3BMCA

Structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (nadp+) and substrate (folate)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
267
structure length
248
Chain Sequence
EAPAAVVTGAAKRIGRAIAVKLHQTGYRVVIHYHNSAEAAVSLADELNKERSNTAVVCQADLTNSNVLPASCEEIINSCFRAFGRCDVLVNNASAFYPTPLVGKTVETQVAELIGTNAIAPFLLTMSFAQRQSNLSIVNLCDAMVDQPMAFSLYNMGKHALVGLTQSAALELAPYGIRVNGVAPGVSLLPVAMGEEEKDKWRRKVPLGRREASAEQIADAVIFLVSGSAQYITGSIIKVDGGLSLVHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pteridine reductase
publication title Structure-based design of pteridine reductase inhibitors targeting african sleeping sickness and the leishmaniases.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Oxidoreductase
total genus 88
structure length 248
sequence length 267
ec nomenclature
pdb deposition date 2007-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3bmcA00
4R41A 2P9CA 4R51A 1NX6A 4ROSA 2JCYA 4D3DA 4P8RA 5A5FA 4YJDA 2D0IA 2NTVA 5JBIA 4RPGA 1NP3A 1GYQA 1ONOA 3JCZA 2B4TO 4RVFA 4X54A 4KUHA 4MVJE 4KQWA 2VT3A 4NH4A 3ST7A 1YDEA 3AOEA 2BKAA 5I9MA 3U49A 3QY9A 4E30A 4EI2A 2FSSA 3KOUA 4OQYA 1PJBA 3PWSA 3JTMA 5A9TA 4Y98A 3CE6A 2PD3A 3I83A 3I5MA 1EMDA 4ZRMA 1N92A 3KXDA 2P5YA 2NU8A 3ZWBA 1HEUA 2Q1UA 4XX0A 4RPJA 5KCZA 1M6WA 1TA4A 2VYVD 2C5EA 4DLBA 5BSEA 1B7GO 2GUGA 4FD3A 4UULA 3O38A 4K1LA 1K0UA 3PZBA 3TL2A 2NVBA 4UUOA 2H63A 2O50A 1KC1A 1YO6A 1T1SA 3CZRA 4ZU3A 4E33A 3L6OO 4JBHA 3G49A 4Z0HO 1M75A 1YOVA 1ZEJA 3ON5A 1T2EA 1BXGB 1C0PA 4NFYA 4B7UA 3GG9A 2PH3A 4MVJA 3OH8A 3OJFA 3KEQA 1LTHR 3PDUA 1GD1O 4UEOA 2HO5A 4YJHA 3ONDA 5TT1A 4F46A 3VPHA 3A1NA 2ET6A 1K6XA 1KEVA 2PD6A 3DZHA 1CIVA 2G5CA 1NR7A 4PLWA 3A9WA 1E0DA 3OSUA 1KBZA 1NWCA 2FY8A 3H3JA 3ROKA 3ZV6A 5ICMA 4EUEA 4GBJA 2DBRA 2NU6A 4I08A 3ASVA 4XQGA 1UR5A 1PJCA 4RVDA 1DXYA 4AJ4A 3D1LA 1C1DB 2EWMA 3QWBA 4BOYA 1VJ1A 3F47A 5DBIA 4M1QA 3WTCA 4YAIA 1DBVO 3VH1A 2JFGA 4TWRA 4ILKA 3ROQA 1SPXA 5G0SA 1CERA 2VRCA 3RQSA 1KEPA 5L4LA 4CMGA 4R9SA 1LDBA 1X7GA 4CM9A 1ISFA 1GUZA 4ZJUA 4BO1A 4E4YA 5DT9A 4D46A 4M89A 3I4CA 1Q0QA 5I9LA 4RVGA 4E5YA 1NQOA 1YH3A 4KZPA 4IQGA 4WKGA 3KETA 4GVXA 4ALJA 1A9ZA 1VL8A 1B2LA 4WEOA 1BXGA 5JY6A 2YFHA 4BGEA 1FK8A 4IQ8A 3CXRA 4GQAA 3SC4A 2VRCD 3LZ6A 4I9HA 1E7SA 3ULKA 1NPYA 1ORRA 3JQ8B 3GZNB 2ZCVA 5TT0A 1AGNA 2QQ5A 5DNAA 3PI7A 3K6JA 2B36A 4Q3CA 5AOVA 2Y05A 1XQ6A 3B20A 2BGKA 3KSUA 1FDVA 5HWSA 4DTIA 2EHDA 1DC6A 1ZMTA 2CUKA 3BMCB 1ZUD1 1UZNA 3WBBA 2Y1GA 1SNYA 3FCOA 4MPDA 5I7EA 3H5NA 2RAFA 4R68A 3FTNA 1R66A 1C1DA 1QYDA 1CJCA 1EVIA 1SB8A 3H7AA 4E13A 4CMCA 4D79A 5ER6A 4BO6A 5AVOA 2X0JA 3OFSA 2FR1A 2G0TA 4LMPA 3HN7A 3G1TA 2NV6A 1HF3A 2J3IA 2BHLA 3MEQA 4FPXA 5JC8A 2NQTA 5T5QA 1H9BA 1R16A 2HAEA 5AXBA 4J7UA 2NQ8A 5JO9A 4Z3DA 4CL3A 5TJHA 2ZB4A 2E6UX 4IJVA 2DT5A 1NQAO 1V3UA 5JMWA 2ZYAA 4II2A 3SXPA 5COQA 3ZWWA 4QO7A 4U0KA 5TJ9A 3QV1A 3HZZA 2GZ2A 3GPIA 4J1QA 3ZWMA 2W2LA 3RROA 2VUSA 4Q3DA 1LQTA 2O2YA 4IGEA 4CLEA 4HFMA 3OQ6A 2C7GA 1D3AA 3ENNA 3R6DA 4I8XA 1HYGA 1ZJYA 1AN9A 2I3GA 4D3FA 3V2UA 2HCTA 2EIHA 4ONEA 3JQ8A 3RI3A 3GZNA 4OYRA 2JL1A 3WGTA 1U4OA 1W0CA 4CLOB 5BSFA 4IPTA 2FOIA 4XZ3A 3TZ6A 3TQHA 4J2OA 2HMUA 2UVDA 2Y99A 1IHXA 1R37A 1EK5A 4KMSA 2D3TA 2V6FA 3QHAA 3VDRA 2BF7A 1Q7GA 3EVNA 1NFRA 4CLXA 3INGA 3PJFA 5AXAA 1RWBA 5CP8A 4YT5A 4OXKA 2V6GA 1HZZA 4YDRA 5GMOA 4MINA 1ZBQA 2Y0DA 3WLEA 2Y0CA 4LW8A 3JQAB 4QFCA 1YB1A 1GEEA 4DXHA 5IZ4A 2NSDA 3E9QA 5L53A 4A27A 3NUGA 4GGOA 4LSMA 1QORA 4CQMD 2IEDA 2GASA 3JSAA 5LCXA 2I76A 4YVFA 4CMIB 1MXFA 3WGQA 4R1TA 2R6JA 2O7QA 3INTA 1A9YA 4GKBA 2V6BA 2ZB8A 2OHXA 5ENDA 3E03A 4AG3A 1E7WA 2CDCA 5GZ1A 2Q2VA 5JXWA 1P1JA 1XR3A 2W2KB 2YY7A 3WIDA 1XA0A 3MJ4A 3N74A 4D45A 4PLVA 1CWUA 4H3VA 4TKLA 1I2ZA 1Z6ZA 4CUZA 3WB9A 1HDOA 1GZ3A 2HMWA 4CR6A 1E3EA 1TLTA 3QA9A 3INRA 3WG9A 3DC2A 2VNSA 4FFOA 4OOFA 3W4IA 3WLFA 4BB5A 4BNVA 4WJZA 4LCEA 1I24A 2XXBA 4L8VA 3G1UA 1K5HA 2RBEA 3JD3A 2BGLA 3BTOA 4E21A 4IJKA 5I8WA 1ZW1A 1OC4A 4S3MA 4CLOA 4NBRA 3UF0A 2R00C 3GEMA 5DN9A 3OICA 4ALMA 5IJZA 1N9GB 1F06A 3PWKA 4INAA 1BSVA 4BO7A 1LNQA 1RKXA 4DQXA 1IULA 1Q2XA 5IFLA 4KDFA 3CSDA 3QE3A 3QVOA 4PLPA 4Z9XA 5EJ2A 3RBXA 2GZ1A 4U6SA 4E3ZA 4IUYA 3WSWA 5DBGA 5A3VA 1XCBA 3EC7A 1HE2A 3JQAA 2DTEA 3MCVA 3QLJA 1YBMA 1KVRA 4BNWA 4PGFA 2YDYA 1RM0A 3G79A 3GDFA 5G4KB 3O26A 4CM4B 1ADBA 4P4LA 5I8ZA 4MJLA 1BXZA 1YL6A 3DAPA 1E3WB 2HMVA 4M54A 3BMNB 3UUWA 3X2EA 4CMIA 4RVHA 3LF1A 4TROA 3RBVA 2PV7A 3D3WB 2FRDA 4IDGA 1N1EA 1PX0A 5COAA 3NJ8A 3I9OA 4KOAA 1EUCA 1UDAA 4BNJA 2BFPA 3QQPA 2J3HA 4E2YA 5KJ1A 2Q46A 3PJEA 4TMFA 3S8MA 1RYEA 3KSDO 3GNTA 2O4CA 4E5NA 1YKFA 5ILGA 3K73O 1DHTA 3GRKA 4YB8A 4DA9A 3DZJA 1DC3A 2X9GA 3GRPA 4OAQA 1GPDG 2DU8A 1RM3A 3KLPX 3BYZA 1T2AA 1PGJA 2JHFA 1ISHA 1PZFA 5JLAA 2EV9A 4CMKA 2Q4EA 4B7CA 2Y1FA 1A4IA 3B1JA 3ZW9A 1DB3A 1VL0A 3ADOA 3PJDA 3LLVA 4GL4A 3TZCA 1U5AA 2NU9A 1HXHA 1E7YA 1N9GA 2C82A 3PFFA 4Q39A 3JD4A 4B4VA 1I32A 4Z0PA 1T2FA 1SBYA 4GSLA 2OXIA 3NT5A 4B4UA 3NTRA 4J0FA 1Z7EA 4OJNA 3MWEB 1DFGA 5KJEA 1MP0A 2QX7A 5AXCA 1VPDA 1UUFA 4BNHA 2SCUA 1C0IA 1P33A 2YHIB 4IDDA 2C07A 4PRKA 2I6TA 1PJ2A 1KC3A 1SOWA 2Q99A 1W4ZA 1I01A 2C0CA 2VRBA 4J1TA 2JFFA 4CM4A 3EDMA 