 5JDIA 4E13A 4E4YA 2E48A 2D8AA 4YQYA 1M76A 3IKVA 1ISHA 3PEFA 3GG2A 2X0NA 2F00A 1UZLA 4E31A 1VC2A 5KJFA 3WR5A 3GN2A 1PGQA 4OOFA 1I33A 2OHXA 1AUPA 1T2AA 2OORA 4E5KA 4IXTA 2AHRA 4XIJA 5I9MA 4ZICA 5I7SA 4EI2A 1DO8A 3RFXA 4NIMA 1GEEA 4WGGA 2G0TA 2Y0CA 3DZJA 4XYEA 3H2SA 2UDPA 1CF2O 4R9RA 1U3VA 3GVIA 2CY0A 2X5JO 4YAGA 2UUPA 4YJGB 5T57A 1KEPA 5BSEA 4RDIA 4RF5A 4XYGA 1H6AA 3K73O 5JDCC 2CDAA 1T4BA 1Y8QB 1IY8A 4WASA 5JYEA 1GYRA 4S1VA 1B16A 1CQJA 3W6ZA 1NFQA 4JK3A 4M1QA 1PZGA 3K96A 5G4LA 5IZCA 1H6BA 1VPDA 4XB1A 2BI7A 1KEWA 1ZCJA 1ZEJA 3QVOA 1IHXA 1BW9A 3DC2A 4BQRA 1QSGA 5HM8A 1EUZA 2AXQA 5AXDA 1K6IA 3WNQA 2GASA 5A03A 1PX0A 2G1UA 3TOXA 4L4SA 3HJAA 4O59O 2GRAA 1K89A 5IFLA 4TZKA 1I3NA 3OICA 1HT0A 4NBVA 5A04A 3EAGA 3I52A 3QE3A 4R51A 3JQFC 4IM7A 1DJNA 2VYVA 1MA0A 1SEVA 4I08A 4Q9NA 3CE6A 4YPOA 2QZ9A 3FPLA 4AICA 5FWNA 5IN4A 3JD2A 3IC5A 1DPGA 3KLPX 4RLHA 5HRUA 4A2CA 2YFHA 3ZWPA 2FPIA 4QQRA 4RV9A 3NDIA 4UAGA 2WE8A 3OIFA 4UEJA 1W6UA 4CM6A 1Z7EA 4WLUA 5JMWA 2HDHA 1P44A 1T2CA 3JYLA 3N74A 3WJAA 3B1JA 1PQWA 3PPIA 4CMJA 3KSDO 1DAOA 4J0EA 3VPXA 2J6IA 3DR3A 3IUPA 3WFIA 2PZMA 4YR9A 4AG3A 1F8GA 2HU2A 4E5PA 3CUKA 4CLOA 1Z73A 3SEFA 3WG9A 1GDHA 1PGPA 3Q0EA 1H5QA 1P9LA 4ZRNA 1KC1A 1ORRA 4Y8VA 4DUPA 1V35A 4G65A 2J8ZA 3ETEA 5GZ6A 3ZV4A 5B4TA 3K6JA 4WEQA 1NASA 4KMSA 5TF4A 4D41A 5F21A 1O94A 4LW8A 4O0LA 1GAEO 1PQUA 1P3DA 1Z74A 4IPTA 3HN7A 2OMEA 3ZV5A 1MLDA 3K92A 3NUGA 3EDMA 1J0XO 1XYGA 4JLWA 4YVFA 4BB5A 4UUNA 1LA2A 1HYGA 3CXRA 2RH8A 3UH1A 4P22A 2PZJA 4R5HA 3RKRA 2X0IA 2JD2A 3IIEA 4NG5A 1PEDA 3PI7A 3L4BC 1E7SA 1ZVMA 2HMSA 4LMRA 3FNHA 4IMRA 4W99A 3RD5A 1L7EA 1X7GA 2C54A 4BNMA 3P19A 2Z5LA 1G1AA 2DVMA 3DHYA 3PLRA 4B4WA 1ZKMA 2A35A 4CLRA 3BTVA 3GFBA 3U9LA 3SC6A 4CM3A 1QLHA 4FOOA 1QYVA 4NQZA 4WOJA 1EFKA 4MO2A 1PTJA 1XHLA 1A7KA 4CV0A 4XRGA 3DEYX 3UFXA 4UUPA 9LDBA 3INRA 4ALLA 1LLUA 1AE1A 2R00C 4N54A 2XOXA 4UUOA 1GV1A 1K6XA 1PGJA 4B8WA 2VYND 3U3XA 3DZHA 2OUIA 1SCUA 4DIBA 3C7DB 3I5MA 5U9CA 2C20A 4RPLA 1Y6JA 5JSFA 2Q4EA 1WXDA 1E3SA 4BKQA 5L4LA 3LZ6A 2BLLA 4BNLA 1WVGA 2C82A 3QV1A 4HUJA 1SAYA 1C1DA 4I9UA 1VE9A 1BWSA 3DO5A 3PK0A 4XJTA 1QYCA 2TMDA 1EDZA 2RAFA 4MJLA 5F1OA 3INTA 3KYCB 5KKCA 1U5AA 4N5LA 4IDGA 1ZIDA 2VZ8A 4Q39A 4YAEA 4DRYA 1VI2A 2PA3A 1ENOA 3CZRA 2EW2A 5ENVA 2BRUA 4O1MA 4YB8A 2EEZA 2O4CA 5K0ZA 3GY0A 4J1TA 3DOOA 4J6FA 4XGIA 3WLFA 5JAMA 2VYVD 3CMMA 3F1KA 3UCEA 1IPEA 4XQEA 3I9OA 4G81A 2Y93A 2I5PO 1HKUA 3ROPA 3H3JA 2F1KA 2GGSA 2Y1DA 3RQSA 1RWBA 3FBGA 1FMCA 2OXIA 4BO9A 2BI8A 4HFMA 1JVBA 1YXMA 1JW9B 4BO1A 2DUUA 3D5QA 3RUAA 2EP5A 5KOIA 2YQ4A 4RGBA 1HSZA 6ADHA 4Q3CA 2VNAA 4DC1A 1N1GA 3PJGA 2P5YA 5IXSA 1Z75A 4KQXA 2VHWA 3MZ0A 4R4JA 2ZB8A 5L3ZA 2O2SA 4C4OA 3ZHZA 5K6AA 4DIOA 3PHGA 1KERA 5EERA 3G0OA 4CV3A 2IXBA 2PKQO 2YHIB 3EYWA 4FGSA 5COBA 1S6YA 4R1SA 2GO1A 3NRCA 4RO0A 1VSUA 4CMAA 3GHYA 1YQXA 2ZTMA 3VPSA 3RBXA 4K9DA 2Y1EA 3KVOA 3G49A 4PLGA 4IIUA 1P1HA 5KVCA 1A9ZA 3PZBA 4OMUA 3DTYA 4HXYA 4U6SA 1TB4A 3WQRA 1VRWA 1FK8A 1YONA 4DPKA 4DPLA 1NAHA 3NT2A 5T5QA 1KEUA 2H63A 3GLQA 4BHTA 3HDJA 4HFRA 4PG6A 2O3RA 3BTUA 2R2GA 2ZQYA 3RFTA 4AJLA 3M2TA 1GADO 3E82A 5CDTA 1TXGA 1GPDG 3DZIA 3E9NA 1IPFA 1U28A 2WWRA 4EEZA 4BGIA 3RU9A 1EUDA 1EBFA 2WD8A 3S2FA 5AQ1A 3WWZA 2FSSA 4H15A 3JQAB 4UUMA 1LRJA 4XWYA 4FFMA 1JAYA 5JNLA 3H8VA 2VWHA 2HQ1A 1XIVA 5L45A 5I8ZA 1WWKA 3PHJA 5ILGA 3N7UA 2NV6A 1ID1A 4BNJA 1TT7A 2AEFA 1FDUA 1KIFA 2DBRA 1YS4A 2W4QA 3R6DA 1ONPA 5DZSA 3TDKA 3PJFA 1RM3A 4BO6A 1DIBA 2Y1FA 3UHAA 3WYEA 3E6AA 1X1EA 2ZTVA 3BMOB 3F1LA 5TRTA 3TN7A 2PK3A 4G2NA 3X2FA 3AK4A 3DFUA 3KHUA 2AMFA 5I9NA 3H9UA 1J6UA 3I9JA 3NTRA 1DFIA 2VRCA 1BDMA 3VPHA 4FJ0A 2FWMX 3G3EA 4IINA 3NGXA 1P33A 4CMEA 3KUXA 1CJCA 1JTVA 4YXFA 3ANNA 3LYLA 2O3JA 3LF2A 4L8VA 4M49A 2YV1A 3R1IA 1YL7A 5EQFA 3OJEA 1HLDA 5T64A 4R5MA 3L6DA 1UAGA 4DQXA 3PWKA 4CQMB 4YJHB 1DC3A 3CMCO 3WJ7A 1C0KA 3RU7A 1JQBA 4CQLB 1FDSA 4YEDA 1K0UA 1NWHA 4JJIA 3FWNA 2YDYA 4MVJM 2GN6A 3C1AA 5L95A 2E6UX 1CWUA 2EKQA 5COAA 3LSYA 1K6JA 1ZXLA 3NJ8A 3PTZA 4R3WA 4WK6A 5F5LA 9LDTA 2PGJA 4WOKA 1ZSNA 1MP0A 2WEKA 5DCYA 1ONOA 2DBZA 3DHNA 1XG5A 2X9NA 3K31A 4KQWA 4R68A 3UUWA 1ISJA 1SC6A 3B1FA 1KOLA 1UXIA 2QW8A 2DQ4A 1I24A 4J4BA 2IZ1A 1A9YA 3VDQA 1U8FO 1QYXA 4GBJA 4GKBA 2ZYDA 2YV2A 4AJ4A 1E92A 4CR6A 4FOSA 2NU9A 1QYDA 2PGDA 3IOYA 3LU1A 5TC4A 5IF3A 1B26A 4U5QA 3BYZA 2NVWA 2FR8A 2Q2VA 4CMIB 1Z7BA 3DMTC 4TRJA 1N7GA 4DQVA 3S1LA 2AQIA 5AVOA 3W4KA 4RDHA 4Y6SA 1H94A 4BO8A 4BNXA 2NQ8A 3I83A 1Q0LA 4MDHA 5A9SA 1SO8A 4BS9A 3CH6A 4J90A 3WWYA 3BMCB 3UXYA 3COSA 4CLHA 1J5PA 1LNQA 3BMQA 3I9NA 4QO8A 1V3TA 3AU8A 3QQPA 4GX2A 3OIGA 4RF2A 2O48X 1KETA 5HA5A 1LX6A 2I9PA 1YBVA 3W8EA 1LDMA 5B4UA 1V9LA 1ZO8A 3FSRA 5EN4A 5JE8A 3CSDA 3WLEA 5T6BA 4E5NA 4JN6B 3FI9A 4J1SA 3DBLB 4EW6A 1F8FA 1PZHA 1RPNA 2PWZA 1LJ8A 5JMPA 1GYPA 1ULUA 2JD0A 1SEPA 3QWAA 2I65A 5JCXA 2NM0A 1ML3A 3AJRA 1EVIA 4FJ2A 1HXHA 3LT1A 1TLTA 5G0SA 3DOJA 4TZTA 3NJ4A 5G0TA 3LLSA 5KWEA 2H5LA 2BFPA 4UVIA 3D3WA 1X7HA 3DOCA 1HETA 2BFAA 3U4DA 4P4LA 3LVFO 1IUKA 1P1FA 3BMNB 1EDOA 2CFCA 1ADBA 3F6YA 3K2EA 4Y98A 4FS3A 1FDWA 3U0BA 3WGOA 4CR8A 2CNBA 1JKFA 2GZ3A 2V6BA 1B2LA 3K2BA 2WYUA 1Q7CA 4IJWA 3OJFA 2C2YA 1NXQA 4YJDA 1DLJA 2RBEA 4HP8A 4A27A 4MOWA 1JWBB 1I3MA 1BXKA 3NKLA 4M8SA 2O23A 2X1HA 3AU9A 3TWOA 3QVXA 1Y8RB 4ND2A 1WDKA 5L7TA 1C0IA 2W98A 4DREA 4WE3A 3GZNB 1QRRA 5H83A 2CSUA 2GN8A 2YDXA 1E0DA 1E6EA 4TKLA 5THKA 3WSVA 2X5KO 1EUCA 3IP3A 4BVAA 4I5GA 1AXEA 4CM7A 3ONEA 1HE5A 1GCUA 1VSVA 2BGLA 2C29D 1HF3A 3IKTA 1WMBA 4RZHA 5KJ6A 2QRJA 1I3KA 4I9HA 3UICA 3UCFA 2I3GA 4U0JA 5ER9A 1RM5A 2BKAA 4PVDA 3VH1A 1CDOA 4E21A 4IDEA 1GUZA 1NQAO 4F6CA 3DZFA 3U09A 4R9SA 5CPFA 1ZBQA 3HDYA 4L9RA 4PZEA 3Q3CA 4ND3A 2IEBA 1BVRA 2V6GA 1I2ZA 4PG4A 1KY5A 1BGVA 5EMHA 4D3SA 4CM4A 4NHEA 3KRTA 4U0KA 1GD1O 3I23A 4XX0A 5KJ1A 3ZW8A 5IDYA 2XPCA 1XLTA 5H81A 1BXGA 4L4RA 3NAQA 3H9GA 4RVFA 5EJ2A 1NVGA 4YCAA 1E5LA 1MFZA 4DLAA 3VKVA 2DKNA 3O26A 3DAPA 3SBOA 1XU9A 3PIDA 4URFA 1E7WA 2Q2QA 3DQPA 4RVSA 1Y81A 3DXFA 5T8KC 3AW9A 4YJFB 5A1TA 1P31A 3ZHXA 3KEQA 2HAEA 4R01A 1NTOA 4CMKA 2PV7A 1PR3A 3HG7A 5KVQA 4ZVVA 1E5QA 2B4QA 1ULSA 2CUKA 3V2GA 1EVYA 1YBMA 4BMSA 4DLBA 5FFFA 5B37A 3T4EA 3WTBA 1LXCA 4KDEA 3DMYA 4BNTA 1ZUD1 2DBVO 2EIHA 4HBGA 4KZPA 1EFLA 5CDYA 3E48A 1GV0A 3GEMA 4J9VA 2J5KA 4JQCA 5TS3A 1YOVB 3QWIA 5IZ4A 3TPCA 2IODA 4F45A 5G0VA 3ZWOA 5CEFA 2D1YA 2PNFA 1PGNA 3RSHA 4DXHA 4FC6A 4NH4A 3GFGA 2FRDA 5L40A 2GD1O 1UXKA 3ENNA 4TVBA 2VWQA 2EV9A 1HYEA 2A92A 3B6ZA 3ZZNA 4BV8A 4DC0A 3SJUA 4BOYA 4OGWA 5ER6A 4NU6A 1N5DA 3WYCA 4TRRA 3E1KA 3WGYA 2DPHA 1EQUA 1LSJA 2ZJ1A 3H5AA 1V3VA 3TZQA 3PYLA 1R37A 4IQGA 3TFQA 3FR8A 1HZZA 5IG2A 3VH4A 3ZNQA 4GLOA 2EP7A 4A0SA 4JJFA 4J2OA 3E9QA 3C1OA 1GFSA 3G1TA 3Q1LA 3I9KA 1WZEA 5F3RA 4LN1A 2CZCA 2D3TA 3P2OA 1PS9A 5T67A 4ND1A 2X0JA 5KTKA 2OOSA 4MIYA 2B0JA 3NGLA 5KCZA 3MEQA 1QV7A 4O6VA 2VT3A 1PR9A 3H5NA 3PP8A 4GX5A 4ZJUA 2Q46A 3DDNA 1YQDA 4F3YA 1R0SA 3ZU2A 2AE1A 4PFJA 2JCYA 1YKFA 3JQCA 2XXBA 4RCVA 1GEGA 4Z0TA 2D0IA 2OP1A 3AOEC 3Q6IA 4WCFC 2QQ5A 1NFRA 2NNLD 2P2SA 2X6TA 3MJSA 1MG0A 5G4KA 5TJ9A 1HDRA 3ZI0A 2P68A 4N18A 3WDSA 3BIOA 3ICCA 4FFRA 4EUFA 1QR6A 2FPPA 3C1TA 2J3IA 3DBRA 1A72A 4ALKA 1PS8A 1R12A 2BFOA 4A10A 5JW6A 2JFFA 4N7RA 1X14A 4ROSA 4A73A 3H3FA 2O3UA 1XGKA 1EK5A 2CVOA 5FF9A 2JAPA 4ALIA 1C14A 4FC7A 5KJCA 3NT4A 2O2YA 3S2IA 4D44A 5JO9A 3GNTA 2ZQZA 4IIVA 1E1MA 2CVQA 4MP3A 4I5EA 5B12A 1ISGA 4DMMA 3I3OA 1Y7TA 3PFFA 1PZEA 2R6JA 3TZHA 5AOVA 3HNPA 2HRBA 3S55A 5A4DA 3E8XA 3GUCA 2C7VA 2NLOA 4NR0A 2W2KB 1BRMA 2YJZA 3WBBA 4ZRMA 3W4JA 1DBVO 3JYNA 4BNIA 4RVHA 3B70A 1T24A 2FZWA 1C1XB 2CD9A 1DLIA 3FBTA 5FI3A 5L4NA 4ZA2A 4XQGA 4OKIA 4TKMA 1R4MB 3C8MA 3P5SA 4EUEA 2QIOA 3KYBA 4N5NA 3K8ZA 4BUCA 4IDDA 3RJ5A 1PJ4A 4FFNA 2W2LA 4CM1A 3PQFA 3ZV6A 4IQ8A 4DQUA 4YJGA 1J4AA 3ULKA 1WMAA 1DAPA 2NUAA 3GAFA 2ZYGA 1P1JA 2E49A 3CTMA 5IDQA 2VRBA 4CM8A 3RUIA 3GGGA 2RHCA 1MX3A 3X2EA 1BHSA 5BSHA 2C7GA 2PD6A 1YE3A 1NBOA 3EK2A 4DPMA 1PJCA 2EF1A 3DBHB 2OL4A 1O89A 2A94A 1T25A 1ZMOA 3PJEA 2JCVA 4QECA 1CYDA 4AJ2A 4NPCA 1DRVA 1VJ1A 3ETGA 3ROKA 4GGPA 3LT2A 4PLWA 1JVSA 1U5CA 2WSBA 1NPYA 1UXGA 4WCFB 4TSKA 1NVMB 3STHA 3GVHA 4D3DA 2OGUA 3ANMA 4UEOA 1S7CA 3JQ9A 3UAGA 4UEKA 5JAIA 3LC1O 3PIIA 1E1KA 4ZQHA 3DZKA 3GH3A 3JQ6A 1LDBA 4I1IA 1YJQA 1I8TA 3AM3A 3DZGA 2AEMA 3DWFA 1F17A 5EL0A 2PZLA 5IAAA 4TMFA 1IL0A 5HWSA 1SBYA 3AI1A 2VTEA 3GMDA 4MVJA 2W8ZA 2I76A 4GLLA 4MVJE 1EVJA 1I32A 4IY1A 4JBGA 4QXMA 4CM9A 5CG2A 1MV8A 3LF1A 4BKRA 2DFVA 1VKNA 2EG9A 3C7AA 3ZWMA 4R1UA 3E18A 4PG5A 4KUEA 2YHUA 5ENDA 1ADCA 1IHYA 5DCWA 4D79A 1HEUA 3MJ4A 4RVUA 5A05A 5I7FA 4J91A 4CLRB 3GNSA 4JBIA 3RBZA 3PZRA 3QWFA 3I9LA 2AG8A 4YTEA 4CODB 3MOIA 1HDZA 4LSWA 4U6QA 3BA1A 2JHFA 1BG6A 3JQ8B 4XYMA 3WICA 3PFWO 3HHPA 2FR1A 3GAZA 5C5IA 3EHEA 2VQ3A 2IXAA 3IDSA 4P4NA 3ZCXA 