1LQUA 5JYDA 2I67A 4CUKA 4R5HA 1E3WA 2JD2A 1OBFO 2O3JA 3BMNA 3JD1A 4NZ9A 1UXKA 3KB6A 4PIVA 3D3WA 2YDXA 4DBVO 3AU8A 4YRAA 2VWHA 2NADA 5A9SB 3Q9NA 4BNMA 1M76A 2BRUA 3RU9A 4AJIA 3ENKA 1ISGA 3QWFA 3ITKA 4RZIA 1YVEI 5T6BA 1SAYA 1ULUA 2AXQA 4HBGA 1C1XB 4MIOA 4CMEC 3G17A 2FZEA 4MP8A 1VSUA 5DP1A 5JDCC 3ZV4A 1R15A 3DOJA 2VZ9A 3PQFA 2C5AA 4GLLA 2IRWA 4W82A 3H8VA 2O4UX 4Z0TA 3C7DB 2GO1A 2WYWA 1K6JA 4CM3A 4E2WA 4BGVA 2RH4A 2EJWA 1JA9A 4W9NC 5IZCA 4IXTA 4K9DA 1OFGA 5DULA 3PYMA 3CUKA 2OMEA 2PZKA 3D64A 1HDYA 3N7UA 1GU7A 5K6AC 3F9IA 5L7YA 1K89A 1EEHA 3VH4A 4E32A 3GF4A 2X9VA 3KEOA 1NQTA 1G0NA 1V35A 4HWKA 3DMYA 5ITVA 3AU9A 4W6ZA 1ID1A 2QG4A 3O8QB 3WGYA 5HS6A 2ZQZA 4R1SA 4H7PA 1LC0A 2NTNA 3Q9UA 2D1YA 3AM5A 2YHIA 2VYNA 2AMFA 4B8WA 3L4BA 1YS4A 3RUAA 4MVJM 2D4AA 3ASUA 4ZD6A 4D3SA 5U1PA 1V0JA 4TZKA 1LLCA 3UOGA 3I4FA 3U4CA 4AJJA 4K26A 3ZWCA 3IOYA 3MJEA 2YFQA 1FDSA 1SEVA 2ILTA 2Y1CA 4NDNE 2CF5A 4QO8A 3U5TA 3C7CB 4XWYA 3RFTA 3QRWA 1I0ZA 4ND3A 4BO0A 1P1RA 4AJLA 3GK3A 3EY4A 1GV1A 3PHGA 5B4VA 3OQBA 5EN4A 2X7HA 3ZGYA 4F6LA 1C1XA 2EF1A 2GZ3A 2E49A 1L7EA 1DSSG 5ER9A 4DREA 4WLVA 3E6AA 4ALKA 4YPOA 4TRRA 5G0WA 3OF2A 1B14A 1V9LA 2NUAA 1WW8A 1A7AA 7MDHA 3IKTA 1E1MA 4AFNA 1P0FA 4JJFA 3E1KA 5KOIA 1UP4A 1EVYA 3CKYA 3GUYA 3WGZA 3HG7A 2GN4A 3W4JA 1QXSA 4MKXA 2BH9A 5FFFA 1U4SA 1VJ0A 4MVJI 1PS9A 3PGJA 1GQ2A 1GL3A 1UH5A 2YUTA 3TZQA 1L7DA 1ADGA 3F46A 4XYBA 3D5TA 1XWFA 3PIIA 2AEJA 2HK8A 1BVUA 3ETGA 3HDJA 4ALNA 1KETA 1KVQA 4J1SA 1EFLA 3O8QA 3KBOA 4NU5A 4QT0A 4JCOA 2A94A 4C7JA 3H9UA 3T4XA 5C7LO 3Q2KA 3H9JA 4RF3A 1DC5A 1PJ4A 4C4OA 1LRLA 1VL6A 2RIRA 1PZGA 3RC2A 4CLDA 1DIHA 1ZFNA 2Y68A 3TN7A 5JAIA 4GX0A 4MKZA 3UVEA 3OJEA 4MO2A 5COBA 1HDXA 5L95A 1UXJA 1WMBA 2BFAA 5TGDA 3IP1A 5A9RA 4YXFA 3FPLA 3RUIA 3ZDFA 5CG1A 2D5CA 3OEWA 2IDZA 3I6QA 3D5QA 4E12A 4L4SA 2X5KO 3K8ZA 5DDIP 2TMDA 3HJAA 3K30A 2QIOA 3GEDA 1NHWA 1MFZA 3C1TA 3V1TC 2DFDA 2ZTVA 4NJOA 3WSVA 4FOOA 1LDNA 1O5IA 1IPEA 1N7HA 3L6DA 3M1AA 4OIMA 4OL9A 3PFWO 4MIEA 2V6MA 2ZTMA 4RLHA 4QSMA 3ZWAA 2Y66A 1LSUA 5CPFA 1AHIA 1B0AA 2B37A 4XD2A 4XCVA 1ISJA 1Y9AA 1GQYA 1W6UA 3OJ0A 4IDFA 5GZ6A 1WZIA 1W8DA 2CMDA 3GC6A 5JSFA 3B70A 5IXSA 1DIBA 4GWKA 1E3SA 1GY8A 3PYLA 1ZNQO 4XDZA 5I7VA 4TRJA 1SO8A 3WFIA 5KVVA 4N5MA 4GI2A 1PJQA 2VTDA 2GR9A 5HRUA 5KNLA 1ISMA 4OHUA 1JVSA 1WAMA 3LQFA 1GQQA 4U0JA 2Z1NA 1ISIA 1U8FO 2XXJA 3ZWVA 4WLOA 4DQVA 1E77A 1I10A 4PZEA 4RDIA 1LXCA 3AI3A 4O6VA 4A5OA 2EGHA 4ZQBA 1C3VA 2I66A 3WNQA 4YEDA 1KYQA 3MJSA 4OSPA 2H9IA 3L4SO 3BHJA 3KVOA 2PA3A 2I99A 4MP6A 4YQZA 4EYEA 3F5QA 2TMGA 4BO4A 3P5SA 5T57A 1LRJA 3U0BA 1UXHA 1ZVMA 1YRLA 1I5RA 3PLNA 4PG4A 5FEUA 1E5QA 3JYLA 3FNEA 3I9LA 1VC2A 1Y8QB 1HSOA 1SC6A 4Y6RA 4O0LA 4WLFA 5JCJD 4C7KA 1I30A 3AI1A 2RH8A 3MJCA 5JS6A 4YA6A 2W4QA 4PLGA 1NASA 2AEMA 2IXAA 4KUEA 3RBZA 3ZU3A 1X0VA 1DRVA 4YAGA 1FDUA 2ZTLA 4BNFA 4K6CA 3ZWNA 2VCYA 3GFGA 4BO5A 2VYVA 3JQBC 2CVOA 3ZHYA 2OFPA 1H2BA 3IUPA 3FWNA 4ZN6A 1HDZA 4UAGA 3BTUA 3P2OA 4LCJA 5I9NA 1ML3A 2RHCA 3KHUA 1X13A 1QV6A 3TL3A 1G0OA 4YYZA 1U7TA 1NAHA 4UVDA 3ZU2A 2CFCA 4J4TA 1MC5A 3GAFA 4R1NA 4ZRNA 3PIDA 3U09A 1XIVA 2WYUA 1QYWA 4YJGB 3O03A 4ZQFA 3DQPA 1NVGA 1Q7CA 4YT4A 3L6EA 3E48A 5AXDA 2AE1A 2IXBA 4CV1A 2PGJA 4L9RA 2W98A 2WD7B 5DCYA 4EBFA 1NTOA 5JY1A 3VC7A 3V8BA 1PU2A 1MXHA 2VHVA 1WDKA 3ZW8A 3DWFA 1NQ5A 2PZMA 4FFRA 4UUNA 1ENOA 2QRKA 3BMQB 4L4RA 4RQTA 4Z6KA 3B1FA 3LT1A 3CINA 4A2CA 3Q2IA 3GVPA 4BNGA 3WTBA 1FF9A 1OAAA 1PJLA 3RAJA 1U3VA 1Y8QA 2WE7A 4JN6B 3DHNA 1U2DA 5JAQA 2G1UA 4EEXA 5JDIC 5KJ6A 3C24A 4NIMA 1T2DA 3DZIA 5L40A 1UAGA 2X22A 3DFZA 3GNQA 3RJ9A 5CEJA 2BGMA 1DEHA 3JYQA 2HK9A 3T7CA 3WYEA 1HDCA 3KSZO 3TOXA 4IMRA 1QG6A 4L4XA 3DBLB 4AJNA 3H3FA 1VKNA 2GN8A 2Y67A 5BNFA 4FJ1A 3BTVA 3JQ9C 1S7CA 3QVSA 4NK5A 4FIZA 2O3QA 1O0SA 1YL7A 5B4UA 2WWRA 3ZCXA 3CPSA 1DJQA 3DZBA 3PHIA 2CD9A 4W7IA 5KKAA 1E6UA 4IS2A 5BR7A 1KS9A 4KTVE 4YJGA 3NDRA 3Q1LA 1P1KA 7ADHA 1P3DA 4W99A 2PGDA 1G1AA 3KRTA 4NU6A 4ND4A 3WGIA 1OOEA 5EL0A 2WD7A 2VOJA 2X0IA 5CHEA 1ONPA 3LVFO 1IHYA 3BTSA 1WDMA 2Q1TA 2VHYA 3D7LA 2Z1MA 2DPGA 3JYPA 4YT8A 3BMQA 1ZH8A 4S1VA 5BT9A 4CM6A 3WGHA 2CF6A 2OORA 1HRDA 4I5GA 3JD2A 1H94A 2A4KA 4TVOA 5AQ1A 3TJRA 3FI9A 1XSEA 1MC4A 4BNTA 2YZ7A 1NPTO 4JP2A 3RUFA 1PIWA 3GAZA 3P2YA 1D4FA 2AG5A 3NEPX 4YTEA 3S55A 2GRAA 1TT5B 3EK2A 4K28A 4ZQGA 2HMTA 3AOGA 1WPQA 1PS0A 4AJOA 2DQ4A 3VPSA 3G0OA 4CV2A 4A7PA 2Q50A 1ZXBA 1FJHA 4CQMB 1GR0A 1OMOA 3DBLA 4XQCA 1A71A 3H9GA 4B3HA 1JN0A 4B4OA 3JQ7B 1GEGA 3L77A 3E9MA 5B12A 5T8KA 4U5QA 1YJ8A 4DLLA 1AXEA 4P4NA 5L45A 1HE3A 3VPGA 4E0BA 3FTPA 1SEPA 3IJRA 2OOSA 3DBRB 3I52A 1HKUA 2BFOA 1ULSA 3OQ1A 4CM8B 4ZHSA 2PKRA 2QZZA 4DVJA 1LLDA 5EERA 4B3JA 4O1MA 4R1UA 1MG5A 5KKCA 5THQA 3NRCA 1J6UA 1MFPA 1DDOA 3JQEA 1B16A 1LUAA 2VQ3A 4AVYA 4M87A 4F3YA 4EUHA 4RZHA 1ZK3A 1IB6A 5KIAA 3PRJA 1U2GA 3E9NA 2J8ZA 2DAPA 2FP4A 1C14A 1BXKA 1CF2O 2C59A 1IZ9A 4J16A 3FNHA 3TDKA 5IG2A 3ZNQA 3WJAA 5TQVA 3HWRA 3OP4A 4DBZA 2PLAA 4R3NA 2YHUA 4PZCA 1DC4A 1TT5A 3MJTA 3NT2A 5CDSA 3U4IA 3HB5X 4FN4A 3NTOA 4WOKA 4D43A 2UUPA 4O59O 3DEYX 5KJFA 3GDGA 2P68A 4ZQHA 4WASA 3DBVO 2ZCUA 3OBBA 4DYDA 4CQMA 1EDOA 2O23A 3ZU4A 1LJ8A 3TZHA 3H5RA 5GZ3A 2LDBA 