5JS6A 4RPHA 4RPJA 4IJVA 2PH3A 1XA0A 1SB8A 3FTNA 3BHIA 1YBAA 3QA9A 2DFDA 1I36A 3L6OO 4OXNA 4II2A 4D3FA 3IAHA 1KVQA 3WGZA 1CQIA 5ES3A 3JCZA 2HUNA 3F46A 3DFZA 3GMSA 4RPGA 1FXSA 4EUHA 4S3MA 2IYOA 2GN4A 3D4OA 1C1DB 2X58A 1LRLA 5A9TA 3FNGA 1FJHA 3ZWCA 4LK3A 4LRSB 5JDCA 3PWZA 2W2LD 3BTSA 3RASA 4BMNA 1N9GB 1XQ1A 3G1UA 2IYPA 3HSKA 4J43A 4G5HA 4BKOA 5JCJA 4Z0HO 4GWKA 1R66A 3H6KA 1JKIA 1CEQA 4EITA 2RCYA 1NAIA 5KIAA 5EINA 4CMEC 1G0OA 3HUDA 3OQ1A 4LCJA 2Q4BA 4PLVA 5DOZA 4CL3A 5B1YA 1AGNA 2X4GA 4XEHA 3KEOA 5A06A 2JHGA 1CRWG 2O3QA 3KYCA 3SLKA 2NVBA 3JQFA 3U62A 3V2HA 2UV8A 5MDHA 4CM5A 2D2IA 5JBIA 2NTJA 4ZGWA 3GNQA 2VUTA 2P9GA 3QLJA 1QKIA 1N92A 3OBBA 1UDCA 4AVYA 1YWGO 4HFNA 3MJTA 3ZWYA 5G0UA 4KTVE 2O4UX 1QV6A 1PL6A 4Q3NA 3C85A 1E3WB 3Q9NA 3UVEA 1SZJG 1PSDA 2O7SA 4BO2A 3IL2A 4E2XA 1I01A 1G0NA 4ITUA 5LDGA 3W1VA 1IYZA 5KVSA 1YRLA 1TT5B 4XDYA 1HDYA 1X7DA 1YDWA 4AJPA 4BGEA 2QG4A 3H9EO 1SOVA 3CEAA 3EZLA 3ITKA 3WX0A 2UVDA 1W0CA 4WNCA 2J5QA 2J3JA 5AXCA 4H16A 1F06A 1C0LA 3PGXA 2QX7A 3PJDA 2X5OA 4GKVA 2X7HA 5DULA 4WCDA 4XZ3A 2YHIA 2FHSA 3HQ4O 4AJOA 4PGFA 1B3RA 3RUEA 3OJOA 2B37A 4FPXA 4E5MA 2B35A 2E82A 4JJGA 4UVDA 2GNAA 1JKJA 4Y9DA 1LQTA 4CR7A 2Y1OA 1X15A 2BMAA 2HRZA 5C7LO 2PD3A 2GN9A 4RORA 5TQVA 2HMTA 1H6DA 2JKVA 4EYEA 5C3MA 3LT4A 2X86A 1PZFA 3AY6A 1Q7GA 3L4BA 1GR0A 3JD4A 3ROQA 4AJHA 1XQ6A 4GSLA 1GPJA 1P45A 4J49A 3ABIA 2AE2A 4FBGA 2WYVA 4OL9A 4WUVA 3ROMA 3U5TA 5F1KA 1MFPA 5L7YA 5DDIP 4W4TA 3PQDA 1HE3A 4RQUA 3WBFA 1U3WA 3TL3A 4BO5A 4KP7A 5TIIA 3GDOA 3BAZA 3LDHA 1N7HA 1VLLA 2DTDA 3FPCA 3JQAA 3P7MA 1EEHA 2Y0DA 4RVDA 3TZ6A 3ZN2A 5ADHA 4BO4A 5B4VA 4MVJI 3OHSX 4YT8A 5JFOA 4IUYA 5LCXA 3L0DA 3CZMA 1NHGA 5IN5A 4AL4A 2P9CA 1NHWA 5BSGA 1MG5A 3AOGA 1PL7A 4WEOA 3A06A 1NQ5A 1FDTA 3BMOA 4MVJP 2VHVA 5A5EA 2NQTA 4Z3DA 3M1AA 4HNHA 5IXYA 1GU7A 1YB1A 4YT5A 2W90A 2VWPA 1U7HA 3NDRA 4CMGA 1MXFA 5TNXA 1O0SA 2JJYA 3OFSA 4ZHSA 3V2UA 4E2YA 1PWZA 4A7PA 3B1KA 2O3TA 4ZQFA 3EUWA 3SJ7A 3WGHA 2AEJA 2BELA 1CERA 1Z82A 5JO0A 2Y05A 1Q1NA 2WDZA 3QWHA 4JNKA 3F5SA 1LU9A 2QRKA 4KUHA 5JC8A 5TJHA 1LSOA 3TNLA 2WYWA 3KYDB 4BB6A 3ETDA 4NFYA 4CQMA 3KV3O 3TQHA 3V1YA 5TSDA 2FN7A 1XELA 1WDLA 5L9AA 5AXBA 1H6CA 3MOGA 1EE2A 4WPGA 4OYRA 4WLVA 5GZ1A 1OOEA 1A27A 3A4VA 4QSMA 4CQLA 5TT0A 2BH9A 4BKPA 5C7IO 3BXXA 4UREA 2C2XA 3ST7A 4DIFA 2CMDA 4NK5A 1K5HA 1U3TA 2BGMA 4E3ZA 2HK7A 4L75A 4O5OA 3O8QA 4KOAA 2AQ8A 3EC7A 4FQ8A 3DAFA 3Q2IA 2O7QA 4YAJA 4GH5A 3JQ7B 4YQZA 3PHLA 3KZVA 4D45A 2EJWA 4OSPA 2ZCVA 3VKUA 1CIVA 4N5MA 5C7OO 4QFDA 4FJ1A 4EJ0A 1B8PA 3DL2A 3DBVO 2PKRA 5HTOA 1P1RA 1SNYA 1GL3A 4OM8A 1O5IA 4CMBA 2PR2A 4ALMA 5JY6A 3KTDA 1HE4A 3NDJA 3JQGB 2VHZA 3HWRA 1LSSA 4CMIA 3PQEA 1KY4A 1EVZA 4ND5A 1IZ0A 2XF8A 3S2EA 3PLNA 4YDRA 3MTGA 2C5EA 4B7CA 4W9NA 4ILKA 4E12A 1Q7BA 1GTMA 1XEAA 3D1LA 4B3JA 5CEEA 5JY1A 3GRPA 4GL4A 3RUFA 1SPXA 3BMCA 3UKOA 5I7EA 5J23A 3KM0A 4E0BA 3W8DA 3U4CA 4M89A 5JLAA 4W82A 1Q2XA 2VRCD 4IGEA 3ZWVA 1LLCA 2C07A 5JYDA 4JCOA 3DBLA 4IQ0A 1QYWA 4MKRA 2RH4A 4XGNA 1W4ZA 4U7WA 5C37A 4PLZA 3NYWA 2X23A 1LRKA 1LC3A 2OBYA 4PLCA 1A4IA 2HJRA 2PH5A 3EGOA 1GYQA 3AFMA 1BSVA 4FFLA 2GPTA 3VVCA 4J1NA 4IZHA 2VWGA 5BSFA 2NWQA 3ASVA 4J2HA 2BGKA 4J7XA 5THQA 4YAKA 4PN3A 3CINA 1ZEMA 2ZYAA 3N58A 3SC4A 1GZ6A 2YFQA 1NNUA 5IDXA 1DC5A 4NJMB 1B0AA 3KB6A 4M87A 1ZSYA 2ZK7A 3H9JA 4A5OA 1GY8A 1DIRA 1ZJYA 4YRBA 1JU9A 4IDCA 3IP1A 1PJTA 3TFOA 2BFMA 1IE3A 4GGOA 5JAZA 3HE3A 3VOSA 1XSEA 4Z6KA 4XGKA 1Y8RA 3JQBA 2WD7A 2V7PA 2FSVA 3GF4A 3GZNA 1E3EA 1PQPA 5CEJA 1U9JA 1XDWA 5K9ZA 2C0CA 3L6EA 5HS6A 4B3HA 4XKJA 4NBTA 3OJLA 5ITWA 4CM4B 1DSSG 2X9GA 2XAAA 1N2SA 1C3VA 3ZWNA 3UW3A 3H65A 3ZH2A 1YO6A 3LC7O 2AQHA 3WGIA 1E7RA 3IMFA 4CLEA 4PRKA 3L9XA 3WNVA 4EBFA 1DIHA 2PY6A 3OQ6A 3ZV3A 1LSUA 1C0PA 1PGOA 1A71A 4EZBA 3ZNNA 5L4SA 3OIDA 3T7EA 1NQOA 2GCGA 4O63O 4BMVA 2CVZA 4CLDA 2C5AA 2I6TA 3RC1A 6LDHA 2A9FA 1T1RA 1GUFA 4TRNA 1D7OA 4JX8A 4ID9A 5KJEA 2C59A 5MGBA 4MVJG 1K2WA 1DC6A 3KO8A 3ADOA 4OQYA 5L51A 4QT0A 4B4OA 4FGWA 4JP2A 2GERA 3GUYA 5JDIC 1HRDA 5IDWA 2NACA 4E32A 5GZ3A 1F0YA 5GY7A 4BNYA 3I1JA 2RIRA 5JPIA 1N1EA 2Q45A 3RC7A 1R4NA 4ZQGA 3RROA 4DA9A 4K6CA 2JL1A 4HADA 4PVCA 4Y6RA 1Q0QA 3PYXA 3QSGA 1YL5A 3FF4A 2RHRA 4GSKA 4KUGA 8ADHA 2Z1MA 4K26A 4IDBA 3DONA 4I8XA 4OKNA 2Y99A 4YJFA 1X1TA 2X8LA 2Q3EA 4XJSA 3GDGA 2BF7A 1MXHA 2DU8A 4TVOA 5IJZA 2OP0A 4J1QA 5ICMA 5ICSA 3KETA 5CHEA 4XYLA 3D3EA 2P4QA 4IJKA 3OEYA 3GPDG 1M75A 1EE9A 4UVEA 3G79A 1ZZEA 2WJPA 1E6WA 1PJLA 1DEHA 4NBWA 1Y9AA 4FW8A 2P4HX 3HFGA 1YOVA 5IZCC 4L0QA 4EJMA 4Z0PA 1OMOA 2OFPA 4BIIA 1H93A 4DL9A 2B4RO 1WDMA 4KTTE 4JXKA 2OBNA 2PD4A 3PRJA 5ILOA 3RWBA 3D4NA 1OI7A 3HDQA 5DBGA 1VJTA 2YV3A 3RKUA 3H2ZA 3I6QA 1BXZA 1U2DA 2VHYA 2Y1CA 3WS7A 1NQTA 3WFJA 1GCOA 3LT0A 2DT5A 3PHHA 4BO3A 1U3UA 1ZXBA 3M2PA 3L07A 1SOWA 2CF5A 3CPSA 3F9IA 1D1SA 1BVUA 4E33A 4FFOA 2VCYA 4HWKA 4P8RA 1IZ9A 4UVGA 4NNJA 1VKOA 4E5YA 2YUTA 4MKXA 4LVUA 4R1TA 1WP4A 1YQGA 4INAA 3UCXA 4LSMA 4Q3EA 3HADA 4J16A 4ONEA 2EKPA 3E5MA 4J9UE 3GN1A 4GPD1 1LDGA 5DN9A 3GEGA 3VVBA 5G0WA 3VPGA 1QXSA 2WTBA 1QP8A 2IDZA 2D5CA 4IBOA 3QHAA 4HX5A 1JN0A 2I3AA 4D0RA 3WMWA 2I66A 3GEDA 3O03A 3VAZA 4OAQA 4YWJA 4EGFA 1RYEA 4L4XA 1E3IA 2FMUA 3A28A 4B4VA 1QMGA 3JV7A 3RBVA 2JD1A 1OC2A 4CV2A 4QFCA 3VPFA 1P1IA 2EJVA 5U4QA 3IQDB 3SLGA 4YACA 2VZ9A 4WLFA 1PWXA 4XR4A 4BL5A 1KYQA 5AXAA 2P91A 2I99A 4YT4A 2ZKLA 1ZK0A 2PGLA 1DOHA 4DTIA 1PJ3A 1M67A 1PJQA 5TT1A 4Z3KA 4RF3A 1DIGA 5T8KA 1UP7A 2G17A 2PZKA 2B4TO 3TRIA 1HZJA 3GGPA 4Y6PA 4AJEA 3AI3A 2DM6A 1RM0A 2NVUA 3GQVA 2Z1NA 5CP8A 5A3JA 4W6ZA 3RC2A 2EW8A 2DAPA 3I4CA 3RC9A 4H3VA 3TOZA 4A26A 3KLMX 2EKLA 2HLPA 3KXDA 1UAYA 4B4UA 1ZMTA 5BQFA 2Q50A 1AHHA 1JDJA 2QRLA 1H9AA 4PCVA 4XQ9A 2V6FA 2ZIZA 1GQ2A 3FNEA 1ISIA 3FTPA 5DF1A 3SVTA 5DNAA 4OJNA 4ZD6A 3FD8A 4YYZA 1BW9B 4BNVA 1H0KA 1F12A 4LMPA 3ZHYA 2GF2A 1KVUA 2J5RA 2GYYA 2Q1WA 4NFHA 4YRDA 3VH2A 3JYPA 5CFZA 3GK3A 4XQCA 4NBUA 1T2FA 3WSWA 3Q9UA 4XB2A 4J3FA 5A9RA 4ALJA 5A02A 2GZ1A 2Q2WA 1P0CA 2VYNA 2WE7A 4CM8B 1RJWA 3OM9A 3GR6A 3RI3A 1Y8QA 2W2KA 2DBQA 4LCEA 4P38A 3O4RA 4D42A 4RQTA 3FNFA 2H1SA 3OMLA 3VZSA 1C1XA 5TLSA 2HMUA 1NPDA 3BZUA 4IZIA 3H7AA 4NMHA 1CETA 1DRWA 4RZIA 1R4MA 3RFVA 4XD2A 4BNHA 1E1LA 3L77A 1NR1A 3MWDB 3INGA 1Y9EA 1MB4A 3HB4X 4MP6A 2Q1TA 1V6AA 4FN4A 2VHXA 1E7MA 3NX4A 1YB5A 3K30A 1DJQA 1R0LA 2UUOA 3IS3A 3QVSA 4EDFA 5KVVA 4GX0A 3R0IA 8LDHA 4Y67A 1XCBA 4Z9FA 3S8MA 4JP3A 1RYDA 1YGYA 1VL8A 5JXWA 1B15A 5HBRA 3TL2A 5FEUA 4CLOB 3GT0A 2DLDA 1L7DA 3ZU4A 2YY7A 3DBHA 5K6AC 1UXHA 4ND4A 1DRUA 3DTTA 1E3JA 1Y1PA 3F47A 4U8GA 2P9EA 4WLEA 5HS4A 3PVZA 1YJ8A 1UP6A 4UULA 1KBZA 1M66A 1ZFNA 2NTVA 3AOEA 3UN1A 4WCFA 2HSDA 1U4SA 4XRRA 4JBHA 3JQEA 2NU7A 3AM5A 3NTOA 4QX6A 1O9BA 1LDYA 1DHTA 5F1PA 1OAAA 4MIOA 3F5QA 1HDCA 1QORA 3PHIA 3JYQA 3C24A 4IJUA 1IOLA 1OFGA 3HN2A 4WLOA 2E37A 4R54A 2IE0A 4K28A 1Z6ZA 3ONDA 4OO3A 1PJBA 3O9ZA 2P5UA 1NX6A 1SMKA 4MINA 4W7IA 3RUCA 4ZQEA 1H2HA
chains in the Genus database with same CATH superfamily
4MCHA 5BRAA 4C9BA 3M6VA 3NNSA 1JG2A 2B8WA 2PUHA 5BNIA 1X1DA 3F8SA 2QN2A 3P2YA 4G5FA 4LHXA 2CC2A 4W7HA 2IFTA 5CNJA 1WMEA 5FKJA 1G3UA 3ONVA 5FA8A 1DAEA 1F1BA 4ZYLA 4EPYA 3SR4A 1ZH8A 1G7CA 1G66A 1NW9B 3I6ZA 5CLJA 4AJ1A 4QLBA 4X71A 4EKEA 2XA2A 3ER9A 3NVMB 3QOFA 4ZCQA 4CKZA 2XCQA 4QAQA 1QHXA 1W5AA 2I2BA 4DDMA 1CQXA 1L5OA 4RTJA 5F76A 3ZHVA 4G5RA 3QPVA 3AUAA 1HL3A 2VHTA 4MWZA 3UH0A 2AYXA 3JQ8A 4AF6A 3WFZA 1JAXA 1LF5A 5GINE 4MQFB 1I5RA 1UDWA 5K4GA 2BHNA 3PDJA 4B5LA 1KNXA 3PUZA 5ES4B 2WA2A 2J5XA 3OP4A 4LQ4A 5FHRA 1GGVA 4HO1X 521PA 3SKYA 3U4GA 2PX2A 1RLUA 1Y9DA 4KHZA 1S2OA 1C4WA 4K6FA 1GN9A 1UWLA 5IBPA 3CEPB 4H7FA 5DVZA 3BIXA 4H7HA 2RC5A 3QJGA 2HIGA 1YIDA 3AB7A 4NOMA 1KK1A 4RQAA 1C0EA 1SUDA 1I6KA 1SQ0A 5K3CA 2O5CA 3UJPA 2C5GA 2WJIA 3BSSA 3D7SA 4MRPA 4QA9A 2EZ9A 4ZJYA 3AF5A 1JI0A 2H07A 2UAGA 4NU5A 2YYZA 2EJCA 5JATA 3FCAA 4TRMA 5LA6B 1RQRA 2X7XA 1M6HA 3A3PA 3N75A 3O4HA 3PCXA 1ZGZA 4OA8A 3DV2A 4RPKA 3W5BA 4GKJB 3FBWA 3P97A 1V8BA 2VK4A 4Q37A 2ZLBA 4X91A 1RHKA 2WA1A 3I09A 4IZ6A 4MPDA 3D3JA 1KFJB 4KL8S 3MJHA 4CL8A 1BVYF 2IU3A 4N76A 1PJAA 4ISCA 2GM3A 5H82A 2CLOB 3BJRA 4YMGA 2FQWA 4M1WA 5DCUA 2I4MA 3W9YA 4F38A 1KOFA 5A5FA 2NZVG 3SZRA 5CXSA 3F3SA 3NP9A 3GLTA 3Q7SA 2QLTA 4F2DA 3I34X 1C7RA 2OENG 5AW5A 4B8ZA 4E4TA 1CHDA 2XOKA 3I32A 1G8YA 3H04A 4NPAA 3NV9A 1XA3A 4RJIA 2IBTA 5DHSA 1AN9A 1YKSA 2W4MA 4MVJD 3VHQA 1VIMA 1SUIA 2H57A 2JFGA 4JOBA 1FU4A 3HDHA 4IH4A 3M5WA 1IG3A 3A1SA 4PLYA 3O83A 5FBKA 3OZSA 1WXEA 4AY2A 4GZ6A 5A7FA 2YYYA 3OEWA 4NCJA 4HGZA 4MMZB 2JCXA 3DB2A 4H7PA 4AFNA 2XBLA 1HKHA 3KHKA 4TTJA 2CDCA 1G5FA 2GUGA 5GONF 2REQB 3EIFA 1SU7A 3F7TA 4RL4A 4EG7A 5C53B 4M55A 1OILA 3OIVA 2ZTLA 2FR8C 3A3OA 5FDFA 2Z9CA 5CJPA 3FRJA 5B3JA 1E61A 3OM8A 2RCNA 3BEDA 4K6GA 2GZ2A 2IS4A 5K03A 1DDIA 1ZZGA 2B36A 3EQZA 4Z9XA 1FVOA 