4YRBA 1E3IA 4YR9A 3JQ7A 2B4RO 2CSUA 3OJLA 4DYVA 3I9KA 4HXYA 2HQ1A 1B26A 4RL6A 2CDBA 1HE5A 1TXGA 4DMMA 2IE0A 4JJIA 3DBRA 4M55A 1U7HA 4CM8A 3L0DA 1WXDA 1SMKA 4J9UE 2Z5LA 2EXXA 4WCFC 4J49A 2EERA 3K2BA 4MKRA 3HADA 1U1IA 3ONFA 5F5LA 3BZUA 1HLPA 3OETA 4YRDA 5C5IA 4GAEA 3KV3O 5CPBA 1UXIA 5K9ZA 1PGOA 5ILOA 2WE8A 4N54A 4J1NA 1R0KA 2ZYDA 4GKVA 4KQXA 4J0EA 1GUYA 4NFSA 4BNYA 1PJSA 4RGBA 3DHYA 4BMNA 3PQDA 1WWKA 1U28A 1X15A 4QTZA 3QIVA 4CV3A 1A7KA 3P7MA 4AJKA 3JQFA 2CZCA 3ORFA 4JGBA 4Q3AA 3RFVA 1EZ4A 3GN2A 2XOXA 5MDHA 3DZKA 4Z3KA 2IEBA 2UYYA 2PWZA 3JYOA 4YBZA 2VT2A 1YXMA 3W1VA 3ZWXA 4E2ZA 4GPD1 1YQGA 5F21A 4FJ2A 3WGOA 4TSKA 1BRMA 3WNVA 5CDTA 3VZPA 1JLLA 5KVQA 2PZLA 1HZJA 4ESOA 1PTJA 1YONA 4BS9A 3RUDA 1KEWA 5IDQA 1WNTA 2VHZA 3DONA 2IZZA 3EYWA 2DBQA 2FR8A 5JPIA 2P4QA 3AY6A 1JKJA 1I3KA 4AJHA 5C3MA 1I33A 3RUEA 3H65A 3K9QO 1HSZA 4NPCA 4OOEA 3FBGA 2FZWA 3A28A 3UH1A 5BQFA 1BWSA 1XELA 3ANMA 4J91A 3HDYA 3DZFA 1C0LA 3Q3CA 1BMDA 4PVDA 4KWHA 5IDYA 3QJ5A 4JIGA 1DLIA 4Q3BA 1HYEA 2VZ0A 3A06A 4HX5A 2OO5A 1QR6A 3DXFA 4L73A 4L74A 1P45A 2Y93A 1ARZA 5U4QA 4G81A 4HFRA 4FB5A 1Z74A 3IQDB 3MWDB 3UCEA 1ZCJA 3GGOA 4J43A 1FMCA 2EP5A 2HMSA 3WMWA 1GPJA 1EQ2A 3RCBA 1KOLA 1QRRA 3VTFA 2EW8A 4L76A 4DIBA 3H4VA 2X0RA 1HYHA 3ANLA 5L4SA 2RHRA 3GZ4A 3CTMA 5JC1A 2UDPA 5EMHA 4BKPA 2G76A 3FHLA 3AOEC 4IINA 3DR3A 1ZK0A 2DBZA 4FJ0A 3WBFA 4CUJA 1J5PA 5JNLA 4BVAA 3SEFA 5A02A 5HA5A 8LDHA 1CQJA 3UCFA 5L51A 1TEHA 1V3TA 4HNGA 4DPLA 3OM9A 1IPFA 4IXWA 1T1RA 3KZVA 5HBRA 1E3LA 4BL5A 1NM5A 3STHA 4WCDA 3ZNPA 3PLRA 4PCVA 1YWGO 1LI4A 3TOZA 5ICSA 4FFNA 4LGVA 5LDHA 2QYSA 2NNLD 3HSKA 4WPGA 3VVCA 3FNGA 1IZ0A 5EIOA 2P9GA 5IN5A 3FF4A 1P9LA 4KUGA 3B6ZA 4BNNA 4BO9A 2IZ0A 1WP4A 4EDFA 1I2CA 3GQVA 4U8GA 1CYDA 2P91A 4R5MA 3WXBA 2WM3A 2IYOA 1QYVA 4I5EA 2ZIZA 3DMTC 1GZ4A 1K6IA 2PD4A 2Q2QA 2WJPA 4B3IA 4ND5A 4EW6A 4TVBA 3GOHA 1X1EA 5TC4A 2FHSA 5TLSA 5I7FA 4IZHA 3WR5A 1YBVA 5ENVA 4DUPA 3GEGA 3N58A 3H2ZA 4OQZA 2BFMA 2GNAA 2Y1OA 3DO5A 4JBGA 4IM7A 5CAEA 1VJTA 3HE3A 4GH5A 4BKOA 3EZLA 3PHJA 1TB4A 1RYDA 1Y81A 3QWHA 1ZEMA 3GMSA 3FD8A 2DM6A 1JWAB 2GYYA 3C3XA 4WEQA 3E18A 2GGSA 1DAPA 2NU7A 4HKTA 1F14A 3NAQA 5G4LA 3PWZA 4DWVA 4G2NA 3PHHA 4Y6SA 3GGGA 4FR5A 3FR8A 2W90A 4YAEA 4B4WA 4L0QA 4RVUA 4RF5A 3I1JA 4Y8VA 4XDYA 3LT2A 4LVCA 4J7CA 1NPDA 1R12A 5J23A 5B1YA 3UW3A 4H15A 1SZJG 1E7MA 2CNBA 3CEAA 2OGUA 4WLNA 1HL3A 4YACA 3HDHA 2EGGA 1YB4A 3TRIA 1UP6A 3CMMA 1Q1NA 5FI5A 4IGFA 1PL7A 1Z75A 3VPXA 2Q3EA 3NDIA 2E37A 3H6KA 3ZHXA 5FWNA 4W7HA 1EVZA 3TWOA 5AYVA 5BSHA 5JFOA 1LLQA 1H2HA 4TKMA 1NFQA 5LDGA 1M6HA 2J5KA 1JDJA 5CDUA 4F6CA 2FMUA 2X5OA 4AJEA 1OI7A 3AFNA 3RC9A 4UVHA 1MX3A 3H5AA 1WVGA 1LBEA 1E1LA 4NBVA 2B0JA 5TS3A 4AICA 3KLMX 1U8XX 1H6DA 2XPCA 4FFLA 5EESA 3OA2A 1G6KA 3GLQA 1H6CA 4IIUA 2O48X 3TNLA 3SJ7A 3GMDA 1QMGA 4FGSA 4RVSA 5DF1A 3PK0A 3L9XA 2A92A 1ENZA 1X14A 3PEFA 3E5RA 2I9PA 2HRZA 2GDZA 3DTTA 2NLOA 4J7XA 4PG8A 3GFBA 3ANNA 4G5HA 3W4KA 3FSRA 3VKUA 1V3VA 5MGBA 4XKJA 3AUAA 1WDLA 3GG2A 3OECA 5IF3A 3IUSA 1BW9B 1HDRA 1A4UA 3QW2A 4HUJA 4TQGA 3NT4A 2JCVA 2HUNA 1I3MA 2GPTA 5ES3A 3NGLA 3H9EO 4OMUA 1IY8A 4YAJA 2PKQO 2P4HX 1KVTA 4CR7A 1GCOA 2O3UA 4IMPA 3WS7A 1IUKA 2PGLA 3ZWPA 1XEAA 5TIIA 1BGVA 4GVLA 3SX2A 1OC2A 2AE2A 1AE1A 4RF4A 2UAGA 3C7AA 3FWZA 1LC3A 2AQKA 1ZKMA 2HK7A 2B5VA 4RPHA 4Y67A 1RJWA 1P1IA 4RV9A 1PEDA 1PJTA 3ONEA 4BO3A 4IY1A 5TF4A 3NYWA 2V7PA 4EJ6A 4YAKA 3BHMA 1JAYA 1NHGA 5DP2A 2CDAA 4J4HA 1AXGA 4NI5A 3WFJA 4NBWA 3V5NA 4GX1A 1M67A 2HJRA 4WECA 4HNHA 1J49A 3ZHZA 3F3SA 4ZICA 4NG5A 5A05A 5JE8A 3I3OA 4UUMA 1ZO8A 4J2HA 3Q11A 5ADHA 3IAHA 3GUCA 3IKVA 4BKQA 3ZHBA 4J9VA 4CLHA 2IZ1A 1T4BA 3ITDA 3JQDA 2O7SA 3MZ0A 5DOVA 2EKPA 4E5PA 4LRSB 3CIFA 2C2YA 4J90A 9LDBA 3F4LA 3X2FA 1BW9A 3O9ZA 2YJZA 3WX0A 1YJQA 4RO0A 5DOZA 3JD0A 2D2IA 4MVJH 4CMAA 2QYTA 4FOSA 2PR2A 4HY3A 5FYDA 1CETA 4AL4A 4D0RA 2ZB3A 1A27A 2FN7A 3U4HA 3AM4A 3ZNNA 4UVEA 5JCJA 4ZGWA 1WMAA 5KJCA 3E8XA 2DTXA 1XQ1A 4CQLB 1DIRA 1O9BA 4NR0A 2XF8A 4IDEA 4FCCA 5DCUA 4P4GA 2Z95A 4OM8A 4BNXA 3TFQA 3IS3A 1RM5A 1B8VA 5KTKA 3V2HA 1QP8A 2B4QA 3S2IA 2YYYA 3U62A 3M2PA 3PTZA 4EGFA 4OSOA 4EEZA 4RPLA 1EVJA 4FC6A 2NVUB 5BSGA 4DQUA 4U7WA 3SLKA 5EPOA 5L4NA 4XEHA 4PFJA 2VWQA 2PK3A 1KY5A 4RPKA 1F8GA 3WIEA 1JAXA 3GPDG 4FSHA 4ND1A 1LA2A 4CJXA 4NQZA 2R00A 5CG2A 2WYVA 2X6TA 4XB1A 3ROPA 2I3AA 1P44A 5THKA 3S2GA 4UREA 2J5QA 1ENPA 2JCXA 3NTQA 1DFHA 4YWJA 3GN1A 1IOLA 2ZKLA 1BG6A 4TZTA 1DO8A 5IAAA 1I8TA 5CEEA 1N1GA 3IMFA 5HS4A 1PGQA 3AUSA 4ID9A 4RLSA 1I36A 1E3JA 5A06A 2NM0A 1FDWA 1UZLA 1VI2A 2VHXA 2LDXA 4BNLA 4MVJF 1YGYA 3VZQA 1R0SA 4XA8A 3VH2A 4CQLA 1DPGA 1GAEO 2IODA 3RKUA 1J4AA 2W8ZA 4XRRA 5C7IO 3EUWA 5HTOA 1LDYA 3ZNOA 3OIDA 3QWAA 1DOHA 2X4GA 1H0KA 1ZZEA 3VH3A 4IZIA 3ICPA 2G82A 2PFGA 1QV7A 3MTGA 4LN1A 2JAPA 4CR8A 3W6ZA 2AG8A 5H81A 2WSBA 1JQBA 3ABIA 4QECA 3W6UA 1JWBB 3GH3A 3K96A 3AK4A 4N18A 3TZKA 3D3EA 4RF2A 3C85A 2HJSA 2NVUA 1KEUA 2DFVA 3C1OA 1XYGA 4BUCA 4JBIA 5FI3A 1GYPA 2VHWA 3HFSA 3LDHA 4AJ2A 4IJWA 5KVSA 4ITUA 1ONNA 4XJSA 4HV4A 1TI7A 4CODB 5JAZA 4FQ8A 2WD8A 3LLSA 5CFZA 4BKUA 1K3TA 4J6FA 3NKLA 1HETA 3KM0A 1KVUA 1X7HA 4MVJG 1GCUA 2YV2A 4PG5A 3PZRA 1JTVA 4EJMA 2OBNA 2DUWA 4W4TA 2BD0A 2JD0A 2VWGA 4JK3A 5A5EA 3DOOA 1B3RA 4GSKA 4XR4A 1GV0A 1AHHA 4OKNA 1U3TA 2Q1SA 5IXYA 3DMTA 4A73A 5L9AA 3TSCA 1CEQA 5BNTA 4PLFA 3W8EA 3RJ5A 1DIGA 4M86A 3VHRA 5JAMA 1PQUA 4BQRA 3RVDA 1EK6A 3D4NA 4ZA2A 3WWYA 4I9UA 3EMKA 4UEKA 2Q45A 5JMPA 4EUFA 3UICA 1Y7TA 5IZCC 1XU9A 3HNPA 1Y5MA 4B8ZA 3OHSX 1DLJA 2GN9A 3D4OA 5L7WA 4CMEA 1Y8RB 3AM3A 2EKLA 4IDBA 1E92A 4M8SA 5H82A 2GERA 1MLDA 1H6AA 5JDCA 2D8AA 3RWBA 1JKFA 1RPNA 1U9JA 1GADO 4MVJD 4WE3A 2UUOA 1W73A 5JW6A 4E2XA 3C1AA 4CM5A 1VKOA 4YCAA 3NDJA 4Y6PA 5IDXA 1QSGA 4QFDA 4GMFA 4E5MA 1D7OA 3L4BC 1U3WA 4DC0A 5EINA 3AW9A 4W9NA 3H2SA 4XGKA 4XYEA 4IBOA 4DRYA 1NR1A 3H9QA 4CM1A 3ROMA 5K6AA 3WDSA 3T4EA 5I7SA 3GVHA 1OZAA 4R16A 2PNFA 2EW2A 2Q49A 1MB4A 3IL2A 5F1OA 1VE9A 2ZQYA 3HB4X 4UVGA 4XQ9A 4URFA 3G3EA 1EDZA 1ADCA 4CMBA 4WNCA 5JCXA 1EUDA 1MGOA 4YT2A 3DFUA 4PG7A 1ZK2A 4WOJA 4GGPA 3LU1A 4EJ0A 3PGXA 4PLYA 5HM8A 1YQDA 4JJGA 3PP8A 3A14A 2UV8A 3DAGA 1PR3A 2E48A 4CM9D 3R1IA 1NBOA 2FWMX 1WZEA 2QRLA 5C7OO 1UJMA 3RFXA 6LDHA 3TF5A 4UUPA 1EBUA 5TX7A 2X0NA 1V8BA 3DHEA 2C7VA 3DB2A 1RM4A 1F0YA 1GZ6A 4XYLA 5KVCA 2AEFA 4XB2A 2X86A 2WDZA 4OXYA 5L3ZA 3OIFA 3UFXA 1DAOA 1Y8RA 3L07A 1MV8A 4Y9DA 4N5LA 2CY0A 2OZPA 2HSDA 4JNKA 5C37A 4R69A 3DTYA 4MIYA 1PR9A 4OXNA 3BHIA 1BVRA 2XAAA 2ZJ0A 4HP8A 4BHTA 4BMVA 4D0SA 3S1LA 1HTBA 1Y9EA 1XLTA 1Z73A 2YW9A 1XDWA 3I9MA 3MTJA 1M66A 3QSGA 4JP3A 3D4PA 4II3A 4UVIA 1NFFA 2OL4A 3KTDA 3LC2O 1X0XA 4XYMA 4P22A 4XJTA 2YQ5A 4KTTE 4XGNA 1BHSA 2B69A 1E6EA 4K6FA 3EAGA 1UXGA 3LF2A 2JD1A 4NMHA 1HT0A 2GF2A 1YE3A 4OO3A 3WICA 5T67A 4CL8A 3UXYA 3EGOA 3E82A 5FF9A 1V6AA 3VVBA 2DBVO 1GUFA 4QX6A 4MVJP 2V65A 4WUVA 4DIFA 4JQCA 1Y6JA 4CLRB 1MA0A 4PVCA 1P77A 1WLYA 1TT7A 2X8LA 1R0LA 4R01A 3PQEA 1ZMOA 5ITWA 1R6DA 3NGXA 3KYCB 2JKVA 4ALIA 4WK6A 4E31A 2PZJA 1NWHA 2FPIA 4HFNA 5KWEA 3EVTA 2ZATA 2DPHA 3EHEA 3NX4A 1HWYA 3BMCA 3M6IA 1ZSVA 1LDGA 3FN4A 2P5UA 4NHEA 3PXXA 4XQEA 2W2LD 1CRWG 3RUCA 5JYEA 4ZVVA 3PPIA 3JQ6A 3KUXA 2ZK7A 5L7TA 1LSOA 2EEZA 2H6EA 3ETEA 4IS3A 4EITA 3TFOA 4JXKA 3Q6IA 3IIEA 4GMGA 3VPFA 5BNIA 3HUDA 3ADPA 4ALLA 2HKIA 3LSYA 3SBOA 1IL0A 4A03A 4G65A 5IDWA 3SC6A 5DBFA 2J6IA 2YV1A 3BAZA 2NWQA 3ZV3A 1CDOA 3VAZA 3DOCA 4QUKA 4J4BA 3KO8A 4DPKA 4BNUA 2ZB7A 5TNXA 1DIAA 1PQWA 3R0IA 4NK4A 4A0SA 4RJTA 1SB9A 3KYBA 2O2SA 2CVQA 4D44A 5B4TA 1LRKA 1Y5RA 3K2EA 3F5SA 1PSDA 1KIFA 1E1NA 2H1SA 4NJMB 1QYXA 3M2TA 4TRNA 1JW9B 3CMCO 2VOEA 4NFHA 4BIIA 2QW8A 4D7AA 3VKVA 2JHGA 4B7XA 2HU2A 1U5CA 4CLRA 2Y1DA 2GSDA 3AFMA 1EQUA 5G2OA 4R3WA 4Z9YA 1PS8A 1H5QA 2C2XA 2PY6A 3C8MA 1JKIA 2Y1EA 1T25A 4FFPA 3KYCA 4I5FA 3ZWYA 3K31A 4XIJA 1ENYA 2FPGA 1R4NB 3LT0A 1UZMA 4FC7A 5F1PA 3I9NA 2VZ8A 1NVTA 4R4JA 3ZV5A 1P1FA 2Q4BA 1JU9A 4FGWA 1N2SA 2I5PO 4PLCA 1PWXA 4RCVA 1O94A 4RQUA 4PLZA 2F00A 4D41A 1ZK1A 1S6YA 3WGGA 1IYZA 2HRBA 3F6YA 3EZYA 1E1KA 4FFMA 1PJ3A 2DKNA 4RDHA 3RKRA 3S2EA 4GLOA 1MG0A 1ZSYA 4E5KA 3IDSA 1EE9A 1B8UA 1PQPA 3HFGA 4GX2A 3AY7A 3JQBA 3LT4A 1PZHA 1H6BA 3HHPA 3DAFA 3RD5A 3GY0A 3A4VA 3SLGA 3EW7A 1DFIA 2W2KA 1HE4A 3QVXA 4BB6A 1ZIDA 3W8FA 1B15A 2EP7A 4NBTA 4NJMA 4WLUA 3VDQA 1SOVA 1Z45A 3GVIA 3O4RA 4DGSA 1DRWA 3WYBA 5U9CA 3JQAD 4IQ0A 1EBFA 2X23A 4OH1A 1JVBA 3GR6A 3WMXA 1XHLA 1I3LA 1SCUA 3JQGB 4AJPA 4IJUA 4DC1A 2NTJA 3GGPA 2H5LA 3AWDA 4FBGA 5G0VA 1Z82A 3ZN2A 3BMOB 1X7DA 4MP3A 1GTMA 1LDMA 1A5ZA 4PLTA 2POQX 1R4MB 1LSSA 1YQXA 2BI7A 2EKQA 4I9NA 5G0UA 1Y1PA 3IP3A 3UGKA 1J0XO 4N7RA 4LK3A 3BIOA 1P31A 2A35A 2YQ4A 4D42A 1R4NA 5K0ZA 1KY4A 3M1LA 4WNIA 4WGGA 4BQPA 1YL5A 1QKIA 3IC5A 4CM7A 2BMAA 4TRMA 1O8CA 3GNSA 3BXXA 2WMDA 1PZEA 1DRUA 1HLDA 3KYDB 2PKQP 3RU7A 2ZTUA 5JDIA 2QZ9A 3CZMA 3AUTA 5G4KA 4DLAA 3MOIA 1I2BA 2OP1A 4R9RA 4BV8A 3B1KA 3OA0A 1PGNA 2Y0EA 4Q9NA 1EE2A 1F17A 1P0CA 1P74A 1Z7BA 2E4AA 2O3SA 2JAHA 4DIOA 2WTBA 4L75A 4M49A 1UDCA 3HDQA 3JQ9A 4BO2A 1E5LA 3OIGA 5G0TA 5T64A 2FSVA 4LSWA 5H83A 2J3JA 1HDGO 3WQSB 1QLHA 4YJFB 4I1IA 3COSA 1O6ZA 2GD1O 2EG9A 3R3JA 2EJVA 4BGUA 1NXQA 3MOGA 1GYRA 4PZDA 3I23A 3FRJA 1T2CA 1EFKA 4JLWA 3VZRA 3JQGA 3K5PA 2B5WA 2QRJA 4MOWA 3BMOA 3V1UA 1XKQA 1XG5A 4IIVA 4IDAA 2IYPA 1LU9A 1PWZA 2F1KA 3FPCA 3S2FA 4DMLA 3OMLA 3HQ4O 1R4MA 3L9WA 9LDTA 3HN2A 3U3XA 1FDTA 3UAGA 1D1TA 4QQRA 1N8KA 1X1TA 5A1TA 2R2GA 3QVWA 3QVTA 3AUUA 1PL6A 5F5NA 4PN3A 3FNFA 4CMJA 3PHLA 5TSDA 3F1KA 1M2WA 4A10A 2AW5A 1Q0LA 5T8KC 4B79A 3DDNA 4I5DA 3BA1A 4UEJA 4DL9A 4ND2A 4O5OA 3KYDA 4CPDA 2FPPA 2DC1A 1KVSA 1VSVA 5A03A 1EUZA 4BO8A 1IE3A 2JJYA 2BLLA 3RC1A 1LX6A 1E7QA 2O3RA 2YV3A 3ZZNA 2C20A 2Q2WA 4BNZA 4F45A 2NVWA 1MUUA 3GHHA 1ZXLA 3ZI0A 5IN4A 3IJPA 4CV0A 3PJGA 1ZK4A 3UCXA 5A9SA 1QYCA 2P2SA 3JYNA 4OKIA 2X9NA 2VUUA 3ICCA 1D8AA 4XYGA 1E6WA 3NJ4A 5A3JA 3ZU5A 4BNKA 4DPMA 2G17A 4YJFA 4U6QA 3DBHB 3F1LA 3T7EA 2VYND 3GT0A 4OGWA 2GN6A 3OJOA 1O95A 8ADHA 4WCFB 1KERA 2FR0A 3AJRA 3I6IA 4BV9A 4EZBA 1BDMA 1PL8A 1UAYA 2J5RA 4RORA 5DCWA 3ZH2A 5A04A 4NBUA 2AHRA 1O89A 4KWIA 2RCYA 3LC1O 2C29D 1H93A 2X1HA 3R3SA 3Q0EA 2DUUA 3P19A 2E82A 4XGIA 2HLPA 5CDYA 1B8PA 4H16A 5GY7A 3V1YA 4LVUA 4ZQEA 4J3FA 2AQIA 1N5DA 1DHRA 2B35A 1Q7BA 4JROA 2X5JO 4IDCA 5F3RA 3V2GA 4CMHA 3GHYA 4FDAA 5JO0A 3GA0A 1LEHA 3WOHA 3GVCA 2PTGA 4XR9A 2BELA 5DZSA 