1MABA 4E30A 5BVGA 5K09A 1W6RA 2PEYA 1T4DA 5FHQA 1GRVA 3WXBA 3FN4A 1UZNA 1LI4A 4NDNE 5COQA 5LZ5A 4MSUA 4C0HA 5IC5A 3NBMA 2VLBA 3Q12A 2AN9A 3EMKA 4FOPA 2Q3BA 3SKVA 4D8UA 3ZHBA 1AKWA 1U3DA 2P6UA 3DWIA 4FCCA 4B2PA 1OR8A 1TTQB 1ESZA 2GSDA 2UZAA 3EY9A 3OEHD 4FSHA 2J9YB 2QN7A 3AONB 3AQIA 3D4BA 2YC4C 2V7QD 2QVXX 2QU7A 3FI0A 4GU5A 5THXA 3ZVNA 3RSFA 2X0RA 1F48A 4EG0A 1UDBA 3QXSA 4URWR 2R8XA 4I36A 1LV7A 1YB4A 3MGCA 2I62A 2WC1A 1L3BA 1U1GA 1NFFA 3C8ZA 4TUYB 3WOHA 1BKYA 2FCAA 4GMHA 3RRBA 3IMGA 4I4LA 3UT5A 4IHJB 2OCGA 2CLMB 4MJ7A 2HREA 3MUFA 1A98A 3WAKA 4DCVA 2XMGA 3C70A 2KS6A 2Q4DA 4K7JA 3WGTA 4EVQA 1EDEA 1ZD5A 4LYFA 4UJ3A 5DRYA 3DCYA 1SUFA 4OQEA 5EZ5A 4X3CA 3SM9A 4V0SA 2OZPA 3KQLA 4LXUA 4YQEA 1NUTA 5EZYF 3X0DA 1J00A 3JASB 1DQZA 1FTQA 3K5PA 4DR4B 1W8DA 1L4BA 3RK0A 2HSEA 5E6RA 2RGNC 3AM1A 3E05A 3OA2A 2AX3A 4PBRA 4BJ6A 4EJSB 4HHEA 5GVRA 5KU1A 1KVTA 1R6DA 2FOIA 3EA4A 3G2HA 2GDJA 4OK5A 3KB8A 4EPVA 3QFCA 4WJZA 1ABEA 2IYTA 4QYMA 1PLLA 4GOXA 5HJ2A 4AKEA 3H2BA 3PDUA 1XMXA 4BV2A 3ASYA 3T35A 1S3FA 4ZOLB 4LHVA 3AI2A 4DVJA 4M0CA 1A82A 1S2MA 1TQ2A 2H4YA 2H8GA 4P1ZA 3W04A 4BNZA 1QRSA 2PUGA 5G2OA 5D6NA 1Q83A 3BE8A 3BTOA 4IFBA 2AC2A 4E6EA 4YRGA 4FM9A 4IDNA 2ET6A 2FTKE 1Q1QA 2DWCA 3ASUA 3HXTA 3RLIA 3V4OA 1DXYA 4HDQB 4XUEA 5F1YA 1DX9A 3ZKAA 4G5XA 5ITVA 4TV8A 1CY8A 2M1ZA 3O2SB 1UUFA 3PWTA 4GZLA 4PQFA 1O57A 5HFJA 4D0LB 2QAGA 3QJ5A 2NU9B 5KSWB 3FGOA 1ZHFA 5U1PA 3VOTA 1AGPA 5IVPA 1ZK3A 4M9RA 4BFSA 2IV2X 4Z4EA 3O8QB 3JQBC 3LLCA 3TGPA 2V74B 1FU8A 3P20A 4HX2A 2R4QA 5ESDA 5IJ9B 2B4AA 3TO5A 2CFOA 2Z8ZA 3EZ9A 4U2FA 3ZQ4A 1OFUA 4DUYB 3B6MA 4QVGA 4E94A 3CEMA 1L1FA 1M9NA 1XZQA 4PQRA 4XVUA 1EUYA 1CLUA 4J0QA 4R2MA 3KYDA 2B5VA 1B41A 3UC9A 2CLDX 3VGPA 4BNKA 1EX6A 1U0OC 4DMLA 3U09A 3OJCA 3ZWXA 3F5MA 5E0KB 1KMHA 2ADFA 1IXRC 3KDAA 1E2GA 3VZCA 2CXHA 5KI6A 3TTXA 5DNCA 3THYA 3V4FA 1YE8A 3C5HA 3AWDA 3AFIA 3EUAA 3ON5A 2FZLA 3ESZA 1AUVA 2NSJA 4WDQA 4YRAA 5A3QA 1RWNA 1V5EA 2O5EA 4CMCA 3QQ5A 3H75A 2H9IA 4JS0A 4Y2SA 4EHKA 1E6KA 4GO1A 2ZUEA 4TPKA 3M1IA 3N2NA 1T9KA 1GQRA 1TO1E 2IZ0A 3AHJA 1VP3A 3MHTA 4D46A 2Q1YA 4IEEA 2R8BA 5AVTA 1DKRA 4KWIA 3KB1A 3SJAA 1EFVA 3QUAA 4LOLA 1BO6A 2W0MA 3GRAA 3IJPA 5EMJA 4NCHA 1XBTA 2ZI7A 1TFUA 3WYBA 1XQXA 5B6JA 4CV1A 4YUVA 4RAQA 3DL0A 3ZWBA 3HN6A 3TIVA 3BL8A 3LY5A 3ZWKA 5C4IA 2PO5A 3BUSA 4PC1A 1UXJA 1YQ9A 3UM9A 4TQGA 5CBPA 5KNLA 2ZB4A 4AMUA 1NBME 1WF6A 4EW2A 3JQAD 3NBQA 2H16A 4Y30A 4ZPJA 2H5JA 2KLBA 3QSYA 3G0GA 4LDRA 1D5WA 3I2HA 4UBJA 4X90A 3RS9A 4PSDA 2Z6QA 1XKLA 3F6SA 1X2EA 2YMLA 3ORSA 3T7CA 3GFVA 2EYQA 2HMVA 2I91A 2ILVA 4EHHA 4GM0A 1WEHA 2WP8J 2ZYRA 4DOMA 4UAVA 3VZBA 2W43A 3R0VA 3K9QO 1E8DA 2YN2A 1M8JA 2YWDA 2FRDC 3ILXA 1KMNA 2YWEA 2H06A 2ZIVB 1RCUA 1ZOOA 4MV6A 4R1NA 4EAAA 2D5BA 4R69A 1TU3A 1L0BA 3AFGA 4N03A 2C1ZA 2PAFA 2LDBA 5J2UB 3RVSA 1RYBA 1KDTA 1KI4A 4IDFA 4IX9A 4RA6A 2ROQA 4K1LA 4TS1A 4X84A 2EATA 3I9MA 5E6UA 1GQYA 1MC5A 5DTEA 1R8JA 2XEXA 3PXXA 1QF9A 2G1AA 4G5YA 2O8FA 2JANA 2AA3A 1MB3A 4M54A 3LQFA 1V37A 2Z98A 3NAMA 4N7BA 3VDNB 3LY7A 3TR6A 1GG8A 1T3TA 3D7NA 3AF3A 5TV2A 4IHKA 1YHYA 2AYZA 1VPVA 3DUFB 3EVNA 3AVPA 3P26A 1QFSA 1WOYA 3C6BA 3RVOA 4L6IA 1QWSA 1K06A 2CHVA 2VOEA 3P94A 2DF8A 4XCXA 3ROEA 4DTCA 2WB2A 1YHZA 5EESA 5CW2A 3GFQA 1FIUA 1VKJA 1FC0A 2ABWA 3OPNA 4DSTA 2DTEA 5AHKA 1TM5E 2GXSA 2P65A 4NBLA 1G4HA 3ZU3A 3ZJTA 3EQ6A 3BGDA 3BOSA 1KJ8A 3I1FA 4L15A 3SS7X 3BC1A 1XKQA 4A8HA 3CBQA 2HD4A 1JLMA 3PC8C 1U3CA 2PANA 2O57A 2I8CA 3MWKA 2XKJE 1SCIA 1YCHA 1RBQA 3AJAA 3AO0B 2P7IA 2J9FB 3BCRA 2R86A 3MIIA 4Q9JA 1CUDA 2COKA 4BVFA 1B42A 4WNIA 4XYBA 1C3JA 3SXPA 3I92A 2JLRA 3F6PA 1QVZA 1P8JA 1GZ3A 2X3FA 1TYEB 3L43A 1B8UA 1RKXA 1YE5A 4TV8F 4L51A 3G2OA 3PYMA 5CB6A 3A32A 2HO5A 2QX4A 5AM5A 4UXJA 2KQUA 3PRHA 4GI2A 3RADC 4Z49A 4JLOA 5TVGA 4MP8A 3S0JA 3IKJA 3BQNB 5EUMA 4II3A 4HB4A 4Q4CA 2W22A 2YOGA 3D0KA 3FMGA 3FDJA 2AFVA 3E03A 4D4KA 1FUIA 1I5OA 2PBFA 2PSFA 2A9RA 3IIIA 3JWGA 4MA0A 4X1YA 4YYEA 4DLPA 1Z5WA 4KPEC 3PRKE 1U0RA 2Q0XA 2XVYA 3HVIA 4H9GA 3SM3A 4DNXA 1XU7A 2YQ5A 1C9MA 2LZ0A 1C7JA 2GF0A 1B0UA 1SHLA 2PIDA 2V7XA 3CUSA 2W6ZA 2VT6A 5JSQA 3B6JA 4QFMA 2GKGA 3NWPA 4INOA 1K5GA 2OXEA 2JRLA 1P6XA 1YTUA 2G9ZA 2POQX 4WADA 5EP1A 1ZYUA 1WUTA 5JJBA 1VI6A 4U7FA 5GMOA 3B36A 4ARUA 3H17A 3IP5A 1SBTA 4GXQA 5LMZA 2YYSA 2NTEA 5AHOA 1EGHA 2VN8A 2ZR9A 4HNTA 1E2BA 1JU4A 4AZWA 3OU2A 5H3LA 1QIHA 1QLJA 2D59A 4ND8A 3FTQA 3KOZA 