4PG6A 1DJNA 1B3BA 4A26A 4Q3EA 3WQRA 1FXSA 3SVTA 1K2WA 4LMRA 4GWGA 4BGIA 2OP0A 5B37A 1CQIA 1F12A 3WYCA 5A4DA 4BKRA 4XIYA 1ADFA 2VN8A 4E6PA 1LSJA 3PYXA 1C0KA 3I9JA 4XRGA 3DBHA 2OUIA 1YB5A 1E7RA 3JQCA 3JQFC 1A72A 3F4BA 4BMSA 1UDBA 1N7GA 2A9FA 1VLLA 1VM6A 3LK7A 5CDGA 1LLUA 4P38A 4WCFA 1NVMB 6ADHA 1U3UA 4Q3NA 3AY3A 1BTOA 3MJVA 2D5AA 3VOSA 4MDHA 1YBAA 2WEKA 1ZJZA 4Z9FA 1BDBA 2C54A 2AQ8A 3K92A 1T26A 3ETDA 4PLHA 1UP7A 2B83A 4QEDA 3TPCA 3W8DA 2PH5A 4JX8A 1LDEA 1YDWA 4LRTB 3FBTA 4FW8A 2AQHA 3U4DA 2Q1WA 4O63O 3VZSA 1GDHA 2GCGA 2DLDA 4N5NA 4BNIA 3WJ7A 3PDJA 1NAIA 3SJUA 3CH6A 3D0OA 3DZGA 1T4DA 1QLJA 1TVEA 2VUTA 1ZSNA 2I65A 4NNJA 1T24A 3QP9A 2D59A 1D1SA 1XGKA 1AUPA 4GX5A 3DL2A 3GVXA 4QXMA 3GDOA 2JFHA 2DTDA 3UN1A 1P1HA 2X58A 1GFSA 4YQYA 3VTZA 4FS3A 3RSHA 4KDEA 3RC7A 4KP7A 1H9AA 1NYTA 3OEYA 2VTEA 5TRTA 2HDHA 2VWPA 4LISA 2O3TA 1VRWA 2ZJ1A 2P9EA 4PRLA 1NNUA 3NV9A 2AA3A 2VNAA 3WWZA 5CEFA 1Q0HA 5EQFA 3RIHA 2QHXA 3U9LA 2DVMA 2NACA 1I3NA 2ZYGA 3E5MA 1YOVB 3QWIA 5LC1A 1XU7A 4HADA 2GLXA 2BI8A 5EQDA 3UKOA 3ZWOA 1PGPA 1F8FA 4AJ1A 4HFJA 2OBYA 2CVZA 3JV7A 3RUHA 4R54A 3UHAA 1L1FA 3AI2A 3FR7A 3WQQA 4YJHB 4WLEA 3PVZA 3LC7O 3RASA 5F1KA 2J3KA 3LYLA
chains in the Genus database with same CATH superfamily
3PNKA 1EFUA 5J5CA 1SOMA 1VHTA 2D6FA 2C98A 2P9CA 3EASA 1NX6A 3FJ1A 4WINA 2X8JB 4I2VA 1YK0A 3Q3JB 4YJDA 2ZZNA 1KJQA 3RRBA 1DARA 1YRWA 2XZDA 4AZ0A 2JJMA 4RPGA 4F71A 3DAYA 4Z8XA 1W49A 3FWPA 4LE2A 4RVFA 1W36C 4X54A 2AHOA 4KQCA 3ZIDA 2AFHB 4MVJE 1Z26A 2VJQA 2FMIA 2HDNB 4WZAA 1YDEA 2YRWA 5F2OA 2RJNA 2G9UA 2HBYA 1MB2A 4JJAA 4P3PA 2QBYA 3LP6A 1AS2A 3JTMA 5AW4A 1G7CA 1CP3A 3DXZA 5KYXB 1EUQA 2PD3A 2VJCA 2QVLA 2FRXA 2H5JA 4RWZA 4UM5A 3K70C 2NU8A 1K7EB 1OXTA 2ASEA 2Q1UA 3CF4A 3IAM1 2HF7A 3PFHA 4NAVA 1TA4A 3E22B 2C5EA 4DLBA 2FDCA 1DCKA 1AF7A 1Z39A 3VHXB 2ZFUA 1NZJA 2AJCA 2AFHE 3O38A 3W05A 3AHDA 3COPA 4IOMA 5T4BA 2DFLA 3UQYS 1JEOA 3WMFA 2NQ2C 2FWBA 4UUOA 3V3KA 5BUSA 3M4JA 1KC1A 1P6XA 3N5KA 4YRRA 4OREX 1ZUNB 3BB3A 4E33A 2DJIA 1YOVA 1ZEJA 1F0KA 2IYZA 1LJLA 1QFJA 4W9RA 4WV3A 2FP3A 4GZ5A 3MGCA 3TD6A 5K0SA 2YTZA 4LDQA 2XNDA 4C29A 4F85A 3OJFA 2IH5A 2BGTA 4J6EA 3FE2A 3ZXUB 3PENA 4MV5A 2RJ3A 2VRWA 2IH2A 2ET6A 2PDAA 4O4LA 1KPIA 1S96A 3C74A 3DZHA 4ZI7B 1VCOA 4FBMA 5BVHA 2VF5X 2DKFA 4PLWA 1QG0A 1IEQA 4B3SB 4KVAA 2PFSA 4B71A 2JZCA 5CTJA 3P2MA 1NWCA 4V1CA 3G13A 1VHQA 2FY8A 5ICMA 1K3UB 1KP3A 3AB7A 4KN5A 4ZEMA 5TR9A 4GBJA 4TWBA 5BR1A 3NCHA 4RCZA 1P19A 2FSGA 3AEXA 3H4MA 3I2KA 3ER8A 2WSYB 1OV6A 3L7MA 2WMNB 1DXYA 4MXDA 2LIPA 2GPAA 3HYRA 2ETVA 3GCXA 4BOYA 4I55A 2BFFB 4HVTA 1ZG3A 2QF7A 4RZ3A 1U99A 4BFUA 3WTCA 1TM7E 5FIUA 4F0JA 4YAIA 5ALDA 3ROQA 4PAGA 1CERA 1L5KA 2BKUA 3RYFA 2AXEA 1PCXA 1O6GA 1ZNZA 1NG9A 3KOZA 2WU8A 1NLYA 2H7XA 2XZPA 3E1SA 2W8BA 4IDQA 1I1NA 1X39A 2R9VA 4GQBA 4PTYA 4KO4S 4XCQA 5ALIA 2PKCA 3UT5A 3WK5A 2M32A 1QHGA 1TUGA 1Z5ZA 3U4GA 2IQ5A 4WA7A 1SCJA 1Z2DA 3FDXA 4FT2A 4HQFA 4IQGA 4AUMA 3IEKA 4GVXA 1A9ZA 2CHQA 5I51A 5LOVA 6Q21A 1E79D 3W79A 3U44B 3HU3A 1E2PA 3D3QA 1IMOA 4UDOA 4PYJA 2Z8ZA 2R8ZA 4Y6GB 4BGEA 1L5ZA 4MV8A 2ENWA 3GEHA 2GBLC 1S5PA 4JSRA 4I9HA 1E7SA 3ULKA 1UEJA 3JS5A 4DR4B 1ZR2A 3JQ8B 1TMGE 3GZNB 2ZCVA 1DXOA 2EX1A 3ELUA 5KYWB 4OTZA 1AGNA 2BEWB 5BYBA 1QQ6A 3SCZA 3PI7A 5EFZA 5T4FA 1XQ6A 4F5ZA 1EH5A 2WR8A 3QPAA 2BGKA 2ZIVB 2XA1A 1FDVA 4JSYA 3WBKA 3TIXB 5KYUB 4JCCA 1DC6A 1ZMTA 2WF8A 4JOBA 2RCNA 4CTOA 2XB4A 2VSNA 3AL2A 3LD9A 4TUYB 4UZFA 4ZU6X 2FH5B 2ZVQX 3HVKA 4NCNA 2OSVA 3K09A 1W2GA 1W6RA 1R66A 4P3OA 1ZC4A 1K8ZB 4I99A 4JAVC 1QYDA 4UJ3A 4ZO6A 2WTUA 5H02A 4QT4A 4CMCA 1OZGA 2FV8A 3V97A 4BO6A 3ZHUA 3BL8A 1I0IA 3IPRA 1MR3F 2YOHA 3KU4A 2FR1A 3LYAA 1ODKA 1QPBA 2G0TA 3V4LA 5DM4A 3W2HA 2BHLA 2G72A 3LKVA 3MEQA 4BVLA 5TMPA 3AR7A 1YDGA 1EB8A 2OCGA 1EINA 1DXHA 2HAEA 3ZGVA 1KDRA 2ZSAA 4KPUA 2JGIA 1TO2E 3SEZA 3QEMA 1FPQA 2QD4A 3ZGZA 3UH0A 2JLQA 3JR3A 2F48A 4X93A 3QXSA 4A0FA 1DWQA 1P7ZA 2ZYAA 1EAYA 1U7UA 3T9CA 4BLSA 5HJ5A 5ECGC 2GZ2A 1BH6A 2YH2A 3KWLA 4RUKA 1SUEA 1UL1X 2WU0A 3OQHA 2F3RA 3BJEA 4RM3A 5HQ3A 2RKWA 1PWYE 2VUSA 1EDDA 3PHCA 2P3QA 2E4YA 4O0MA 5EKUA 3RV3A 2Y2UA 2BJVA 2X77A 3I9V1 4HFMA 4CLEA 5FA6A 3LG2A 1D3AA 2WF6A 3IVXA 4MS1B 1HOXA 1ZJYA 1WX1A 3JXEA 4ENQA 5FBRB 1P5JA 4JI5B 2C4MA 4JB0A 3SG0A 1XXLA 4D3FA 2DG2A 2HCTA 4OHMA 1RFLA 2GETA 2K6GA 4P34A 1ZZGA 2CMHA 4OYRA 1ZJ5A 3IRVA 4LHZA 4RDXA 2VI5A 4JB8A 5IHXA 4B3GA 3LRXA 3MNFA 4J2OA 2UVDA 1RRFA 4GMHA 1IHXA 3H5IA 5HKOA 1R5NA 3AJ9A 3LQRA 3LC0A 1K97A 1MA3A 2GVDC 1EWVA 1RJFA 3DEAA 3ROEA 1OPRA 3MK31 1F3OA 4YT5A 4OXKA 7ABPA 2UZAA 4BWFB 3MM4A 3ICEA 4RV4A 5KWJA 2VF8A 2Y0DA 1K5GA 4I46A 4GQIA 1R8YA 1HQYE 1U2ZA 3JTEA 3WP1B 4NABA 1GEEA 3TNFA 4QFMA 4KI7A 2WUVA 2GARA 1MKYA 3G5LA 1TZKA 2Q4DA 1L7MA 1Q83A 2GZAA 4DMGA 1ZC3A 2B3TA 3NUGA 4Z4HA 4LSMA 4CQMD 2PSEA 3F49S 2IEDA 2K7FA 3FPKA 4QKQA 2R7LA 2C1EA 2AV6A 4R1TA 1A97A 2R6JA 2NUAB 1I2DA 5K3CA 4F8JA 2P2ZA 3IODA 5K0CA 5EJAA 3PTAA 4AG3A 3P26A 4QZVA 1GGEA 2YWFA 3HCFA 1OSNA 2IK8A 1C3LA 2BV3A 2GFQA 3HMKA 1XA0A 3IVRA 3MJ4A 4J0DA 3WIDA 4D45A 2R68A 5IKXA 2AKEA 4P84A 1LNSA 3FPFA 4FHEA 5DLPA 1SULA 3KE8A 4IRMA 4TQAA 2ZPAA 4PC1A 1I2ZA 2VPQA 2GBGA 1Y63A 1HDOA 2JEZA 1GZ3A 3WB9A 4CR6A 4CUZA 3PITA 2UZ1A 4NZNA 4OOFA 2I2DA 3B2NA 3E5HA 3ODGA 1IWOA 4P31A 4WJZA 1ADYA 4MTCA 3EIXA 1JKMA 3JQQA 3UKJA 4CDMA 1I7QB 4MUFA 1AZWA 2BGLA 2CL5A 3O8OA 4K40A 4KPFC 1DOZA 3RK4A 4EI8A 1ZAKA 2HYDA 3AILA 3NYRA 1OYWA 4NBRA 4TYNA 3E2IA 3M6MD 3L8ZA 2R79A 3NKFA 1N9GB 1F06A 1TCCA 5HK9A 3BXEA 3BDIA 1M2VB 2QDKA 2Z04A 3HGMA 1Z0DA 3IQZA 3UB3A 4LF4B 1PFYA 1JZQA 2XMBA 4BO7A 4DQXA 5ESXA 4RYDA 2QUZA 3PF8A 4D0GA 3QE3A 4IF6A 3ZZMA 1SZPA 4CN8A 2VP2A 3CLTD 4MB0A 1RQ2A 4YCBA 3JPWA 2CMFA 2GCIA 1HE2A 2EATA 2MSWA 1LTQA 2ZANA 2WB2A 3QLJA 4KDRA 1RFGE 1AB6A 1YRYE 1AKUA 1ISPA 4AAYA 1K3FA 3G79A 3GDFA 1SA0B 4X84A 3R7FA 2XCUA 3O26A 4RY9A 4BEJA 3OIWA 1NJ5A 1DKLA 1X2BA 1ADBA 2UUCB 5I8ZA 2XAUA 1HFWA 3RYTC 3A9SA 1BXZA 4WFKA 1GGNA 3ODPA 1IQPA 1T0JB 4NCBA 3UUWA 4YXFA 4QXPA 4RVHA 5C32A 5KNDH 1WMEA 4QYIB 3LF1A 3RBVA 3BWMA 2PV7A 1FTSA 2FRDA 3CKLA 1X7XA 4FX5A 4YRJA 1E2EA 2ETXA 4F4IA 5JFGA 2BTEA 4QATA 1AQJA 5COAA 9GPBA 1EIZA 5CB4F 4K3VA 2X2FA 2UXDB 1EUCA 1IM2A 4G01B 1UDAA 2BFPA 4CBVA 3AMVA 4MI3A 4JLBA 1JEQB 3NBAA 3I2HA 3WKDA 5H4GA 3AF1A 5JH7F 3BORA 1EPUA 1CTQA 2Z2JA 3NHLA 5TMBA 3HN6A 4Q82A 3EGWA 4MV6A 3DZJA 5KSOA 1JDTA 2X9GA 1UJCA 1FXWA 1ZOSA 3GRPA 4KIUA 4ZCLA 5HUHA 1U2DC 1UBEA 2B8EA 5JBQA 1GPDG 4DSTA 4YRSA 3KLPX 2VTBA 5KS2A 1SBIA 1T2AA 5CLIA 1QFMA 3DVQX 2FQ1A 1IFXA 1PLJA 5JLAA 2EV9A 1XUOA 5CA1A 3RVSA 3B1JA 3PJDA 3LBFA 2WRZA 4IUCS 5ALSA 1J9EA 5H80A 1P5RA 2G9RA 3E2PA 2NU9A 2DX7A 1HXHA 2OM6A 3CLSD 5GJWC 2F55A 2I1WA 1S8FA 3LL4A 4WXHA 4C04A 1JVNA 3N0XA 1SBYA 1UM9B 4GSLA 3NT5A 4J8PA 4MR8B 3VQTA 4B4UA 2ZBFA 3NTRA 4J0FA 3HXOA 1TUBB 2SBTA 5KJEA 1E9EA 3D6FA 4JJ7A 4KQIA 4MWDA 1K6EA 1OZFA 3L8FA 4DV1B 5AXCA 2R65A 5E6SA 1CUFA 2BTQA 1C0IA 4PRKA 4JZYA 2C07A 2J9GA 1R0YA 4O2BF 1BFKA 1PJ2A 1JHPA 1SOWA 2Q99A 4ENPA 2VLIA 3ETNA 4OIFA 4KLNA 3D4IA 4HAYA 3WB2A 2R7AA 4CM4A 1LQUA 3K1AB 3O3OB 5JYDA 3PFBA 4KZKA 3VKHA 4CUKA 4NE7A 3RYIB 5ETJA 2Z98A 1L7VC 2GD2A 1DTEA 1E3WA 2LTAA 3JD1A 1OH7A 3W5AA 4KX3A 3HPQA 1UXKA 2CXNA 4FOLA 2NUTB 3O74A 2NADA 4TLLB 5HFJA 3Q9NA 4ARSA 5A9SB 1BJKA 3CRRA 3IEIA 1WSBA 2OWEA 3ENKA 3H5VA 4P86A 1VYUA 3RJZA 3TDMA 4B84A 5A3RA 4Q7EA 3R7DA 3ITKA 3A4YA 3PB3A 2CLEB 2QZPA 3OM1A 3URKA 1C1XB 3OTGA 3G17A 1GLNA 4KSCA 2OORC 3QNMA 4NYIQ 4BFCA 1KNQA 2PH1A 3K9NA 5CLHA 1R15A 5DP1A 5HCNA 3ZDAA 2VAMA 1O96B 4LJAA 1L8AA 4UD6A 2AX4A 1CUYA 1OIVA 4F2PA 4Z0TA 4J0GA 4YCCA 3NHWA 1K6JA 1M72A 1L7AA 4LBVA 2PMCA 1KDTA 3CWCA 1J0BA 4ZYWA 3RRMA 1T13A 2G83A 3NOQA 3PYMA 4PGGA 3CUKA 3D64A 5KSZA 4ES6A 5KYGA 1GU7A 1EYZA 2ZE5A 3F9IA 2WNHA 1IZ7A 1EEHA 1NLFA 2HUPA 2UVPB 2ZJ7A 3A1CA 3KHTA 4G24A 4N48A 5KNCH 1N33B 1H1LA 4P4SA 3GFTA 2OCIA 3GF4A 1NQTA 1G0NA 2CNNA 2JBHA 3H87A 3MWEA 4LHSA 5AM0A 1ZH2A 3WGYA 2YCBA 2L2QA 3VI4B 4DUZB 3QVMA 2NTNA 5M34A 3Q9UA 2GWRA 2CXHA 2Q6OA 3AM5A 3KLNA 3HVUA 3TIFA 4RTLA 2E0IA 3FCEA 1DIOB 4ZYYA 1XAHA 4YUXA 3RS8A 4BRZA 1F1BA 5LD2B 1YS4A 1DAGA 3RUAA 4MVJM 3TH5A 3IAS1 4HDKA 3ZGXA 1QQ5A 5U1PA 4X00A 5BWOA 2ORIA 3DG9A 4UPDA 3MWLA 5AK6A 5IMBA 3UOGA 4RVNA 3U4CA 1E2LA 2PHZA 4B74A 3FMFA 3PC8A 4JB2A 1OLXA 2IFTA 2BN4A 4KLZA 1SEVA 3E15A 4R2MA 4HXFB 3RT9A 4FE4A 3C7CB 4PO9A 4XWYA 3CW9A 4YONB 3RFTA 4ND3A 1QQTA 4BO0A 1VJCA 4FIDA 4XFJA 1QCDA 1VQ1A 4D92A 3WYNA 3N0RA 4R05A 4NCKA 3FGPA 3FVVA 3PHGA 3OQBA 2AOTA 4DJ5X 2X7HA 5DSXA 5ES4B 2AOXA 4XVRA 2RC6A 2XLBA 4J16C 1D1PA 1FNMA 1KOGA 4AM8A 3IV7A 3LUDA 4REMA 3OF2A 5E7JA 2QLLA 1V9LA 2NUAA 3Q0IA 1WW8A 4DLRA 1E1MA 1DX9A 5LDHA 2J7KA 1P0FA 4C2AA 4COOA 4UBNA 1XLTC 4L5CA 4PFQA 3HXTA 3GUYA 5F9HA 3HG7A 1U0EA 2I78A 1ZIYA 3HPRA 3UXMA 1GGKA 2ORWA 2JFOA 3DP9A 2B6NA 1VJ0A 3UMSA 1MW9X 2GD6A 3PGJA 3ILXA 2YUTA 3ZE2B 4MEAA 4F12A 2J0SA 5EKXA 3F46A 4E1VA 4JNCA 4JYZA 3BD9A 1C9YA 2FMHA 5BORA 3Q0TA 3KSRA 2FSHA 1YSCA 4N0DA 3UANA 3KWMA 4ALNA 1BVUA 2ZBUA 3WHLA 4D26A 1KETA 3M89A 3R7WA 2HU8A 3C43A 3F9CA 1Z06A 4D96A 1EFLA 2GJ8A 3O8QA 1OXVA 1QCCA 3RSCA 2O57A 3DCIA 2VDUE 4LXGA 1FUYB 4MR7A 4QT0A 5BN3B 2A94A 1E6MA 2Q5JA 3GT7A 3M5DA 4X3PA 5EMMA 4AS3A 4RF3A 1H8ED 2R1UA 4N3GA 3NBFA 4C4OA 4D8VA 1VL6A 1UT5A 5K8IA 1SU6A 4JT2A 1ESNA 2OHFA 4U4AA 4CLDA 3M6XA 3ZCUA 4M1WA 1KZYC 3FDZA 1WOYA 1QKKA 4EVSA 4GX0A 4DNPA 5JAIA 4MKZA 4DJJA 4CF4A 2ZAOA 4BFVA 4OATA 4MO2A 5COBA 1G1MA 1M6EX 3EFBA 3IP1A 4JUFA 4XDGA 5E4YA 5TQ2B 3RUIA 3C3DA 4YCDA 2OQVA 5JG7A 5IPFA 4MDEA 2IDZA 3DL7A 1T91A 2HZBA 3K6RA 3D5QA 2X5KO 3VO2A 2H0RA 1POWA 2F7SA 2W2MA 3F6SA 3HSYA 3EVBA 3QUBA 3NZEA 2AIRA 2DKOA 2NN3C 1G3MA 3GEDA 1YMQA 3C1TA 2QD1A 2ZTVA 3OD5A 4NJOA 4FOOA 1LDNA 1SIBE 3OZAA 1O5IA 2ZIXA 4JS0A 2ZUVA 3L6DA 3N7TA 3M1AA 3ZDDA 3TKLA 1Q7RA 2JLXA 3LPCA 3PPWA 5JNTA 1OFTA 2JIPA 3PFWO 4MO9A 1CEYA 2C2BA 2K2QB 5B6PA 4QSMA 3EXEB 1T36B 3ZWAA 3NP9A 1AHIA 1B0AA 2LXNA 1FY2A 5D3MA 1U98A 2YC4C 3COJA 1GZDA 3ZY4A 2JLWA 2DFPA 4ZKEA 2W4MA 1GNQA 1W6UA 4CKWA 3LUFA 1DT5A 4M4SA 3DUFA 2IEGA 3B70A 3GC6A 3WKAA 2OV4A 3K94A 4E4TA 5IXSA 1DIBA 4EEKA 4X1KB 5A0VA 3AEQA 2MOKA 1FLNA 1TQDA 3LUAA 1E3SA 1RYNA 2P2YA 1PVOA 1HUQA 4XUGB 1ZNQO 1AD2A 1Y8CA 3R6GA 1KI2A 1DBWA 1JS1X 1SO8A 2HT6A 5KVVA 1SKBA 2G1KA 2BCEA 4N5MA 4GI2A 3UC9A 2H65A 4G9BA 2FMTA 1GAWA 2ATXA 3F6RA 3J81A 4FVTA 4JH0A 4QBTA 3H86A 5IYZF 4YPFA 3I5XA 3LQFA 