2QRQA 4HWRA 3A6PC 4A2QA 4LE0A 3W4IA 3PWSA 4XPIA 4H3KB 4UHCA 3JY6A 3B82A 4YHHB 1C8KA 2YZGA 2Q0SA 2W6PA 1I7QB 3MRSA 1WEKA 1E3LA 3WQQA 2C7PA 2VQEB 5IUNC 1NKSA 1MPTA 1W4RA 3HR8A 3AF2A 4ETIA 4EARA 5JZ9A 2P67A 3RJZA 3V4VB 4MQEB 2XYQA 3OI7A 4EO4A 3SN6A 5EJFA 4L16A 5DP2A 1A8UA 2BDEA 3M5PA 2ZE6A 3U40A 4GRAA 4LMBA 4BLOA 4OF4A 2HT6A 4PLHA 3L8ZA 4QJ5A 3T4XA 4EK9A 4GEKA 3QYFA 1KHTA 2JGAA 3GB9A 1V4BA 3FWZA 4Z9YA 4ZCRA 1M8GA 1G1MA 2QJOA 4WLNA 1I1OA 3CHYA 4OHUA 1HURA 4R16A 5KDDA 2ZSAA 3HVHA 2R60A 1OI3A 1OAOC 3LGAA 3GA7A 1WB9A 2VQ6A 3TBFA 2PCJA 1ADFA 1RQGA 4IS2A 4Q15A 3T1QA 1JEJA 2CFSA 3HKCA 4O02B 3RFCA 1HRKA 1NJFA 4DYVA 5C80A 1HDIA 4YA6A 3VDRA 1SHKA 1X9IA 2KSQA 4LY6A 5HCIA 3D7LA 3TR5A 4B45A 4EY8A 5TX7A 5DGIA 3GPLA 4IF4A 4O5AA 3RVDA 4BRSA 5BURA 1SRRA 2X0FA 2H2DA 4NBRA 3TSOA 3IO3A 1KGDA 5CA0F 2CYCA 3WGVA 1QONA 1E1QD 4ZALA 2YMPA 3GZTB 2CK3A 3FOWA 2EQBA 4KH1A 3RFFA 2WW8A 6REQB 1K7FB 4YAIA 1WNTA 1B2RA 1D8AA 1GUYA 2VUHB 1AXGA 5AHRA 2CNWD 1WXGA 1ND5A 2IDKA 2UU9B 1FYWA 3ZGZA 3QKSB 4RK1A 2R97A 3JD0A 1USKA 3FCYA 1Y5RA 2FW9A 3DE5X 3GWGA 3NEAA 3MELA 3NOVA 1JFRA 3T12A 4E1VA 1PUIA 3U7RA 4JROA 4DLTA 3TF5A 1Y3FE 2BTQA 3C14C 1KFBB 1KU0A 4HDRB 3JQ9C 4NFSA 2G82A 5KTSA 1L5WA 1PT5A 1WABA 2F59A 1E77A 1SB9A 3IBSA 1B7GO 3HWX1 4IV5A 4BNUA 1KQGA 1YRBA 4D3YA 2PPLA 4ZU6X 2GEDA 2OLJA 2O1EA 1EAYA 1C29B 4ZQBA 3U61B 1KRXA 1X77A 1RM4A 2A4KA 4G0UA 1MJ5A 2A4MA 3HHEA 5AHXA 5CB4A 1QANA 3CIFA 3DDHA 1Y3CE 2XDWA 4M3NA 4PNPA 5CH5A 4DR7B 2OQIA 1BDBA 2XJ9A 2XWSA 1RXUA 4XI9A 1WA5A 4J0GA 3Q3JB 4X54A 5CYFA 5AOBA 4KLAA 4BBPA 2AQKA 1G7SA 4DJJA 1XPOA 3N1UA 4TWRA 1T3SA 3WGQA 2RGDA 2GAOA 2IQIA 4MDFA 1JJVA 2HLDA 3UGQA 3UNXA 2HA2A 3SE7A 5BNZA 4XM0A 1NV9A 3MJEA 4X24A 4U7PB 4U3JA 5EWJB 4FZ5A 3SPXA 4Q9AA 1T2EA 1BMDA 1P74A 4HNUA 1OC4A 1O6FA 3W3AH 5JDIA 4G2TA 3T9AA 3MINA 2H4XA 4A6EA 1NI4B 1QDUA 4MLCA 1QHHB 1ISHA 1RYMA 1POXA 3FJYA 2F00A 2F9FA 2HRCA 3GG2A 3PEFA 4X8LA 4BATA 4E31A 5FUQA 5H8WA 1PGQA 1R9JA 2OD7A 5FBWB 1SN7A 2FDRA 2OHXA 4Z1MA 2FCRA 1T2AA 2OORA 2RHDA 2Q5QA 2AHRA 3I01M 1LF0A 3MVEA 5ALEA 1Y8ZA 3FSJX 4AZSA 2A9KA 3FUVA 1T4MA 4IQFA 4MRRA 5K8LA 3E2MA 3RFXA 4BYMA 3CLTC 3OFJA 4LOJA 4CKWA 3DGEC 1I3OA 4PWYA 4XYEA 3H2SA 4DG5A 1BHO1 3PNVA 1U3VA 4QPZA 1SM4A 1UBKS 2CY0A 2FQ1A 1E4VA 3VQTA 2RH5A 4QJ3A 2E1RA 1M5TA 2D74A 1IN5A 4YAGA 2UUPA 5EI5A 2AX4A 2OBMA 1RP1A 5EP2A 4C3OB 4M1SA 4RDIA 5BSEA 5I6DA 5LYJA 1GITA 4IJQA 2EVWX 3V33A 1W44A 2I6SA 2Q6VA 2CDAA 3GRYA 3CZ4A 4WY2A 1IJEA 5DMXA 4AD8A 3AEYA 1B16A 1CQJA 5HKKD 3W6ZA 3OOEA 3T1NA 3CN7A 5FUMA 4F72A 2INGX 4M1QA 1H6BA 1RTTA 1VPDA 2HA5A 4QGGA 4HT3B 3HA7A 3IDZA 1QQ7A 4XPZA 4EKYA 1KPGA 5HM8A 2AXQA 3T7TA 3WNQA 4URVR 1UJNA 3D7MA 3OT5A 4O29A 1XNGA 3HXLA 4BQFA 4GMKA 1PX0A 2G1UA 2I33A 2PVCA 2PZAA 2ZRMA 3D7KA 3C8HA 4YP6A 5H1YA 4ZIRA 1FZQA 5CFMA 4MR8B 1O6BA 3LPDA 5I7WA 4EHIA 221PA 3EAGA 3STVA 1J70A 4R51A 2R6CA 1WBBA 1CS0B 1UBHS 4JXXA 2ACEA 3DPUA 4M99A 1DJNA 3KZ1E 2G9RA 2VPWA 4I08A 4JNCA 4QBTA 4Q9NA 3MNFA 5F77A 5HF9A 4OKSA 4AICA 4BQOA 1FP4B 3HZHA 1DDGA 3ELWA 3JD2A 1OZFA 4TTTS 1R0BA 5CXQA 3ZXSA 3KJNA 1RQ2A 1H2XA 1PK9A 1DPGA 5KDLA 1CX9B 3FVVA 3HP7A 2YFHA 2FPIA 3HRIA 1H5NA 4NDAA 2RHTA 3MWDA 3NDIA 4QQRA 2OILA 4AUEA 5BWBA 2QZSA 1C7ZA 1T0IA 3A2NA 3GGCA 3N74A 4JSYA 5HHTA 4UNQA 4CMJA 2O0JA 2HPHA 1N5LA 2XUDA 3R7LA 4B71A 3P0RA 1E8MA 1RPAA 2QLLA 3WFIA 3K6SB 5HJ5A 3SG0A 1F6DA 1U0JA 2FUNB 1XDUA 3VVLA 3IDAA 4AG3A 2CFRA 2UVPB 2HU2A 1H69A 2L82A 4J94A 1WSAA 1LBIA 5EMMA 1Z73A 4K9KA 1GOTA 4CLOA 4DR5B 1GDHA 1PGPA 4EUKA 4CEIB 1JPJA 1H5QA 2C94A 2WT8A 3QX3A 3EIQA 2FJ0A 1ORRA 4NXMB 3WGNA 1XRMA 1V35A 2IYWA 3PX7A 4YX9A 2XGJA 2J8ZA 1YGPA 4R81A 5GZ6A 3ZV4A 3PE3A 1YULA 2L17A 4WEQA 1NASA 1GTVA 1VPWA 5EWMA 1GAEO 4IPTA 1P3DA 3A6GA 2BZGA 1VE7A 1R10A 4HRAA 3ZV5A 4WZAE 1MLDA 1G21B 4FIDA 2P2NA 1XYGA 1EM8B 1UFRA 2XMQA 4RD2A 3WLSA 4P22A 2X0IA 3IIEA 1CQIB 2HK6A 3OD1A 3SICE 4BFTA 4DMUB 2AJBA 2ZXEA 1XOIA 2CXPA 3OOSA 5K05A 1L7EA 2VNJA 3P9ZA 1DX6A 2A86A 3TFWA 4XX1A 1G1AA 3EBPA 4FKMA 5F5XA 2A35A 4CLRA 3GFBA 1T15A 2X2OA 3IAXA 4D1YA 4D8VA 3SC6A 4LYEA 3GLHE 1QLHA 4EGQA 4OQPA 2X6RA 3A1VA 3KT6A 1Y7LA 1RR6A 2QP3A 1TMYA 1A7KA 2OZKA 4Q02A 4CV0A 3KEGA 2CBGA 1KQFA 1SKYB 1YAHA 5EE9A 4FDVA 4INZA 4Z0NA 4EVRA 4UUPA 9LDBA 5EJ9A 1CUGA 1LLUA 4N54A 1Q0TA 4EYGA 1X19A 3TYXA 1VA5A 2G25A 2XE7A 2TECE 1OKKA 4MWGA 3N8NA 5U9CA 4RPLA 4EW1A 5JSFA 2JIBA 3GCWA 4BKQA 5TPWB 1JSRA 3JRNA 3ZHCA 4KO3S 4O2RA 4BNLA 3DG9A 3KQQA 5LYJF 1K8ZB 5EKSA 2RAFA 4PANA 4Q1VA 3DW3X 4MJLA 3INTA 2Q9UA 3R3HA 4MQFA 1ZI6A 1U5AA 5F1OA 1GIAA 4CCSA 4I4TF 1M5RA 4KWCA 2NZWA 2VZ8A 4NJEB 4Q39A 3FTEA 1U7WA 2PA3A 5EIWA 1O0CA 4XOUA 3HVKA 4O1MA 5ENVA 4EY5A 2EEZA 1I0LA 2HJGA 3HWWA 1XMPA 2CL5A 5EGSA 4J1TA 1NMEA 2FXIA 3FPAA 4PV7A 1JMYA 1ZOPA 3CMMA 2W42A 4XQEA 4IIGA 4IFIA 2Y93A 3ROPA 4R2WA 4BMXA 2W8BB 3U56A 3C6KA 2IEZA 3VSBA 1HQCA 3DOEA 3H3JA 3MIZA 1QZ3A 3VR4A 1QH0A 2GGSA 2XNKA 4TM8A 4D4GA 5DNEA 1FMCA 3ZG6A 1QDEA 5KYNA 2BI8A 3A6JA 1P39A 2RGXA 1Z5NA 3QENA 4WTOA 4BO1A 5A4MS 1OJLA 2VDNB 2GD2A 2PMDA 3BERA 3HR7A 3FRIA 5LA6A 5K3AA 3BX1A 5BUZA 3IPLA 2VNAA 4U02A 4DRXA 4KXMA 3D8SA 4Y6OA 5JYBA 4FMDB 5IYZF 4KQXA 5JZMA 4F5WA 1Y82A 2VBCA 3Q3EA 4AXBA 4C4OA 4LZOA 3AHCA 5KOJA 3F7NA 3FA2A 1KERA 3K0AB 5EERA 4UPEA 2IUYA 3N5CA 4C7MA 4CV3A 4DBLC 2YHIB 3PQ2A 1E3MA 1IVSA 2F3TA 2GO1A 2I55A 1PAUA 3I5AA 1XCLA 1TTHA 3RD5A 5FXMA 4KACA 1JKJB 1Y9ZA 2ZTHA 4PC3A 3ORQA 1UKBA 5T41A 1KZ9A 3RBXA 3PHBE 3KCQA 3WLNA 2Y1EA 3MD0A 1GAXA 1O94D 1MPXA 4A8PA 4PLGA 1UJ4A 1F8YA 1W9MA 2ZSKA 4YR7A 5LP1A 3OMWA 1D2CA 1P1HA 1A9ZA 1JDSA 4X7PA 4ZEVA 4FT2A 1VRWA 2HWKA 1X86B 1YZYA 1YONA 2ZGVA 1ZRMA 2FE1A 2PL3A 3EXAA 3FOBA 1NAHA 3G9TA 4PS0A 5T5QA 4DPKA 1OZ0A 5CX1A 3FUUA 1XMIA 1B23P 2H63A 4IH1A 1REQB 3HDJA 3O0DA 4WDRA 4BHTA 4PG6A 2O3RA 5LB4A 2PFKA 2P62A 3PX3A 2PGXA 1AH2A 5ALQA 3M2TA 3N8KA 4P83A 2VQSA 2GYUA 2IEGA 3ACCA 3MFQA 1CNFA 4ZCMA 1GPDG 3DZIA 2XDYA 1F6WA 2CVFA 1N25A 4IVRA 1NW5A 3OM1A 4I14A 2C9BA 5AQ1A 1FTYA 4GT1A 2FSSA 3ZV7A 4FYMA 4HVAA 4ZVLA 4QOEA 1ECLA 2QMOA 3K6RA 4LSZA 1DGQA 3ENVA 2HQ1A 5NLLA 1M7GA 1TMKA 2FYTA 2XNHA 1LPAB 3NHJA 2NV6A 4MRAA 1IBSA 4BNJA 5KYKA 1FDUA 4C5BA 2IEAA 1YS4A 1P17A 2W4QA 4LA4A 4PEVA 1JDVA 1G20E 1MC1A 4EKNB 1ZISA 3SHOA 2YBDA 2XQVA 1WTAA 2VRNA 1U6JA 3L41A 3WYEA 1C8BA 1U3GA 2ORIA 3HLYA 1ZM7A 3TTTA 2ZTVA 1QFZA 3BMOB 1G5PA 2Z6UA 2V1UA 1E2JA 2C58A 4KGZA 5DBHX 1X70A 3DFUA 3CJTA 3WYDA 3QVJA 1SQFA 4OFWA 4JYPA 3FETA 3C3BA 5C5CA 2IS2A 4LYGA 2YVKA 1WU8A 3K1TA 4LNAA 2FSUA 1EM6A 4TKVB 4TUYA 2XUKA 4MWCA 1WXFA 3I9JA 4C89A 1ZN2A 4MPPA 1BDMA 4DLRA 4IHJA 4LWQA 3NR2A 2D7DA 3DKIA 1GTJ1 2EWVA 3CPJB 1I4OA 3RG2A 4CMEA 1JG3A 1LTKA 1P0MA 3KUXA 2QD3A 3VSDA 6NULA 3O0TA 1JIUA 4YXFA 1XTUA 2HTFA 2O3JA 3LF2A 2HHHB 3FYUB 4NECA 3EFBA 4NESA 3L6DA 5LP6B 1I4LD 3PWKA 1KSHA 3JASA 3KVYA 4F8YA 1TC1A 3ZJVA 3DZDA 1DC3A 1NDHA 4EJSA 2XOKD 3DXZA 2Y92A 5C32A 2RGEA 2P9JA 3RU7A 1QAOA 3NTLA 3FPHA 4D9JA 3NANA 3K09C 3P9QA 5AVJA 4WZ6A 3HTXA 4KIJA 4N3AA 1WIWA 2B30A 2YV5A 3U3KA 4MI3A 4C0AC 3WIBA 5IM4A 4YGYA 1V39A 1QMPA 4RHFA 4ZOLA 2FSVC 1WZUA 5CH8A 2IPAB 1VKHA 2WEKA 3QIAA 1OT3A 2QN6A 1OYWA 3DHNA 4EKGA 4C6HA 1BZYA 1JFFB 4GMDA 1Z6QA 3DBOB 3QVKA 4KQWA 13PKA 4TQUS 4ES6A 2Q4RA 3KPUA 5F73A 1SC6A 1KWKA 1KOLA 1VE5A 4V0ME 1QHNA 1AKEA 1UXIA 2C4NA 2OV6A 3L1VA 4XPIB 3QPWA 4ZI7F 4TKZA 5LZ7A 1A9YA 1IM5A 1QYXA 3K9HA 1YC2A 4GBJA 4GKBA 5CH3A 1L8OA 1PVOA 2J7KA 2YV2A 3FVQA 1E92A 2XSZD 4AJ4A 1IUOA 2J4CA 2NU9A 1T0HB 2ZI3A 3E53A 5HKLA 3I0NA 5TC4A 3K94A 5TDHA 3M6AA 3T3GA 3AKEA 4QVKA 5JPDA 3O3CA 3BYZA 2J41A 5ERYA 2XCSB 2Q2VA 3ZLBA 3DMTC 1UZUA 5IJ9A 3EIWA 4MQBA 5AVOA 3W4KA 2ZSIA 1UPBA 4RDHA 5JHHB 5L4NA 3SOZA 3QF7A 4JDPA 3WNCA 3D02A 2QBYB 3T61A 2R62A 1YV9A 3I83A 3CWZA 4GECA 3WWYA 4NZNA 1EESA 4CLHA 3KQHA 1FRZA 1HFEL 5EE0A 1HYBA 2FWAA 4GX2A 1OCEA 4IFTA 1CR1A 1XDBA 2XA1A 3ZQKA 4BLSA 3QEBZ 1JZQA 2ZS8A 3L7JA 3HJGA 1LDMA 4R8VA 1U9YA 1D8TA 1NR5A 3JARB 3TBKA 1ISSA 4QTTB 4B84A 1V8OA 2ESRA 3CSDA 1NSYA 1RT9A 4JUIA 1ABFA 2OSVA 3OHMA 2OYRA 4N7JA 2YR0A 2JGDB 2FF5A 2PWZA 2EZ4A 1ZMXA 1NN0A 1LJ8A 2ERXA 1TZCA 4ARZB 1MVLA 1XWIA 2VDPB 3JATA 4HWTA 2JGJA 5JCXA 1ML3A 3EXG1 1CZOA 1DBIA 3TQTA 3LT1A 2AZ4A 4RTSA 3DOJA 3KB2A 5D7BA 4DM4A 3NJ4A 3T1YB 3ABQB 4U1RA 2ID9A 2WJYA 4BNDB 1Z0UA 3BICA 3DF7A 1RU3A 3IILA 3KK0A 3LLSA 2H5LA 4UVIA 2APJA 2XTAA 1WUHS 4P4SB 5D84A 4CFSA 3GJYA 2IEYA 4XM1A 3WGJA 4DGQA 5ADWA 1IUKA 1Z2CA 3QNWA 4LI0A 4BXOA 3BMNB 5HXAA 4ND6A 1L4FA 2WFLB 3ESXA 3I01A 3K2EA 5EUBA 1AKTA 5GJVC 3H5IA 1OROA 4MV3A 3U5ZB 3LGSA 2CNBA 3SZ3A 3LRXA 3R4CA 1B2LA 1G9SA 1RPTA 1P18A 2CW5A 4H1VA 1ODIA 3ND5A 1Y1LA 1JWBB 4C4AA 2V54A 4H18A 1CDEA 5DYWA 4AMZA 3A4YA 2RK6A 1K4YA 1AQIA 4JUDX 2GAAA 4ND2A 4NYJR 4JC4A 4MGZR 1UDRA 1R88A 2Q0HA 2GBPA 3TMAA 5J2UA 2IX3A 1O6CA 4NRDA 2FF7A 4IIYA 4WRRA 5IJWA 3MCWA 5HVNA 4TKLA 1ZC3A 5T4EA 