1S2MA 1M5RA 2WUFA 4U0JA 4BQOA 4YMSA 2NSLA 4H17A 4MRVA 5B55A 3P2EA 2GLTA 4DQDA 3OMXA 1E77A 1I10A 4DQVA 2QSZA 2PGAA 4ZJYA 3CX4A 3U2QA 5ALKA 4CF7A 1LXCA 2YR0A 1PSWA 1IBRA 1U1GA 4WXRA 4A5OA 1C30B 4Z4EA 2I66A 2KI5A 1N5KA 2NZ8A 2ONKA 1KYQA 2QAJA 4HVLA 4I4TF 5CCBA 3KVOA 2PA3A 5AICA 2D8MA 4YQZA 3T6KA 4EYEA 2TMGA 2P62A 1O3YA 4RMJA 2R4UA 2M2IA 2CHUA 3BILA 2CLIB 5DSZA 5T57A 2GLUA 3DPSA 3G2HA 5CXUA 4BBAA 3SOPA 1ZVMA 4HQRA 1OVMA 4OYHA 4ZCRA 3KVNA 1JQ5A 5FEUA 1Y6GA 3HA7A 3JYLA 3K5HA 1KL7A 4IDNA 1OWLA 2FNAA 1LS6A 3PNVA 2ZTHA 1VJGA 2R7KA 5KYNA 3B3QA 1LPNA 1O94C 5FA5A 4Q93A 5JCJD 2D00A 1I30A 3AI1A 4EYKA 2H4YA 4YA6A 5KYKA 2IHBA 4PXYA 3VJRA 2D1QA 3DCYA 2IXAA 3HABA 3IVCA 4MKFA 3H9BA 4KUEA 4Q1DA 4M2LA 5FHQA 1JIQA 3LFTA 4FM9A 2YWBA 4G67A 5AJUA 4JASB 4Y9SA 4FYXA 3G9QA 1I4LD 4G1MB 1DRVA 3GI1A 3KJZA 3LKBA 4YAGA 5JWRA 1S8AA 4BNFA 3FOCA 3HBLA 4K6CA 2VCYA 4IH4A 2KLHA 4OGLA 2LIVA 1XZJA 2DSTA 2WJ6A 2F3QA 3KTAB 3J81k 5AVKA 2QD2A 5D86A 1D6NA 1RAIA 1HDZA 1KE1A 2NPFA 2O2JA 3BTUA 3VSCA 5I9NA 1RQ7A 2JI4A 1T0UA 1X13A 4Q3LA 5EMKA 4EG8A 2NU6B 5KC9A 3NIWA 1QV6A 1G0OA 2G4LA 2J9FB 2R1ZA 1NAHA 3PXBA 2I6XA 3OZCA 1KRHA 3B48A 1MC5A 1SVKA 2A67A 4WKOA 3PIDA 4ZRNA 2QMQA 3PEVA 4EFDA 3VKWA 3HO1A 1HDIA 3H5WA 1XIVA 3LX8A 1O57A 4NPAA 1SUFA 4YN3A 1ZVVA 1F4PA 1U1EA 3DQPA 1NVGA 1XTZA 3LOPA 3THYB 1E5XA 1B43A 2BVNA 3L6EA 4UHBA 4EO7A 3GJXC 3GCWA 1W5EA 2C1XA 4TPKA 1HKHA 2C2ZA 2W98A 5ALOA 5E3IA 1IJFA 2JRCA 2YICA 4WY5A 1QGED 3UT0A 1YA4A 4AD8A 4BEWA 3GJSA 4UU8A 3V8BA 5DLDA 3WIUA 1WDKA 2Z6UA 1Y1RA 2BSXA 4UHJA 1ATIA 1F2TB 4XWOA 4UUNA 4Z1OA 1CVLA 4YGXB 4PIMA 1GPYA 1KI7A 3LPLA 4BRUA 1N5JA 2I34A 3LT1A 1H2XA 1VIVA 2FE1A 2J4DA 2OCDA 1GNVA 2JHPA 3CINA 1H2RS 1Q1EA 3W8RA 3K6SA 4YGYA 3WTBA 1FF9A 5HP4A 2JLVA 3MD9A 2I9KA 1AT1A 1G8KA 1N6RA 1Y8QA 2WE7A 4EY8A 2C8LA 3OTOB 3ID6C 4FQ7A 3TRJA 3KELA 5CIWA 5AKXA 1PWEA 3INYA 3K72B 4KH1A 4OXRA 4P93A 3VSAA 5JDIC 4QPCA 3U3DA 2Y9PB 1T2DA 5CFQA 1WA5A 1V7PC 4D98A 4Y2VA 3DZIA 1UAGA 1JIXA 3QUCA 4HHEA 1ZRHA 2A0FA 3DFZA 3PR1A 3L4KA 2QLMA 4ND8A 4X0EA 4PSVA 1DEHA 2V8BA 1F6WA 4Y1GA 2BYTA 2CLHB 1BMQA 1PG2A 3WYEA 1RPAA 2WIGA 1HDCA 3K4HA 4UXIA 4RTQA 3MT7A 1VKNA 3JVDA 2TYSB 2ZRGA 5LBUA 3IVMA 3MMXA 2JLSA 3WIOA 1ZIXA 4D4MA 3GDHA 3ABZA 1U5BB 3JQ9C 4PYQA 4TOIA 5DSTA 4EJ2A 2H29A 4XH9B 1XMOB 1OT3A 2DZDA 2O3QA 4OQEA 5LXTF 1O0SA 3G23A 1KZ4A 1DTSA 2GTIA 1JYEA 2O07A 4A6PA 3ZKWA 5AFSA 5B4UA 1NN0A 1G5IA 2JJ8A 3FHCB 5DI3A 1W7AA 1TM3E 3KR2A 2JB9A 5EFOA 3H8WA 3WXMA 2P9YA 3PHIA 3FOBA 1ICIA 1Q19A 1DKRA 2C95A 2HNKA 2QOEA 2YWXA 3CB4A 7ADHA 1P3DA 2G25A 3WGIA 2AOUB 3RHTA 2WFAA 3ZBTA 2WD7A 2ZI5A 2ZR7A 1RPJA 2DUNA 1ZNWA 2NV0A 1M8GA 4HAUA 4EHKA 1DZIA 2POCA 1OJ7A 1THZA 2OXRA 3HBMA 1KA9H 2Q1TA 2V4MA 3D7LA 3ZHQA 3ZCSA 2RD2A 3BMQA 3K4PA 5BT9A 2FEAA 1JG7A 2VDQB 5AVXA 2CF6A 1KGDA 1IVSA 1H94A 1X7ZA 4U9HS 2NPOA 1GZVA 4EY6A 1KGSA 1E2UA 4RGQA 3VPDA 4G0VA 4BNTA 2YZ7A 3OOHA 4KQ6A 4QBIA 2YBEA 5G1OA 3F97A 3GAZA 3P2YA 1D4FA 3MN1A 5FPYA 2A33A 3QVGB 2B4KA 5HR5A 5LPNA 2RARA 2GRAA 4Y2SA 4AS2A 2JFZA 2QVYX 3AOGA 4DWWA 3RYCA 1DEOA 1H85A 1JPUA 1PS0A 5JZMA 4AJOA 1J20A 1WULS 2FGJA 4N40A 3H11B 4CV2A 1SUWA 2PUCA 3LGAA 3OSZA 1FJHA 3DBLA 2B25A 3MWKA 4XQCA 1BKYA 1A71A 4M0FA 4PONA 3MGGA 4YJ3F 2DXIA 3KOWA 3A1DA 1GEGA 1LVGA 4O5AA 5B2EA 1XTJA 2XB8A 1AMUA 2WT4A 4D4LA 1T6XA 3IV6A 5F23A 4U5QA 3O47A 3RC3A 1WHTA 3RUPA 1JHZA 4JVOA 4M0DA 4Q4JA 1NN1A 1P0PA 3SJAA 1QGAA 3I52A 4ZHSA 1ULSA 2BGJA 2G88A 1BN7A 2PVCA 2YL2A 1EJ2A 4LBWA 1CR2A 4G26A 4Y7DA 4XWWA 4HMQA 5LWQA 3SZMA 1WU8A 1J7JA 4F21A 1FYVA 2XXAA 4R1UA 1VZ3A 5THQA 2DOKA 3NRCA 1D8TA 1E9CA 4HD8A 1NDHA 3EZXA 1RP1A 3JQEA 4QASA 4AVYA 3MFYA 1SUCA 4M87A 1YTUA 3RVRA 4EDHA 1G8AA 1IB6A 1E1YA 1PEKE 5K99A 3K16A 1UPCA 1GA6A 1YD7A 2XADA 2C0QA 1S01A 1GXSB 2WFLA 4LHVA 1WSDA 4TYMA 4X62B 2C59A 2WWVD 5IG2A 1NKTA 3MSXA 2PMWB 3ZNQA 3NBUA 3QJGA 4ZYZA 2JJQA 4YUAA 2XCQA 1YF3A 1XMXA 4RK0A 3UUGA 1C29B 3MA0A 3F9RA 2IHYA 3U80A 1IBSA 3G9TA 4KAAA 1KBOA 2WJ3A 4OG2A 4DEYA 1AKEA 5D85A 3RTCA 3CKKA 4JYMA 1TW3A 2HK6A 5BN5B 3RLIA 3DL4A 3NT2A 3CX7A 4D43A 3ABQB 3NTOA 4K2HA 4WOKA 3UV3A 4M1EA 2OENG 3GDGA 2P68A 4TSFD 3DBVO 4PNEA 2VH2A 3G2QA 3L79A 4MA4A 2QTCA 2GN0A 1JH9A 2Z6VA 4PGHA 4LX0A 3DE3X 1EDOA 1MC8A 1YJXA 5AT1A 1IOZA 3H5RA 2LDBA 1SCDA 4HDCA 4N8SA 2RI6A 4YMLA 4MTLA 1ND6A 1E3IA 3RRNA 4KQJA 4X8LA 1NDQA 4DYVA 3PJRA 3TUZC 1Z3IX 5ALZA 1DRKA 2OR3A 1JKJB 4RL6A 4MSUA 1HLGA 2X6RA 4RPCA 3O8BA 4Z4GA 5DO9A 2QN2A 1S1CA 3WI7A 1SMKA 2PUHA 3PQ2A 3HRIA 1KAMA 1YZYA 4OEHA 2QV0A 3ZXSA 2Z5LA 5DNUA 2EERA 5BSKA 2WMYA 4HDNB 5KKNB 3BZUA 1HLPA 1MNQA 2GHQA 3I2FA 4EVQA 5AK3A 1M1NB 5KDOA 2J5BA 1NN3A 5MN5A 5ILOA 4U2CA 3SNKA 4N54A 3BE8A 3IVGA 3QNWA 3EWSA 1PYDA 1MEEA 4KQGA 5BNZA 1PJSA 4MAMA 4X97A 4BMNA 5EIXA 2HXGA 3A6LA 3BJIC 3GGCA 5EIHA 5F7OA 1U28A 3TL2A 2JFBA 4KO2S 4QTZA 3EFOA 5K8VA 3P52A 4FTWA 1WCWA 3B6IA 3KAQA 3P7MA 1A04A 3BVPA 5JNUA 1R6AA 3BL6A 3ESYA 3JQFA 5DN6A 3VC2A 3S1SA 2CZCA 1YB2A 1RYBA 5FAKA 4JGBA 4Q3AA 3G8DA 4YP6A 3RFVA 3GN2A 3I72A 1DT3A 2H00A 4OFBA 5CW1A 2A1TR 5MDHA 4DIDA 1VL5A 5BOSB 3V8NA 5KOYA 4DKJA 3UZUA 3FVWA 4G0XA 2YXBA 3JYOA 4QXRA 2VK4A 3MQ2A 1UWVA 5TVGA 5C53B 2ESRA 1YXMA 3W1VA 4ZWNA 