5HBGA 5DM70 1N78A 2X5KO 5AO9A 3IP3A 4CM7A 3ONEA 2WPDD 3O8RA 1VSVA 1GCUA 2MSWA 2PX6A 2OM6A 1HF3A 5JS2A 3DUFA 5KJ6A 4GIBA 3HSSA 5CNIA 3HA2A 1C4XA 1E1YA 6GPBA 3ZK8A 3DAHA 2MINB 1YKGA 1MJHA 4F1KA 3NONA 3P45A 4X95A 5H4HA 1BDHA 1T9ZA 2X5XA 5AVUA 1KJ9A 1MD9A 2F1JA 4IDEA 3D6TB 4MQMA 4ZTUB 3IB3A 1CUUA 2GBIA 4IWXA 4II7A 3NIDB 4UBMA 2W6ID 2F43B 4BX0A 3ITNA 2HCRA 4DMHA 1DAKA 2RI0A 2I2WA 4X0EA 4D3SA 1KY5A 1BGVA 4B17A 1N6RA 2ZJ7A 2B6NA 5EHZA 2A8YA 2J9FA 2PH1A 2IYFA 4G6ZA 1P4SA 4MUGA 4U0KA 4CKBB 2WIJA 5KJ1A 1IBMB 4YO7A 3RSOA 1A5TA 1WKBA 5SYNA 5EJ2A 1AHPA 3NEYA 1EK0A 1JIXA 5M3BA 3K6KA 3VA7A 2OVFA 1MFZA 3VKVA 1XVVA 4BNNA 4M7WA 2C9DA 4DMCA 1JL3A 2OGZA 1XJ0A 1QU3A 4RHXA 4LIPD 3DD1A 3PXUA 4RVSA 3WC4A 2CMHA 1Y80A 3TRKA 1AKMA 1Y81A 4BDTA 3AW9A 3WKDA 4ZAZA 1R18A 3CXUA 2ZUSA 1W4LA 3ZHXA 3V8EA 3VC1A 4KFSA 3KHTA 2D13A 3W1WA 1XTIA 3BXHA 5ALRA 3KLBA 1J23A 1THZA 2HC9A 2G5PA 4ZVVA 4KYTA 2B4QA 5KVQA 2CUKA 4JQYA 1EVYA 3D1JA 4PZYA 4XUDA 3IVAA 1R8QA 2Z4RA 4OXQA 4DLBA 1W2HA 1JLSA 2C31A 1Q12A 2JC3A 1OE0A 1E6MA 4K9PA 4BNTA 3ZDBA 3OZXA 3D4LA 2XIJA 3NOOA 1ZUD1 2DBVO 3F6RA 2CEKA 2BEUB 2WZCA 2FFRA 4FOTA 3OWXA 4DMGA 5KTYA 1GV0A 4M1MA 1KH3A 3C4VA 3H84A 3K8QA 3RM3A 3TOVA 4ZVKA 1YOVB 2DQYA 4LGYA 1V8DA 3TPCA 1CRPA 2XQIA 4F45A 4RETA 2RSLA 4ZREA 4NL4H 3K5WA 5G0VA 2H3HA 1FVHA 1V41E 4LQCA 1JQDA 2RH9B 3ZWOA 4HR7A 2BR5A 3EW9A 1I0IA 4WJKB 5J5CA 1VMKA 4G5OA 3GFGA 4X6XA 2QLBA 3FWHA 2VS1A 1ZRSA 1AUOA 2B4YA 3EG5A 3UKDA 5AI6A 4NZMA 2A92A 2Q3DA 3B6ZA 2CBZA 4YV2A 1TCBA 1Y1KE 4O4HB 5D5PA 3IJEB 5BRJA 3ED5A 3P4XA 4MQEA 5KTOA 3Q6MA 5D7NA 2ZBPA 3WGYA 1EQUA 1D7AA 5ED4A 2A0XA 2TRSB 5LL6P 1T1EA 3K9CA 1FFAA 2VIIA 1FCJA 3L0CA 1Q7TA 3I2GA 3NHPA 1R37A 4FYHA 3HYSA 2C3YA 4NCXA 3RS2A 2ZRGA 3ONWA 3RVMA 1JIJA 1V5WA 1TE2A 5K0CA 3OFVA 4ZYTA 3ICVA 3E9QA 3DDCA 3VVMA 3Q1LA 3DLCA 3U6KA 3ZCQA 2AEEA 5I5GA 3HKEA 5F3RA 2GKSA 4LN1A 2CZCA 1PRYA 2R4UA 4FCTA 4CIDA 3I76A 4DUGA 4ND1A 4YECA 4UW9A 2V96A 5E4JA 3L5KA 4B2YA 1TYDE 2I1WA 3CE9A 4MIYA 2FZVA 4NLLA 1QC5B 3JR3A 3NGLA 1JZSA 1YJBA 2HZBA 5SY4A 3MEQA 4DR1B 4F3TA 1R8XA 3PQ4A 3BZBA 5FTWA 1Q74A 1II8B 6REQA 2GTPA 1JHAA 1EAMA 4KO8A 4ZJUA 2FI1A 1SKUA 5FI1B 1Y3IA 2QMHA 4ZCPA 3X1JA 4NH0A 4BUZA 3GXOA 4KKVA 3WWPA 1BA3A 1ORIA 2BM8A 2OD9A 2IV3A 4EL0A 2GZDA 3JQCA 3CS3A 1RWWA 4GS5A 4RCVA 4Z0TA 2DP4E 3VC3A 1RZ3A 3VDMA 3LUDA 4KE6A 1ZWKA 2JLYA 2VHJA 3AOEC 2MYPA 4JXJA 1GNSA 3SS8A 4QZVA 1Q50A 3IQIX 3LKBA 1JEAA 1JF8A 1HE1C 2H2HA 3K0CC 3KKQA 1G8SA 1H22A 4HDRA 4B33A 5LUAA 2BR3A 3DMFA 1C1YA 4NV3A 1T91A 3BIOA 3ICCA 3SQMA 4BC0A 2RDMA 4S05A 2CKDA 1LZLA 2W7TA 3DM5A 1Z6TA 1V3QE 3ZTWA 1R5JA 2BFEA 3M4JA 4G9GA 5T3UA 1V95A 1OH8A 2V55B 1GUDA 5ETJA 4M8KA 5BQ5A 3GEEA 1W19A 3BHNA 4MVWA 4RY8A 3FCUB 3O3NB 1TX4B 3SZLA 2OCDA 4TL6A 1EK5A 2CVOA 3NTVA 4JLUA 5K3EA 3OTIA 5ALUA 2PQ0A 1Z0IA 4GD3Q 3OCZA 4ALIA 1DL5A 1WG8A 4K9MA 4OFXA 1VGQA 4B1FA 4Y9TA 3S2IA 3K05A 3A7EA 1WZNA 4W5NA 2FX5A 4PAOA 2G71A 2L2QA 4D44A 4RSHA 5LYYA 1WB5A 5JO9A 5T3YA 2VC2B 1TM1E 3WLTA 2OK7A 1PO7A 4RIEA 2FSFA 5B12A 1AUQA 4DMMA 2J9XB 1U2RA 3I3OA 3KL4A 1E2EA 2H54A 2ARKA 2YYAA 4LY9A 4JR2A 1PZEA 1NI4A 3GCGA 3HNPA 5FOQA 2GNOA 1UJ2A 1QHHA 3IESA 2X2FA 4FZRA 1B6TA 3OPYA 2XB8A 3GUCA 5KNDA 3B8HA 4V0KA 1DC7A 1OAKA 3DOIA 3SWWA 1JNXX 1X94A 3W4JA 2PXAA 3CRNA 5IP5A 3EIEA 4F6CA 4D4HA 4YYZA 2IIPA 3FBTA 4I50B 4AQDA 5B30A 3EVFA 4E09A 1P9WA 2QVZX 5FA6A 5DWVA 4M6WA 4L9WA 2QIOA 2P4SA 2Q2NA 1LBSA 1DAFA 2FN8A 3A1UA 4ECEA 4BFLA 2P8JA 3RJ5A 1HO3A 3HCNA 3B2EA 2AMLA 4CM1A 2AG1A 5JT1A 4OHFA 3SNKA 1XP5A 5ALVA 3HUUA 1WMAA 2NPIA 1DAPA 3KR9A 3Q4GA 2IJGX 1YQEA 1I6WA 1F38A 2IHBA 3HVUA 5AUPB 9ATCA 1XAIA 4F5YA 3UHFA 1V7CA 5ED0A 1JSXA 3RUIA 1SR8A 1ODLA 3X2EA 3W9SA 3PPWA 2FWNA 3PUVA 5PNTA 2C7GA 1EWRA 1PZNA 4MV1A 5E1DA 3GFFA 3DBHB 1Z8FA 2F67A 5H70A 1T25A 2BBWA 4YWHA 1BXRB 1F51E 1MC8A 1VJ1A 4X61A 3WSTA 4NWIA 4TTAA 1GPWB 2SKDA 4GGPA 2JFVA 2Q5HA 4RA9B 3ROKA 3UUEA 4A6PA 3C0KA 2WSBA 2JI7A 4HYEA 3RTCA 1EJ2A 2B21A 4OK6A 2XGMA 3EC2A 1P5JA 3NS7A 3Q2OA 4FYXA 1T8WA 1VLZA 1XJQA 1BX1A 4L9SA 4NP6A 4UEOA 3VJRA 4ARAA 1A8QA 4Z7JA 1NIPA 1ST3A 2D8MA 2ODEA 3ANTA 3EBOA 2OCIA 2QTGA 3PIIA 4ZQHA 2NAFA 4I1IA 3PF8A 4I19A 1YJQA 5HIJA 3ZHRA 4HPXB 1FP4A 1WCV1 3DZGA 2HLDD 4H27A 4R6XA 3TW6A 4WD3A 5EL0A 1AU9A 4P82A 4TMFA 3KYJB 5CUQA 3R5XA 1ECFA 1KDZA 2E4XA 5D3MA 4QGSA 2C9CA 1BCRA 2W8ZA 3MRTA 2C2HA 4Y2PA 4QREA 4OP3A 2IHZA 1UBMS 1GAQA 4IY1A 4JBGA