4Y30A 5LQSA 4GPD1 4A3SA 1MAWA 1BRMA 4TSKA 5CDTA 1T1GA 4U2KA 5CU7A 2JK0A 1P9NA 2J31A 3SSAA 2X8BA 4TN5A 4EY5A 2OHGA 2PZLA 5EJ6A 1AK1A 1EP3B 4KVGA 1YONA 4BS9A 1QONA 2FWPA 2WLSA 1R5BA 1PDOA 1WNTA 3AXTA 3DONA 4ENTA 1QVRA 2X1VA 2YXNA 5EZ6B 3QYPA 1P7CA 5LU8A 5J4VA 3AY6A 1V25A 2C9CA 1VE6A 1NQUA 2EWWA 2ONCA 3GYBA 3RUEA 3H65A 3UV6A 5AVUA 1YRBA 4EFLA 2DFNA 1D03A 4H77A 1F6BA 3TXAA 3CNLA 2PMDA 5DEIA 5BQFA 4G09A 1BWSA 3QU7A 4J91A 5G53C 2P6OA 1C0LA 3Q3CA 3QUQA 1EK2A 4L57A 4FWIB 1DLIA 1HYEA 2RHJA 2VNKA 2VXBA 5KOHB 2V98A 4G81A 4FB5A 2ID9A 1JYSA 3LX6A 3PPYA 2X13A 3E23A 3GGOA 1W35A 4J43A 4O4JA 3TCKA 3DKRA 4UD2A 2IH4A 1GPJA 4MCAA 1YIDA 1EQ2A 2LRHA 2PH7A 3RCBA 3KAPA 1NBIA 1YFZA 4LBZA 3SJCA 3D0RA 4GW3A 1I80A 2PJRA 5ENZA 1QB7A 1FP2A 3ANLA 4KMRA 5F7JA 3HWWA 3UEOA 4QG3A 1GITA 1RRGA 1WCIB 4BKPA 4BE4A 4C4YA 3FHLA 3P0JA 1LPPA 2CXOA 4IINA 4EYGA 3SHQA 2O8FB 1ZK0A 4NCAA 1JXQA 2H2FA 4WX2B 3CJQA 4KDCA 2WVGA 3BQNB 4CUJA 2NU7B 5IVKA 2AR0A 2VC2B 1WZCA 4BVAA 3LA6A 3LBIA 3EPHA 4XCXA 1SK9A 3C5EA 1TEHA 4DPLA 4MYHA 4TTIA 3DVSX 4R9VA 5C1PA 1C1YA 4XGQA 4KBYA 4A6EA 4KR3A 4NNPA 4IXWA 5JATA 1T1RA 1G8PA 4LJ7A 4JUAA 1ZD5A 1L9KA 4BL5A 3UATA 4M8IA 1KJZA 1O03A 3D3KA 5CLJA 2V03A 1BS2A 1LI4A 3TOZA 4WZ6A 3SC2A 3I92A 4KXVA 4BTEA 4F8YA 2WB4A 5ICSA 2Q3CA 2BSQA 2BF4A 2BMJA 1SXHA 5BVGB 4YRNA 5AUPB 1QC5B 1RZVA 4BO9A 4Z51A 2UYGA 4JL6A 4K05A 4J2TA 4MV1A 5DK6A 3VX4A 1F8XA 1P7WA 4KMMA 3ZHTA 4EDFA 5JADA 4G9GA 4C3UA 4U8GA 1CYDA 1W93A 3DBIA 4EG7A 4I5EA 2EHJA 3CUWA 4LXHA 3D2CA 2XUHA 4H4CA 3DMTC 1UT6A 4JOCA 1P0MA 4OQLA 4TV9B 4HVCA 2WJPA 4ITRC 4D9JA 4ZYLA 2DWCA 3TI9A 3A2KA 5JSZA 4GRAA 4EW6A 5FOVA 4IKEA 1FP7A 3EA0A 5TLSA 1L1EA 1NMSA 4Z2AA 1M7HA 3IAEA 2HNAA 4L1KA 4DLZA 5I7FA 5L3QB 2PU7A 2O8EA 2Q27A 5CB4A 5IMSA 3GEGA 1JEEA 3MWDA 4Z8YA 2XMPA 4LDNA 1ECCA 1PBTA 4JBGA 1FUUA 2PRYA 3UAXA 1GGMA 3VSBA 3ZBUA 1VJTA 4G4JA 3RS3A 2W7TA 4GH5A 2N46A 3AG6A 3BIWA 4IEIA 3HCAA 4F5WA 5JH7A 3U37A 4BEBA 1NNSA 4Y1RB 3TNJA 3ZE8A 4DLXA 1X38A 4CWAA 3GMSA 2WP0A 3B2QA 1FTWA 4YLYA 2OQIA 2GYYA 1JWAB 3C3XA 5I47A 1W48A 1U9CA 3CUUA 3E18A 3VHLB 4YRZA 1PR4A 4RELA 5FWAA 3PWZA 4G2NA 2H54A 2QSYA 3TFWA 3UO8B 3JAWB 3W5DA 3IRUA 5GVSA 1JAZA 3LXMA 3FR8A 2OXCA 3QBEA 4FR5A 3T15A 3T5GA 5F7XA 4L0QA 2CJPA 4RF5A 2F1JA 3RVNA 4B6PA 3EPJA 1DMSA 4XDYA 1P62B 2HIAA 3PCXA 3LT2A 1Q17A 3DHWC 5CBPA 2GEJA 2ZSIA 3COWA 1XZEA 1ZVKA 2BHRA 1EFTA 1JQKA 3KOXA 4H15A 4IJ6A 4PANA 4RLFA 3ZUPA 1HGXA 5JSHA 2XE8A 5E1MA 1XCJA 2OGUA 2GD0A 4HLDA 2BMDA 3D7KA 1P1BA 2QW1A 4GOKA 4URWR 2PL9A 1T35A 2REQA 3E0QA 3HDHA 1YB4A 3DEIA 3KZ1E 3VKGA 3RRZA 1UDRA 3CMMA 3GX1A 4Y2HA 3PX2A 4O2BA 1GZUA 1PL7A 2C7BA 4II7A 3WHKA 2D0DA 3BN3A 1Y7HA 1SKQA 3AUJB 4AYXA 1Z33A 1NUUA 2AMVA 3ACDA 2IYTA 3U40A 3ZGNA 4Q03A 1Y4UA 3FCCA 4C30A 1FRZA 5LP1A 4QU5A 4H3KB 4Q7QA 1OBOA 3OE1A 2J5KA 4BVBA 4JELA 4C05A 2FMUA 5LYJF 1B6RA 1YC2A 1OI7A 2ONYA 4UVHA 4DEVA 1MX3A 1YR3A 1KH3A 1P4RA 1E1LA 1WVGA 3H5AA 2ZVDA 1XZFA 3M3HA 4G5SA 3SJZA 3V4ZA 3EF0A 3A8TA 1HTTA 9ATCA 4PM4A 5TGZA 3UPTA 1JSLA 3LY8A 4KC0A 3M3DA 1EWYA 1D0SA 1U8XX 4HGNA 3IBYA 3PQCA 1G6KA 1VBFA 2KPOA 1C7IA 2OM2A 4K0RA 1C4XA 4NECA 4QGBA 2WV9A 3T3OA 1K0FA 1XMIA 3GMDA 2PUFA 1U90A 3OIVA 1S2LA 1I6KA 2B7CA 2IHKA 3N6VA 4IHQA 4R1PA 4RJIA 5F12A 2RHDA 3TQOA 4NV0A 1RP7A 3W5BA 1ENZA 1J90A 5IVIA 3O8NA 3IE1A 3LM8A 5DNVA 4WI1A 1F7UA 3DTTA 2AOVA 2GDZA 4PG8A 2A2ZA 3ANNA 4LEIA 3N2GB 4CU2A 2HXYA 3M6VA 2F43B 4RHYA 2DCUA 1JG6A 4XKJA 3QPVA 4RFSA 1RXEA 2SHKA 3ZPXA 3MCUA 3V80A 1HDRA 3IIKA 1Z0FA 4LBYA 4OU4A 1L4EA 2EZTA 1G8SA 4HUJA 4TQGA 1F48A 3QYAA 1I3MA 3EDYA 4M9QA 5D6NA 1Y42X 3CY6A 3T0GA 1EFHA 4RETA 2H1RA 1SCNE 1IY8A 2D2VA 5K4AA 2PKQO 5AKZA 1NVXQ 2PYDA 3K9LA 4IMPA 1IUKA 2VAWA 3I4LA 3TX6A 3CONA 4N0EA 4EFKA 1XEAA 1MAHA 2B3DA 1TTHA 1NOIA 1OC2A 2ZQ5A 1Y82A 4WBXC 1LBSA 1J8FA 1S1MA 4RF4A 3SX2A 4UXJA 3KWFA 4X6LA 5FUBA 8MHTA 4EX6A 2AJBA 5LA6B 2AN4A 3L1IA 4Y67A 3HXLA 4B76A 1PZNA 4ID3A 1A9XB 4BJ1A 4CIAA 4BFTA 1F60A 4CL2A 3R09A 5DRTA 3ZH9B 3CE9A 3BGDA 4IY1A 5TF4A 4WMLA 2ZBGA 4GEKA 4P6VF 1E66A 3OT5A 2OVBA 1EM6A 2OG2A 1KPHA 4K7JA 5H5JA 3WFJA 4NBWA 3V5NA 2F8SA 1U3GA 2HJRA 3M33A 4WECA 1EA5A 4MRMB 1QIFA 4MMXB 5H9VA 4RD6A 5AW0A 2MT9A 3AR5A 3ZHZA 2XCLA 3NETA 2PUVA 2G67A 1B6TA 2Z2ZA 1J07A 3ELWA 3I3OA 4LCBA 4YC7A 4U7TB 3F5MA 1JDBC 4INPA 3RQIA 2BHTA 5ADHA 3GUCA 4FHCA 1TVKB 1J8QA 5FWXA 3UFBA 1D9XA 3ZHBA 2OCAA 1TKAA 3G2KA 3ZZTA 2WPDD 4WVFA 4DAOA 1SQ6A 3U26A 3D8RA 3M6UA 3MZ0A 2EKPA 1TF7A 3FHJA 3P94A 3CIFA 3PEUA 1C0EA 1NLUA 2R66A 4DT1B 3THXB 9LDBA 5E2BA 3EVCA 1VTKA 1FOEB 5DLEA 3SFZA 2YIJA 5DV9A 3HKEB 2YJZA 3TD2A 3L46A 1J8YF 1I7PA 2N3ZA 4FU0A 5A5VA 3HS3A 4RO0A 5DRYA 1TC1A 3U3ZA 4CMAA 1JHOA 5FYDA 1W52X 3ND8A 1L7NA 4R8SA 3QBDA 2ZB3A 5FBQB 1A27A 5CIYA 4US0R 2Z57A 2NZWA 1B42A 4R7GA 3AIKA 2P4SA 3IOMA 5J2TB 3C97A 4UVEA 2C9BA 5JZSA 2QJRA 3ESDA 2XRFA 1FRNA 3MMSA 5AHWA 3U81A 3E8XA 4R1LA 4CCSA 2BP7B 1ZD1A 4WJLA 2ZETA 8ABPA 2EFYA 1Z4KA 4NR0A 4PYMA 2C4UA 1J5XA 3ABOB 2ZI3A 4J0QA 5DXFA 3VKFA 2XA2A 2ZRBA 1FU8A 1G6Q1 1Z4LA 1G3RA 2A0YA 3S70A 1RVDA 4CKBA 4D81A 1RM5A 3G2PA 1L5SA 1E32A 1J99A 3ILSA 4NNOA 4NX2A 3V4VB 4BMZA 3G2OA 2IUTA 2OC4A 3CH4B 3EC2A 3S2IA 1IN6A 1N3LA 1O97D